4IRZH

Crystal structure of a4b7 headpiece complexed with fab natalizumab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
222
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQRLEWMGRIDPANGYTKYDPKFQGRVTITADTSASTAYMELSSLRSEDEAVYYCAREGYYGNYGVYAMDYWGQGTLVTVSSASTKGPSVFPLAPCSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha4 subunit
publication title How natalizumab binds and antagonizes alpha 4 integrins.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 36
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2013-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH01
5L2KB 4WEBL 3V8CA 5GS2D 5FCUH 4U05A 4EBQL 3MGAA 4OM0L 1WJ3A 1G6RL 1S9VB 1MY7A 3SDAC 1XAUA 5GSVB 4TQEH 5E8EA 3E3QE 4GSDL 1RJZA 5AAMA 1BJMA 1B0RA 4IDJH 4R26L 5CUSH 3FFDA 1TZIB 2R23B 1ZSDA 3GMQA 2ZUWA 3MRFB 4JY6A 2DLIA 3QUXA 2JCCE 3EJYD 2BJMH 2Y25A 3GSUB 1OCWH 2VDOH 5GRUL 2CRIA 1JNHA 2GTWA 1TXKA 1MFEL 1AJ7H 1KJVA 3BN9C 4HBQA 1IGFH 5J3HC 1NSNH 3P40A 4F37K 5IK3B 5AYUL 1INQA 1R3HB 4L4TD 2XKUA 2XZZA 1CDGA 4EDWH 3MNWA 3OHXA 3UJTL 2IANB 4Y89A 3ULSA 4EIGB 1WLHA 1Q9KB 1AGCA 1AHWA 5DK2B 4FQ2L 1QFWM 3MJ8B 4A6YB 2VL4A 1FYTA 5DD1H 4DW2L 5KVFL 4G8IB 3DRTA 5BZDA 3WMSA 3V6OE 4JVWA 4CKVX 3QQ3B 4OFPA 1DL7L 2UVEA 35C8H 4RX4A 2BVYA 1CG9A 4NRXA 4YGVA 4NQCD 3DV4B 3RUGE 2J88H 2X4SA 3GSWA 3LKOA 4GQPH 2AGJH 1OP3H 5D8JL 1E0OB 2P7TB 3O4OB 5MEPA 1ZHKB 3W11C 4OCYL 4QOKA 1ACZA 5DO2D 4L5FH 1MSPA 5C0DB 2VXQH 5IVXA 5HBBA 1YC7A 1ZHNB 3H3KA 5DDHB 1LDSA 2W59A 4MA1C 4XB8A 4WWKB 5H2BB 1ACYL 1V7NH 5HXMA 1EV2E 1I8LC 4M7LL 3PL6C 7CGTA 4X6CE 4DKEH 3MLWH 2J5LC 5MEND 5EULV 3I3EA 2FEDD 1BHGA 5T5FH 5B3JF 3TBYB 1MFAH 3T1FA 4NSKB 3WSQL 4GXVH 5EN2B 5HHXL 4L9LB 1RZFH 1H8OA 3IKCB 4F57L 1GGYA 4N0CD 2M8XA 4L8SC 3FQWB 5I1IH 1A6WL 1U93A 3RZCB 1PDKA 4TNWK 1PZUB 1WBZB 5EDXA 2FJFB 4YDVB 2PCPA 4MX7B 5D93B 1Q9LB 3WN5B 2NXZB 2GUOA 2VQTA 3FT3B 1ZKAA 1ZT1A 4KHTH 4NQDD 5DYOA 1VFUA 1I8MA 5L9DH 3NVQA 1HH9A 4L8BB 3RWEB 3QNYB 5CBAB 5E8DL 2P5EE 5DMGC 3WHE1 4JPVH 2OBGA 1P69B 4P2OB 5LAXB 3G5ZB 5DJCB 4NQXB 3ARDD 3OXSB 4FABH 4F9LA 3SDXB 3L7EB 4U1NA 3FN0L 4TUKL 1S7WB 2OJEA 4P5TD 5IVNA 1AR2A 1K6QL 2CIKB 1YN6B 4FFYH 5ALCH 5D7JD 1RSFA 1WIUA 4A2MA 4Q9RH 1BOGA 3VFMA 3L5WB 3B2UD 1QKZL 5DUBA 1YNLH 3LQAC 4FS0A 1QFWI 4OZIB 2FGWH 2IBZY 1A9EA 4LMQE 4FG6D 5DK0A 4UILL 1HYRC 1K8IB 3V6OA 1BQLL 3O0RH 1LEGA 1ZVSB 5I75B 4X83A 1ND0B 3VCLB 1QLEL 2D7NA 4PRHE 2VH5L 1OLLA 2VXVH 1R3JA 2YPLE 5EBWB 3VWJB 5ANME 2GK2A 1FNEB 5HJ3A 5IBTH 4MXVE 4XVSL 1GZPA 4LGSB 3WHE0 1I85A 2Z4QA 5I8EA 2H6PA 4L4JA 3TT1L 4LBEA 4ZXBC 2E27H 3IFLL 1V5JA 3O41A 1OAKL 3X13B 5DJ6B 1P9MC 3H3PL 4NQVB 3MJ7A 2BMKB 5EORH 2VLLB 3OAYH 5HYJB 2NX5B 4X6CA 3BVNA 4KAQL 3TM6A 4RISL 3LEVH 2A73A 3K1KC 5DFVC 4KKCD 2H32H 1OAUL 3KPRD 1A14H 3TNNB 4UU9A 5H37G 4RGOL 3C8KB 1H8NA 3QJHB 3I9GH 4G9DA 2XYCA 4LOUC 4YXKL 1VHPA 4FTVE 3GUTA 2FH6A 4EQ3A 3ECBA 4S1DD 3S35X 4ZQKB 2Q3ZA 5DFWH 1BGXH 3W2DH 3RDTB 3DI3B 4ODWA 4HLZG 1WCBA 1YN7B 1G7HA 2DQTL 5MEQB 1IGJA 1YEKL 3IDJA 4WI6A 4LEOA 4GRLD 2PR4H 4YK4B 3MRQB 3KPQB 4ZUUB 4XPHL 3OKYA 1HOCA 4MCYA 5C70A 2AEQH 1FO0L 1JE6A 3RWFB 1X5JA 4XC3H 2WQRA 3QA3A 3QUZC 2H8PB 1JPFA 1ZHBA 4DN3H 2FJGB 2VC2L 3I50H 5E2JA 4RGMB 4AL8L 3LKPA 3VD5A 4MD5A 5DJYB 4OZFH 2H32A 1JGLL 3HTLX 3BIBX 3P9WB 4F7EA 1R5VA 1AP2B 3DVGB 3S36X 4GAGH 1FG9C 1R5IB 5EB9A 5T3ZH 4X7EC 4WW1B 2ZG3A 4K71B 4PRDA 5GISL 4PG2C 2F5AH 5J13B 5DRZB 4X7SH 1Z0MA 5JQ6L 5HDBF 2GQHA 4WNQB 3O8XC 2HMID 3WJJA 1KV3A 4PRHA 1KNOB 2F53A 1A6TB 5AEAA 4JREC 5MP6L 3S97C 5ANMA 3QHTC 4J3SA 5E5MA 2FATL 2BDNL 2NPLX 4G80A 1C12A 3U0PB 1MLCA 4HFUH 5ISZB 4CL7A 3PXHA 4QNPE 3JVGA 5EUOB 5MHSE 3GDBA 3T0ED 3L95A 4DK6A 1B88A 3T3PF 2V7HB 3UJJH 4D9QE 5KVGL 3NH7H 1QA9A 1UXWB 3C2AH 1C08A 4YXLL 4YBLC 5C09D 5ID0A 4OZFA 1F6AB 2XRAL 5DC4B 3VGDA 2AJUL 2RHEA 5A43C 3U30C 3LN4B 3UZEA 2PW1B 3DSNA 2IMNA 4E41D 4K8RD 1J1XH 4R97B 5FYJH 1I1AD 4WEUD 1BZ7A 4WHTA 5FM5M 3D18B 2DI8A 1JTOA 2D4DA 5I74B 3RY6C 1HCFX 3O9WA 4X5XB 1BLNB 4FMFA 1KIQB 3EJYC 2XICA 3QUML 2I9TA 1OAQH 2BOCB 3MROA 5M7QA 3GI8L 1ZLWH 5I8OH 2PETA 1X3DA 4ODHH 4MHHG 4Z7WE 1KFAH 4WHYH 3UTQA 3VE0A 5FYKL 3QXDB 1T0MA 3TBWA 5DJZA 1X6LA 2HVKB 2IBBA 4NZRH 5SWZE 1P7QD 3QCTL 1QSFB 5AG8A 5IMMA 2EKJA 4U1MB 5IB3B 3DGGA 3BE1H 4M62L 3HZVB 1QSEE 5JR1L 1JF6A 1DUZB 4RMVA 2IH3A 3G6JF 2X42A 4EDXB 2GJZB 1G1YA 1GVIA 4LRIA 3EYOA 4XPTH 5FV1L 1CGWA 3P0VL 3UROR 2BVQB 5DC9B 2ADGA 5D5MF 2Y07H 3BP4A 4FFWD 4HF5L 5DVMA 4IRZL 5MEOA 2VB5A 4XP5H 4PJXE 4MXWH 4PP1D 4I0PB 5DO2C 2CKBH 4PJ5E 3E2HC 5L7XH 3OKLB 5HI3D 4GJTB 2VN7A 5EO1B 1D5ZB 3A6BH 1S7QB 4Y5VB 2BFVL 3DO3A 1RMFH 3T8XB 3IJSA 5BRZD 4PR5A 2NXYB 1A1MA 4OIAA 1CXLA 4PJAB 3NAAL 3GSOB 1DVFD 2AV7A 2WLYA 5E99H 3QDMD 4JRYB 5IMKA 5JOFB 1XR9A 2CK0H 5GJTH 1RU9L 2FEDC 2GITB 3WKMH 5EBLB 1U8NB 3BEVB 1U8QA 4N0CC 2NTFB 5E9DD 3SOBH 1JHKH 1JRHL 2IADA 2YD7A 5CCKH 2YWYA 1ODAA 4LKCA 3GJFK 1T5XB 1U6AH 1UJ3C 5HGGS 5C08E 4JY5H 5F9DC 4KZDH 3N06B 3ZKND 1RI8A 5C0BE 4YHPB 2D31A 4UBDD 3HI5L 2YKLL 4WIQA 3LB6D 4JFDD 4JZOA 2Q7YA 4U1IA 4ZAKA 1F8TL 1XGRA 4ZOAA 3F58L 2XACC 4F7PA 1U3JA 2CKBA 4NIKB 1CCZA 4HKZB 1LDPL 4N9GB 5FKAB 2V5RA 4U1HB 2FWOA 5FOJA 4K7PX 4AENB 1S9WA 2PYFB 3ZDXE 3ARDC 3SE4A 4RZCB 3T77A 4LIQE 1MHEA 1FFPB 3K8MA 4P5TC 3ES6B 3ULVC 3IDXH 4FZ8L 32C2A 5J7CC 4Z7WA 5D7JC 4UAOC 3D9AH 1FZJA 3ORJA 5IVXF 4JY4B 5GJSL 1NCDL 1WIOA 3DURA 3B2UC 2Y1VA 2F5BH 1INDL 5EOQL 2W92A 5K9KA 4AQOA 3KYOA 1RULH 1QSEA 3NCCB 1EMTL 4FG6C 2XZQH 4OF5A 4W70A 2HLAA 3J8F7 3FO0L 3LKNB 4MQ7B 2BOBA 4JO1L 4RGNC 4OFIA 4D94A 5C8JA 2DN7A 1RZJH 1L7TH 1K4CB 3MCKA 4Z78A 5BS0E 1QFOA 4M61B 3LDBC 4OF8A 4JFXB 3M17B 5DD6A 2C1PB 4PJXA 3GMRA 1YMHA 1P2CB 3SJVE 3RWJA 1J1OL 1SBSH 4LARL 4PJ5A 3UJIL 1OGAB 4OI9A 4JRWA 4WI5A 3VH8A 1I9RL 4ESKA 4POUB 2R0WH 1PBYA 3U4BH 1A3LH 1GOHA 4NHCH 4P4KB 5D72H 5CSZA 5DQJB 4OLEA 5B8CC 3Q6GH 3EOYG 4G8FB 4NQEB 3FFCD 1LP9A 4Z7VB 5B39A 1MLBB 4KKCC 4FZEH 4NN5B 4WW2C 5D7LD 2MKLC 4ZUVA 3BYYA 5LBSL 4JFPA 4ONFH 2GFBB 5HGDB 3QAZC 3HNVL 2JCCF 2HWZL 3VDAA 2ZNXA 4UDTA 5E08L 4POZD 5CINL 1S3KH 1KLGB 2PO6D 4S1DC 4D8PB 1OOAA 1OSPH 3SEPA 1VFMA 3GMPB 5DEFA 3RPIB 5C0BA 3RZWA 3H7LA 2GCYB 1F3RB 1KEMH 3INUH 1CD8A 1YYMH 4GRLC 3D39D 4UDUB 4NO2B 4QRTB 1A8JH 5EZLB 1FG2B 1WITA 4OZ4A 4JLRB 5HI5D 3ULVL 4LCWD 4OLWL 4X6BB 1BM3L 5E6IA 1XGPB 3IDUA 4P4RB 1B0GB 3RUGF 3DUUB 4XGZA 4H5SA 1I7UA 5DHVH 2DLFH 3OXRB 2BX5A 3F5WB 1UYWH 4WV1C 4XX1E 3SKJL 3S5LA 5IG7B 2IFGA 1EGJL 2DICA 1FVDA 2XT1B 4JAMA 5L2KD 2Z92A 2H45A 1JJUA 4I2XE 3NFSL 5FYJU 4HK0A 1VGKB 5E2TH 3EDEA 1F4XH 3MGTB 1KIPB 4U1GB 5E8PB 2CIIB 2HMIC 4LLYB 5CD3A 1QBMH 1IKFH 4NM8H 3IU4L 4P57A 3OKKB 5BS0A 1PSKH 1BEYH 4KK8D 1UCBL 4IRJA 1OF2A 3VXTA 4PJCB 1MHCB 1FNLA 4M6ML 2OR8A 2DJ4A 3N50A 4N68A 4C59B 3T0EC 1YY8B 1XR8A 1KPRA 2C3VA 1C1EL 2AJYL 1DLFL 1KBGH 3W9EB 8FABB 3GZKA 3HZYB 3D25A 5J1TC 1CK0H 2NW3A 3QIUA 2FHBA 3IGAA 5I1AB 1OP5K 2W60A 5DHVA 2CXGA 2BVPA 5TF1H 5C0AE 2CR3A 3PWLA 1M71B 4QF1A 2IAND 4GS7B 4DFHA 5TDPB 1W2KT 2P44B 5C0GA 2PN5A 3CPLB 3SDDC 4Y4HD 4K8RC 5D1ZA 4M7ZC 2B1AL 4F33A 1I1AC 3BSZL 3ZL4H 1NGPL 2W9DH 1KT2A 5DRXB 3LAFA 3H2WA 3X12A 2JJUA 5ESAA 1IM9B 1KTDA 5E56A 4OUUB 1KIRA 4ORZC 4P46A 3SQOL 1XGYH 3GEWB 2W9EL 3O3EA 4OM1L 3MUGA 4UNTA 1H3PL 3JBG7 3QCUL 1FSKB 3D0LA 3KXFE 5K59E 2E7MA 3BZ4A 4WWKD 4WFGD 1X7QB 3H0TB 3T2NL 5H35B 5T1LB 1ITCA 1CGYA 1N5YH 2EYSB 2WM0A 5T5NG 4FQLL 3QUKB 2EH7L 4Y1AD 1MFBH 1MAKA 4MXVF 5IF0A 3UXFA 1VKXA 5JHLL 3ZHDA 4Y5XB 2DLHA 5E2VH 3HZKA 1OD7A 2E5EA 1R3KA 3QUYD 3TBSB 2OP4H 3LIZH 5BVJB 4ZFGH 3TCLB 3P4MB 5I8CA 3KPSB 4GBXA 3DWTA 2VXUL 5IFHH 1X9QA 1E6OH 5F6IC 4FFWC 2CLZB 5AAWA 3STZA 4LSVH 5ICXB 5CJ5A 2R1WB 3QDHA 4PP1C 4JG0L 4P5MA 1IC7H 3AXLB 1A3QA 2NXZD 2VR9A 3QEGL 5HI3C 1RZ7L 1J12A 2I9LA 2Z8WC 3BO8A 5EBMB 2GTZA 3RJQB 3BDYL 3H3BC 3V7AG 4LGRB 1IVLA 1RURH 2YOCA 3TV3H 1DVFC 3T0EE 2NY5C 4P2OD 2I24N 1J11A 3QI9B 4RAUA 1A64A 2YD6A 3F7YB 1KGCD 4PG9B 4A2LA 4KJYB 4NZTL 3SDCA 5IM7A 5I2IB 1F58H 4WFHD 4ZUTB 3LCYA 1IGCL 4K8RL 4OLZL 3VW3H 1AO7B 1A7QH 4M7JL 5DI8B 5C0AA 3D0VB 4EJ1C 2KQMA 3GM0A 1G0DA 1EO8H 3X3GH 4UBDC 1BJ8A 4CDHA 3U9PL 3UTTE 3UTSA 2DJSA 1RQ5A 1RUPH 3LB6C 1CWVA 3MRMA 3U9UB 4MB4A 2I60L 5ID1B 3P4NB 4P3WA 3V6FA 3FT4A 1RFDH 2DMBA 1EEZB 3MV11 1G0YR 1P7HL 1BD2D 4TUOB 2OTWA 3MRLA 3O2WH 3QIBA 2UY7A 4J3XA 3KXFA 4DKAA 1JPST 3W0WD 3IETA 4UT9L 5HYJD 3E8UL 2AJVH 2DIAA 5HSFA 3WO4C 3AM8A 5F7YC 1FVCA 3GBNL 4AM0B 1YMMB 4QNPF 4APQB 4ZDHA 2HT2D 3VWKB 5CILH 3FQNB 2AK4E 3PQYA 1WVZA 3D69B 3QNZB 3MLUH 4XAWH 1RIHH 2DQDH 3I75B 4OCLC 4JG1H 4YGAB 1EHLH 3BH8A 4ZPTA 3P77A 5IESH 1IL1A 2DBLH 3G9VA 1KCUL 5FF6B 1SVZA 1QNZL 1G6VK 1FGVH 4JZJA 1T04B 1KXQE 2ICWJ 2V9QA 2Q87A 3MRGB 2BK8A 5J9PB 2YXFA 5HY9A 1UWXK 2B20A 4EI5A 1LEKA 2QR0B 3V5KA 4HULB 2ADIA 3L7FA 5T1MB 3GSQB 3VFNB 4EN3B 4UOW1 1MHPL 1J18A 3ZTNL 4BH7B 3IXTA 2BNQB 4QGTA 4GKZA 4ZYKB 3KJ6L 3TO4D 4ELMB 5KSAB 3RGVB 4B0MM 4YWGH 4HH9A 5DTFA 4YHOH 4I0KA 5FDWA 5KVEH 1U8KB 5T1DH 5I1KH 5LCVH 3CZJA 4NKIL 1KENH 4XBPA 4IMLA 3TVMB 5BXFA 1WBXB 1WEJL 4QTIH 5JW3L 4POZC 1KN4H 5DUML 4GMSL 5J0BA 2IGFH 3O11B 5BW7C 2VDLH 2PO6C 4DAGL 3MLRL 4Z7WF 2X4QB 3ARSA 2BSED 4ZD3L 3JUYA 3KPOB 5JA9A 4MDJB 4ZUWB 4O5LL 4HAGA 1IEAA 1V7MH 1AI1H 4ZOEA 3UTTA 4MA3B 4J2XA 1YEHH 5KSUB 1TJGH 1B3JA 4F15B 4ODTL 1NFDB 5TQ0H 5HI5C 1KACB 3VA6A 1N3NB 5JMOC 4NZUL 2P8LA 2AABH 2D9CA 1G7IB 4Z7NE 3R0MA 5K93A 4CN4A 5LGKA 4UOW0 5ISZD 5DMIH 2BXZA 1BIIB 1R0AL 4F2MA 4C57C 5SWSA 5D1XB 4NKQB 3VXUE 2OL3H 1FP5A 3G08B 2ZUSA 1F4AA 3KJ4B 4QRSA 3OZ9L 5IV2B 4YQXH 2P8PA 1ZOXA 5F44A 1AQKL 1ED3B 1LO3L 5EA0L 2GY7B 3QPQD 5DD3H 4NN7B 3U0WH 2D7QA 4F80A 1N0LA 4LP4A 4OB5L 5ICYB 2EEAA 5IIEA 3UP1A 1H5BA 4X0KB 2BP3A 3DUSA 4HUKB 4KK8C 4YEEA 3UO1H 3SQBA 2FHFA 4FN0A 3TA3D 4RIRA 3THML 5C0RL 4QRRE 3MV9B 5FHBH 1KCVL 3PV6B 3VFOB 1MQKH 1J7VR 1ZANL 1CFTB 3HI1A 4OF0A 4WO4A 1G0XA 1IGMH 3BP6B 5HYIA 5KBNC 2Y5TA 3PWPB 1QG3A 1IM3A 2OTUB 3O6LL 3QO1A 4LLWB 1OB1A 2MCPL 4JKPL 4DZ8B 4GG8B 4F7CB 2Z91B 2OL3A 5HI4D 5A2IH 2CK2A 1QSFD 2V17L 1IARB 3IB4A 3BD3A 4P2RE 4XT1C 4TUJB 5GRVK 4Y4HC 3ZDXF 1WWBX 5F9WB 3MLVH 3RWDA 3CSYA 4DGVL 2NLJB 4OSUH 5D1QD 1C5CH 3NTCL 1X4ZA 2HJFA 3QDJB 3WNPA 5F88A 3B3IA 1GHFH 4W4OA 1CDJA 2HT3D 1JF5A 2VQUA 4L3EE 1JHLL 4KTYA 1WV7T 5FA4A 4XPFH 3F8UB 4UT6L 5DLMH 5F7EH 1DBML 2XG5A 1T83C 2EE3A 2VITA 1ZLSL 2Z8RA 1K8DA 2CLRA 1AGDB 4WY7H 2IQAA 1ETZA 3NCYP 1I9EA 4M93B 4ZNEE 3FCTB 1IQDA 4FQCL 4AG4H 4WWKC 1IGIL 4BQ9A 2EH8H 2JE8A 1Q72L 3B9KD 3OAYK 4MD0A 1KEGH 4PP2B 2NXYD 3DVNB 1J87A 1ZS8B 5JO5B 3RFZC 2YD2A 4UV7H 1WFNA 1QLRA 2X7LA 3F12B 4GAYB 4L1DA 3QQ4B 4DZBB 1YYLH 3FQRA 1MAML 3CGTA 5EZJA 5JPMB 3QUYC 1UM5L 3CFJA 1NAML 1QSVA 4XPAL 2KKQA 3VXUA 1T0NA 4QRQB 3QWQB 5F9JB 5FGCE 5E0QA 5F3BA 2F15A 1YDPA 3MLSL 5IB4B 2DKMA 2VXSL 1EEQA 5J6GA 4H20L 4UIMA 3OKMA 4PGCA 4GG6B 1TMCB 2XA8L 4DGIL 4NDMA 4JQXA 3EJJX 5C07D 1PX4A 5E5RB 4G43B 3ROLA 3E0GA 2ZCHL 2NXZC 2A0LD 1N64H 2O26U 1NCCH 1UCTA 3P9LA 1FDLL 5BZWB 2PXYB 5CEYB 4XP1L 4R2GB 3FQUB 3WUWB 3WIHL 4M8QA 1FCGA 15C8L 3FAWA 4LPXA 3MX0A 1EBAA 3HC0B 4XNMB 4P2OC 2FBJL 4UV4L 3T4YA 4AEIH 5JIPA 3TC9A 4Z8FH 2HFFA 3GNML 4KRNA 4QRRA 4BA8A 5B38A 2UZIH 1M4KA 5KSVA 5TE4H 4S2SB 1FE8H 5DJDA 3MMEA 4MZ2A 3RWIA 3FMGL 1U92A 4L8CB 5I9QB 3NCJL 5ALBH 3WXWH 2KPNA 5E8OA 3MOBH 4ZPVB 3C60B 4X8JB 4MXQD 5JNYB 3EO9L 4YFDB 5C0FB 2NY1B 4WEBH 4NYLA 1ZV5A 2HH0H 5TF0A 3WUWG 5DJ2B 4LL9A 5A2FA 4EBQH 4P2RA 4OM0H 3BKYL 1SYSA 1IAII 2YN5A 4PREB 1G6RH 3C6LA 3ROOB 2NY6B 3JV5A 1SQ2N 4M8VA 2FL5B 1K2DA 3MUHL 2FDBP 4MWFA 1WTLA 4GSDH 1M7IB 3VGBA 4L3EA 4DCQB 3H7BA 3PXJA 4R26H 43C9A 1DBAH 3ZYIA 1VADB 3C5JB 2HG5A 4IOIA 3WIIL 3MA9L 4YHZL 5EZIL 1OGAD 4ZNEA 1MFEH 2BNRB 4U6XA 3SKMB 3ULUE 1DJSA 2VZ3A 1E6JL 4LVEA 4X4ZA 3HG1B 4RDQG 4WI7A 5FDYA 2UVFA 3GJFB 4GKOA 4EVNB 1WC7B 4P4KD 1I8IA 4HDIB 2P8MA 4PJDB 3VFTB 1IEBB 4WUKH 4NQED 4XWOD 1CXEA 3PP3H 2ZUXA 1MOEA 3BUYA 3DXAE 1HHGB 2HT2C 4J3VA 3V2AR 5KVFH 4O9HL 4NO3A 3F65A 4M1GL 3NA4A 5GPRA 1G6RA 1Q1JL 4R6UA 2JELH 1YNTB 3EDFA 1FAIH 4R96A 2IPKB 3IDYC 4NCDA 5TE6L 2EKSA 4WW2F 2LVCA 1J0HA 4OCYH 5D2NC 1MRFL 1NBZB 1XIWD 1ZLWK 4KPHL 1T22B 2A6DA 2BY0A 1HYSD 2IPTL 1ACYH 2R23A 4X6FA 4JFFD 5IVZB 2ICEA 4M7LH 1EO5A 4IIQC 5IB5A 3RAJL 4I18B 3SDXE 3TO4C 1K5NA 3ULUH 2VZTA 4N5ED 4HJGA 3WFDL 3QQNA 3IFPB 4YIQA 2DWEB 3O3UN 3UPCA 5IK3A 5H8DA 2DIBA 5D70L 5D7IB 4XNXL 3P3YA 1CLZL 3GHEL 1YEIL 4OZIE 1FRGL 1IBGL 1PG7X 4G8GA 2VWEE 4JDVB 3MZGB 2Y72A 1JK8A 4K71C 2LU7A 5DS8A 1ZT7A 1RUML 4HS6B 2VLMD 1SVCP 3HS0B 4OZHB 3SGJC 2YHGA 5I1CL 3MRHA 2FSEB 1LO4L 3EJZC 3SY0B 5IOPB 4X8XA 3NBNA 1EHAA 2P7TA 4HIIB 4JO2H 3MOAL 3HB3D 1ZHKA 4C4KT 3KPPA 4YH6A 1BECA 4XP4L 5C0DA 3AS1A 4BSWB 1GC1H 5DJ8A 1ZHNA 1XF2B 1CVRA 4R3SB 1U3HA 4OJFL 3C5ZA 4BZ2H 1MJJA 2YR3A 4TUKH 1NQBA 3L5XL 3CVHL 2JB6A 4PY8I 2NX5E 2E8ZA 4MNHB 2BXYA 5HDOA 2VL5B 2WIIB 2Z31B 1MAJA 1FHGA 3EO0A 3WNLA 2P24A 3TBYA 5HYEA 4NSKA 3LMJL 2KDGA 3AB0C 1FNFA 1RUKL 3QPQC 5EN2A 4L9LA 3DXAA 1DE4B 3ARWA 2XPGB 3FQWA 3RZCA 4UQ3B 4EZMA 4R97C 1QLFA 3P73A 5GGQL 1XEDA 2VH5H 2DTSA 2FLBT 1ZA6A 4MX7A 1T5WB 3TA3C 1IGTB 4UI2A 4Q6IC 2NY4B 3RX5A 2EDHA 4XVSH 1JZ3A 3REWA 5J1AB 4QRUA 3GSXB 4TVPD 3CFKB 1KCKA 3MV8E 3EYSL 5C3LD 4FXKA 2G75A 2ARJB 5I76B 5HYQA 3DMMB 3IFLH 4FMKA 4NZDA 1CU4L 3DYOA 1OAKH 4JJHA 5GRZA 3H3PH 5EO9B 2QSTA 4NQXA 2PTTB 5HTSA 4GW1A 3HE7B 3DSFH 4KJPD 2VJXA 4DVBB 3SDXA 1YEGH 3L7EA 3QB7C 2HLFC 4HLZH 5HI4C 1KJ3L 1DN0A 1MPAH 3GB7A 4KAQH 4XZUA 1L6XA 5HHVL 3K2UL 1D6EB 1YN6A 4OKVB 2WP3O 4FQJL 1OAUH 1QBLH 5GGVY 4RGOH 5D1QC 1NLDL 2GAZB 1F11A 3RVVD 5DC0A 4YXKH 2RFXB 3IKKA 4OZIA 2RBLA 3KNBA 2D3VA 2IAMD 1A7RL 2WBKA 4PJEB 4Y8DC 3DX8A 2NYYD 1U8LB 4P9HC 4PGEB 4NC0B 5EUKB 4F9PA 3O2DL 4GW5B 2A1WL 3VCLA 4CW1A 1YEKH 5C6TL 2XZCH 3P9MB 1C16A 1LWRA 1I8LA 1FLRH 1I9IL 4BZYA 3BP5B 5F7FA 1BZQK 2F8XC 4XMPL 3IDMB 3GSNB 3B9KC 5F6HI 5ISZE 1J8HA 1RUQH 3MV7B 7FABL 2J8OA 5EUOE 5JMRA 4NNXB 3QI9D 3JWOC 1UFUA 2GSGB 5JLZA 3C8HA 4K7PY 4OLYL 5DVNA 4POYA 1BX2B 1Z5LA 2OSLB 4N0UB 4HMDA 5C0JA 2VC2H 1D5MB 1CE6A 4L8SA 2YPKA 5CKAA 1KELH 1R5WA 2NX5A 4JQIL 1OM3L 2R9HD 1QVOB 5GS3A 2ESVB 2ARWA 1JGLH 3WLBA 2A6KB 4PJHB 1RIUL 2JJSC 1FV1A 1MCEA 5LVEA 4AIZB 3TNNA 1A1NA 3MNVB 5I1GL 2B5IB 2M26A 1YEFL 3TPUA 5GISH 1A6ZA 4ZFOB 1G84A 3QJHA 5CIPB 2NY3B 3S34H 4M48L 3HMXL 3AMLA 2A0LC 4NJ9L 4YC2B 5JQ6H 2XWBB 4YAQA 3ZTJH 1PAMA 1NFKA 4ZQKA 1WZLA 3RDTA 1TNNA 3FQXB 3MUY1 4PRPA 2N7AA 1Y18A 2BDNH 1RJLB 1G9MC 1N5AB 3QXTA 3DHMA 5IHZA 4JDZB 1RZKC 1OP9A 3KPQA 3MV8A 2X70B 12E8H 4PJ9B 2O61A 4F7TA 1HNFA 1V8HA 1KCRL 3QJFB 5FUCC 1CZ8L 4ONGH 4MXQC 2FGZA 1QPXA 5TE7H 2EC9T 2IALB 2FJGA 1KPUB 2XRAH 1A5FL 4Z7NF 1CVSC 5KN5A 4HKBB 4YHLL 1U8MA 4P9HL 5DJYA 5HHQA 1TZGL 3EGSB 5I18L 2CO7B 4APQD 2M2DA 4OLVH 1KTRL 1OPGL 3UYPA 3T65B 2F54B 5BV7C 2XWJB 5IQ9B 5IQ7L 5FGBA 2FIKB 3ELAT 2A9ML 4YDJA 1FZKA 2R0KL 2DQIL 3QUMH 1KNOA 1EAJA 3U0PA 3NFNA 5KS9A 3QISA 3U2SB 4OZGB 2MOVA 4JRYE 1BWWA 3HN3A 4P4KC 1CQYA 1JGUL 2Z8SA 5EUOA 5E8EB 3BDBA 1OY3B 3QCTH 3CXDL 1RJZB 1MEXH 5KSAD 4JFEA 3RGVD 3BD5A 3FFDB 1UXWA 5JR1H 1ZSDB 3GMQB 1CD0A 1S7RA 3TVMD 3QUXB 4DK3A 2IQ9H 4O00A 4N1EA 2R29H 5JPNA 1JNHB 2GTWB 1MNUL 1QOKA 2ICES 1ZLVK 2J6EL 2PW1A 4HF5H 5CHNA 4IRZH 3CMOH 4XBGB 2DLEA 1A7PH 4YBQD 1O7SA 5BQ7A 1INQB 2DQHH 3FB7B 3IAPA 4M9PA 2XNAA 1G9ML 1UM6L 3MNWB 2XTLA 3OHXB 2R2BA 3MCG1 4K3EL 1WFOA 5EG6C 5L0QB 1X5YA 1EH9A 2AXFA 3ULSB 1XIWC 4HX1A 1RZKL 1F3JB 2VYRE 1HYSC 1AGCB 1AHWB 2BFVH 1L7IL 3QUMA 5JHDB 5SX4I 4LLQA 1BBDL 5I73B 2E7LC 5FGSA 5BZDB 3QUZA 4PYHA 3GKZA 1W8OA 2DS4A 1JFQL 4IS6B 5C9KA 4N5EC 2DLTA 5C71A 4KXZH 5HHPA 1CG9B 5I0ZA 3EUUA 2YD3A 4YGVB 1S7VB 5IJKC 3PJSA 1RU9H 3CFBA 3K0WA 3F7VA 2ZUQB 1OW0C 1LO0L 4TNVK 1IC5H 5IGXL 2XQBL 5MEPB 2A74A 4ODXA 1JRHH 5IVXB 5IB3A 1MFDL 1DQML 1DR9A 3HZVA 5DF0A 3EKCA 4DOHB 5BV7L 1P4LA 2ZOKA 5GGRB 5DVLA 1RHHA 3I02A 1PFCA 4FQIL 3VGFA 2YKLH 1B9ZA 2BVQA 5E6ZA 3LEYL 1BQHA 3P0YL 4I13B 3F58H 3T1FB 4XNZB 3HB3C 4I0PA 1N26A 2VDRH 3OKLA 1UJTA 1QO3B 4H1LH 3IXAA 3MV9D 3I6KB 5C0EA 4UINL 2BY3A 3QXUA 4OD1L 1QRNB 3LSOA 4FZ8H 3QZWA 5K9JL 1HKLL 1CL7L 3B6SB 5GGTL 5GJSH 4Z7VE 1NCDH 1Y0LB 1I8MB 2GITA 3HI6L 1HH9B 3HNTL 1INDH 5EBLA 1U8NA 2Y23A 1KB9K 3VJ6A 4GS7C 3IS0X 5C0NC 3LN9A 4E5XA 5J12B 4L8DB 3PGCB 2Q1EA 3FO0H 3TJEH 3V4UH 4JO1H 3BPOC 3R0NA 3P30H 4C56D 1T5XA 3QG7L 3VDCA 3O4LB 5AD0A 3C2SA 4U6VL 2X44D 5BJTA 2APXA 2C4XA 4LASL 1J5OH 1OWWA 1CDYA 5IMLA 1DQQA 5I8KL 1E4XL 1F13A 3MBEB 1TVHB 3UJIH 4L4VE 1MWAL 4LQFL 1AY1L 5DUBB 3BKJL 4HKZA 1I9RH 4H1LA 1FSKC 5DK0B 4RZCA 4KJPC 3CDYA 1FL5B 1HSAA 1PZ5A 5LBSH 5HJ3B 2ED7A 1UWEH 3HNVH 1GZPB 1WUNT 4X7FC 4CVWA 4Q58C 1H0DA 3F6LA 2H6PB 3RVVC 4LBEB 5CINH 4I5BA 1EUUA 4YHIB 2IAMC 1NMBL 3ULUF 2PF6A 3BGMA 2NYYC 3MRNB 2VDQL 3O41B 1HWHB 3MJ7B 2XTJB 3CUPA 1HNGA 2DJUA 4RMQA 2OXHA 4X6CB 5KW9H 3BVNB 2A73B 1OQXA 2O93L 4UU9B 3DO7A 4PJCE 1MCPL 3ULVH 3HFML 3T0BA 1DUYA 1NANH 4UZGA 4U6TA 1GGIL 5EFIA 5EU7E 3GI9H 3T2OA 3QI9C 2XY1A 5TDNB 3VFVB 5I1DA 1HZHL 3FKUS 3GUTB 3MXVH 2B39A 5E5UB 3VI4E 3MODH 4ODWB 4Y5YA 1MF2L 3VFWA 1WCBB 2R9HC 1G7HB 1IGJB 1HQRA 3MLPA 4Z7VA 3C60D 3WJLA 1VFOA 1Q0YH 1KTLA 1J0KA 2IEPA 1PVHA 2NY1D 2VISA 3AY4C 3ZKXB 2DQCL 4NQDA 1W8NA 3RHWK 3TO2A 1HOCB 4MCYB 5EOCJ 2QQKL 3SDXF 2NY6D 4IOFD 2AJXL 5ERWA 4TVPL 4D8PA 4PS4L 3QA3B 4JDTL 4IM8A 3IU4H 4N90E 4G7YL 1A6UL 1ZHBB 3HE6D 5C92A 1ZMYA 3N1MC 3ARBC 4LSRL 4TN9A 2K7PA 3LKPB 5DJAA 1XGUA 1UCBH 3EOTH 3VGHA 4MD5B 4YBHA 4OZIF 2H32B 4QHNA 1A3RH 4HK3J 4M6MH 4IMKA 4F7EB 3ARGA 1R5VB 4HIXL 4L4VA 3BI9X 4OLXL 5D7JA 4BYHA 1JPTL 5EZLA 3HRZB 1C1EH 4PRDB 2AJYH 1QBAA 4RMTA 4EIZC 4EQ2A 1EHXA 2BNRD 2IF7A 2D7TH 1K4DA 1T21A 4G5ZH 4P4RA 2RR3A 5DURB 2ZG2A 3U0TA 3PGFL 5KJRH 1IAIL 3ET9F 1LILA 4H25A 4RBPH 2DQJL 3V7AE 4PRHB 2F53B 2VXTL 3O6KL 4ZOCA 5E5MB 3D3VD 4G80B 5AUMA 1C12B 3HAEH 4Y2DC 3WKNA 1MLCB 3WXVL 2WK2A 3KPSE 2B1AH 3BSZH 3RIFK 3GKWH 1NGPH 3BISA 4XTRD 2LE9A 3V0WH 2BHZA 1FFNA 3HC4L 1AH1A 4V2BA 5IUSA 1U8PA 2CIIA 4JKMA 3VGEA 4D2NA 1SJXA 4LLAA 1VEPA 5HGHA 2Q6WA 3V7MA 3UTPD 2W9EH 4P23B 5ID0B 4F58L 4OZFB 4OM1H 2EEDA 2E3VA 3QCUH 3FOMA 2O5YL 5IHBA 1JGDA 3AREB 4XNUH 4D3CL 4OGZA 4WHTB 3W9EA 1TQCB 2EH7H 5KSAC 3RGVC 3DROA 3LH2L 5J8OA 2WV3A 4WI8A 3WIFA 5I1AA 1AO7E 3BKCL 3O9WB 4MGXA 4O2EA 3TVMC 3I6GB 4ERSL 1IC4L 2I9TB 3HAEA 2VXUH 1SMOA 3O6FD 4LHJB 1JI2A 4OZFG 3MROB 5DJXA 4YBQC 5TFSH 3VE0B 5IB2A 1T0MB 1XFPA 2W0FB 2GIYA 4LPUA 5GIRA 5IMMB 3IJHA 1RZ7H 3K8LA 5DXWA 1LK3L 3BDYH 5HPOA 2IH3B 3EYOB 3B83A 5GS0C 5HHOB 4KJQD 1FBIH 3BP4B 4MA8L 5MEOB 1FAKT 3MSPA 4S11A 1PG7W 3ZT5A 3B43A 4Y0GA 1IGCH 3VG0L 3C6SB 4OLZH 5E00A 1D9KD 3KJ4C 4KQ3L 3DLQR 2CD0A 4Y5XA 2XIDA 5DZOA 1IT9H 2D0FA 3ARFB 1YMME 3KR3L 3BPNB 3TCLA 5EUOF 4NWTL 4PR5B 4NN7C 5FO9A 4OTXH 4TTDD 3BIKA 2AV7B 4XP9H 3U9PH 1MJ7L 1NGWA 4WUUB 2BSTA 2CLZA 4GAFB 1HINL 1E4WL 1U58A 5ICXA 2I60H 2R1WA 4H8WH 3OAZH 1YC8A 3GIVA 2NY2D 3JV6B 1DFBH 2XXCB 4NT6A 3G04A 3K74B 2E6QA 4KRLB 3V4VL 2IADB 3SKNB 1WZMA 4W81A 5F7HA 4LKCB 4HWEL 3IRZA 2YS4A 4Y4FC 5IROC 2D31B 2BNQE 3L3DA 5IKCA 3F7YA 5DVKA 2D4FA 4PG9A 1B90A 1QFHA 3HC3H 4KJYA 1MIML 4WHYG 4ELME 2GW5A 4JZOB 2A9NL 4U1IB 3HE7D 4UT9H 5I2IA 3WEXA 3VXRE 3BWAA 4ZAKB 3SDDA 3TIDA 2C7UA 1F2XK 4F7PB 1UH2A 2CKBB 4Z76A 1I1AA 3P2TA 1GCFA 4Q9CA 5EO0A 4JFHD 2FWOB 1AO7A 2AS5M 5F9WC 1S9WB 3IF1A 5DI8A 4OCMC 3T77B 4LVHB 3D0VA 1MHEB 1P4BH 2JIXB 4C55A 32C2B 4MLIA 4QHMA 1DBBL 3CFIC 1FZJB 4PJBA 1KCUH 5HHNA 5LQBL 1CFNB 1LHZA 3KAAA 2QTEA 1QNZH 4I8DA 3HR6A 4NUJA 3DURB 2EE2A 1NFDE 3BPLC 3I3BA 2XQYK 4FQQB 5GS0L 4S1SL 5ID1A 1IEHA 4M93C 5T3XE 5I1EH 3L3HA 5K9KB 3KYOB 1A21A 1QSEB 2AI0H 2R2HA 1ADQL 5GZND 1ZT4A 2V2WA 5AWNH 4I3RL 4XHJD 1MHPH 1FH5L 2BOBB 4GXUN 1KB5L 3MV7D 2V6HA 4EI6A 1FCCA 1D5BA 4PYGA 3KJ6H 5C8JB 3T04D 3PP3K 4PRID 3TZVC 1ORSA 4CVZA 2L0DA 4Z78B 4LCUB 3RU8H 5TJWK 5F8RC 1T20B 4NKIH 5DD6B 4PJXB 5TPWL 3GMRB 1YMHB 3GK8H 1WEJH 1S9KC 1G7JB 1MCBA 4UB0L 5DUMH 1E4KC 4GMSH 2GJ6A 3TBVA 4M03A 5CGTA 4PJAF 4QWWD 3O3DA 3VH8B 3MLRH 4AM0A 4ZO7A 1TPXB 4XBEH 1YMMA 1C5BL 5FECA 4GKNA 3VWKA 5IEHA 1EJOL 2F74B 1FFRA 1R6VA 2EDRA 4N9OB 5CSZB 4Q0XL 4S1QL 2NY7L 3LPFA 3O2VL 3AS2A 5JW4Q 2E8YA 4ZMAT 1LP9B 2YUZA 2H2PD 4OGYL 1YPZA 1AD0A 4ODTH 4ZUVB 4JFPB 5J11B 1FNGB 1KB9J 1KLUA 4NZUH 2KUTA 3MV9E 4MMZC 4N0YL 4N8PA 3LRSA 1OTUD 3MRGA 1AFVL 5J9PA 1NL0H 1TQBC 3VH8G 4W6YB 3PWPE 5T1MA 2ZWLT 1M7DA 2BNQA 2X10A 4ZS7L 1YEJH 3S3SA 4KMLB 4G3YH 4X98A 2JJTC 5IMOA 3MCLL 1KF9B 2H2SC 1CFQA 3PV7A 3VXRA 2DQUL 2FIRT 4J8RA 2NY1C 1AQKH 2QQQA 5CEZD 4OZ4B 5EA0H 4ODSL 4MJ6A 1YEEH 3BZEB 3QDJE 3A67L 3O11A 5LG1A 1ZTXL 2NY6C 4IOFC 4QKXB 2XN9B 4OIIH 2R2CA 4NNYA 5KZCB 4P2YA 1UQSA 4XGZB 4H5SB 4ZUWA 3ZSSA 5GS1B 3HE6C 2WUCL 1VSCA 1JV5A 2DLGA 4CN6A 1N6QH 2F54D 4L29B 3SO3B 2WBJD 2VLRA 4UNUA 2FB4L 2PTUA 3S5LB 5C0RH 4MCZA 1SJEB 1NCTA 2EO9A 5MERB 3VFSA 1NFDA 1FVDB 4LCYB 4JAMB 2QQNL 2VO5A 2Z92B 1ZANH 4KDWA 3WDIA 4XVJL 5I19L 1MVUA 3O6LH 4YJZL 1DQLL 4PJGA 4LLDA 3HZMA 1T4KA 4CJ1A 4F7MB 5D1XA 4P57B 2V17H 5BS0B 2ZKHL 1QUNA 4PJFA 3G08A 3LZFL 4IRJB 4X9BA 3MNZA 1OF2B 4Q9QH 3VXTB 4IRSC 4DGVH 4N8CH 2WWMD 5IV2A 3S5LG 1XR8B 3QUXD 1ED3A 4GG6E 5EWIL 4AEHL 3IS1X 2EE9A 1JHLH 3QIUB 4UT6H 4Z7VF 1DBMH 3IGAB 1EIBA 4ZFZA 5JORB 1ZLSH 5ICYA 2V9TA 5DHVB 5FKPA 3WHXA 2P42B 2BVPB 4D0DA 4JGJA 3PWLB 4Y19D 4QF1B 5ITFB 1L0XA 5C0GB 1Q0XL 1IGIH 3FRUA 3NA9H 1Q72H 1I7RA 1KYOK 1FYTD 3LKQA 4MJ2A 5HHMB 3PV6A 3TN0B 4I18C 2ZP0T 4MJ4A 4R90H 2BNUA 3BP6A 4WI4A 4RX4D 3X12B 4RWHA 4R4FH 1MAMH 1FC1A 2EDLA 2OTUA 4MLSA 4K3DL 1UM5H 1BFSA 3OJDB 1NAMH 4HT1L 4LLWA 5ESAB 1TITA 3FONA 4I4WA 5BW7A 1KIRB 4P46B 4PJ8A 4GG8A 3CMGA 1E27A 1SM3L 3SGDI 1LEIA 4HV8B 5ACMA 3QIWD 3O6FC 4ALAL 2Y5EA 4QOKD 3MUGB 4YR6B 3W39B 1DBJL 1JYVA 4TUJA 4NWUL 4F8QA 4O58L 4H20H 1JVKA 1SEBA 3D0LB 1A7NL 2XA8H 3BZ4B 4N1CA 4DGIH 3WNKA 4RNRA 3QDJA 1M1SA 3OJ2C 4NC1C 2ZCHH 1F3DJ 3MZTA 2LTQC 1FDLH 5E95B 1BF8A 5CMAA 3S37L 5IF0B 4XP1H 1VKXB 3WIHH 3HZKB 4HEPG 15C8H 1OT2A 4LSUH 3PHSA 3IDNA 2FBJH 2VERN 3VGAB 3GNMH 3QDGA 5I8CB 2V9RA 1EXUA 3FCTA 3VFUA 4KJQC 2BNRE 4U6YB 4B5EA 2N4IA 3HG1E 4NO0A 4P5MB 3NCJH 1D9KC 5MI0C 4GAYA 4PJDE 1LO2L 4PTTB 3QQ4A 1NAMA 4P0DA 5E1HB 3EO9H 1MCSA 4OUOA 4PJCF 4H0HB 3L1OL 5D6DA 3L3KA 4NN6C 1EX0A 3BKYH 4TTDC 4XX1G 3RTQB 2VE6A 4RAUB 3LS5L 1CLYL 1UKQA 5CLTA 3VI4F 4NKMA 3SDCB 3HPLA 5IM7B 4GG6A 3KS0J 2ATKA 3P11H 4HUWA 4MNQA 4FA8A 2BC4B 1J10A 2NY2C 1SEQL 4X4ME 4PB9L 4JB9H 1CD1A 4I3GA 1LD9A 3WIHA 3MA9H 2PXYA 4HQQL 1BVKB 1R3IH 2D7MA 2X9WA 3NCFB 5EU6E 2A6JA 4YHZH 5ESQB 2EIEA 1H8SA 1Z9SA 2VLJB 5T5NF 3VG9C 2H41A 1P84J 3UTSB 3U48A 5DQDL 3S7GA 1RIVH 4Y4HA 2OI9B 3GJFH 2QSCH 2F58L 4MAUL 3CFCL 1ORQA 4PRNA 2P49B 2J8UB 3BGFC 3V6FB 3FT4B 3TP4A 5D7IE 4O9HH 1F45A 2J12B 3LS4H 4QT5A 4M1GH 5DJ2A 3FB6A 1Q1JH 2OTWB 2JJVA 3BZFA 3MRLB 3QIBB 3K4DA 4HUNB 1T83A 4PREA 1VFBA 1JI1A 3KXFB 4G6JL 3BD4A 3CJJA 5TE6H 1T89C 2FL5A 2XTJD 4OZHE 4K9EL 3IETB 1NCAL 2OM5A 4XMLL 4ENED 3OR7A 4DCQA 2B0SL 3EDKA 2BCKA 1FVCB 5GZNC 3VXOA 2WLZA 4XHJC 2YA0A 3CK0L 4ZDHB 3NMEA 3T08A 2D03H 3PQYB 3CDGA 4BQBA 1CDHA 1NMAL 3QUYA 4LHUD 3TFKD 4JM4L 3WFDH 4HXAL 3DJ9A 3K1DA 4RA0C 2ICWA 3SKMA 5E2UH 3BH8B 3GJFA 3P77B 4EVNA 4F37F 1DQJB 4CVXA 5JDSA 5F1NA 4PJDA 4JZJB 1RUAL 4XNXH 1CIDA 2C26A 4L1HA 4QWWC 4OFYA 4KKLD 1FRGH 2CUIA 5GGRY 4RMSA 3HUJA 4EI5B 2XFXA 3V5KB 1DANU 2ADIB 3L7FB 5JZ7D 2B5IC 5F7MC 2LU4A 1TTFA 3IXTB 3UBXA 3DX9A 4GKZB 4YC2C 1I3GL 1CBVL 4XPBL 3WS3A 4Z77A 5CBEB 5I1CH 2H2PC 2IPKA 3EDDA 4HH9B 1TDQA 1UT9A 5DTFB 4NM4H 5EU5A 4GMTL 5CP7A 1G9NC 3VMPA 5BXFB 2BSRA 4EKXA 5F3HB 1OTUC 1OLZA 1Z9OA 4XP4H 1UVQA 4LSSL 2R39A 1T7WA 3AS3A 5EU6A 1JGEB 4OJFH 3ARYA 3B5GA 3KPNA 2ZPKL 4M5YL 3MO1A 3NABL 1N7ML 1II4E 3CVHH 3F7RA 2W38A 2HKHH 2E7BA 5C2BL 1V3MA 1OGTB 4OCWL 4HFWB 3VD7A 3NGBC 4JFHE 1ZXQA 2Y6SD 1FNHA 4JRXA 3LMJH 4PRHD 3VFRA 1RUKH 5ADPL 4CBPA 3FRPA 3B2VH 2YPLD 1TFHA 5D7IA 2CR6A 5K9QG 1JZ5A 3SE8H 4TSBL 5AZEH 3UDWA 4PJEE 4TNWF 5DD5L 2E9IA 4U3XA 5GSRB 4JFQB 4F2MB 1D3CA 5SWSB 4X9HA 3RVXD 3QXAA 4HS6A 1BD2A 2WBJC 3PHQA 4HIEB 2N56A 4QRSB 1JNNL 2SEBB 3SPVA 4OCRH 2YMXL 2P8PB 1MRCH 1YY9D 1NGXA 1CU4H 4IOSD 2BVTA 3MV7E 3NPZB 3A6OA 4M7KL 4BSWA 5T3ZD 3BKML 1LVEA 4MJIE 4LCCA 4QHKI 4Y4KA 1G7QB 2R1YA 1PGRB 5IIEB 3DOSA 5AYQA 3CVHA 3OAUH 5I66B 2Q76A 3BQUA 4N0UE 4TPRL 1KJ3H 3CSBA 4FTVD 4LEXL 3ZKSD 1JRHI 5HHVH 3T1WA 4FQJH 2ESVE 2WWMC 2VLKE 4M02A 4XHQA 1NLDH 3O9WD 3UEZA 4PJHE 2X9YA 3F7PC 4LU5H 3B9DA 3HI1B 4OLUH 4HS3A 2Y5TB 1IM3B 1ZLUH 4S0SD 3QO1B 4ELMF 3O2DH 1OB1B 1G9NL 5CJOL 2OR9L 4UQ3A 1B2WH 5D2NA 3VRJA 3MLZL 3QYCA 4S1RL 5C6TH 3TIEA 5DWUL 2ATPA 2OTPA 1GXEA 1TJHL 1I9IH 4RRPA 5I30L 4JHWL 4M3KB 4NGHL 3TNMA 1AHWC 4M00A 3Q5OA 3RWDB 1FIGL 1OTTD 3BH9A 3CSYB 3QG6B 1OP5H 2ZG1A 3GSXA 1QHOA 3ARTA 7FABH 4KJWD 5F88B 4Z18A 1F6LL 2R1XB 3RPKA 4KUCD 2UUDH 4OLYH 2IG2L 5FA4B 5EO9A 4F8TA 1T2XA 1P5VA 4CDGC 5LWYH 2PTTA 2HKFL 1JPSL 1JN6B 3OF6A 3IJYA 4JJ5B 4GQ9L 4PB0L 1NFDF 3FHAA 2MNUA 3TWCL 1K8DB 3QIWC 4PV9A 5E4EB 4X6DE 3VXSB 5I17B 1UZ8A 4KMTL 4XRCA 3PIQA 1RIUH 2RQ8A 5ADOL 1KPVA 4MAYB 1OT1A 1IQDB 3NPSB 3RWHA 3OKEA 2NW2A 1T66D 3CH1A 5I1GH 1YEFH 4WFFE 3S98A 4MD0B 1C7SA 3U7AA 2GAZA 3KYAA 2E9WA 3HMXH 4NJ9H 2RFXA 4FQHB 2EC8A 2HAZA 1QLRB 3O2DA 1PJ9A 1U8LA 2F54E 1CXFA 3I2CL 3FQRB 3B5HA 5MHSD 3MREB 1S7XB 3CFJB 2BY2A 5D9SB 2K7QA 2YD8A 1T0NB 4D9QD 1HDMB 2XOTA 4PRBA 2FNBA 3PF2A 3UC0L 1N4XL 1IZJA 3CDCA 5J6GB 1L9NA 4UIMB 3OKMB 3IDMA 3U46B 1T03H 4PGCB 3MRIA 4OZGE 3FAXA 4NDMB 1KCRH 4GRWH 3LQMA 3ROLB 3QPXL 3KYNA 4MJIA 5CJ8A 3P9LB 4CMHB 3WFCH 3E3QC 3S9DB 4N0UA 2OSLA 2C3GA 3K2MC 5A16A 1D5MA 3IRPX 4M8QB 3PDDA 1A5FH 5FCSH 3MBXH 4PJ7E 5EIIA 4MMXC 5J12C 1QVOA 1TZGH 3T4YB 2VLKA 5I18H 2A6KA 3E6FB 4PJHA 4LKXB 2HFFB 1K85A 1I7TA 5B38B 2HJKA 5KSVB 4TRPL 3TA3A 3RKPA 4F9LC 4GOSA 3HMXA 3RWCA 1OPGH 4YDIL 4FNLL 4DQOL 5DJDB 5GXBB 3MMEB 1FL3A 3RWIB 1U92B 4BSVA 5E8OB 4S10A 2H26A 1MFNA 4XPGH 2A9MH 5FCUL 3OB0H 5ACZA 2R0KH 3NFPA 1NANI 2DQIH 4U7MA 3QRFM 4URTB 2WANA 3O6MH 5DR5L 5SWZD 2PUQT 5JHDE 4P2RB 4U0RB 5J6HA 2CDFB 3LRHA 4KRPB 3RP1A 1QSED 3C09B 2R69H 2FLRT 3IVKB 1X5ZA 4JDZA 1K2DB 3V6OC 4IDJL 4RBPK 5B38G 2X70A 4PJ9A 4MWFB 3S96A 1XH3B 2E6PA 1J0ZA 4ZFFA 2ZCLH 3H7BB 3QDAA 5D7SL 4JHZA 3PP4H 4BUHA 4KI5E 2LQRA 2VDOL 2HG5B 3V8OA 4IOIB 5TH2A 1I85C 4UQ2A 4JN2A 4X6DA 1IGFL 1MELA 3KHQA 4PJ5D 1NSNL 4DOHE 1MNUH 1GRWA 2X4UA 4XCNA 2P5WB 4GFTB 1PX3A 2J6EH 4Y16A 1T7VA 4EDWL 3EGSA 3W82A 4NBYB 3MR9A 2XTJC 3QNXA 3MXWH 4IHOA 1IAMA 5FA3B 2B1HL 1I8IB 2P8MB 1HK6A 2R0ZL 4K3EH 5E03A 2YC1B 3CLFL 2AJ3A 4ENEC 2RAMA 3B9KA 4HHAA 3SCMB 3AFLA 1HI6B 2DL9A 3UZQA 4NOFA 5FGCB 1WF5A 4NO3B 4GG6F 3IAQA 1WAAF 4GXUM 1G6RB 4MNGB 2CMRL 2YEZA 4LNVA 3TFKC 4R96B 2AGJL 1DDHB 2QQLL 1QRNE 4I9WE 2H1PH 4JHAH 3CH8A 3U2SA 1FNSH 2V2XA 4OZGA 4YHKL 1BREA 4LCIL 1LO0H 2EKSB 1C5DA 4S0TD 5GGUA 5C08D 3VXQA 1PD6A 1H15A 2VXQL 2JJSA 5C0BD 4W68A 5IGXH 1X44A 2XQBH 3L3OA 5IBUG 3IU3A 4KKLC 4WHCA 4JCMA 4M43L 1NPUA 1MFDH 2B4CL 4ZTOH 4XAKE 2A6DB 4XXCA 3ZKXC 4PJ7A 4X6FB 3CFEA 3RKDD 1MRDL 3QEQA 2ICEB 4LDEB 2J6EA 2HA1A 3GMLA 5IB5B 5E6ID 4FQIH 5T5FL 1K5NB 3O4LE 3LEYH 1MFAL 4HJGB 3G5XB 3G6AA 3D2UB 3P0YH 3WNNA 1UWXH 4YIQB 4FHBD 5T1KD 5KZCD 4JM2B 4XBGA 1QQDA 3SGEI 2JJWA 3FB7A 4HG4K 4QTHA 4ODVH 4D9LL 1CE1L 6CGTA 4JFOA 3X3FL 5HD8C 1BP3B 2EDKA 3BX7C 1F3JA 4G8GB 4RDQF 4RFNC 2GK0A 4MDIA 2MQ3A 1NC4B 4OFVA 5JHDA 4G9FE 4DVRL 4OD1H 1JK8B 3MYJB 3F7QA 5DS8B 1ZT7B 2XQYG 2NR6D 2EYTB 2KQNA 4KKBD 5L9DL 1HKLH 4IS6A 1CL7H 3WBDA 1WFTA 5GGTH 5DD0L 1S7VA 3CSPA 3MRHB 2JK5A 2Y6SC 3G9AB 3BWUC 4RAHA 1PY9A 3WJJC 1Y6KR 4FQXB 4MQSB 4OF3A 5BS0D 25C8H 2VAJA 3JWNC 3KPPB 5DJ8B 3SJVD 1U3HB 3C5ZB 1MJJB 2XTJE 2DRUA 3RVXC 3OAZK 4U6VH 5GGRA 1CFSB 4PJDF 2JB6B 2MQCA 4LASH 1CD9B 5L6YH 1YNLL 1W72L 4XNQA 2FGWL 5TQ2H 4KDTC 1YY9C 3EO0B 3RL1A 1MWAH 2P24B 2HFGL 4LQFH 5FYLE 1CXIA 1W0YT 3SDAB 3ABZA 3BKJH 5F1OB 1MCRA 4CNIA 1T6WA 1UXSA 1ZE3C 3BPCA 3ZHLA 3DXAB 3O0RL 4GUPB 1X5AA 4HGWA 4HC1L 2ZNWA 1QO3A 5DRWA 3DX6A 1MCWW 3DIFB 2VXVL 5D1ZD 3I6KA 1QLFB 4QXGL 3P73B 5IBTL 1QRNA 5GGTA 1ERNA 1ZA6B 4M1DH 3B6SA 4LK4A 3O9WC 4ZUSA 1JNLH 1Y0LA 2GT9B 2WWKO 5FXCH 3REWB 4QRUB 1P4IL 3BXNB 1MVFA 2X4NB 5I6XB 2OR7A 4FFZL 1NMBH 4FXKB 2G75B 5HYQB 3FL7A 2FECI 4BZ1H 1QR1A 1PLGL 2PW2A 4L8DA 5IW1A 4QHKJ 1QRKA 3PGCA 5D7KE 1XIWA 5L2JB 3JTSA 3LEVL 4GW1B 2D2OA 4KROB 1DBKL 4OCSL 3O4LA 4V1DA 1DN0B 3GB7B 4HH8A 1HIML 4XZUB 5FM4A 5A2JH 5CP3H 1EEYA 5D7IF 3KVQA 3J7HA 1OTTC 1MCPH 2CLVA 2E7HA 3HFMH 1MWAA 3QEHA 3MBEA 4KJWC 1TVHA 4NO5A 5FYLH 1GGIH 1NC2B 5IJKA 3CX5J 1F11B 3E6HA 4LRIC 1OW0A 5AZ2L 3REVA 1T1WA 1HZHH 3KNBB 4GBXD 5I16A 1ITBB 3DX8B 4MD4B 1CR9H 4MZ3A 4G9FA 3NIDE 1XF1A 4OZHF 5JOPE 2OYPA 1MF2H 3PWUB 1FL5A 3ZYJA 4AJ0A 3K8KA 4MA1B 4CW1B 1C16B 2F53E 1YEDA 5CJXA 1CFVL 2G60L 1T66C 3QFJA 1IAKA 2DYPD 2X09A 2DQCH 3JV0A 2J5LB 2P1YA 1J8HB 2QQKH 4YHIA 3I50L 4TVPH 5JLZB 4CADA 3MRNA 4PS4H 4JDTH 1KJ2L 1Z5LB 1A6UH 3SDCD 5C0JB 4WDIB 3EW3B 1CE6B 4L8SB 2YPKB 1QTYT 4LSRH 1R5WB 4TULH 4BK4A 4TOYL 2Z0BA 3UCRA 4GAGL 5CP3A 3WLBB 1X5GA 4K23L 1ZWIA 2F5AL 1FV1B 4HIXH 3BGAA 3NZHL 4LSTL 5C0AD 4OCXL 1A1NB 1HHJB 1XCQB 5T3ZE 1MI5E 1IKNA 3ARZA 3TPUB 1A6ZB 1I4FA 1FQ9C 2EZ0D 1X5KA 4U2ZA 1JWSB 5TDNA 3VFVA 1JZ4A 1YQ2A 3PGFH 3UTSD 4YAQB 1IAIH 2J4WL 2FD6L 2IFFL 2VXTH 4HFUL 4PRPB 4D9RE 2X41A 3O6KH 4YDLC 1Y18B 4TVSa 4U49A 1UACH 3K7UA 4ZTPH 5IHZB 2FX9L 3UJJL 2WINA 3MV8B 3QSKB 2O61B 4F7TB 1FO0B 4KTDL 3C2AL 3HC4H 1SJVA 3QIBD 5CJBA 3MFFB 4RWYL 3KXFD 2HRLA 2DQFA 4JFZL 4KGJA 4JKWA 1AGFB 4ELKA 2I07A 3LQAL 3CC5A 3MRPA 4F58H 5HVGB 5KN5B 1J1XL 1WGOA 1U8MB 2YUVA 1Z2KA 2GKIA 5HHQB 4PJEF 2NTSP 3MRJA 4Z0XA 5HHOE 5DRNB 4HUXA 3PQYD 3HRZA 3Q6FA 4N0FB 5FYJE 4B50A 3TT3L 5KAQG 1EERB 4ZXBB 3CLEL 4YHYC 4WGWB 1FZKB 4YDJB 1IC4H 4JE4B 4ORGB 1KFAL 3VD3A 5TGBA 3FO2A 3QWRA 1V05A 3T0DA 3NFNB 5KS9B 4NZRL 1IAOA 4EI5D 4PBVC 2PYEE 4OT1L 4HW6A 1Z9LA 4WUUE 8CGTA 1GJIA 2YXMA 4U1KA 1CXKA 1S5IL 3OKNA 3BE1L 3RIAK 1I7ZA 3PWVA 1F90L 1MFCL 4JFEB 3EYFA 3ZTJG 3JUZA 4PJHF 1DQDH 4OD2A 2Z8VC 1S7RB 5SWQA 4P23A 5JPNB 1G9EA 1VESA 1VEOA 1XF5A 5GRJH 5CHNB 1MI5A 1SJHA 4WU5A 5BQ7B 1AIFA 1AC0A 5L7XL 2XNAB 3AREA 1TLKA 3I85A 1REIA 1RZJC 3VXMB 3VMNA 5ILTH 2R2BB 1Q9OA 3UTTD 2BRRH 3MLTB 2AXFB 4KKNA 4HX1B 4TSAH 1XF3B 3QUMB 3KR3H 3RKDC 5I1JH 4LLQB 3I6GA 4NRZB 3LHPL 4RFOL 4HJJL 3STBA 3QUZB 4HGMA 2CK0L 5E6IC 4FRWA 1G1CA 4WTWA 4PY7A 2AKRA 3WKML 5HHPB 3ARBA 2XZAL 4LAQL 3PJSB 3CFBB 4O2FA 3F7VB 1HINH 1JHKL 4HWZB 5SWSD 3DBXA 4X6DF 2W0FA 3DNKA 3SO3C 1F97A 2A74B 2AQ2A 4ODXB 1OQOA 1M05A 4KHXL 4LLUB 4JY5L 4KZDL 4DTGH 2V5YA 1R24A 4G8EA 1P4LB 3O8XB 3EAKA 2ZOKB 4X99A 4X4YB 4AIXA 3I02B 1RHHB 1NBYA 5D71L 2QHRL 5HHOA 1T0PB 1MIMH 3GIZL 2AK4D 1BQHB 3RNQA 2A9NH 4Y2DA 3OR6A 5IR1B 4FOMA 3C6SA 2P43B 3ILQD 2YA2A 2M1KA 1F5WA 1P6AB 2DTML 2R56L 3IDXL 3D5OF 5M94B 3IXAB 4OZGF 4PLJD 3AAZA 3ARFA 3EHBD 3LY6A 4YXHL 5C0EB 2VQ1B 2EDEA 3WL9A 3LSOB 1JPGA 1WWWX 1DBBH 3QZWB 4WO4D 2PYEA 2UYLB 4LRNH 2WUBL 4WUUA 1UB6A 3U7WL 3DRQA 3VU2A 5LQBH 3CX2A 1LP9E 4RQQB 1BQHG 2EDQA 5D2LA 4DWHA 3ZE0F 3M1BB 1JHTA 5GS0H 3DARA 4PJ7F 4S1SH 2XZQL 3VJ6B 3H8NA 3JV6A 4E5XB 4I77H 1CLOL 5D1ZC 1FH5H 1L7TL 1RZJL 1GYAA 3SKNA 5FUOH 3CU7A 2VZSA 5FUZL 2YD5A 5JUEL 1CICD 5AD0B 2ERJC 5BJTB 1S7SA 4MB3A 3QZWG 4HG4J 5TPWH 5IMLB 1DQQB 3C08H 2W0KA 2RJMA 3MRBA 2R0WL 3U4BL 1A3LL 3UPRB 4NHCL 4LIQL 2UZYB 1OSZA 1QFPA 4H1LB 4JQVA 4JKKA 1C5BH 1L0QA 3OSKA 1EJOH 1HH6A 3Q6GL 2XN9E 3WV0A 3U1SL 4HMCA 5H94B 2NY7H 4FZEL 3O2VH 5A3ID 4XP6H 5EC2A 4YUEL 5DA0B 2JIXA 1SY6H 1HSAB 1PZ5B 5ELIA 2HRPH 1CFBA 4OGYH 3V5DA 2XKSA 5EOCH 4G6MH 1DSFH 4R4BB 3GHBH 1WT5A 1CFNA 1I1RA 4NQCB 3VXUD 1S3KL 1H0DB 1N8ZA 2G9HA 3HPJB 2OQJA 3HLAA 4N0YH 4FQQA 4X7TA 4I5BB 1A02N 1AFVH 4GBXC 2ICWI 3BGMB 3T0XA 1IMHC 1RZGA 4H1LG 1A9BB 3CUPB 1BFVL 3E2HB 1I1CA 3C8DA 3ARQA 4ZS7H 5KSBB 1URLA 4LCUA 1T20A 4GLRH 4U31A 3DO7B 4ODSH 2VUYA 3MQIA 4RFEB 1DUYB 3UBXI 1G7JA 3A67H 5EFIB 3GMMB 5I15L 1FFOA 3VXNA 5I1DB 5E94A 5HDLA 4HPOH 3G5VA 4QRRD 1JP5A 3SDCC 2FX7L 1UYWL 2F74A 4FQ1H 5CEXA 2HFTA 4Y5YB 3VFGL 1SY6A 1CGSL 3VFWB 4D0CA 3GSVB 2OLDA 1HQRB 3GJEA 2FB4H 4Y4FA 1UJ3B 4PGDA 4I48B 3LN5A 4XB7A 5E2TL 1KTLB 2EIBA 1ZVYA 4HUMB 1QR4A 1F4XL 1FNGA 2VISB 4PGBA 1MCOL 4NQDB 3TO2B 2EZ0C 4P2RD 5I19H 2RCSH 2R8SL 4Z6AT 1NAKL 5HHME 4KRPD 4PV8A 1DQLH 3C6LD 1YUHA 1ZHLA 3H9SA 5ERWB 1PSKL 5HGAA 2OI9C 2ZKHH 4G6AD 4L3ED 4GKSB 1JMXA 4U1JA 5DJAB 1XGUB 3S4SA 4KC3B 3ZKMD 4P5KB 2BSSA 4P5TB 4QHNB 3TGXA 1FYHB 3ARGB 5BCAA 1KBGL 3FT2B 4L4VB 5D7JB 4UAOB 5EWIH 5J4MA 4AEHH 3LPWA 3QIBC 3BZEA 3SBWC 1T2QL 4F3FA 5TF1L 1K4DB 1T21B 2XN9A 3WFBL 3U0TB 2CSPA 4H25B 5GS1A 3IYLW 3BAEL 2FEEL 1O5DT 2MTPA 1K3ZA 4L29A 3AM8C 4KY1H 5AUMB 4RGNB 1Q0XH 1SJEA 5MERA 3TZVA 5FO8A 3LV3B 3QRGH 4LCYA 3LDBB 1CI5A 1FFNB 2ED9A 2X1WL 1AXSB 4X6CF 4HT1H 3SO5A 1U8PB 4R7NA 1RY7B 2XWTB 1SM3H 4F7MA 5HGHB 3KLHD 2Q6WB 1AXTL 3LD8C 1P1ZA 2AEPL 2H3NB 1DBJH 4NWUH 4O58H 4PGZA 4QXUL 4EI5C 1ZLUK 5B8CB 1A4JA 2AQ3A 4AEEA 1N5YL 2EXWD 4PD4J 3FOMB 1JGDB 1MFBL 3KPRB 1NLBL 1GAFL 5SX4H 1U9KA 3N0PB 2OP4L 5A2LH 2W91A 1RHFA 3DROB 3BEWA 2UWEB 3WIFB 2BHUA 4O2EB 5JORA 4R7DA 1E6OL 2XI9A 2GEEA 4P99A 3HAEB 2UUDK 5B22A 4LSVL 5ITFA 1U8JA 5DJXB 2VLJE 3ZZ1A 4Y8AA 5C86A 2JJTA 5IB2B 3UTSE 4P2QE 4K94H 3TN0A 2ZSVB 3DYPA 1TTUA 1LO2H 4UIKL 5GIRB 1WIPA 3IJHB 4M1CD 3QBTB 4OBSA 4U0QB 4E0RB 1ZLVH 1RURL 2J8UE 3OJDA 2VDPL 1IC1A 4MSWA 4Q9BA 1INEH 2F8OA 2J1KA 2X4OA 4HV8A 3LKSA 4C58B 4WCYL 4PBXA 1UG9A 3LS5H 1CLYH 4YR6A 2P48B 3HAEG 1FGNH 3W39A 3NIDF 1EAPA 1U3HD 5K9OA 3RA7H 2VIRB 1MJ8L 2BZDA 3ULUD 1SEQH 5E00B 1OWRM 1EFXA 5DUPL 5INCB 4HQQH 4K3HA 1F4WL 1KCLA 4NPYA 4O4YL 1OL0A 2YZ8A 3NCBB 4WI2A 3UTOA 5FM8A 4QCIA 3PQYE 5FO9B 3BIKB 4OD3L 3DXAD 2ZSWB 1NGWB 4WU7A 2YRPA 1U8IA 5DQDH 2BSTB 3RZCD 4MHHI 2HFEA 3D3VA 4HWUA 4U6YA 1TJIH 1H5BC 1U58B 4IRSA 3CFCH 3ILQC 1FORH 2WNGA 1F6FB 3GIVB 1BZ9A 3KG5A 4PTTA 3BRDA 1I3RA 2FYYA 5CZXD 4NT6B 3G04B 1BFTA 3IDIA 4PLJC 1CGXA 3EHBC 5CFHA 4BH8A 1VDGA 4C54A 4WO4C 1QEWB 4G6JH 2DF3A 3WNOA 3RTQA 5C09B 3L3DB 5IKCB 3X17A 5CD5D 5LKNA 3OB0K 2MHAA 3D1MC 4K9EH 1NCAH 4KROD 3WEXB 3BWAB 4E41B 3SDDB 3TIDB 2C7UB 2Y9RT 3MRDA 2BC4A 4M7ZB 4Z76B 1I1AB 3R8QA 5EO0B 3ZDYE 1MCFA 5ACLA 4Z0BL 1BVKA 3IF1B 5KANI 5ESQA 4JG1L 1F00I 3BW9A 1CICC 1NMAH 1EHLL 1QHPA 3CD4A 2C3HA 4OKDA 3OG4B 1CGUA 5IESL 4HXAH 3ZKNC 5C0IA 4DGYL 2VLJA 4QHMB 3W5NA 3IFNH 5F70A 3FTGB 4PLKD 1FGVL 2FECL 4PJBB 3O6FA 4P2QA 5HHNB 4NUJB 2X1XR 1RUAH 5E4EC 4NFBA 2Z9TA 2J8UA 3L3HB 3VWJD 4KUCF 3RWGB 2R2HB 4KDVA 1ZT4B 2V2WB 4JN1L 1XT5A 2OJZH 5F1SA 2NCMA 5A3IC 3P4LA 1JTPA 4YHOL 2D0GA 2HN7B 5KVEL 4EI6B 1D5BB 1I3GH 1CBVH 4KK9D 4XPBH 5I1KL 5SWSE 2Q20A 1ORSB 2HP4A 4CVZB 2CRZA 4QTIL 2IGFL 4GMTH 2VDLL 5F6IB 4XXDA 4U7SA 2APFA 2NX5D 4CGTA 4XCCH 2GJ6B 3TBVB 1I9JL 4LSSH 3N1PC 3O3DB 5DZNA 2GHWB 1V7ML 1AI1L 2ZPKH 4M5YH 3NABH 5FECB 4GKNB 5IEHB 2FJHA 1YEHL 1KLFA 5HGBA 2V2TA 4JQXC 3ZO0A 4CMMA 1KG0A 4X9GA 1B4RA 3K4AA 4LHQB 5C2BH 4OCWH 5BRZB 5JW4M 4JGMA 1YPZB 1AD0B 1DVFB 3U4EB 1DQJA 3RDTD 4PRPD 1KLUB 4DEPB 9CGTA 2NY5L 1BVZA 3LRSB 2A83B 4TSBH 3AROA 5JIHA 3MV01 2DOCA 5I1LA 1T6VN 1OAYH 3HR5A 3LRGA 5DD5H 3MYZA 3RJDA 2OL3L 5E9DB 3MV8D 4AYFA 3O81A 3RRQA 3WS6A 1M7DB 3VGGA 4X98B 5HVHB 1FPTL 5IMOB 5CBEA 1RV6X 1CFQB 2YMXH 3VXRB 2EDBA 4J8RB 3U0WL 3OQ3B 4U0RC 4JFDB 2R4RL 4MJ6B 4KRPC 5F3HA 1J88A 1BVLA 3C6LC 3C09C 3BKMH 3WD5H 4G6FB 4R0LA 2C9AA 1JGEA 4UOJA 4NNYB 4BKLA 3OJMB 4JO3L 5FK9A 1UQSB 3UO1L 4NKOB 4TPRH 4P3DA 4CUCA 1JV5B 4G6AC 1ZEAL 1NFIA 4YFLI 4UTBL 3NN8A 3G6JE 3ZKMC 1WZKA 2LVEA 2VLRB 1JZ8A 4KTEL 1OGTA 3VXSE 4UUJA 4X6EA 4HFWA 4UT7L 4PTUA 4MCZB 5JW5B 5FO7B 3VFSB 5DJ0A 2APTA 3SE9L 4BELD 4CAGA 1CGTA 4P9ML 1MVUB 1KCSH 4PJGB 4LLDB 1G9NH 5CJOH 1MCKA 2OR9H 1F42A 4Z7OE 2O5XL 3MLZH 3WO4B 2R15A 3HZMB 4S1RH 2XXMB 3TYGL 2EYRB 1T4KB 4JFQA 2NZ9D 4PJXF 5DWUH 5GSRA 2WQ8A 4FP8L 1LNUA 5I30H 4JHWH 4PJFB 4HIEA 4NGHH 1AGBA 2Q8BH 3MNZB 3EOAA 1F3DH 1FIGH 2SEBA 4PRIA 5KTEL 1VPOH 3VA2C 3NZ8A 1CL7I 5DLML 2OX5A 1JNJA 4LPTA 2IG2H 5T33L 3V5HA 3DYMA 4JKLA 1CTNA 1LP9F 1JPSH 4WY7L 1VFAA 1G7QA 4ZFZB 4GQ9H 4LLMB 5FKPB 3WHXB 3TWCH 3KLHC 3U6RA 5I66A 3RL2A 4D0DB 4KMTH 1FN4A 3KYMB 2N1KA 5ADOH 3O3AA 1U95B 3FRUB 2EXWC 1I7RB 1KIUA 1GSMA 3LKQB 1V3JA 1YYLL 2J8HA 3JWDH 1HSBA 1CT8A 1S9XB 4LSQH 2BNUB 1E4XI 3I2CH 5J06A 1PKQB 1T1ZA 2ADFH 4XCEA 4J4PA 1D6VL 4I4WB 3FONB 3ME0A 2PO6B 4Y7MA 4PJ8B 1E27B 2Q7NA 3GMOB 4ZSOA 1LEIB 1EUTA 4LSPH 4YHML 3KS0H 3UC0H 3NCEB 1N4XH 1I8KA 3HCVA 3TJHD 1SEBB 4OF7A 4H88L 3QG6A 1N64L 1YJDH 3D39B 1IAIM 4RNRB 4NRYB 2R1XA 3S88H 2CJUL 4M1CC 3ALWA 5FHAH 5CMAB 2W0PA 3I6LE 4WHDA 2V5MA 1JN6A 1WISA 4JJ5A 3GBMH 3G6JA 3IDNB 5EU3A 3O45A 3O4OC 1NMCB 3LPGA 2CXKA 5I17A 1AKJA 3VXSA 4I0PD 1EVUA 3SE3A 3QDGB 1EXUB 4MAYA 5LXGL 2P5WE 3VFUB 4TRPH 1U3HC 3TH2T 2G2RA 4JO4L 5D5MA 4FNLH 3WXWL 3K81A 1UWGH 3Q48A 4NO0B 3ULUC 1YECL 4BFEA 3BDXA 3LVEA 1KXTB 4FQHA 5F1IA 2HH0L 3BT2H 4JRYD 1HQ4A 1NAMB 3MRKB 1J8KA 4J3UA 4XWGH 1S7XA 3MREA 4Q2ZA 5DR5H 2AAVA 5D9SA 3L3KB 4C4KO 1HDMA 5DFTA 4L9LC 2XV6B 4M4RA 2VE6B 1AD9A 4JVPA 1GOGA 4MNGE 3RZCC 5IW6A 1H3UA 4NKMB 4JR9L 3U46A 3HPLB 4DKFL 1DBAL 2ATKB 2DWDB 1KJMA 4MNQB 4HUWB 1TIUA 3VRIB 4OQTH 4WTZA 4YX2L 5D7SH 5D93C 3WN5C 5JXED 1ES0A 1CD1B 1LD9B 1I3UA 5CZXC 4O02L 1LO5B 4OV6F 5DSCB 4YO0A 2BVUA 2A6JB 5I6XC 2CPCA 4KVCL 2A77L 4UTAH 3UYRH 1GC1C 3E6FA 1NDMA 4LKXA 5CD5C 6FABH 3FQTA 2MSPA 4Y19A 1IQWL 3T4AB 4WUKL 2B1HH 4HD9A 4KROC 2R0ZH 4Y4HB 3CLFH 1KSRA 3QCVL 1ORQB 3DECA 4AH2B 1A6VL 4PRNB 2LV4A 3BUTA 1VACA 4ODBD 4HIHA 4A6YL 1RK1A 2JELL 1FAIL 3TLRA 4G8GE 4QT5B 1MCQA 1FZOA 2CMRH 3BZFB 3FB6B 2QQLH 2CDFA 2VWEC 4AMKL 5JDJA 1VFBB 3QIWA 4PLKC 4YHKH 5GGSB 4LCIH 5JIKA 4F9PC 3IVKA 5E4IA 4PJIB 5I75C 4OQTA 1XH3A 3OR7B 4M43H 2B4CH 2QLVB 3VWJC 2Q8AL 2IWGA 2BCKB 2C1OB 4LPYA 1JWMA 4W4NA 3VXOB 2BHYA 2ZCKL 3ULUL 3JXAA 4Y1AB 3TYFA 1MRDH 3MLXL 3D85A 2Y06L 3CDGB 5GRUH 3QWOA 4KK9C 3QUYB 2P5WA 1JWUB 4QO1A 5C7XL 5DA4A 3PABA 1CYGA 2ICWB 4Z7UB 5AYUH 4J23A 4D9LH 1NBQA 5FA3A 4CVXB 1CE1H 3UJTH 5JDSB 4ZS6D 2YC1A 5F1NB 5ETUA 3X3FH 4U6HA 3SCMA 5FIEA 1HI6A 5IFAL 3W9DA 3HUJB 2XFXB 4B7LA 4FQ2H 3CFDA 4DVRH 5KG9B 4XVTL 4DW2H 3WFEL 1JL8A 2VDKL 3UBXB 2FR4A 3DX9B 1DL7H 4MNGA 1DDHA 5DD0H 3WS3B 4Z77B 4JO2L 3RDTC 5EU5B 5D8JH 3RI5K 5CP7B 1GC1L 4TNVF 2JCCA 2BSRB 4BZ2L 1UVQB 4CRPA 1RZIA 5EU6B 3ULVD 2EDYA 4H26B 3ARGD 3KPNB 4HGKC 1MCNA 4YK4C 4NBZB 4L4VD 1B0WA 2C4FU 3MO1B 1RK0B 3GSRA 4HS8L 2APBA 3UBXG 4XVUD 1TVDA 2J8UF 3G5XA 3D2UA 1W72H 4JM2A 4M3JA 2HFGH 4JRXB 1PW3A 1WBYA 3X11B 3WSQH 4IJ3B 5KOMC 4RGMC 3VFRB 4QRPE 5A2KH 4F57H 1EFQA 5HHXH 1MIEL 3EO1A 4RGND 1GZQA 4HC1H 1AQDA 1A6WH 5K59F 1MCLA 3RUGA 3S3PA 1NC4A 4QXGH 3MYJA 5ABDE 5AG9A 1BAFL 5J13C 4JPWL 3QXAB 2EYTA 1BD2B 1NCWL 3PHQB 3PUCA 5FGBC 3QXWA 5J1SC 3SPVB 3ALPA 1P4IH 3KPMA 4FFZH 5E8DH 1BWMA 2Z35A 3W0WB 1KN2L 1NGXB 3L3JB 4FQXA 1I75A 3FRPG 1PLGH 1J8HE 1WICA 3DSFL 1DEEA 1YEGL 3BRFA 1NUDA 3HNSL 1J9CT 1MPAL 4LCCB 4Y4KB 2R1YB 5J57B 3ETBF 4Q74A 2NZ9C 1DBKH 1BFOB 1D7FA 3CVHB 3FN0H 4OCSH 2Q76B 3BQUB 1QBLL 5DQ9B 4FXGA 1HIMH 1K6QH 1CFSA 1W72A 1P5UA 4LHUA 5CKGA 4JFYA 3IDYB 1QKZH 5AZ2H 3SDAA 1R3LA 2FH8A 4HC1A 4HS3B 3RQ3A 3SGDH 2C5DC 5C3TA 4GUPA 1FJ1A 1N59A 1TETL 3MACL 4UILH 4OGXL 2XZCL 5C6WH 5D2NB 3VRJB 3DIFA 1BQLH 2RGSA 1ZK9A 1FLRL 5DGQA 4TTGA 3TIEB 4ZO9A 1QLEH 2ATPB 2P5EA 2D7PA 3MUJA 4PRPE 4KGLA 1LK2A 1CFVH 3AU1B 3ZDYF 1RUQL 2G60H 4M6AA 3F62A 4IIQB 4N90D 5I74C 3TNMB 1IM9D 43CAA 3TO4B 3BH9B 2GT9A 3BXNA 3TT1H 2X4NA 2ZUVA 1HCVA 1EPFA 4ETQA 1WK0A 2JKXA 3UAJD 1KELL 1JMZA 1KJ2H 4JPIB 4EUPH 1N2RB 3FOLA 5CLWA 3IJYB 5L2JA 4TOYH 5IBLD 5CJQL 5T1LD 4PV9B 3SKOB 4RISH 1G7LB 1UZ8B 4XRCB 3PIQB 5C9JA 5HDQL 4K23H 1F4YL 3TJHC 1KPVB 3NZHH 4LSTH 4RRPG 3RWHB 3S34L 4OCXH 1JGVL 2NW2B 3OKEB 3CH1B 4QRPA 4C83A 1NC2A 2PTVA 1HEZB 2ZZUT 2HT3C 3KPSD 2L4OA 2YPLA 4MD4A 5KOVC 4YFEA 2DB8A 2J4WH 2FD6H 2IFFH 1Z3GL 3PWUA 2DQTH 3H42L 2RB8A 4CU8A 4I0PC 2MWCA 4PRBB 1VCAA 12E8L 4JHBA 2FX9H 3LEXA 3CZFA 5EU4A 4Y5VC 5TDOA 3PL6A 5KS9E 3QO0A 4XPHH 1RZ8A 1H3XA 4KWUA 3MRIB 4KTDH 3UTZB 3W5MA 2NXYC 2RIKA 2WBWB 4ONGL 3RHWF 3VI3E 1FO0H 4KDTA 4RWYH 5TE7L 3KYNB 1H3TA 2WWKT 1KJ2A 3N1QC 3EOBA 4JFZH 4MJIB 2IJ0C 3AB0B 4KH2A 4EUPA 5BO1L 4JFEE 5A16B 1HXYA 3V4PL 3LQAH 4WDIA 1NUFA 4WJ5B 3SDDD 4AL8H 5EIIB 4FQPA 2VLKB 4FTVA 4OLVL 1AO7D 4NCC2 4L3AA 1I7TB 1ZA3B 3RY5A 2HJKB 3TA3B 1HHJA 1XCQA 3GM8A 4Q6IB 3RWCB 5BVPL 4O51A 5HVFB 1FL3B 5JXEC 5E1AB 3VXME 1JWSA 3TT3H 4BSVB 3AUVA 3BHBA 2H26B 4GLRI 1IILE 3CLEH 1DEDA 3STLB 5ACZB 5FOBB 3NFPB 5E6YA 1H3GA 4KQ4L 5MP6H 3S35L 4NHUA 5J6HB 1OTSD 2FATH 4LPWA 4OT1H 1HXMB 2YRLA 4GO6B 1GGBL 1MEXL 1XF4A 5FYKE 3ZE1E 3RIFF 1S5IH 4GRWB 1FO0A 2X1PA 2J7LA 4KU1A 5D1QB 3S96B 4EOWL 4WVRA 3MFFA 1XGTA 4ZFFB 1F90H 1MFCH 5KVGH 2IQ9L 2R29L 3MJ9L 2X9XA 1FLTX 4J12A 4KVNL 4YXLH 5TH2B 4XCFL 1AGFA 4UQ2B 4JN2B 4X6DB 1A47A 1MCDA 3CMOL 2GJ6D 1A7PL 2AJUH 4WFEE 2X4UB 5F9OL 3PNWB 4XCNB 2X89D 2DQHL 4MA7L 1AE6L 4PRAA 4Y16B 3U83A 4Z7OF 1YMMD 3MR9B 4E9LA 3VWKD 3OX8A 3QNXB 5DRNA 2EDJA 4IHOB 4N0FA 5KANG 1QBBA 1NUGA 3N1FC 3S36L 2AJ3B 2P47B 1JF1B 3B9KB 3EYUL 4HHAB 4LAJH 3P0GB 3MA7A 1M6OA 4M5ZL 4ZXBA 1QPPA 3LHPH 3KLAA 4L3CA 4HJJH 4RFOH 4ORGA 3TH3T 4Z5RA 5C0CE 1P9MA 3JWOL 4I3SL 2YEZB 1Z6JT 3GI8H 1G7PA 2DQGL 2XZAH 4LAQH 2AXJA 1MCWM 1IC5L 2V2XB 4I1NB 3VFPA 5FYKH 4MJ5A 1U91A 1C5DB 5GGUB 4U1SA 3VXQB 4EN3D 1H15B 4Y5YC 4OI8A 2ZUUA 4ZS6C 2MMXA 3V9FA 1XCTA 2BNQD 3KGRA 4YHNB 3L3OB 4LPVA 4XWOC