4IRZH

Crystal structure of a4b7 headpiece complexed with fab natalizumab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
222
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQRLEWMGRIDPANGYTKYDPKFQGRVTITADTSASTAYMELSSLRSEDEAVYYCAREGYYGNYGVYAMDYWGQGTLVTVSSASTKGPSVFPLAPCSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How natalizumab binds and antagonizes alpha 4 integrins.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Integrin alpha4 subunit
total genus 36
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2013-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH01
3CPLA 3LQZA 3UP1A 5INCA 3MRBA 1NAMH 5BV7B 1A0QH 1DL7L 2R2BA 4KQ3L 3CSYB 3MLVL 4PJ7E 1KPRA 1KCVH 4G6KH 4PLNC 1X5IA 5DMIL 4NUJA 3IS1X 2HJLA 3UAJC 4P2OC 2AJVH 2MCG1 3ULUL 5C0JA 2XZZA 4L4TA 1VESA 2J88H 3EKCA 1ZSDB 4LSTL 1I7RA 3A0OA 5D1ZC 3EGSB 4D3CL 2XWBA 4IRSB 2EH7H 4PRPE 1T0NB 1YEKH 2BNRE 5IB1B 5J3HD 1E4WH 1KFAL 5JR1H 4JFHD 2ZUQB 5DURB 3EAKA 5ACMA 5KOVC 5H37H 1G6RH 2WWMD 1WZ1H 2J8OA 3O6FA 4FQQA 5DGRA 5F7DA 2YMXH 3IETB 4GG8A 3MV8D 4MXQC 2KUTA 3ILQD 3OKKA 3P77B 1UWGH 1AXIB 2VQTA 5E6ZA 3DROB 1OARH 1HZHH 5IVXF 1FZKB 2ICCA 2J8UF 3O4LA 5IP4A 3KYNA 1FNLA 4P2OA 3SQBA 2BVEA 5F96H 4OCRH 3ULVF 3DIFA 1XGUA 5FUOH 3X12B 1LVEA 1PYWB 4ZAKC 1S7TB 4IOFD 3NPSB 2GSGA 3M8OL 3ZYJA 4AG4L 3TN0A 4M7ZB 2P5EA 3CFKB 3TJEH 4HLJA 5ADOL 1MEXH 4P4KC 2AJXL 1CXIA 3ZKQD 4V2CB 1JTPA 4U1LA 5AZEH 3P11H 1BQHA 5EU6E 5JDJA 1W8OA 3I6LD 5HHVL 4PJEF 1NQBA 3AS3A 3GSNB 4LCWA 1Z9MA 4YO0B 1I9EA 2CKBA 3EYFA 1FQ9C 2EH7L 2PW2B 4BQBA 2DQUL 4JPWH 1T7WA 4OFYD 5JHDD 1IEAB 4LVEA 2CKBL 5A3IC 2J6EA 4M6NH 4OBSA 3WMSA 2JCCF 3FQNA 4E5XA 1H3GA 4QHUB 5HVHB 1KJMA 3MO1A 4LHQB 3QWOB 3WEXB 4P2CG 2AK4E 3ARQA 5ERWA 3VGAB 4NCDA 3D0LA 3LKPB 2H9GA 2BSED 3HE6C 1IM9B 4YIQB 4XTRC 5T5FH 3SE8H 3PF2A 5IK3B 4KHXH 1ZLUK 4AQ1B 2NR6C 4D0DA 5I18H 4GW5B 2AJ3B 3I2CH 1X44A 3FO2A 3IJSB 4MHHI 5GGVL 1MWAL 2OI9B 4LL9A 5BS0A 1N0XH 2XNAA 2XACC 1HYRC 1R3LB 5KS9F 2QBWA 1QRNA 3PP3K 2A6KB 1JV5A 2D31B 4X6DF 4WEBH 3TBWB 3LEYL 2VOTA 3UTSE 4AZ8A 1EFXD 1HKFA 1BJ8A 4D9RD 1PGRB 4OF0A 1YYML 3QG6B 4KRPB 5FUCC 2X4UA 2DQFA 4D8PB 4KKBC 3MLUH 3OKLA 4KRPC 2NTSP 3L3KA 1EFQA 4WWKC 4G42A 2VC2L 4XP5H 5E8OA 1U8IA 3FT2A 4OLWL 1OPGH 1F45A 1AI1L 4HC1A 2UUDH 1EV2E 5IMLB 4U6HA 1DEEA 1Q72L 4LBEA 4IEFB 2VLRD 5FHAL 1U2HA 1A14L 3QDJB 3BKJH 5CHNB 3TO4D 2WW8A 4NQEE 3EYOA 3TNMA 1FGNH 2G5BA 5CGMA 5CS7A 1D6VH 1EXUA 2DLFL 4L8DA 4KVNH 2CMRH 1PG7H 1OW0C 4X7DC 1G7JB 4HIXL 1XR9A 4A6YB 4F9LA 2PTVA 3TYFA 1UZ8A 2B7DT 4NQCB 2EKSA 4UOW0 3AM8A 5H2BB 4YEEA 4EDXA 3ZT6A 3SDCA 5I73B 4HIIB 5L8KB 1WICA 2R4RL 3G6JF 1MPAH 3KR3L 4HJGA 5DRZB 1YMMB 1U8JB 1IGIH 4XNUH 4EXKA 2FCBA 3DRQB 3W39B 4CNIB 1LEIB 4AL8L 4YXKH 4QY8A 1D7FA 1BJ1H 1JPGB 5JOFA 3H3KA 2E8ZA 5GSRA 2F5AL 4S1QL 1G6RA 3ARDD 5ESVB 2DQGH 5HGDA 4RGMC 2ZUUA 1P7QD 1G9NC 4XPFH 5HYJE 2DQIL 5C6TH 4HZLA 5DWUH 2F53A 2DLHA 3GMNA 2NXYD 4R97C 3WKMH 1RIUL 1T2QH 2PXYB 3TPKA 4YC2B 2I24N 2W07A 4JKWA 1FZOA 3O2DA 4X0KA 1QP1A 1OAQH 3RL1A 2QADC 4PRAB 5TF1H 2VDQL 4KKCD 4S1SL 1EHXA 4PRPA 3SE3A 3MGOA 4HKXB 3MMEA 2OTWB 5TJWK 4LBEB 4ZXBC 4YH6A 3JZ7A 1GZQB 4P23A 2XRAL 4YHZL 1XAUA 2W91A 5CMAB 1YY8A 2D7TL 3OPZL 4P46B 4FTVA 1TVBA 2VXQH 3CFDB 1LO0H 5SWQB 5GRZA 1WC7A 2I5YH 3C5JB 1IFHH 1RZKL 2Q76A 3ARBA 3OJ2C 3DXAA 5IW3A 1SBBA 3G5XB 3UYRL 1JPTL 5HYQB 1BAFL 1CFVH 3WD5L 4PRPB 1MHEB 1CU4L 2VJXA 1LILA 3BDYH 3RUGA 4P46A 1UM5H 5L6YH 3GSWB 3SQOL 4ISVB 2ZPKH 2BC4A 3SDAD 3RU8H 1U8LA 1NFKA 1INQB 4PJIB 3SPVA 5ERWB 5KG9A 5CD3A 1KJ2H 1J86A 4PG2C 5D1XD 2V9RA 4EI5D 4FZEH 1KGCD 2F54B 1LE5B 4OZGA 3OSKA 1IC7L 4ZO8A 4KC3B 2MWCA 4P3WA 3BPOB 1XZ0B 3LD8B 2VUYA 4AEFA 1PZUB 1BVKB 4KZEH 4NO3B 4KKNA 4TUOB 4BZYA 5A2JH 5INDB 4XNYL 1G9MC 4FQXA 4WW2A 5DUML 1EMTL 1AP2A 5E5MB 7CGTA 2O5YL 2H2PD 3TNNA 3MV9A 5FYJH 4BELD 3MFFB 2Z8VC 1S7RA 5KBNC 3S4SG 1G7LA 2QQLL 3BKYH 1R3IH 3VXOB 3V0WL 1QNZH 1ED3A 5D2NA 4LSSL 4R96A 5ILTL 2W9DL 1J1PH 4JFEE 1ETZB 2XRAH 4NO3A 4ZDHA 3WFDH 3FOMA 2UVFA 5A3ID 1IM3A 4YBLC 3TBYA 4X5XB 3SCMD 4U1JA 4NQUA 1F6AA 5IBUB 4NKQB 4RMVA 3ZE2E 2ZNWA 5D7LE 1KJ3L 2OCFD 3CDGA 1SYSB 2EYRA 4UAOB 4KI5F 4XCEA 5FDYA 5C3LD 1KCUL 1CIDA 1PZ5A 2OR9L 2VERN 1NC2D 1DBAH 1M71A 2XICA 3THMH 5CIPB 3V2AR 5LVEA 1N5AA 2A83A 4JDZA 4NPYA 4W68A 3BI9X 2L7UA 1S9VA 4MD4B 5BQ7A 5F21B 5MEPB 1MCLA 2BC4B 5MERB 2F54E 3AS2A 1I7ZB 1C12B 1QLFA 3QO0B 5SWSD 1XCTA 4P9HC 2AVGA 3HG1E 1B0RA 2HFGL 4KI1A 2YUXA 1M4KA 2NY4D 4CU7A 1H3TA 1SEQL 2XG5A 2ZUVA 2VWEE 3HC0B 1NGQL 3LPGA 1UXWA 4M6OL 4KRNA 4R90H 5F7EL 3UROR 4Z7NE 1KPRB 4KHTH 1FIEA 1QSFE 3BGMA 4Z0XB 5KSBE 4UILH 1EK3A 4XPTH 3V8CA 43CAB 2FWOB 1IAIM 1HHHA 5AZ2L 2ADJA 2P8LB 4YDIH 3EZ8A 2FH8A 2V5RA 2AABH 2Y23A 3MJ7A 1BIIB 2XZCL 5GRYA 3TEUA 3GSNH 3KHOA 4NCC2 4P9MH 4I2XE 5C0CA 2ADIA 1IC5L 3FL7A 5HSFA 1TZGH 1QBLH 4XZUB 3FONB 4N68A 1V3KA 1JRHL 1FGNL 1U9KA 5H94A 2GJZB 2I9TB 3JWOH 1UKSA 3EOBA 1RK1A 4G6MH 3OWEA 5LGHH 1QBMH 4NOFA 2VE6B 4JB9L 1NBZA 2YD4A 3LIZH 4OD1H 2FATL 3GSNL 4Y4HB 3U7WL 1IM9D 3DVFA 4XP4L 4TSCH 2EDLA 4QRTB 3E3QE 1HKLH 3MRDB 1KN2H 3RJQB 4UT9L 1ZHBB 1D5MA 1XGRB 5I1IL 1RZJL 2OMNA 1S7SA 4PPTA 2EDKA 4R90L 3QI9B 3WLBB 4QY8B 3PWUB 2BVOB 3STZA 3V0VB 4XP6L 3MUHL 2DOCA 5IMKB 3D39A 3MNZB 3RGVA 3FFDB 4JDVB 4P2QD 3RVUD 4N0CC 2WIIA 3MLTA 3QSKB 4P23D 4M7JL 4DK6A 3L3HB 4IMLB 1AC6A 2FB4H 4ZFGL 4MWFB 4CN4A 4UIKH 3EFFB 1NKRA 3CFJA 4PJDB 5D7SL 3CZFB 2DQTL 4LEXH 3VXRD 3O0RL 1UVQA 4Y5VC 4MZ2A 2BSSB 1G7IB 1CFSA 4MNQE 5ILTH 2YD7A 1FZMA 5E4EB 4F57L 3DMMC 1IZKA 4MJ4A 1NMBH 3ZHDA 5LWYL 1XF2B 4HUXB 3I9GH 43CAA 5EBWA 3QQ9C 4LFHD 3SE4A 4XP9H 1F4HA 1YUHA 5H8DA 4YHLL 1B9ZA 1D5IL 4YGVB 4BK5A 2DQGL 2IAMC 3T4AB 4IRSA 4F7EA 5KSVB 5TE7H 3MROB 4HH9A 3RDTC 3LCYA 4Y4FD 5EPMB 3HLAA 1R3IL 2CLRB 3KPTA 3SGJC 3O3UN 5ADPH 3QEQD 3QXAA 1S9KC 3BX7C 1KV3A 1QBML 1OCWL 2BY0A 5ESQA 2R1YB 5JZ7D 3HCVA 4LSUL 2Y5TA 5A40E 1XF5B 1LO3H 4PREA 3OXSA 4YHIB 1NMCB 4P59L 4ODTL 1CDYA 3FO9A 3C60A 3PWJA 4ZODA 1RJCA 2GJJA 3DUUA 4NJAL 1KTLA 4LCWD 1H0DB 4UB0H 4WV1A 2W59A 1YEDA 4PP1C 3D48R 4JRXA 1T4KB 1U3HC 1B6DA 1F6AB 3AAZA 2ZKHL 4QHMA 3FCTB 4GW1A 1YMMD 5ACZA 4NWUL 4DKEH 3AS1A 2NY1B 4PJEA 3QQ3A 5E03A 5IVOA 2D2OA 4HS3B 1YEKL 2CDFB 1MRCH 4MNQB 4WU5A 1GCFA 2MKWA 5E7BA 4XP1H 5JQ6H 4JZOA 3QJHA 3BP4A 2XKUA 3WUWB 1HCVA 2XQBH 3S37X 5D9SA 5HI5D 4IBLT 5MERA 4GJTB 3QPQC 5BQ7B 3WSQH 3CAFA 3QDJE 1HIML 4P3DA 4HXAL 1OP5H 2GFBB 3CX5J 1AJ7H 5A2IH 1FH5H 5JNYB 1U36A 2D0GA 3HPJA 3UYPA 3ZHKA 3RWHB 1Q0XL 5JW5B 5J1AA 1ZA3B 2IBBA 2G75A 5BXFA 5IEKA 1J8HE 1JNLL 4HD9A 2PYED 3Q5TA 2HAZA 3JWNC 3U4EB 4XAKD 4GBXA 1JHLH 5KVEH 2OI9C 1U8OB 3GMRB 4BA8A 1O0VA 5DMIH 5DUBA 1GVIA 4ODUA 3PV6B 3TPUB 1U42A 2CH8A 5F72S 5T5FL 5LKNA 1KIQB 1FNAA 4F7CA 4RFEB 1JF6A 1ZA6A 2IBGA 3HI1B 3LN4B 2CDEA 4XNZB 5EU4B 3RUGF 1UACH 1JHKH 4QNPF 4PTUB 4NWUH 1DANT 4HPYL 3RNQA 5ICXB 3TBWA 2CIIA 4LARL 4GXVH 3VFMA 3AVEA 1WC7B 4UNVA 4OD2B 3QUKA 2H3NA 5D1QC 3GIVB 2M26A 3U4BH 3V0AC 4ZD3L 3ARFD 3LMJH 5CMAA 4G3YH 1DLFL 1BOYA 3MOAH 4PJGF 1QSFB 3GHEH 1D5XB 4N1HB 1NGPL 1T1XA 3IDNB 1R24B 5IW6B 3CH1A 1RZFH 3KPSE 3OKEB 4PGEA 1U3YA 4AEIH 3C2AL 2PCPB 1LO3L 1T2JA 4I5BA 3LKPA 4YHYB 1FFNA 2YPKA 1A14H 4IDJL 1L0YA 5HDQH 4LSDA 4N0CD 2PYEB 5AAMA 4DGIL 3OAUL 1RURH 5IG7A 2D4DA 3ALXA 4N5ED 3ZT5A 4FQCL 4UT6H 3RWJB 3L3JA 2EE9A 3NCBB 4P5TD 4I4WB 2HJKA 1TCRA 5J9PB 1L6XA 2CMRL 5C0CB 1M1SA 2IEPA 2AQ3A 3OAZK 1UENA 4P5KA 4GFTB 3SCMA 4QOKA 1FJ1A 5E0QA 4LLQA 4KTDL 4TSBH 2AJZA 2XN9A 3C6LD 4P4RA 3S4SB 4G8GB 3LPWA 3GI9L 4HUVB 2NY2D 4CVZB 4OZFA 5EUOB 2V2XB 1T5WB 5L8LB 5F1NB 3QULA 4CNIA 5K9JL 3VFSB 3OR7A 5HHXH 1LE9B 2AXFB 4MAYA 5I1EH 5BJTB 2IPTH 2C1PB 3KGRA 2XA8L 3MV9D 4UTBL 1IQWH 2VDOH 3SJVE 2DL9A 1QHPA 2VMFA 3HC0A 5KOMC 2CDEB 5DD0H 4U6XA 3ROLB 3ARGB 3CSGA 2Q8AH 1CLOH 3SJVB 4RAVB 5I75C 5HI4C 4M7KL 1CD9B 1KJVA 4ORGA 1QR1A 4MYWB 4TRPL 1OLZA 3S5LB 5J1SC 2FJGA 1E4XI 3ZHLA 4JEGB 1F5WA 3C60C 4HLZG 3I50L 4YNYB 1E4JA 4OIBA 2CUHA 1P1ZA 1I9JL 2WQ8A 4HIHB 4GOSA 5LGHL 5ALBL 1DDHA 3G6AA 1MWAH 4XBEL 4XRCA 3SGJA 5EO1A 3DMMA 4LVHC 4Z7OE 3IFNH 4HG4J 5CZKA 3UJIL 2F58H 3RFZC 4KZEL 1PKQB 4LDLB 1VGKB 5DFVC 4YHOL 4NHUB 1H3XA 2Q1EA 4Q0XH 3FQUA 2WWKO 4G9FD 1KCSL 4OFIA 5L7XH 2VN7A 1J1XH 4MXWH 2DQEH 4HX1B 4L1HA 5EZLB 4IDJH 3LS5L 5J1TC 1T22B 4W70A 4X7FC 1NCTA 1OAUL 4JRXE 5DYOB 3AU1B 1XGQA 2JB5L 4G9DB 4M6OH 4CADA 4PY7A 4I77H 4Y2DB 5HPOA 1V7MH 5HY9B 3BPNB 1Z9LA 2D03L 4EUPG 1PAMA 1S78D 4MB5A 4A2MA 5BS0B 1U8NA 3KLSA 4MA7L 1P7QB 4RZCA 1F6LL 2F9BT 4DW2H 4OF3A 3IFPB 3T0BA 3SCMC 3QUYA 5JPNB 3ZE1E 1WWWX 3U6RA 2P46B 1V8HA 5IHZA 4MGXA 5DD1H 5E00B 5FM5O 1KEGL 1BMGA 3G6JB 3Q6GH 2I5YL 1FAIH 1A7QL 2C3GA 3ZE2F 2B1HL 4DZBA 4LSRH 2ARWA 3H9SD 2R8SL 2E8YA 3A6CL 2DMKA 3FQRA 4LPYA 4OZGB 4Y8AA 3GNMH 4HXBH 3QUZB 1P2CB 3EFDH 5M7QA 3AGVA 2VXUH 1BFTA 1F11B 2DQTH 4LEXL 5E8EA 1T66C 3L3KB 1TQCC 2F53D 4UU9B 1A6WH 3IDYB 4J3VA 3TV3L 3ZZ1A 2DQFB 4YNYA 4XCFH 2P45B 5IWLA 3LOWA 3H6JA 3HNVL 5GGSA 2VZUA 4K7PL 5EU7C 3O6KL 1MREL 4U1KB 3VWKC 4JFQB 4PJIE 2RCSH 1BQLL 2YPVH 3BMWA 5D6DA 3HMXL 5HDLA 3R06B 4OV6F 4PTUA 5I17B 1QPPA 1UM4L 2RR3A 4PJXF 4YBLB 1AGDB 1CQKA 1EO8L 3QFJE 5KVDL 2WZPD 4EI5C 4YUEH 3B2UC 4ACPA 2E7LA 3WNKA 2XT1B 3MV7D 5CEYB 2H32B 4RISL 1GRWA 3C09C 1RMFL 1M7DB 4W6WB 1MFAL 3B3IA 4L9LC 1I3RA 2UZXB 3I84A 3WE6A 2AJYH 3QFDA 2R1WB 2A6IB 2BSRA 3KPNA 2ZUWA 5FYJL 4RMTA 4TQEH 3MQIA 1OT1A 1DVFC 5ANME 3GNML 4HXBL 3BD4A 2G75B 4YZFF 5BXFB 2CKBB 3EYFB 4AQOA 4J4PC 1A7PL 4HWZA 1T1WA 1GHFH 1WFNA 1KTDA 1JPST 3WEXA 4XNXH 4Q9RL 3SE9H 2QQKL 2OTUA 1FL6A 3K4DA 2HA1A 1MCNA 3S8WA 5MI0B 2F58L 3C8HA 1I75A 3JV5A 5EO9A 5FKPB 1CN4A 3AS0A 3GGWA 5E8PB 3BD3A 2QSQA 3QEGH 3NCCB 3QJHB 3LS4H 5F9WB 1R3JB 1RZKH 4EN3A 4AENA 35C8L 4DFIA 3MRJA 4FZ8H 3LKRB 4A6YH 4X6BA 3MV7E 3QRGL 3VFTA 3RU8L 1UYWL 2FHBA 5EC2B 5EBMA 3SDXA 2PO6C 5JUEH 5C09D 5GS2H 1A6ZB 1F3DJ 2I9TA 5J11C 5HYSG 4PJ9C 1CU4H 5IVXA 3TP4A 1NH6A 2WM0A 4CRPA 2OYPA 1N59A 5C9KA 3QIWB 4KMQA 2K3TA 3V6ZB 4D2NA 1T20B 4UTAH 1TITA 3VXNA 1Z6JT 4NQTA 2OP4H 5AWNH 4NJ9H 2C3WA 3FHAA 4GLRI 3BIKB 4ZG1A 2VXSL 3ALWA 3KJ4B 4WO4C 3SKJL 3VXSB 2NY0D 1YNTA 3S88H 1DVFA 4WI9A 4K55A 3ARZA 3KJ4C 4RX4A 2IANE 5D7KE 5F7YC 5FYKL 4P5TB 5BOZG 4FQIL 3SGDI 1JZ2A 1PLGH 1YECH 4R2GC 1AIFB 3RZCD 3FMGH 3R8BB 1Q9KA 2Z91A 4LCCC 3ISWA 1CDCA 1BFVH 1FNSH 2JJSC 1A7BA 4JQIL 3FT2B 4Y16C 5JTWA 5TGBB 4H5SA 2AK4B 3SJVD 3VWJC 2CQVA 1FLRL 1DQMH 2DDQH 1SMOA 4TVPE 5K9QG 5DMGD 4YWGH 2CDGB 2VDOL 4X9IA 4IOIA 3OJDB 2GTWA 2P5WE 3QDJD 4JVUA 5D9SB 5CIPA 5GJSL 3ECBA 5TQ2L 2EICA 4LCIL 3QDGD 1DVFB 5F1OB 3MRRA 1FPTL 5LAXB 4WHCA 15C8L 1QQDA 2RBLA 3NTCH 4HKJB 5ITBL 1KN2L 1P4IL 2NYYD 3ORJA 4RA0C 1D3CA 2Z93B 1BQSA 5J06A 1CFSB 5HI3C 5AWNL 5IQ7H 3QEQA 5MEQA 4YGAB 2AKRA 4S1RH 5AZ2H 3TBVA 3K2UL 1PG7L 5LBSH 4GRMA 3BSZH 4MCYB 5SX5H 4WNQB 1IEBA 5DC9B 5T5NF 2CXKA 1B4JH 4PJCF 1NGQH 5EOQH 4LIQL 3AXLA 4WO4A 4LLUB 4YDLC 3X13B 3BZEB 2SEBA 3STLA 3ARTA 3CXDL 5HDQL 5HYJD 1A9BB 5HHQA 1OPGL 4ZPVA 1EA9C 3CLFL 2JCCA 3VGFA 4QCIB 5DT1H 3C2AH 1S7SB 1JHTA 1NFDA 2BVQA 3L95B 1UJ3B 1F8TL 3UPCA 3U0WL 5J12B 5KVEL 5GGRB 3LZFH 1ZEAH 2R69H 5KAQG 3HLAB 4R0LC 1MCFA 3DVGB 4NWTH 4KK5C 5E6YA 3SE9L 2X4RA 1CDGA 2DQJH 4X9BA 1CK0L 1CG9A 5EORH 5F1KC 3LMJL 3FO1A 4N0FA 2A0LC 1XCQA 1NUNB 3O2VH 3HFML 2BMKB 5I0DA 5JXAH 1FL5B 1NGZA 4JO1L 3MRQB 4QYOA 3AXLB 4WO4B 1EUUA 5EU3A 5D2LB 2NY1C 5I8KH 4KPHH 3T0XA 4JCMA 2BHZA 3MV9E 2R29H 1DBML 5JW3H 1JPSL 1LD9B 4L4VA 4WTZG 4KGLA 2X70B 4YLQT 4C56E 3BJLA 5EA0H 3OKDA 4F15B 2ICWA 1XH3A 4KJQC 5C08A 1X5KA 2KPNA 1VEOA 1P4LA 5EU5A 1TDQA 4XC1H 5B39A 2QSTA 5KSBA 4OGXH 3QIUD 1A9EA 1UQSB 1A64A 3FFCA 3MRRB 1DBMH 3G5XA 3VXRE 1L0XA 3O11B 5DMKA 1ZHKA 3KJ6L 4OUOA 4IOFC 5DUPL 3B9AA 4JG1H 3SDDB 3TCXA 5KVMC 2A74B 3RHWF 1DQJB 1CDJA 4NNXB 3LQMA 4UT7L 3MV11 5IBLC 3GI8L 4HF5L 2I9LA 3D25B 2W9DH 1I7TA 1TJIL 3P11L 4BFGA 3PDOB 4OZHA 1S9WB 3MV01 5E94B 4NUJB 5HD8D 4GG6A 2ENYA 4ZUUA 1RULL 1AE6L 4G6JH 4ZAKB 1IE5A 3CLFH 4AT6B 5JXEC 4MCZA 3QWQB 1IGFH 5KZCB 3RVVD 3QXVA 1E6JH 1A6UH 4P57A 4ODWA 3D3VE 4X98A 4TTDC 5F1IA 1PX4A 4AEEA 3RNKB 2HWZH 2Y1VA 5K9KB 3BQUB 4YQXL 2W65A 4PJXB 1GOFA 1IAKA 2FSEA 3VMNA 1LP9F 2JJWA 4PJXE 3G5ZA 2MSPA 3EOYG 1KJ2L 3O6MH 1IKNA 2F8OA 2CLVB 3QEHA 2ESVB 4PRIE 4OLYL 4Y16A 5JHDE 5DEFB 4PY7B 3BZFB 4D3CH 5ICZB 4HWBH 3RRQA 1QBBA 5HYJA 2EO1A 4OIAA 2Q86B 3RY6C 3L7FB 3P9MB 3GK8L 3HZMA 4HGMA 2QSCH 2GSIA 2VRAA 3PDDA 2DS4A 3MXVL 3K1DA 5AUMA 3F7VB 5IGXH 3AM8C 2FBJL 1H3PH 4OCYH 3ZYOA 4YHOH 2R4SH 2R23A 3DX9B 4PGCA 2FBOJ 2R0KH 5TE4L 2H6PA 5E6ID 3ZKMD 1EZVX 3P30L 4UDTA 5FA3A 2VLJA 5IIEB 4I18A 1C08B 4RNRA 1NBQA 3VXUD 3H2WA 4DUXA 1WK0A 3KPNB 3IT8D 1H3VA 2HRPL 5E9DD 1YNKH 3WE6B 4X99B 2NY4C 4I3RH 4XB8A 1OTTC 5I8EA 2F8XC 3Q1SH 3ARXA 3M1BA 1DP0A 1CBVL 5KN5A 4K7FB 32C2A 5DHVA 1T0PB 5C0RH 5A2LH 3U0PB 3TN0C 3LH2H 4KUZH 3O9WB 2B2XH 1KELH 2IH3A 1GGUA 3IFLH 1S7VB 1A7NL 1I9RH 1K2DB 1S7UB 1SHMA 2QV2A 2XXMB 4LHJB 4JQVA 1TQBB 3VI4F 2W0KA 3DWTA 5C0DA 4MA1B 2D9QB 1E4KC 3TCLB 3WO3B 2A6KA 5J13B 1OAZL 3CFEA 3HUJA 3LKOA 3HKFA 2HFEA 4LQ1A 2UVEA 3S9DB 4LKXB 1V3MA 1CK0H 5EORL 3WJJA 4O4YH 1YC8A 3H7BA 4NN7C 4N0UE 3KS0J 4I0CC 2HJFA 2FJFA 5M94B 4X6EA 3HI6L 5HDBF 4WWKD 1ZWIA 4D94A 1JGDA 3WIFB 1VHPA 1A5FH 4MNGE 4H25B 4QRRE 4WFGD 5DI8B 2C3HA 2ENSA 3P0GB 3RWJA 5D1QB 4UT6L 2XPGB 4NQXB 3UX9B 2FIKB 1MHCB 3BKML 1BPVA 3GRWH 4ODVL 2E7LC 2D7MA 4U1IB 1OD7A 1FFOB 1E0OB 1X6NA 4QHUA 4TUJA 1KIPB 1EFXB 1MAMH 2D7PA 5GGTA 1RZFL 4WI6A 4DUWA 4M6ML 4YAQB 3TVMC 4YQXH 1KBGH 3CSPA 5C6WH 5CD3B 1QYGH 4YPGA 4HMCA 4K94C 5EDXA 1INQA 1CF8L 3EIFA 1A4JA 1RQ5A 4NQEB 3F6LA 2NXZD 3H9SA 3ARRA 2CK0L 3K80A 4X5WA 3FZUC 3GMLA 4F58H 5I15H 3PNWB 1Q94B 5C8JB 4JFEA 2P5EB 3CFKA 4HS8H 4YUEL 2YWYA 4LRIA 4MD0B 3TF7C 5HYSA 4YK4B 5I19L 1XGUB 3X12A 1U8JA 4TQEL 5BS0E 2V7NA 1LP9B 4L29B 2Q20A 1BLNA 5I9QC 2CRZA 2VXVL 5CILL 1CGWA 3PGDA 1X3DA 4J3TA 2XWTA 1FBIH 4JO4L 4MJIE 4MA3B 4Z78A 5C0GA 3VFGH 3LEXA 1OAYH 5IJKA 4Y4FC 3NFPA 1T21A 5ELIA 3SKUD 5CCKH 5EIIB 5CBEB 4U05A 5T3ZE 3GMRA 3QHZH 1YNKL 1TENA 2PW1B 4HGWB 3QUXB 2F5BL 3NN8B 3TGXA 3B9KB 4DKEL 5E9DE 1IRAY 1BM3H 5DTFA 1Q1JH 1C1EH 2G60H 4S2SA 4OZHF 5D7LD 1XF1A 3A6CH 4EVNB 1RU9H 2ITCB 3RX8A 2IPUK 5HHNA 4BZ2L 5I1LA 2DIAA 1FZOB 4IRJD 1CL7L 4JFDB 4XVJH 4Y5VA 3IS0X 1P84K 1EGJA 1FC1A 1L7IH 3GSRB 2MHAA 3FHQA 2FZ3B 1PG7W 3TVMA 2R69L 3BE1H 5LXGH 3KYMA 4JREC 3LDBC 3M8OH 4Q74A 2XXCB 4TPRL 1JIBA 4ETQB 1S7WB 1NMAL 1ACZA 1VFBB 3RX7A 2R8SH 4JKPH 2FX9H 1KLUB 1J0ZA 2LVCA 1ITBB 1KEGH 5C0IB 3T2PA 1DR9A 1IKFL 4PBWD 4NQDB 2QEJA 4O00A 2J8HA 1FJ1B 5FGBA 4WHTA 2NXYC 4UOW1 4BSVA 5FV1L 2VLKE 1ZVYA 2A73B 2Y6SD 2E3VA 2I26N 3HAEG 3BP5B 4OQTA 3JTTB 4BSWB 3KLHC 3I9GL 1JF5A 1ACYH 4OJFL 5HHPB 4M3JA 1INDH 4LNRB 4Y88A 5CP7B 4WCYH 2YA1A 4PY8I 4HK0B 1A1MA 2P48B 3BRFA 1Z2KA 4HW6A 4Q2ZB 2P5ED 1I8KB 3K4ZA 3VH8B 1XIWD 4JZJB 2HG5B 3L3OA 4MQTB 1FYTD 2IC2A 2EIZA 2AI0L 4JHBA 3X11B 1DLHB 1LK2B 4GW4A 1HHKB 3ZKXB 4ZFZA 1FGVH 2X4QB 4M8QB 4RAUA 4C57C 4JLRA 1GZPB 1T5XB 5IR1A 4G42B 4KRMB 3QIWC 4LKCA 1HHIA 1ZVSA 1SY6L 3KG5A 3ZKND 3VXMB 2CLZB 3T0WA 4D9QE 1DQLL 3ARWA 4L3CB 2B8OT 1A6PA 1HHGB 4GQ9H 5C0BB 2NZIA 3TWCH 1S9XA 5LG1A 3M07A 4ELKA 1ZLSH 1JFQL 4FQJH 5EBWB 2A77L 2V5TA 2YPVL 3C5ZD 1N8ZB 5AG8A 4UV4H 4Q6YA 3QHZL 2ED8A 5HGHA 3KPMB 4FHBD 4YBQC 4NN5C 3QEUB 4PLOB 1BVLA 4KH2A 1GIGL 2WQRA 1ADQA 2E7BA 4HCRA 4K8RL 4CGTA 5E2UL 3BO8A 1IGJA 3W2DL 1XT5A 3MLWL 3FQXA 2X7LB 4Z95H 5CGYC 1DQQA 3ARPA 3VJ6B 3U36A 4MSWA 5FB8A 3JWOL 1NC2A 3EZJB 3L3HA 3TJHC 4JHWH 5CJXA 1QFWI 4HIJA 2C9AA 2I25N 4JDVA 1V3JA 5FO9A 2V2WA 2J6EH 2AEPL 4NCC1 4KJPD 4Y5YC 2D7QA 3EOTH 1F2QA 3O2VL 2NW3A 4L9LB 1OP5K 2ZUQC 3OMZA 2FYYB 2AEIT 1OLLA 5CEZH 1HSBB 1NGWA 2VDMH 4FQHB 4NWTL 4OCWH 5EFIA 3W11D 2I60L 5BMFH 5GPRA 5J6HB 2RQ8A 1MJ7H 4NDMB 4KTEL 4U3HA 3IVKB 1UJTA 5DO2D 4N9OB 1F42A 3B8YA 2ZSVA 4KVCL 3SDDD 1BF2A 3MOAL 5C0EA 4HK3J 4N8VA 4L3EA 2IBZX 1LNUA 3OKOB 3VFVA 2A6JB 4F8TA 3DGGB 4JZNB 4WFED 5EU6D 4QTHA 5FUZH 2AEWA 5HPMB 3K81A 4LARH 2B39A 1BJ1J 2B0SL 3UJTL 5D72H 5MENA 1AE6H 4PJ7B 4RFOH 1H3UA 2C1OB 4X4YB 5CKAA 3RBSA 4WW2F 5I66A 1MJUH 1G9EA 3F65A 8FABB 2AS5M 3VRLF 5ANMB 5DGQA 4XWOC 4R9HA 2ICES 3U9UA 2HTKD 2XYCA 4HC1H 2VR9A 4OM1L 4ZUSB 3NAAH 3S96A 1BBJA 2VR5A 4WW2C 4PGDB 1PKQE 2I07A 1AGFB 5CJ5A 2YD1A 1YQ2A 3P30H 4GUPB 5T1LB 3QDGE 1FIGH 5FOBA 3T77A 4Q9QL 1VPOH 1CGYA 2FJHB 1YYLH 5EZOH 1EDQA 1TNNA 5A16A 1GC1L 3PGCB 4QXGH 3S98A 2O5XH 5L2JB 5F7KC 4HZAA 3RL2B 1MCKA 2XWJA 4Z7VA 4PJBB 3EJYD 1FVDB 4RISH 2MPAL 4J3XA 3DYOA 2K7QA 1HSAB 3TA3D 3MGTB 4XWOD 3UBXI 4TNWF 4WFEE 1Q9OB 5M95B 3VDBA 3QUMH 5D70L 5CJOL 3WV0A 1JWMB 4JO1H 3NFSH 2AV1B 3TM6A 1UCBH 5F97E 1RUKH 3GBMH 3LQAL 4MQ7A 4BKLB 1WWAX 4P23C 5IEHA 1X4XA 2VAAA 1S5IH 4Z7OF 4WIQA 1NUGA 3ME0A 3VXUA 2BJML 4RMQA 4UQ3A 2E7CA 4HIEB 4PJDA 3TBYB 4WWKB 3VWJD 1VGEL 3ULVL 4K3EH 4W4OC 3B2VH 3QJFB 4GQPH 4Y5XA 4HWBL 2CJUL 4LSSH 1Z9SA 3HZVB 2A38A 5D7LB 1E6JL 5IFAL 4X6BB 1LEKB 2FH6A 2MNUA 4H1LB 1UB5A 2V6HA 4MJID 2B5IB 1JWSB 4O5LL 2QHLA 1OP3K 2VISB 1UWGL 1MJJA 3KVQA 3EDEA 2XTJB 1A6TB 4M6NL 4R4FL 4X6DB 3VFWA 3T0EE 4CVXB 4OZ4A 5ETUA 5EH1A 2BZDA 3VXTB 1WIPA 4CN6A 3K2UH 4YHYC 1CTNA 3M17B 5I2IB 3MCG1 1Y18A 4NYLB 1R3HA 3C9NB 3MRDA 4R7DB 3I02A 1FE8L 5FYLL 4FFZL 4HJJL 3DOSA 4TTGA 1YEGH 3NA9L 4NKDA 3QNZB 4C83A 2QTEA 5MHSE 1CD8A 2PXYD 1F58L 1FYTA 4ZYKA 3BH8B 12E8L 3ARED 4GMTH 4POZD 3DRTB 2LTQB 3GKWL 4YC2C 5F9OH 1BX2B 1DUYB 1YN6B 1OQOA 3N85L 3C6SB 5ALBH 4HGKC 1E4XL 5GSVB 1GGCH 1Q9WB 1Y6NR 4WUUB 4JFDE 1U6AL 1R3KB 3QHFL 2WUBH 3BE1L 3GMOA 1U3JA 2JF1A 4RBPK 2Y72A 5JPMA 4M61B 3MJ7B 1OW0A 2PTUA 3O2WL 4J1UB 3OZ9H 3MV8B 3F62A 1FBIL 5B38G 2R0ZH 3HE6B 4LCCA 1P53A 1RUPL 1I1AB 4L5FL 1RZ8B 3K0WA 5GQBA 3OV6A 4JG1L 4YHML 1IAMA 3IDGB 5FECA 2PXYC 1S7XA 5EOCH 5F3HB 5DRXA 5C0ND 3DX8B 1T6WA 1T83C 3GRWA 4W4NA 1XGTA 4R97B 3V4PH 5JORA 3HZYA 2V17H 3DI3B 5IFJB 2X4TA 3L9RB 1I4FA 4OKDA 1AQDB 4CW1A 2Z4QB 5B4MD 2IH1B 3KPQA 3HAEA 4H20H 3VGDA 2JK5B 3DV4B 5CJXC 4QXUL 1JK8B 3VXPB 2APFA 4P2RE 3ARFB 2OZ4L 1UM6L 4HUUA 4M6MH 2X4OA 4XCYB 4XBPB 5DQ9B 2W1NA 3JUYA 3W5MA 4V1DA 4ODXB 2X1OA 9CGTA 3OKNA 4UINL 2C7UB 4MMXC 1NDMB 4MJ5B 1NFDF 4XH2A 3RWIB 2VTFA 3IKCB 4MXVF 4UMGA 3HC4H 3CLEH 3LHPH 3G08A 4OD3L 3VFVB 5K93A 4EN3B 2ICEA 5EIVA 4HFUL 3HS0B 1KPUB 1U8MA 4Z0BL 1XF3B 4OZFH 3BP6B 1XGPB 4PGJA 4M48L 2NXZC 1IL1B 1ONQB 2D4FA 4C4KT 3GZKA 3KPRD 5IMOB 3L5HA 5IFHH 2LU3A 3QFJA 3TO2A 2QQKH 2VLKA 3MLZL 2HVJA 3O45B 5D93C 2AABL 2XFXB 3EO9H 4D0CB 5ID0A 1ED3B 1NDGB 5E2TL 1T03H 4MNQD 3WDHA 5CP3A 2Z8WC 2B4CL 2ESVD 4FQ2L 4Y4HC 3QQ4A 4AL8H 5D4QA 5DHYA 3L5WA 4DAGH 4LLWA 1ZLVH 3AU1A 3INUL 1FO0L 3TIDA 3BVNA 3GMQB 2WWKT 3OTTA 3WCYA 4Q6IA 3LSOB 2ED7A 2X4SB 5CZXC 5F9WC 1T1YA 4LLYA 1T03L 5E2UH 1J9CT 4WU7B 1DLFH 5FF6B 3RGHA 5GRVL 5IVZB 1L7TH 1SJHB 1D6EA 3PHOA 3TZVB 3GEWB 3QUMB 1C16A 3KPMA 1MSPA 1U8PB 1RZGA 2RGSA 3U46A 3MRIA 3K8LA 5J11B 2ZOLB 3E0GA 1E28A 3QWRD 1Q8MA 4ONGH 4HFUH 4PJ9A 3V6OE 2XI9A 2HFGH 4M1DH 4M1GL 1MVFA 4MB3A 2IWGA 4OCNC 2ADGB 2VSCA 4N0YH 3SDYH 3D3VD 2Z31B 2UWEA 1W2KT 4X7SH 3WYRA 2JJTC 1X5XA 2F53E 1F4WL 3GJFB 5CEXB 3A67H 3E6HB 5E4EC 5HYQA 2DYPB 2YPLA 3JVGA 4Y8DC 4YDJA 4KV5F 1QSEA 2KBGA 4K23L 1EIBA 5DFVD 3AUVA 2EDDA 3B9EA 1A1MB 3PE9A 4N8VG 3CDYA 4NKOB 1QFWL 3GSQB 3MBXH 4WI5A 1ORSA 5JXAL 4NC0B 4M62L 5B22A 1HCFX 3RWGB 1JWUB 4H1LG 2BDNL 5CBAB 4Y1AE 3GDBA 4RFNC 1CFBA 3RDTB 2AJSH 4OGAC 3D2UA 5EBLA 1WV7T 5DUMH 5HHOE 2BXZA 4PTTB 1FVEA 5CWSA 2QKIB 1AR1C 1KIUA 5F3BB 3ZDZF 2VN4A 2LV4A 5KSAD 4APQB 1AGCA 1BVZA 1N4XL 4E9LA 1MJ8L 2Y5EA 4OF8A 5SWSE 4XXCC 3CXDH 3D85B 5TQ0H 1S5HB 4JJHA 4O58L 4KV5E 4M1CD 3MRHB 2HFFA 3N9GL 3O6ML 5HBBA 35C8H 2X4NB 2ZJSH 4YXHH 4NRYB 1WZKA 3RIAF 4I5BB 1MHPL 3BKCL 5BRZA 4PJ5D 4WUUE 3L3DB 4Z7UB 3VFRB 4K3EL 3BJ91 5GGUA 5C0CD 4NP4L 5C86A 1U3HA 1UEYA 3SKOA 1DUZA 5BO1L 3G5VB 3UTTD 4WWID 4N1EA 3FQUB 4IM8A 5HHVH 2ILLA 1MLCB 2Z31A 4NHUA 3BUYB 1EAPA 4NO5B 5KAQF 1VGKA 2YBRA 4BZ2H 5GHWL 4AM0A 3RVTD 3HE7C 1G7PB 1P6AB 3V5DB 3CFBA 5J8OA 1EO5A 4ZXBA 1Q1JL 3FB7B 3QB7C 4HHAB 2E7MA 3JSSA 1SQ2N 2XG4A 3I6GA 4NSKB 1N6QH 3IXAB 5H35A 2VZ1A 4HIIA 4GMSL 4XNMB 3PGFH 5CIPH 2WIMA 4PJ7F 4NQCA 2IH1A 3KPQB 3QUYD 1RFDH 2X9XA 4JY6A 1UZ8B 1NANH 1X5YA 4QXGL 3BW9A 1FNFA 3PV6A 3B2VL 3TPUA 1P69B 5AG9A 4POZC 5D8JH 3DX6B 1ZLWK 2OL3A 1J8KA 1FL3A 4WENB 3ROOA 3QP3A 2FB4L 3GM8A 1NAKL 2MFNA 2HVKA 5HGBB 1BP3B 4YEFA 3MRPA 5D2NE 5IB1A 2R2HA 1RJLB 2Q7NA 4XAKE 4EI5B 1RZ7H 4Y2DD 4ZSOB 2BOCB 2VXSH 5C8JA 5JLZB 5C08D 2YXMA 2WMPA 4IJ3C 5JO5A 1AR1D 3AB0B 3QXDA 4M61A 2BHYA 3Q6FA 3QAZC 1CR9L 1AJ7L 4Q58C 1N3NA 5E08L 1JN6A 3QUXC 3KXFA 2WBKA 4MVBD 4PUBH 3LZFL 4WUUA 2GTZA 1CL7I 1AGBB 2QR0B 1GOHA 4EZMA 2DICA 2FX7H 2JE8A 4KPHL 5EB9A 4NRZB 4O2EB 5I30L 4GSDL 1NSNH 4HPOL 2WAHA 1RUAL 2O5XL 3REVA 5GS1C 25C8L 5DJDB 1K8DA 1FFPA 4C55A 4U3XA 4BJLA 2BOBA 2RHEA 4RGND 2XZQL 5TH2B 2Q7YA 2VXVH 3QDMB 5T1KD 3T8XB 4V2BA 3RWFA 3ULUF 3EYUL 3BP7B 3L6FB 1NAMA 3OKEA 1QR4A 1NPUA 4WEUD 5JW4R 2R4RH 5ALCL 2K9UA 3B6SB 1WBYB 3WIIH 4ZS7H 3NPSC 1L0QA 3WS6A 4GW1B 3IKKA 1YMME 3QIUB 1T4KA 2CO6B 2HMIC 1NGXA 1MI5A 1DANU 1MNUL 3G04A 4P5MB 5T1MA 4QKXB 1URLA 3CFEB 4ODHL 1KB5A 2IGFL 3TT3L 4HULB 4LCWE 5BO1H 5ALCH 1X5HA 3DSFL 1HQ4B 3ES6B 5L88L 4X6CB 4L8CA 1DCLA 4OFKA 3KWWB 4WHYH 3KR3H 3MRMB 4JCLA 4KFZC 4ZO9A 1MCPL 2D0HA 4CL7A 2AXJA 2VDLL 2ZCHL 4M3KB 2ZUTA 3KPLA 3VGAC 1RJZB 2VABB 1CFQB 3HZKA 2H41A 3PWLB 2JCCE 3IDXH 2AXGB 2EDTA 2DKSA 2NNAA 4PV8B 5EC1A 5HI3D 4XPHH 5ESAB 4E41B 2XTLA 1TJGL 4PS4H 1JFQH 4FQJL 3CVHH 1K5NB 2X40A 5BMFL 1U93B 4U1HB 1HYSC 5GGRY 1C08A 2IQ9L 2YN5A 1VACB 2YPLE 1VDGA 1T1ZB 3ILPA 1MVUA 3JV4B 2R0KL 2CRMA 3BHBB 4Z5RA 3BEVB 2X4PA 3JWDH 4R8WL 4LRIC 3QDGB 2EEDA 1WZMA 4OCXH 5L2KE 2XOTA 3GUTB 4PFEA 4IMKA 3FFCE 4FRWA 2VC2H 4TSBL 4XP5L 2NY1D 1VFUA 2OXHA 4XVSL 4XTRD 1BFVL 1UC6A 1P4BH 5F93C 2CIKB 1VADA 4X80H 4ELMA 5K59F 1TZHB 3WFHB 5B38A 1KLGA 3MA9L 2GKIA 5I1DA 2DWDB 1B3JA 3FFDA 2P8PB 4KK5D 3SDDC 3D1MC 5IMKA 1RURL 3PWUA 3E8UL 4DEPB 2E9BA 3RHWK 1CIUA 5HVFB 3QIUA 1A1NA 1PBYA 4GKOA 4NFCA 1T3FB 3V6FB 3V5KA 4K3JL 2ZUYA 4JPWL 1F3JA 1F4YH 5DHXB 4FFWC 1TPXB 3QQNA 1IGYA 4X4XA 2HKHH 4ERSL 4X9FA 1NBYB 5E1HB 1JP5A 1FN4A 3JWOC 2M1KA 4U6VH 3PWVA 3CVIH 1H0DA 4K9EC 5GGQH 1JNNH 3H0TA 1NCBH 2BRRL 2CD0A 4IRSD 3PGFL 1EEUA 4JB9H 1DTUA 5IQ9B 1CTOA 3TJHD 3QQ9D 3ESUF 2OSLB 4DJMA 1JGLL 2NW2B 4D9LL 4OFPA 4XNYH 5I76A 3CX2A 5DQ9A 2IADB 5I1CL 1HXMB 4GG6B 1J1XL 3C8DA 1S9WA 3GMMB 4FNLL 1NC4D 1A7OH 1QO3B 3NCYP 3H9SE 1CDUA 3VXSE 2RB8A 4B41A 1OF2A 4NQSA 2I27N 2VNCA 5JDSB 3F58L 3RVUC 5FOBB 1J5OH 2OK0L 1INEH 4H0GA 4J4PD 5B38B 3IXTA 4KUCD 5FYJU 1K8IA 1ORQB 3VXSA 3D69B 1A3RL 1JTTA 2AGJL 3VFGL 5GS0C 4K3DH 3DO3A 4QEGA 3FQTA 3RWCA 5CD5D 3BDYL 3P9LA 4WEMB 4F7TA 3VRIB 4B7IA 5BRZE 1UKTA 3GBNL 1J18A 5IB4A 1A6WL 4NO0A 2VSDA 5E99H 5IESL 4F9PA 1MLBA 1T7XA 1W0VA 3E3QC 1WITA 3TO4B 1WAAE 1LDSA 4OBRA 3QA3A 4R8WH 4WI2A 3E2HC 4ZXBB 1W0WB 3CSBA 3MBXL 1Q0XH 3ZYIA 4Q9QH 1QHOA 4ZFZB 5CJOH 3QI9A 4WHDA 3SN6N 2IQAA 5KZCD 2DWEB 2R2EA 3WO4B 4JO2H 4DWHA 2YD2A 1JZ6A 3KDMB 2RFXB 5IESH 3GSOA 1QYGL 5F44A 3IFOB 2P8MB 1HE7A 1XGRA 1I8LC 1M7IA 2P4AB 5FYLE 3MYJB 5DJAA 4PJFA 4R3SB 2OTUB 4DOHB 3RVXD 5ACLA 1T04A 3QH3A 1R6VA 4N90E 3LAFA 1T66D 1PEZA 1KB5B 1UWEH 1MRFL 2ZCHH 4LSRL 3EBAA 4Y4KC 4BSWA 1JYWA 2O5ZH 4O2CB 1QSVA 3KYKL 5GRJL 1P7KB 4HBCH 2EH8L 3MLXL 1R0AL 4PRHB 4QRPA 4XPFL 3SO3B 3MV7B 4BUGA 2VDKH 4QRRA 3O6LL 4KK6D 1DEDA 3GHEL 1H5BB 3UTTA 1BVKA 3VI3F 3RBGA 4APQD 3NA9H 4BUHA 2Y07H 2HH0H 4DVRH 4PRID 3CVIL 1CE6B 4ZD3H 5KS9E 2BVYA 5EOCJ 5JIHA 4NGHL 3QZWG 5DVKA 1UB6B 3RWGA 5IW1B 1R5IB 3IU3A 3OB0K 2PO6B 4B7LA 2FLBT 4UZGA 5LQBL 1QBAA 1KPVB 2VQUA 4FFYH 1ZLVK 1NKOA 4LSPH 1XFPA 4JFYA 3SPVB 3FRUA 4WY7H 4U1KA 3VRIA 3OX8A 3A6BH 5FO8A 5JQHC 2HT4C 4PJBA 2BVPA 5IF0A 1EEQA 4R6UA 2HRPH 1UFUA 3CJJA 4HUKB 2LAGB 4PJ5B 1NLDH 1MH5B 4UIKL 4XVUC 4UDUB 2PKDA 1AD9B 3KNBA 2PTTB 4Y19E 1UA6L 4HWUA 1DBAL 1KIRB 1WISA 3BKJL 4FQLH 3LHPL 2WSKA 3BDBA 3U1SL 3FZUD 2PO6A 4JFZH 4XMKL 2VL5A 4CAGA 2HT4D 1IC4L 3C6LA 5ID1A 4L8BB 3QUZC 4I2XA 4UQ2A 8FABA 4JHWL 4XGZB 4ZQKA 2MKLC 2NPLX 2BK8A 1V7NL 4JFPB 4NJ9L 5L0QB 3SGKA 1BFOA 1R5VA 4J6RH 4OI8A 3CVHL 4Z95L 3MXVH 1NFDE 3WIHL 4F2MA 3CX5K 4OQTH 3TZVD 1VFAB 2CR6A 3S3SA 2EIDA 2AEQH 2ESVE 4PRIB 1M6OA 4MX7B 1NGYB 1RD6A 2PYFA 3STBA 4PB0L 4R96B 3MLRH 2R0LL 1YJDC 4QF1B 4Z7WB 1WJ3A 4NN6C 5KS9A 5B3JF 4O2CA 5HY9A 5I16B 2DLEA 4Y4KA 2VLRA 3LN5B 4OZIF 1VFBA 1ZLSL 4APQC 5DRNB 4G9DA 1CT8A 3T2OA 4KK6C 1YECL 4G8FA 3OQ3B 2ZSWB 3SDAC 2IG2L 1OTUC 1C5DA 4U1GB 2D7OA 3DGCR 2EE3A 5E9DB 2EEAA 4FXKA 2OQJA 2PYEE 4Z8FL 3NGBC 3VW3H 5DJZB 1PG7X 4JZNA 4ZO6A 1U92B 3OR6B 3P3YA 4M7ZC 5JOFB 2G2RA 3GSUB 3QCUL 5DRNA 4XH2B 3S36L 1X5GA 2NXYB 3L1OH 3MA7A 5GRUL 1X5ZA 2XN9E 4KHTL 3UTPE 4P2RD 5IOPA 3J8F7 4MSWB 2VH5L 3ZDXE 4K7PX 4JGMA 3N0PB 3BXNA 3FT3B 4G43A 2GITB 1JNNL 1JRHI 2V2TA 4EOWL 3U7YL 1G0XA 4BYHA 3PABB 2VQ1B 3IDIA 4APQA 2ZCLL 2LQRA 2Z31D 2VXTL 4OM0H 3DXAE 4OZHE 4KVCH 2YMXL 1MCBA 2YD9A 1VGEH 2P47B 1KIRA 3DX8A 2G5BB 2HT2D 2R39A 4CU6A 2YRPA 3F7YA 4XP9L 3GIZH 1O7SA 3VRJA 3IDGA 2WUCH 5FECB 4M62H 3HE7B 3C5ZA 3MGAA 3G5YB 3WDJA 5I1KH 3MJ9A 1LO2L 5E1AB 5GISL 3WL9A 1WCBB 1UCTA 2VLRE 3NZ8B 1KOAA 3QUML 3NCEB 4XVTL 1BM3L 5I30H 3O0RH 4G6JL 1PY9A 2NY3B 4GRLB 2Z9TA 3O3DB 4PBXA 4NM8L 3L3OB 2CKNA 1HN1A 1N0LA 1CFTB 2EE2A 3W2DH 2B1AL 5E95B 1SJEA 1OY3B 1X6LA 2FX8L 2HJKB 5JIPA 2CUIA 4IIQB 1EHAA 4UIMB 4TVPD 4ZUVB 3BD5A 2COQA 1GPOL 4PGBA 3RI5F 4ZTOL 2DRUA 1MHHB 1QEWB 4U6YA 3DYMA 5D1XB 1K85A 1I1CA 5DZOA 4MDIB 5IHZB 3U6RB 1OAXL 3WXWH 4AYFA 1L4IA 4K2UL 4IRJB 2FO4A 3MNVB 1NBVL 1QUNA 4P5TC 4PJIF 2EDBA 1UB6A 3N1GC 5E70A 4N1CA 3VWJB 4U1GC 1HKLL 4TTDD 3PABA 3VI4E 3U7YH 3ZTNH 3P4OA 4D0BB 1J10A 3NGBB 3QG7L 5IMMB 3LIZL 5DF0A 2W9EH 4Y1AA 4HT1H 1MCPH 5K9OB 3G5ZB 3QCVL 4JHAH 5GRXG 4PJAF 1U95B 1KCRL 1H15A 4XCCH 5I1AB 2AK4D 2DIJA 3EYQC 1HQRB 4NM4H 2P49B 2ZG3A 4Q97A 1QFPA 2ERJC 1VB9A 4PJEE 3AMLA 4GMTL 4XPAL 1G9NH 2ZKHH 3S3JA 1N64L 2ARJB 3J7HA 3P0VH 5IBLD 1YEFH 4GKNA 2BY1A 3WUZA 4FP8L 1EEZA 1W72H 1NC4A 4P0DA 5GZOD 2NR6D 4FNLH 1U3HD 1BGXH 5MENE 3LRSB 3KPOA 2O61A 1OAKL 3U0TB 3QZWB 4OGYL 3VRJB 4XRCB 5IVNA 5DT1L 5KW9L 1A6AA 1MIML 3DIFB 3GSXA 3BT2H 5I71B 4F3FA 2R23B 2PN5A 2MQ0A 1T7YA 4XMPH 4PB0H 4HEME 3OB0H 4E0RA 1YDPB 4QRQB 5J12C 1CXEA 2VITB 4GRWB 4PBVC 5CKGA 3RGVD 4DN3L 1A47A 3X17A 3PHQB 1IQWL 1JK8A 3VXPA 2H2SC 5CSZA 3WXVH 3WNPA 2A0LD 4S1SH 3C08L 1IKNC 1XR8A 1AQDA 5J7CC 1IAOB 4JE4B 5ISZE 2VXQL 3OHXA 1G7PA 4WU5B 2NY4B 2YZ1A 5CZXD 3W9EA 1MQ8A 1LK3L 1TXKA 5CLWA 4H0IA 1A4JB 4LLDA 3DTXB 5E9DA 1FYHB 3H3BC 3S7GA 4JAMA 3WS6C 2R0ZL 1XF3A 4MXQD 4AK1A 1JCKA 4NQVA 5DR5H 4Y4KD 4XPBH 4X98B 2WUBL 1YEHL 3T2NL 5F6HI 2X44D 4N90D 2DTMH 5DK0A 5DRWA 2WNGA 4G8IB 4NT6B 1CE6A 4RSVA 5DVMA 3ZDZE 2F54D 3GSVB 5FDWB 4PREB 4GBXC 1G7HB 2CKBH 5C9JB 4JPVL 4ALAH 2N7AA 4PS4L 4EIZC 3Q48A 4YXLL 3L95A 3V7MA 2J8UA 2ARJQ 1RK0A 5B39G 1NGPH 3DVNA 1E6OL 5I15L 1EVTC 4QCIA 1OTTD 3BN9D 4W6XB 3LPFA 1S7QA 3UTZB 2BSTB 5F7UA 5EO0A 4BH8B 1E4KA 2AI0H 3GB7A 4HAFA 3BAEL 4XPAH 1T6VN 4EI6B 5DC0A 1CFNB 4LPUA 5D1ZA 5J3HC 2BERA 3PQYE 3NIFF 4FZEL 2Z35B 3KPSA 5DMGC 1T0MB 4PJFB 3ZKNC 3R0NA 5ECJE 5BRZD 3P73A 3I6KB 4HIEA 2B4CH 1ROWA 5GS3A 2W9EL 4A2LA 1AKJD 2Q8BH 1AD0A 1EH9A 1ND0B 3UBXB 2P5WB 3U30B 1OGTA 4OI7A 3OKDB 1WEJL 2EDNA 3DV6A 2EDQA 5E2VH 5HYEA 1I8MA 4X6FA 5FHBL 2UV3A 4WJ5A 2AV7B 5EN2B 4MWFA 3BEVA 2ID5A 4JO2L 3HI5L 3X3GH 4XVJL 4U1NB 4OD3H 1ZVSB 4QT5A 1ODAA 1C7SA 2WINA 3O6LH 2IALB 3NIGE 3RWHA 1FYTE 4K7PH 3B5HA 4LOUD 3S36X 2DLGA 1I8MB 3HZKB 1I7RB 4R7DA 4JAMB 3H9ZA 1ND0A 3ARYA 4V1DE 1HIMH 5EN2A 1FG2A 2ITDA 5CEZD 2MJWA 3EO1A 2PO6D 1DFBL 1ORQA 1J0JA 3I3BA 2VDNH 1RIHL 5SWSB 5AAWA 1KNOA 1LDPH 3VFOB 1OTSD 4N5EC 2VZVA 5EULV 4JRYD 4J7RA 3VG9C 3U9UB 4HBQA 4XP1L 2WBJD 3Q1SL 5EZOL 2DQCH 1BBDL 1RVFH 5K9OA 4ZOBA 3IF1B 3CVHB 3QR2A 3EUUA 4HUWA 1GAFH 3D85A 2W0LA 5CP3H 2BSTA 5CINL 1ES0B 3LB6D 4GRMB 1BEYL 4EJ1C 3S35X 2W65B 1NAMB 3GB7B 3PL6C 1XGPA 1ZGLM 3KYAA 4WHTB 2P24A 4JN2A 3V6OA 1YN7A 5EA0L 3F12A 1WZLA 4PRNA 1HWGB 4LF3A 5T1KB 1BWMA 4M5YL 1H5BC 3QA3B 3U79A 4K8RD 2LVEA 2DD8H 2VH5H 3GK8H 5I19H 3OXSB 3SDAA 1T83A 3U0TA 1IQDA 2BNUA 2YEZA 3RA7L 1PQZB 1TNMA 3K7UA 3WFBL 5E24E 2NTFA 1YQVH 5DZNA 3V6BR 1J0KA 4RWHA 4J12A 4XMLH 4F7PA 3D25A 5CSBA 4JM4H 1E27B 5CZVH 3QCTL 4QRSB 4I48A 1RZIA 5D7JA 3HAEH 4K3JH 5DHVH 1VFOA 2C4XA 4YPJA 3WJLA 1B88A 4CVUA 4EBQL 2D3VA 1MCRA 3EO1B 3MOBH 3ROOB 4TSAL 3B8SA 5E6IB 2OL3B 1MFCH 4NBZB 4HGWA 1FV1A 5C0BE 3GUTA 2FHCA 1MCWM 3HNSL 2FDBP 3VFOA 1GOGA 1CGVA 5FIEA 1HXMA 5EG6C 1P4BL 1M05A 2R9HD 3R0MA 3LH2L 1DJSA 3HRPA 5C09B 1WIOA 1IAIH 4LEOA 1L7IL 4PRBB 1BX2A 1DQTA 1DUYA 4HLZH 5EC2A 1MCJA 3L3IB 5HGHB 2A6JA 3QZWA 3ZE0F 1FNGB 3SKMB 1QFWH 2H32H 3R4DA 1I1YA 5D7IF 1U91B 4KKAC 1T2QL 5BV7C 5AD0B 4WDIB 3OX8B 1NBYA 3IGAA 4R4BA 2VDPL 2Q6WB 2F5BH 4XXDB 5IMOA 4M93C 1ZHBA 5MEOB 3TBSA 5DEZA 3HR6A 4YR6A 3D3VA 1U95A 3SDAB 1BOGB 1NEZA 2BNRA 1HQRA 1CFNA 3AMKA 5D1ZB 2OP4L 4QRRD 4GKNB 2FATH 3O3AA 3U7WH 4Z9KB 1MOEA 1VERA 5EO0B 1X5LA 4H25A 3NMEA 3VFRA 1NGXB 2DM4A 4W4OA 1Z5LB 3INUH 1ZTXL 2DLIA 2FGWL 1C5CL 4RWYH 4X4MA 1SEBA 4RFNB 1AR2A 2X4NA 1QZ1A 3B6SA 3MREB 4G7YH 4LIQE 2NX5D 2GIYA 1DN0A 1FG9C 4POYA 3REWB 3VD3A 1EHLH 4F2MB 3CMOH 3GJFK 3VA2C 3ARFA 1IMHC 2W38A 3B9KD 4GAJH 3C2SA 4OSUL 4BKLA 4M00A 5CWSB 2VKXA 2NX5A 3MLXH 1MFEL 2IFGA 1K3ZA 4G5ZH 4Z0BH 4KJWD 1Q9OA 2B0SH 3UJTH 1T04B 1W72L 4DGYH 1JGEA 3WFEL 2CK2A 4JN1H 4HV8A 1A4KB 5B21A 4YFEA 2W0FB 8CGTA 4ZFOL 4LP5A 4GS7B 4JKKA 4I3SL 1BD2A 4JFFA 5TDOA 4UUJB 4U1MB 3GMOB 4HT1L 3E6HA 2XN9D 2BCKA 4H26B 1J0IA 5DLMH 4JPIA 5DFWH 3DTXA 4XNQB 4AH2A 1LO4L 2I07B 1RMFH 4WFHD 5CEZL 1P2CA 3ARDA 2YSSB 4EUPA 1FNGA 5AD0A 4NQDD 1G7MA 3PP3H 5FYKE 5KVGH 3EOTL 1CXHA 1AXSB 2VLME 2ORBL 1OP9A 2FJGB 3BIAX 1MFBH 2R2HB 1N5YH 3W81A 2A1WH 4NKDB 2F19H 1PY4A 4U0RB 5FGBC 3RWDA 3GMQA 3GFUA 4J2XA 5DEGA 3FOLA 2DDQL 2X4SA 1DBKL 1DE4B 4OLEA 2JELL 1YEHH 1D6EB 3PHOB 3O6KH 4HHAA 3QISA 3HZMB 3D0VB 4GKSB 3MRCB 1RFDL 2DTSA 2G5RA 1SEBB 3LEYH 3F7RA 3FB5A 4WU7A 5TH2A 4F15C 5EZIL 1S8DB 4XNMA 3H9SB 4Y16B 4HKZA 2EZ0D 1EO8H 5D7LA 3T4YA 4C56B 4LVOC 5C0AD 4BFIA 4KMTL 3NAAL 3NOIA 4ETQA 1ZGLA 1MCOL 5I0ZA 4ZNCD 5SWZB 2ZSVB 5AYQA 3X14B 4FTVD 4LVOB 2P7TA 3EDJA 4Y5XB 4ZS6C 4QRSA 4RMRA 1FCCA 3QXWA 2W9LA 4KAQL 5J6HA 2GHWB 5BVPL 2EYSB 3IYLW 1KCLA 1LO4H 3QIBB 4HKZB 1EZVY 4NIKB 3HRZA 3PP4H 5D5ME 3DXAD 4WI3A 3C87A 3BH9B 5FM4A 3TJEL 4DVBA 4U2ZA 5BOPA 3S37H 3KYOA 1QACA 1EPFA 2Y36H 3HNSH 3WBDA 3UMTA 3DNKA 3QIUC 5J6GA 4QF1A 4HUUB 4HIHA 3HG1A 2RAMA 3MODL 4IHOB 3O3BB 1FVEB 5D6DC 3MNVA 2FO4B 1KXTB 1QRNE 1V05A 3O6FD 1IGJB 4NNYB 1HZHL 1VENA 2A9NL 2LABA 4JY6B 4I9WE 3OB8A 1EERB 2HKHL 3VWJA 2YS4A 4ERSH 3T0EC 4CDGC 3GBLA 2QKIA 2WANA 3BAEH 1FO0B 4QHLA 3A6OA 5JIKA 3RX5A 3MC0A 2FEDD 4MQSB 1MH5A 1K8IB 4H8WL 2EIEA 3E6FB 4Z8FH 5IB3A 2J1KA 1AD9A 5F1NA 3SOBL 1OAZH 3RPKA 3V5HB 1UCBL 1RI8A 2VL5B 4ZTPH 3K2MC 4QHNB 4JLRB 3VD9A 4R0LB 5BV7H 3SDXF 3D3VB 2PTTA 2QHRL 1MLCA 4AY0A 5GS0L 2X70A 4P4KA 3BWAA 1D9KA 5EOTA 1RULH 3H9HA 1IVLA 5KSUA 4BK4A 3P4NB 2FR4B 2YPLB 5CUSH 1DUZB 2D9CA 1U3HB 3DO7B 1UT9A 2RFXA 4XVSH 2AK1L 3R8QA 1HINL 1NCBL 1ZT1B 3MJ8B 5JIIA 5GXBB 4JDTL 1KIPA 1ZLUH 2WWMC 4M7JH 4PP2A 4ZFFA 4PJBE 4NC2B 4KUCF 3GJFH 5KJRH 5DJ0B 2HFTA 2VUOA 2H2PC 3X3FH 4YXLH 4E41A 4XBGA 1IARB 2YRLA 5IVZA 1JPTH 2K1MA 1A7RH 2N4IA 3RVXC 3AB0C 1JI2A 5FF6A 3H42H 4UTBH 4HK3N 3LV3A 1WTLA 3TA3A 4CJ1A 3BZ4A 1A3LL 3MREA 4K94H 3MRIB 4FQXC 4PP1D 5IBTH 5DJ6B 4X4ME 4XVUD 3OKMA 1IEHA 3MV7A 1B6UA 1JWSA 4NZJA 4S1DD 4XCNB 3HR5A 4YHZH 2FX8H 3BZDA 4JQIH 1H5BA 3GSUA 3BWUC 1KN4H 3OR6A 3QNXB 4IHOA 5FK9B 5IM7B 4RFOL 1I85C 3ZDYE 1C5BL 1CZ8H 1PD6A 3UO1H 2W60A 1RZIB 3MNWA 3WHE1 3EYSH 4PJGE 3OKMB 1IJ9A 1T7ZA 3FAXA 3FN9A 3TT3H 1B4RA 5SWSA 4JRYB 5C2BH 2IAMB 2R2CA 3HPLB 4MDIA 4Y2DC 3GSVA 5FDWA 3JTSA 5D5MB 2Y7QB 3KLAA 4O51A 4DN3H 3CK0H 4KKLD 4KDWA 4EVNA 3CFCL 1YEJH 5DRWB 1B0WA 5CZVL 1JE6A 3PL6D 4GBXB 4XNZC 4ZFOB 2AV1A 5DJXB 3S5LG 5E8DL 3G6AB 1JZ5A 1ZOXA 4LCUB 2ZOKB 3RPIA 3V52H 4M5ZL 5J4MA 2DMCA 3ILQC 2Q8BL 5TPWH 3QNYB 3RA7H 1M05B 3QUMA 4LSVL 5KSUB 4GRLA 3G6DL 4IMKC 1NCDL 4LEOB 3AREA 4X4XB 5T1LD 3C6LB 1EO7A 3F7VA 3PIQB 1DE4A 4RGMB 5C0AB 4RRPA 3VGGA 1XGTB 3LS5H 1MJ7L 2UYLA 5C2UB 2XTJC 1AIFA 1AD0B 4Z7WE 1OTSC 1BFOB 5F7MC 5GRVK 1WTGT 4GRLD 3WUWA 2OL3L 2J5LB 1EVUA 2XWJB 3KWWA 5EU5B 2J12B 5C08B 4F7PB 4J3WA 5FXCH 4JPVH 4BQ9A 2DJSA 2YA0A 3O11A 4CMHB 2APWA 2J4WL 3OXRA 4I3GA 4NBYB 1WWCA 4LAJH 4X4YA 3K46A 5L9DL 3VXME 1FNEB 4KUZL 3V79C 4LK4A 4URTB 3IXAA 1N59B 5C0AA 2DQDL 3TH2T 3B4NA 3FQWB 4E0RB 5IKCA 3RY5A 1FZJA 4JM2D 1CLOL 1MELA 4Z5RB 2GUOB 2AEQL 3F6IA 1JNHA 3ABZA 1CXFA 2EYTA 2OJEB 2P42B 4R7NA 1Q9WA 1BD2E 4JFFE 1U92A 1Y6MR 2PUQT 1FCGA 3RKDD 3H42L 3REVB 1FSKC 4PB9H 5J6GB 4NO0D 3RPIB 5LCVL 4C4KO 2NX5B 3KYOB 4HH8A 4OLYH 3VFWB 3FFCD 5D6CA 3CC5A 1LEGB 5GHWH 2Y7QA 4Q9CA 4N8PA 5KSAA 3M45A 4H8WH 1IAIL 2NZ9C 2Y06L 1F4XL 4XHJD 1NC4B 2OLDA 3IJYA 5JLZA 1AY1L 1II4E 1JHTB 1NFDB 1TZHA 1UWXH 3WFHA 3VD4A 4NN7B 4WUKL 1NGYA 4I18C 5B8CB 1ZXQA 1KF9B 4PRHE 3VXUB 3QFDB 2P8PA 3FB6B 1YPZF 1LP9E 1ZA6B 2VITA 1NEZB 4KRPD 4D9LH 5DA0B 1F97A 4JQXC 2P43B 4JKLA 3IETA 5D71H 3TFKD 2H32A 3VE0A 4WWKA 1L9NA 2H2SD 2VZTA 3RWDB 3MZTA 2BRQA 1T1ZA 3N1MC 1LP9A 5I6XC 3ULSA 3TA3B 4XBGB 1CFTA 5ESAA 5HYSB 2BMKA 4XX1G 5T33H 3DX9A 2B4CC 1CVSC 1YZZA 4HPYH 5TDNB 2UWEB 4ZUVA 3FN3A 4NBXB 3S36H 4KROB 3E8UH 3ARVA 3I6KA 4NPYB 5ETUB 3H8NA 1I9IH 5IFAH 4NQED 4X6DA 1CWVA 2DKMA 3GKZA 4HMEA 2VLLB 4CMMB 4XI5D 1HQ4A 3ES6A 1OARL 4NKIL 5IJKC 5E8NA 3NIFE 5F8RC 3KPLB 1N2RA 2W0FA 1OQXA 3UJIH 3V95A 2OM5A 4JZJA 3QNXA 3JTTA 4WW1B 3UYRH 5BZDA 4LGSB 5E2WL 3EJZC 2RJMA 1K4CB 3P4OB 2A1WL 5D5MF 1IFHL 1WIUA 3BRGC 4KGJA 4JR9H 3SKJH 2HLAB 1YMHA 4PV9A 5EZIH 3W11C 4D9RE 1ETZA 3MCLL 5FGRA 4G9FB 4M7KH 4NN5B 3RIFK 2FRGP 4RGNB 4PJCA 2CPCA 2FD6L 5D1XC 4DOHE 2Q7YB 1UXSB 5IOPB 4LCUA 5F6IC 4JO3L 3PWVB 4PLJD 4UI2A 2XFXA 1MAML 2F15A 3P4MB 4I0PD 3UPAA 5GGTH 1PDKA 2HVJB 5TF1L 3HCVB 4LP4A 4N0YL 5MEOA 3LRSA 3C60D 4KZDH 5IQ9A 4OI9A 4XXDA 1CD1B 2DYPD 1A7QH 3IGAB 2YC1A 3X14A 1HEZB 4HAGA 3BEWA 4ZNEE 4JRWA 5LQBH 4OTXL 3DETD 4XHJC 2FLRT 2J2ZA 4R0LA 5LBSL 4OQ1A 1S9VB 4MD4A 2GQHA 4Z6AT 5FHBH 5KS9B 5C0FA 1KLGB 1BZ9A 2H26B 4ODXA 1MNUH 1JYVA 2X7LA 5D96B 3QDMD 1VCAA 1MIEH 4ZS7L 1YDPA 3DX6A 3NACH 1IGCL 2JJTA 1MRDL 4DUVA 3T1WA 1U8HA 3PJSA 4JVPA 4PJBF 4QRQA 4X7EC 1F3RB 4F7MA 2GT9A 1FL3B 2X42A 1KNOB 3HI6H 3QCVH 5A2FA 2ITDB 3LV3B 3DHMA 1QKZL 5BJTA 1QD0A 2WK2A 5B3NA 4U33A 1WT5A 3MLZH 3VXMA 2V7NB 3F8UB 3ZYZA 5BZDB 4WV1C 4JFOB 3KHQA 2LU7A 2V17L 3DURA 5C0AE 4UUJA 4UV4L 2EZ0C 4GAGL 1N6UA 3O3EA 5E6IA 5DJ8B 3VGHA 5TQ2H 3PWNA 3W0WB 4OFYA 2BVPB 2N7BA 1GAFL 3DVGA 3ZKSD 4H26A 2YSSA 4WW2B 2A9MH 3IJHA 2AV7A 4XC1L 1CE1H 1BD2B 4JFFB 3RZWA 3QI9D 3BWAB 4OF6A 2HT2C 4PR5A 4TUJB 2F8VA 4OIIL 5DR5L 5FO8B 1ZV5A 2R56L 1YN6A 3WNLA 4TNVF 3K74B 4DKFL 5T3XL 3HE7A 3TV3H 4QHKI 2BP3A 3GM0A 4J8RA 3LQAC 1RPQA 4MDJA 3U9PH 4ZFGH 1HH6A 5KVFL 4XHQA 3WFZA 1U8QB 4HS6A 2OR9H 4ORZC 2YK1L 3NCYS 3Q2CA 2OBGA 3LN9A 3L6FA 5SWZE 3LRGA 5K33A 4KI5D 4BH8A 5JW4M 4LKXA 1P7KA 3CCHB 3VXRB 3QEGL 1F90H 2O5YH 3OKYA 3T0VA 1N6VA 4K71B 3PWPD 4ZUWA 4XGZA 4ZQKB 4N0RA 2K7PA 2Z4QA 3U2SA 3UTTB 1S3KL 4K71C 3X3FL 4NZTH 4QWWD 1NLBH 4CBPA 1BGXL 1WEJH 1PSKL 3BPLC 1ES0A 3IDXL 4RMWA 3WNMA 5T3ZH 4IS6B 4BQ6A 2XY1A 4DZ8A 4MDJB 3O3AB 3EJYC 4GMSH 4NP4H 3NBNA 4GAFB 4LIQH 2XZAH 1UZ6E 1E4XH 5TDOB 4I0PC 4OCSH 5TDNA 4OLUH 4P9HL 1S7UA 1AY1H 2PF6A 1KIQA 1OCWH 3IJHB 5HI5C 2AJYL 1RV6X 3DURB 4YHNB 2X4PB 1G84A 2ZSWA 2FIRT 4EXPX 1T80A 2VL4A 2HTKC 5ISZA 4PLKD 1I85A 2X9YA 1W0YT 3SGDH 3JVGC 4M8VA 1MQKL 5D2LA 3PWNB 3Q5OA 4YZFE 3EDKA 5I1CH 2MQCA 3BW9B 3LEXB 4YHLH 1WGOA 4RNRB 3MRPB 1LWRA 1VEMA 1FVDA 5FUOL 5HGBA 4OCLC 4OLXL 4O5LH 3NN8A 1EGJH 3PQYA 4JHZA 1Q0YL 2DI9A 1R3HB 2XQYG 1GGIL 4O58H 2GITA 1MRFH 3SDXE 3T3PE 5FKAB 2N1KA 2VQ1A 1O7VA 3FRPG 2D31A 3CFBB 5KVFH 2GK0A 4YFLI 2P5WA 4Y89A 3MLYL 1GH7A 4YHKL 4ZPVB 3DI2B 3S37L 4P2YA 3G9AB 3U48A 2YBRB 2IAND 3D9AH 3L7FA 2F19L 2NQCA 2V9QA 4Y5YA 4HSQA 5ACZB 1WLHA 4YPGB 3U82B 4R2GB 5DEFA 4DGVL 4DFHA 1F4AA 3N50A 4FQ1H 1LO2H 4LCCB 4R3SA 1WBYA 3GI9H 2R9HC 1A8JH 5ABDE 3Q6GL 2HT3D 2OSLA 3HG1D 2AERT 2L4OA 1FVCB 4ZAKD 4LLQB 3V6OC 4DZ8B 1EXUB 4QRUA 4MCZB 4IS6A 5JOEA 5C0NC 3B83A 1LNUB 4PRHD 3FQWA 4PGEB 4KK8C 5C0EB 4BFIB 3DVIA 2YA2A 1JGVH 2JLLA 2JB6A 4EKXA 4C83B 1FNEA 1A3RH 4DEPC 4JN1L 1BQHB 3NFPB 4PYGA 5HYIA 4PJAA 3ZE1F 3FRPA 3LS4L 1K4CA 5HGAA 5IKCB 3WS3B 4NQVB 3QXDB 3SJVA 4HUWB 4Z18A 1ORSB 5F89B 3RTQA 1OOAA 2DQEL 3D2UB 5EBLB 4OZHB 4OLZL 1OL0A 2P44B 2C3XA 2HH0L 4DVRL 4PJ5A 2D03H 1I3GH 4NJAH 4WI8A 2I9LB 4HCRL 2VDKL 3WIIL 3RKPA 4HUVA 5GZND 1ADQL 3OHXB 5ICXA 4EIGB 4CMMA 3MBEC 3ARDB 5GJSH 1S7XB 5DVLA 3RAJL 4FQQB 5E8NB 4AIXA 4LSUH 5DD3L 5AYUH 2AQ2A 3VXQA 1I1AA 5I8CB 2IGFH 4D0DB 4UU9A 1VADB 5E2TH 4ELMB 3HE6A 1PQZA 1MCWW 2MCPH 1HHGA 4TULL 5DJXA 3MNZA 3RGVB 3AREB 4ZFOA 5HDOA 1BZQK 2O61B 5EU6B 3ULSB 1TTGA 1AXTH 1FFNB 2EDOA 1I3UA 1MCDA 4NYLA 2PCPA 2EO9A 1HSAA 3GSXB 1X4ZA 1W72A 2VABA 1ZK9A 1CLYL 4M02A 4B5EA 1Q72H 1JI1A 5KSBF 3L3GB 4LQFH 4RGOH 1RZGB 2AXGA 2XTJD 4JR9L 3UDWA 3EYSL 4P99A 3CXHJ 1RJZA 4TYUA 1DN0B 4XB7A 3CZJA 1U8KA 2CDFA 2FGZA 5IHUH 3D2UD 4OQTL 5F9AC 1RUMH 4QRRB 2QSCL 5F70A 2FD6H 3C8KB 3VFUB 3TO4C 3A67L 1BF8A 4F37F 1MI5E 2VLKB 5FGSA 2RIKA 1TJHL 4AEHH 4MJIB 3HZVA 3W5NA 3SDYL 1UB5B 4FQCH 4N8CH 4MAYC 3SKNA 4FQ1L 1OAQL 3JWDL 3VG0H 4NC1C 3QIBD 1W72B 4KKLC 1UA6H 2NLJA 3O45A 3VMPA 2X89A 2IQ9H 1INEL 1ZHLA 4P3CH 5I8EB 2ADJB 1REIA 2P8LA 3NABL 3BRDA 3EHBC 3MJ6A 4L3AA 5F88A 1JNHB 3QDGA 2NW2A 4X8XA 2OJZL 5DJ6A 1LEGA 4JRXB 4NKOA 3OZ9L 2HT3C 4EOWH 1A7OL 4KJQD 4R7NB 2IQAB 2FBJH 4FFVD 4WFFD 5FM8A 1ZAGA 3I3EA 4LF3B 5T1KA 4OD1L 4J8RB 4DKDC 3ESVF 5I8CA 5L2KD 2G9HB 4G8IA 1A21A 4GXVL 3DYPA 4R4FH 4JN2B 4H88H 1QSEE 1IGYB 5C3TA 4YXHL 1JHKL 4L4VE 3V9FA 1HHJA 4S1DC 2BVTA 3MJ8A 3OKLB 1LK2A 1UZ6F 2YKLL 3H9YA 4HCRH 4FA8A 4Q9BA 4LLAA 4TVPH 1MAKA 1J7VR 2LTQC 4HJJH 3O3DA 3T77B 3RZCB 3WIHA 2VWEC 3W0WA 5GGVY 1D9KB 5EOTB 1AGFA 4JPKL 5DD5H 2FECI 4I2XB 3PGCA 1IAOA 3MJGX 1U0QA 3WL9B 2ICWB 1R0AH 4XBEH 4XPTL 4E42B 1N7MH 1KC5L 1UVQB 4OFDA 1XR8B 2DJUA 4U1JB 1HNFA 2QQNL 5F96L 3BP5A 2ZJSL 4JFED 2CIKA 4JVWA 2ICWI 1RAMA 5B39B 5KSBB 1RVFL 3LEVH 1QFUH 5I76B 4BSVB 4MJ6A 2UYLB 4XC3H 3DPBA 1CDIA 1P6FA 3SO5A 5L6YL 4P48A 4QTIH 1A6AB 5T1DH 4AEHL 3TFKC 3ARGC 2FX7L 3S6CA 1CFVL 3T3PF 4QRUB 3KPOB 1R3JA 3VFTB 1QG3A 4DN4L 3BOVA 1F4XH 2XQYK 3HRZB 1F3DH 2V7HA 5GIRA 2IFFH 1CICD 3NIGF 1KFAH 2R56H 5K9JH 4XNQA 4AH2B 1OWWA 4NHCL 1YA5A 3FB7A 4KAQH 3BISA 4ZYKB 5IR1B 4M1GH 2AQ1A 5INDA 2YK1H 3JTSB 5JMRA 5LCVH 3BP6A 5DMJB 1OGAD 3PWLA 4KWUA 1MCOH 4GW4B 3K8MA 2EDHA 3QIBA 3U9PL 5D5MA 5E5RB 3S3PA 3T4AA 4I9WD 3WLWC 1OD9A 3UCRA 4CDHA 4LLUA 3X13A 2HFFB 3O6FC 5T3XH 2BOCA 4D9QD 2VAJA 4U1SB 1CS6A 3KPSB 4XVTH 5H94B 2AJUL 2GCYB 5ENWA 3TN0D 1YY9C 3AY4A 3H7LA 3QUXA 1QPXA 3FQXB 4EUPH 3O4LE 1G7QA 5CBEA 5EIIA 3PDGA 2L0DA 3EOBB 3I3DA 3VJ6A 4KU1A 5DUBB 2P5EE 1JYNA 4YDKL 5I1HH 3UC0H 1M7IB 3S97C 1G9MH 2P8MA 1G7HA 3BO8B 2OMBA 1MQKH 2LE9A 4O4YL 4HS6B 4LVNB 3QDMA 2X1QA 5EU6A 4JPIB 1TVBB 3CFDA 5IFHL 2Q76B 3ARBB 4HQQL 3VI3E 5DURD 1TFHA 1OM3L 4I77L 1S7WA 3FO1B 4N0FB 1D5IH 4JZJC 1TTFA 3H9HB 5D71L 3SGEH 2D7NA 3X11A 4JGJA 1X7QB 4ZFFB 2VLLA 1WCBA 2ADGA 1SJEB 1Q9KB 3U4AA 5C1MB 5HXMA 1UWEL 3OXRB 3EO9L 2H8PA 1L6ZA 3WHE0 4DTGL 4YFLF 2YUWA 3W9EB 1RHHA 4MMZC 4Y0GA 5HHPA 1SYSA 2SEBB 1Z3GL 3IFNL 4IIQC 1DBJL 4LNRA 5GGSY 3B9VA 3NIDE 3V7AE 3N1FC 4GAJL 3EO0A 5T3XD 1JNLH 2VKWA 4WTZA 3QUYB 1R5IA 2KQMA 2FEEL 3IU3B 4JGUA 5E00A 3Q0HA 4G8GE 3RWFB 4IRJC 3S35H 4NQCD 5IT2L 3RDTA 1I7UB 1NCUA 4Q6IB 1AXTL 1EJ6A 4XXCA 1NUFA 3MLYH 3QUKB 4YHKH 5F7NC 4NOBA 5B8CA 1RZKC 5F7FA 1FFPB 1PX3A 3TCLA 3O3BA 3MA7B 4PRHA 3R1GH 1A6ZA 3KAAA 4KMLB 5C0DB 3LY6A 5JQ6L 1K4DB 5HTSA 1O5DT 5C0CE 3KYMB 2AK1H 2G2RB 3SBWA 3IJYB 4XP6H 1QSED 4Z76A 4JQXA 2EDYA 4Y2DA 4EBQH 2IAMA 4FXLA 1N6QL 3TH3T 1MIMH 1ZGLB 3RNKA 2Y25A 5BV7L 3QFJD 4K3GA 4OFVA 3HNTL 1DQDL 4Z7UA 3VDCA 4P49A 4HQQH 1C7TA 1ZLWH 1D5ZA 4C56A 2VLKD 3C08H 1IILE 2F5AH 4S1QH 4BZ1L 1GHFL 3ULVD 1CGTA 3MGTA 1YEFL 3U4BL 5I1LB 3P0VL 3OAUH 1IGFL 1K9TA 3IU4H 4K7PY 1DEEB 4MB4A 4HIJB 1TIUA 4UILL 2Z8RA 3GKWH 1IKFH 4X9GA 5FUZL 1SEQH 1TZGL 3WDIA 2GJ6D 2BVUA 1MI5D 3FOLB 2X09A 1BJMA 3OG6B 1FE8H 3B9DA 4ZPTB 1LE9A 3BT2L 5TE7L 4TN9A 1NMAH 2NY6C 2H26A 1BLNB 3TYGH 4OLZH 3ALPA 3PNWA 1Q94A 1T2XA 1HHIB 4NZTL 2KDGA 3MACL 4JFXA 4UQ2B 3UC0L 2DLFH 4WFGE 3V0VA 4P4RB 1CICC 5HVHC 4R26H 5EUOA 4PP2B 4GG6E 5DRXB 1KB9K 4IIQA 2BJMH 4PUBL 5C07A 2C5DC 3FO2B 4QOKD 3OR7B 5EO9B 4FP8H 1I1AC 5FKPA 1KCUH 4HV8B 1GPOH 2BCKB 5D7JB 32C2B 5DHVB 2XKNB 5FFLA 2YUZA 3UZQA 4J4PA 5MENB 1A4KA 3TESA 5E99L 3D9AL 3QHTC 4Z76B 3VA6A 4P2QE 3FQNB 4E5XB 4PRNB 5I8KL 4Q2ZA 4X6DE 3KPRE 3NA4A 2VDQH 3QWOA 5I1AA 3I6LE 1DL7H 4QGYA 3PV7A 3WN5C 3IB4A 4TUKL 4PTTA 3V4UL 4U2YA 5BS0D 4HFWA 1UXSA 1CLYH 1GC1C 4Z7UF 4O51B 3TWCL 1AGCB 1KB5L 4XPGH 4ZOEA 5AUMB 2ZUSA 3GHBL 1MHEA 1ERNA 4OD2A 5I1IH 1XGYL 3FB6A 1FFQA 5GZOC 3RY4A 4L8BA 1SVCP 3RNQB 1S7TA 3L9RA 1PYWA 4TUKH 4ZUTA 5JORB 4O02L 5DYOA 3BUTA 3TVMD 1NEZG 2BNQD 3ZL4H 4HG4K 5IROC 1YC7A 5GJTL 3AC0A 4PJ8C 5L2KB 3EYQD 3VU2A 2HP4A 4NM8H 2VDRH 3GSOB 5D93B 3KPRB 2EYSA 4YR6B 4YDLB 3HR5B 5D72L 2Y9RT 2BNRB 3QH3B 3E1F1 1JMXA 2IH3B