1E4WL

Crossreactive binding of a circularized peptide to an anti-tgfalpha antibody fab-fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQTPSSLSASLGDRVTISCRASQDISHYLNWFQQKPDGTVKLLIYYTSTLHSGVPSRFSGSGSGTDYSLTISNLEEEDIAFYFCQQGGALPFTFGSGTKLAIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TAB2
publication title Cross-Reactive Binding of Cyclic Peptides to an Anti-Tgf Alpha Antibody Fab Fragment: An X-Ray Structural and Thermodynamic Analysis
pubmed doi rcsb
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4wL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4wL01
1WT5A 1PKQE 1U42A 3FO1A 5KS9E 5IV2B 3WO4B 3O81A 3DYMA 4P23B 4ZPVB 1WV7T 1RZ8A 4YZFF 1NH6A 2ITCB 5E2TL 5FYKL 5I1LA 5BXFA 4MNQE 4KDTC 4KKLD 1Q94B 1QP1A 2VR9A 1I8LA 4F9LA 1JGLH 4G7YL 2P49B 3MRIA 1CIDA 5EIVA 3IXTA 1DQDH 3QUMB 4F7MA 1BPVA 3DWTA 5DFTA 2VITA 5SX5K 1CZ8H 5HGHA 1OSZB 4Y5XA 5ISZA 4G9DB 4XVSH 3VFOA 5D7IB 2QKIA 2QQLL 1FZJA 2X4OA 5EZJA 5E6ID 2BVOA 2DLFH 2YHGA 1BIHA 3QUKB 1TVDA 4HV8B 1GGCL 2LU4A 1A6ZA 2L7JA 2XQYK 4QHKJ 4FS0A 5JQ6H 5JXAH 2VLKE 5EPMA 1SVZA 1CL7I 4ODUB 1M71B 5T3XL 1BX2B 1KCSL 1MF2L 1P1ZA 4LCIL 3BP6A 5E70A 5DI8B 1S9WA 3K3QA 1UM6H 2RR3A 5L8LB 1AD0B 1F2XK 4YBQD 3BEVA 4N8CH 2P8MA 2A1WL 4X98A 4Q6IC 3UZEA 2AP2A 4KJWD 4NO5B 1NCAL 3ARYA 3HN3A 1ZLSL 5C2BL 4X5XB 3ZKMD 1J05A 5LGHH 3WEXB 1GRWA 4Z5RA 3KPRA 4XNYH 1XGTA 4HK3J 2KBGA 4DQOL 4YE4L 2IFFL 2FRGP 3ULSB 5TQ0H 5DJCB 4OLEA 1WICA 2QR0B 3GRWL 1MREH 1DVFC 1KLGA 2AJYH 1WWWX 2J8UB 3RU8H 4L8CB 3DJ9A 4HS6B 1MOEA 3X11A 4DKFH 3S96B 1ETZB 3UTZB 2CIKB 2XXMB 1EBPA 4NQUA 2ZZUT 5FUCC 5JLZA 1GCFA 4ELMF 1R3IH 2BP3A 5EULV 4Z18A 5INDA 3MO1B 2WWMC 3NFSL 4IMLA 3CSYA 3P4NA 4Y4FC 3HUJF 4NWUH 4G8FB 1Z9MA 3DTXB 4HWBH 4PB0H 5I76A 1IGML 4Z7QF 1V3LA 1QSFE 1QG3A 5LQBL 2D4FA 4UDUA 3A6BL 4G9FA 5IOPB 2E7LA 3QEUB 2HFTA 5IVXB 5ECJE 3T0VA 5FA4B 5ID0B 3BJ91 3RZCB 3SGEI 1YMME 4OCRL 1YNTA 1CVSC 5DJ8A 5C6TL 1U8LB 1MCKA 1R0AL 2JB6A 1KYOK 2Z35B 1F97A 4CU7A 3LMJH 4GRMA 5L2KB 2EDNA 1DBBH 3V5DA 3GBNH 4O00A 5DGQA 4PJCE 2CDEA 4RGOH 1LEKB 3ARWA 1PY4A 4MD4B 1GIGL 1LK2B 4XNZB 3BZ4A 3S3PA 4Q9BA 3ARDA 4X5WB 4P2CG 3J8F7 4ONFH 1NKRA 1KTRL 4Z7OE 5D2LF 1I7ZA 1LNUA 2NY2C 2L4OA 5SV4A 1AP2A 5JPNB 2I60H 2LABA 1WBXB 2VXVH 1MFCL 3R1GH 2HFEB 4X6DE 2C1PA 4CMHC 4XBEL 4MCYB 2W0FB 5D7SH 5JPMA 4W4NA 3G9AB 3OGCB 3QQNA 4MA1B 5JOPD 1XR9B 5DHVB 1D5XA 2OQJB 4PRAB 1RZJL 4OUUB 3S37H 4B5EA 2DDQH 4ZUVA 4LCWD 4JG1H 1OGAE 4P5KA 4N0YL 5DJYA 1DVFD 4N0RA 4JDVA 4KVCL 3ULVC 1TTUA 1JZ3A 1HEZB 3VFMA 1BF2A 1JZ7A 1UJTA 5ANMA 4S10A 4JQVC 4JFFD 4J4PC 2CLRA 5KN5B 3DUUB 5CMAA 2FJHB 3K81A 5D93B 4MYWB 2RCSL 2CR3A 3BI9X 1WTLA 2WWMD 4YH6A 1H3PL 3FRUB 4Y4FD 2A77L 3F12B 2FX8L 4AZ8A 1QSED 2PTTB 3IETB 1KGCE 4NWTL 4FQCL 2JKXA 2E9WA 1RIVL 2DM2A 1U8HB 3TO4A 3LEVL 3WD5H 5F3BA 2P8LA 2VWEC 4GRLC 2VC2H 2VDQH 1HDMB 3NA9H 2ZUVA 3U30C 3PHOB 3C08H 3WXVL 5JIKA 1JFQL 2CJUH 3DRTB 4PGBA 3RTQB 2MTPA 2V9RA 4BZ1L 4QHMB 1KJ2A 3S37X 5I0ZA 2B1AL 3O3BA 5KVFH 3F7QA 1ZT1B 1N6UA 1T04A 3BDBA 5DD6B 3GSQA 3EYSH 2NNAB 4L3CB 1CICA 5IB2B 3PWUA 2BVYA 3DVNA 3KS0J 2JTDA 4NNPL 5ERWB 1WIPA 3DURB 4AEIH 3QH3A 3IDUA 2NY2D 3WNLA 3TBWA 1I9IH 1KOAA 3CDYA 4LSRL 3F5WA 3FB7A 5SWZA 3KPTA 2Y06H 4I18C 5ETUB 5HHNB 3GSOB 3DIFA 1FVCA 4PJXE 1RHFA 1RUMH 5E6ZA 1UB6B 4MGXA 4NGHL 3GM8A 2H2SC 2DL9A 3QFJD 3O11B 4FQJH 4ZAKB 1DSFL 3ULVD 4QGYA 1S3KH 4YDJA 1KEML 3O9WB 4YIQB 1QRNB 2E5EA 1KFAL 1C8PA 4JFPB 3O45A 5HGGS 3BHBA 2VLJD 4I2XA 1G84A 4J4PD 1OB1B 1XGUB 3GJEA 4ONGH 4LSUL 4NRXB 3WFEH 1DQJB 2UV3A 3QIWB 4G43B 3V7AE 1IM3A 4F9PA 5IHUL 3MUHL 4I48A 1YMHA 5L88L 4XCYB 3RWDB 1W0YT 4OBSA 4V1DA 3FQTA 2ADFL 5DRZB 2I26N 3Q6GL 3JWOL 1KG0A 1OY3B 4OCMC 2DMKA 2PYFB 4JVUA 4U6TA 3O6FC 4LVNC 4KVNL 1KJ3H 5C7XH 3LDBC 4GRLD 5KSVA 5HVWA 3CVHB 3VI4E 3D18B 3P30H 5HYSA 1S9YB 1F5WA 1J0JA 2FYYA 3AXLB 2DQIL 5HD8C 2H9GB 3WJLC 1LP9A 1PZ5B 2IALA 4GAGL 3MNVA 1JYWA 3BH9B 1PY9A 1MRDH 2R2HA 1IGFL 2NCMA 5KTEL 2IPKA 3KYNB 5DRXB 5DT1H 2OSLB 5GHWL 5BRZB 5I1GH 4KJYA 1T89C 1J7VR 1X7QB 5IFAH 2VISA 3BUYA 3VD3A 2WQRA 4RSVA 1XF4B 1BD2D 2IBZY 4G7VH 4IHOB 4PRDB 3AMLA 4WUUA 3SKMB 1C16B 2HT3C 1FH5L 4ZFOB 4UTAH 4TUJA 4DN3L 4LEOA 4ERSL 4FABL 3DXAA 3UYRL 5IW6A 1NBZB 1BWWA 3JV0A 1R24B 1IQDA 5JW3H 5F1NB 2OMNA 4BSWB 3LKPB 3HI5L 1NCNA 3SE3A 32C2B 2H2SD 1UWXK 2CDFB 3L9RA 3VGDA 3MOBL 2GJZA 2BRQA 1A6TA 2HRPH 2H32A 2P45B 5C09A 1WAAE 2OXGA 3LKRA 1PKQA 3W9EA 2IANE 2PYEA 3FT4A 4XP9H 1CK0H 4KGJA 1FGVL 4F58H 5EU4B 4NKOA 2X4QA 2ZCHH 3PHQB 2ZUYA 2FJFB 4F7EA 3SO3C 3EYOA 4MJID 1T6VN 4R3SA 5DD5L 3FO1B 1A6PA 3LKQB 4IRSA 1AFVH 1RZ8B 5HDBE 4LPCA 3OBAA 1OW0A 4EI6A 5I1LB 3DX8A 2XFXA 2B4CH 4NQEB 2JB5L 4Z7VE 4OCXH 1CTOA 2JK5B 4WHYG 3MYZA 3O6FD 3MRIB 4JQIH 3IXTB 1CFSA 3DO7B 4JZNA 3RWGA 3TJEH 1YNLH 4F7MB 1Z9LA 1MFEH 3FQWB 2VITB 4M6ML 2D7PA 5DC9B 5HGHB 4Y5XB 2YBRA 5DJDB 3VFOB 5ISZB 5HD8D 2QKIB 5I8OL 4JHAL 5DMYA 1RUKH 4JO3H 5JIPA 4JO2L 2VLKA 2X4OB 1CTNA 2BVOB 1BFTA 4HWEH 3BEWA 1SEQL 3LN4A 1NKOA 1MNUH 3MXWH 1A6ZB 3HTLX 3QHTC 4X5LA 1HQRA 5ESQA 5ALBL 4YC2B 4XPHL 3RX7A 2BSED 5EU6E 1J88A 4GG8A 1P1ZB 3MOQA 1VSCA 3BP6B 2JJTA 1G0DA 1S9WB 4Q58C 3IYLW 1IJ9A 1BZ9A 3BEVB 4NN6C 3X3GH 2P8MB 3PABB 2D0FA 1A7PH 4X98B 1E4JA 2ERJC 3BT2L 5DMJB 3VFUA 2FO1A 5BV7B 3LQAL 4HAGA 3TVMA 4Z5RB 1FPTL 2P5WE 5DK2A 4X9BA 1GPOL 2G60H 2IPTH 3KPRB 1XGTB 1ZLWK 9CGTA 2BNQD 1ZLVH 3SY0A 1CU4H 2VDKH 2O5YH 4KI5C 1JBJA 2E3VA 1J0ZA 1KLGB 2RHEA 1CWVA 5CINL 2FB4H 1G9MC 3CLEL 3K1KC 3RUGA 3V9FA 2HLAB 3T0EE 4L4TD 3X11B 1QBLH 2I5YL 3DSFL 1JHKL 4ODWA 4XAKD 3VGAB 2KZ1B 5JLZB 5KSUA 1F13A 1QSFA 5MHSD 4Y19E 5INDB 2B0SL 2R29H 3CSYB 4IMLB 3P4NB 4HMCA 4LHUA 4RIRA 2Y07H 5I76B 4E41D 5KVEL 2D3VA 3K4ZA 4NT6A 4UDUB 1M1SA 4G9FB 3O2WH 4HLJA 4PJAE 5A1AA 4OLXH 3TIEA 2OZ4L 1S7UA 2FX7L 4PJGA 3O3UN 1A3QA 1SBBA 1NUGA 1YNTB 3KPOA 5DJ8B 2X4NA 4HD9A 3ZDYF 4PJCA 2JB6B 4JJ5A 1V3JA 1Z9SA 5I9QB 4GRMB 3D5OF 5DVKA 4UI2A 3V5DB 4Z6AT 2CDEB 4WFEE 2D0HA 2RB8A 1P7KA 2VE6A 2PR4H 2N56A 4RBPK 2ICES 3BZ4B 1S5IL 3PQYE 5HYEA 3MJ7A 1ZT7A 3G6DH 3KLHC 5DUPL 5GRUL 3ARDB 2C3HA 1I7ZB 1LNUB 4K3JL 4DUXA 4IMKA 1AP2B 4OUOA 5C2UB 2C1PB 3UPRA 2NZ9C 1VCAA 5JPMB 4YXLL 4S1RL 5F96L 2E6QA 1SJXA 1ACYL 1D5XB 1FO0A 2AEQL 4JEGB 1I3RA 2AS5M 4ZUVB 5C07E 1VGEL 5GS0H 3HKFA 1CXIA 4KI5D 4XWGL 3MFFA 5DJYB 5FYLD 4JDVB 1IARB 4WO4A 1L9MA 5L8KB 1KB9K 3VFMB 3BISA 5ANMB 4P46A 1QSEA 2CLRB 4ZFGL 4D9RD 1T0PB 4M7LH 5CMAB 1MI5D 3MYJA 1UQSA 2XV6B 1OGTA 5IROC 4R8WH 3D2UA 4AL8L 1W72L 4JM2F 4K9EL 5ESAA 4KQ4L 4GAJL 2R0LL 5CKGA 1DL7L 1DBKH 4J1UA 2VXQH 4NIKB 5IJVA 2R2BA 2XQBH 4CRPA 3CMOL 1IEAA 2P8LB 1WBZA 4U6VL 1OM3L 2DYPD 4U6YA 3O4LD 5I8CA 5FYKH 5T3ZD 3BW9A 5D1ZC 3UBXA 15C8H 3WUWG 2C7UA 4G7YH 4PGBB 4WTZA 2YD9A 4TN9A 2DLIA 1KJ2B 1RUQL 4JFOA 4PJHA 4JJHA 4YHZL 1KEGL 1JNHA 3O3BB 1F8TL 3MRKA 2EO9A 4Y88A 1T04B 4XPAH 1B0RA 3GSQB 4JRYE 4NQCE 3DMMA 4FP8L 2V2TA 2CRIA 3PWUB 4KMLB 1JPSL 3KLHD 3DVNB 3OJ2C 5HYJE 3IDIA 3BKYH 3LKSA 4KHXH 5DJ0A 5F70A 3KPSA 1JK8A 3QH3B 3VGGA 4X7EC 1GGCH 1EHLH 3TBWB 5JUEL 5CJQL 2COQA 3F5WB 3DX7A 2F53A 4OFYD 3FB7B 5SWZB 2ATKA 5D1QA 3DYPA 4QOKA 3U4BH 2NZ9D 5T3XH 3EOBA 2HFFA 1DBAL 1MF2H 4HC1A 4YDLB 3DIFB 4LCIH 1FVCB 4QHKI 4N8VA 5KZCB 3SDAC 4UQ3A 4J4PA 5EB9A 5E8NA 2A1WH 35C8L 3KDMA 3NACL 3LQZA 1XGYL 4YDJB 1TQCC 4PY8I 4PLKC 1V3MA 1ZLSH 3O45B 3BHBB 4I2XB 5EIQA 4PR5A 4PGEA 3RJDA 3AB0B 3GJEB 2A0LC 2AW2A 3X13B 1MCFA 4TQEL 2BSTA 4CL7A 4NZRH 4DQOH 1FBIH 3GBML 4YE4H 2IFFH 1VFBA 1IM3B 3I85A 1JHLH 5D7KE 4I48B 1EUTA 1YMHB 4LDOB 1NGZA 2C5DC 1X6LA 4V1DB 5IBLC 3GSNH 1BFVL 4JQXC 3FRPA 1KG0B 4EXPX 3B9AA 2FDBP 5A2KH 3K4AA 2UY7A 4OIBA 2OI9B 1J1XL 2NXZB 4BA8A 5KSVB 2X4UA 4PJFE 5IFHL 2DIAA 5HYSB 2Y9RT 3CSPA 2FYYB 1NCUA 2HJFA 5D1ZD 2Z8WC 1CGSL 1KPVA 2OTPA 2QSVA 2X89A 3QUML 3NFSH 3NIDF 1LP9B 5CLWA 2IALB 1GL4B 3CIQA 3MNVB 4XCCL 2XRAH 1IGMH 4DUWA 5EO0A 2CMRL 2JIXD 5J0BA 1U58A 1MRFL 2R2HB 1EA9C 1IFHH 5LQBH 3A6BH 3RVTC 1CI5A 3MA9L 4KJYB 2BNRD 4U3CA 2WANA 4M1CC 2VISB 3HZVA 3BUYB 3HAEA 1B4JH 4CGTA 1FQ9C 1ZMYA 5LXGL 4GXUM 4OCRH 4D0CA 1T7WA 2ICEB 1F3DH 5FXCH 5C6TH 1AC0A 4CUCA 4WUUB 3CUPB 5D96B 3S7GA 3UO1H 4TUJB 4X6EA 4JY6A 1CFVL 4G6JH 5F7DB 4J23A 4LEOB 1A4KA 4D9QD 3DXAB 4R90L 2DLEA 2VKWA 1FG2A 4MQXC 5IW6B 4ZO6A 3B9VA 4ZD3L 1D9KA 4RMUA 1IQDB 2B5IC 4Q0XH 2FEDC 1GIGH 5GJSL 4GXVL 3SDAD 4UOW0 5DVNA 5B39A 2YRZA 2XXCB 3L9RB 2GJZB 1A6TB 2DM7A 1XH3A 4MNGE 4MJIA 2H32B 1JPGA 5I73B 2YA2A 5C09B 3VXMA 1PKQB 4PLKD 2PYEB 1MFCH 3FT4B 4JGJA 2XOTA 4XBEH 5HI3C 4NKOB 5F7NC 2X4QB 3D39E 3STZA 1HHHA 2A0LD 3PP3H 1C1EL 4LPXA 1W8OA 4IRJA 4R3SB 3LKOA 3CVIL 5IWLA 1WCQA 2KL6A 2BY2A 5D7LD 3GSWA 4Z7VA 3C5JA 4IRSB 4CU8A 5LG1A 3KLAA 5C6WH 1KIUA 3QJFA 4N5UA 2QADC 4PP2A 2HVKA 4EI6B 4KVCH 3DX8B 1IGCL 5TFSL 2XFXB 5IBLD 4WHTA 4HKZA 4H0HB 4PGZA 1EZVX 4EI5C 1CFSB 2EH8L 5E6IB 1E4KC 4L9LC 2MSPA 2YPLE 4JZNB 3RWGB 2Z91A 3H9SE 2DM3A 4DN4L 3HNTL 1WZ1L 4TULL 5HDQL 1JWSA 2YBRB 4YHPA 5DA4A 5F9OL 5IVNA 5DLML 4APQA 3CGTA 5IG7A 4RX4D 2VLKB 2FX8H 1ZGLP 2P42B 2EYSB 1XCQA 3MBXL 4N0CC 5ID1B 4NWTH 3BEWB 3LN4B 2R56L 4FQCH 2J8OA 1KCUL 1RIVH 3RVTD 3LEVH 4FTVD 1MY7A 1HQRB 2DQTL 4OCNC 4MQTB 5ESVA 3L3OA 4Z7NE 5ESQB 1CE6A 1U3HC 3PGDA 2C3WA 4GG8B 1SY6L 4KDWA 1AGEA 1JFQH 3Q5OA 3SKUD 1LO0H 3VG0L 5K59E 4S0SD 3GJFA 3RA7L 3D85D 1N5AA 4GRWB 4HKJB 4BZ1H 1MIML 1BZ9B 1PYWA 1CGUA 2VLME 4MQXD 3VFUB 5FA3A 3WLBA 1J8HE 3UC0L 2APWA 2FEDD 3MLUL 2C1OA 3TVMB 5BS0D 5DK2B 3EYFA 4JO4H 1UYWL 4NC2B 1TQBC 3SY0B 4N1CA 4RISL 3OTTA 3IDNA 5A3ID 5HI3D 1N64L 4JFED 2HFGL 3RUGB 4P9HC 3BKCH 1K3IA 4X9IA 4K23L 4Y19A 2VOTA 1YEHL 2VSCA 1RUPH 4CMMA 1A6UL 1MELA 3HZMA 3KXFD 4ODWB 5I16A 2QADD 3SGJC 5KSUB 4NN5C 1DSFH 1QSFB 3F8UB 4W4OC 3SEPA 2IBBA 3Q0HA 1MHCA 2AV1A 4RIRB 2PTUA 2VDML 4LHUB 5FUOL 4LLWA 3RWCA 1QO3A 2P43B 4EI5D 2I24N 4JZJA 5C0DA 4YXHL 4NT6B 3IDJA 3O8XA 3KR3L 3NMEA 4HXAL 3B9KA 3OAZK 3EDEA 5IHUH 4KZDL 4PJGB 1S7UB 4YHLL 5L88H 2W9EL 4O9HH 4LSPH 4N0CD 5D71H 4Z7WE 2ADFH 2GJJA 5KVDL 2X4NB 3PV6A 2FGZA 4RAVA 3Q6GH 4PJCB 1W0VA 4JJ5B 2D7OA 1UGNA 4AY0A 1AKJA 3C5SA 4KVNH 1NQBA 2BVUA 1U3HD 4M93C 5KW9L 1LO5A 4PRPE 2J6EA 5MI0C 2AJ3A 4MHHI 2DQIH 1P7KB 2Y36L 2VE6B 1VEPA 2NY5C 3RY6A 1ZT7B 2NMSA 3MCLH 3OAUL 4XVJL 1MWAA 5F9AC 1C5CL 5FM5O 2HP4A 1IGFH 1BZQK 5GHWH 5B38G 1PGRB 3BIKA 4WY7L 4MXVF 3S35L 1J0IA 5DQ9A 5GRWA 1B4RA 2HAZA 3HNVL 1JMXA 3MV7A 3ABZA 4PFEA 5D72L 1FO0B 2A38A 1A21A 1I3RB 5KJRL 1FH5H 1X5XA 1LILA 5HPOA 3MFFB 1JNLH 4ERSH 4FABH 3WJJC 4WO4B 4GJTB 1QR1A 4S2SA 4RQQB 2J3SA 3QA3A 5INCB 1QEWA 2F54E 3VI3F 4P46B 3HI5H 1QSEB 4X4ME 1RVFL 4M5YL 2W0KA 2ID5A 1XZ0B 3MYJB 4R6UA 1UQSB 1OGTB 1Y18B 4F33A 5E9DA 4TUOA 4JKPL 3D2UB 1CD0A 5AYUH 1SYSA 1F4AA 4PRHE 4QO1A 4URTB 1MQ8A 1OLZA 2DYPA 5J1TC 2BY0A 4HWNA 5IJVB 2R2BB 4MNQD 5C0BE 1IEAB 1YDPA 1WBZB 3IRZA 2ZUUA 4RGMC 5DXWA 1NGYA 5CZXC 1UZ8A 3L3GB 3RVUC 1CD1A 4U6YB 3KYOA 5I8CB 3WO3B 1P9MA 3BW9B 5T5NF 3UBXB 4QRRD 2JB5H 2BSSA 2C7UB 4PPTA 3VRIA 1V7NL 2IPUG 4XCFL 4FFVC 4PJHB 1JNHB 3RKDC 3MRKB 3I3BA 4PRIE 4PB9L 4PJBE 3T0WA 1B0RB 1BGXL 2QQNH 3QUXC 5DMIH 5TE4H 3DMMB 2VDRL 4JHAH 3QDJE 2V2TB 1UJ3C 3CH1A 4JO2H 1A5FL 4R0LA 3IDIB 5E2VL 1GJIA 3TBSA 3LKSB 5DJ0B 5K9QI 3KPSB 1JK8B 2F53B 1Z9OA 2OM5A 5CP3H 1XF3A 2ATKB 1KACB 5D1QB 5EN2A 5FCUL 4QOKB 5ALBH 5B3NA 4NM8L 4FXKA 1UWEH 2NY7L 3EOBB 2HFFB 4XPHH 3VU2A 5FYKE 4ZFOL 4UB0L 2XG4A 4RCAA 2A6KA 3SJVD 4N8VB 5HGDA 4IOSD 3HG1E 4UDTA 3WNPA 2ICWA 3RVWC 3RNKA 5KVMC 3NCMA 4UQ3B 2YUWA 5JOEA 5E8NB 5KG9A 2EXYC 1AI1L 4P4KC 3KDMB 3P9MA 8FABA 1G7LA 3LQZB 1S5HA 2W9DL 4UNVA 3LQAH 3IU4H 3IJYA 4O5LH 3ZO0A 2YS4A 4PR5B 4X9GA 3A67L 1YY8A 1FPTH 5L6YH 1FNFA 1GPOH 4XPBL 5TDOA 4LRNL 3BMVA 4DK6A 2BSTB 1U3YA 5GGTA 4YXKH 1DUZA 1VFBB 1OARH 5KAQG 1NGZB 3S5LG 5T3XE 4WTWA 2ARWA 3UDWA 3CLEH 3ALWA 4NRZA 3RL1A 4ODVH 2I5YH 1I1FA 4K94C 2X4UB 5CZXD 3QUZA 3V4PL 3RVUD 1I7RA 2HJFB 3EFDH 4LSQL 3VH8A 1KPVB 4RFOH 4ZFZA 1QFUH 2B0SH 1BQHA 4E5XA 3ISWA 4FFVD 4BM7A 3NZHL 2EDJA 5EO0B 3RKDD 4H25A 5KVEH 1YMMD 1U58B 4TSAL 3LN5A 4U33A 2O5ZL 2FBJH 3QUXD 4R2GC 3T0AA 4WU5A 3LIZH 1ZWIA 4F8QA 1EO5A 3W9DA 2DJ4A 3N9GH 4XH2A 2OZ4H 2FX7H 3QZWA 3L7EA 4D0CB 5LCVL 3HA0A 3JWDC 3WHXA 3AS3A 4X6EB 4DZBA 3SE4A 2FJGA 4B50A 3PNWA 4QF1A 1A4KB 4G6ML 1FG2B 4XPFL 1B88A 5F9DC 3SGKC 3IFLH 1D9KB 4JDTH 1I1YA 3UJJL 1SBSH 5FIEA 1A4JA 5BV7L 3RVWD 4M1GL 4QRSB 3L3IA 5DUPH 5B39B 5GRUH 2EXYD 3Q6FB 4U0RC 3MBEC 4P4KD 4X9FA 5FGBC 3I3EA 3D39A 3LCYA 4HFUL 4MQSB 1XH3B 4MJIB 1JPGB 5FK9A 4K3JH 3VXMB 4EVNA 5K9JH 3DX9A 4EUPH 1FAKT 3QI9A 1RIUH 5BVJA 1URLA 4RMWA 2A9NL 1HHHB 1OGAD 4YXLH 3STZB 2MQ3A 5DWUL 4S1RH 3QWRD 4IRJB 5F96H 3OAYH 4TOYH 3LKOB 1ACYH 4C57C 1XGQA 2AEQH 4Z7VB 3GSWB 3DPBA 4PJEE 3C5JB 4LVNB 4HGKC 4YHKH 1VGEH 3KLAB 3WXWL 3QJFB 2GHWB 4PP2B 2HVKB 4F8TA 1MLBB 1DN2A 4MSWA 4WHTB 2AEPL 1V8HA 4HKZB 4RX4A 5CFHA 3BPCA 1KN4L 3S3SA 4BZYA 2Z91B 5KSBF 1HXYB 3NCFB 1KGCD 4ESKA 4Y1AE 1JWSB 4YHPB 4H1LG 2EDTA 1GZQA 5GRZA 4APQB 5IG7B 3QXDA 3WFZA 4KQ4H 1XCQB 1BJ1H 2R0LH 1YEGH 3BWAA 1DL7H 1LDPL 3V6BR 2FR4A 3CMOH 1MY5A 5ESVB 4R2GD 3L3OB 4U6VH 1CE6B 5SV3A 1OM3H 4OZFA 2DKSA 3PGDB 4FQXC 4ODXA 4KK5C 5FHBL 1I85C 4D9LL 1IMHC 4Q9QL 2YUXA 1J8HA 3GJFB 3U36B 1N5AB 1INQA 1FFOA 1N3NA 4NQDE 2CKNA 3T2PA 3VXRE 1RUQH 4QRPA 4YHZH 1KEGH 1PYWB 4OF0A 4X6CA 5ACLA 4PJ7A 5EZOL 2K3TA 2XWJA 1ZHNA 3GMMA 5FA3B 1GZPA 3WLBB 2X41A 3QG7H 5DMGC 5GGVL 4PGCA 4FP8H 1AJ7L 1EFXD 1FZOA 2ESVE 1E6OH 2C1OB 3I50L 1JPSH 1ZAGA 3F7PC 2CK2A 3EYFB 3MBED 3U0WL 4KK8C 1L4IA 3VFTA 4LSSH 3U46A 2A6DA 1YEIL 1WWBX 5JUEH 1Q9WA 2D2OA 5D2NA 3CFEA 3IDNB 4RGNB 4M5ZL 3ARQA 3BP4A 4HH9A 1DBAH 4EBQL 1G1CA 3K7UA 2GK2A 5C9KA 3GK8L 4PBXA 5J1SC 3V79C 1CDBA 3T3ME 3O2DA 4C56D 2F19L 4CMMB 3VXSE 2IBGA 4TPRL 3ULVF 2FCBA 1KXQE 5J6GA 3NACH 3O2VL 2P5EE 4JFQA 1WUNT 5D5ME 1HWHB 1MHCB 2AV1B 3RWCB 2EYTA 4LLWB 1CGVA 1QO3B 4PJIE 3LH2H 2R0WL 1FZKA 4NFDA 3D0VA 3QDGE 1FC2D 3MRJA 4JZJB 5C0DB 3B4NA 5DQJA 4JFHE 2IQ9H 3O8XB 3IDJB 3ZE1F 1FE8L 1MJJA 1NAML 4GOSA 2QJDA 3LHPH 4TQEH 1IBGL 3GBMH 3B9KB 1NFDE 2IADA 3R06A 4YFEA 1RPQA 4OZHB 2Q6WB 3VWKC 2OL3A 3WDJA 4X4XA 1DANU 3PV6B 3AS2A 2JJWA 4M62H 4M7LT 3K2MC 1W0VB 4RMVA 3VG9C 3HC0A 2VLLA 1AKJB 3C5SB 1J1XH 1OSPL 4ZS7H 1LO5B 5IFHH 1NL0L 4FQXD 3BXNA 4KK5D 5GGSA 2AJ3B 4JDZA 4GKNA 1CGSH 5IBTH 3QUMH 3B5GA 4DVRL 1DJSA 2ZG1A 5T1DH 3GNMH 4P3WA 5LBSL 3ZHDA 5D1XC 1MWAB 2CMRH 1P84J 2Q7NA 5H35A 2VZVA 3MA9H 3BIAX 4L3ED 5DMGD 43CAA 3CZFA 2XZZA 2K7PA 3BIKB 3RY4A 4WUKH 5DQ9B 4K71B 1U9KA 3S88H 4PJ8C 5LXGH 1WGOA 3MV7B 4JM4L 4ONOA 5HDLA 1A7OL 2F5AL 5J9PB 4KK8D 1NC4A 2MPAL 3QISA 5F1KC 4OLUH 1CGXA 1CFVH 2F54A 1S7XA 5I1CH 2CGRH 3DV4A 4R90H 3FCTA 1MI5B 2ZCKL 1QR1B 3K0WA 4O2FA 4S2SB 3W39A 5DRWA 1CDYA 1KN2H 3QA3B 4R4FH 1QEWB 3KJ6L 2IAND 4GXVH 4KGLA 3VFRA 3MJ9A 4TSCL 3KGRA 4QXUL 3R4DA 2YD5A 4BK5A 4F33B 5E9DB 4TUOB 3L3JA 1SEBA 2V2WA 3T0EC 1SYSB 4P59L 5E8PA 1U8NA 1RZFH 2DYPB 4JPKH 1P6AB 3OXSA 4Y5VA 4M61A 3CVIH 3DVFA 1I8IA 4ZNEA 1YDPB 5AG9A 1NGYB 2W92A 5IGXL 2QHRL 3IKCA 1UZ8B 3VD9A 4B7IA 1CD1B 3S4SA 3VWKD 3KYOB 5IR1A 3HMXA 3T4AA 1IGCH 4PRIA 4WI2A 1AD9A 4HPOL 4PJBA 2BSSB 1EMTL 2ZUQC 4LLUB 2CXGA 5CIPA 3VRIB 3QDJA 4JCLA 4XXCA 3UTTD 2QQQA 1MPAH 2DIJA 4D2NA 4DN4H 4TULH 5HDQH 5DLMH 3CH1B 5IP4A 4KZEH 4RRPG 2MJWA 2H6PA 5F21B 5D1XD 4R0LB 2R4RL 5E4EB 3TBSB 2KUTA 2R56H 5T1KA 5EU6D 3VD5A 4YO0A 2VQTA 4XPTL 3R8QA 4YWGL 3V6OE 4YDIL 1XF3B 4MAYC 4Y4HA 5EN2B 2JELL 4FXKB 2DF3A 3LS4L 3OR6A 4B7LA 4EN3C 4PJ8D 1YQVL 4I3RH 4H0GA 2GJ6E 1D5ZA 1SY6H 2A6KB 1Z6JT 5HGDB 1I8MA 1MJ7L 4UDTB 3PGFL 3HMWL 4UBDC 3QNZA 2ICWB 3RA7H 5F88A 3RNKB 2BDNL 3D3VE 2Q8BL 1MCOL 3P9MB 8FABB 1G7LB 2P5WD 2A9MH 1S78C 1JZ5A 1AHWC 1I1CA 1YY8B 3CLFL 5CBEA 5JNYB 4WW2C 1UYWH 5TDOB 1TNNA 4PJDE 1DUZB 5ICZB 5GS3A 3T0ED 1FJ1A 4QNPE 3OKNB 4RISH 1IZJA 4E0RA 5DHVH 3HNSL 5H8DA 4OZGF 4UUJA 1AE6L 2QLVB 3I6GA 1BFSA 1N64H 2HFGH 3F6IA 3WUZA 2ARJQ 3WDHA 4JN2A 3MX0A 4LDEB 5DJAB 4XT1C 5JHDA 1A8JH 4K23H 4NRZB 1AGDA 3RL1B 1YEHH 1NCTA 1A6UH 1I1FB 3GMPA 4U1NA 3EIFA 1I7RB 4LEXH 3WN5A 3VH8B 3P77A 1QYGL 3FN9A 4ZFZB 4KRLB 3H7BA 1BQHB 4E5XB 2Z0BA 3D87B 1UJ3A 3FKUS 4HLZG 3GRWA 4H25B 4YXHH 1KB5A 5FEBA 4O4YH 5IFJA 3LN5B 4QHUA 4HXAH 3B9DA 4L4JA 4WU5B 1JYVA 1ZWIB 3W9DB 3QULA 4XH2B 1EUUA 2DQCH 5MEOA 3QZWB 4YHLH 2R2CA 2W9EH 3CAFA 3T4YA 1FV1A 4UILL 1O7SA 5CS7A 3MLYL 3V2AR 5KVDH 5EOQL 3WHXB 1DE4A 4DZBB 2FJGB 2FWOA 3PNWB 4MAYD 1I7TA 4QF1B 5KW9H 4DGVH 4YBLC 3RGHA 3PQYD 3AU1A 4PLJC 4EN3D 3T0XA 5IB3A 3OPZL 2NXYC 2XI9A 5ADOL 2XZCH 4GMSH 4LCUA 1I1YB 2DKMA 3KVQA 4UBDD 2P7TA 3C09B 3WSQL 4DGYH 3L3IB 3OAUH 2VUOA 4XVJH 4MJ5A 3D39B 1C5CH 1UVQA 2FD6L 5FK9B 4EVNB 3DX9B 1NFIA 4NHCL 4JE4B 5HHXH 1S78D 4WY7H 1YEKL 3QI9B 5C07D 5BVJB 4HBCL 4FQIL 2ZNXA 2BY1A 4FQQA 3EJYC 5D72H 1IILE 1XGQB 3NABL 5I30L 5LWYL 1JGUL 4Y16C 3SQOL 4GSDL 4KI5F 3GHBL 1B3JA 3EJJX 3AFLA 5D7JA 3WFHA 3TNNA 4WWID 4MA3A 3NA4A 4MSWB 3JUZA 4OM0L 3WV0A 4YDVA 4RDQG 5AEAA 1SQ2N 5GGSY 3GSRA 3MCG1 4CJ1A 3DROA 4LRIA 3BPCB 1RVFH 4M5YH 5EUOE 1CDUA 3AREC 2CIIA 4XMPL 1RUAL 3ARZA 4ZUUA 1FGNH 3WIIL 3V8OA 1UH4A 5C70A 4JKPH 2MKLC 1CDHA 1GZQB 4U1JA 3GDBA 4LU5L 3E0GA 3QXDB 4OB5L 2AKRA 4OZIF 3MV9E 2EEAA 1TJHH 4K3GA 5EOCH 1N0LA 2FR4B 3L5IA 3D85B 2JCCF 1S9VA 4HIXL 5F7EL 4ZQKA 4OZFB 4LKXA 4ODXB 2EE9A 3TCXA 3SE8L 3VFPA 3IJHA 4KTYA 1YNKL 1J8HB 3CVHH 4BUGA 1FFOB 1INQB 1N3NB 4HJ0C 2VNCA 4JRYD 4NQCD 4XCFH 4QRPB 2ESVA 4P2OC 3TN0C 5T1MB 2E8YA 4IBLT 4X6CB 4PJ7B 4YPJA 3PDOA 4PLJD 2XWJB 4PB9H 1J12A 4LCCC 4PYGA 1GZPB 4K2UL 2NXYD 4NNYA 2WMPA 2OLDA 4LARL 1FZOB 1YYLL 4LK4A 5E2VH 1AQKL 4KJPC 4NO3A 2EDOA 3VFTB 3P0VL 3U46B 2A6DB 1Q9WB 5D2NB 1N59A 5BW7C 3CFEB 3RWIA 5FCUH 3OJVC 1FO0L 4NM8H 1NGPH 4HH9B 4P5MA 3VXOA 5C0RL 1OD9A 4UB0H 4N1HB 4ODTH 3EJYD 1UCBH 1H8NA 3S6CA 1T7VA 2E9IA 4DZ8A 5TGBA 5MERA 4Y16D 4PJIA 1G6VK 5FHAL 1AI1H 5D2LE 5J6GB 1IAIM 4JFQB 4O2EA 2W9DH 4K7FA 1AXTL 3OF6A 1N5YH 2EYTB 1NFDA 3HLAA 3ZDZF 3WFDL 1Z0NA 5HI5C 1FZKB 4OGYL 3D0VB 4GG6E 5D7KD 3MRJB 5DQJB 3OB8A 2G2RA 3ARED 1MJJB 4LRNH 4XB8A 1T7ZA 2ORBL 3R06B 2IADB 2VZSA 4Y7MA 2MQ0A 3G6AA 2I9TA 4NC1C 5HYSG 3QEQA 4BQCA 3G6JF 2QL1A 2OL3B 5A2JH 3PV7A 3NIFE 4X4XB 4U1SA 1EXUA 5BVPL 2VLLB 1AO7E 2WSKA 1TCMA 1CLCA 4NFBA 1U6AL 3QXAA 3VFWA 3QAZB 3BXNB 3AY4A 4P9ML 5GGSB 4FZ8L 4JDZB 4LSQH 1MJ8H 4GKNB 5AD0A 3K8LA 1EFQA 1V05A 3CX5J 4HJ0D 4OQTL 3TN0D 4P2OD 4PV9A 1A1NA 4TSAH 5H35B 2O5ZH 1H9VA 3GSXA 2B4CC 43CAB 3CZFB 4F15C 2QV2A 2Z31A 2FIKB 2WWKT 5F9WC 2ED8A 1PQZA 2V5RA 1B2WL 1Z3GL 1R3KA 4KJPD 5CEZH 1NC4B 3MUZ1 3ULVL 4HC1L 2F54B 2VDPL 1EBAA 1S7XB 5FGCB 4I0PC 1MQKL 5GRXG 3DV4B 1OAYH 4G6MH 3FCTB 3MOAL 1OAKL 3W39B 4F7TA 3FTGA 1CDIA 3QJHA 5EBLA 1MCBA 4RFNB 5EFIA 3FAWA 5DD0H 4DFIA 3UJJH 1OTUD 4J3VA 5BV7H 4M1GH 3VFRB 1MCJA 5D7IE 2PO6C 1WZMA 5GRVK 1BVLA 3TIDA 5I6XB 1I1RA 3L3JB 1OAUH 1SEBB 2V2WB 1XIWC 2EE3A 5HI5D 5E8PB 1QZ1A 1U8NB 2A9NH 1MFBH 1GHFL 2J7LA 3O3AA 3OXSB 1ND0B 4Y5VB 4M61B 1IC5L 4FQLL 1ZANH 1I8IB 4JVWA 3HI6L 3T04D 3ROOA 3SHSA 2YD3A 3WXWH 1BJ8A 3BQUA 3S4SB 3T4AB 2YPLD 4PRIB 1TTGA 2AEPH 1AD9B 3W11C 4NBZB 4RFEA 4HUWA 4UU9A 5CIPB 4KTEL 4PY7A 4QRUA 1KN4H 3QUYC 3AS1A 1JGVH 2LVCA 4M7JL 2KH2B 3ZSTA 4W6XB 3RJQB 1FL6A 4ZO8A 2BVEA 3SDDC 3UMTA 2H6PB 1BVZA 4TVPL 1Z0MA 2GY7B 1I3VA 2V5TA 2X9XA 2GJ6A 4YO0B 3TWCH 4LOUC 2XTJB 5FM8A 3UCRA 3WBDA 4Y4HB 4I9WE 3FB8A 2IAMA 3D3VA 3OR6B 2HMIC 4WIQA 1CBVL 1D5ZB 2KKQA 2V9TA 2VUYA 1TJIL 1DQLL 1I8MB 1ZGLA 5MEQB 3QNZB 2IBZX 5F88B 2YSSA 3GM0A 2FECL 4I0PD 1O5DT 5EZOH 3VXUA 3ZT6A 3BP7A 2VZUA 3OGOE 4PJDA 1TVBA 4M4PA 4JZOA 3BPLB 2OJZL 1FLRL 1KJVA 3QIBA 4G3YL 3BZDA 5K9OA 2X2YA 1X4XA 3W0WA 3PWPD 2PO6D 5IVXE 1RZKL 4MLIA 4LLYA 2OCFD 4WHDA 1XIWD 1FJ1B 2X4SA 4E0RB 2GI7A 1DQQB 4UUJB 3EDKA 4M5ZH 3I6GB 4AH2B 5HVHC 4CVWA 4EBQH 3UJTL 5I1AA 4JN2B 3GK8H 5JHDB 1VERA 4X7DC 5L2KE 4XMLL 3I02A 4LQ1A 2F19H 1H3TA 2VZOA 3P40A 2WBJA 4TPRH 1U3JA 4U1NB 4BELD 3WN5B 4YHYC 1IEBA 3P77B 4NYLA 3FHQA 3W11D 4X6BB 2NY1C 3OZ9L 2ZG3A 1UJ3B 2GFBA 3RIFF 5GS0C 4HEPG 4OT1L 3NPSC 3QUYD 1KB5B 5IFJB 4M7ZC 1FE8H 5FDYA 4F37K 4QHUB 3L7FB 4EZMA 4WI3A 3MRGA 3QULB 1AR1C 5EBMA 5DEZA 2BERA 5MEOB 3SDDD 4CN1A 3HB3C 1K8DA 2R2EB 1OAXL 1TPXB 3RDTC 3T4YB 1EERB 1FV1B 1JZ4A 4PRPD 4GKZA 5ITFA 4KKBC 5IJKA 4GMTL 4YK4C 5E2UH 4LOUD 1DE4B 1K2DA 2XN9A 2FWOB 1FNEA 1I7TB 1C5BL 3AU1B 4EIZC 1T03L 2HMID 5IB3B 3JVGA 4U4BA 1GH7A 1KJ2H 1QACA 4OIAA 1TZHB 3EOYG 3TYGH 4Y0GA 2P7TB 4I3GA 4I77H 5EOTA 1K3ZA 1MAML 3QG6A 1UVQB 5F97E 4DEPB 2ZNWA 3UJIL 4HFWA 5E94A 1D5IL 1NFIB 1Y6KR 5FF6A 1JYXA 1F45A 2F8XC 2ARJA 4U3HA 1T83C 3F7RA 1C7TA 3ZDXE 3D48R 3B8SA 4DTGH 3LD8C 1I4FA 3M8OL 1A7OH 4FQQB 2F5AH 2I9LA 5IQ7H 1ZLUH 1S9XA 4ZUSA 4GT7A 2BZDA 1QFOA 2F5BL 4XP1L 5D7JB 3WFHB 1OAZL 3TNNB 3TT1H 2ZCKH 4MA3B 3GHEH 3PG2A 2W65A 1JPST 2DQEL 4Z7UF 4YDVB 4LSTL 3GSRB 4LFHG 5L7XH 3CK0L 4LDLB 1REIA 2CIIB 5ICYA 4ZUUB 1ACZA 4UAOB 5HHPB 5E5MA 5KS9F 4R2GB 4I4WA 2NY1D 5KVGH 1F6LL 4U1JB 5C0BD 2DD8H 4ZUTA 4U1LA 4P59H 1DBJL 2AKRB 5GS0D 3P0GB 4L8SA 4ELMA 2B2XL 5C0FA 4WTZG 1TNMA 3HUJA 1A7NL 1F42A 4LPYA 4O02L 1AR1D 4HXBL 1S9VB 5TE6L 3VRLE 4ZQKB 2QHRH 2HH0L 4NFCA 4FMKA 2X10A 3FJTA 3HB3D 4LKXB 3RDTD 3VFPB 1D5BA 2CLVA 4JPWL 4WNQA 3IJHB 4I13B 3DLQR 4MJ6A 3WE6A 4KKBD 1EMTH 2J6EL 1Q9KA 3CCHA 3LAFA 2ESVB 3RWEA 3LKNA 1A6VH 2H45A 1BMGA 1QRNE 4I0CC 4U0RB 3ALPA 3EOAA 1HYSD 2W0LA 4NNYB 4AMKL 3O41A 1JPFA 5J57B 1UKQA 3U48A 5D70L 3OAYK 4YBHA 1CGWA 1I7UA 1I9EA 4N8VG 1DDHA 4NO3B 5FYKD 3NCCB 3ULUH 2FZ3A 3MRLA 4OF7A 4C56B 3RGVA 1BQSA 1CLYL 3SKJL 1JI1A 1N59B 4YDIH 4KROC 3RWIB 3SE9L 2WIMA 1E0OB 2JELH 2X4RA 3A6CL 3I9GL 4UV4L 3ZL4H 4P5MB 3LS4H 1G7IA 5D2LA 2CK0H 3VXOB 7FABL 4LVOB 1MHHA 1YQVH 4JFZL 4OD2B 4M48H 4N68A 3PGFH 1G9NH 4DZ8B 5TGBB 5MERB 3S8WA 2BDNH 3EYUL 2LV4A 2Q8BH 1ZXQA 3H9ZA 4PJ9A 1MCOH 5L8JB 4GQ9L 3U7WL 2NY0B 4B53A 4O2EB 4K7FB 4KMQA 2X1QA 3WS6C 4H20L 3HLAB 4QRTA 2H32H 2FGWL 5BRZE 2D9QB 3CLFH 5CWSA 4F80A 2G2RB 5T3XD 3CFCH 1NLDL 5B38A 4CBPA 1PX3A 2NX5A 1R3HA 3BSZL 3G6AB 3HNSH 2I9TB 4XC1H 3VWJC 4OI7A 1AE6H 4P3CH 3QEQB 5EU3A 5BZDB 5CHNA 3MLWL 4U1SB 1Q0XH 3OMZA 1EXUB 2X7LA 1WF5A 2VRAA 3BP5B 2HVJA 2NYYC 3RY5A 3IS1X 4HW6A 4HX1A 3MACL 1MFNA 1NLBL 2X44D 4UNUA 5HVGB 2AJXL 1MCHA 2EH7H 5GGUA 3QXAB 5JIIA 3VFWB 1JN6B 2J88L 2UY6A 4MMXC 4KK6C 4K7PL 5DHYA 1SHMA 3BKJL 3IF1A 2R23A 5AD0B 5F1SA 1AQDA 3IDGA 1UA6L 5I1HL 2MHAA 4A2LA 5DFVC 3BPOC 4PV9B 3JZ7A 3KPNA 3ARFC 3VMNA 3SDXF 3GSXB 2NY6C 4P48A 2Z31B 3WNKA 2H2PC 3GFUA 3O6LL 1Q94A 1VFUA 1PAMA 8CGTA 3WNMA 1I3GH 1R3KB 2E27H 5EOQH 4OFKA 3UYOD 3QDHA 3ARBA 4KROD 1KCVH 4NQEE 1WJ3A 3NN8A 1JZ2A 4YHIB 5KANG 5CEYB 2BNUA 1OSZA 3ORJA 3BE1L 3OPZH 4GRWH 4Z7OF 1A0QH 2WP3O 3FTGB 3QJHB 5EBLB 5EFIB 1PZUB 5H37G 1MCRA 3RIAK 4LVHB 4X6DF 3WSQH 3GB7A 5ISZE 3O3DA 1BVLB 2FD6H 2YMXH 1K4DA 4QXWA 5I8KH 4NHCH 1YEKH 2H1PL 3RAJH 5F9JA 1CFNA 4UINL 5F89A 1U3ZA 4HBCH 5GGTL 1TVHA 3U4EB 3O3AB 1ZA3A 4WDIA 4QXTA 4Y8AA 5GSVA 1AD0A 5CEZE 3NABH 5I30H 4LSVL 4ZXBC 5LWYH 1TZGL 1JGUH 1GAFL 3SQOH 4GSDH 2Q20A 3ROOB 3GHBH 3BQUB 1FYHB 1Q72H 4NKQB 2IJ0C 4BSJA 2NYYD 4RFEB 4Y1AD 4HUWB 4UU9B 5JMRA 4PY7B 4QRUB 3QFDA 4PGDA 2CRMA 1A22B 5E0QA 2VR5A 3QPXH 3V7MA 4XMPH 1RUAH 1IAOA 5DVLA 3WIIH 4NC0B 1EGJL 4KK6D 1FL6B 4ALAH 7CGTA 3B5HA 1IKNA 1IC4L 4LU5H 3KPRE 1JTTA 4OB5H 4Y5YA 5DFVD 2V2XA 3QO1A 3ARFD 3JSSA 2LTQC 3PXHA 3AS0A 4HUXA 2JF1A 1JTPA 3S5LA 3ZTJG 2H2PD 5F7EH 3FB8B 4F2MA 1ED3A 4NQDD 5F72S 1BECA 2IAMB 3VXRD 3NBNA 4Y4KA 3SE8H 3D0LA 3IDXL 1QUNA 4JRXA 1U41A 4G8FA 1YNKH 3Q3GA 1ZGLB 4HUKB 1QTYT 1P7QD 4KRMB 2YSSB 1AY1L 4XMKL 4QWWC 2VDOL 3VXUB 4OCLC 3BP7B 5GGQH 2EIZA 4K2UH 1TVBB 2HA1A 4JZOB 4AEEA 1WBYA 3C60C 2R0ZL 1XIWA 3BJLA 1NAKL 1KJVB 3QIBB 5K9OB 4XI5C 4CADA 2DJUA 2H3NA 4Q6YA 2APFA 2V6HA 4JG0L 3W0WB 1AQKH 2GTWA 3RL2B 4MQ7A 4PJXF 4X7SL 3CSBA 1F3RB 1RHHA 3QWOA 4HIIA 5E00A 4YFDB 1FO0H 3VXSD 2YD7A 5I1AB 2PXYC 4H26A 1LEKA 1OLLA 4ZUWB 3TH3T 3JTTA 1PEWA 4EDXB 4ZXBD 5HHQA 3AAZA 1XCTA 3SCMC 2P47B 2WBJB 2X4PA 4YDKL 3QDGD 5L9DL 3JUYA 1UFUA 4R7DA 2UZIL 3E6FA 5B8CA 2OTUA 1IEBB 4NYLB 4JFHD 5MP6L 1EHNA 1AXTH 3EBAA 4ORGA 2VAAB 3WFDH 4NCDA 5JA8B 2GFBB 3FFDA 4MVBC 2CKBA 2VH5L 4OGYH 3V0WL 3H8NA 1FYTD 1PFCA 3WIHL 2ORBH 3MRGB 5EBMB 3AMKA 2XZQL 4R97B 5E8EB 1HEZA 2D31A 5CUSL 2E6JA 4GKZB 1EEQA 5ITFB 5BVPH 1K2DB 2XN9B 5CJXC 1MCCA 4GUPA 5CSZA 3T0DA 3L1OL 3DYOA 3MLXL 5ANME 2D7TH 4P9MH 4FZ8H 5E8DL 5GSRB 3IETA 3QCVL 1AHWB 2RBLA 1CDCA 5EOTB 1NCCH 3QG6B 5C0IA 1U8HA 3DARA 4QWWD 3HE6C 5D6DA 4P57B 4H1LA 2FHFA 5IVOA 4HFWB 5C08A 5E94B 2OX5A 2HTLC 3C60D 3I3DA 5FF6B 3GI8L 5F44A 4C4KT 1YEDA 5ITBL 3F7YB 2ARJB 2J5LC 5EZIL 1ZOXA 4XI5D 5DUMH 1I4FB 3DRTA 1B2WH 4YAQA 1H5BC 3RTQA 2I9LB 1S9XB 4ZUSB 1G6RL 1RZ7H 4XX1G 4HC1H 1ZT1A 2VDPH 1P5VA 1W8NA 4L29A 2W65B 2PXYD 4FQ2L 1OAKH 1NMCC 4NZJA 4WV1A 1WAAF 1R5VB 3MPCA 3BGFB 5CJOH 3ZKSD 3BZFA 3HC3H 2VXUH 2GSGA 3SCMD 1WQVT 5LKNA 5HXMA 5ICYB 2HRLA 2GEEA 1H3VA 5E5MB 4I4WB 5DMKA 4XP4H 5FCSH 4ZUTB 4U1LB 3OHXA 5FUZL 4MVBD 5HDBF 1I9RH 4L8SB 4CVZA 4ELMB 5TPWL 4U05A 5SWZE 1MUJA 3FMGL 1KPRA 1IC5H 3IJSA 3HUJB 4FQLH 3PL6A 3TM6A 2OL3L 3LQAC 2IH3A 3HI6H 2A6IA 4NO0A 3AC0A 1MCPH 5DURD 1IGTB 1D5BB 3BAEL 4WVRA 4H8WL 3T2QA 4MJ6B 3NFPA 1U8QA 1QNZL 3WE6B 4YHML 1BVKA 1CS6A 4OAWA 3GKZA 3MFGB 2FEEL 1Q9KB 3CCHB 3LKNB 4YGVA 4FFZL 1A14H 5IKCA 2VDNL 3QIWA 4M7JH 1CLOH 2HWZL 3EOAB 4P2RA 1IVLA 4I2XE 4JREB 5DQDL 1MIEH 1MHPL 3O41B 1JPFB 3V52H 4GBXA 3ES6A 3RWFA 3QDME 3DVIA 4NBXB 4TVPH 1I7UB 3HE6D 2XT1B 1DDHB 1EV2E 2FZ3B 3HAEH 1KLUA 3MRLB 3KPPA 3RGVB 5F6IC 4V1DE 2HTLD 5T5FL 4P9HL 2APTA 2X4RB 4OLVL 1G7IB 5D2LB 4L3AA 1MHHB 4JR9L 3C5ZC 1DQLH 3RRQA 5AAMA 4FG6C 4N9GA 2R8SH 4Z78A 1RY7B 1X5GA 3NIGE 3KYNA 1HH9A 4NQXA 5BRZA 1YEFL 1LP9E 4LLMA 5DK3A 5EO1A 4MXVE 3LB6D 3O4OC 4QRTB 4MLSA 1FLRH 3MJ9L 3VDAA 3DGGA 2CLZA 4G3YH 3V0AC 5CWSB 3IKKA 2DB8A 1RZKH 5CZKA 4ZFOA 1IL1A 5B38B 2DN7A 5BQ7A 2NX5B 1IQWH 3H0TB 3SOBL 1R3HB 3MNZB 4K8RL 1B90A 1JZ6A 1BLNA 4WUUE 3VH8G 5EU3B 5I75C 4MS8C 2X7LB 2MMXA 2HVJB 3DXAE 4JM2A 4HX1B 2CO6B 3BD4A 3VXQA 5D4QA 2XWBA 2FH6A 1EEZA 2IMMA 4P2OB 5GGUB 2VXTL 2NY3B 1OP5H 2V7NA 5DGRA 4NZUH 2JJSA 3QIUA 2NY5L 5DHYB 3IF1B 4PJAF 2R23B 1S8DA 1AQDB 3IDGB 3QZWG 3OZ9H 3MTRA 2MHAB 5C09E 1PD6A 3NH7L 3ZKXB 3C6LC 3KPNB 3ZYIA 4OT1H 2PYEE 2NZIA 3LKQA 5HI4C 2ADJA 4XXDA 4XCEA 5J11C 4M7KL 3OB0K 1PJ9A 3NCBB 1J5OL 2VDLH 4HDIA 5F6HJ 4NQEA 5MENA 4KUZL 1OAXH 1X5AA 3BGAA 2JK5A 3RWJB 4OGXL 5DVMA 2LU7A 2CRYA 3BOVA 1IM9D 4GMTH 5HHOA 4HT1H 4BUHA 3DO7A 3STLA 4LASL 3ARBB 1Y6MR 3CXHK 3FQWA 3VW3L 4HPYL 1S7RA 4FA8A 3NN8B 4JLRA 1C5BH 2BNUB 4OLZH 3JV4A 5DJDA 4NDMA 1T03H 3GJFH 1IC7H 3IT8D 5I1IL 3C5ZD 1BQLH 5SWSA 3ZTJH 1MEXL 4FG6D 3WFCL 1T21B 2XA3A 2DLTA 2XKSA 5JA9A 1MAMH 3GB7B 1HNGA 3O3DB 3LOWA 5K33A 4YX2L 3L5HA 1K4DB 5E6YA 4EIGB 3FFCA 4RRPA 5F9JB 4Z77A 1S9KC 3MROA 1CFNB 5F89B 4PRNB 1TVHB 4WW2F 3INUH 1ZA3B 4WDIB 4QXTB 5GSVB 4KPHL 4M3KB 4XP5H 3TC9A 3CMGA 3PABA 4KWUA 4EQ2A 4XP1H 2IFGA 3BPNC 4Y2DC 4GW1A 4GRWE 3UBXI 4BQ6A 4MS8D 4G6KL 4WFHD 4U49A 4LSTH 5IMKA 1KJMB 1Q38A 3X14A 3LY6A 4DCQA 3UTOA 3QFDB 5CJ8A 1E4XL 4PGDB 3ARUA 4Z0XA 1UKSA 1IAOB 1ONQA 3CJJA 5E7BA 5DJZA 5D9SA 5GS1C 3OR7A 4C83A 1KB5L 4OZFG 3UEZA 4XVUC 5SX4H 4Y5YB 2HLAA 2V2XB 3C6LD 4FOMA 5JDJA 4KY1L 5HI4D 3QO1B 1U2HA 4P2QD 4NUJA 1A7NH 4PJ5A 2Y72A 1QLRA 1UT9A 4EEEA 4HUXB 5CSGA 3S5LB 5TE6H 3RUGE 1M4KA 4P5TC 4F2MB 1ED3B 4HCRA 5J56B 2YD4A 4Y4KB 4IIQA 1E4WL 3D0LB 4YNYA 4JRXB 4PIRF 3Q3GB 3GKWL 4YFLI 3S36L 3BX7C 2DQFA 5JMOC 4OCYH 2J6EH 1F58H 4ZSOA 5J13B 4YUEH 1RK0A 3PWPB 4TRPL 4ZOAA 2VSDA 2PO6B 3WO4C 4P23C 2EIZB 3D69A 3H3PL 1WLHA 2H8PA 3B9EA 1WBYB 1MWAH 1XIWB 3QB7C 4MB3A 4D94A 2OP4L 2C9AA 3W2DL 5CP7A 1GC1L 2Z92A 4CADB 4KHTL 2H3NB 2Q8AL 2GTWB 2I27N 4M9OA 3DSNA 4PJGE 2GAZA 4MQ7B 1ZVSA 1H3UA 1FZMB 1RHHB 3QWOB 4HIIB 5FKPA 5E00B 1CLYH 3T2OA 3BDYL 1V3KA 4WI9A 1NJ9A 4M43L 4WENB 3MMEB 3A6CH 1BJMA 4NZTL 4UV4H 3DETC 1OCWH 1Q0YL 4H26B 2GQHA 1K5NA 4OFPA 1FSKB 3MRQA 3JTTB 5HHQB 3AAZB 1ZTXL 1ZHLA 3E6HB 5DK0A 1XCTB 3SKNA 3P0YL 4JHZA 5CGTA 2X4PB 4Y2DD 1T7XA 2X4TA 2ZUXA 1L7TH 4R7DB 3ARGC 3E6FB 5B8CB 2OTUB 3U7WH 3L6FA 3AM8A 5KOVC 5JOFA 5JR1L 3TZVA 4ZDHA 4ORGB 1ZE3C 4H20H 4HGWA 3CDGA 1YJDL 4ZG1A 3FFDB 2CKBB 3MQIA 3NOIA 3C2AH 4JO1L 4Q9RH 4OCWH 1NLDH 4N1EA 1DUYA 3MJGX 3KHOA 4ZS6C 3BSZH 2UZYB 1K4CA 4XVUD 1IKFL 1AO7D 4JFDA 4PJFF 4U1GB 2D31B 1GGBH 1PG7L 3MLWH 1J86A 4OLYL 5TQ2H 1GGUA 2ADGB 1OAQL 3LQMA 4L4VD 5JZ7C 1NSNL 4EXKA 4MZ2A 4D3CH 3TT3H 4GUPB 5CSZB 1NLBH 5F1IA 5FUCE 1N7MH 4P5TD 4GS7B 2AK1L 3W5MA 4OSUL 5AWNL 1CE1L 2J88H 1BBJA 1QSEE 4QHLB 1NAMA 1JL8A 2J12B 4LPWA 1FAIL 1FFRA 3SDCA 1UA6H 4WEMB 5I1HH 4OJFL 1HH6A 5C0IB 4YJZL 4S1DC 3NAAL 4H1LB 4P23D 5C08B 1Q8MA 3NGBB 1HI6A 4PV8B 3NCJL 3OWEA 4PG2C 2FSEA 1YEDB 3AVEA 4XC3L 1F6AA 2Z8VC 2PN5A 5DD1L 2A74A 3TYFA 5IESL 4YAQB 1TXKA 5ACMA 3RX8A 5IB5A 2VLRD 1FDLL 3G5XB 2EKSA 4HH8A 4N5EC 3H7LA 4L29B 3SCMA 1MCWM 1UC6A 3ZYZA 3DETD 4XWOC 1FRGL 1M7DA 1QR4A 4WV1B 4PJHE 1QBAA 4LLQA 3MRCA 2NY1B 3RZCC 1KCRL 4AT6A 3BZFB 3J7HA 3QDAA 1ZV5A 2GSGB 1AGCA 4XTRC 3QWQB 1QBML 1SJHA 5DUBA 3L5XL 3ARGD 5F8QC 3OG4B 4FFYL 1A7RL 5DMKB 1YECL 1UACL 3KPSE 3PIQA 3S4SG 3OHXB 4N0FA 3H3BC 4UINH 1KCKA 5GGTH 4CVZB 2D7QA 2F53E 2EEBA 3B2VL 1MUJB 1E6JL 4K3DH 4QOKE 1KPRB 4XNZC 3IJSB 1I8KA 4WWKA 5DSCA 4IDJL 3PL6B 4LSVH 2GY5A 4NN7B 3P4MA 4FXGA 3ULVE 1GAFH 4UV7L 2IH3B 2A6IB 4NO0B 4ZS6D 1KUMA 4GLRH 4KRPB 3NFPB 1U8QB 4LGRB 5T1LA 4BFGA 1BVKB 4OAWB 5JZ7D 1QKZL 4BYHA 3FO9A 1ZHBA 3E3QE 4MA1C 1TZIA 1J1PL 1EO8L 3X13A 4YGVB 1YPZF 5IKCB 3QDMA 1T22A 3REWA 3OXRA 4P2RB 1YA5A 4UMGA 3HR6A 4G5ZH 4Z7NF 4S1SL 1QSZA 1EJOH 4GBXB 3ES6B 3CH8A 3RWFB 1DLFL 25C8H 4S1DD 2MCPL 1KLUB 3KPPB 1GOGA 5K59F 3CX2A 4R96B 2O5XH 4GW4B 3DRQA 2C4FU 5F71A 5ICXA 5D93C 1HINL 3BDXA 4W6WB 4JAMA 3CFKA 4MJ2A 3IDXH 3MV8A 4G8GA 4EDWL 3TA3C 1EJ6A 4N9GB 5IHBA 4Z78B 5FECA 1JUFA 4HJGA 4N5ED 1RMFL 1BEYL 5HYIA 5DS8A 1AY1H 1HH9B 4NQXB 4DGIH 3RI5F 5C0NC 1UM4H 4LLMB 4HWUA 2VDOH 3RIFK 1A6WH 5EO1B 1KTLA 4XWOD 3T2NL 5C0AD 3ET9F 2Z93A 5C71A 1QPPA 4GW5A 4KU1A 3RZCD 1NAKH 3DGGB 2CLZB 1ZA6A 2ICEA 5AG8A 4TVPE 3LS5H 4HHAA 5C1MB 1KB9J 4JG0H 4JHWH 4XTRD 3CUPA 1F4YL 5EBWA 3WLWC 1IL1B 5I15L 5SX4I 4ETQA 5BQ7B 2LVEA 5F7DA 4MAUH 5L2KD 3FO0H 3GMQA 3HFML 2X42A 3BGMA 1BLNB 4U7KA 1I1AA 5EO9A 3T77A 4MD5A 2RJMA 4HZLA 3SBWC 3V4VH 4TTGA 2GT9B 1AH1A 4WCYH 3TCLA 4JM2B 2YR3A 3P11H 1J8KA 1U95A 4WHCA 4L5FH 1WWAX 3VXQB 2XWBB 1EEZB 4PS4L 3K74B 4YDKH 3IAQA 2V7NB 5L9DH 4LKCB 1ZGLM 2UZIH 3QIUB 1JPTL 1BM3H 1S8DB 1GGIL 2BVTA 3FN0H 3ARXA 4MDJA 4MJIE 1QFWM 3VXME 2VH5H 1ODAA 2XPGA 4PGJA 4Z7WF 3KAAA 2ADJB 2E8ZA 1L9NA 2J4WH 2EC9U 4XXDB 4RZCA 5DZNA 2VTFA 1YYML 4XCEB 2WBWB 3QCUL 5EC2A 2VABA 2VZ1A 4ZAKC 1TTFA 1KTKE 4HDIB 1CZ8L 5MENB 1JGDA 3O9WC 1BAFL 5CUSH 2YWYA 3M1BA 4PG9A 1J1OL 4OZFH 1D6EA 5HHOB 4Z8FL 5E6IA 5EBGA 2FO4A 3ZT5A 1LE9A 3STLB 4HJJL 1S7RB 2OJEA 3L1OH 3OKLB 4JLRB 4WW1A 5GGVY 4IJ3B 3JV4B 4NDMB 2EDEA 2XZAH 1OQXA 2W38A 3ETBF 4OD3L 4WGWB 3AROA 2PW1A 3GIVA 5JXAL 1N6QH 2BXZA 3HC4H 2BC4A 2EYSA 3JXAA 5SWSB 1QFWL 3TA3D 1T0NA 5ID1A 1RZGA 3TPUA 1JRHH 5C0ND 2LQRA 2HG5A 5E24E 3QHFL 1UM6L 3LEXA 4X80L 4F3FA 4GXUN 3L3DA 4N8CL 2ZOKA 3FFCB 4LHQB 4Z77B 3MROB 4M1DL 1DFBL 1T0MA 3L3HA 5GISH 2HT3D 3Q5TA 4K07A 3WLWD 4HKJA 1I9JH 4AENA 3CU1A 2NY4B 1DQMH 3LEYL 4XNYL 3O2DH 5FB8B 4GW1B 4U2YA 1IE5A 3H42L 2YK1H 5L0QC 3V5HA 5IMKB 2AJYL 3X14B 4DCQB 1XMWA 3RU8L 1XEDA 3S97C 3X3FH 5ALCL 5BOZG 3C6LA 4Z0XB 1H8OA 1ONQB 5DJZB 5D9SB 3FL7A 1X4ZA 1DBML 3OR7B 4KTDH 4C83B 3PE9A 4KDTA 5FUZH 1IRAY 4FQPA 2ICCA 4X0KB 5C0CD 4NUJB 2YRPA 4RGNE 4HWBL 4PJ5B 2LAAA 1QLRB 1G9EA 1LO4L 2FLBT 4HZAA 4XB7A 4ZAKD 4DKEH 1UWXH 1JIBA 3O9WD 3U82B 4IIQB 1F6FB 1QRND 3BAEH 4H8WH 4PJBF 4YNYB 4E41E 1QNZH 4YHMH 5TH2A 2DQFB 2ICWI 3U4AA 3LRHA 4MD0A 4ZSOB 2G5BA 4FFZH 1WT5C 3EO1A 1RK0B 3PWJA 2VDNH 3O6KH 4UT9L 2HWZH 3D69B 2YA0A 2VZTA 3CD4A 5DQDH 2H8PB 2AQ2A 4OLWL 3WKML 3LMJL 1D7FA 1MHPH 4U7MA 5CP7B 3RVXC 1FNLA 2Z92B 2LAGB 4Q74A 1I8LC 4F9LC 4RGOL 2GAZB 4OZHE 3V0VA 1ZVSB 3G5YA 5FKPB 4AQOA 4FQ1H 1NJ9B 5T5FH 3K8KA 4Q6IA 4OLVH 1HKLH 2K7QA 4Y5XC 5GXBB 5DTFA 1K5NB 3MRQB 3R1GL 4JR9H 4ZTPH 4ISVA 4NBYB 1EDQA 3HCVA 1ZHLB 5DK0B 4YEFA 4GLRI 1CD9B 2APXA 3SKNB 5HHMB 2I07A 3H6JA 1OHQA 3IAGC 2X4TB 2UWEF 1B0GA 3B83A 2Y1VA 2R4SL 3RBGA 3L6FB 4LCWA 5JOFB 3TZVB 4ZDHB 4JG1L 1SJEA 1JCKA 1DVFA 4HGWB 4YC2C 3CDGB 3MJ9H 2AK4D 1KPUA 3EAKA 1NGXA 4OTXL 5KSAC 3FQXA 2YWZA 2EKJA 4JFFA 4A6YA 1DUYB 2W59A 3KPMA 3MV7E 1JHTB 1LO3H 3SOBH 1T5WA 1FIGL 1K4CB 1MFDH 3FZUC 4K8RH 5KSBA 5HHVH 4JFDB 5BV7C 4RQQA 4TSBH 2M26A 3KNBA 5INCA 2V17H 4Y4FA 4ENEC 4OV5A 3ZE2E 4E42A 1MI5E 3HMXH 5F1IB 3MRRA 1XZ0A 1PDKA 2IQAA 3MZTA 2XG5A 3FONA 1Y18A 4CVXA 5CIPH 4KKCC 1BBJB 1NAMB 1NMBL 4XX1E 2VC2L 2VDQL 2NPLX 4OF6A 3SDCB 4LAQL 3PWLA 1HH6B 5E9DE 3KS0H 2W07A 2CJUL 4C55A 2JCCE 3QQ4A 4OKVA 1HI6B 3L3GA 1VA9A 5E2TH 4CJ0A 4Q97A 5KVFL 3VGAC 2FSEB 3RVXD 2D7MA 1F6AB 2A74B 4KUZH 3TYFB 2XICA 3KYMA 3QRGL 5IB5B 1X44A 4MA7L 2ATPA 3ZKQD 1ORSB 5BO1L 4PREB 2R69L 3E2HB 2EKSB 5J1AA 4IOFC 2XNAA 3SCMB 4AEIL 2GUOA 4ZOCA 4OQTA 2E7LC 1I9IL 5ISZD 2B39A 2BRRL 1M7DB 1MCLA 2QQLH 3RX5A 5I18L 4LLQB 1T1YA 3MRCB 4AT6B 2Y06L 1MEXH 2NW2A 3WFCH 3VA6A 1AGCB 2AI0L 3MCKB 5HTSA 5M7QA 1SJHB 2EE2A 5DUBB 4X7TA 1RUML 2UUDH 4YX2H 5I9QC 4PJEF 3MJ8B 3QFJA 5CEZD 1ORQA 3MXVL 1KCSH 3PIQB 4TTDC 4N0FB 3UTSD 3WHE1 5DURB 5J12B 4KQ3L 1X6NA 4CN6A 4J3XA 3KWWA 4ZODA 4AJ0A 5KSAD 2WBKA 2VLJA 1N0XL 2XY1A 1I8KB 4FQHA 4JQVA 4NKIL 4WWKB 4YGAB 4KPHH 3ZHKA 5DSCB 3DO3A 3P4MB 1MCSA 3ARDC 4FXGB 4X99A 4RBPH 1VKXA 3FZUD 3WFEL 4S0TD 1NCAH 5C2BH 3HHRB 4ENED 5T1LB 1RZIA 5IEKA 4G6KH 4PLOB 5AUMA 2BXYA 3FO9B 1ZHBB 1QFHA 3ZTNL 3HRPA 1TZIB 2VJXA 2YD1A 3KPRD 3QDMB 5H2BA 1T22B 4M4RA 4NM4L 3REWB 1J10A 3HE6B 3OXRB 4KKCD 4GRLA 1CD8A 1JRHI 1JMZA 3GRWH 1XF2A 1A9BA 3Q2CA 1KB5H 5GZNC 4P99A 3EYQC 2VAJA 4J3UA 3RNQA 1JV5A 4KY1H 1VEOA 4J2XA 2AAVA 1KNOA 4YR6A 2F8VA 4HG4K 3OKDB 3DRQB 5ICXB 4JAMB 5I1GL 3PWVA 3CFKB 2P8PA 5EORL 1E4WH 3MV8B 4Y89A 1NMCB 4G8GB 1UCTA 3EYVA 3GKWH 5FV2A 4WU7B 5FECB 2Y7QA 1BD2A 1JUFB 4HJGB 4IOFD 4A2MA 5DS8B 4WHYH 4G9FD 3TO4C 4TRPH 3PDGA 2QTEA 1KTLB 3WIFA 3BYYA 2Z93B 5F7WC 4I18A 4GW5B 2OP4H 5DRNA 1G1YA 3W2DH 4D8PA 1GC1H 2LU3A 1ZA6B 4HHAB 4N0UA 4B41A 2ZJSL 4XNQA 2Q8AH 5EBWB 3MNWB 1R0AH 1A6AA 3GMOA 5JW3L 3RPKA 4ETQB 4DW2L 1P7HL 3T3PF 4D9QE 1YEJL 3T3MF 1QHOA 3GMQB 1EIBA 3BDYH 3VGHA 4TTDD 2EDRA 4WFGD 3BGMB 1HZHL 1OT2A 2L0DA 1I1AB 5EO9B 2IH1A 3T77B 2DAVA 4MD5B 4HZLB 2WLZA 4UNTA 4DK3A 1CICC 4Y8DC 4XP9L 1CK0L 3KG5A 5D5MF 4BFIA 4F58L 1A1MB 1UZ6E 3TCLB 4QRSA 3KHQA 1U95B 3Q6FA 1ZTXH 4PJIF 3ARDD 4YHOL 3GSVB 3P0YH 2EDWA 1NCBL 3P2TA 1FNGA 3JBG7 2ZG2A 4BJLA 2FEEI 1A3LL 2WUCL 1NFDF 5DEFA 1SM3L 1YJDH 3ARPA 4MDJB 4XAWL 4YDLC 1KIRA 3EDDA 2XPGB 5D7LE 5CILL 1RZJH 4XVTL 4DOHB 4O2CA 4YEEA 3O6FA 3SKOA 4RZCB 4JQIL 2K9UA 2VIRA 5F6IB 4N0YH 5EC2B 3TJEL 2VABB 1MLBA 1YNLL 5GZND 1MFEL 3EYQD 4G8EA 1JGDB 4OGAC 5GQBA 1CGTA 1PG7H 3M1BB 3WJLA 5EU7C 5DDHA 4PG9B 1RUKL 1OAQH 1D6EB 2FO4B 1LE9B 1NSNH 3AB0C 1KLFA 5I74B 1HXYA 2OJEB 1CLZL 2RCSH 4WW1B 2AK1H 4LL9A 1B0WA 1X5LA 2AXHA 3MXWL 2CUHA 4OSUH 5AWNH 1H3PH 4F9PC 1CE1H 1T89A 2A77H 2PW1B 3GIVB 2ADIA 2ITDA 2BC4B 2VR4A 3I2CL 1T0NB 1FAIH 1BF8A 4MB5A 2GIYA 4OJFH 4OBRA 1RZGB 4F7CA 1QA9A 3TPUB 4FTVE 5EH1A 1NBVL 2PUQT 4KDVA 3TO4D 2HG5B 1QHPA 3LEXB 2OI9C 4M1CD 5B3JE 2CH8A 2NXZC 3MLRL 4F3FB 2ENSA 3CDCA 2AERT 3L3DB 2ZOKB 4QY8A 2BY3A 2DMBA 2OBGA 3BWUC 1A7PL 3GMLA 4IOIB 1WIUA 3RWHB 3WXVH 4XC3H 3P73A 1T0MB 4GH7B 3L3HB 3IS0X 5DD1H 5IESH 3U36A 4PP1C 1FDLH 4AENB 2B1AH 2X9YA 3ZE0E 2BNQA 1MLCA 3EKCA 1CU4L 1FRGH 4QRPE 1CICD 3ULUC 3VXTA 4X6CE 3V5HB 4PJ7E 1PG7X 1RULL 5FGRA 1GOFA 4NNPH 4XNXL 2WZPD 1EVUA 1R3LA 3C6LB 4L4TA 1QBMH 4LSRH 5HSFA 1WZKA 1JF6A 4N8PA 3X12A 3EO9L 2CKBL 4POUB 5SWZD 1RURL 4FFYH 5AZ2L 1H3XA 1ZT4A 1G9NC 2KQMA 1RU9L 1HILA 5D2NE 2DQUL 1MCIA 3DUHA 4NGHH 1E6JH 2BSRA 2Y07L 5KZCD 4E41A 3SE3C 4ZFFA 1T80A 4Q2ZB 1UXSA 1GYAA 4UV7H 3U0PB 1SYVA 5I73C 1KEMH 3O2WL 1LGVA 4OGAD 1KFAH 4Z95L 5TH2B 1FN4B 4MD0B 4LSUH 3MUY1 4X6FA 3UZVB 2OR8A 1J1PH 1EO8H 3P9WB 2G5BB 3EO1B 3PWJB 4LP4A 2VMFA 1ZKAA 1KSRA 4IRSC 3RFZC 4OZHA 2Q6WA 3G04A 1OW0C 4UT7L 1OOAA 2FHCA 1DLFH 4V1DD 4RAUA 3PXJA 5I1EL 3JWOH 1U92A 3TNMA 3V0VB 2MCPH 1VDGA 4ODSL 3G5YB 3LPFA 3UTPD 5A43C 2NXZD 4NKMA 1F11A 3MRNA 4Q6IB 1KXVC 2VN7A 2E7BA 5DTFB 4GAGH 4EDWH 4PP1D 4ISVB 2MWCA 3HCVB 2BJML 4MB4A 2AK4A 2P46B 1RD6A 5KTEH 2I07B 1RMFH 4WTXA 1B0GB 4LCWB 4BKLA 5T33L 4PJDF 5GS0L 5I1JL 1SJEB 3ULUD 1X4YA 1DVFB 4M8QA 4QNPF 3L95A 1FCCA 4F37F 1ZSDA 4OFVA 3ZYJA 1DEDA 4IM8A 1KPUB 5TDNA 4XHJC 5J9PA 1EH9A 1NGXB 4U1HA 3MLPA 1F4YH 2JJTC 4WUUD 3FQXB 3UYPA 5I15H 3MRPA 4JFFB 4A6YB 1JI2A 3KPMB 1KC5L 4DN3H 3UYRH 2NQCA 3DXAD 4QEGA 1T5WB 1MI5A 3WCYA 3HFMH 5KSBB 5BZWA 4KJQC 3KNBB 4R8WL 4Z7UE 4Y4FB 4OV5B 4XZUA 5FGCE 4CAGA 4X83A 3TVMC 4KV5E 4E42B 2E7CA 5CAYB 3MOBH 2IQAB 3MRRB 4HUNB 3FONB 5BMFL 2VXQL 1QPXA 2XQBL 5C09D 4CVXB 1MRCL 1JF5A 3FQUB 3BD5A 2PYED 5E2JA 1FGVH 1JPTH 2JCCA 1GGIH 3O4LA 3O6ML 1LD9A 3PWLB 4HIHA 2YD8A 5HYQA 1RFDL 5DD5H 15C8L 2EDYA 2EXWC 4M6OL 1NEZA 3MGOA 5IW3A 2VLRB 4IRSD 3QQ4B 2EC8A 4OKVB 1SVCP 4AG4L 1F4WL 1YYMH 4HK0A 3QCUH 1UEMA 2FL5A 4QRRE 5FO7B 3V5KA 4XPAL 1WC7B 4ZNEE 1BAFH 3KYMB 2DTSA 5D8JL 4LLUA 1J1OH 2ATPB 4Z8FH 4HJJH 5J1AB 3BKYL 2WLYA 4M6MH 2XNAB 4KHXL 1DCLA 2NY2B 2G5RA 2GUOB 1L6ZA 1EHLL 2FIRT 2YEZA 1RI8A 4OFYA 5I8OH 3ARGB 4OD3H 4CMHB 1T1YB 2VLKD 3OAZH 1QFWH 1WZLA 3U4BL 2NW2B 1SEQH 3UROR 3UTSA 5E5UB 1TMCB 1L0QA 4X7TB 5KSAA 1W0WA 3C2SA 3QHFH 4PY8J 1NMAL 4X80H 1RAMA 1F2QA 3QFJB 1ORQB 2Z4QA 4HIJA 5EWIL 3JWNC 3SJVE 4G6AC 4M1DH 5E08L 1DFBH 4DKDC 1G7QA 3B8YA 4XHJD 2XTJE 5HVFB 3KWWB 3Q1SL 1KBGL 2H26A 2VLJB 4FQHB 4X99B 2YPVL 3NZ8A 1VKXB 3BT2H 2M1KA 3DHJA 3EZ8A 5EUOF 3LEYH 3EHBC 4IMKC 4KJQD 4NZRL 5IROA 1FBIL 2WM0A 3FN3A 4GO6B 3H42H 1VADB 1JHLL 1RZIB 1PBYA 5CEXA 5IEKB 1I3UA 1JE6A 3IGAA 4L8DA 3TVMD 4POYA 5AUMB 5JNYA 1LO2L 1PX4A 3G6JA 2AVGA 4Z0BL 3GSNL 2WV3A 5ALCH 5H2BB 1J87A 1ROWA 3KYKL 5ICZA 3PHSA 4GQPH 3OKNA 5MEPA 4GRLB 2CO7B 3LSOA 3I75A 1DBMH 1XF2B 1A9BB 3BESR 3E8UL 2ZUSA 3U30B 3GSUB 5CINH 4WO4C 2X1WL 5DJAA 2WUBL 5D1ZA 3MLZL 3WNOA 4JANA 3RNQB 1JV5B 2EDHA 2EXWD 5FO9A 4KH2A 3G08A 5JDSA 4P46C 5F8RC 3DSFH 1KNOB 1X5HA 1JHKH 4YR6B 1H8SA 2XRAL 2JIXA 1LO4H 5JHDE 1IFHL 1QSFD 4ELKA 1CCZA 2HT4C 3EDFA 3FOLA 1LWRA 3PWVB 2BNRA 2P8PB 2YUVA 2X1OA 4LHUD 5IEHA 3VFSA 5C0AB 3EYVB 1EGJA 1B4JL 2Y7QB 2C4XA 3S98A 1BD2B 2PF6A 2EICA 3SDXE 4UT9H 3UO1L 5CBAA 3WIFB 4G6JL 3U2SA 4OLWH 4GFTB 3WKMH 4U1IA 4I18B 5DRNB 4ZMAT 4D8PB 3BN9C 3K8MA 4N0UB 2Z9TA 1X5JA 4XNQB 1G0YR 1A6AB 3GMOB 4Q0XL 2AJSL 2DQGL 3D6GA 3SDAA 1OVZA 4FZEL 3M17A 4NP4L 1WCBA 2E7HA 3SPVA 2GSIA 4G6AD 2IH1B 4CU6A 3SO5A 5TF1L 3DMMC 2EIDA 1S5IH 3IXAA 5GIRA 4BFIB 1JF1A 5E95B 5F7LB 2B20A 3MV11 4XCNA 1FNGB 4GG6F 2KQNA 3EHBD 5D7LA 4RMRA 1NCDL 1EX0A 2R4SH 2BCKA 1DANT 1BBDL 5BCAA 5D1QC 1S7WB 2V5MA 1T2JA 1YN6A 1X5KA 5DEFB 5I17A 1KIRB 4JQXA 3NIFF 4O2CB 4OTXH 4OV6F 4POZC 3O6FB 3SKOB 3LDBB 4KUCD 2VIRB 4XWGH 1CFBA 1J11A 2UVFA 4ACPA 1FIGH 4G8EB 4R9HA 3E3QC 4WO4D 1MAKA 5DDHB 4HCRL 3OQ3B 4P46D 4ZFGH 3TA3B 3IRPX 5E7FA 3RIAF 2HT4D 4FTVA 2IGFL 4AL8H 4R7NA 3PP4L 3D2UD 3DECA 1UADC 1W72H 2GW5A 2BOBA 1RQ5A 4K9EH 1NMBH 2ADIB 2ITDB 3WIHA 4GAJH 4LFHD 2OXHA 3I6LE 4LAQH 6CGTA 4F7CB 1QA9B 2JE8A 3REVB 4X4YA 3IVKA 2ZSVA 4ODBD 1LO0L 1HE7A 3BZEB 3D85A 1FIEA 4U2ZA 3RKPA 4QY8B 3GMLB 4HF5L 3P73B 5IM7A 3BN9D 1WEJL 2N7BA 3QRGH 5IUSA 3OKOA 3JTSA 1BREA 5FOBA 4MA7H 5LVEA 5BS0A 5T1MA 1EK3A 5BO1H 3GGWA 1F8TH 2FLRT 2R69H 5GGRA 4WI4A 4JO4L 1U36A 2BNQB 1MLCB 4GAFB 5D7IF 2ZOLA 5FO8A 5IIEA 2BRRH 2QEJA 5I18H 3DMMD 3VXTB 3B2UC 4JFEA 4OZGB 4R4NC 2AXJA 3SO3B 1R3LB 1WFNA 1MFAL 3KPSD 4L4TB 2AI0H 3BKCL 3BRGC 5CJQH 2DI7A 4WI6A 1RUPL 3X12B 1IT9L 2F53D 5C0CB 4XRCA 5D1QD 3TV3L 2FX9L 3KXFA 4QOKD 4QCIA 5JW4M 2E6PA 4IEFB 4K3HA 1ZT4B 1G6RA 3MXVH 4TNWF 1HILB 3VFGL 4C56E 1D9KC 4KQ3H 2BSRB 4POZD 4E41B 1N0XH 4EI5A 4NKIH 4ZFFB 1E4KA 1UXSB 35C8H 4L9LA 4LBEA 1ES0A 1SYVB 4K7PY 3QXTA 3OJMB 1XGYH 3R8BB 1J0YA 5GRVL 4M6NL 1WFUA 1ZK9A 3RI5K 1RZKC 1G0XA 5I8EA 4LIQL 3BO8A 1N4XL 4O9HL 4LSPL 1SJVA 3BRFA 5D71L 4X6FB 3ZTNH 4IRJC 2DOCA 4HIEA 1QFWI 2ZUTA 5IWLC 4NM4H 5C8JA 1TETL 4LLVA 2X9WA 1AXSA 3LVEA 1U3HA 3F65A 5CJ5A 1JWUA 3G04B 2J8UF 4RAUB 1CQKA 1BFVH 3BH8A 1U92B 3TNMB 3TESA 5GRJL 3L3KA 5KAQF 3QEQE 5EZLA 4NN6B 4RA3A 3MCLL 1HXMA 4NKMB 1F11B 3MRNB 2ERJB 4J3OC 4QLRA 5EC1A 2X89D 2XIDA 5EORH 1S7QA 2AV7A 4APQC 4XCCH 5L0QB 1ZLVK 2EZ0C 2X1PA 2AK4B 4FRWA 4MHHG 1MRFH 2OTWA 3QO0A 4L3EE 1AC6A 4ODHL 5A40E 4TVPD 1C08A 5IVXF 4PBWD 3ALXA 4BKLB 3O0RL 3U1SL 2FIKA 4I0KA 4M8QB 1F02I 3B2UD 1JNLL 3L95B 4R4ND 3V8CA 1ZSDB 4YQXL 1LE5A 3RHWF 3OKEA 5TDNB 3R0NA 2R9HC 3QNXA 2ZJSH 4U1HB 2H41A 2HJLA 3MRPB 2GYSA 4Z7UA 4DW2H 1H3WM 2NR6C 1YEJH 1FFNA 4NQVA 4LLAA 3SGJA 2VQ1A 3TJHC 2EDBA 1HZHH 4W4OA 5BZWB 4ZD3H 5A2LH 1D9KD 5FOJA 5AYUL 5IT2L 5KS9A 1G7MA 2P1YA 5GJSH 4XZUB 4XBPA 1F3DJ 4YHOH 1EEYA 2BHUA 4OZIB 1NCBH 4MNQA 3VXMD 2Y6SC 5IB4A 3F7VA 4U3XA 1A3LH 2JCCB 2WUCH 4RGNC 4JRWA 2UYLA 3O4LB 2V5SA 1LD9B 1SM3H 1C1EH 4HIHB 4XAWH 5A16A 1RSFA 5BXFB 5HYQB 4QRRA 1ND0A 1FFPA 3CSGA 4IRJD 5CILH 4XVTH 1NEZB 2ZUWA 3MGOB 3MLSL 3HR5A 1HIML 4AIXA 1E28A 4HK0B 5FYJL 5EG6C 3S3JA 2FL5B 5TFSH 3PWNA 3V5KB 2QSQA 3QNYA 2QQNL 1KIPA 5DMIL 5TE4L 1Q1JL 3UTTE 3W81A 1FZJB 1R6VA 2EH8H 5J7CC 5EZJB 4JZJC 5LJYH