4IRZH

Crystal structure of a4b7 headpiece complexed with fab natalizumab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
222
structure length
217
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQRLEWMGRIDPANGYTKYDPKFQGRVTITADTSASTAYMELSSLRSEDEAVYYCAREGYYGNYGVYAMDYWGQGTLVTVSSASTKGPSVFPLAPCSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha4 subunit
publication title How natalizumab binds and antagonizes alpha 4 integrins.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 36
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2013-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH01
5F7YC 4ODUB 2ITCA 1Z9SA 4X98A 4Q6IC 1M05B 3MGAA 4QOKE 4BZ1L 4F15B 1CBVL 4Y5VB 1H3PH 3H7BB 4JKMA 4OCRL 2P5ED 1P1ZB 1CLZL 2C1PA 2DMKA 4N5EC 1QFWL 1VCAA 1HN1A 2DTML 3UTZB 2WK2A 1FVDA 4HUVB 3BKJH 3G6AB 5GIRA 3BEWA 2WBJD 1ACYH 3HE6C 3ULVD 4WV1B 2CRMA 2XXCB 3WFHB 1OHQA 3DX8A 4R4FH 4PJ9C 4DJMA 5EBLB 4LLUA 1AY1H 4ZYKB 1ZHBB 3QXAA 4Y16B 1YPZE 2ICES 1J86A 1G9MC 1H3PL 2A0LD 3TBWA 2FL5B 4HJGA 4R97C 1L7TL 3VGHA 3SO5A 4Q9QH 3MNWA 3AREC 2BX5A 2DQIH 1J0HA 3QJHB 3NIDE 1U8JB 3QXTA 5CBEA 1A9EB 4GKNA 4RNRA 3BKJL 5B38B 5IQ7H 3DO7B 1K3IA 3KS0H 4LU5H 1IQDA 2EDYA 3GMRB 3VCLB 4OD2A 4XPHH 4R4FL 1G7QA 5C0CD 1B4RA 3MV7B 1I1CA 1AY1L 1GGYA 4L4VE 3ULUH 4JM2D 3MRNA 3NVQA 3V0VB 3EZJB 4BUHA 1JHKH 3KWWA 1ZVSA 4Q74A 43C9B 3QIBB 2OI9C 4LCUA 1MHEA 1XF4B 4LSRH 1LE5B 4Q9QL 3S8WA 1BEYL 2V5YA 4KROB 3W9EB 4CMHC 2DQIL 3GMQA 4EDXB 3U9UB 2VLJE 3RY6C 1GJIA 4KK8C 3QUZA 1G9NC 4AM0A 4MX7A 1I8KA 4XPHL 1U8OB 3RPIA 3LKPA 3OAUL 4KY1H 4LDOB 4BH8A 2BHYA 3GMNB 3O3EB 1VADA 4V1DB 4XTRC 1G1YA 1FHGA 3EZ8A 4QRRE 3R0MA 3MJ8B 2H6PB 2EC9T 2HJKB 5CZVH 5K9KA 3IGAA 3QIWA 4JY4A 3I50L 5DK0A 1ZLUH 3D87B 4WCYH 1OQOA 4XHJD 4LEOA 1WIOA 5DS8A 5HHMB 2CKBH 4EEEA 1X7QB 4M02A 3ARBB 4LSRL 4ZUSA 1XEDA 3NMEA 4PJ5A 1N2RB 1DLFH 5E2WH 3U46A 1SJEB 4YGAB 5MI0B 3FHAA 4OLXH 3T2OA 2GI7A 3RWFB 1UZ6F 1ZS8A 1BGXH 1NMCC 4XMLH 5KAQG 4ODWA 3W81A 1GSMA 1LWRA 3AB0B 4K7FB 4PRAB 4X6CE 4HKBB 4JGJA 2EDWA 1ZLUK 2HFTA 2XFXA 3C6SA 5D70H 2ZG1A 2YUVA 2B4CH 4JKPH 3U4EA 2ZJSH 3W9DA 4K3DL 4X7EC 3LKNA 3QDMA 5JOEA 5ESQA 3RGVD 2AEWA 1QA9A 3Q2CA 3PGCB 5F8QC 2FJHB 3CFJB 1AO7B 3H3PH 4MCYB 4WCYL 1EMTH 3MV8D 2CKBL 4QT5A 1WITA 2NY7H 3C5ZD 1T20B 4FP8H 4U1IA 1DLFL 4IRSD 3RQ3A 3RWGB 2QQLL 3N1MC 5E2WL 4LSTH 5GS1B 3VXSD 3VFSA 3VI3F 4JFDE 4OLXL 5HGAB 3OR7A 5FF6A 5KSAC 4F7CA 1KACB 4GUPB 3K4DA 2WBWB 3QQ4B 1CXKA 3GB7B 4PJ7E 5D70L 2H2SD 2B4CL 1B0RB 2R1YA 1EFXA 5E6ID 4BFIB 4Z7VE 1FIGL 1S9XB 4P5MB 3F12B 2LE9A 5CZKA 2GJ6E 1X9QA 3H3PL 1EMTL 1IBGH 3C09B 1FNLA 2FWOA 1CIUA 4JKLA 3D18A 1KLFA 1GZPA 5K93A 4BM7A 4QRSA 5A3ID 1BWMA 5DJAB 3A67H 3PWPB 2FYYB 3QUYB 4H8WH 1F11B 1F42A 3DLQR 4PRPB 1KF9B 5D6DC 3K2UL 4ODSH 3QCUH 1IKFH 1CG9A 3IB4A 4F7TB 5JW5B 5E7FA 5DDHB 2ITDB 4LHUD 2VRAA 1Y6KR 5KANI 4OI9A 1MAKA 1S7TB 5EU6E 3EYFB 5JHDA 3O8XC 1ONQB 4HZLA 2FO1A 1RUKH 1MELA 3BP5A 3ULUD 2Y06H 2GK0B 3RVUC 2DRUA 1MREH 1QLRB 4ZG1A 4JFYB 1I9IH 3S5LG 1XR9A 1IBGL 1QSED 3RWCB 1NFDF 5IOPB 3AS2A 3C6LD 2J8UE 3ZE0E 4MDIA 3A67L 1EHNA 2CIIA 3VFMA 3WXVH 1SJXA 4P3CL 4CVZA 2GSIB 4JR9H 1FG2B 2V2XB 3RGHA 4ODSL 3QCUL 1MHCA 4AENB 1KIRA 3FN0H 1R3KB 3IKKA 3H9YA 4FXKA 2BVPB 5I66B 3L5WB 1QRNE 3FONA 3TVMD 1OGAD 3BGMB 1HHGB 3NCCB 2F8VA 1CGXA 2AXGB 5BV7H 4P2OD 5D1ZC 5HPMB 3KYMB 2Y06L 1QRKA 3GSOA 2YSSB 2LFGA 4YDLC 1I3UA 1MCPL 1I9IL 2YN3A 4L4TA 3SDCA 3QUXB 3WBDA 4IRJA 2BY3A 2ADJB 1KTLA 3GBMH 4XCFH 2BOBA 4HJ0D 3U1SH 1JNLH 4M8QA 3QZWG 3IETA 4K94C 2C4FU 1DFBH 1T7WA 1BVLA 3IJYA 4JR9L 2D2OA 4JDVA 5J6HB 4EN3B 3W82A 1R5VA 4ZAKB 1X5XA 3FN0L 3WUWB 4DGYH 4JFEE 5DFVC 3QJFA 4K9EC 3EDFA 1A1OA 4G9FB 4X4XA 4HGWA 3GSQA 3EUUA 3P73A 3IFNH 2V5SA 5I0ZA 1MAML 2Q7YB 1NDGA 2Q7NA 4ZQKB 5BV7L 5I1AB 2X4QB 5DD0L 1HOCA 5CZXD 2Y07L 3BN3B 5DJ6B 1BIIB 3DRQB 3IF1A 1P9MC 2OZ4H 4XCFL 1XZ0B 5A16B 1JNLL 2HMIC 1RZJC 2XN9B 1DFBL 1S78C 3MBEB 1FAIH 2PYEE 4FA8A 3N85H 3RHWF 3W39A 1HINH 4LCWA 1KIQA 4UT9H 4DGYL 1I8MA 4JFFE 3MRFB 4FZEL 5ANMA 1NFDA 5HYSG 3IFNL 4Y5XA 5JLZB 1I9RH 2YD2A 1S7QA 3D69B 2Y1VA 1JI1A 5F9WC 5FGRA 4B53A 2Y25A 4OGAD 4PBXA 4TSBH 3T2QA 4Z95H 1CI5A 3TV3H 4KUZH 2WW8A 3QDAA 4RAUB 4GLRI 2FJFA 3D0VB 5I1DA 2GCYB 3HB3D 5D7LD 5K9JH 2C3GA 1FAIL 4QHUB 4XVSL 3VD9A 3RZCA 3N85L 2SEBA 3RWJA 1HINL 1BOYA 4UT9L 2B2XH 1KLGB 3SJVA 2XQBH 2WUCL 3ZMRA 4LDLB 1KCUH 3OKKA 2C7UA 4P2RB 3VFVA 2NXYC 4CL7A 4IRZH 2EEDA 3TO4A 3BIAX 1CR9H 1I9RL 3GJEB 4F33B 2DQFB 3EYQD 4FQXB 2A83A 1UM5H 4G8FB 1T1WB 1UFUA 3UYOD 4X7SH 4TSBL 4NQCD 1RV6X 1UB5A 5IJVB 4HFWA 4Z95L 1S7XB 4OZHB 2IPTH 1NEZB 4BUGA 3K4ZA 1TTGA 4KUZL 5L7XL 4OV5B 3GGWA 1L6ZA 5IB1A 3MRPB 1V3KA 4KPHH 5LWYH 4D9QD 4GRLC 4M5ZH 4H5SB 3S97C 4WUUD 1TZGH 5K9JL 3HC3H 1AI1H 1DP0A 1BQSA 3V4UL 1GGCH 5INDB 4HUUA 2B2XL 2A38A 2XQBL 2XWBA 2ZSWB 3ROOB 2C3XA 4IMLB 3PQYA 3VFRB 4IRZL 4F8TA 1CR9L 1KGCE 3JVGA 4NQTA 1TZIB 1U2HA 3V7MA 1LD9B 3A0OA 2GITB 3CXDH 1OB1A 5BOZG 1UM5L 3SGDH 1IC4H 4HMEA 4K55A 4WW1A 5IF0A 1W8OA 5I18H 3HI6H 2QADB 1J0IA 5AYQA 5A43C 4OKVA 2UZXB 2UY6A 4JY5H 5TPWH 4WW2B 5I17A 2Z8SA 3CLFH 5EOTA 4XGZA 4KPHL 2W07A 3FCTB 5HDBF 2YMXH 1TZGL 1UKQA 3VDAA 1V3LA 3HC3L 1CGWA 5CJBA 5AUMB 1GGCL 1EVUA 1I85C 3V5KB 3THML 3TBYA 5JUEL 3QFDB 2WINB 4NIKB 4N0YH 5D1XC 3OKDB 5C0CE 3QUKB 6CGTA 4DEPC 4LCYA 5EA0H 5DRZB 3V5HA 1KG0B 1UT9A 1DEDA 5C6WH 3CXDL 3DX9A 5I1HH 1IC4L 2ZG2A 2NY4C 3CFIC 3QCTH 3HI6L 4HMDA 5TQ0H 4G42B 1CLOH 3RJDA 4JY5L 5TPWL 3LKQA 4BFEA 4M3JA 5D7IE 2C3VB 5JIKA 3QNYA 3V79C 1OP5K 4LRIC 2YMXL 3DI3B 5E5UB 5EFIA 4MA3A 1SMAA 4RMSA 3WFDL 3CZJA 3MLSH 2UYLB 4EXPX 4JANB 5MERA 4N0YL 1C5CH 3BWAA 2FSEA 3JV4B 5JO5A 4KI1A 5DRWA 1UH2A 5EA0L 3IU3B 4MGXA 1NUDA 2DTSA 4YXHH 1F45A 2VDRH 5I1HL 3K3QA 5KS9E 3BPNB 3QCTL 1S7UA 2FNBA 3U2SB 5TQ0L 3MYJA 4HS3A 5I15H 1CLOL 4JREB 1P7KB 4YHIA 2I5YH 3TA3D 4MXVF 3PDOA 4QWWD 2GTWA 5DGRA 4Z7WB 3MCKB 4U1SB 4OKDA 4YAQB 5J9PB 2ZZUT 4Y4FD 5EIVA 3MLSL 3JTSA 2W60A 2HFFB 3MCLH 1C5CL 1Q0XH 4YX2H 1QLEH 3DECA 2VZ3A 3O3AB 1Q94B 2PXYC 4P23D 1JN6B 4OIAA 4YXHL 3NACL 1ND0A 4XPFH 1ETZA 1Q9WA 3HAEA 2BP3A 5I15L 3MRBA 4N0CD 2I5YL 5C0EA 3CZFA 1L9NA 4ZOCA 1RFDH 2DM7A 4UT7H 5B21A 5IROA 3VRJB 5IEKB 3HZKA 4OTXH 4RFOH 1LO0H 3B9VA 2RCSL 1CT8A 1CL7H 1H3TA 4ZOBA 5L2KA 5F9JA 3I2CH 3UTOA 3RI5F 2MFNA 2CJUH 1CFNB 3TC9A 1M6OA 1Q0XL 1XF1A 1QLEL 5D7JC 3KR3H 2CLVA 2N7BA 2Z31D 1GC1C 1I9EA 5DVKA 2P47B 1DLHB 4LCCC 3SDAD 4UIMA 3VI4F 1U3HA 2CDGA 3NZHL 3T2PA 5MEQA 1DVFD 3LKOB 1KPUA 2ERJB 5CEXB 3VD4A 2APWA 3KPRD 3MRKA 1LNUA 5TGBB 4YHZH 4J6RL 1CFSB 1JMXA 4WWKD 4NBYB 1U58A 1RFDL 4ONHB 4UT7L 2I9TB 2UVFA 5JW3L 2GTZA 1DQQA 5KAQF 3PWJA 4OTXL 1U8HA 4RFOL 4M3KB 1LO0L 4LLQB 1CL7L 2AQ2A 4UV7H 3I2CL 3GM0A 1N8ZB 4R0LA 2CJUL 1A21A 4P0DA 4ZNEA 3X3GH 4X99B 1BQHB 4KJYB 2YXFA 1JIBA 4QHLA 2CK0H 1JPGA 3KR3L 4PJDA 2M2DA 3RIFF 4PRID 1UJ3C 3Q6GH 2Z8RA 2R23B 3VJ6A 3SQOH 4O51B 4ESKA 1HDMB 4RZCB 3OKYA 4J4PD 1F3JA 4IM8A 4X6EA 4YHZL 4R4BA 1HQ4B 3V4VL 5IM7A 1NSNH 1CYGA 1CDBA 5FYKL 4QRTB 5FO8B 1I4FB 1MFNA 2P8PB 3SN6N 5I75B 5J11C 4KDVA 4MB5A 2A73B 3DVGB 3S37H 2F8OA 4TRPH 4G8EA 3X3GL 3FJTA 1FNSH 5BJTA 1JWMA 3OB8A 4MD4B 3Q6GL 1U8NB 1SY6A 3ARTA 5GGQH 3VXOA 5C0RH 3GI9H 4ONOA 1FNEA 1PVHA 3SQOL 5GGUB 3DNKA 3BPLB 4TVSa 3DX6B 3LDBC 1YN6A 3FO9A 4KJQC 4F7MA 2ITCB 4WRLA 1NSNL 4MS8D 1ZT7B 1UKTA 1RUMH 4XZUA 2YPLA 3KLAB 2C1PB 4OI7A 3PL6A 4JO1H 1DBBH 2AJUH 1NDMA 1FVDB 3S37L 1LO5B 5ENWB 1FZMA 2HLAB 4Y2DA 3G5XB 4TRPL 5CEYA 2ZOLA 3BEWB 4UU9A 5F9OL 2VDKH 1FNSL 1NKOA 4MDJB 4W4OC 3MLVH 2NLJB 5GGQL 5C0RL 3GI9L 1N59A 2XWJB 4Q6IA 3L95B 2LVEA 4QF1A 5I6XC 2NW2B 3NAAL 3CFKA 3HPJA 1J10A 4P5TA 3QXAB 4LNRB 2FECL 4WU5A 3KPMA 1PG7W 4YZFE 4UDTA 2QL1A 2XRAH 2IMNA 4HJGB 4NGHH 5F70A 1A1NA 4KI5C 1GZQA 3CGTA 1FYTB 1TXKA 4KRPB 2OJZH 3FQTB 4JO1L 2AJUL 3ZLQC 1LDPL 1ITBB 5DSCA 1A5FH 3RA7H 1CK0H 1XCTB 4LARH 4GKNB 1X5KA 3WLWC 1XIWB 4RNRB 2CIKB 4XNZB 4PJ9A 2VDKL 5KJRL 3TN0D 3U9PL 5IBUB 3IDGA 3X12A 4HUWA 4OD2B 3KLHC 5HVHC 2KPNA 2PW1A 3NCYS 3W2DL 5DD6A 1K8DA 3LD8B 1ODAA 4RMWA 2EDJA 3MLPA 1RZIA 4LOUC 1PYWA 1WZ1H 4X4YA 2JJSC 4K3GA 3IXAA 3AREA 2XRAL 1EJ6A 1UJTA 1IGFH 1ZVSB 4NGHL 2UV3A 2DMCA 1JV5B 2CKNA 5ITFB 5I2IB 4YDVA 4OZFA 2DQEH 1AGCA 2OJZL 3PXJA 1A5FL 4LARL 1A6AA 2VIRA 3WIFA 4AM0B 4I5BA 4N5UA 1I1FA 1A9BA 3IFOB 1I8KB 1GGIH 1YYML 1M4KA 3LKPB 4NZRH 3BP7B 1A6ZA 1OLLA 1VFUA 3AAZB 5D2NC 2CK2A 1VEOA 4P5KB 1VADB 2L4OA 2ZUVA 3IGAB 5DURB 1WZ1L 2X44D 3QIWB 5HYQA 3CFDB 1T89C 4JRXA 4HUKB 5DK0B 1D5ZB 1SMOA 4N90D 1IGFL 4J8RB 1DQMH 4LEOB 4D9QE 1RIHL 2PW2A 5IBLD 1VFBA 3RY6A 3SKUD 2DQEL 1QQDB 2Q6WA 1QVOA 4DUVA 3H0TB 1ADQL 2J4WH 3GSRB 3S5LA 5EU5A 1TFHA 5FGSA 3P3YA 5IMOB 4M9PA 3UPAA 2EE3A 1MQ8A 2VZ1A 3MLZL 3UMTA 5HD8D 4R9HA 1GGIL 4MYWB 4NZRL 3UZVB 5CLWA 4RDQG 4K3EH 2WBKA 1MCFA 1FPTL 5A2FA 4WHYH 1QA9B 3F7YA 3VD7A 4F9LC 4TNWK 1KELH 2F53E 3QI9B 3KPOB 4NNPH 5KSBE 4QT5B 2V2TA 5DTFA 5J6GA 3PWNA 4Y4KC 4U1IB 4UI2A 1J11A 2X4SA 4MMXC 3P9MA 5L0QB 5MEPB 1F4XH 2R2HA 3BPCA 5FF6B 1JZ6A 3I6GA 2C9AA 4F7CB 3MJ9H 4D94A 1DCLA 4L9LA 4FFZH 1A6PA 5LJYH 3QZWA 4CADA 4XCNA 3FN9A 1F2XK 3V52H 1O7SA 2NXZD 4X6BA 2MNUA 1S5HB 4IRJD 1KELL 2R0ZH 4Z8FL 1AD0A 3ZYZA 2XV6B 2YD6A 4NNPL 5D71H 4F80A 3IDJB 1KPRA 3L7EA 1VGKA 2FWOB 3JWDH 3QO1A 4MXQC 4RFNC 4KH2A 3QDGE 1GZPB 4AG4H 3S34L 4FMFA 4UIKH 1F4XL 1NCNA 1BVKA 3E6HA 3HE7C 4HH8A 4JPKH 2UWEF 3QPQC 2A6JA 3MJ9L 3P0VH 3CX5J 1OAYH 2EDNA 2O61A 2QV2A 4OQTA 4FFZL 1TVDA 4YBLB 3SCMA 1C8PA 1CZ8L 4M93B 3GSNB 4R2GD 1JGEB 1J7VR 1G6VK 1KUMA 1J12A 1QSVA 4NN5B 2OXHA 2HRPH 2N4IA 1EK3A 4HZLB 2AJZB 5IBTH 3BP5B 4ELKA 1WV7T 2R0ZL 3BZDA 5HYSA 4HV8A 1ZTXH 3ZKND 2FIKB 4IBLT 1EBAA 5D71L 1E0OB 3B2UD 4EQ3A 2WANA 2R8SL 2O5XH 1D7FA 4WI4A 1TVBB 3CC5B 4MDIB 1L0YA 2CIIB 4RRPG 1FFQA 1MI5B 3RBSA 4CVZB 4JPKL 1ZE3C 2W59A 3P0VL 3MFGB 1OAYL 1MHCB 1L0QA 2VXQH 1T03H 3O8XA 2VXSH 2H9GA 4JE4B 1TLKA 1NJ9A 1U2CA 5DJXB 2AEPL 4DQOH 2HRPL 1NUGA 2Z92A 2JB5L 2I07A 3GSOB 5D5MA 3KJ6H 2AVGA 3QULA 3UO1H 2Y36H 5C0BE 1FORL 3CVHB 1EEZA 3SDCB 4YEFA 1LGVA 2HH0H 1QSFE 4L3EB 3SE4A 2BRRH 1TNMA 1R5IA 3RZCD 1KTLB 4G3YH 5MEOA 1TTFA 2CXKA 3T0ED 5F9AC 2QQNH 4N8CH 5HHNB 4JQVA 3NTCH 2JCCB 2VXQL 1JZ2A 2J3SA 5IEHA 3QJFB 1UGNA 1A1OB 2XQYG 4ZD3H 5D1ZA 4X4XB 1PBYA 2AV1A 4RIRA 4Y16D 1CD9B 1CFTB 2K3TA 2WIMA 1IC7H 3P73B 3QDJB 1R3IL 2YEZA 3BZ4A 3JV5A 4DQOL 1NDGB 3B9KC 4HLZH 4NO5A 3KJ6L 3HZVB 4I13B 4PJIE 3UO1L 1CLYH 2Y36L 4NO2B 3GKZA 2NZ9C 3F5WB 4OT1H 4LIQE 5AD0B 4KHTH 5EOCJ 2BRRL 1U41A 4G3YL 3ZSTA 4F2MB 2EDFA 1Y0LA 2E9IA 2NQCA 5GGRB 5IIEB 4N8CL 2VLRE 3TYGH 4PRIE 1KIQB 5DZOA 2P8MA 4N8VG 1I8MB 1RY7B 2ADGB 2IQAA 1T5XB 2IAMC 4P59L 2NTFB 5F7HA 2Z8VC 3WFEL 3ABZA 3AM8C 5JW4R 5SWSE 2MQCA 1KT2A 3MRJA 4UV4H 5I1EH 4O2EA 4I18C 1HXMB 1S7QB 3GSWA 3H6JA 4NSKA 4O4YL 2ADIB 1GOFA 4MA1C 4TNVK 3QIBD 4XBEL 4KVCH 3WDIA 1H9VA 3IJHB 4ZFGL 4Z7QE 2VLLA 1LEGA 4F9PC 3LEXA 2JIXB 4OT1L 1ES0A 4KHTL 3CDCA 5DUBA 5CGMA 4Z77A 3UJJH 4D0BB 3BW9A 2IALA 3GIZL 2WQ8A 3F7VA 3IFPB 3IFLH 1OAXH 3V0WL 1RVFH 3QQ9D 3TYGL 3FB5B 2OBGA 5ESAB 3MRGA 4LVOC 5FFLA 2OL3H 3SJVB 3J7HA 3P9LA 1VKXA 4NP4L 5IFHH 4V1DD 2GJZB 2XA3A 1ZXQA 1C1EL 4WHCA 2C7UB 3LSOA 4UV4L 4WVRA 5I1EL 4PGCB 4GG8A 3MRLA 5JZ7D 5HHMD 3EYSL 2MMXA 4MJ4A 4KVCL 4Y1AE 5CHNA 3ARBD 3K8KA 2A1WH 1UB5B 1TJIH 4M7ZC 3I3BA 3EHBD 1CICC 3WYRA 5IB1B 4K8RC 3UJJL 4XWOC 5DJYB 1FJ1B 2H1PL 1SM3L 5TH2A 3PJSB 2VDPH 4RBPH 2W9LA 1RVFL 3ESUF 5EORL 1RZFH 2X10A 5TJWK 1SY6H 1I7TA 2OL3L 4R7DA 5C0AE 2IH1B 1J5OL 5IFHL 3DGGA 3PQYB 1I1YA 1OAQH 3PABB 2F74A 4LVHB 5DQ9A 1BD2A 2EDTA 4EOWH 5D1QB 1SYSA 1AO7D 4QHKJ 1MLBB 3K46A 3TYFB 1G7HA 4RBPK 4Z7UF 3LV3A 2A1WL 4POUB 5IF0B 5T1LB 5BMFL 4GRLA 4HK3N 1IEBA 3ARDA 2DN7A 4GW1A 4X4ME 3QNXB 2X1QA 3VD5A 4G8IA 5I74B 4CU6A 1MCRA 4WGVB 4R4NC 5EBWA 4IS6A 1UACH 5C08B 2CUIA 8FABA 3U30B 1L7IH 2Z91A 3QWOB 3EFFB 4HFUH 1SY6L 1HNFA 2EXWC 4NC1C 3B8SA 4IOFD 1KB5A 5AAWA 1F02I 3HUJF 1F4HA 4MD5A 1JHLH 2VE6B 1R5WA 3R1GH 5AYUH 1OAQL 2F54B 3ARFC 5EO0B 4PS4H 4PJEE 3H9SE 1D5MA 3HMWL 4HKXB 5FEBA 1FDLH 4HWBA 1MCQA 1YEHH 2MCPH 1ED3B 2BVTA 1AJ7L 2AK4D 2MOVA 2OR7A 2AGJH 3DMMC 4U1NA 3CX5K 5FYKE 15C8H 2YC1A 3PWPD 5C0IB 4QY8B 3MREB 5L2KD 4PRPD 3RDTC 1UACL 4WY7H 2DIBA 1L7IL 1TVHA 1QR4A 5B22A 4ZSOB 1D5IL 4MA3B 4R96A 3VXRA 3TEUA 4MJIE 1W0YT 4P9HH 1IZKA 3BUYA 4NQVA 1JHLL 2FSEB 4ZPVA 5JO5B 3R1GL 5DRWB 4PJFF 4OI8A 1A6UL 5F96H 2P43B 2ZWLT 1R0AH 4PS4L 5IVXE 4DFIA 3V95A 3ZTNH 5D7KE 1FDLL 2BNUA 1YEHL 2NY3C 2MCPL 3MOBH 4CGTA 1EEUA 5EU4A 3CH1A 2R1XA 4NUJB 5JA8B 4JKKA 4LSQH 1KJVB 2XTJC 1JRHI 1G0DA 2BNQE 3PGDA 1RMFH 3MGOB 1AKJA 5ISZA 3UPRA 2CH8A 3VA6A 3ZDYF 4IHOB 5B4MC 3VU2A 1R3JA 4KDTC 4Z7UA 2W60B 1PKQB 3DIFB 3CU7A 5FV1L 5KVEH 4U3CA 3PIQB 3OXRB 3WD5L 5F96L 3BD5A 3OB0K 3T65B 2FR4A 1KB9J 2EIZA 1ETZB 2VDOH 2FB4L 3QUXD 4NZJA 1FCGA 3MOBL 3VGGA 3U4BH 5H94A 2RFXA 3BIKA 4EQ2A 3REWB 1YEGH 3SGEH 1JBJA 2FBJH 1BOGA 1WWCA 1QFUH 3CZFB 4K2UL 2Y6SC 1QR1A 3HUJA 3PWUA 1FSKC 1RMFL 2HLFD 3O41B 3UX9B 4EN3D 3QG6A 4WI8A 2KZ1B 4ZAKD 5SWZE 3TCLB 4G80A 4R7NA 4AL8L 5GXBB 3TH2T 1WBYA 2V17H 5DRXA 1ZHLB 4G9FD 1O7VA 3M8OH 4WEMB 2DYPA 2VO5A 5KVEL 4EI5D 4MWFA 2CLVB 3JZ7A 3NH7H 3RBGA 1FFOA 4UIMB 2VDOL 4P49A 1U3HB 2CDGB 3OF6A 4PR5B 3U4BL 5E24E 3MC0A 1YEGL 3LAFA 1Q38A 2MKWA 5I8OL 2IBZY 1C7SA 3D3VD 1QFUL 2XN9D 1U58B 2PO6C 4KDWA 4ZO6A 2D7PA 3MLXH 4HMCA 4P4KD 1MIEH 1FC1A 3VWJA 4PJFA 2W0KA 1BM3H 2EDDA 1U8HB 1K8IA 1PD6A 4I48B 2V17L 1MH5B 3PUCA 4OF6A 1CFQB 2ZSVA 3VFWA 2BJMH 4HK3J 4C59B 1U92A 1MHHA 1E4KC 4RDQF 5IESH 3FMGH 3DROB 3KPPA 4C56A 1JPGB 4PJDB 4UOJA 1IGJA 4NRXA 3NIGE 4ELMF 4PJBE 4E41A 3ZL4H 1ZGLP 2EDQA 1KULA 4J3SA 5FIEA 3SDDB 5JMRA 3S96A 1A22B 4KMQA 5I8CA 4I0PA 5FYKU 2X4PB 4I8DA 4CMMA 5GQBA 2QHLA 4R4BB 4PG2C 5IM7B 1B6UA 1PY4A 5CSZA 2JLLA 1F4YH 1FGVH 3MLXL 2J5LB 5SV4A 1MIEL 3HZMA 1VDGA 4CKVX 4OZGE 2BY2A 5C9KA 5JNYB 1RULH 4P2RD 1IGTA 4MAYD 4G8EB 5FHAL 1VPOH 3F6LA 5IESL 3FMGL 4FQXD 4X9FA 2FCBA 3LKSA 4HDIB 3VDBA 4UILH 4YHMH 3UJTH 1SVCP 1A02N 2NY6B 3DV6B 3FO9B 5T5NG 4M61A 4F7MB 4AH2A 3ULVC 1YEFL 4O5LH 5EN2B 4E42A 1T66D 4WU7B 1F4YL 5CIPA 1QEWA 1G7MA 1KNOA 3MA7B 1AHWA 1MEXH 1LP9F 4KQ4H 1R24A 3FL7A 1RULL 4H25A 4H88H 1DDHA 4MQSB 1IQWL 4APQB 4JFQB 5B39A 4JDTH 1TCMA 3V5DA 2ZOLB 1VPOL 3MBXH 3QYCA 1WFUA 1HSAA 3OG6B 3VFOB 2PTVA 4UILL 3UJTL 4YHML 4TSCH 5C0DA 4Q6IB 2Q8AL 3RWHB 3L5JA 2ZCHH 1JGVH 2EC8A 4WU5B 4KU1A 4IIQC 4X6DF 4O5LL 4UDTB 1WAAF 3CK0H 1G7IA 5CD5D 1ZA6A 1A6VH 1RSFA 1TZHA 4OCWL 5ESVA 4K7PX 1F3DJ 4PJGF 4XNQA 4XXDB 5EULV 3VWKA 4ONFH 3LHPL 4ELMA 2LAGB 3D85B 1MEXL 2ICWA 3HE6B 4JM2C 4KQ4L 3BJLA 4YUEL 3LRHA 1VEPA 1H0DB 3MV7E 4JDTL 4RAVA 5DJ2B 3T4AA 4HIEA 5HGBA 4PJ9B 1XCQB 4I3GA 4JGMA 2V2WB 3QWRD 3OXSA 5FB8A 2PW1B 4JAMB 4TSCL 2DQHH 4WJ5A 1DQDH 2QTEA 4D9RD 4R97B 2E3VA 5CD3A 3DX7A 4BFGA 1JGVL 2X7LB 2XTLA 1PYWB 3EO1A 5F88B 3L6FB 2R2EA 3AREB 3MUJA 2GJJA 2OTUA 3CK0L 1A6VL 5ID1A 4OZIF 4F7PB 3IDYC 2WWMC 2Y9RT 2A77H 1OM3H 4OZFB 1J87A 4I3RH 5IW1A 1PX3A 1WEJH 3X3FL 5IV2B 1YY9D 2G2RB 1HH9B 1IAIH 1B2WL 2GSGB 3LY6A 3S9DB 1A6AB 3PHOA 3S36L 4L8CA 4CDHA 4V1DE 4XHJC 1T7VA 2VIRB 1ZEAH 4KK9D 1ZLWK 5TE6H 3U36B 4I5BB 3WIFB 3MXVH 3CNKA 4AIXA 5DA0B 2DJ4A 3FO2A 3N1FC 5HHME 4ODXB 1VERA 2JJSA 2DQHL 2IFFH 4GBXD 3MJ6A 3UEZA 1DQDL 1RJYA 4MSWA 4PB0H 4FQ1H 3KJ4C 3ARXA 3EAKA 2YA1A 3RWDB 1NGPH 1LP9A 4ZTOL 3L9RB 1CFVH 2HYMA 3TESA 1FVEB 5HYQB 3WHXA 4JRXB 5JPNA 5EWIH 5F3BA 4CMHB 2DI8A 4HHAB 3JTTB 5F8RC 1VFBB 4G43A 2A77L 1OM3L 2NX5A 3UDWC 4NT6A 1Q8MA 1QVOB 1WEJL 4HS6B 3RGVC 1KB9K 2IPUG 5E2TH 1HI6A 5EU5B 3SCMD 1RD6A 3W0WD 1ZEAL 5TE6L 4X6DA 2FX7H 4IRSC 1WAAA 3X11A 3HRPA 1P4LB 1AO7E 4NC0B 4RRPA 1U8QA 3O2VL 5GHWH 3EYUH 5E5MA 5JDSA 4YGVA 4PJGA 4PB0L 1BMGA 1MFAH 4M6OH 1UEMA 1Y6MR 1NGPL 1CFVL 1HHJA 1KJMA 3HMXH 5KVGL 5EWIL 1A0QL 3VFGH 2ESVB 4JRYA 1A6TA 1WLHA 5IMLB 3E1F1 3NOIA 1U8KB 2LU7A 5E6IC 2WM0A 1F6AB 3MRIB 1X44A 1NMCB 3BRFA 4HPYL 4Q9CA 6FABL 4LLYA 4BQBA 2ATPA 3P9MB 5ALCH 1K3ZA 3RY5A 3UTSA 3CCHA 5DJDA 4GG6F 5HYJB 1P84J 3C9NA 5IK3B 4PTUA 1MY5A 4GAJH 1OWRM 2HA1A 3BZEA 2VDNH 3HG1B 5JIIA 3QRGH 1SBSH 1CIDA 2FX7L 4LLDA 1TMCB 3BPOC 5A3IC 4XP5L 3QIUA 3T8XB 4XCNB 3EYUL 5DVOA 5F6IC 3WJJC 4F9LA 5EC2B 4M6OL 1MCJA 1FVCB 1HH6A 3HMXL 4LDEB 2XNAA 3PWPE 4Y4KA 4MQ7B 3U0PA 3VFGL 3I9GH 4PRPE 4QHNB 5F1IA 5JOFA 3EYOA 1KPRB 1VGKB 2DI9A 3QO1B 5KSAB 3SEPA 5ALCL 3UBXG 3GHBH 3ULUC 1D9KA 2E7BA 3E6HB 1BVKB 4GAJL 4ZUUA 2FO4B 2EKSA 3LQAH 3QRGL 2P5WD 1VGEH 3KPLB 4OF0A 1U8MA 3C6LC 3WS6C 5F89A 1YPZF 1YMMA 1I3RA 5F1SA 4X4ZA 3QA3A 5F7MC 2CQVA 2DD8H 5H35A 2NY2D 4GXVH 2X4TA 5IFJB 1Q9LA 3QWQB 4GMSL 1HNGA 3I9GL 3MV9A 4HV8B 3NIDF 2OR9L 4KMLB 2BCKB 3KDMB 5CP7B 5HPOA 3MO1B 1GHFH 4KK5C 3MRRA 4P2OC 4X7TA 5C6TH 1M1SA 3LIZL 3LQAL 1VGEL 4OGXH 2EXYC 3O9WA 3TNNA 2OTWA 3O8XB 3IDXL 4AEEA 3O81A 4HJ0C 2H9GB 2G75A 4R8WH 1NJ9B 2PYEB 2DD8L 5T1KB 1UH3A 2VQ1B 4HXBH 5MENA 4GXVL 1HYSC 3ZKXC 5D5MB 1J8HA 1FO0A 4G6FB 4GG6A 3QULB 1YDPB 1K9TA 3OKOA 4ETYA 1KBGH 2B4CC 1EEZB 3QSKB 3RNKA 1GHFL 4NQDA 3SPVB 3BGAA 1N7MH 1S7VA 1R5IB 4G9FE 4JO3H 1T5WA 2C1OB 1DN0A 2G5BA 4WFFD 5C6TL 3K4AA 5CZXC 3O6KH 3IAQA 2EH7H 2D9QB 3TWCH 2EYSB 1T3FB 1PY9A 3PP3H 4OGXL 1FFPB 1BWWA 1AC6A 2FEEI 4XC3H 4YO0A 5DJ0A 3S6CA 4OSUL 1TJHH 4R8WL 4RIRB 4JHWH 3TIEB 4YDLB 1II4E 2V5RA 4DFHA 1N5AB 1XGPB 3QEQA 5DWUH 1FNFA 4X8JA 3VXNA 3WFBH 3N1PC 2XN9E 1FYTD 4KRPD 1MPAH 2CR3A 2K7QA 3TO2B 5J0BA 1KBGL 3RU8H 2CDEB 3PP3K 1C5DB 1T22B 1YC7A 1XIWD 3NCBB 1YPZA 5EU3A 4NWUH 4K07A 4X6CF 4OGAC 1BBDH 1M71A 1JCKA 1T2XA 1UCTA 2AAVA 2VNCA 3O6KL 2EH7L 3GSNH 3TWCL 1Y6NR 2BSTB 4LHUG 3LS4L 2P8MB 4UDUA 2IQAB 4PJ8C 3IXTB 3F7RA 4HUNB 3MRJB 1KT2B 3VA2C 3EOAA 3HR6A 4MZ2A 4H8WC 4NSKB 4WO4D 5FM8A 5DWUL 4O2CA 4ZUTB 4OD3H 3OKEB 4QHMB 3O3UN 2HKHH 3WFBL 1LEGB 3L3HA 5HHPA 4M6MH 4DKEH 3SGJC 3RU8L 5I1KH 3Q1SL 1WFNA 4M62H 5FA4A 3ZT5A 4AZ8A 2ARJB 4J1UA 4OGYH 4DZ8B 1IM9D 4L4VA 4NWUL 1EX0A 3UTTB 5CMAA 4P2RE 4QLRA 4PJ7F 1C12A 5M7QA 2CR6A 4F7EA 4XNYH 5CP3A 4LLVA 3GSNL 4Z7VF 1IMHC 4N9OB 3MA9H 3QO0B 3P9LB 1BJ1H 4GSDH 4PRNB 1IC5H 4LP5A 5F9WB 4H1LB 3L7FB 5LAXB 4OZHE 4ZPTB 2VLJA 4F9PA 3I85A 4LSPH 3MRLB 5JXED 3CD4A 3S3SA 3BISA 3CIQA 4OD3L 5CHNB 5HHOB 2HKHL 4MNQD 5GZOD 4M6ML 3LB6D 4DKEL 3U0TA 2VLKB 2Z93A 4M62L 2ARJQ 5I1KL 5FDYA 3L3KB 1BFTA 4I9WE 4OGYL 4QRRA 1N5YL 1RUAH 4D0DA 4KJWD 1H5BA 1HZHL 4N0FA 2ZUSA 2X1PA 5EO1A 4CJ1A 4UOW1 4XNYL 3AS0A 4LPYA 3WNOA 2A6DB 2YHGA 2NXYB 1HE7A 1MCWM 1RUPH 5EU7C 3MA9L 4S1DC 2B0SH 2NR6C 4GSDL 1MF2L 4A6YA 3ARYA 3CXHK 3E3QE 4JFHE 1CU4L 3O3BA 2F74B 1W72B 1BD2B 3VGBA 3QI9D 3CVHL 4X6CA 2OK0H 5GSRA 5K59E 1P4BH 1G7HB 4EUPB 3CDYA 2J8UF 3LV3B 1P84K 4P4RB 2WLZA 3ZE0F 2HT4D 4GRLB 1AKJD 5C09D 4GW1B 3DHMA 4YC2C 5DMKB 4G8IB 1WSST 1MCHA 1RUAL 5IVZA 4N9GA 1U91B 2WNGA 5F72S 4NPYB 3RTQC 2Z91B 4XVJH 1RZGA 3KPNB 5HY9B 1F97A 1RUPL 1I3GL 2VZUA 4OGZA 3EGSA 3L3IB 4PJCB 3OKLA 3REVB 4JFDA 1A7BA 1N6QH 5T5NF 1R5WB 4FQCH 4OM1L 3TNMB 2MTPA 3O6MH 4YDJB 4CVWA 1CCZA 5K9OA 2P7TB 3BHBB 2H8PB 2M8XA 1Z0NA 2OK0L 1ZSDA 2ARWA 4CDGC 2E27H 5EZJB 1T21A 1WGOA 1ZLSL 1PQZA 5A2IH 4YDKH 1YECH 4Z7VA 4DVBA 3V6ZB 3TJHC 3IKCA 3QQ3A 1XF5A 3RKDC 4J2XA 3O4LA 1G7PB 3O3DA 4KKCD 1TVHB 1NGXA 4XVJL 5D1XB 5GRWA 4R96B 2BSRB 4DEPB 4JZJC 1BFOA 5HDLA 4GXUN 1HQRA 3ARFA 2HFEB 4U33A 3MFFB 4K3JH 4QWWC 4LKXA 4QTHA 3RVWC 2R1WA 4F58L 3MRQA 3DO3A 1MFCH 4DVRH 1N6QL 3RUGB 3FRUB 4FQCL 1PKOA 2NY4B 2COQA 3MUGA 1Q9OB 3ME0A 5GPRA 3O6ML 4Y4FC 3D48R 1AXSB 4RX4D 2E27L 4Z7WE 3P0YH 2BC4A 4HKJA 5DMGD 2FZ3A 3VWJD 3CH1B 4F37F 2R1XB 1YECL 5DC0A 3OX8A 4JHZA 4P23C 1CE1H 5HDQL 1MI5D 1LEKA 3P0GB 3PGDB 1LMKA 3ZDZE 3UPRB 3HS0A 1HHIA 3SGEI 1A2YB 3FAXA 4HJJH 5F9DC 2J7LA 3L3OA 4P2QD 1NPUA 3GZKA 1R3JB 2BSSB 4U1HA 2BZDA 2J8UA 4CNIA 4DVRL 1MFCL 5BS0B 3CU1A 1AXTH 4DCQA 3DJ9A 4O58H 1YA5A 3ARUA 2FR4B 2I25N 1WFOA 1CGTA 2O5YH 3PDDA 3RL2B 2C4XA 4PTTA 1D5BA 3P0YL 5H94B 4L3ED 3MQIA 5LBSH 1QRNA 5K9QG 1Q1JL 2Z31C 5IQ9B 1U8IB 4GW5A 1CE1L 3IU4H 1RQ5A 5EUKB 1INDL 2CRIA 1QR1B 2X40A 3G04A 4XNMA 1U93A 4KDTA 1NC4B 2E8ZA 2VXTL 1YUHA 4HIJA 3FOMB 3RX8A 1DVFC 3DVFA 2CLZA 1X5ZA 1DBAH 2PXYB 5IB4A 1NGZB 4WWKC 1JF6A 5FECA 4PY7A 4NN6C 3QDJD 2J1KA 2DYPB 3EYVB 1AXTL 2Q3AA 4MWFB 2HJFA 4Z7NE 5LKNA 1OSPH 1YEDA 1U3ZA 1JK8B 2O5YL 2W0LA 3OKNA 1JYVA 4LPWA 4L1DA 5TDPA 2APTA 1EZVX 5LBSL 1JZ7A 3X13B 4NO3B 4LLWB 3FO1B 5IHZA 3IU4L 3ULVF 1RHHA 1PG7H 3SKOA 2VSDA 2YA0A 3VFPB 1T04B 2BOCA 4J4PC 4OCXH 5D7JB 1VB9A 4JZNB 4ZTPH 5CWSA 4XP1L 4LCCB 1G84A 3FB7A 4C56B 3KPPB 4XP4L 3RFZC 1JZ3A 3I6LD 1YY8B 4LQFH 4PLJD 4MNHA 4XCYA 3BP4A 4U2ZA 1CE6A 3V0AC 3CVIH 4ZDHA 4JM4H 1S7SB 2PO6A 1MHPH 4JFFA 3D39A 4OLWH 4MJ2A 1KFAH 1UXWA 1IILE 3VWKD 2VKXA 3T08A 2NY1D 3FT4A 1CD0A 5BVJA 1PG7L 1QLFA 3SBWC 3HZMB 1JWSA 4AQ1B 4OCXL 4U0RC 1P4IL 1UJ3B 4LAQH 4JY6A 4X5LA 4ZTPL 4Z78A 3VXUD 2LAAA 5ETUA 2XACC 4JM2F 1ZHNA 4JO2H 1XFPA 4Z76A 4X5XA 5E2VL 3QUZC 3BVNA 4RCAA 4LQFL 5E9DB 1KTKE 3LMJL 2VUOA 3GKWH 5D9SA 3KHOA 1INQB 4JM4L 4WNQB 1MHPL 5D7IF 3ZE1E 1GRWA 5DD3H 4OLWL 4EDWH 4AH2B 2BXZA 1V05A 1NBVL 1I1AD 4NKIL 5CIPB 4POZC 1QEWB 1BZ9B 5J11B 1T7YA 1G7MB 4U3XA 1W0VA 3AY4C 3DUSA 4WFFE 1IGIH 1DUZB 2P5EA 5I1GH 3ARZA 3D2UB 3UJIL 4H25B 4OV6F 4LAQL 5B39B 2W65A 1JL8A 4YK4C 4JO2L 5D1QD 5EZOH 3LDBB 1KXQE 5FDWB 5KS9F 1KXTB 1WISA 1HWHB 2WBJA 1IVLA 5T1LD 3KPTA 1ORQA 3O2DA 5HJ3B 3GKWL 5C0DB 3UP1A 5CCKH 1FYTE 1GOGA 5DD3L 3ORJA 5DJCB 2HAZA 3FQWB 3TH4T 1YEIH 1U0QA 5C08D 2NW3B 5IWLC 4WIQA 4Y8AA 3UZEA 3NGBC 1TZHB 3GJFB 4NKOB 5EBGA 2NY5H 2E7CA 2LVCA 4XCEA 5I1GL 3JWOL 4PY8J 3T4AB 2F54D 4HIEB 5HGBB 2F58H 2Y5TB 4NO0D 5EZOL 5I0DA 2VL4A 5I6XB 1BZ7B 4L8SA 5FO9A 1IAII 4Z0BH 3RWIA 1KTDA 5CCKL 3C2SA 5C0CA 2YZ1A 5A2JH 1OL0A 1J05B 1OCWH 3WFCH 1PEZA 3KNBA 3OBAA 1E28B 1CD8A 1JUFB 5M94B 2AJYL 2EYTA 2R2BA 5J7CC 4JM2A 1C5BH 2BNRB 4FFVC 1HKLH 3VFTA 3EJYC 1MWAA 2A74A 3S37X 3TBTA 1A3LH 2DIJA 4AIOA 2EDRA 4XRCA 3KG5A 1RJLB 5D2LB 2VZOA 4BZ2L 4HBCH 3LQMA 5I30L 5HVHB 4L8CB 5D7IA 3CFCH 2F58L 4M6NH 3WS3A 3UBXA 4TVPH 2AKRB 1TQBC 4ZO7A 3GMPA 5HI3D 2M1KA 4GOSA 4Z0BL 3OR6B 5TDNA 3QXDB 3SO3C 2W0FA 1FL3A 2BVOB 4Z7OE 5F6HI 5ICXA 4E9LA 5HD8C 1I7RA 1OCWL 4KGLA 5DEFA 1WCBB 1YEJH 3WFCL 4TTGA 1A7QH 4AEFA 1C5BL 1K6QL 1AD9B 1HKLL 1KV3A 3EOBB 5CP3H 1O5DT 4G43B 4PRHD 1A3LL 1XF2A 4LQ1A 3BH8B 4NT6B 2Y4SA 1NBYB 4WUKH 1YNKH 3QHTC 5D2NB 2XPGA 5IG7A 5DD1H 1DBJH 4KRMB 2W0PA 4M6NL 1ZGLB 1WIPA 4TVPL 5JQHC 3M45A 5JDSB 2ED7A 2MSPA 2EZ0D 1IL1B 3GM8A 3P9WB 1YJDL 3FFCD 3RIAK 3EO0A 3O6LH 3EDJA 1KJMB 2YD4A 2B20A 3BAEH 5DJ8B 1YEJL 1JJUA 1E27A 2LV4A 5J4MA 2R0WH 3RGVA 1A7QL 3ZKSD 4KK6C 1SJHB 2D0HA 2NXZC 3HR5B 4X9BA 1GVIA 3MV8A 3DYPA 3UTSB 1Q9KB 3C5ZA 4IRJC 4IRSA 3VXSA 1OGTB 1YNKL 3DTXA 3BZEB 1DBJL 2IANB 4KQ3H 3BKCH 3VGEA 4WI9A 2OQJB 3QFJB 2W92A 2JJTA 3CUPA 5ECJE 2YPVL 5E6IA 3BAEL 3PWLA 3UAJD 3Q5TA 4MLIA 4Y4KB 4KGJA 4M7JH 5J3HC 4XPGH 4BSVA 4OF5A 5I1LB 5DHVA 2R0WL 3VG9C 4PRBA 5F1IB 3U7WH 3EYOB 4QOKD 5GS3A 3BZFA 1DUYA 2RHEA 5IVNA 3ESVF 1ZWIA 4GKOA 4CAGA 4GH7B 2E7LA 4I77H 2GUOB 2IH3A 2DWEA 4XBPB 3WJJA 1G9ML 3NA9H 2I60H 3ZHLA 4G8GB 4PV9B 2D9CA 1T1YA 4KQ3L 1U8MB 3BKCL 4HUXA 3S3PA 3SDDD 5F89B 4YZFF 1YMMB 5GGSA 4FZ8H 3QA3B 1NAMB 3MROB 4LHUA 1MJUH 3V6FB 4DN4H 1JMZA 1Q9LB 4RFNB 4BH7A 4M7JL 3QUMB 4Y5XC 4XPGL 1MI5E 4JPIA 3U7WL 3GSVA 1BX2B 3BQUD 4CW1A 1OAKH 4W6YB 1T0PB 3BT2L 4M7KL 3HE7B 4XAKE 1UCBL 3QEGH 4YQXH 2BXYA 1QSEA 4MZ3A 3MRRB 4Q0XH 3STLA 4X7TB 3L3DA 4I77L 3SKNB 5IKCA 3NA9L 2I60L 1F8TH 3WNNA 7FABH 2OTWB 3B9EA 3RZCC 4TVPD 2HWZH 2G75B 3EDEA 3T0EC 2V9RA 3T0DA 4FZ8L 4L3EE 4FABL 1MJUL 5H2BA 1PZ5A 3LCYA 3LQZA 3TVMA 4DN4L 3TO4C 3LVEA 3LKRA 3O4OC 1IGYA 1B88A 1G9NL 4KTDH 3VH8A 4P2OA 4TULH 4DK6A 1OAKL 1MJ7L 4YPGB 1T2QH 4Y4HD 3TJEH 1N6VA 3VXMB 4APQD 3QEGL 4YQXL 5EOQH 4UOW0 2CKBA 3ISWA 4Q0XL 5BQ7A 2FATH 1X5GA 1KIUA 1ZT4A 3QDJE 4XCCH 1C7TA 4NM8H 3E8UH 1JF1B 3WCYA 4AT6B 1F8TL 3DUHA 1QFPA 2HG5A 4JN2A 2HWZL 1KCVL 2R2CA 1HILA 3MR9A 5DUMH 2Q87A 5LGJA 1FLRH 1S7RA 4P2CG 4N5ED 1WUNT 1EERB 4MNGA 1B0GA 3QEQB 3VXNB 4XB7A 5FCSH 3JVGC 4KTDL 4HF5H 5INCB 2FRGP 4YFDB 1RPQA 3W5MA 4OCSH 4TULL 3D85D 5E8PB 3D0LB 3CFEA 3HE6D 2VITA 4XHQA 2F5BH 3QEUA 1NGWB 1FZKA 1T2QL 3OGCA 2R9HC 3QHFL 4J12A 5CINH 2IG2H 5ERWA 3TJEL 2F15A 2EIBA 1J18A 4U6YB 3MLUH 1J1XH 2FATL 1EAPA 4HBQA 4XCCL 3U6RA 2YK1H 2HT2D 4NM8L 3MRCA 5DA4A 1NCDH 4YNYB 3A6BL 4OQ1A 5C9JA 3I6LE 4OFIA 4D8PA 3JWDC 4QXUL 4UDUB 1RZ8A 4FFWC 3B9KB 5KVFH 3R06B 3VXTB 4DZBB 3L5XH 5DUML 2Z4QB 2YD3A 1R3LA 3EOAB 5KSBF 1WBXB 4O2CB 1WF5A 5FKPB 5F3HA 2DBLH 3L3HB 3S4SA 1AGBA 5HHPB 3MNZB 3OL2A 4OCSL 1T1XB 5C0JA 4HIIB 1LK3H 5FA4B 2F5BL 3G08A 5CINL 3SJVE 3PE9A 2IG2L 5FM5O 5JZ7C 2GAZB 4GKSB 4FTVB 4MMZC 3CPLA 4Q2ZB 4F7EB 3C60D 4Z6AT 3UTQA 5CAYB 2IAMB 2YK1L 5IMMB 2BY0A 1WIUA 1X6NA 4N0UA 5D7LA 2JK5A 2ID5A 4I18B 4MA1B 1MCBA 3L5XL 1LEIA 3SE8H 2YUWA 3MJGX 1CQKA 5E94B 3F58H 5FGBC 4ZFFA 5GRXG 5BZWA 3ZDXE 5FXCH 1Y18A 4ODHH 4KK8D 4WI2A 3U0TB 2GJ6D 5FAAA 2OMBA 5FGCB 4HC1H 4NQCA 4R3SA 3G6JF 5I8EA 4UNUA 5DUPH 4RAHA 4LVOB 1D5XB 4N0FB 1XGRB 3VXPB 1OP3H 3PQYE 1PW3A 5F7NC 4XAWH 4MJ6B 3OAZH 4A6YB 1J0YA 4NJ9H 1BHGA 3M1BB 3C08H 3MOAH 3R8QA 3KLDA 1MJJA 2QSCL 3E6FB 4M7ZB 1CICB 2YPKA 5GSRB 5C08E 4UQ3A 5EU6D 4ODHL 4Y5YB 4U1MA 4MCZA 5B38G 5E5RB 3OAZK 4HC1L 4K9EH 2IF7A 4AYFA 5IVZB 5DUPL 4N9GB 2X4NB 2A6IB 2F53A 4WDIA 2JTDA 3EOTH 2F54E 4UQ2B 5J1AA 4G6JH 2B5IC 5KSBA 5HHQA 1A7NH 1PJ9A 3WFZA 3VDCA 5B3NA 4XAWL 2ICWI 4J3WA 5BRZB 1G6RA 1NC2B 1ZA3B 4MJ5A 2ZOKB 1DZBA 2O5ZH 3OKLB 3OGOE 1LO2L 3C08L 3MOAL 5F7DB 3DRTA 2E6QA 4X80H 1UXSA 5KW9H 2VB5A 4PP1D 5KG9A 5SX4H 1RZJH 4KZDL 1EGJL 1ZSDB 4K94L 1D6EA 5FM5M 5KSAD 4ZSOE 1K85A 3BO8A 4KVNL 4S1QH 1N4XH 2H3NA 4DVBB 4LFHD 1WTLA 4K9EL 3EO9L 4UINH 1TQCC 2KDGA 4LPCA 3O4LB 5IHUL 4YHNB 3EOTL 1U3JA 4EIZC 4WTXA 1I7UA 1NGXB 2PTTA 4E0RB 4G6JL 3AGVA 1BAFL 1A7NL 2AABH 4H1LH 1UB6B 5T3ZH 1HQRB 4FXLA 4NQSA 5JPMB 3ARFB 3O45A 4KKNA 5T5FL 1UQSB 3ARGA 4HWUA 1NGQL 2O5ZL 2QLVB 2X4RA 5FUCC 3G5VB 1CWVA 4R0LC 2VAJA 4JFED 4EXKA 1TJGH 4PJIF 5H37G 5KW9L 3G6JA 5EPMA 2UUDH 1P7QB 3DMMB 1INEH 5DHYA 2FHCA 1RZJL 1CTNA 2EH8H 4M6AA 4F3FA 1XH3B 1PZUB 4NRYA 4ISVB 3HLAB 1CVSC 1EO5A 2WIIB 3FT2A 4HKJB 3GMMA 3RDTB 1N4XL 1EEYA 5JOPD 1PKQE 4UINL 4NRZB 1N6UA 2R0LH 3TA3A 1WC7A 2MQ3A 2V9QA 2BRQA 5FO7A 1HIML 3PG2A 4Z5RA 1HHIB 2UUDK 2AABL 2EYRA 5EIQA 5T3ZL 2C26A 1BFVH 2QKIA 3QP3A 2HJLA 1QBMH 3RVUD 4U1HB 4WEBH 3GIVA 4KZEL 2PYED 3BOVA 2NY0D 1JTOA 5T1KD 4DCQB 3FQUA 4Z7QF 4DKFH 1TJGL 3UXFA 1U8PA 3OJDA 5E1HB 4G6FD 3JSSA 1INEL 2EH8L 2XTJB 2HVKB 1S9VA 1D5BB 1JFQL 1MCNA 4EI5C 3F65A 2P44B 5HTSA 2JF1A 5F7EH 1T4KB 1CLZH 2R0LL 4Y19B 4HIXL 4HIJB 3FAWA 5T1MB 1FFNA 2X4UB 5IMKA 3VRIA 3BX7C 1QBML 3PL6C 4WEBL 1EAJA 5SWQB 4YH6A 3FT3A 1N3NA 2Q20A 2V7NB 4P4KC 3GMLA 4XNUL 1HSBA 4Y2DC 5GRZA 4DKFL 3FFDA 5EUOA 1X3DA 1TITA 3K8LA 1J0ZA 4J3UA 2Z31A 4JZOA 1CXLA 3DURA 4OLZH 4QGYA 5TDPB 3SDAA 1FSKB 1IKNA 2GFBA 2VXVH 3G9VA 1DVFA 1L7TH 4OBSA 4P5TC 5F7EL 5IHZB 3KPRA 5ILTH 5DFVD 4G6KH 4ZNEE 1FNHA 3WLBA 1RHHB 4WWKA 4PJDE 2VQUA 1FL5A 4L29B 2YD9A 3VFNB 2VXUH 1OTSC 4G9DB 1M7XA 2QEJA 4YEEA 3BYYA 2XWTA 3DV4B 3T4YB 1U6AL 2FGWH 1A14H 4BKLA 5FUZH 3DVNB 3IDIA 5I1IH 1U36A 5ACZA 3CDGB 4MNHB 4TTDD 4XCYB 1A7PH 4LPVA 3QNZA 4PRIA 1FE8H 5DHVH 3MNVA 5JMOC 2HMID 3GO1H 4XVUC 1KGCD 4MAYC 2PO6B 4OLZL 1AP2A 3DBXB 4GRWB 1S9WA 3D39B 3RZWA 2G9HA 3SDXA 1DBMH 4P9HC 4XH2A 4OUOA 3W11D 3NN8A 5SWSA 2VXVL 4DUXA 1UXWB 4J4PA 5ILTL 5DO2C 4G6KL 1XGYH 4PP2A 3RVXC 5BVJB 1BEYH 3V2AR 3MV11 1F13A 4GMTH 2WUBL 5C3LD 5IB2A 4QXTB 1SYVA 3BD3A 2VXUL 1T66C 4JY6B 5CILL 5T3ZD 2OR8A 4U1KB 4ZFZA 4TVPE 5ETUB 4PJEF 2NNAB 4UNTA 2FGWL 1A14L 5FUZL 5I1IL 3DXAB 3OAUH 5HHOD 3HA0A 3ALWA 1UWGH 4ZOEA 2F8XC 1A7PL 3PDGA 1MCKA 1SBBA 3VD3A 1AR2A 1FE8L 5A40E 2VLKD 3GO1L 4TUOB 2G5RA 1A6WH 2VR5A 4W81A 3I50H 1DBML 3SBWA 1PGRB 3VI4E 1RIVH 4YBQC 5GGSY 2HT3C 4ORGB 4WFGD 1XGYL 3WUWG 2VABB 3WL9B 2DWDA 4NKMA 4WTWA 2IBZX 2KUTA 4MA7H 2HN7A 4GMTL 5KTEH 2P5EB 3PV6A 3VFUB 4B0MM 5CS7A 1H8OA 1XGQB 1SEBB 3HZYA 5IVXF 3LEVH 2EO1A 4PJXB 4M5YH 5KSVA 3OKMB 1F4AA 2QR0B 3D25A 3RWEA 1UWGL 1ORQB 3LZFH 4KHXH 4K3DH 2ENSA 2BHZA 4X9GA 5C0AA 4OIIH 1A6WL 4C4KT 3WSQL 2APXA 2YOCA 4X9HA 3AY4A 4HX1A 5C07B 1RIVL 1SJVA 1WQVT 2X5PA 1A4JB 3KPSB 3N50A 5FKAA 1GC1H 2QQLH 1ZAGA 1K4DB 4MA7L 5KTEL 1IGMH 1T6WA 1B0WA 2Y72A 3NZ8B 2AXFA 1UYWH 3AMLA 4K71C 4M1DH 1WK0A 3LEVL 4LLMA 5DFTA 4NNXB 4M5YL 4LSDA 1JZ4A 4C83B 4IIQB 4L9LC 3TN0A 2Z9TA 3LZFL 4KHXL 3RWIB 1FIGH 1UM6L 5IWLA 4ZXBD 4XBGA 4OIIL 2Q86B 2XOTA 4KK9C 1FNGA 2MPAL 4NKDA 3ARVA 1DQTA 2R2BB 1T7XA 4JM2B 5FOBA 3H9SA 5D1XD 5F1NA 4GBXC 1YMHA 1MWAB 3TBTB 1GC1L 4JREC 2Q1EA 1ZGLM 1IGML 4M1GH 1UYWL 3JV6B 2W9DH 4QYOB 4M1DL 3KXFB 3K2UH 1EO7A 2OM5A 5EC1A 1MCDA 5FK9A 4MAUL 4OF3A 1RK1B 4LMQE 3WS3B 3B5HA 4JRXE 3BXNB 2DL9A 1FIEA 4PRDA 2DQGH 3PGFL 4L8BA 4QRPB 1FH5L 1NEZG 4LKCA 3SCMC 2W0FB 3H9HB 3N1GC 1J88A 2V7HB 4O2FA 3IDYB 1Z9OA 1I7RB 4IDLA 2Z35B 4M00A 1NANI 4HIHB 4WHDA 2DIAA 5IVXA 3K7UA 4LSSH 5E8OA 1Z5LB 2F19H 4NNYB 5E8EA 4U1LA 4YWGH 3GSXA 2P24A 2D7TH 2PYFA 3GHEH 1KJ2B 2DQTH 3ARRA 3WIIH 5J13C 5EZLA 4M1GL 4P3CH 3T1FB 2W9DL 3RP1A 4KMTL 2NZIA 4PREA 3NIGF 25C8L 4PJBF 3ILPA 4FQQA 4PBWD 4JDZA 5ACLA 3KJ4B 1IZJA 3EW3B 4WI3A 2ESVE 2DQGL 4GKZA 4NOFA 1P5UA 2YS4A 2ICEA 2YUXA 3EO0B 1MIMH 4MA8L 5M95B 5C0GB 3GJFH 2VWEC 3MODH 4HXAH 5DRNB 4NQEB 1E27B 4U3HA 4OZGF 1MCPH 1NC4D 5HYJE 2WLYA 3RGVB 3STZB 4LSSL 3HG1E 1VENA 2F19L 1MAJA 3VE0A 3QH3A 4YWGL 2PXYD 1S8DB 2D7TL 32C2A 3GHEL 2DQTL 3WIIL 4OBRA 2CLRB 4EI6A 5I76A 1JF5A 1U8LA 2AW2A 1L9MA 3NFPB 5A1AA 1PLGH 5T1DH 3SE4C 4IRSB 4BZYA 3VXSB 2RB8A 4EKXA 2VISA 3ECBA 3GJFK 2I9LA 3TZVD 2PCPB 5JORA 4JQVC 4NBXB 4ETQA 4KC3B 5FCUH 1I8LA 4M1CD 4P57B 1E4XI 1MAMH 2I26N 1FN4B 1MIML 5E6IB 5FA3B 3MODL 3PWLB 4HXAL 1O0VA 1C08A 5DD0H 4TNWF 4BSVB 2Y07H 1Z2KA 4WTZG 1DL7H 1GGTA 5D7JD 3S98A 2NY2C 4HLJA 1G6RH 1ZWIB 1PLGL 5T1DL 3FKUS 4UT6H 3BPOB 1G7JB 4X7DC 1A4KA 2DWEB 1K2DA 4XT1C 5F6IB 3BKMH 4HUXB 4FZEH 5F21B 5CJ5A 4YJZL 5FCUL 1HHHB 4YR6B 5H8DA 1TPXC 4M48H 5C8JA 4HWZB 4ODVL 4D9LH 1EHXA 1NFIB 4BH7B 5JOPE 3BI9X 3C8KB 3GSUB 2E9BA 3Q6FA 4PJBA 3MACH 3O11B 3U7YH 2P1YA 1DL7L 3C2AH 1Z0MA 4R6UA 4U1GC 3WNKA 1S5IH 1G6RL 4H26B 2D31B 4OUUB 3C6LB 4XVSH 4UT6L 5EBMB 4D0CA 3MMEB 2AJ3A 5E9DD 2APVA 2WUCH 1ADQA 4X6FB 3VMNA 5D5ME 4OZGA 3BGFC 1JNHB 3BKML 5DK2A 4URTB 3CDFA 5IT2H 1LE9A 4F57H 5HI5D 2YBRA 3SKJH 1I7ZA 3TH3T 2H2PC 2GT9A 4M48L 1RK0B 3C8HA 3EJJX 4D9LL 4ODUA 3LQZB 1OGAB 3GI8H 1AQDA 3VH8B 3H7BA 4S2SA 3MACL 3K8MA 3U7YL 1HCFX 4P2OB 4YE4H 4U49A 3C2AL 5I8KH 1CGSH 1P1ZA 3UCRA 5L7XH 3D2UD 3BFOA 4WHTB 1YNTB 2CKBB 1S5IL 2LABA 1CVRA 4HULB 4HUVA 5BQ7B 3G6AA 3V4UH 4KJQD 2R4SH 2W9EL 2DQJL 2UZIH 3T0EA 2DM4A 4WV1A 3WFHA 3V8CA 3HTLX 5IT2L 4JN2B 2XZAH 3WIHL 4NUGL 4F57L 4RGNC 3ZKXB 2OJEB 4QTIH 1X5JA 3SKJL 5LGJB 1S7RB 4MNGB 1ZHBA 4ZYKA 4Y16A 3OHXB 2RJMA 3KGRA 3GI8L 5IR1A 4DGIH 4MLSA 4YE4L 5I8KL 1H3VA 3QB7C 1CGSL 3CFEB 4NQXB 4NOBA 3QEUB 4L3CB 1BQHG 3L5HA 4WO4C 5HGDB 3ARDC 5IW6A 3QJHA 1F00I 1Z9MA 4PJAB 1EAPB 4QRUB 5B38A 3DO7A 2R4SL 4ONGH 1BBJB 2UZIL 3MRCB 3THMH 5JUEH 4LGRB 5E03A 2HVJA 5C9JB 1NAMH 3VCLA 1RZ8B 1JGDB 3MJ9A 2XZAL 2OS7A 4KI5D 4GS7C 3QUMH 4QTIL 5DYOB 3UYPA 5E8NA 3T0VA 1ZLVH 3P4MB 5GJTH 3RL1A 2E9WA 2R4RH 1JWUB 3UTTE 2BNRD 3V0VA 4A2MA 2XXMB 2MHAA 2VSCA 5HHVH 3S4SB 3WLWD 4DGIL 1UZ8B 3QIBA 1HK6A 1XF4A 1RURH 2F53D 3IVKB 1LE5A 5FUOH 3W9EA 5C6PB 4LIQH 3P4NB 3NCMA 5JXEC 4WENB 2O26U 3H42H 4DKAA 5T3ZE 1W8NA 4E5XB 3ZSSA 4EDXA 1HEZB 5GZOC 3LPWA 2V5MA 4PJ8B 3WFDH 1ZLVK 4ONGL 4OD1H 4N1EA 4N0UB 5D7LB 4F8QA 5HHOE 1NAML 3IRZA 5CUSH 5AZEH 1U8OA 3FN3A 4Y0GA 1OP5H 2VLKE 3QUML 4TSAH 4V1DA 1FV1B 3MJ8A 2H6PA 5GJTL 2HJKA 4ZFFB 3BE1H 1QO3B 1AQKH 2R4RL 4TNVF 1Y18B 4FQLH 1CF8H 3RNQB 5HHVL 1S9YB 4WFGE 4JPVL 2OX5A 3PWVB 5JIHA 2YKLH 1E4WH 1RURL 3ARBA 12E8H 3QBTB 4JFXB 4NQCB 5FUOL 1N2RA 3N1QC 2DKUA 4NYLB 1EJOL 4LIQL 4JEGB 4LPUA 3H42L 3RWFA 3H3BC 3MXWL 3QDGD 4FG6C 3ARQA 3ARGD 1QBLH 2HT4C 1BD2E 4OD1L 4QGTA 4WUUB 4PRAA 4K7FA 1PX4A 4HKBA 3C5SA 5CUSL 5AZEL 3BSZH 5FGBA 2RAMA 2IFGA 1UENA 2R69H 4X0KB 1EZVY 5C2BH 4TSAL 3NACH 3NFSH 2R56H 3BE1L 1AQKL 5GGVL 3PGCA 4FQLL 2FJHA 1CF8L 3CFJA 1AO7A 2W38A 4BFBD 1JTTA 2YKLL 1E4WL 1UG9A 4P46D 3QQNA 4MCZB 12E8L 3LN4B 1N0XH 2EECA 3RWGA 4HH9B 3BWUC 5SX4I 4PJCE 4YPJA 2FIRT 5GS1A 4P3WA 5IBUG 3T0BA 4WDIB 1QBLL 2RCSH 4GUPA 5J56B 2GY5A 3BMWA 4IDJH 3DSFL 3QQ4A 4PD4J 4KKLD 3MOQA 3GB7A 2H45A 4MJ5B 3BSZL 2E9JA 1NLBH 3WEXB 4M7LH 1B0RA 2R69L 4BFIA 5C2BL 3DRTB 1LDSA 1S9XA 5CSGA 2V5TA 1MCOL 2R56L 3NFSL 5E8DH 4TPRH 3NZHH 4YC2B 1D6EB 4HS8L 2AEIT 4J6RH 2J2ZA 3RTQB 4KRLB 1TETL 2AK4A 5C0BD 1N0XL 5JW3H 5J1SC 4XP9H 5DJAA 1P2CA 3PWPA 1QSFD 3RUGE 5C7XH 2FYYA 4JGUA 3QUYA 5TQ2H 4G8GD 1F11A 4PRPA 5DMGC 2ZUUA 5AG8A 1CN4A 3VWJC 4IDJL 1GGUA 1M7DB 2M26A 5I16A 2RR3A 4F7TA 5JW5A 2H32B 5E00A 1NLBL 4LHJB 4M7LL 3U79A 3WO3B 2ITDA 4B5EA 4M7LT 5CSBA 1S7TA 3EYFA 3UBXI 1MVUA 4NJAH 5E8DL 1ONQA 1XGUB 5EPMB 4RGMC 4Y89A 2UY7A 4TPRL 4FFYH 5HXMA 4F3FB 2AK1H 2GK0A 2FHBA 4OFYA 3PP4H 1QLRA 1V3JA 2FD6L 1NAKL 1A47A 1X4YA 5C0ND 1H3UA 3V4VH 2VLME 1LILA 4JHBA 1EEYB 3FQXA 5FYKH 4I0PC 4JZJB 4XP9L 4HG4J 5BS0E 1RJZB 1WC7B 5C7XL 5TQ2L 4JQIH 4Z5RB 1FG2A 2V2XA 2X1OA 2QKIB 4AENA 3AU1B 1YEEH 5I73C 2VLRD 4Y4FB 2BVPA 5DI8A 5I66A 4XMKH 1QFWI 5GS2H 2OL3A 3BGMA 1HHGA 5KN5B 3UC0H 4K8RH 1FZJB 1XR8A 4NJAL 3S7GA 2AXGA 4FFYL 5SWSD 2AK1L 3B9AA 2VTFA 4P23B 3PP4L 3Q48A 3VXMD 4U2YA 3BN9D 4L9DA 4HSQA 4ACPA 3QUXA 1DEEB 5FYLL 2YUZA 3N06B 2K1MA 2ADJA 2AI0L 3JBG7 4RA0C 4JQIL 3WKML 2IADA 4PIRF 2IWGA 4EN3A 4OZHF 1AHWC 4ZAKA 1F4WL 2ZNXA 1C16A 1YEEL 4JFPA 2BERA 3H7LA 5F9OH 4XMKL 1NUNB 3IJSB 4G9FA 3K1DA 1N3NB 3O6FD 3W5NA 3UC0L 5EUOB 4K8RL 5DMJB 1GIGH 4EI5A 3OPZL 4ZQKA 5I1AA 3NAAH 1KCLA 2Z31B 2X4QA 4U05A 4JZOB 3DURB 2VQTA 4RSVA 4X98B 5DJ6A 1BIIA 4Y1AD 5CKAA 3DRQA 1DVFB 3L3GA 3KPRB 5BXFA 3M07A 2NYYD 3D3VA 4C56E 4WWKB 2XN9A 4NN6B 4KKAC 1MCWW 1LDPH 3ARWA 3MPCA 4P4KA 3B9KD 5GIRB 3VWKC 4WW2F 1JPTH 5GRJH 4ZS6C 3AVEA 3QHZH 2NY1C 5KJRH 3U9PH 3QPXH 5K59F 3DX8B 3IDIB 4HWEH 3Q3GA 5C0AD 2Z8WC 3W2DH 1GIGL 1XGTA 4OFVA 2DLFH 4LLUB 1E4JA 3FHQA 4QCIA 35C8H 2ZP0T 3GRWH 1QFOA 3SDXB 2HTKD 3GBLA 3TBWB 4LBEA 3NN8B 4DW2L 5FHBL 4BQ6A 4NCC2 4PP2B 2VMFA 2IAMD 3MNWB 4RAUA 3CH8A 2L7JA 3OV6A 3D0VA 2GCYA 2VN4A 5E9DE 5IB2B 1N0LA 5CBEB 2JELH 3U0WL 1MVFA 1JPTL 5GRJL 5L6YL 1I1AC 3QHZL 2XIDA 4ZFOL 4P2RA 3QPXL 1AH1A 1IQDB 5JDJA 4HWEL 1YYMH 3NCYP 4MAYA 1UA6H 1G7QB 2HTLD 4LSUL 3GJEA 2DLFL 4H20H 4FQXA 4G8FA 4LEXH 35C8L 3T77A 3GRWL 3H9SD 1HCVA 2CUMA 3MRNB 1S7XA 4PUBH 4OZHA 4XPTL 3KWWB 1UM4H 4LCUB 1RIHH 4OV5A 5FYLD 1MHEB 3MRPA 4PLKC 5L88H 5FYKD 4U0RB 5CEZE 3CMOL 4H5SA 3RVTC 1RZKH 2DQCL 3EDDA 3GMQB 2HN7B 1ADQH 1X5AA 2JELL 5INDA 3QUZB 2DB8A 3MLZH 1ROWA 4PJHF 1S9KC 4OM0H 4MX7B 5KVMC 2ZSWA 1GL4B 5LGKA 3ROOA 5KSVB 4IMLA 1CICD 2R0KL 2EKJA 3RPIB 4Z7WF 1UA6L 4MJID 5GS2D 1XMWA 5JR1L 4BH8B 1CXHA 1TZIA 4K8RD 1LD9A 5ADOH 4H20L 2VUYA 4LEXL 5K9KB 1FPTH 4ELME 3DUUA 4JY4B 5D7KD 1PG7X 4PUBL 4PD4K 3ZDZF 2H41A 1UM4L 4WW2A 5DS8B 4ENEC 3KHQA 1MFDH 3ES6A 5L88L 3FZUD 4ZUSB 3FCTA 4YHLL 4PJ5B 2QJDA 3G5YA 3AXLA 1RZKL 4HEPG 3U46B 2KH2B 2BNQD 4QNPE 1NLDL 4YK4B 1NC2D 5BRZD 2L7UA 5AUMA 1AIFA 1IEAA 1ZS8B 3V5KA 3VG0L 4ODWB 3QFDA 3K2MC 2WINA 3UPCA 3NIFE 4OM0L 3ZT6A 3OKDA 3QUKA 2XFXB 4KI5E 3C6SB 1KG0A 5L2JA 3U4EB 5ADOL 2BNRE 1EPFA 3W9DB 5D72H 3R8BB 4OCYH 3QWRA 3LKNB 3QDMB 2XZCH 5ESQB 4XBGB 3QIUC 5D2LE 4S0TD 1D3CA 4Z8FH 5IHBA 2B1AH 1MFDL 3EDKA 4FRWA 4IMKA 5F1NB 5B3JE 4OAWA 3S34H 3VFSB 5I19H 3OR7B 5SWZD 4Z7NF 2UYLA 4JANA 4MVBD 5EC1B 1D9KC 2YZ8A 3JV4A 3DMMD 1CZ8H 1CXFA 2R1YB 1EFXB 4L8BB 4DN3L 3K0WA 4HG4K 5D72L 3RDTD 3WJLC 4OCYL 2XZCL 3U2SA 4O2FB 4GBXA 1WZLA 5JTWA 2CMRH 1IFHH 1P7KA 4PJHA 4FXGA 3TIDA 2B1AL 2YA2A 5D2NE 1X5IA 2CPCA 3D18B 2R8SH 4X6DE 4U1LB 4QRSB 5FYJH 2P24B 4U1SA 5D96C 5I19L 5J9PA 4MQXD 5GISH 4PREB 3I3EA 2HFFA 1TQBB 4UTAH 1CG9B 3RJQB 2X89D 3O3AA 3SO3B 1Q94A 3W0WA 2XTJD 1U95A 3V6OC 1JTPA 1JN6A 5KZCB 5C71A 3ZYJA 2AEPH 5JHDB 3O9WC 4HPOH 5H37H 5EB9A 4WI5A 2JB5H 1CGVA 2DLTA 3UTSE 5DEGA 2CMRL 1IFHL 4NZDA 1FORH 1VA9A 3Q0HA 2GK2A 4PGEA 2GHWB 1XR9B 5KVDH 2BDNH 5JW4Q 2IANE 5FYJL 2VKWA 3HI1A 5IEKA 3VFMB 4EI6B 5GISL 1U8LB 3QFJE 3D9AH 1KYOJ 1OP9A 3RY4A 5K9QI 4UTAL 1KIRB 4JG1H 4FXKB 2NY5C 4M4RA 3ZE1F 5L8LB 3FONB 1T0MA 2Y6SD 4CN1A 3TT1L 1DLHA 1R3IH 1WICA 4HPOL 4ALAH 3ZTJH 3LKOA 4J3VA 1P53A 5TGBA 2NXZB 1BFSA 1CFSA 4ZO9A 1MLCA 3QAZC 4L4TB 4JQXC 4ONHA 1W2KT 5KVDL 4IRJB 3RPKA 2BDNL 4G8GE 2BOBB 5J1TC 3F7QA 4M8QB 3P30L 4LLQA 3IETB 2VDLH 4K7PH 3D9AL 3STBA 1YMME 1BVLB 2KBGA 3AS1A 3IJYB 4JDVB 4TQEH 4IJ3C 3ZKMD 1R5VB 4X99A 3DWTA 1X5HA 3BQUC 4KJYA 5BOPA 4HCRH 2E6PA 5DMYA 1BP3B 2XKUA 4JG1L 3T3PE 2ATKA 4P59H 3WFEH 2R23A 2P5WA 4HGWB 1T83C 4I2XA 3GSQB 4O51A 4AEIH 4ALAL 4ERSH 4O4YH 3VG9B 2A9MH 4XBEH 4ZFGH 1XAUA 1HQ4A 2UWEA 4ORZC 1HOCB 3P40A 1KJ2H 3LN9A 4AY0A 4QRTA 3IF1B 3B8YA 1ERNA 1I4FA 2P8PA 5GS0H 5HYFA 3GIZH 1OW0C 4J3OC 4U6XA 4JKWA 4NKQB 2VDLL 2A73A 3DVGA 4K7PL 4FNLH 3V0WH 4TQEL 1MUJA 3DXAD 4V2BA 2HP4A 4UZGA 2AJ3B 3W39B 4LCWB 4HCRL 5MENE 2QBWA 4NP4H 3MV7D 4Y4HC 4GG6E 3MJ7A 1DQLH 5DK2B 1U8NA 1C1EH 5ANMB 1NFDB 2JKXA 3LOWA 5LGHH 4H0GA 4Y5XB 3DX6A 4AEIL 2X05A 4ERSL 3VXME 1K4CA 1AC0A 3EYSH 2A9ML 1TENA 4KJPC 4KROD 1AQDB 1UWXH 1KJ2L 4S2SB 1ZT7A 3KLAA 5GS0L 4GQ9H 1MCIA 4XXCA 5FYJD 1WJ3A 1SM3H 1X4XA 2H1PH 2FJFB 5I1DB 1OQXA 4FNLL 3BEVA 1LO5A 5ENWA 2HLAA 5EORH 3RZCB 3AROA 3G5XA 1H5BC 2SEBB 4L8DA 4QXGL 3RVVC 3RWJB 3T0EB 4EZMA 4N8PA 2X9XA 3QEQE 4MDJA 1J5OH 1UWXK 1DQLL 2NLJA 4Z7OF 2CRZA 3VFVB 3OKKB 2XWJA 3TO4B 5LGHL 3O4OB 4MB4A 3HN3A 3L95A 2ED8A 2NW2A 5C07D 1RU9H 2HT2C 4LNRA 2A83B 4U7KA 2EIDA 2VC2H 3KPSD 4OJFH 5IR1B 5BMFH 4HFWB 2QHRH 2VOTA 4KKBD 3HMXA 1FYTA 3GGWB 5D93C 2ADFH 4GQ9L 3SGDI 1G0YR 3FQTA 5IW6B 2OTPA 1XCTA 2IBGA 1XIWA 2CIKA 4HUUB 2Y5EA 1ACYL 3V7AE 2HVJB 3LRGA 2XWBB 2RGSA 2LU4A 4UB0H 3C60C 4U31A 1RU9L 5E8NB 3HMWH 4DAGH 1OB1B 4HGKC 3RL1B 4WW1B 4FTVE 1AJ7H 5HGGS 2VC2L 4OJFL 3OQ3B 1S7WA 2MHAB 4WO4A 2QHRL 4OKVB 1JV5A 5I1JH 5I17B 3OZ9H 3MRMA 5ITFA 5EOTB 3GMOA 1WWWX 4XGZB 2ADFL 5I2IA 1J9CT 2AEQH 2XZZA 4WEUD 3KXFD 1QFHA 2QQQA 3NA4A 1D5IH 1IM9A 3MGTA 5IQ7L 4MXWH 3PV7A 3WNPA 2XKNA 4LU5L 4O00A 3TBYB 1UEYA 3NPSC 4QRPD 3IFOA 2N56A 4DOHB 3BP7A 3AAZA 1A6UH 4LCYB 4P5KA 3WHE0 3V5HB 4UB0L 1SEQH 2WWMD 5FGCE 5F7LB 4WFHE 4DAGL 3DX9B 1CS6A 3ULUL 5F7UA 3ALPA 1QPXA 1WVZA 3CFDA 1D5ZA 5FYLE 1JHKL 4J8RA 5JXEA 2BFVH 5I1JL 3OZ9L 3LKQB 2D7OA 4MNQA 3QUYD 1IC1A 1QQDA 2ZUTA 4KAQH 3QNYB 5GS0D 2AEQL 2QQKH 3H0TA 3GSRA 3BRDA 5EFIB 5IMOA 5DZLA 3SGKA 4MXWL 2X4OA 3KYOA 3C5SB 5MERB 4MQTB 3BWAB 3DETD 4KY1L 4Q9BA 3WD5H 4OFYD 1SEQL 4L1HA 4NQED 5CZVL 2FB4H 1BREA 1S7UB 3MYJB 3QI9A 3KPOA 4HS3B 1KYOK 4KUCD 2BFVL 4YHIB 5IB3A 3OB0H 4K2UH 3PDOB 3CX2A 5J8OA 5BRZE 4Z0XA 4KAQL 2GTWB 4PP1C 5E4EC 5CJXC 2QQKL 3B5GA 5C09A 5MEPA 4FHBD 1BGXL 2CSPA 4XMLL 4AL8H 1FP5A 3B83A 2J12B 3JTSB 3BDYH 5GJSH 2F9BT 2NTSP 4JKPL 5GGTH 1CL7I 2ZJSL 1ND0B 4D2NA 1Q9WB 2FLRT 2JCCF 3HAEB 1MJ8H 1S5HA 3O4LE 4NC1E 4OZFG 3MRBB 1MCLA 5T3XH 5I8OH 3IDJA 5C0EB 4IOSD 2NY7L 2PN5A 2W1NA 2BSED 1BJMA 1OF2A 4FP8L 5EOCH 4BQ9A 2AK4B 2OMNA 2B5IB 3S35H 4AJ0A 4LSTL 5CBAA 3T0XA 4NHCH 4CN4A 1P2CB 3HZKB 5TF1H 2FEDC 1CT8B 5L2KB 1WT5C 5F9JB 2JB6A 4BSWA 3ZYIA 5I16B 2HRLA 3BDYL 5GJSL 5E70A 1M6OB 1A1MA 5E00B 3QXUA 5SV3A 5JW4N 1HHKA 3GSNA 3UZQA 4KV5F 3VW3H 5GGTL 1JGEA 5MP6H 1MVUB 2AJZA 1MJ8L 1IAOA 3QR2A 5MEQB 1KPUB 2FIKA 3MRKB 1LNUB 2NY0C 5T3XL 1TQCB 4RX4A 4S1RH 1CXIA 5EOCL 3G5ZA 3FQXB 3MBED 3S35L 2GTZB 1DQQB 5TE4H 1TVBA 3CC5A 4NHCL 1VESA 4NHUA 3PWJB 5TF1L 1CDHA 4H8WL 1MI5A 5C0FA 1VFOA 2ZCKH 4AEHH 4R0LB 1J0KA 1IKFL 2XTJE 5FHAH 1EEQA 5DI8B 4QHLB 4P2QA 5J57B 2MCG1 3VW3L 2OL3B 3VJ6B 5DJXA 4KK5D 5MP6L 1XR8B 1V5JA 1J8KA 1RUKL 5DD5H 4P2YA 1JPFA 4Y19E 1MREL 2XY2A 1F3JB 4AMKH 2DJUA 4X6EB 2X09A 1L6XA 1YEFH 1PAMA 3ZE2E 3CVHA 4S1RL 4POYA 4L3EA 2EXYD 5TE4L 3OJVC 2DF3A 2FECI 3WXVL 2C5DC 1OY3B 4W6XB 5HHNA 2IADB 2ZCKL 4AEHL 1IQWH 2JCCA 1I3VA 4JFPB 1C16B 1HYSD 5BJTB 1JWMB 3NCJH 1IEHA 3ZDXF 1CFTA 3VXOB 3QDJA 1FNEB 3E2HC 4EI5B 2Q8AH 3V4PH 5DD5L 1YN6B 3HZVA 4AMKL 4BK4A 2WBJC 1FZOA 4NO2A 1KIPA 4LFHG 1NEUA 3DOSA 5F93C 3F5WA 1CDIA 1EA9C 5AD0A 3L3GB 4OCWH 3TPUA 4TTDC 4XZUB 5BXFB 3GBML 2YPLB 4F2MA 3U1SL 3D3VB 3LHPH 3PL6B 5GGRA 4I9WD 2H32H 5IIEA 1NDMB 4P4KB 4YUEH 1DJSA 3ZZ1A 2A0LC 1FZMB 4Y2DB 3W11C 3FRPG 4X83A 1X4ZA 4U4BA 5CEYB 4UU9B 2ADGA 4GRWE 1T5XA 3D39E 3NCJL 2NTFA 5KBNC 1OSZA 3C8DA 4WFEE 3Q3GB 4EBQH 1N59B 2NCMA 2QADD 1HXMA 1XGTB 3V4PL 2ADIA 4QF1B 3CFKB 4JFHD 4L8SC 1KN4H 3HPJB 3IJHA 4QCIB 4P5TB 1BLNA 3KPMB 1KXVC 4HQQH 2E7MA 5DR5H 1JGLH 5T3XD 1I75A 4LBEB 2JIXA 3BDXA 4OCNC 1A1NB 2OZ4L 1IM3A 1GZQB 3NCEB 4PJ8D 4WGWB 4D0BA 3IFPA 3OAYH 3DXAE 3X3FH 1CGUA 1NMAH 5DSCB 1B2WH 2Z0BA 1OTUD 3FB5A 5ESAA 1WZMA 3S36H 3ETBF 2AQ3A 2GJZA 3IDGB 3X12B 4HUWB 1IT9H 3VXUA 4MAYB 4EBQL 4N68A 4PGCA 5DD6B 1K8DB 3MRDA 3HFMH 3OJ2C 4Y8DC 1KN4L 4HAGA 1RZIB 3OAYK 4ZTOH 3T77B 1ZLWH 2P5EE 4X4YB 3IXAB 4HQQL 5DR5L 2DLHA 1JGLL 3TV3L 5FYJE 5E6ZA 3N9GH 1GOHA 4PJXE 3MTRA 1FJ1A 5DJYA 3DARA 2J6EH 4G6MH 3KYNA 4YDVB 3HC4H 3PJSA 1AGCB 4FN0A 5E6YA 1I1AA 3D1MC 1NMAL 2H26A 3ULVE 4XPAH 3MZGB 2IH1A 2FJGA 4S1SH 1I1FB 1A9BB 1KCUL 3SQBA 1T6VN 1IT9L 5C07E 2PETA 3PABA 1A6ZB 3O2VH 4B7IA 4DK3A 5D1QA 3HFML 5DF0A 2P4AB 3KPSE 1MLBA 2BY1A 3TYFA 1JPSH 2OI9B 5JA9A 4X7SL 4DKDC 5T1LA 3DUUB 5KVGH 1A0QH 3SHSA