4IRZH

Crystal structure of a4b7 headpiece complexed with fab natalizumab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
222
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQRLEWMGRIDPANGYTKYDPKFQGRVTITADTSASTAYMELSSLRSEDEAVYYCAREGYYGNYGVYAMDYWGQGTLVTVSSASTKGPSVFPLAPCSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How natalizumab binds and antagonizes alpha 4 integrins.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Integrin alpha4 subunit
total genus 36
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2013-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH01
4Q9QL 1EX0A 2QSCH 1NC4D 2N1KA 4Y5XC 5J56B 1AKJD 1W8NA 1V8HA 1QFWH 3HE6B 3ARED 3P73B 1J10A 1HYSD 4PJXA 3MV8E 2X4TA 3WDHA 3E6FB 5FHAL 4O02L 2XYCA 5DRZA 2XV6B 1C1EH 2NCMA 4F57L 4KJPC 4RISH 2VLLA 2QQQA 3AVEA 2Q86B 3GKWH 4G8IA 2BSSB 2AP2A 3SGJA 4G8GA 1XGUB 4IS6B 2FJGA 5M94B 1K8IB 4NQEA 4PFEA 3S88H 4GRWF 3RQ3A 4G9FB 1LEGB 1JPFA 1IZJA 1U3HC 4ZOBA 3L5WB 5BZWA 4HEPG 3U7AA 2GTZB 4Y19E 4KK6D 3ES6A 2SEBA 2O26U 1JE6A 4JFEE 3BXNB 4YPGA 4LQFL 1WWCA 3QXDB 1F90L 4ZUWB 3KWWA 2ADJB 3MRJB 2LU7A 2K7QA 2PR4L 5J11B 3RL2A 3HCVB 2EXWC 4ZUWA 2GJJA 3CCHB 4QWWD 5FM5M 3V52L 5BRZB 5FO8B 5DJ2A 4O2FB 3HG1D 4JFFA 3TCLA 3BDBA 5I6XB 2WUBH 4GFTB 1R3HA 1SBSL 4HCRL 5TF1H 1PGRB 1WZMA 2VLKD 2EC8A 3C60D 2A6JA 3MJ6A 5J12C 3HI6L 3PGFH 1HXMB 5JW4N 3OPZL 4J3XA 5D2NC 3BVNA 3EO0B 2FSEA 4LNRB 4LSQL 3VXPA 1S7UA 3SKNA 4HKBB 1F4WL 2J88H 2AKRB 1ADQA 3DX7B 4IRJD 3KHQA 5F93C 4XHJC 2XTJC 3UTTB 2YPLE 3I6GA 3MRRB 5T5FH 3T0EB 3S37H 2APXA 2LVCA 1MCLA 4LHJB 3NPZB 1N8ZA 2Z31B 2X09A 4S10A 3TYFB 1FG2B 1IGIL 5DHYA 4M1CD 3TV3L 3ZTJH 1K2DA 3LS5L 2AJZA 1TMCB 2X4TB 3V0VB 3GIVA 1EHLH 3CD4A 1G9NC 3RVUD 1X5GA 1EHLL 2CIIA 4WWID 1RK1B 4M6MH 3RZCC 2BSRA 5C92A 1HILA 3QYCA 2Q8BH 4N9GB 3NCCB 3W39A 3MLSL 2CRYA 1S9XA 3AREA 3FQTB 1NBYB 5IMMB 3BW9B 1EGJH 3MLXL 5AG9A 4UAOC 4BZ1L 4L4TE 4K8RC 5JR1H 1JMXA 4HFWB 5JHDE 4DVBA 2W9LA 1Q72H 2Y6SC 5D7LA 3O9WC 4LCCB 2WV3A 4MWFB 4KJQC 5LGJB 1KACB 4YDJB 3ZLQC 5IQ9B 1V7MH 3V2AR 3L3DB 1RUPH 1J8HD 5I9QB 4U1NB 4ZDHA 4OAWA 1EFXA 2C3WA 4TOYL 5JMRA 3GIZL 4NKDA 3LH2H 4P3WA 3RI5K 5IVNA 3TJHC 3B9AA 4YBLB 4G8FA 3SDCB 1W0VA 4OCLC 2FIRT 4M9PA 3VD4A 3GSOB 1A4KB 1AD0B 3SGDI 1NKRA 2WW8A 2X70B 3KYOB 2F74A 3MA7A 4LHUB 5DEFB 3VFMB 4UV4L 4I18B 3REVA 2WWMD 3R0NA 2EIZB 4S2SA 3BZEB 4JRYE 4HWNA 4M7LH 4AEHH 2NZ9D 5AYUH 4LLUA 1EUTA 1YEKL 1MY7A 1JI2A 4G43A 4KQ4L 4NKQB 1ZGLA 3TO2B 1YY9C 2H3NA 3VFSA 4ZNEE 3TBVB 3HTLX 4ZS6D 2KUTA 4K7PH 5I19H 1DEDA 3BP5B 1FZKA 5GGVL 5ISZD 2IWGA 3W0WE 2H2PD 3UBXB 3GM8A 3RUGB 4JZOB 5KSAB 3G5YA 1YPZE 4DGIL 3BUTA 4ZSOB 4PJ9B 2VE6B 4JRXD 5FA3B 5ESQB 1XCQA 4IRJA 1PZUB 3S98A 1F45A 3X3GH 3QRGL 1U0QA 4L8SA 1C7SA 4JLRB 4YIQB 5HDOA 3M8OH 5A2KH 4GXUN 3NFNA 3MUGA 4QRTA 3EO9L 3VI3F 1EEUA 4HXBL 3QIUD 1CE6B 2WK2A 3CFJA 2DLIA 3QEGL 4F9LA 1IQDB 3DVNB 1L7TH 1KENH 1LO3H 1P5VA 3STLA 4G8GD 1L6XA 2F74B 2WBKA 5F1KC 5IW1A 1NLBL 1NANI 3JV0A 3RJDA 3DLQR 4NDMA 4EDWL 1UCTA 3TH4T 2GJ6B 5CGYC 3VXSE 3BQUB 5AWNH 3EYUH 3TBWA 1ADQH 3MLUH 4R0LA 3FRUA 3KPLB 2HJLB 3UAJD 1EIBA 3RNKB 1BBJA 2H9GA 5D1QB 5HHMB 1HHKA 2CKBA 1D5BB 3DYPA 1FNEB 3JZ7A 5CJQL 1W72L 4FQXD 3MV9D 4IJ3C 3A67L 5TQ2H 3VXQB 1FZMA 3MZTA 4P4KC 1AKJA 1NGWB 3RA7H 2V6HA 3LKOA 4MD0A 2XG5A 5AYQA 3PL6B 1DQJA 2Y07H 5ITBH 3MNZB 1K85A 1NFDE 2FL5B 3SPVA 2VISB 2C1OA 1FYTE 1KBGL 4PJGA 5DFTA 4RRPG 4WNQA 1HXYB 3ESVF 3B83A 5F7EH 3FFDB 4L4TD 1M6OB 4GRLB 3DGGB 3VD9A 3T0EC 1R3JB 4MXWL 1QSFA 4W4OC 4MSWA 1EJOH 3IT8D 1ONQB 1N6QL 4QOKD 1TNNA 1FLRL 4QTIH 1TVBB 4UT9H 1NCDL 4OLZL 5ENWB 3OAZH 4P48A 4GKNA 5ICZA 4L8DA 4LIQE 3QUZC 3X17A 3U0PA 2B0SL 1NGQH 4KDTC 2EIBA 1JZ2A 3AS3A 1CN4A 3QIUB 5IIEB 3RZWA 3NABL 3K3QA 4HJ0D 4O4YL 4OKVA 3LQAH 1MI5B 4YDIL 2W9DL 4OZIF 3BIKA 5J3HC 4HKZB 2Q87A 1XR9B 3DTXB 1I8LA 3PWJB 5F7FA 3BP7B 4HMEA 2G9HA 1FVDB 5HPMB 5ISZE 4QY8A 5CD3A 3MLRL 5CJOL 4GXVH 1JGVH 2JF1A 1HXMA 4IOIA 1MAMH 2N56A 1OTUC 3DUSB 2H2PC 2P24B 3K80A 1KLFA 2HG5A 3T04D 3F7VB 2KBGA 3VWKC 1AR2A 1MHHA 5D9SB 5FO8A 1BZQK 1S7VB 1U91A 5IP4A 2F53D 4U1JB 1KXVC 4EOWH 1T7YA 3UTZB 1I8KB 1QFOA 4PD4J 1I9IH 2WIMA 4O58H 2X2YA 3FQRA 4DEPC 2OSLB 4L4VD 1UENA 4R90L 4MYWB 3WIHL 2IPTL 5ITFB 4XVJH 4Q0XH 3BPCB 3MO1B 5DFWH 3ARXA 4M1DH 1SEQL 3SE8L 3MJ7A 4XNXH 3H9HA 3VFUA 1JPFB 4LP4A 3VH8B 4WY7H 4X6DB 2HJKA 2F8VA 1NCWL 4PJCE 5EU6B 3LMJH 4MB5A 4PLOB 2VJXA 3DYOA 1PKOA 1N0XH 3CH8A 4PBVC 1H5BA 1YMMD 2FEEL 5IB3B 5DO2C 3UBXA 2BOBA 3HRZA 3MRLA 1IC5L 2KL6A 1MWAB 5I2IA 4MAUL 5EOCL 4BA8A 4AY0A 4G3YH 3CSBA 3Q6FB 3P0GB 1FLRH 5DRXA 2X05A 3VMNA 2EO1A 1B4JH 2EYRA 1U8IB 4CU8A 2AXFA 4QGYA 2IFFL 1AJ7H 4YHKL 4AG4L 1A6VL 1KOAA 3QUXC 4PJAB 1N6VA 1MJJA 2CDGA 3FN9A 3C5SB 4GAYA 3LV3A 5SWZD 1KCRH 4YDKL 1OGTA 5GZNC 3UJJL 4N1HB 3GSOA 1GGBH 5CIPB 3T2NL 3C5SA 4GAYB 2R0ZL 5SX5K 2UY6A 1JVKA 2EDJA 4TQEH 1GRWA 1WEJL 2BNUB 2HT2D 2OQJB 2Z31D 1F5WA 4JHBA 1K3IA 4M1CC 1NBQA 3GBNH 4APQD 5GGUA 4DN3H 3ZO0A 4TNWK 2XA8H 4U1LA 4OBRA 1DFBH 2FYYB 4EXPX 4UB0L 1ORSA 3D3VD 4FRWA 5FUOL 1J0JA 2HFGL 4XPHL 5HI3D 1A7NH 5IB3A 3VFWB 1A6WH 1TTGA 1S7TA 1X7QA 4BUGA 3IDXH 3V4PH 3B2UC 1MLBB 3TN0A 3V4PL 3BPNC 5GGQL 1MRFL 4X6DA 4RGMC 1CF8H 4L4TA 3MCG1 4B5EA 8CGTA 4LCIH 3G6JB 3WJJA 5F6HI 3PXHA 4G6FD 5C09A 2FX9H 1SJHB 4DGIH 4NM4L 4ZFOB 5I76A 4NZUH 1F2XK 2PCPA 5GSRB 4Y89A 1QA9A 1N3NA 5CJQH 1MFNA 4K7FA 4XX1E 5EBWA 5DLMH 5AEAA 4ODWB 4BQBA 2DQHH 4KJWD 2DI9A 1REIA 4AH2B 4YR6A 1C8PA 3HNVL 3TA3B 4FQ1H 3MODL 1H3PL 4HS6A 3WBDA 2EH8L 4P2YA 1IGJA 4LPVA 1JGDB 2DWEB 2BJMH 5D7LD 1FFRA 3M17A 1P7QD 3UTTA 4C4KT 1E0OB 2G75A 5FYKL 4P23C 3D9AL 5I1GL 4G6AC 4OT1L 5I16A 5GRVL 5I75C 3PE9A 2FGWH 5FM5O 4U1IA 4XNQA 4WWKA 1B90A 4RMRA 4Y7MA 3CPLA 4LNRA 4FQXA 1DCLA 5C3TA 2Q6WB 2YSSA 1AQDA 1OVZA 4PRDB 4QGTA 2G60L 2H26B 4EDXA 1EH9A 2DQUL 1R3HB 4MB4A 3GSQB 4R2GC 4M5ZH 1KCRL 3L6FA 4YDKH 2ADFH 1T2QL 4KRLB 1P7KB 4YEFA 2QLVB 2HT4C 4LPYA 2QTEA 2VOTA 2V2XB 4JHWH 1FNFA 3D85A 1TZGH 1EVTC 1UB6B 4XNZC 1UKSA 3ARDC 1QFPA 5TFSH 1NEUA 3FQXA 2AEIT 2WP3O 4TVPE 3IKCA 5F1NB 5JA9A 2R2HB 4Z8FL 2SEBB 4JFDB 1XF4B 1I9RL 1A1MB 1NCUA 2ZCKH 4OLUH 4XI5D 3ARFC 1AHWB 4JCLA 4LDOB 2BXZA 2DI8A 3GJFK 4F9LC 1U3HD 1IC1A 3GZKA 2BOCB 2BVQA 2H32B 4PJGB 2YA2A 5MEQB 3ARBA 1GHFH 3SE9H 4HIIA 4HUKB 3TVMC 1NCBL 4TUKH 4M8QA 5BJTB 3H0TB 3QEQA 4QOKE 3WFDH 3NIGE 1U58B 4E42A 4ZUSB 1NFIB 2A2QT 4QCIB 4ZUVB 2F54E 4Y88A 1SMAA 3RWJB 2FR4B 5AZ2H 2NY1D 3QQ3A 1NJ9A 3QPQC 4RIRA 1YQVL 1TVHA 3IVKA 5CMAA 3BGMA 3N9GH 5C0FA 2WQ8A 1NCWH 3TBWB 2OK0L 3VCLA 1FVEB 4I0PA 3WS6A 4HWBH 4ETYA 3CX5J 1JUFA 1A6AA 3EO1B 3DX9A 4RNRB 1NFIA 4QCIA 1TZIB 2BNRE 1N5AA 3SGKC 5DJZA 2ZUWA 5CBAA 1IEHA 4NQDD 3MRKB 5BOPA 2HYMA 3ULUF 3CDGA 3C08L 5J6GB 5I66B 2QBWA 3FO1B 1KCVH 4Q7DA 5DR5L 1CR9L 1NC2D 4O58L 1CDYA 3QJHA 3RWEA 2DQGL 3LS5H 1JGEA 2ZOLB 3L3OA 1MQKL 3SKOA 3LIZH 1S7RB 3KLAA 3N06B 4X5XA 2PNDA 2FEDC 5HGHB 1RMFL 3JTTB 1DQDL 2OR9H 1DBKH 1T6VN 1U3ZA 2IAMC 3WJLC 3VFTA 1OAYH 2HN7B 5EO9B 3QDGA 4EN3C 5IR1B 1NMCC 3S96A 5GZND 4Z5RA 3OTTA 3SKOB 2E7LA 1I7UA 1RPQA 2XFXA 5KVEL 4APQC 5IESL 3KJ4C 4IJ3B 2HTLC 1WFUA 3KPMA 2JIXA 5ILTL 3SJVB 2APBA 3DUUA 2M8XA 3TT1H 3THMH 4XPAH 4C56A 1KG0A 5DRNA 1JGUL 5GJSL 5J1AB 5IG7A 5CGMA 1D9KC 4JM2C 3HB3C 4FZ8L 1OAKH 4J3SA 2DD8H 3SDDC 1X3DA 4JFQA 1UC6A 2VQTA 4OCYL 3C60A 1EJ6A 1W0VB 1RURH 1YA5A 2EDKA 3T0DA 3BRGC 4TUOA 4PLKC 2ZPKH 2FO1A 3VW3L 3PWVA 1IGJB 5IKCB 4C59B 2F19L 3DI2B 3DIFB 2R29H 4JCMA 1FPTL 1IARB 4Q6YA 5EOCJ 5TF1L 2DDQL 2ERJC 3UCRA 4ZFFA 4JPWL 2VDNL 3LKRA 1YYLH 1WBXA 3DROB 1VPOH 3ARBD 4KDVA 5FXCH 1CDCA 3BE1H 4J12A 1U93B 1WSST 3DXAA 4LDEB 3GBMH 1DQLL 2DWDB 1I8IB 5HSFA 2NY2C 5FYKH 3RP1A 1P4IL 3G5ZB 3LEXB 4PJ5B 4P5KB 1OAZL 3HI1A 4RA3A 1HQRA 3O3AB 1B2WL 1RZ7L 2KZ1B 4IBLT 1OP3H 1FVEA 4I0PB 4HK0A 4R7DB 3GSXA 2P44B 5JXEA 5IEKB 1JTOA 4R0LC 4LPTA 1ORSB 3KYMA 1LK2B 5DLML 5JIIA 3HR6A 3KPNB 3LB6D 1G6RB 4P46A 1UWGL 5J57B 4N8PA 1HSBA 3HE7A 4PTUB 2BNQD 2PUQT 4QNPF 2YMXL 4Y0GA 1WJ3A 3H9SA 4A6YH 5K9KB 4Z0XB 2BNUA 2V17H 4R7NA 2P8MB 4O2CB 1D3CA 5C0CE 4R26H 1JTPA 1MCNA 3MCLH 3L6FB 4JJHA 4P4RA 1O7SA 3MRNB 2AV7B 4NQED 1DQML 3TIEA 4X5WA 4Y1AA 2B39A 2DYPD 3SE3A 3TT1L 1VFAA 5C9JB 4WUUE 2CDFB 2X89A 1FL6B 3LY6A 3HLAB 1BLNB 4P5TB 1V3MA 1HSAA 4FZEH 5CZKA 5JW4R 1A9EA 1CDBA 1CFNB 3H3BC 1KPRA 4JANB 2GFBA 3OBAA 1LGVA 1OSPL 4JRYD 4CN1A 5CS7A 5J0BA 5DS8A 5I18H 4UQ3B 3MRJA 2Y7QB 4G8EB 4HLJA 3V6OC 4D2NA 5CZVH 3QCVH 4G9FD 1KIQB 2OTWB 3QDGE 2VQ1A 2VN4A 3IGAA 4JFYB 1BVLB 3HUJF 1WIOA 2JB6A 4ZOAA 5EBMA 2BVYA 3ILPA 5HDBF 4OUUB 4D0BA 3LMJL 2R9HD 4MX7A 3MLZL 3GSWA 5LBSH 2X41A 2JTDA 5KW9L 4IIQC 2D7MA 4TSBH 1MJ7L 4MNGE 5JNYB 5LXGH 1CTOA 3KPSB 3ULVF 4PJDA 3WS3A 5FGBA 1Q9OB 1MAKA 1T7WA 3O9WB 3TZVB 3FQRB 2JE8A 4Z7VE 5JDSB 5I0DA 3U0WL 4NQCB 1NGPH 2DWEA 4HS8L 2W1NA 4HJGA 4KI5C 1NAML 2HMID 1TCRA 4OZFH 4LK4A 3WXVH 3QB7C 3WFZA 3FO2B 3AY4A 5DK3A 2J4WL 4L3CB 4I3SL 5HGDB 3HNSH 4LARL 5F96H 4TQEL 4GRWH 5IVOA 3QZWG 4CVUA 4OZGA 4HF5L 4YNYA 1O0VA 2QKIA 3GMLA 1RZJC 4WU7B 4L3EE 4OZHF 3IDYB 1DEEB 1FVDA 5HHPA 1DDHB 1ZLUK 4CN6A 2YUXA 4S0TD 3NA9H 1AD9A 4HQQH 1R0AH 2YD6A 4LLYA 1WITA 4BFIA 4DOHE 2P7TA 4OSUH 5HDBE 4WWKD 1S7WA 1T1ZB 1KPUB 3QAZB 5EFIA 1IGCH 1PKQB 3V7MA 1F4XH 2AXFB 5D7JC 4XCYA 1INEL 4GKNB 5ICZB 2ATPA 2X4NB 4HHAA 4NQSB 5DC4B 3HAEA 4MA8L 4IHOB 1AI1L 2X4NA 3LKPB 3X3FL 3L5XH 3EOBA 4GW4A 4NKMB 3TZVC 4XP1H 5CILH 3PWNA 1AGDA 2JJVA 5GRWA 4KK8C 4F57H 3VD3A 2HJKB 4PJCA 3MNWB 1AD9B 3MYJB 4OCRL 3UZEA 3GHEL 5B39G 2W60A 1BZ7B 5HYJD 1HI6B 2LAAA 1KTKE 3ZMRA 2WWKT 3RKDD 4KHTL 4M61A 4Z7UF 4Z0XA 2C1PA 2HJFB 3L3IA 4F15C 2FWOA 3BKYH 5F3BB 2QKIB 4PP1C 1A5FH 1LDPH 4PY7A 4FG6C 4OT1H 2PKDA 4FP8H 4RGNB 3GB7A 3VXUD 3E1F1 1HHKB 3NFSH 1XGTA 1HHIB 3BMWA 3OB0K 2A6KA 3L3HA 1ZXQA 1XF2B 1JN6A 4MJIA 5CLWA 1Q94A 1UFUA 3L3KB 3GSVA 3WYRA 3MBEC 5HHXL 3WFHA 1HQRB 4YHYC 2PETA 4HIJA 5DFVC 4PRAB 4XRCA 3MJ7B 3VFUB 5FYKE 4P5KA 4FQQA 4P2QA 3QP3A 4J1UA 5FF6A 4JKPH 1D6VL 3W0WB 3DXAD 4N0UB 1QO3B 3MRIA 1MHCA 5SWZE 4QRQB 1JHTB 3HR5B 3FN3A 2JK5A 1UYWL 1XR9A 1T03L 3C8KA 1T4KB 5T3ZE 4R96A 4XP6H 2QQLL 3SBWA 2EEAA 4MNQD 3D2UB 4P2OD 5DK2A 1ES0A 1FJ1B 4IDJL 1PYWA 3QULA 1JNNH 1Z5LA 2Y7QA 4N0YH 1Q9LB 1BQSA 1DBAL 1UZ8A 3O2DL 5IB5B 2Y5TB 3AU1B 4JZJA 1I9JL 4MXVE 4UQ2B 1QR1B 3NACH 2DLFL 1RZ8B 3OXSB 5DA4A 4WWKC 2B1HL 3DGGA 2V9TA 1U8MA 4DAGL 3VRIA 3RVTC 4X7EC 5E2UH 2VZVA 2LU3A 1FO0H 1N6UA 3F12B 1S8DB 5DJ0B 1OGAA 4JY4A 5D8JL 2W65A 4GKOA 3C5ZC 4HIHB 4ENEC 2ILLA 2D0GA 4YFEA 3LZFH 2FLRT 3P30H 5C3LD 5E99L 5D1QC 2VL5B 4NQXA 4WTXA 3T4AA 4GAFB 5TPWL 4P2CG 1DQMH 3EYSH 5EU4A 3QIBA 2BNQE 1AGCB 2GK0A 4UTBL 5KVDL 3NCYS 1JGLH 4UU9A 2ATKA 5FKAB 2VTFA 2IAMB 3QQ9D 3P11H 5FYLH 3EJYC 1E4WH 5T1LB 1J5OL 4MA3A 4MDJB 2WBJD 1RUKL 1YECL 4ETQA 1CL7I 3OAUH 4NFDA 4O5LH 1U8HB 2VABA 4ZS6C 4M6OH 2K1MA 1FHGA 2EDLA 2AJVH 5I66A 2MQ0A 4U6VL 4D8PB 5DD0L 1YEHL 4UINL 1JF1A 2J5LB 1F4YH 3MRKA 2CUIA 4PTTA 5FO7A 1DBKL 5ID1A 4RWYH 2ZCLH 2DWDA 4AM0A 1Z3GH 2WWMC 5LQBH 1PY9A 1IGFH 3FAWA 5HXMA 5HHOB 2FB4H 2GSGB 4APQB 4JFEB 1U8NA 4JPWH 5TQ0H 2RCSL 4B0MM 4YXHH 4PLNC 2V2WA 2PYEB 3IS1X 1W0WA 1G7QA 5DJCA 4I2XB 1DUYA 4CVXA 4P46C 2C7UB 2ICWI 3KJ6H 3RIFF 1A02N 4EN3D 3B4NA 2ZUTA 3VXNA 4ZFFB 2AJZB 5FYKD 1A14L 4H20L 1F6AA 4N8VA 5HYSA 4FN0A 4NNXB 5FCUL 5JIPA 2V5TA 5EU3A 3RWGB 1FV1A 3OJMB 4QHLA 5IW1B 4PUBL 1OAKL 3TYGH 5FM8A 3AREC 1MFBL 2ZNWA 4XMLL 2B2XH 3ARDD 3D0VB 2WIIB 3ZT5A 4XB7A 3MLTA 2J4WH 1PQZB 3DURA 3OXSA 1KG0B 5DRNB 4K8RD 3DUUB 3Q3GA 4V1DA 1VFBB 2WLYA 3DUHA 3EFFA 1GZPB 2P5EB 2X70A 1I9EA 1M05A 2UZYB 3QEHA 3LQAC 3GHEH 4Y5YA 4MXQC 3O3BB 4U3XA 4JZOA 4JQVA 1QSFD 4DVRH 5SWSE 5C6TL 2D7TL 1H0DA 2JK5B 1QR4A 4ZG1A 3QRFM 1ZHKB 4JO2L 1S7XA 4U4BA 3TBVA 2BNRB 4NFCA 1S7QB 1EEYB 4KUCD 3TO2A 1IQWH 3MOAL 3O6KL 1UJ3C 3CFDA 5E2WL 3CFEA 2VNCA 3CAFA 4BK4A 3O11B 3ZT7A 5ACZB 2NY2D 1PKQE 5EC2B 1GPOH 5D6CB 3BYYA 4XNQB 4LSRH 3I6LD 4DQOH 1VHPA 4IS6A 5IFAH 3F65A 2Y07L 4U3HA 4U6VH 5E2VH 1G0DA 2CMRL 3C60C 1T2JA 4JHWL 2YK1H 4HX1A 1Y6MR 5TE7H 3RGVD 5IHUL 2VIRB 2E5EA 3AY4C 4D9RD 3HZKB 3MLZH 5E8PB 3JV6B 3VA2C 2BVOB 3QFJD 4OAWB 4KGLA 5FCSH 2GQHA 2VUOA 4P9HL 4Z7QF 2E7HA 4KXZH 3NCMA 3OX8B 3BSZL 4XWGL 1X5XA 1K2DB 4HUMB 1WWWX 3W2DH 1HOCA 4JGMA 1DLFH 1KTDB 1AO7D 5IK3B 4XCEB 1XGPB 3LS4L 3L95B 4PV9B 1HEZA 4HS8H 4PJIA 4FXKB 1SM3L 4MAYA 1HNFA 5D6DC 1R5IB 1EFQA 3BYTA 3L7FB 1OQOA 2NY0C 4P2OA 4RX4A 4IRSA 3OAYK 1YJDL 4NSKA 3F6LA 2AAVA 4WIQA 3RAJH 1M1SA 4LARH 5F96L 4QKXB 3BAEH 3PP3H 4PB0L 3V5DA 4R8WH 3KPPA 1AXTL 1YEFL 4TVPH 3SDAD 3QQ4A 3HC3H 5T1KA 3PL6D 4I13B 1L7TL 4PGDB 4N0CD 1KCUL 1I1AB 5B3NA 5IOPA 3UPAA 2UYLA 5ESVA 1ACYL 1OQXA 5DD3L 1ED3A 5JUEH 5HD8D 2XI9A 1UQSA 1I8MA 1C08A 1LNUA 3WCYA 1DEEA 2VDOH 4E41D 1CFBA 3ECBB 2XTJE 1RZ7H 4L4JA 4L1HA 4R4FH 3NACL 4K9EC 3B8YA 5MERA 3RWDB 4HPYH 1SJXA 2Q1EA 1QYGH 1FO0B 3G08A 5H2BA 5EZLB 1FFPA 3OGCA 1FC2D 4WW2C 4I8DA 4OLYL 5H2BB 4X4YB 3MV7D 5KG9A 4AL8H 1PDKA 4NT6A 2IQAA 5DHVA 5CZVL 5D7KE 1FNSH 3T3PE 5A3IC 3D18B 4WW2B 3J7HA 3M17B 2IMMA 5GXBB 4ELMB 4KY1H 5GRZA 5CSZB 2MQ3A 3WJJC 1NC2A 2W91A 3GMQB 3R06A 1HYRC 2Z8SA 3RU8L 5DWUH 2GYSA 2OJEA 4AEHL 4F8TA 3WNNA 2D7QA 1NBVH 3OXRA 3IU3A 1SYSA 4PJCF 4PJXB 1JPGB 5CHNB 2IQ9H 5C0CB 3V0WL 3DVIA 1UCBL 3F7YA 3BZ4B 5E70A 3BPCA 3T65A 1PW3A 5HYQB 1ZSDA 2AJYH 2VUYA 1OTUD 3RL1A 2OJEB 5TGBB 1KCKA 2VQ1B 3IGAB 4JFYA 3ZKND 1MIMH 4MD4A 4S1DC 4K3EL 4ODHL 4Z7UB 1A2YB 2MPAH 1PJ9A 3OF6A 4UQ3A 1EDQA 1R5IA 3QEQD 3RX8A 1FGVH 5DRZB 2XWJB 2KQNA 4DEPB 1BEYL 5JW4M 4MLIA 4X7DC 5FYLE 5HDQL 2NXYD 5E8EA 1CLZL 4P57B 1RK0A 1GC1L 5D93C 2XN9B 3IETA 4Y4FD 5FOBB 5BV7B 2C4FU 2GTWA 4YXLL 5HPMA 3RX7A 1U8JA 1P7QA 2D4FA 1OAZH 1ED3B 3D3VB 3HZVB 1OB1A 2EEBA 3SQOH 2FIKA 5CEZE 2B5IB 1J8HB 3ARGB 4GW5B 1B6UA 4RAVA 4WHDA 4YFLI 5ELIA 1E28A 1CXEA 4KMTL 3Q1SH 5INCA 4KK8D 3L1OL 5SWZA 4J23A 1CICB 1I3VA 2FD6L 2EYRB 5JOEA 1W72A 3C6SB 3EGSA 3MV11 5EIIB 3U7YL 1ONQA 5FGCB 3PDDA 1FNHA 3VMPA 1J0KA 1D9KA 3L7FA 3QFDB 4AIZB 1UACL 3HG1A 4G5ZH 3QNZB 2HKFL 3W9DB 1BFOB 4LCYA 2ADGB 2BC4B 4HLZG 3W81A 3TPUB 4JY6A 3ROOA 1T0NA 2NMSA 4Q6IA 2YPKB 4OCNC 3UTPD 5JR1L 1NMAH 4QTHA 3H9HB 4XWGH 3T3MF 2VERN 1IAIL 3ZE0E 1IRAY 1XF3B 1M05B 3FOMA 3QDGD 3VXQA 2CR6A 1I9IL 2P5EA 4IRJC 4P5MA 5ESAA 5SWSB 1VFBA 1QTYT 1IVLA 2AK1L 3B2UD 3KYAA 4IMLA 4OI7A 32C2A 2VYRE 2VXSH 3IU4L 1F90H 3RNKA 4O4YH 4QRSB 2LQRA 2EIDA 5KSUB 4XPTH 3SDXB 1DZBA 1MNUL 1KCSL 3S35H 1UM4H 2MMXA 1EZVX 1T1XA 1WLHA 1ITBB 3BHBB 3QXWA 4F7PB 1B0RA 1CICC 5GS2H 3PIQB 5EU3B 3QIWD 4WTWA 5E4EC 3CFEB 4C56B 2RGSA 3MV7A 3CSGA 4AK1A 2R4RH 4KHXL 1PSKH 1PLGH 1DANT 1QFWI 2FZ3A 4YXLH 1W0WB 5F3HB 6FABL 5ERWB 5FYJH 1A7QL 2X1PA 5DD1H 3MQIA 4KVCL 5E24E 4WENB 3RVXC 1CGTA 2A77L 1GHFL 2NXYB 4KKLD 4PTTB 2HFFA 5FO7B 4EUPA 5MEND 3G5YB 2YBRB 4OZHA 3P9MB 3WXVL 1D5MA 5ADOH 2PR4H 1BBDL 1SJEA 4FA8A 4D9RE 5J4MA 4OLEA 1EERB 3TT3H 3C9NB 1A3LL 3MMEA 3SE3C 3ARVA 3B9KC 5GGTH 3GM0A 2NY3B 1GGCL 2UUDK 3QXUA 2AEQL 5DURD 1C1EL 4JM2A 4X4XA 4K3DH 2C5DC 2ATKB 4ZFGH 5TJWK 4G9DB 4NN6B 4KK9D 1UB5B 1MRDH 4IRZL 1A1NB 3F7QA 5EORL 4WCYH 1FL5B 4Z76B 2VL5A 2RFXA 1KCUH 3RWGA 4QHKI 5IBLC 2X44D 1NGXB 1A6AB 1GAFL 3LKNB 2VDKH 3ZKXC 2BFVH 4JPKL 3WV0A 2IAMA 1JGLL 1FFQA 1TVHB 3VXNB 3WJLA 3IDJA 3VG0L 4E41B 3SCMD 4GBXC 3TO4A 4L3EB 1D5ZB 3TWCL 2V2WB 4OF8A 3L3DA 3U46A 1KT2B 2HT3D 2VH5H 1G6RH 2GSGA 4NQXB 4YBQC 3RVVD 3ZSTA 4GQ9H 5AG8A 4GAGH 3D39E 4HIIB 4Q97A 2ZSVA 1A8JH 2J8OA 3FN0H 4HFWA 3P9MA 1DQTA 4QXWA 3QULB 4OZGF 1X5KA 3F12A 4JFFE 3F5WA 5DSCB 3BQUD 3DWTA 5EUOF 1P7HL 4NO3A 4JM2B 4PRPB 4X4XB 1VFMA 3IDGA 4LCWD 5ALCL 1T5WB 1XZ0B 4EDWH 2ICES 2A0LD 1AGCA 2GK0B 25C8L 4LIQL 1ZT4B 4Q74A 4YBLC 4U3CA 1ZLWK 3ZDXF 3LRGA 4YHKH 3DBXB 3LS4H 3ZHLA 1EO7A 1XF3A 3Q5OA 4ZYKA 5IMLB 2HFFB 2UZIL 2A77H 2EYTA 1WCBB 2YA0A 3B2VH 2XQBL 4KKCD 1CBVL 3RUGA 1ZLSH 1IFHL 4L1DA 4QWWC 4NCC2 1KFAL 3PG2A 3U36B 3FO9A 3PABA 4R6UA 4YDLB 1MHEA 1FPTH 3QFJB 1QO3A 1TIUA 3FQUB 4JZNA 3RGVB 5KSAD 1TTUA 2YD1A 3VXRE 1MJUH 5I16B 2HKFH 2DKSA 3VXRA 3TC9A 3HMXL 4HZAA 3INUH 2VXTH 5L0QC 1B0RB 2R56L 1BIIA 1CD1A 1IBGH 2C26A 1BF2A 2CXKA 3L3IB 5D2NB 1PYWB 1K9TA 1NMAL 3P77A 5BRZA 2HTLD 4RGOH 4YLQT 1NCCL 1Q9WB 4PJBB 1VEPA 4JQVC 7CGTA 4YR6B 5D1XB 2FRGP 3KGRA 1ZHLA 2A6KB 4GJTB 4KKAC 1U8PA 1QLEL 5CEXA 1RZFH 3WNPA 2CD0A 4XPBH 5I1DB 4PJFA 1RZFL 3IFNH 3V8CA 3IU4H 3VFVA 1J88A 2XZCL 1AY1L 4OZ4A 5FOBA 5F7DB 4JREC 1T6WA 3ULVD 1RK0B 3NN8B 1QNZH 4ZD3H 2J8UB 4P9HC 3QO1A 2DJSA 4LOUC 3NCJH 1D6EA 4GRWE 1JNHB 3U83A 3S34H 4OCRH 3DSFL 3VGHA 3L3KA 1KEMH 3BWAB 4OSUL 4G7YH 3VRLF 2ZSWA 3KPQA 4HH9B 3L9RA 1XH3A 3QEUB 5E2TL 4P59L 5T3ZH 3ETBF 1RZJH 1SY6A 5A43C 2UWEE 3QIWA 1BWWA 5KN5B 4BSWB 2AK4B 5ICXB 1RIUH 4UV7L 4ZPVB 4HK3N 4EVNB 2GT9A 5CIPA 1AE6H 2IPUK 1F4HA 4Z95H 2RIKA 3I6KB 4Y2DD 43C9A 5F9OH 2OTUB 4Z7OE 3DX7A 1FFNA 2X5PA 4R4BA 2PYED 4W81A 5LGHL 5TDOA 4NQCA 4J6RH 3DI3B 4HF5H 2E6PA 1XR8B 2Y1VA 4M6NL 5CD5C 1JGVL 4GXVL 1S9WB 4JZJC 1U2CA 5C1MB 2EE6A 3VXOA 4PJDB 5HYQA 2BOBB 4M7JH 3MXVL 3IDIA 3FL7A 3JWNC 4PP2A 4PJXF 5LXGL 5EULV 3ZTNL 3EJZC 4WGWB 3VWJC 3GRWL 3G6AB 3VFPA 3H3KA 1P1ZB 2BVTA 3U0WH 1AO7E 4OUUA 4D0BB 3C5ZA 1YEGL 4J3OC 5EOQH 2DOCA 1Q9OA 4ELMA 4HZLB 5JOPD 5JNYA 2QJDA 4M1GH 3WFBL 2P49B 2J5LC 1F58H 1TNMA 3I9GL 3V6BR 4N5UA 2EDFA 3OAZK 1A9EB 1B6DA 2F53E 4YHPA 4XBEL 3VFRA 3NZ8B 4LDLB 4CNIA 2OZ4H 1MCWM 4DK3A 15C8H 1IM9A 1TCRB 4EQ2A 1YUHB 4KMLB 2O5YL 2ZJSL 1OP3K 3GMQA 5GGRB 1KIQA 2OTWA 3UX9B 1J05A 4PRHB 4KKNA 4P23B 1HHHA 1Z9LA 5J11C 3ECBA 1INQB 2GK2A 5E5MA 2ICWB 3V6OA 1CLCA 5KVGH 3RWCB 5DHVB 4PJFF 4PJIB 3TVMA 1ZMYA 4AENA 2NXZB 1J1XL 1FFPB 1KEGL 2QSCL 3SKUD 3WNMA 1P9MA 1KEGH 2PYFA 4YPJA 3MOQA 5GIRB 1GOHA 5HHQB 3RWIB 4G6KL 4WUUA 3UTQA 3Q6GH 1U92B 2NY6B 2F54A 4K3EH 4ODHH 3KPPB 1VB9A 5EBMB 1CD8A 4KRMB 5E2UL 5C0RH 4Z18A 4E41E 2DLTA 3EYQC 4IRSB 3JV6A 1X5ZA 1D5IH 3TIDB 1AGFA 3WL9A 4O2EB 1B88A 5LGHH 1INDL 1T83A 5DZNA 3P30L 4Y4KC 3VXSA 1MCCA 2P8LA 1E4KA 5E9DB 4LRNL 5C0JB 5IM7A 3BKYL 3W2DL 4U6HA 1TETL 4M7JL 4MAUH 5IK3A 2NYYD 1FSKB 3IJHA 4HK0B 2AJUH 4OCWL 3ORJA 1DLFL 3H2WA 4LASH 3T09A 2MHAA 4Z0BL 2HRPL 3WFCH 2VKWA 3UZQA 1E4XL 5MENE 5I74B 4FXGA 5E2WH 5L2JA 3OQ3B 3ZDZE 5JPNA 1MLCA 3W0WD 3QNYA 3WLBB 2DBLL 1IAIM 4Z78A 2C3HA 5IFAL 4J3WA 4S1RH 1CGUA 4XCEA 5HPOA 1YNLH 1BHGA 3GKZA 3MX0A 4QHNA 4XAKE 3OZ9H 4O00A 3KYNB 4NQCE 3ZT6A 1T22A 4JO4L 4NZTH 3I3BA 1CD0A 4ZXBC 4CJ0A 4I9WD 2KZWA 5IEHB 2DYPA 4FFWC 5F7HA 2NY4C 1JV5A 4XPHH 5EN2B 2IGFL 5DTFB 3MRDA 3IRZA 5BOZG 1BOYA 4YHNB 2CLZB 4RX4D 1PZ5A 3PABB 4K7PL 1R3LB 2NXYC 5E2JA 4TULL 4JO2H 3CFKB 1VCAA 3IFPA 4Z7WA 5E00A 5D7JB 2JJUA 3FT3A 5ISZA 4GLRH 4BSJA 3G5VB 2O5XL 4XZUB 4WDIB 2ENYA 4GUPB 5C6WH 4TUKL 5GS0H 5I9QC 1WBXB 2JIXB 3DROA 3V0AC 3W11C 3V8OA 4Y19A 3ULSB 5F88B 3ARDA 5D7IA 3HC4H 1FNLA 4WV1C 1ZT4A 3QQNA 4HGWA 5C0AA 1FDLH 1J18A 4XNYH 2O5ZL 5E2VL 5MI0B 2JELL 3MA9L 3IDYC 1SEQH 1CI5A 2BVUA 2E27H 3MLTB 3BGFB 1KELH 2Z4QA 3L5HA 5ICYA 5EPMA 4GOSA 4WU5B 4M6NH 4GRMA 2Z92A 2CLZA 4M00A 1OAUL 4U2YA 3K1KC 4F58L 3O3EA 5EBLA 3S88L 4NNXA 4ELKB 1XF5A 4H20H 3QJHB 3RWEB 3OHXB 4M6AA 1MVUA 5DR5H 4UNVA 5DEFA 4UIMB 5JO5A 1J5OH 4UT6L 1F02I 1YNKL 2MCG1 1DANU 1U3JA 1WAAF 1LK3L 5TDPA 1NCBH 3WSQH 3H0TA 3GMMA 5B3JF 3R4DA 1BJ1J 5TDPB 5LJYH 4F7TB 4DGYH 3QUYC 3BPLB 5IB2B 3QIUC 1H3UA 2AXGA 4M5YL 3VCLB 4U1NA 5ALBH 4KI1A 2RFXB 4GMSH 4CVZB 5JTWA 5CMAB 4MNGB 1U8HA 5DJ0A 4I2XA 3RWJA 1BJMA 1OAXL 3ZE2F 3CGTA 1UXWB 4PJGE 3WUWG 4NQCD 3JUZA 1AR1C 1J0IA 1DP0A 2H32H 3TLRA 3O3EB 1RZIA 4MHHI 4OD1H 4WHCA 4XVSL 2VRAA 2NY4D 3X11A 2KH2B 4M62L 4XH2B 1JHKL 2YD8A 3IKCB 1IKNA 5LAXA 4ZXBD 5IMMA 5DJZB 3UYRL 5IB1A 1IILE 2EIEA 4CL7A 4UUJA 3BJLA 1QP1A 5CJXC 1B0GB 3JUYA 1D9KD 2BOCA 2MKLC 2W07A 3JV4B 4P9MH 5JA8B 1BVKB 5E6ID 4R97B 3IVKB 1ZAGA 3MREB 3QZWB 4R96B 4WI4A 1NAKL 2ZUYA 5DUMH 2FR4A 3R8QA 1NUNB 4WDIA 5GGSA 1NEZG 3MCKA 4X7SL 4YH6A 3ISWA 3V7AE 2V2XA 1MCHA 5FUZL 3V9FA 1KGCD 1CLYL 2NY5L 1SBBA 4ZNEA 1WK0A 4WTZG 2IBBA 4QRPD 5HI5C 4RDQF 3E8UH 1Z5LB 1TZHA 3U2SB 4LLMA 5ALCH 2DYPB 1H8NA 5ID0A 3EOTL 4JR9L 3W11D 1ADQL 2C3VA 2N7BA 4HS3B 4JHZA 4LAQL 3V4VH 4JEGB 3TCXA 2NX5D 4ZOCA 5EH1A 4HUUA 1J7VR 5DJ2B 4YE4L 1T04B 1LO4H 3OAUL 4O5LL 3EW3B 3W0WA 2P5WD 1FJ1A 4PJ9C 1FO0L 4WO4C 4X8JB 4POZC 4Y5VA 3G6JA 5L2KB 3C5ZB 5DZLA 1D5IL 3BAEL 4DCQA 1WFTA 4K9EH 3EDJA 4Y16A 4JRYA 2BX5A 4KH2A 4PLKD 2Q3AA 1GYAA 4U6HB 2Q76A 3B3IA 3QCUH 5I8EB 4IRSC 3VJ6A 5TDNA 4CW1A 5I30L 5EIIA 4AIXA 4KK6C 1UZ6E 3SDXE 5JXEC 5IFJA 1XR8A 4FXLA 4N5EC 4Y1AD 3KVQA 4NUGH 4HGMA 3I02A 2AJ3B 1OTSD 1A7QH 2XZAH 5TDOB 2BCKA 1XIWB 4KTDH 5CCKH 1S7TB 5C2UB 1L0XA 3HE7C 3KHOA 4BH7B 3KJ4B 1FAKT 1ZK9A 3UO1L 4LRIA 4RBPH 1FL3A 2R4SH 1A7OL 3SKMB 1HIML 3HZYA 4ZTOH 5F1IB 4NFBA 4U49A 1JYNA 1NMCB 1JPTL 3QG7L 5GIRA 3ZYOA 1IAII 2RB8A 2F58H 4JM4H 1QACA 4BSWA 7FABL 5C0GA 3UYOD 4KAQH 4HWZA 1UJ3A 4LSTH 1MJ8L 1AXTH 2XKUA 3QISA 2BZDA 3Q6FA 3DPBA 1PBYA 1QFUH 2BRRH 2ITCB 4XP5H 1S9YB 4U6TA 4ZAKB 3AS0A 1AGDB 4R2GD 1MFCH 5D2LB 1IGCL 1S5HB 2XWTA 4TNVF 3QUKA 4WFGE 2UVFA 4PGBB 2FHBA 1JNHA 2Z9TA 1RULL 2I25N 3EJZD 2DQDH 5FDWB 4LBEA 1QQDB 1N59B 1CFQB 1X5LA 4IHOA 3LKQB 2AW2A 3PQYA 5FYJE 3BKCH 5E4IA 5C0BE 4PRBB 4HDIA 5D1XD 1QLFB 1Y0LA 3OKDB 1ZSDB 3KYKH 3ARQA 5KSBE 4GO6B 4RMTA 1ND0A 1NBZB 5C71A 1FP5A 3T0AA 4WY7L 1MAJA 2WINB 1Q9WA 1G9MC 1IKFL 4IIQB 3G6AA 3VFPB 2NY0D 4F7EA 3NA9L 1ZVHA 3H9SD 1JWSA 1TXKA 1MCIA 5E95B 5ITFA 3VI4E 5DMGC 3QWOA 2AABL 4JFZH 3D0LA 5DEGA 4P3DB 5KG9B 4P2RE 3VGGA 2VXVL 1TQCC 1HSAB 2EDBA 3BGFC 2VAJA 4L29A 5HYJA 3HS0B 1JHLH 1YMMA 1J12A 1RUMH 3UJIL 5HJ3B 3GK8H 5EU6A 4JDTL 2UY7A 4M5ZL 5DZOA 1RIHH 3P0YH 5JLZA 2ESVE 5C07E 3LN5A 3U30C 4BSVB 3DYMA 1OGAD 4S1SL 1R3KA 5A16A 1KFAH 1ZLUH 2LV4A 4PJEF 5LWYH 1Z3GL 1KIRB 5K93A 2D03L 3OZ9L 2UYLB 3MV8B 4K9EL 5ESVB 4G8EA 4X6DF 3HPJB 5DT1H 3HE6C 1Y0LB 4OCXH 4L4VA 3INUL 3PQYB 3RVXD 2JJSA 5F7EL 3VWKB 4FTVB 4MX7B 3QCUL 4PPTA 1FFOA 3ILPB 3C8HA 4DTGL 5L0QB 4IDLA 1MFCL 4WNQB 2FBOJ 3ALXA 1UG9A 3AUVA 4PS4H 3O6ML 3I3EA 5D4QA 1A9BB 1CK0H 4JFDD 2O61A 1GXEA 2DLEA 5L7XH 4L3ED 4MQSB 4JDZA 4LPXA 4ALAL 5H35A 2JB5L 2X6MA 1B2WH 3O6FD 3B2VL 3PL6A 3KPRB 4X6EA 1I9JH 2NR6C 1T66D 3TBSB 1BLNA 4HBQA 3AGVA 4I77L 3EYOB 4YHML 5IVXE 1NEZB 4POZD 1A7OH 5B22A 1UWGH 1QHPA 1KJ3H 2XWBB 1FLTX 4DWHA 4X5WB 4MDIA 5JW4Q 2M26A 4JFFD 5IWLC 1WICA 3N0PB 4YHZL 4A6YB 5CP7B 1UYWH 1T03H 4OI9A 4WUKH 2ESVA 5C07A 4JB9H 4PYHA 4X9IA 4LKCB 5B39B 3VGEA 4KK5D 5ENWA 4YZFF 4R97C 3ULUC 3VGBA 3K1DA 4GH7B 2Q76B 1I7RB 3LN4A 4KPHL 4LSVH 4JQIL 1I1YB 4M43H 4MHHG 5DMJB 2HJLA 4JHAL 1PY4A 4PJEE 4MMXC 4M8VA 3VXTB 1R5VA 3CK0L 4PGJA 4OFVA 4Y4HA 3NZHL 3T0EE 4TOYH 4UMGA 3HI1B 2BY2A 1UWEL 2FX8L 1JZ4A 4WFHD 4Y5VB 2EYTB 3RKPA 5EPMB 5EZJB 2ZKHL 4NQVA 4RFOL 5E56A 3KXFB 2VDLL 3ZDXE 3QH3B 2E7MA 1KB5A 4DGVH 1D5BA 1CGWA 1KB5H 4KHTH 3JWDL 3AM8C 4X6FA 4EI5D 4KQ4H 3LQZB 3VI4F 5E08L 5L88H 4OIAA 4NQEE 5ESQA 3BQUA 5B4MC 1JGUH 1MCFA 4GUPA 3QUXB 5HI4C 4NDMB 2EIZA 5EZOL 3W5MA 2G2RA 2CKBL 1OTTD 1HQ4A 4OM1L 2YHGA 2YD4A 4W4NA 1XT5A 2OR7A 2A1WH 5ICYB 1CZ8L 3H7BB 3LH2L 3CSPA 2XXMB 1HQ4B 4YXKH 5CD5D 3QDJA 3X3GL 3I6LE 5EN2A 1TZIA 4GMTH 5KS9A 3C09B 2WAHA 5D5MF 4XC3H 1EAJA 4L8SB 1SQ2N 5GGTL 3O6FA 3MA9H 4HV8B 1QBMH 4MJ5B 1T22B 5F89B 4I5BA 3DHMA 4JPVH 4BFEA 1IGMH 1WIUA 1G7QB 4I48A 5DJCB 2X4SA 1J0HA 3JV4A 1CVSC 4WV1B 2CJUH 3VFTB 5JHLL 4WI2A 5GHWH 3N1GC 2F54D 1NUFA 4YBQD 3O45A 1A1NA 1WWAX 1BFOA 1NUGA 4LCYB 4MAYC 3BN9D 5HGAB 2AXHA 1CICD 1PFCA 3QNZA 3NIDE 1ZGLB 4P2OC 3TPKA 3GI9L 5HHVL 5BS0E 3FZUD 2CDEB 1RD6A 2DQGH 5DVKA 3QQ3B 1E6JH 4JFDA 1FG2A 3M45A 5IB2A 3QO0B 4XP9L 1MFEL 1NMBL 5CBAB 2DI7A 3NPSB 3HMXA 1FN4B 5LQBL 1AGFB 1IKFH 2FZ3B 3QUMA 1C5CL 2EECA 4FMKA 5FGSA 4JY4B 4ZPTA 1ETZA 1TFHA 4LSQH 4GW1B 1MWAL 1OP9A 2X42A 3VXMD 1V3LA 5HHQA 4K7PY 4LIQH 4RGOL 3WFCL 2GCYB 4WTZA 2PXYD 1K4DA 5DQJB 4PLJC 4JFFB 1UKTA 1CWVA 1HDMB 1AXSA 2Y5TA 3EOYG 4CMMB 3RL2B 1UZ8B 4LSSL 1I7TA 3IFNL 4ODUB 4FS0A 1INQA 4HKXB 3IFLL 4X80L 4Z7UA 2R4SL 5C08B 4OJFL 1VGKA 2AGJH 5EDXA 4P5MB 4WW2F 5ESAB 4HIXH 4X4MA 4AH2A 2WUBL 3ZYJA 4FABH 5MEPA 5FK9B 4GBXA 3TO4C 3UTSD 3CVIH 3MODH 2ZUUA 1CLZH 2I24N 1HE7A 2R2HA 5GJTH 2ZCKL 5GRJH 3RWHA 3WDJA 2VC2L 5EOTB 1JPGA 2XKSA 2YPKA 1CFSB 1F4WH 5JHLH 4JRXA 4J1UB 5EO1A 4F3FB 3H42H 4NCDA 4NWUH 5I1GH 2OX5A 3SQOL 4TTDD 1NGPL 4NNYA 2GTZA 1JV5B 3UBXG 1OHQA 2BNQA 5F1SA 5CCKL 3DOSA 4WI5A 1IL1B 3PP3K 4JQXC 4NN7B 5BXFB 4GT7A 4M7LT 3RKDC 4QRUB 5C2BH 1RUQL 4U7SA 2DMBA 3UBXI 3P73A 1XGTB 3CZJA 4G8GB 5JOPE 1LE9B 3BI9X 4P2QD 3ZE1F 3AXLA 2OZ4L 2ICEA 4F2MA 3KPRE 3IXTB 3B6SA 4PJ8A 1JF6A 4RFOH 1WGOA 2HLFC 3FO0H 2DTMH 4LHUG 3OB8A 3MUZ1 3LD8C 3N1QC 4RISL 3VXRD 3RUGE 3OKNB 2RCSH 3KR3H 2BJML 5D5MA 1LILA 2GTWB 3B5HA 4NQUA 1HHGB 3S4SG 3MCLL 1G7IB 4YGVA 4PRIA 1ZA3B 3MGOB 3WE6B 4PGDA 1FH5L 3IJHB 3VA6A 2JJSC 2DQTH 4LSVL 1RJLB 4NHCH 4FZEL 2G5RA 4XBPB 1XGYH 1MCWW 2Y36L 3DVFA 4J8RA 1DUZB 1IE5A 4BYHA 3QI9C 5I2IB 1G6RL 1XH3B 2DF3A 4FOMA 3K8KA 5CKAA 4PJDF 4M4PA 5FHAH 2NY3D 3P0VL 3P9LB 4K94H 4AQOA 3QRGH 3ULVH 1FAIH 1DVFB 2OTUA 3VXMA 1DQQA 1F8TH 4NJAL 43C9B 1MF2H 1JFQH 2P46B 3BRFA 4JKPL 2MWCA 2RJMA 3KPOB 4RFEB 4DN3L 3CC5A 1KJVA 2V2TA 4KC3B 3GMPA 2NW3A 2AK4A 4QRPE 2WUCH 4OGAD 3RHWF 3MXVH 3PUCA 5EU6E 3GBML 1CS6A 3SDCD 1CFTA 5IJVA 3BFOA 5MEOA 2VZSA 1YEDB 4CAGA 5F1IA 4TTDC 3MJ9H 3VWJB 1HH6B 4PJHB 4WHYH 4POYA 4NN6C 1OWWA 4NJ9L 3DVGB 1LHZA 1C5BH 2VIRA 4XPGH 3S97C 5IROA 3RWFB 4DZ8B 2IQAB 2NNAB 4W68A 3TJEH 3O3DA 1NCTA 3H3PL 3TNNA 4NZUL 1KYOK 4WUUD 3U0TA 2Y06H 1MCOH 2HVJB 3BP4A 3WLWD 1N4XH 1B0WA 3LQZA 3WFBH 2R9HC 4Q0XL 3IAQA 2QHLA 2VXQL 2QHRH 3IFOB 3O9WA 3O11A 1CDUA 3X13A 1KXTB 2DQIH 3MRFA 2PW2B 4EI5C 3WIFB 4OF6A 4OZ4B 1U8LB 3KLSA 1YZZA 1JWUA 3KXFA 1N26A 2G9HB 2AJSH 5T1MA 2H41A 4U1GC 5LGKA 4F37F 4UDTB 1UEMA 1F6FB 2VLRE 4M93B 3QEHB 1CK0L 1FZJB 2RBLA 3P2TA 1V7NL 1INEH 5T3XD 4HK3J 5E03A 5GRYA 1LP9B 4V1DB 3K74B 3Q1SL 3D39B 4Q58C 1X5JA 2DLHA 4ZMAT 3MLWH 1ERNA 3IDGB 3A6BL 2EDXA 2EKSA 4MAYB 3F5WB 4XNXL 5DSCA 4ZO9A 4JJ5B 1T2XA 3FTGA 4KZEL 1IC7L 3F7VA 4QLRA 2EDNA 2K9UA 3S34L 1N7ML 5CJXA 4KDTA 4NO0B 4TVSa 2ZSVB 4BZ1H 1KBGH 1KB9K 1RU9L 3DBXA 3RY5A 4NOFA 3GSRA 1WUNT 1NEZA 3U0PB 5IMKB 1U8QB 4KQ3L 1EJOL 1N6QH 4QY8B 3SKJH 5DVMA 5CD3B 5EUKB 5F6HJ 2XQYK 4ODVL 1KJMA 2J88L 2X4PB 2PYEA 4ODVH 2HKHL 3CFBB 1XZ0A 5C0AE 1FN4A 4XWOD 1JIBA 4UOW1 5D93B 1DLHB 4X8XA 2DJUA 5K9JL 2PXYA 4XMLH 1RVFL 2C1OB 3RIFK 4R90H 3L1OH 4UUJB 3VXUA 1C12A 1DVFD 3VWKA 2AJXL 1YQ2A 5JORB 4LEXH 1KJ2H 1IQDA 2XN9E 3DVNA 3LKOB 4MZ3A 5D96B 1P2CB 4AL8L 1Y18B 2QQNL 1JPTH 1KN4H 3PDOB 4NHUB 1QBML 1DBML 1QBLL 4Y8DC 2PO6A 3PGFL 2O93L 4OCMC 1UADC 2AJSL 2BSTB 5C09D 2H9GB 5AAMA 4PJBE 1Q9KA 1R24B 5DDHA 1BAFH 4KJQD 4LKXB 2YPVL 1A4JB 3PV6B 2DIJA 5C8JA 1WF5A 4PJ9A 4K71C 5JUEL 1YNTB 1OSZA 1AKJB 1UCBH 1ZHBA 2FGWL 2I9TA 4OM1H 1MCSA 3BUYA 1LDSA 1FORH 2J1KA 3O6FB 4L29B 5JW5B 5DJDA 4XC1L 1A6PA 1L7IL 5KS9B 4WEBH 4PV8B 3WIIH 4OV5A 5MENA 5DHVH 1WFNA 3S5LB 1MUJB 3FQWA 4ELKA 3QR2A 3M8OL 3ARUA 3MV7B 4LSUL 4NRXA 3RVUC 4B53A 5D2LE 3OG4B 2ZP0T 3C9NA 3KPMB 4OQ1A 4H5SA 7FABH 4CBPA 1JK8B 2DN7A 4H1LH 2CSPA 3BHBA 3D1MC 4QO1A 4AZ8A 1QVOA 2XY1A 1DFBL 1ND0B 1NBVL 4H1LG 1VACA 3B9DA 4MVBD 1GGIL 4P4KA 2H2SD 1I1FB 4AMKH 1EXUA 3OG6B 1DUYB 4CVXB 3EYUL 4K71B 2WNGA 3LKQA 1J0ZA 2YPLD 5SWSA 5I8CA 4K3HA 2AJYL 5T5NG 1XCQB 4APQA 1J11A 1MCKA 2VR5A 4QHUB 4ZXBA 3BN3B 5FGBC 3OKYA 5FUCC 1XGYL 5E6ZA 4Z7OF 3B9KA 4BQ6A 3MRBB 5IHBA 4XI5C 1DR9A 2D0HA 4L5FH 1SYVA 2NY7L 4LEOB 5E00B 4XAKD 3VXUB 1JK8A 1OCWH 2OM5A 4X7CC 3WFHB 4C56E 1A4KA 1AD0A 4ESKA 5HI3C 1BWMA 1CG9B 3NCYP 4DUVA 3MUHL 5DA0B 4LSPL 3EIFA 2NY0B 4C4KO 2EDRA 5C0GB 5BW7C 1XF2A 4PV8A 2A6DB 1RK1A 4NZRH 4RGNC 3HZYB 2X4UB 1WFOA 3N50A 1ZLWH 5DJXB 3TVMD 1KENL 3VRLE 3V4UL 4H88H 1I1AC 1NJ9B 4PRIE 4RIRB 5ILTH 5B39A 1AO7B 1IC4L 2C1PB 4FP8L 4MWFA 5LGJA 2WMPA 2ESVB 5C07B 3T1WA 5JXAH 3RGHA 4ZUVA 4NN5B 3GO1H 5KSAC 2WBJC 4KKLC 4MLSA 4QT5A 3REWB 1R24A 5DDHB 5L7XL 4ZUUA 3TPUA 1BJ8A 1MRFH 3QQ9C 1WISA 3HZVA 4NBYB 2NX5A 1HINH 2PO6B 4ZDHB 3HI5H 3U4EA 3ULUL 4OM0L 2FHCA 2BSRB 4KKCC 4KV5F 2E8YA 2R0KH 4J4PD 1LWRA 4M02A 4M6ML 4UIKH 3MMEB 1CVRA 1FDLL 4NQDA 2EO9A 5J6HB 1AHWA 1ZA3A 3WE6A 3LVEA 3N9GL 1XAUA 2YS4A 3MUJA 4IOFD 2YWYA 1NL0H 3NCJL 4H8WC 1ZE3C 2KQMA 4ZO6A 3G6JE 5DMIH 2GAZA 4LLQA 2XWJA 5J12B 5DJ6A 1S9XB 3FQTA 4LGRB 3HCVA 2C4XA 4EZMA 1UB6A 2HWZH 1JL8A 4N9GA 3IXTA 1V05A 3D85B 4P59H 3K4ZA 3ZL4L 5I6XC 1MCDA 4ZFZA 5KSBB 1PLGL 3RTQD 4ONFH 4QRQA 1EK3A 5E9DD 2I9LA 3BWUC 2APFA 3U1SH 1KSRA 2DQCH 2NW2A 3U1SL 2X1OA 4LP5A 4QXUH 5C6PB 4UOW0 2C3VB 3MACL 2A6JB 3ZHKA 4LLMB 4IRSD 1DBJH 2IPTH 3FO2A 4NO2A 4WW1A 4HIJB 3T0EA 3OXRB 1U8KA 3QSKB 1QNZL 2HH0L 5CZXC 1KLUA 3OKEB 3KPSD 5GISH 1HH9B 5KSUA 4P2RB 3TP4A 4OZFB 2QSQA 1OF2A 4PJGF 4QRSA 3MFFB 5IBUB 2D4DA 5IHUH 3QCTL 1F97A 2IMNA 3SQBA 2JJTA 1YQVH 5EOTA 4M7ZC 4JN1L 3IDUA 1X6NA 2ADIA 1C5CH 4K7PX 1U2HA 1RIVH 2P45B 1I85C 5TE6L 3E6FA 1I9RH 4OLUL 1LO2H 1MREL 1U9KA 2DIBA 1CDJA 3RWDA 4ODWA 4IIQA 3CLEL 3GSWB 4JO3L 3N85H 4IM8A 4HUWA 1T5XA 1FYTB 3S3PA 3VXME 4LGPB 2BVPB 1RULH 4EI5B 4OGYL 1RUKH 1DVFA 1VEMA 4KRPB 4X9FA 5EIVA 4H8WL 4XH2A 2VLLB 3ZKQD 1JWUB 1RZKL 1IGIH 2D0FA 3HI5L 4U2ZA 4WHTB 4KK9C 1LO5B 5EWIL 3MPCA 5KVMC 4L8CA 2QEJA 4PYGA 5BZWB 1QLFA 2ZCLL 3UJTH 5C0DA 1D5XB 4X99A 3WN5B 3B9KD 1RUAH 2M1KA 5GS2D 1IGML 5JZ7C 1S9WA 1E28B 3P3YA 2AI0L 3PGCB 3STBA 3V4UH 2FECL 1C5DB 2DKUA 1IC4H 3DX6B 1WWBX 2A38A 2VXUH 4Y5XA 4KRNA 1CIDA 5FO9A 3SY0A 1K4CB 1HEZB 3MLUL 4MCYA 5DYOA 3I6KA 3KPSE 4HWZB 4UIMA 4K3GA 1VSCA 2ICEB 2NY6C 3CC5B 1UKQA 4Q9CA 4RFEA 1UT9A 5F7LB 4ERSL 1ZS8B 4GG6E 1BFVL 4WI7A 3CVHH 4LHQB 3LPFA 4XXDB 1XIWA 4D0DA 3RIAK 2EZ0C 1QKZH 3HNVH 5MHSE 1AQKL 3RVTD 1CQKA 4YHZH 1AQKH 4KY1L 5IFJB 1YYLL 2OP4H 4GKSB 4Y4FA 4DGVL 2JLLA 4PJ5A 4R26L 1M7IB 3K4DA 1NANH 3JWDH 4XCFL 2WUCL 1T1WA 4LRNH 1G0YR 3D69B 1O7VA 1RZKC 2UV3A 3BDXA 3CFDB 4UILL 3LKRB 1T89C 4FTVD 5IQ7H 1LEKB 2BDNL 3OJDA 5IMOA 5DD1L 4FZ8H 2MCPH 1JRHH 1HWGB 2OJZL 4H1LB 3GIZH 2ADIB 3HZKA 3HC0B 5E8PA 5CSZA 2W0PA 5K9JH 4TSAL 5DJYA 1A1OB 3VRJB 2DM3A 5E7FA 2WWKO 3VW3H 1ZVSB 4YO0A 2F5AL 3SDDB 5BV7L 5ALBL 5D2NA 3SOBH 4XMKH 3QHFH 2QR0A 1I3GL 2P24A 2HLAA 2R0WH 2WBWB 3TESA 3CXDH 1FL6A 3MBEB 3Q3GB 4KKBD 4OCXL 2P1YA 4D9QD 2D31A 1E27B 3KG5A 12E8L 3QJFB 3CVIL 5GJTL 4DK6A 3V5HA 2C9AA 2EDQA 4JZNB 2H1PH 3BISA 2FH6A 1UM6L 1PEZA 1UQSB 3EFDL 2VXUL 1F3JB 5L8JB 5T3ZL 3VD5A 4XX1G 4NWUL 3O6LL 5K9KA 1NPUA 5D1ZC 4N0YL 4F15B 3SGDH 3FOLA 3JTTA 3QDMD 4ALAH 4I0PC 3QIUA 5AD0A 5IIEA 1BD2A 3RZCA 2ZUSA 4PG9B 2V9QA 3U4AA 3BH8A 4L8DB 1VGKB 1TVBA 4NQDB 4NRZA 4RZCA 5CGTA 4U7KA 1G6VK 1NCAL 5DMYA 2GSIA 4HH8A 3VFNB 3TIDA 3D0VA 5ID1B 2AI0H 3LHPH 4XXDA 4YK4C 2YPLB 4Y4HC 1MCRA 1I8IA 3SDDD 2HWZL 3GI8H 5BW7A 1I4FB 3LEYH 3S6CA 1DQJB 4I48B 2OI9B 3U7WL 4EI6B 3WKNA 2DJ4A 4JG1L 3H9YA 1FZMB 1BZ9B 3FB8B 1V7ML 4RDQG 1A6VH 2XKNB 4AEIH 2DICA 1NQBA 5DJ8B 4AEIL 3QIBC 3PWVB 2NPLX 8FABA 4Y2DC 4IMKA 4JM2F 3MRMB 4AYFA 4HIEA 1TPXB 4DOHB 4D3CL 3PGCA 3MRPA 3S36L 3CFIC 4D8PA 5D7LE 4J6RL 1WTLA 1IM9B 1RV6X 5JMOC 1KELL 1SYVB 3QUZB 3ARBC 4LEOA 4JDVB 3NZ8A 2VABB 3HFML 3WFEH 4N90E 3MV9A 3PGDA 2JCCE 4ONGL 4HWBL 4LL9A 5EG6C 1AHWC 1OT1A 3V6FA 4ONGH 2IGFH 3MUGB 4QRTB 1KIRA 2VZTA 1S7XB 4M93C 3Q5TA 5GGVY 5IVZA 1IAKB 3PWUA 3U9PL 5CJBA 2BVPA 2NY6D 1NCCH 4YFLF 4B41A 1Q9LA 1VACB 3QH3A 1F4XL 3QXAA 4WV1A 3E3QE 3HMWL 4DN4H 3WKMH 1JZ8A 4HGWB 5C0AB 3WIHA 2X4RB 3S7GA 3L3OB 4YZFE 1YEJL 3QDME 3I50H 5IHZB 2H26A 4YK4B 3A6CH 1BFSA 1R5VB 4OD3L 3VGFA 4H0HB 2EDHA 1NFDA 3GHBL 3HG1E 4Z7VB 1NSNH 4HXBH 1OF2B 4AT6B 5FA4B 1X9QA 3STZA 4UQ2A 1QR1A 5KVFH 1UM5H 4JY5H 1R3LA 4JO1H 3O4LA 1OTSC 2I07A 4CJ1A 5JW5A 1AC0A 2G75B 3DMMB 2B5IC 3ARGC 2A74A 4CU7A 4WW1B 4OD2B 5DQ9B 3DX9B 1QSED 3R8BB 2VDKL 1S78C 5CP7A 4ZPVA 1J1XH 5INDA 4TYUA 2AXJA 1VENA 4UT7H 4NO0D 4X0KB 4PJ7A 4FQJL 3P11L 5FYLL 32C2B 3CSYA 4I1NB 4N0UE 1JHTA 3TBTA 5KAQF 1I7ZA 2DBJA 5C2BL 1EHNA 1AH1A 3VDBA 1VDGA 5HD8C 4LBEB 2IH1B 3Q2CA 1OSPH 1NLDL 1UXSA 1NAKH 5F7WC 1CTNA 3BEWB 5DJ6B 1JF1B 1BX2B 2ZG1A 2F19H 1BF8A 4NPYB 1BD2D 3EYQD 4FHBD 1PEWA 3E6HB 1J1OL 4NJAH 2LTQB 4JY6B 3ROOB 5GSVA 1TQBC 3GBNL 4WUKL 1WT5A 4G7VL 4Y4KB 5T1LA 4NZRL 2NTSP 2R1WA 2X4OA 5K59E 2B4CL 1LMKA 4GAJH 3MLPA 3WN5C 1ZT1A 5T33H 1X4ZA 4U1LB 1KF9B 4MCZA 1J0YA 4HC1L 3K2MC 3O6FC 1W72B 4O2EA 3V6ZA 2AVGA 2Y36H 4M61B 3MV8A 5DHYB 5KTEH 2AK4D 3ZKXB 1HI6A 4OGYH 4KTEL 4HG4J 1OWRM 1P7KA 4DN4L 3ULUD 1ITCA 2YZ1A 3HHRB 3UXFA 5CIPH 3FTGB 3PP4L 2R0ZH 2X4UA 3VE0A 4WUUB 5DUPH 1QSZA 3WUWA 4GSDH 2A73A 2YSSB 3CVHA 4KI5F 5B8CB 4NIKB 5DVNA 4UV4H 3VXPB 1TJIH 1U41A 4CGTA 3WHE1 4KZDL 1KGCE 3TH2T 4OZGB 4YNYB 3FO0L 3HC3L 3T0BA 4UB0H 5E8EB 2N4IA 4HHAB 4NQSA 4NUJA 4N1CA 4JDZB 3T08A 4P3DA 3JBG7 5GRJL 4KQ3H 1CYGA 1WIPA 3ULVC 3E6HA 4OUOA 4PREB 4U6XB 4NPYA 4F58H 1JGDA 1VFOA 1EO5A 2YUWA 4MS8C 3MRGA 3QDHA 2WINA 5AZEH 5T1KD 3TA3A 3FQNB 5I8CB 1IQWL 4P9ML 4MD4B 4KJYB 4XPFL 4PJ7B 4J3TA 2CLVA 1YN6B 4FG6D 4JKLA 2UZXB 3MRHA 4Z95L 3QDMA 1XCTA 5FF6B 3L5XL 3FONA 2FO4A 4S1QH 3SDYL 4LSRL 1KUMA 1DQDH 5ETUA 1G7JB 3QBTB 4Z9KB 2DQEL 2E7CA 4OQTL 5DMKB 4DW2H 3ROLB 1CGYA 4TPRL 4LPCA 3S9DB 1XMWA 3T8XB 1Q94B 4NRYB 1F00I 2VLKA 2Q86A 1NC2B 1JN6B 4MJIB 4G7YL 3OV6A 5EA0H 5C0CD 4ZAKA 5IFHL 3L3HB 4KHXH 3UP1A 4G6JH 5GGSB 3C08H 1MI5D 1T3FA 3KPRD 4L3EA 1QRNA 3BRDA 1I85A 2H6PA 3BD3A 1ZHBB 1YNKH 2CPCA 3ZZ1A 1FFNB 3HRPA 1DBJL 1UZ6F 5EUOB 4PJCB 2W0FA 1LO0H 4WVRA 1I8MB 2WM0A 1BVLA 4HUNB 5TF0A 4L9LB 4PRPD 3LRSA 4KKAD 4P2QE 1OAYL 3ZKSD 3WHXA 3HE7D 1X4XA 3PDOA 4YQXL 2LABA 5GGTA 3HE7B 2FB4L 4DUWA 5DRXB 1QFWM 1DUZA 5TE6H 5I8EA 3L9RB 4MNGA 5GGSY 3PNWA 4LMQI 1A14H 4Z77A 5I30H 4PG9A 1H3VA 2R1WB 5F7YC 4BQ8A 2VSCA 2AV7A 3MRNA 3O3AA 1S9YA 3NIFF 4Y4HD 5EU7E 5HHNA 3MR9A 3MYZA 4RFNB 2PYEE 4YXKL 3SDAA 4LFHD 1K6QH 4M7KH 4HPOL 3BDYL 4QRRB 1ZEAL 1DE4A 1HSBB 3RX5A 3NFPA 4P46B 4LVEA 1JPSH 1HZHL 3PWLB 3KYMB 4XMKL 4C54A 1M71B 1F6LL 3OX8A 4ZUTB 2IJ0C 3QEGH 1T1XB 4JPVL 5EO0A 4DKFH 5JHDA 3HI6H 2GJZA 2OL3B 4TPRH 1GJIA 5IKCA 3HPLA 4G42B 2LVEA 2EKSB 5IBTL 4HWEL 1CD1B 4H0GA 3AROA 3EOTH 4CN4A 3TZVA 3T0VA 3FCTA 2UUDH 5FA4A 3KPSA 4UT7L 2XRAL 5EC2A 3IJSB 3FT4A 3RRQA 4XWOC 2P5EE 3FOMB 3SO3B 1S5IH 3BT2L 2Q8AL 4ERSH 3ZKMD 1QYGL 5C0IA 4Y16B 1NLDH 2NLJA 3EYVA 3BIKB 3FT4B 5D70H 1H8OA 4R2GB 2CRIA 1MI5A 1NAMA 1ULVA 2AQ3A 1FCGA 2YD9A 5T1MB 2YN5A 2ZUVA 1ZHKA 1BVKA 4GBXD 3AB0B 1H0DB 3BO8B 3CX2A 1SHMA 4GG6B 5DS8B 2VDLH 4C56D 3WO3B 2V17L 5DRWB 1EMTL 4KRPD 3PWUB 3HPLB 4G42A 4D0DB 4EIZC 5JQ6L 3LOWA 1INDH 1S7RA 4HUUB 3O8XD 2ZUXA 4C57C 3QHZH 5KJRH 2ARJA 4O51A 4PRPA 4QXGL 4ZOEA 5J3HD 4MAYD 5HGBB 5B3JE 1ZS8A 2CK2A 1OGAE 4OZFG 4Z7NE 5GS3A 3FKUS 3PGDB 5J13C 4DZ8A 3V7AG 4S2SB 2C3GA 3FHQA 2L0DA 4Z78B 1GL4B 1NFDF 3ARGA 3WNLA 2EDYA 1ZGLM 4H26B 1LVEA 5ECJE 3EHBC 4Y5YC 1G1CA 3ARWA 4MD0B 3QDGB 1FYHB 1NGWA 3C2AL 3RPIA 4L8BA 4D9LL 1S9KC 4P2RD 2AJXH 1KT2A 1RY7B 5BMFH 3CH1B 5F9DC 3WXWH 1IEBA 4YHIA 4HT1L 1T7XA 2HVKB 4ZFGL 3UPRA 2AQ2A 3I75B 2YOCA 2OBGA 4K3DL 3DHJA 1XF5B 2IH3A 4F7MA 4E42B 1NFKA 3QUXD 2VDML 3V6OE 1PX4A 1HHJA 5IESH 3DJ9A 2NY3C 3CDGB 4GG8A 3MJ8A 1F3RB 3B9EA 4KKBC 2VITB 3UYRH 4GG8B 4WGVB 3N85L 5IW6B 3CFJB 2VZOA 2VDOL 4KU1A 4UNTA 4F7CB 5MEQA 4RNRA 3HNTL 4JFED 3PHSA 3ARRA 3BZ4A 4OF7A 5HHOD 4FQJH 2RHEA 4KRPC 4X6BA 3MROB 3WIIL 4OIIL 3MACH 3C5JB 5I73B 1G7IA 1ZKAA 4IRJB 4U0RC 4YGVB 3OWEA 4OZIB 1T3FB 3I9GH 2EH7L 1FRGL 1H3GA 3QWRD 3R06B 5T3ZD 2JJWA 4M5YH 4J4PA 4O9HH 1OAQL 4WO4D 4IMKC 5T1LD 4Z7VF 2PO6D 1J8HE 4JY5L 2VLKB 3AXLB 3CMGA 5GGRA 3ARYA 1C16B 1HWHB 1PZ5B 1WBZA 3NH7L 3GJFA 2A9NL 4HKBA 5GHWL 5F9JB 2E9IA 3V79C 3UZVB 3LEYL 2UWEA 1PSKL 5JHDD 3T2PA 2CLRB 1MQ8A 4JN2A 4ODSL 3LKSA 4V2BA 2FO4B 1U8MB 3CLFL 2P43B 2C4FT 4YC2B 4X6CB 1AJ7L 4HZLA 4F7PA 4FFWD 4RAUB 4LPWA 3TCLB 4AEEA 2FJHB 1NGZA 3DXAE 4IOSD 4FQIL 4GRMB 4L9LC 1MIEL 2DTSA 2X7LB 1HINL 5EO9A 3WSQL 1H9VA 2EYSA 4PJ8C 1T5XB 4FQLH 4BQ9A 3IDNB 2VWEC 3BD5A 2XZQL 4XPTL 1RIHL 1IT9H 5EZJA 3UC0H 5C0EB 1IGTA 3WDIA 5JQHC 1BGXL 5I1JH 3MOBL 5MP6L 4U6XA 3QHFL 1A7BA 3C8KB 1MJUL 3V5DB 3KDMB 4KZDH 1YEEL 4Y4HB 2KPNA 5J6HA 1BQLL 5D6DA 2H1PL 3U4BL 4DVBB 3IJSA 4YWGH 5IM7B 3BIAX 1I7TB 2DQJL 4ODUA 5C7XH 1FIEA 3IRPX 3WUWB 2Q20A 2YEZB 2BC4A 5C0NC 4UT9L 2XTJD 5T5FL 4LCWB 3AREB 4TULH 4L4TB 3GO1L 4ZUUB 1GOGA 3OKOA 1DTUA 2VR4A 1K4DB 4LVNC 2P42B 1TDQA 3SEPA 4Q9QH 1I3RA 4H25B 1Q1JH 3EGSB 5KN5A 5GS1A 4XNZB 3BP6B 2NYYC 4OM0H 2ENSA 1AP2A 3CFCH 3W9EB 5DJXA 1JTTA 3MUY1 1U92A 4O02H 3EDEA 3D3VE 1U6AH 4K7FB 4KAQL 3KLDA 3L3JB 3PHOB 1NL0L 4NO5A 2WZPD 4YGAB 3SDAB 1BQHA 3CUPA 5HBBA 3LHPL 1A7PH 4FQHA 1DVFC 1BZ7A 3HKFA 5H37G 5JQ6H 2YEZA 3GKWL 4LPUA 3MYJA 1EGJA 1FVCB 4BFBD 5E5MB 1UM6H 1OD9A 1YY8B 2GJ6D 3GSUB 2BVQB 2H32A 3BKMH 3MV7E 3P40A 4PRHA 2CDEA 2HTKD 5HYEA 5I1EH 3VFWA 2J8HA 1G7PB 3WO4B 4Z77B 4LASL 3CXHK 3FZUC 3EOBB 3CMOL 4NUGL 1X5YA 2YXMA 3MV01 3G6JF 4ZTPH 2HP4A 2BNRA 4I4WA 3Q6GL 4O2FA 4KTEH 4AIOA 1XGRB 4OLXH 4L5FL 4KVNH 1BBDH 3UO1H 3G6DL 3IXAB 5B38B 4URTB 4QYOB 3P77B 1U3YA 4U1HB 3WNOA 4M03A 4J3VA 1AO7A 2IBZY 1RUAL 2VDNH 5EUOA 3O4LB 5DGRA 3UTQB 3F7YB 4PJAF 4XGZA 3RVWC 3VXUE 2MOVA 4GS7C 4MQTB 5IB4B 2W0LA 2COQA 4RMQA 4OV5B 1KV3A 2ZCHH 3VXOB 4YHLL 3GJFB 3EYFB 1MCQA 2DQTL 3NTCH 5GGVH 3RWCA 1URLA 3TFKD 4NGHL 4L3CA 5HGDA 3SGJC 4JGUA 4KGJA 3FMGH 3BUYB 4PD4K 5E8OB 5TE4H 2VLJD 2X4RA 1FE8H 3JWDC 1YC7A 2OJZH 4OZFA 4HUVA 1S7VA 1U91B 1WBYA 4NT6B 1RVFH 4N8VB 5HHXH 1J87A 4YJZL 1LK3H 1YUHA 3NVQA 4FNLH 5DMKA 1RZKH 4Q6IC 3OGCB 3PXJA 5ACMA 5E1HB 4X80H 5EWIH 1BFVH 3A6CL 1A6UH 3MRQA 4LVHC 2D7OA 4MMZC 1EXUB 2YC1A 4XP1L 4YBHA 3SO3C 5ICXA 2LAGB 3QDAA 1U42A 2PCPB 5GSRA 4AM0B 1FBIL 4ZNCD 3BP7A 1WVZA 1UVQA 4PRBA 4WCYL 5FYKU 1N59A 2V7HB 1RJYA 1YPZA 3U30B 2DQJH 5C7XL 2XPGB 3ALPA 1P1ZA 3BKML 2IADA 1GAFH 5EU5A 5J8OA 3QI9A 4PREA 1DLHA 4OLWL 4G9FE 2Y6SD 1KCVL 5DJ8A 3C5ZD 5GRVK 3BDYH 4MA8H 4MSWB 1A6TB 5KOVC 1MCBA 4XVJL 2GEEA 1MCJA 5F7KC 1WAAA 4ZD3L 4L3AA 2VDRL 4PJFB 1ZLVH 4RFNC 3LKNA 4PRHD 4NP4H 4NKIH 1IC7H 4EN3B 1A4JA 2E27L 4X7TA 2Z93B 1FIGH 3DMMC 5TE7L 2Z93A 5CSBA 4PJBA 2OI9C 4EVNA 1CFVL 2FGZA 3U6RB 3MRCA 2BCKB 2E3VA 1G9NH 4QXTB 2YRPA 5C6TH 2XNAA 2E9BA 1A5FL 3KNBA 3IJYB 4NNPL 1QSEB 2GSIB 5E1AB 5C0ND 1QLRA 3GRWA 1U36A 2QL1A 4MB3A 5EOCH 2VN7A 5IV2B 3FB6A 2F8OA 1UA6H 2ZOKB 3A6OA 4Y16D 4CRPA 2XN9D 3OKKB 1NCDH 4OLZH 3G04B 1TVDA 1D5MB 2X4OB 4HBCH 4K3JH 1B3JA 1KCLA 4W4OA 4NC1E 3FB5B 4LSSH 3UTTE 3SCMC 4KI5E 1BMGA 3OR7A 4R3SB 2X4QA 2YA1A 1P84J 4X6CE 5F1OB 5CINL 1BGXH 1KCSH 3G5ZA 3BMVA 4X8JA 2VLJA 5EUOE 3CZFB 1W2KT 1CCZA 4JO4H 1MHPH 2XZZA 4PR5B 4PGEB 1EEYA 2Q8BL 1U93A 5CJOH 3MRFB 1PX3A 3TBTB 3MRQB 1QSFE 3X13B 4H88L 4XRCB 1G7MA 4W6XB 2IALB 1QEWB 5F9WC 1MFAL 5LKNA 3TNMB 4P46D 3UYPA 2D7TH 1IGYA 2ORBL 1XIWC 3L3GB 4Y5YB 4ZODA 2A0LC 5FKPA 5J06A 1C5BL 1CGSH 2L7JA 3VRJA 1N0LA 1E4XH 2GI7A 2XXCB 2ZOKA 1QG3A 2OL3L 2A1WL 1TJHH 2Y72A 3VXRB 5J13B 4JHAH 3D39A 3QWQB 3F7RA 5IV2A 1G9EA 3G5XB 3VFSB 3CXHJ 4S1RL 3U46B 1U8OA 1YN7B 4LLUB 4OFKA 1UWEH 3CZFA 4TN9A 4HGKC 5JXED 1P6AB 4MA7H 2IF7A 4YIQA 4XCNB 5AZ2L 1NCAH 4P4KD 5I1LB 3HE6D 4JE4B 4ZS7H 3P4OB 4U33A 1RHHB 4X7TB 4L8SC 2WSKA 2ED7A 4ZYKB 5IMLA 4PJ7F 5IR1A 2CJUL 4Y5VC 3KR3L 5HVFB 5KSAA 5GRUL 4JFXA 3FFCB 3E8UL 4K23H 1NLBH 3WLWC 1LP9E 4LKXA 1ACYH 3JVGA 1MJ7H 2VDPL 5I8KH 2YKLH 4RRPA 4FFZL 5DUBA 1L9NA 2XRAH 5CEZD 4W6WB 4ZTPL 4NYLA 3FFDA 4N0FB 1IAOA 2QADB 4OBSA 4XPGL 4E5XA 2HAZA 1G84A 1HXYA 1RZGA 4MQ7A 5IGXH 1UH4A 3QA3B 1S5HA 3U6RA 2EDTA 5FV1L 3W5NA 3MSPA 4WI8A 4I18A 5K33A 3TGXA 3NZHH 1CZ8H 3P0VH 4GW5A 4B7IA 5JOFA 4BFIB 3MA7B 1CBVH 1SJEB 3GSNB 5JPMA 3BESR 3MNZA 3DVGA 5DJAB 4LLVB 3DV4A 1K4CA 4KVNL 1HH6A 4PJHA 3HZMA 4M3KB 1DDHA 2JIXD 4F7TA 1CFTB 4OB5H 2R2BB 3GMLB 5FKAA 2QQNH 3C2SA 1JFQL 4NZJA 5L8LB 3DX8B 1YEFH 2CKBB 3O2VH 3R1GL 3SKMA 5FECB 5E08H 5DD5L 2CIIB 2B4CH 3W9EA 4IEFB 1YYML 5F72S 1TETH 3MNVA 1DL7H 1YYMH 3BP6A 1YMHB 1SVZA 3QUMH 3VXMB 4AMKL 4DTGH 3ZTJG 2V7NB 5DD3H 1LEIA 3TF7C 4L8CB 3P9LA 3TH3T 4LVOB 4J2XA 4XNMA 1YDPA 4YHYB 3WHE0 3PF2A 3UJIH 3G9VA 5D96C 2GJ6E 1UB5A 4F3FA 5I1HL 1G9ML 1IKNC 2P8PA 3VFNA 5SV4A 2I5YH 4OTXH 3B3IB 5E5UB 3T65B 3MRHB 2W38A 4JVPA 1GPOL 2EXYD 3BPOB 5GGRY 4GQPH 4P49A 3RAJL 3CFCL 5DUML 2X40A 2VMFA 3LIZL 2AGJL 2DQHL 2DDQH 2YMXH 3QIWC 3BH8B 2ERJB 4Y19B 5K9OA 1P9MC 2E8ZA 4N0RA 4DCQB 3RZCB 1FZJA 5DD6B 1ES0B 1N8ZB 2G5BA 4RMWA 5FUZH 3M07A 4FMFA 4JKKA 3IXAA 1NDGA 1UEYA 1DQLH 3IF1B 4YX2H 1V5JA 4K23L 1T04A 5CLTA 1SMOA 3NGBC 2AABH 3QHTC 4ODTH 5DXWA 2ADGA 1LE9A 1FNAA 1Y6NR 2FJHA 1K8DB 5GJSH 1G7HB 5DTFA 1V7NH 4PY8I 5BVJA 4GKZB 3BKCL 5CEYB 3DRTA 3QJFA 3V5KB 1WT5C 2FJFA 2Z91A 4Y1AB 3GSUA 4PRAA 5BVJB 1AE6L 2YR3A 4ZPTB 4P4RB 3QG6B 3U7YH 5GISL 5HI5D 2NNAA 1NUDA 3GMRA 3RDTB 4FQHB 4XTRD 5I71C 3S36H 3S35L 1I1AA 3V6ZB 4HEME 5FYJD 5C0BD 5K9QG 1OP5K 2B1AH 4PTUA 1HHIA 5DURB 4RCAA 1UWXH 2GAZB 3GB7B 3DSNA 3KS0J 1OAXH 4I4WB 4JFOA 4I3RL 5DD6A 4QOKA 5D7SL 3L7EA 3NPSC 1GVIA 2FWOB 4C58B 1S3KL 3HAEG 1G1YA 5D7LB 4X6BB 3U7WH 1NC4A 5BO1L 1I3RB 4H25A 1H5BC 3CLEH 4G9FA 5BV7C 1PG7H 1P4LA 1QA9B 4XMPL 1XGUA 2P8LB 4NOBA 3P4NB 1MIEH 1ZLSL 4JDTH 4HSQA 4PRPE 3FB7B 1CDGA 1P4LB 4ZAKC 4QT5B 5F9OL 3REWA 1KN2H 1MCOL 1FGVL 3GJEA 4Y4FC 3LKPA 1I7ZB 5MP6H 5I1JL 4HULB 4M1DL 3KDMA 3LPGA 4LU5L 2AK4E 4QRPA 4Y8AA 4JFOB 4NN5C 4DKEL 12E8H 4GLRI 2BHYA 1MAML 3RWIA 3T3PF 1JYVA 2PYFB 2F5BH 3GMMB 1NGYB 4N0CC 4C55A 1YEIL 4LCWA 5JXAL 3BX7C 1AGBB 1WV7T 3RDTC 3VDAA 3K8LA 1EO8H 3PWPB 5FOJA 5E6IB 3IETB 4NM8L 4F9PC 1NFDB 4ZFOL 3MBXL