4IRZH

Crystal structure of a4b7 headpiece complexed with fab natalizumab
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
222
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGFNIKDTYIHWVRQAPGQRLEWMGRIDPANGYTKYDPKFQGRVTITADTSASTAYMELSSLRSEDEAVYYCAREGYYGNYGVYAMDYWGQGTLVTVSSASTKGPSVFPLAPCSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin alpha4 subunit
publication title How natalizumab binds and antagonizes alpha 4 integrins.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 36
structure length 217
sequence length 222
ec nomenclature
pdb deposition date 2013-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4irzH01
4TUOB 2LFGA 3D3VD 4Q9BA 1NSNH 4F58L 5BMFH 1UB5B 3P0VH 3GSQB 4G8FB 5DUPL 4NQCE 4QO1A 1N64L 2EDJA 5IG7B 4LSTH 2UV3A 4L3ED 3F12B 2APWA 6CGTA 5MI0C 2PN5A 4PJ9A 3RKPA 5IQ9B 5EZOL 3D39E 4JPIB 3TJHC 4YJZL 1YYMH 3SKJH 4HXAH 4DN3H 4TVPH 2HWZH 1ZGLM 2EKJA 5GSVA 3W82A 1SYVA 3GBLA 2OP4H 1SM3H 4FQ2L 4H1LB 5IMLA 4G8GE 2AEQL 3U79A 3V6ZB 5E94A 4BKLA 2KH2B 1MFCL 1MCWW 1TDQA 5C0IA 1ND0B 1MQ8A 4XNMB 2P5WA 3JV0A 4KRNA 4F8QA 4KROD 3TO2B 3BEVB 5C0FA 3UJJL 3X11B 2BNRB 4YR6A 4ELMA 5FHAH 1T1YB 2HJKA 4IHOA 2HJLB 4YBQD 3S37H 4I18A 2NX5E 4DQOL 5FV2A 2H3NA 1MJJB 4MD5B 5FYLE 2W0LA 1KG0A 1UT9A 4AEHL 4XBPB 2IPKB 5D5MA 4K23L 3QJFB 5ETUB 2X4PB 1TNMA 4GKSB 3QUZA 4DTGL 4JFFE 3P73A 3DV6B 4PJXB 2EE9A 4RDQF 4XAWH 1WT5A 1UCBL 4ZUWA 1ZANL 3GHEH 3D85A 5H35B 2BNQE 5JO5A 2FBOJ 3SDDA 1GGTA 4FQLH 3IDMA 1H3GA 4IRJD 4D9LL 2B4CC 1XH3B 4QXUH 2HMID 4MQ7A 5KSAC 5FO9B 4NSKA 1A2YB 1J8KA 1PGRB 5D7LB 5I74B 4O2FB 1PD6A 5C08E 3MBEB 1KCVH 1YEHL 3ORJA 3KPRB 5FF6A 3VRIA 4P46C 4XP5L 3P11H 3C5SB 3OKLA 2YD5A 4ZNEE 5FKAA 3BJ91 2HN7A 5D1ZD 5ALBH 1F2XK 3K4ZA 3KXFD 4FZ8H 4K2UH 5SX5H 4XP6L 1JPSL 5SWSE 4TTDD 3EYQC 4Y4KB 3VD3A 4GG6B 1KLGA 2VH5L 3QXUA 4PJBE 3KVQA 3C8KA 4X4YA 4ODWA 4Y16C 5LAXA 3KLHC 4KUZH 4ZUUB 3ZE1F 1FRGH 2VXVH 4UBDC 1QP1A 5KVGH 2DWDA 2XZCL 2XICA 1R5WB 2YKLH 5IJKC 1EXUA 4Z5RA 3TJEH 2EYTB 2Q3AA 1LO3H 2AABL 1VFUA 3MRLA 3FT3A 4PJEB 3RBSA 2DJUA 3CDGB 3RY4A 5JW3H 2WWKO 5GJSH 4N8PA 1JJUA 2FD6H 3QDGB 4NQXA 1NLDL 2OI9B 2R29L 4TSBH 3WIFA 1FNEA 3S4SB 2XXMB 5I0ZA 4PRHE 1U2HA 2WP3O 3SCMA 2PKDA 3JV5A 3BH8A 1U91A 1WIPA 5I1LB 4RWHA 3RWEB 2BSSB 5FA4A 3MA9L 5I66A 5HD8C 3HUJF 5EU3A 2FO4A 3OPZH 2BSED 4NWUH 4PGBB 3CK0L 3S35H 4FFZL 3C60D 3L5HA 2CKBA 2CR3A 1A7NH 2JE8A 3V79C 3G5YA 4I3RH 3P30L 1MPAH 4GO6B 3TH4T 3VXRD 3P4OA 3SQBA 3KPMB 3ULVF 4NO2A 3QH3A 3CFJA 1F5WA 4MS8D 5DWUH 2AV7B 4CAGA 1N2RB 3V0WL 3KYNB 1IQWH 4N0UA 4X6DF 4UV7L 3UTSB 5JR1L 1NBZA 3BH9A 1NBYA 4FRWA 4R4NC 3OKMA 3TYGL 1X5KA 5IB4B 4HBCH 1HWHB 5JXEA 2MCG1 4P23C 4Y7MA 1U2CA 4Y4HD 4JZOA 1W8NA 2JCCE 3KXFA 5F1SA 1EERB 5F8RC 1F58H 5TQ0H 1N8ZA 3MJ8B 3I84A 4P57B 5JOEA 1LO5A 3IXAB 3HKFA 1I7ZA 5I16B 4HHAA 5F6IC 1HI6A 2XZQL 4HUUB 4P9ML 5CEYB 3T2PA 4HKJA 1F3RB 1FNHA 2IBBA 4L3CB 4DGVL 3B9KB 5E8PB 2JJSA 1JZ7A 1HOCA 3M1BB 4H26A 4UT7L 3WUWA 1XGQB 2EH8L 5HHNB 4EN3C 1VEPA 2ZKHH 1AI1L 4IJ3C 2A2QT 5D1XA 5KS9B 2DYPB 4XI5C 4Z0XB 2Q6WB 1YEKH 5SWQA 4P2OA 1M6OB 4FG6C 5C71A 1Z6JT 1MFEH 1PX4A 4JFOA 1IGIL 4NQEB 2DQFB 4L4VA 2XWJA 4HIHB 1MFAL 3KJ6H 4EI6B 3BN9D 2EDOA 3HPLA 3KWWB 5DO2C 5H94B 5I6XC 4LVOB 2GJJA 4ZFZB 4YHKL 3E3QE 5I8CB 1X5HA 4PR5B 2WLZA 3HNVL 4EQ3A 4C56A 3L95A 1FO0H 2AK1L 3L7EB 1MVUA 5ANME 2ERJC 1TJGL 4DUVA 2VYRE 5I8EA 3VWKA 1H5BA 1UM5H 4DOHB 2EZ0D 2EE6A 1CXKA 2IEPA 3VA6A 4YEEA 4GMTL 4OQTH 3S36H 1DE4A 3ARTA 2V5SA 2ZG1A 4P5TC 4TSCL 4FNLL 2FRGP 4O9HH 3WKNA 3S7GA 4H8WC 3W0WD 1G7PA 1NH6A 2KDGA 3QUKB 2CKNA 3FN0L 3DYOA 4XPFH 1U3ZA 4QRPE 5IUSA 1AO7E 5IEKB 5HDOA 4HDIA 1F90H 4FXKA 1U8OA 5HYIA 1BQHB 1LP9E 4YNYA 5FO7A 5K9OA 3ULVE 4BH8B 3OKDB 2XN9D 1LEIB 4Z7WA 3KPLA 1EIBA 1KTRL 3KPNB 1RUAH 1I1YB 4X6DE 1DEDA 4M93B 3ARFD 5C0EA 1LDSA 4I4WA 2Q86B 1HHHB 4MJ5B 4P4RB 3GMNA 2FIRT 1F4WH 2UVFA 1IEAB 3X3GH 3GKWH 2Q87A 1D3CA 5F7NC 1CIUA 1YEDA 3VFPA 2EDBA 1B6UA 4GH7B 2F19H 3LEXB 3L3DB 1GPOH 3EFDH 4ZOEA 3UTTD 2H6PB 5ID0B 3MLUL 5IVZB 4F57H 1FBIH 1G6RB 3PHOA 3UBXB 4H20L 1ZOXA 2FBJH 3WNLA 3T09A 4V1DA 3C08H 3QJHA 1EZVX 4M9OA 4M9PA 1OGAB 1CFVH 2YK1L 4H1LG 1P84K 1IQDB 1FV1A 3KGRA 3BIBX 1TITA 3QFDB 5KSVA 1J0HA 2APTA 3UO1L 2O5ZL 4OFYD 3OAUL 3QCUL 3FL7A 3TZVC 3OHXB 4R7DB 1DBML 5SX4H 4IIQB 3BRFA 3ZKXC 1E4WL 5BQ7B 1FP5A 1FYTE 5DD3H 4UNTA 4KAQH 3RA7H 4AG4L 2ICEA 1HYSD 1XIWA 2X7LB 2CK0L 2NY3C 5EBLB 1CFQA 1T6WA 2Y7QB 4PV8B 5EU4A 5SV3A 3MR9A 2OQJA 4LPXA 1ZLUH 3MLRH 5DJ6B 1FL3B 1URLA 3CFKB 4K3JH 4MCYA 1RJLA 2NY1C 2VZTA 1TJHL 5CINH 5HVFB 2ARJA 1KYOJ 3MA7B 1AKJA 3MV9D 3O45A 4IS6B 4E41E 3B9DA 1JGVL 1EJ6A 3CPLA 1ORSB 4PBXA 2EXYC 2UZXB 3KNBA 3ZHDA 4U1MB 5GRXG 3QULB 1JHKH 4XPAL 1S7RB 3VE0B 2ZOLA 3O3DA 3PDOB 1I9JH 3SE4A 4X9GA 5C0AD 1IGFH 3M17B 1FG2A 5J56B 4C83B 3WNMA 2HKHL 3L3KB 1MFBL 4L4TB 5F7YC 3S97C 3HPJA 4BQBA 4LARH 2G5BA 3ARFA 4PJGA 1JCKA 3DROA 2UZIL 4RX4D 5HHPA 2VWEE 3LD8C 2YRLA 1CXFA 1YEGL 2CDFB 5I76A 1GGCL 1BD2B 2VLKA 1XZ0B 4AL8H 3G6JF 5IMKA 4R2GC 1FVDB 2DQEL 1L0YA 5EO0B 4IRZH 4O2EA 3OAZK 5K9QG 5TDNA 4WUUA 3PP4L 2X42A 1A5FL 3PWNB 4U7SA 1IC1A 3NVQA 1DBKH 1B4JH 1RU9H 3C6SB 32C2B 2MHAA 5IMOB 5I1JL 1ES0B 2VLLA 12E8L 4K7PX 15C8L 3AMLA 1Z0MA 2IPUG 3SKOA 3U0TB 4ZUSA 1RMFH 1G9NC 5LCVL 4BZ2H 3SGEI 4UOW1 2VDPH 4JG0L 4YDKL 4MDIA 2F74B 3B9AA 1IT9L 5C0BE 5IQ7H 3FN9A 1TVHA 1EAJA 4MLSA 1DQDL 1DVFB 3DJ9A 1F3DJ 1P5VA 1CIDA 4BH7A 4V2CB 5C8JB 1IM9B 1YECH 3QCTH 3O6ML 4CMHC 3IJHA 1DSFH 1YJDC 4M8QB 1FZJB 4NPYA 2KBGA 5LBSL 3O4OB 2R2HA 1UVQA 5L2JA 4UTAH 3LS5H 4MXQD 4YXLL 1NQBA 1M05A 1P7QA 4HFWB 4OZIE 3FFDB 5T3ZL 3UTPE 5CZVL 1KIPA 3O0RH 5D72H 3VMOA 4RRPG 4UDTB 2MSPA 1XCQB 3TC9A 3QDJB 3DX6A 5BS0B 4EBQH 2C3HA 4S0SD 4ODXB 3U4BL 2R2EA 5E2JA 2C1OA 2AJSH 2DLGA 4OZHE 4BZYA 4ZQKB 3FQTA 1KCUL 4KXZH 4MA8H 3GBNH 3GHBH 3OXSB 3RWFA 4Y1AE 4NO0A 3OR6B 1DQJA 5FECB 2QSCL 2OR9L 3CSBA 4P2RD 1JV5A 4M48L 5FYJU 1VFAA 3OKEA 3ETBF 1PKQB 4L8CB 1U8NA 2Y1VA 4GBXB 2G5RA 3MLTA 2D4FA 1MQKH 2YXFA 1A7QH 5FGCE 3O6LH 4X4XA 4EI5D 5DTFA 2UZYB 3VXMA 5CILL 3VGAB 5DQ9B 4OI7A 1GCFA 1QFWI 4R3SB 5BV7H 4ZDHA 4WFFE 1KLFA 1MJ7H 3OV6A 1TQCB 1UZ8A 1WISA 4LSUH 3WBDA 3VXUA 1OVZA 3JTSA 4MQXD 1UKTA 3DUSB 3O8XC 2Z8RA 3GSUA 3VG0H 4JANA 4XCYB 1A3RL 3RGHA 5DD0L 3MMEB 5DZOA 2VL5B 2XA8L 3KPSE 1MFNA 3TT3L 2BVOA 4HWEH 4IOIA 2IPTL 4GLRI 3W11C 3P9LA 3RWHB 2P8PB 3TBWB 1FO0A 1HSBA 1OAQL 1I8LC 2WBJA 5I9QC 2ENSA 2G60H 3GSVA 5EB9A 4HK0A 5L2KA 1H0DA 2X41A 5C0GB 3PDDA 4OQTA 4ODVL 1F3JA 5HBBA 3QXVA 2XT1B 4NNXB 2D0FA 1IBGL 2VDNL 3GSOA 3T1FA 3UC0H 5BVPH 3PF2A 4O4YH 4K94L 1YY8A 4RFNC 2NY4B 3ZT6A 3BESR 3OG6B 4KHTL 4M00A 2PNDA 4J3UA 1Q0XH 1F02I 3RVUD 2X4UB 1RZ7H 2CUIA 4L9LC 3CJJA 2F8VA 3SOBL 3KS0J 4PJ7A 4OKVA 3DXAD 4PJ9B 4JO3L 4DKAA 2D7QA 2DI7A 5DRNA 2HRPL 2VDLL 1DFBH 4JGUA 1LK3H 3OB0K 2ICWI 4K9EL 2RB8A 4UNUA 4X80L 4ZTOL 5GSVB 1ZLVK 4NZJA 1X6LA 2FECL 2EDXA 4JZJC 1IAIH 3F58L 4HXBH 3QXWA 4UT9L 5IMLB 1B0RA 5E94B 4BKLB 5C0IB 1MLCA 4JFDE 4NUGH 5TFSL 1U42A 5KVMC 4MWFB 1Y18A 1UYWH 3UTQA 5F7FA 5C0FB 1MRCL 4YR6B 4JM2F 1WWAX 4IHOB 1HHGA 3CIQA 43C9A 4I18B 4WI6A 2YUXA 2H3NB 1FFRA 3ARSA 1RUQH 5DEGA 1BQHG 1KG0B 1S7TA 1NC4A 5D5MB 3ZKSD 2BSRA 5KN5A 4OCSH 5J13B 3O2DH 4R4BA 1MHPL 4JKLA 3QUZB 5JW4N 1IARB 1KXVC 3P73B 3LZFH 1A02N 2XRAL 4HJ0C 4D3CH 4KY1L 4BSWA 4M5YL 4G6FD 3D85B 4M02A 2QQLH 1IRAY 2WV3A 3SDDB 3IDMB 4UOW0 2GW5A 1DBJL 4GRMA 4NSKB 3TV3H 3P4NA 3QCVL 2NY7L 5FF6B 1F4HA 3GRWH 3VRIB 5TGBA 2R0LL 2V2TA 3OKLB 3OBAA 1MCEA 1FL6B 3UBXG 4NQDE 1CG9A 2NXYD 2HLFC 1UKQA 2HN7B 5E9DD 2EIEA 4XTRC 4PLJD 3DBXB 4PG9A 5CZXD 4G6AD 4NN7B 3MV01 5IIEB 5DJAA 1OT2A 5D2NA 3MODH 3VXTA 1I4FA 1KLGB 3C8KB 4X4YB 1WQVT 4ODWB 5H37H 5LAXB 3JUZA 4H0IA 2IFGA 3ARDD 1KLUA 5ADPL 2DWDB 4OCNC 4PJHF 5M94B 1RJZB 4CBPA 1MEXH 4Y2DD 1EXUB 3D48R 4GMSL 3S98A 3SGDH 4D0DA 4Z5RB 1A4JA 5C0JA 2Y25A 1CT8A 4OCRL 3MRLB 4UOJA 3WFCL 3FT3B 2VRAA 3NCJH 2F54A 2JF1A 3LEYL 5EPMB 3T0EA 5IFJA 4WFED 1C12A 4NFCA 3SGKA 2QADB 1JPFA 4JGMA 3EO0A 2CIKA 4OGXL 1UM4H 2PR4L 3ZLQC 3QNYA 4NQXB 4D8PA 3HR5A 3HRPA 1I85C 1OHQA 4U33A 4Z9KB 3WIFB 1FNEB 1G7QA 4NUJA 1AHWB 3REVA 2J1KA 2YMXL 3SCMB 3HZKA 5CP7A 1U91B 3ZKND 3ROLA 4K8RD 5FA4B 5I66B 3MO1A 5EU3B 2FO4B 1NMAL 1QRKA 4GKNB 4LKCA 1EO7A 5E5UB 5EU5B 2CKBB 2NLJA 3G5YB 1TJIH 2HG5A 1PY9A 1WAAA 4GRWF 3P4OB 2BSTA 2CKBL 2VXUH 4NO2B 1ORQA 3EZJB 4FN0A 3U7YL 3QH3B 3CFJB 2OI9C 1NCDL 4G9FE 3R8QA 2AJZA 2IG2L 2DI9A 2RCSL 4JDTH 2X4NA 3CGTA 5CEZD 1IEBB 5CKAA 4DN4L 4N0UB 4UQ3B 3BWUC 4PP2A 2DOCA 2DBLH 1NBZB 1A4KA 3BH9B 5HDBF 1MWAA 2EH7H 3LN5A 1JHLH 4E41D 4NM8H 5EU6D 3HG1D 3HTLX 1KJ2H 3FO0L 1C1EL 5D1QB 3Q6GL 3VFSA 1F6FB 4PBVC 1JPGA 1KCSH 2NW3A 3UDWC 3GI8H 2WANA 4RWYH 4YDLB 3DX7B 4NFBA 5I1IH 5H8DA 1N8ZB 4KDVA 4PTUA 2FX7L 3RAJL 1SJEB 3WDHA 4LLWA 4WTZA 2Y07H 1LO5B 3H3PL 1FIGL 4KJQD 1I7ZB 3R06A 5BO1L 3VGBA 1QFOA 4HHAB 3U7WL 1VDGA 5F21B 2R1WA 2IAND 1LD9A 3ARGD 4HKJB 4OCWH 4BSJA 2EO9A 2EDKA 3IFNL 1HOCB 4H26B 3QDMA 3AM8A 1PSKL 3VH8A 1EH9A 2YD1A 4EDXA 3CZJA 3F7VB 3Q48A 2PXYD 4MB5A 5D1XB 1ZT4A 1R3JA 1T0NA 4G8IA 4X6CE 3RGVA 3TO4A 2DTMH 4JPWH 5SWQB 4GS7B 4P2OB 1OAUL 3QZWA 5HGDA 4S1DC 2Z93B 3ES6A 4OIAA 4I0PA 1LMKA 2WUBH 1YPZA 4JFOB 5E2UH 5CGYD 1HK6A 2XWJB 2X70B 3DRTA 4KZEH 5D2LF 3HE7D 3MRPA 3QWRA 1H8OA 3HPLB 3EOAA 3H9SA 4N8VG 5C92A 1BEYL 1P2CA 4QY8B 5I18H 4KK6C 3GO1H 5C0BD 2FLBT 1DR9A 2F53D 4Y89A 4C56B 4JFEB 5F7EH 2NY2C 3L95B 1AD9A 2X4TB 1EFQA 1MI5D 4HWZA 1NMCB 1KFAL 4OZFH 3IXTA 3IAPA 5E4IA 5HHME 5I8EB 3VWKB 1H5BB 4W4OC 3DNKA 1YYLH 1KIQA 2ADIA 3P0YH 3THMH 2BNUB 4GRLA 1JZ6A 1DE4B 3UTPD 2LV4A 2YS4A 2MCPL 3MLSH 4LVOC 3VGFA 2E7HA 2DIAA 3NA9L 5CD3A 3WD5H 4ZTPL 1FAKT 2LTQB 2Q1EA 1U8PA 5BMFL 3LIZH 4Q58C 3P0VL 4KJYA 4RGNB 1G7PB 4NN5C 2WWMD 8CGTA 2ZUVA 4Y1AD 4LSTL 5GPRA 4HDIB 1WEJL 1RZKH 1DANT 3FKUS 4FXKB 1U8OB 3FZUD 5B3NA 3LMJL 5F7DA 3U30C 3DMMD 4PRIA 4U6HA 2JIXA 4YNYB 3MCG1 3DVNA 3H9YA 5JDSA 5FO7B 5K9OB 4MYWB 3HI6H 1NJ9A 4GAGL 2K3TA 1YYML 3SKJL 4HXAL 4LLQA 4DN3L 4TVPL 3NCFB 4HH9A 4Y8AA 4Z7WB 2DL2A 3KPLB 1RSFA 4Q7DA 3V4UH 2OP4L 1SM3L 5AYQA 5C0EB 4I4WB 2R2CA 1BFSA 3GMNB 4X99A 4ACPA 3RHWF 3WXVH 1AC0A 5KOVC 4D94A 3GMLA 4QLRA 2PXYA 3ALWA 4F3FA 5BW7C 5H2BB 3NFPA 5BZWA 5F72S 2I5YH 3VFPB 5DHXB 1XF4A 5AUMA 3G5ZA 4MA3B 1J0YA 4OZGA 5FHAL 4JPKH 2VUYA 1CD0A 1K5NA 4HPOH 1FNSH 3S37L 3SGJC 3PHOB 2R8SL 4KGLA 1INEH 3O2DA 3MJGX 2D7MA 2Y72A 4V1DB 4O5LH 5DRXA 3QJHB 4M93C 4KMQA 3T0BA 1EJOH 4IMKA 4BZ1L 1JWSA 5TH2B 3AS2A 1FV1B 2PYFA 4EJ1C 1N5YH 5E1HB 3LH2L 4P0DA 5FB8A 4XAWL 2ZCHH 3GHEL 2CO6B 4J4PD 3KPPA 5I73B 1SY6H 2ICEB 4GG8A 1XIWB 4QXUL 3GRWA 1MCOH 1PY4A 4PRNA 4M7KL 5EU4B 1BIIA 2HT4D 2OTWA 3MR9B 3GEWB 1KCVL 3D2UD 3TIEA 1RVFL 4KJPC 2XQYG 3ARRA 1UH3A 3P11L 4MCYB 2EDWA 1FDLL 1RJLB 3EOBA 4XPBH 5D6DA 1ROWA 1R3KA 4OIIH 3BUTA 2UUDK 3CXHJ 2E8YA 1AKJB 4IIQC 2GTZB 1VESA 1YY9C 3CPLB 1X6NA 4FZ8L 4K2UL 2DN7A 3KNBB 1CCZA 1PAMA 1NEZA 2CLZA 4XNXH 2OMNA 1WCBA 2ZOLB 3O3DB 4CW1B 1CFTA 4KUZL 3ULUE 1FRGL 4LSDA 2VXVL 5KVGL 1L0QA 2YKLL 3T3PF 1T03L 5I75B 4XPGL 4YDIH 1KENH 3HPJB 5EIIB 3TJEL 2G5BB 5IHBA 5ACLA 1LO3L 4PJGB 2ITCA 3DROB 1MVFA 4U1HA 5IF0A 1JZ3A 4XXDA 3F62A 4WCYH 5C2BH 5JW3L 3V52L 4OD3H 5ESQB 1ZT1A 2VLKB 3PWLA 5JHLH 1A6WH 4NHUB 5E8NA 5IMKB 5CWSA 5F9WB 4O2EB 1I75A 3IDJA 1Y6MR 3IAQA 4M6MH 4TSBL 3U0WH 5TDNB 5GS1A 1J11A 4RMUA 4WUUB 3MJ6A 2MKWA 2O5YH 1C5DB 5C0CA 3QXDA 1NGQH 4PGEA 2CQVA 4U1NA 5T33H 3OGCA 4PS4H 5HVGB 3G6AB 2MHAB 2FEDD 2ZUSA 3OPZL 4NWUL 3S35L 2VLLB 2VQ1A 2J88H 2FWOA 1DZBA 4L3AA 1U6AL 1A7NL 3BKMH 1MJUH 3FRUA 5FEBA 1U8QA 1QG3A 3EYSH 4G42A 1MPAL 3SKOB 1TVDA 2V17H 4LGPB 4MDIB 4KK8C 4LSSH 4OM0H 5DWUL 1TVHB 4NQTA 4BH7B 1F4AA 5FGRA 4E0RA 4NN6B 1GGBL 1XCTA 3CSPA 3L3HA 4P49A 4GXVH 1KJ2A 3RDTD 3LCYA 4NPYB 3CFDA 4AQ1B 5HYJA 3QBTB 1IGTA 3SJVA 4JHBA 2R2HB 1UVQB 1AD0A 1QFPA 5L2JB 2BXZA 3BGAA 4HBCL 1M05B 1P7QB 3KHQA 2Q7YA 4Z7QE 4WI7A 5CBEA 3CNKA 2XV6B 4FQQB 1KIPB 5EUOA 1BJ1J 5D9SA 3DX6B 4P9HH 2ORBL 5FM4A 5TQ0L 1F58L 3QRGH 5TE4H 2R2EB 1DVFC 3N9GH 3FQTB 3PWUA 2QSQA 1BQSA 3RWFB 4NO0B 1IILE 1DQJB 3U82B 1K3ZA 1JV5B 1C08A 5JHDD 1VFAB 3OKEB 5DK0B 3OAZH 1U8NB 2CMRL 3VFUB 4FFWC 4X4XB 4J8RA 5DTFB 2ZKHL 3WN5A 1WITA 3VXMB 3I02A 5ISZE 1FFPA 4ZDHB 4QNPF 4MHHI 1YEKL 1QBMH 1M1SA 2YN5A 4KK5C 4MXWH 1UZ8B 4QHKJ 3VXUB 2R1YA 1PX3A 1MFEL 3LKPA 4JANB 1U41A 3A6BH 3KJ6L 2P5EE 4GBXC 4YX2H 3G5VA 3T0AA 3PGCA 5IBLD 4YHIA 1VEOA 1RURH 3WUWG 2F15A 4JM2D 4KTEH 1HSBB 4U1IA 3T3PE 4G80A 1E28A 5E99H 1P7KB 3H2WA 4OZFA 4XC1H 5FXCH 2NR6C 3GSVB 4WTWA 1PZ5A 1AR1C 4HK0B 5L2KB 1QRNE 1BZ9B 1VADA 3FO9A 2NTSP 1FO0L 4YHZH 1H0DB 2M1KA 1T0MA 4KHXH 4P5MA 1EO5A 3M07A 1H15B 3UTOA 1F3JB 3GSOB 3T1FB 5TDOA 2H41A 4XWOD 5GRVK 5HYEA 3A6OA 5L88H 3S36L 3RWGB 2NTFA 2YUZA 4D0BA 1CLZH 4DW2H 2V2XA 5KSBF 4R6UA 4BFEA 1QFWM 5DVOA 3O3UN 4JE4B 3MSPA 4LPTA 1HSAA 3WCYA 4O9HL 1KEMH 5HHQA 3FJTA 4PJ7B 4OKVB 5FYKE 2VUOA 4HUVA 5IWLA 2F5BH 2GITA 5DRNB 4K94C 3V0AC 5LWYH 3EIFA 1I7TA 5FFLA 3GK8H 1UQSA 3EJYD 2NY4C 4U2YA 1H3TA 4MJ2A 4QXGL 1B0RB 2DF3A 3FQXB 3V6OA 3U1SH 1X5XA 4P4KD 2A9NH 1MLCB 1RUAL 1TZIB 1Y18B 1U93A 3UTQB 2P47B 4JVPA 1L7TL 4PJ9C 3SDXE 5F3HA 4K9EC 5L6YH 1HHGB 1F4WL 5GGQL 4DZBA 5IP4A 3X3GL 3GKWL 43C9B 2FH8A 4NDMA 1N4XH 4P59H 5F1NA 2XWTA 4NFDA 5DEGB 1S7XB 2ARJQ 5DT1H 2Z31A 1S7TB 1NC4B 3ARXA 2F19L 3AY4A 4N68A 2BSRB 4M7LT 5KN5B 5FYLH 3EFDL 4R4BB 3EBAA 4PJIF 5T1LB 5IBTL 4AK1A 4F57L 1FBIL 1W0YT 5HHMD 2DQGL 4CKVX 4OT1L 2I26N 3C08L 4L29A 3TJHD 1NLBH 3E8UL 2BRRH 1CFVL 5JA9A 2FL5B 4I48A 4LF3A 2MTPA 3MUHL 5FV1L 1LWRA 2YPLA 4LMQE 4I18C 5DDHA 4GRMB 3DX9A 3WIIH 5BOPA 1S9YA 3T77B 1SY6A 1FLRH 3P4NB 2R39A 2ESVB 3RRQA 5J13C 4OGYH 5TGBB 3U48A 5DD3L 5JPMA 2W91A 4HS6A 3QUZC 3WKML 4Y19A 2B1HH 5JW4M 5IFAH 3L5WA 1DANU 4QNPE 2VR5A 1WT5C 5DK3A 1U8IA 4U1LB 5E56A 3QFJD 4A6YH 1CR9H 4XP1L 1I7UA 4K3JL 4PG9B 2V2WA 4FXGA 1ZLVH 3HZVB 3BUYA 2NQCA 5DJAB 3O9WA 1BVKA 5D2NB 3SDDC 3VXTB 1I4FB 2ATPA 5CINL 1J87A 4XHJC 1HHIA 1ZHNA 4UV4H 1CDCA 4NZUL 4XXCA 1AE6H 2BHYA 1KLUB 5HVHB 35C8H 4MLIA 1N6UA 2ZOKA 4KMTH 4DEPB 4OQ1A 2OBGA 4D0DB 5C0JB 3I6LE 1W72H 4I2XE 4YQXH 1I9JL 4BELD 3O3EA 1N26A 3AROA 1IGFL 2F54B 1RJCA 3LEVH 4NN7C 3T0EB 1V7MH 3GJFK 5KSAD 5IFJB 2A73A 3QUYD 5C6TH 3CVIL 4JRXA 1C12B 1JPFB 4QOKE 3EO0B 5J0BA 5I1DA 5J12B 3QNYB 4L1DA 2Y6SC 4D8PB 3EGSA 4P46D 4N1EA 5KSBE 1G7QB 4NUJB 3REVB 4LHUA 3HZKB 3KYOA 5CP7B 4AL8L 2P48B 3ROLB 3W9EB 5T5NG 1NFDE 2AJVH 3BGFB 4IRZL 3VJ6B 4EXPX 5D7IA 5FIEA 2PUQT 3EYQD 2X40A 3FFCE 5A43C 1MAJA 1TCMA 2DL9A 5K9QI 2F5AL 3LPFA 2HG5B 2V9TA 1DBKL 4FQHA 2QADC 3N85H 3Q3GB 2NW2A 4EQ2A 2BSTB 4UBDD 3QA3A 1Q0YL 1ORQB 3RY6A 2CXKA 2AJZB 2LAGB 4QHLA 4U7MA 4FTVB 1RMFL 3SCMC 2G9HA 2YWYA 1GC1C 4PP2B 5SWZA 4BZ2L 3SE3A 2VDPL 1RUPH 1A4KB 4OFPA 3ARED 3LN5B 2PTUA 4Z7UA 4S2SA 5F1OB 4JHAL 2R15A 1OP3K 1MWAL 3C8HA 1KCKA 1H8SA 2CLVA 2VIRA 1IMHC 1YECL 3QCTL 5EOQH 3VFSB 1DSFL 3CAFA 2NW3B 1JPGB 2ZWLT 5J57B 3RX7A 3HZMB 2IWGA 2X6MA 5DA0B 1HXMA 2X5PA 5CEXA 4PJIE 4UTAL 3LS5L 1U8LA 4PTUB 4YZFE 1IFHH 4PRPE 3B2VH 1HQRA 4LLWB 4X6BA 3ZE2E 5HD8D 5JDJA 3N50A 5DVLA 5D72L 3R06B 3GM0A 1A6VH 2GFBA 4EBQL 1LD9B 3HC3H 3PNWA 5INDA 5D7JA 2AJSL 2B8OT 1B2WH 5BRZD 3IYLW 5JXEC 4BSVA 4F2MA 4G43B 4MA8L 5B4MC 3QDMB 3VH8B 4HS8L 4X6FA 4EDXB 3MV8B 5D1ZC 4YDLC 4NRZA 1S78C 3BGMA 2VLJE 3HMWL 5EO9B 4TTDC 4RCAA 1ZT4B 1T0NB 3QUYA 5DYOA 5D7SL 4G8IB 4DWHA 3VGEA 4UUJA 4OD1H 3RGVB 1WWCA 3TO4B 4UU9A 5LGJB 1QR1A 4PLKC 1KV3A 4P5KA 5HGDB 3QZWB 1MQKL 3G5XA 1A7QL 5BV7B 3O6LL 5KTEH 3ES6B 1AGBA 1KIRB 4I0PB 3CCHA 2BOBA 1RZFH 1YPZB 3LRHA 4U6TA 5L0QB 1IC5L 4P23D 3TH2T 5BV7L 2JJSC 3MRPB 1MJ7L 2QSTA 1KB9K 1QKZH 5E6IB 5IVOA 4LSUL 3ET9F 1OGTA 3H9SB 5J06A 4GG6F 1P2CB 3RIFF 2VQUA 4K8RL 3ZZ1A 2XZZA 4R8WH 5D1XC 2DICA 5IR1A 2PTTA 1DQMH 5GS2H 1AD9B 3C2SA 4GS7C 4P2OC 2O5XH 4HWZB 3RUGF 3HI1A 4FABL 3C5ZB 4GXUN 5FYJE 1JWUA 3QIBA 3FB8A 4X9IA 1KIQB 2ADIB 3MRQA 4YBLB 5CEZL 4EN3D 2MQ3A 1TLKA 2CDGA 1CGWA 3PWPE 1DUYB 4XI5D 4YE4H 5BVPL 1N5AA 1MF2H 1IGCH 4G6KL 1U8PB 2N7AA 4KJYB 1QSFD 1T5XB 4FG6D 5FGSA 3D69A 4NQCA 1NMCC 3UTZA 1Q0XL 1SJHB 5CJQH 5CJBA 1RZ7L 3VWKC 1H5BC 4XAKE 2AXHA 4N8CH 2HAZA 1JGLH 4PRIB 4U6HB 2JIXB 3DVNB 3B9EA 3D39A 4KTDL 5JDSB 2VZVA 3WNPA 5HYSA 1NJ9B 2EXWC 4Y4FA 1DFBL 4TPRL 4F7TA 4LLQB 4OLXH 4HH9B 3ULVH 4FFVC 4LFHD 2XZAH 3A67H 1KUMA 2LTQC 5EOCH 4MZ2A 4G8GA 1IAIL 4ZD3H 2DAVA 4RGNC 4LSVH 4X99B 4NO3A 3BZDA 2GCYA 1DL7H 1J8HD 3GMLB 2R2BA 4LQFH 4F3FB 1DJSA 4ENED 3NFPB 3ROOA 4NUGL 1WV7T 1YNLL 5BZWB 4XVTH 1OTSC 1UYWL 2B5IB 1XF4B 5AUMB 5C1MB 5IM7A 3WNNA 2HFFB 3G5ZB 4PUBH 1T2XA 4MX7A 4OZGB 3QWOA 3HLAA 4P5TD 3UPAA 1PLGH 1K5NB 2NX5A 2QKIA 5DD5H 1RUQL 3V6BR 5DRXB 4Z7VE 3RI5K 1GIGL 1QRND 4OCSL 3O2DL 4JB9L 1JWSB 4JFFA 2PYFB 1SHMA 1S5HA 3QEQD 4FZEL 2NXZB 1BWWA 1YQVH 5FB8B 1FZKB 4D3CL 2C3VA 3KYKH 5C86A 2BNQA 4LNVA 2GJ6A 2QQLL 3KPPB 1A9BA 1S5IH 4HBQA 5ENWA 4GG8B 2XTJE 4PRNB 5EC1A 3LHPH 3TV3L 1BIIB 2OTWB 3UEZA 2WLYA 5C08A 1QSEE 5DFVC 2KPNA 3TIEB 5KS9F 5LKNA 4PGCA 1N59A 3EOBB 2NMSA 4A6YA 3MLWH 2E6JA 5DGRA 4HC1L 2M2DA 1RIHH 4XMPH 4HGMA 3UBXI 2B0SH 1T2JA 2CDEA 1CD8A 1GL4B 4RA3A 5E24E 4AENA 1VGEL 4PJDF 5SWSA 3JWNC 5I73C 5TE7L 1NEZB 1EGJH 2CLZB 4PJBA 3WS3A 5IV2B 1J1OH 4ZUTA 3K2UL 2YPKA 2XI9A 1IJ9A 3TBVA 3RUGE 3MRKA 1W72A 2WW8A 2QR0A 2WSKA 1UFUA 3SE8H 1BM3H 3TZVD 4HMEA 2QBWA 4JFQA 4LLYB 5JLZB 5IF0B 3NCJL 5DMGD 4XXDB 4PRDA 2NY3D 5FOBA 4YUEH 1ZT1B 4MD4B 3PWLB 5E8NB 2DM7A 4OB5H 5CWSB 3V4PH 3W2DH 5I1AA 3SE4C 3IDJB 2NY1D 1HCFX 5GS1B 2JJTA 4PRHA 3KJ4B 1P69B 5C0CB 2LABA 2A83A 2X4OA 4U1NB 4YFLI 4WY7L 3OGCB 1W8OA 3ARFC 5DUBA 2XQYK 2EXYD 2VQ1B 2FWOB 4ZSOE 4Z6AT 2EEAA 3FRUB 1U8QB 3V7AE 2ZG2A 4Y5XB 2NCMA 5EOTA 4EXKA 3I6GA 2YD2A 2VXUL 1NC2D 1JK8A 2SEBA 4OFKA 2IBZY 3IFLL 2EDDA 2UUDH 2APFA 1MFDL 2AK4B 2BOCA 2Y06L 3ZDYF 3QB7C 4E0RB 5DHVB 4EVNA 3X3FL 4N9OB 2ID5A 3L3HB 1FAIL 2DBLL 1KJ2B 3O6FB 1T66C 2EH7L 3CFDB 3RY5A 5HYJB 3Q5TA 4KQ3H 1JHLL 2R56H 3L7FA 1IGTB 3SJVB 4NM8L 1AD0B 4U1SB 2DJSA 3WIHH 3VWJA 1KJ2L 2UWEA 2Q7YB 4CN4A 5E8OA 5CBEB 4R2GD 5EUOB 1JTTA 1KCSL 2JCCA 1NGPH 1UB6B 3GI8L 2L7JA 3TBSA 4RWYL 5D9SB 5FK9B 5I1IL 4NO5B 3S5LA 3D3VB 4GW5A 4NYLA 2JELH 1XGUA 4S1RH 4L8DA 2YR3A 4QRRD 4NN6C 4K3GA 2VN4A 1NGZA 4ONOA 3RWDA 2EC8A 4UDUA 2WIMA 4OCWL 1C08B 2R1XA 4L4JA 3DRQA 4E5XA 1UH4A 4XCNB 4QKXB 4YBHA 3EDKA 2XY1A 1RZIA 3WLBA 1ZHBA 5KS9E 1ZS8A 5KAQG 1X5AA 3WN5B 3RX8A 2AGJH 2R4SL 3I02B 3FFCD 3TVMB 1FFPB 5T1MA 5FKPB 1NCWH 2DTML 4WTZG 2AJ3B 4H5SA 2VLMD 3QHTC 1FPTH 4KKBD 2R1YB 2DLTA 4PJDE 3DO7A 3B3IA 2WUBL 5E2UL 1PG7L 3TM6A 1RZ8A 2D4DA 3EO1A 5DJZA 3M8OL 5DI8B 4ZXBA 3G5VB 3PGCB 1DQLH 3VH8G 1JF1B 3NAAH 1ZGLP 1OY3B 3K74B 3CSYA 3ZDXE 4CVUA 5I18L 3GO1L 1E28B 4G80B 4OZFB 1J1XL 4H25A 1PZ5B 3LAFA 2APBA 1VADB 3BE1H 3FO9B 4ZS7H 1AFVH 3GSXA 4ODSL 5TPWH 3QZWG 1Q8MA 1T0MB 4NZDA 4Q0XH 2CD0A 1KC5H 5A2IH 4NM4H 2A38A 5TDOB 3RFZC 1YYLL 4LLUB 3P40A 4PRPD 3T3MF 3P0YL 4M6NH 2DQCH 3MLXH 1ZXQA 1L7IH 1NFKA 2NTFB 1Y0LA 1ODAA 2PCPA 1T7ZA 2V2XB 4LSRH 4YHNA 1QBLL 2ADJA 3WD5L 1HSAB 2WBJC 1I8IA 5HHQB 2EDQA 4AZ8A 4S0TD 25C8H 4NGHH 4HUVB 1GGIH 4X98A 2GITB 1YN6A 4QRPA 3O8XD 1AO7A 1I7TB 2YZ8A 4BK4A 1MUJA 1LP9A 1RZKL 5J3HC 2VTFA 1UQSB 1BJ8A 2PYED 2VLJD 3W9DA 4X0KA 1J05A 4I13B 3HI6L 3W11D 3EOYG 4XT1C 5GZOC 4FQ1H 4NJ9H 3ZDYE 1A7OH 3PQYE 2XFXB 3V4UL 1U93B 4NC2B 4XVJH 5F3HB 5HGBA 3INUH 1YMHA 4RMTA 3WXVL 3NH7L 2VNCA 4NDMB 1JTPA 1CXIA 2I5YL 3LB6C 2XWTB 5F1NB 3QI9A 2Z31B 1NANI 1U95A 3WFDH 4W6XB 3DGCR 3EYVA 4JPKL 1BLNA 4U6XB 4HPOL 1FNSL 3GGWA 2BVPA 5KANG 1INEL 4JRYA 2VL4A 2FECI 3QDAA 3NCMA 4L29B 1DLHA 4O5LL 1QR4A 3FB5A 1EJOL 2FSEB 1IAOA 3TA3A 4I48B 4LF3B 3CUPA 2YPLB 2BVQA 1A6ZA 3PWPD 1N5YL 4ZFGL 2Y5TA 1INDH 1B0GA 4N1HB 1T0PB 5DDHB 1IGMH 3DX9B 3F5WA 1S9YB 2ZCHL 2DMCA 1JMXA 1FYTA 3PGDA 4AMKL 4R7NA 3I3DA 4MJIA 5JPMB 4HS6B 1SY6L 4Y19B 2ZSWA 5GRZA 5LGHH 5A1AA 1OTTC 1QFWL 1MCOL 3L5WB 1CICA 1YC7A 1M7IA 1U8IB 3FO1A 3WDJA 5C6WH 2WMPA 4LIQE 1DBBH 1I7UB 2VLRE 4OKDA 2Q3ZA 2V2WB 3FOMA 4FXGB 5I19L 3O9WB 1BVKB 1U92A 1HINH 4MNQE 2ATPB 2VERN 4DKEL 5LQBH 1HHIB 1ZHNB 1RZJH 1EGJA 2UY7A 4YO0A 1JFQH 4U2ZA 1INQA 4HJ0D 4D9QE 4Y4HB 5I8KH 5E03A 4XNXL 4P2QB 3MLYL 5JTWA 1CN4A 1FFNB 5EBMA 1HXYA 2BNRD 3O3EB 1FLTX 1G7LA 1MLBA 3HE6A 5D2NC 2A73B 1IGJB 4JRXB 4YDIL 4OJFL 3CLFL 4FQXB 3G04B 3KLSA 1G0DA 1ZLSH 3JV6A 2GAZA 3EGSB 1UJTA 4QHKI 1K6QH 3LKNA 1QFUH 5HVHC 3IDNA 2FNBA 5H37G 5B3JF 3UMTA 4WCYL 2EEDA 3QT2A 5C2BL 4DEPC 2A6IB 4LHUB 1NEZG 4OD3L 5C3TA 4PJ5B 4YK4B 2HLFD 1K2DB 1CDUA 4RMQA 5JHLL 1A6WL 3QXAA 4WI8A 3IB4A 1OB1A 4WENB 5D7IB 3U0WL 1A14H 1HILB 1I3RA 2O5YL 3S8WA 4YAQA 2IQAA 4MNGB 1NGQL 2CSPA 4MB3A 3T0EC 5F7MC 3ZDZF 5GGRA 1RK0A 2ZCKL 5T33L 3AAZA 4FQHB 3SGKC 4PS4L 1S7WA 2NW2B 5D7LD 5IT2H 1E4XI 1P1ZB 1L9MA 3LV3B 3MV7E 3QA3B 3HI5L 5J12C 2DQIL 4UINH 3IFOB 4K7PH 2W60B 1MJUL 3Q6FA 1QSZA 2Y4SA 3EYSL 1RULH 4TUOA 4QHLB 2G9HB 2V17L 5SWZB 4OGAC 4X5XA 3WV0A 1CGUA 2QSVA 4LSSL 3BGFC 4Z7UB 5IG7A 4WVRA 4S2SB 4ERSH 3F12A 5JQ6H 3HA0A 4MD0A 4QEGA 2CLVB 4ELMF 3V5HA 4GXVL 1LO0H 3WIHA 1B4RA 3K81A 1T80A 3QEUA 4LVNB 2W9EH 1HXMB 1DEEB 5CEXB 2FZ3A 5IKCA 4TTGA 5CAYB 5ITFA 4OZIA 1HQRB 2JTDA 4X6BB 3AB0C 2COQA 2VDKH 3GJFH 1T5WA 2GFBB 5EIVA 4LCWE 4IRSA 4KKNA 3PNWB 4OZHA 5INDB 1HNFA 3PXJA 5TE4L 5D7JB 2YC1A 1U8KA 1BZ7A 3N9GL 4M8VA 4BSVB 5HVWA 4F2MB 5JW4R 4LPWA 2V6HA 3R1GL 2B2XH 4X6FB 5F7HA 4NRZB 3BGMB 1TENA 5E2VH 5DYOB 5EIQA 4UUJB 1MRFH 4UU9B 1QR1B 1IC4H 4P5KB 4YHLH 2B4CL 3MCLH 5GRWA 3G5XB 3EAKA 1AGBB 3CCHB 2BOBB 4PJXA 1H3PH 4RNRA 3ZT5A 4Q97A 1QBML 3AM8C 1LHZA 4MXWL 2XXCB 1OGTB 1MJ8H 5IHUH 4KV5E 1I9IL 3RU8H 4YFDB 5C2UB 1DQTA 4ODTH 1A2YA 3UTSD 5IR1B 3A6BL 2YD9A 5ESAA 3KPSA 2PTTB 4HSQA 3UTTB 4YX2L 3RGVC 3TO4C 3VFVB 3PHSA 3MBEA 5FCUL 3KPRA 1C16A 1RURL 3HI1B 2VB5A 1R6VA 5BV7C 3K8KA 3K4AA 4NZTL 4HPYL 3C5SA 4KTEL 4I0PC 5I1CH 5E99L 1JWUB 5L0QC 4XC1L 3QIBB 3FB8B 1LEGB 3OKYA 1IZJA 1CGVA 3MRQB 4YHZL 3LQZA 3H0TA 1YNTB 4KHXL 2CDGB 4Y4KA 5B3JE 3G6DH 5IHLB 2X44D 4ZAKA 1N5AB 4FQCH 1I7RB 4S1DD 5L88L 5CGTA 4PTTB 1RUMH 1CLZL 1D6EA 3D69B 4NQCB 4DW2L 2E7BA 3UTZB 4RMSA 4BUHA 5IBUB 1I3UA 5IB1A 3B9KD 4GXUM 4Z0BL 4PYHA 2DS4A 5KW9H 3ZDZE 1YEFH 2K9UA 4JREB 4OZFG 1KEML 1BHGA 3D39B 1DQQA 1G1CA 5HYSB 5DQDH 4GRLC 4YBLC 1YMME 2F5BL 4PJEA 4Y4FB 3MROA 5DMJB 3BAEH 4KK6D 4F7TB 5C9KA 2HKFH 2DYPD 3GK8L 2NY2D 1RFDH 3QDGA 5EG6C 4G8GB 4TQEH 4NO3B 3U1SL 2P5WE 2GCYB 3S4SA 1NCCH 2R2BB 4JFDA 2X1OA 3BD3A 3ROOB 4K7FA 3RPIB 5F9DC 3O2VL 4ELME 5IVNA 5MENE 5IM7B 2DWEA 1MCQA 4MX7B 5L6YL 4F37F 3S37X 4IM8A 4TYUA 3QWOB 4M62H 2NX5B 2QKIB 2CJUH 1N4XL 1ACZA 5HYQB 1BP3B 2EC9U 1TZHA 3Q1SH 1PEWA 1NAMH 3MRIA 4GUPA 5HY9A 1E6JH 4S10A 2ITDA 4PRAA 5FYLL 4I9WD 4JFFB 1D9KA 4HWNA 4NOBA 1N2RA 1UWEH 1S5HB 4JVUA 2PXYC 2PETA 1QA9A 4CJ0A 3UTSA 1I1RA 5T1DH 1I3VA 5LJYH 3GMQA 2VXQL 1II4E 1NLBL 4QF1A 5DD1L 5ADOH 2BRRL 1JWMA 4D9RD 3EJZC 2BNQB 2GJ6B 1I3GH 4O02H 1A9BB 1UZ6F 2FYYA 2CIIA 5EC1B 3WIIL 1FLRL 3V9FA 5C08B 1U9KA 4IMKC 2APXA 3RKDC 4PGCB 7FABL 1N59B 5ALCH 3MJ8A 1JGEA 1QZ1A 4A6YB 4BQ8A 2B1HL 2NXZC 2I9LA 5IFAL 4NQDA 3ZSSA 3ZKQD 3BHBA 1Q9OA 4CL7A 5E08H 4KZDL 2CDEB 4L3EE 3C87A 1CR9L 4HF5H 4AENB 5CEYA 1O7VA 5SWSB 1NMBH 5E8DL 3B9KA 2YUWA 2GSIA 4PJBB 1T89A 4ZUTB 1Z0NA 2YPKB 4KMLB 4UV4L 2IQ9L 1XGQA 3TBVB 5HHNA 1EEYA 5EU7E 3MRKB 1AE6L 1W72B 2R4RH 1N0LA 3DYMA 35C8L 2QR0B 3WE6A 4KMTL 5JW4Q 1VENA 3ULUH 2HJFA 5D6DC 2IMMA 3RNQA 2I9TA 1W72L 5ID1A 3V4VH 4YQXL 1KIUA 1GAFH 2QQQA 4U1JB 3DUUB 3QG7H 3C5JA 4PRBA 3LEVL 4PRDB 4TRPH 2W65B 3MV11 5AWNH 1V7ML 4NQEA 5FOBB 2BMKB 1EPFA 4XRCA 1OD7A 1CBVH 3TBTB 2V5MA 1OGAD 5H94A 4KJPD 5I1HH 1A1OA 3BPCB 1G7JB 1ONQB 5I1AB 3S88L 4KFZC 3BD4A 4OTXH 1K4DB 4PRHB 4U3HA 1IKFH 2A83B 5JZ7C 4S1QL 4KKAC 2X4OB 1X5GA 4LBEA 4HQQH 3S35X 1EX0A 4OLWH 1YY9D 2CH8A 5DUBB 5CIPH 3UYPA 4XVUD 2AJVL 5DJDB 3TT1L 3BP5A 1JP5A 1FNAA 3WDIA 3G9VA 4S1SH 4Z77B 5BVJA 2PF6A 1LO2H 3JWOH 5F6HJ 5EOTB 1Z9MA 3N85L 3I6GB 2P7TA 2SEBB 2BVYA 4N9GA 1G84A 4G9FA 2ZUWA 2IH1A 3AGVA 1UWGL 4Z7WF 4W4NA 2AAVA 5GS1C 2BOCB 4R4FH 3KJ4C 2LQRA 3TLRA 1M4KA 4EVNB 5J7CC 2ZSVA 4LHUG 1NKRA 5DS8A 3IAGC 4N1CA 1RUPL 3FQUB 5JA8B 3PP3K 4TNVK 3VWJB 5E8OB 2BZDA 3HNTH 2J6EH 5HI5C 5DRWA 5EOQL 1YEJH 3BYTA 3KXFE 1OAZL 2JCCB 4BH8A 3TBSB 2J4WH 2EDNA 3QIWA 2Q20A 3S5LB 4NYLB 1MCPL 1XGUB 5F88A 4L8DB 3GJFA 4L4TD 4XNZB 2GEEA 1F8TH 3GKZA 1A6VL 3GSRA 3MFFA 2DI8A 3RWDB 4UDUB 1CF8H 1F4YH 1Q94A 4UNVA 1FH5H 1KJMA 1KB5H 1B2WL 2H32H 1BD2D 2R1XB 4JFXA 3W5MA 1CK0H 1W0VA 3DRQB 4M43L 3QUXA 5IVXF 4E5XB 1H3VA 1QLEH 4KK8D 5KBNC 5DR5H 2DQUH 1RZIB 4ZO6A 3WLBB 4LOUC 1ZHBB 2M26A 4WHTA 3MRHA 4KPHH 4U0RB 9CGTA 5I1KH 2YN3A 2FR4A 3EW3B 4OI8A 4EUPB 4X6CA 4OD1L 5T1MB 3QPXL 1MHCB 5GS0D 1OW0A 4H5SB 4WEMB 3IDGA 1MCHA 4ZO7A 3MV7D 3B3IB 3QFDA 4LDEB 4XBEH 4L4VE 1RZFL 2NY0B 4KWUA 5I1GH 5J11B 3EO1B 5DJZB 1GH7A 1TQBB 1QKZL 3FB6A 4PLOB 1F2QA 1DVFD 3WN5C 1KN4H 3VXRE 4C56E 1U3HB 4R8WL 2FGWL 1IM9D 1QLRA 5T5NF 2Y7QA 4LCCA 4H25B 4ISVA 4AJ0A 5IESH 3KPQA 3GSXB 1CU4H 5ANMB 3STLA 5T3ZD 2VDRH 3MNZA 5GGTH 4PBWD 4WGVB 3AXLB 3PV6A 4PJGF 1BFVL 3F7YA 1VA9A 3S36X 3EYUH 4QHUA 3UYRH 3MUGA 4UT6L 2E6PA 5CSGA 3MRFA 3QDJD 5BS0D 1Y0LB 2PCPB 4M1CC 4U1MA 4YHNB 3QULA 4YE4L 1P84J 1ITBB 3U6RA 1S7RA 4RGNE 4LL9A 1I8IB 1MF2L 2GKIA 1NCAL 3H7BA 3QEGH 2IAMA 1NUNB 1WFNA 4KK5D 3UJIH 1PG7W 3EYOA 4X98B 2RBLA 3KYMB 3ARQA 2X89D 1YN6B 4QRPB 1KTKE 4DUXA 1AO7B 2ICWJ 5FYKH 5CJQL 3ESVF 3SE9H 3BKYH 2ZJSH 1MUJB 1LP9B 1T7XA 3N1QC 5E4EB 4GBXD 2ADGA 3W9DB 1J05B 5BXFA 5IROA 5A2LH 5T3XD 2GYSA 4J3OC 1JPTH 3MUJA 3VI3F 1GGUA 5JOPD 4CNIA 4J3TA 4OLXL 4HG4J 3ZYIA 2NR6D 2XZAL 1QO3A 4PJ8A 4X6DB 1AR1D 3E6FA 3A67L 5EOCL 1WTGT 4GW1A 5IWLC 1RZKC 5GIRA 4Y2DB 1DL7L 1V3JA 2CPCA 2EICA 1SVZA 4LQFL 1DCLA 4E9LA 4BM7A 1A0QL 2BDNH 4XVTL 2WBKA 1P6FA 3QI9B 4QRUA 3RQ3A 1U95B 3E2HB 1SBBA 4PUBL 3BP6A 5HYSG 1BLNB 3V6OC 1BGXH 1PLGL 1NAMA 5TE6H 2GT9A 3BT2H 3U36A 5EZJA 1FC2D 5DD5L 4KJWC 3PXHA 3MFGB 1DLHB 3FB5B 2CXGA 3CU1A 1R5VB 2VC2H 1B0WA 1IAOB 3TA3B 2DM4A 5GGVH 4NQVA 3CUPB 5C8JA 1YQVL 2BVQB 1A6ZB 5IVXE 2Y5TB 2NY4D 1B0GB 3SHSA 5CUSH 3IU4H 1J86A 3F5WB 5EUKA 2Z31C 4LRIA 1LO4L 2GI7A 3AY4C 5DURD 1FYTB 1IGYA 4R7NB 4MJIB 1S5IL 2WQ8A 2C7UA 2Z9TA 2RFXA 5IB2A 5GGRY 4H88H 1R0AL 4PJ9D 1Q1JH 1ZHKA 1M7IB 3FOMB 2P8LA 4JQIL 4KI5C 5DC9B 3TN0A 3MOAL 3SDCA 5F9AC 1U92B 3V95A 3W0WE 4E42A 1RIHL 1BPVA 1KT2A 2B0SL 3OR6A 4YO0B 4ZG1A 1Z9OA 1QVOA 3CU7A 4APQA 5DJ2A 1INQB 1ED3A 3QQ3A 4WEBH 2P5WD 1J1OL 1RK1A 1S9XA 5SX4I 4PV9A 1HXYB 2XN9E 1JIBA 3MGAA 1K85A 3MPCA 1G7LB 2A0LC 2OZ4H 2X1XR 5C09A 3SE8L 3TYFA 2PO6A 3GMOB 1MLBB 3O9WC 3SBWA 3QG6A 4X9HA 1K4CA 4TN9A 3ARGB 3VFRA 4NWTH 3RP1A 4Z78A 4QGTA 3JV6B 1OLLA 2GAZB 1EHAA 4XXCC 1VERA 4LHQB 3LKNB 3QUZD 3IDNB 3DUSA 5CSBA 1CTNA 4XCYA 5FUZL 5IW6A 3MMEA 4YUEL 3NACH 1CXEA 1T2QH 3DPBA 1AXIB 3J7HA 4IDLA 1QD0A 3QXAB 5I2IA 2V9RA 4OB5L 1U58A 3PWVB 2E3VA 3D85D 4OLEA 3NPSB 3JVGA 1AXTH 3SDDD 3HMXH 5E00B 3BPOB 4PJ7F 1I3RB 5CIPA 2X1QA 2IQAB 4XHJD 5E5MA 1E6OL 5GGRB 1RK0B 2VDQH 3AAZB 3LSOA 1S7WB 3VI3E 4W6YB 2MPAH 3LKSA 4YC2B 3CMOH 5L7XL 4NC0B 1KULA 3K46A 2EE3A 3EDJA 2V7NA 1BWMA 4YK4C 3W39A 4ZODA 3WHE1 4X5XB 2J8OA 4G3YH 2X4UA 4HV8A 4ONFH 1SEQH 2J8UA 3MRJB 4LU5L 2Z8VC 4MD0B 4WI4A 2VZUA 2WAHA 3V5HB 4F15B 3BQUA 1OAYH 2Y6SD 4IBLT 1Y6KR 2W1NA 4BUGA 3QEUB 3I9GH 3NTCL 4C4KO 4ZNCD 3RY6C 2J6EA 4KQ3L 2R56L 2FZ3B 4D2NA 5IKCB 3WIHL 5ITFB 2CGRH 3QUMH 3MV9E 3T2QA 2NZIA 4OZIB 3NIDF 4XP4H 4HGWA 4I1NB 1NGPL 3SE3C 4ZOBA 3NGBC 3HB3C 1T5WB 3DTXA 4IRSB 3PABA 4U6YA 4OZHB 3P4MA 2JELL 3QO1A 4O2CA 4S1RL 4Y2OA 2YC1B 1U8KB 1BZ7B 5F7KC 2R0ZL 2QADD 4MWFA 4A2MA 4U6VH 5C0AE 1KB5A 1JNJA 2H32A 3I6KA 4LVNC 1Q9LB 3SCMD 3C8DA 3GNML 4P9HC 5F70A 4JY6A 3RIAK 5FGCB 3IGAA 5CCKH 1F6AA 2VZ1A 4TOYL 3S5LG 4BFBD 4HJGA 4JN2B 4RNRB 5D7JC 5GHWH 5ISZA 1ZWIA 2CRIA 5JORA 5FUCC 1NCWL 4Z7NE 2GTWA 2CK2A 3BWAB 1FPTL 1UG9A 4PJFE 2P1YA 4XC3H 3ZL4L 3L3GA 3BKJH 2YD7A 3GJEA 3WHXA 4KXZI 3QUYC 2P5EA 1K8DA 5GISH 3IDXL 5ESAB 3KPSB 1WCQA 4TULH 4GFTB 1C16B 2VDOL 3BRDA 2ADFH 3NAAL 3C6LB 4EIGB 5DXWA 2O26U 4JDVA 1FL6A 5JXED 1AGFA 3LN4A 2LU3A 5D1QD 5B4MD 1D7FA 5GGTA 5FYJH 4UZGA 4ZS7L 3U46A 3DIFB 5GSRA 1AFVL 3ZHLA 5HHVL 1A22B 3NZ8A 1S78D 3LQZB 2VSCA 3DBXA 3H0TB 5HHOA 1EZVY 5IIEA 4OBRA 4Q0XL 1KC5L 2AW2A 4WNQA 4NM4L 5FUOH 4ZAKB 4WV1A 5D7KD 5DEFA 4PLKD 5DUPH 2F8OA 5EBGA 2Q8AH 3UP1A 3VI4F 4M6NL 2DQCL 4G6JH 3MLXL 1L7IL 5EC2B 1D6EB 4J23A 1RJZA 4LSRL 3WFBH 2IMNA 4RISH 5ELIA 3BVNB 4PJ7E 3LS4H 4RBPK 5IB1B 4ALAH 3GFUA 4FMFA 1RJYA 3QIBC 5FM5O 25C8L 4NGHL 1DQQB 1GGIL 3JV4B 1OSZA 3MROB 3AREC 1HKLH 5EPMA 5D1XD 4F8TA 1IVLA 3OB8A 2EYSA 1MFCH 1MCFA 4P2OD 1FFQA 4P2RE 3WFEH 1F3DH 1AXSA 1WC7A 1AHWA 4NJ9L 4JFDB 3SDYH 5AG8A 4M3JA 4I77H 3BMVA 3R4DA 4K7FB 4L4VD 5CZKA 3SDXA 1AP2A 1BX2A 4GKNA 4XVJL 2DWEB 2Z92B 1JNLH 3INUL 4DQOH 4HZLA 5EU5A 4Y4FC 4S11A 4YIQB 2MMXA 4NJAL 4JO4H 3NIDE 4C56D 4ORZC 1TZHB 4JFED 5ECJE 3MRIB 3DVGA 4GUPB 5HY9B 4I3SH 1FQ9C 1WGOA 2ITDB 4PRAB 3MQIA 1D9KB 1IEBA 3VWKD 1UCBH 4WUKL 1FZMA 3NCEB 4QTHA 1QA9B 4UQ3A 3RZWA 1MOEA 1BOGA 1IAII 5KANI 3CH1A 3GMQB 2EXWD 2QV2A 4QF1B 1VHPA 4NBXB 2DLIA 1VACA 4D9LH 1JWMB 3SDAA 3VXSA 4AIZA 1Q72H 4FFVD 4F7PA 5GRVL 5D1QA 2FYYB 5F96H 1HWGB 2CIIB 1IGML 1NGYB 4Q9RH 1LNUA 4XP5H 4RGND 3QSKB 1ZVYA 3QHZH 3DX7A 4MXVF 4UI2A 1QBAA 4JHWH 1NGWA 3HC4H 1SJEA 1JGEB 2DM3A 4YHPB 5ICXA 5LGHL 1OTSD 2I9LB 4TVPD 4NQDB 3SO5A 1XF3A 2D2OA 3BHBB 1Q9OB 4U31A 1YDPA 4LCYA 1YPZF 5D2NE 2VH5H 2H2SC 3DXAE 5K9JH 1HINL 2GSIB 3RDTB 1YEEH 3IS0X 3GI9H 5LQBL 2XZCH 2XQBL 2DQHH 3D18A 1V7NH 1EEYB 3F7VA 2RJMA 4XNYL 2E7LA 4AT6A 4MA7L 1JFQL 3WE6B 4MHHG 5I8KL 3RX5A 4JFZH 2HJFB 3RNQB 2I9TB 4I2XA 4HGKC 2OZ4A 5ID1B 3BP4A 3V2AR 4YHOH 2F54E 3WJJA 2Z0BA 2DJ4A 2Z93A 5DVKA 1BBJA 4XX1E 3T0EE 3C5JB 3O4LA 4PRBB 3HN3A 5KSUA 3KR3H 4PJCF 4YXKL 5C9JA 4QOKA 4XRCB 2X70A 4V1DD 5CS7A 2ZNWA 1FSKC 1N6VA 4JG1L 3ZE1E 4F9PC 5FYKU 5DFVD 3D9AH 2OS7A 4X7FC 1A1OB 1WZ1L 3TF7C 1QFUL 4QY8A 1JPST 5HTSA 4I5BA 3BZEA 4HT1L 1WJ3A 3MTRA 3KS0H 1BVLA 4LBEB 3CH8A 1T1WA 4FFZH 4JFEA 3HMXA 2X4TA 2N56A 4XMKH 1NFDA 1WK0A 1T3FA 3KDMA 3BP5B 1CGSH 3SGDI 1XIWD 3IF1A 4ENEC 5BVJB 1I8MA 1OPGL 2WUCL 2BNUA 2KZ1B 2P7TB 4U4BA 4N9GB 5D71H 4G9FB 2KL6A 2IH1B 4UINL 3V8OA 3ME0A 4Y5VA 4DJMA 1J12A 2JJTC 1NCBH 1NFIA 1RULL 2ZSVB 1OCWL 1AKJD 5DS8B 3HUJE 3TYGH 4HK3N 1IKNA 3STZA 1EK3A 4XVSH 2YOCA 2P24B 4ERSL 5JQ6L 2EYRA 2B20A 5E9DE 5DRWB 4OZGF 3QUMA 3S34H 5MP6H 3PIQA 4OLVL 3QIWB 2W9EL 1MNUH 4NKDA 5EBWA 5F88B 4JEGB 1ITCA 3GJFB 1EEUA 1S7UA 2XZQH 3LDBB 4DZ8A 3GSRB 4DGVH 3MFFB 2VDKL 3K4DA 5J6HB 4GSDH 4JJ5A 1Q94B 1FGVH 3TIDA 5H2BA 1KJMB 5HSFA 4JFXB 4UT7H 2VLKD 5DEZA 3VWJC 4F9LA 5K59F 1W0VB 3QUXB 1DBAH 1BFOB 5T5FL 4MA3A 3RNKA 2B2XL 4WFEE 4WHTB 3MRHB 2CRZA 4WUUD 2VZ3A 2FR4B 3QQ4A 4WEUD 5E2VL 4M6AA 4X6CB 4XNZC 1CDYA 5ICYA 4NHCH 1MRFL 1T66D 3DWTA 1KXQE 1IC4L 1G6RL 4V2BA 3MCLL 3IDGB 3RZCA 1IGIH 3O3AA 5TH2A 1PG7X 4ETYA 1MFAH 5HHXH 1H3PL 1N3NB 3KPOA 2AEWA 4WWKA 1C8PA 2EO1A 8FABA 4M7ZB 3FB6B 4IDJL 4BK5A 1ERNA 5DMGC 4U0RC 4GW4A 1QLRB 4PGDA 4LCCB 4ODTL 4JKPH 5JMRA 4DFIA 5L8KB 4ISVB 5E6ZA 3KPQB 4U05A 5IB3A 3PP3H 5CEZE 3STLB 5MI0B 2W0KA 5D8JL 3MNZB 4PJCE 1P7QD 1X44A 2NY0C 3PV6B 2PTVA 3F7YB 4QHUB 5CMAA 5J11C 3MUGB 3B5GA 4TSCH 5EU6E 2GTZA 4ZXBC 3MRFB 1TQBC 3HG1E 1A6TB 1LQSR 5AEAA 4JZJA 3WMSA 5ILTH 5J4MA 3G6DL 3I75A 3U6RB 4FQCL 3H7BB 4RAHA 2DQJH 2IAMB 4CW1A 3BEWA 4NO0D 4TNWK 3EYOB 3U7AA 1RUML 1ZA6A 4HFUH 2HLAA 3ZO0A 3CDFA 5EIIA 1EMTL 2ADGB 2IANE 5BXFB 4C55A 3WO4C 2WBWB 2Y36H 5DQDL 5DLMH 1WBZA 1SMOA 1BECA 4CNIB 3VXMD 3T8XA 2HKFL 5ESQA 1QO3B 4ONGH 4PJ8B 5B8CA 1S8DA 3E6FB 4NHUA 1T22A 2FEEI 4JCMA 1RFDL 3IFPA 2FHBA 2XA3A 4HLZH 4GW1B 2E9BA 5GIRB 4TQEL 3VXUD 2MQCA 1FL5B 5MHSD 4OZ4B 1NCCL 3VFWA 1C5DA 4LGSB 4JM4H 4ORGA 4OV6F 4QRTA 4O00A 2R0KL 3AU1A 3T1WA 5E4EC 3G6AA 4LLDA 1EA9C 4QRUB 2A9ML 2AXGB 3GIZL 5JMOC 3T0WA 4DKDC 2X4QA 2AXJA 3V0VA 3BP6B 4H20H 1BMGA 1S7QA 1NAMB 2GT9B 5GS0L 2CJUL 2WBJD 2P42B 5EUOF 3U36B 5EZJB 2YK1H 5L2KD 5F6HI 1CGTA 4RIRB 4Z7VA 4NKMA 1DP0A 1UWXH 3TPUA 3OAUH 5J3HD 3S4SG 2F53E 4NQVB 1UWEL 2ENYA 5K59E 4RGOH 5FOJA 1MI5E 2ZPKH 4HUXA 3ARPA 3QI9C 5EUKB 4MMZC 5ADOL 3E2HC 4QWWC 4X9FA 2YA2A 5GZOD 2CK0H 1IGYB 4KKBC 4O51B 1ZTXH 1I3GL 4Y16B 4B41A 5LGKA 4O02L 3BJLA 2C7UB 2RFXB 1J88A 5I17A 5IB2B 4FQQA 1YEIH 1QSEA 1L6ZA 1ZHKB 1JTOA 3CFCL 4IEFB 4NNPL 3MYZA 1TJHH 1D5XA 5GQBA 2P8LB 3TA3C 3TN0B 3SDCB 3EUUA 3LB6D 5ALCL 3RVWC 4PREA 4LIQH 1X5YA 1JGVH 1IL1A 3VFGL 4E42B 1KT2B 4HF5L 1QVOB 4APQB 5DJ2B 1ED3B 3QQ3B 4CADA 3D25A 4LQ1A 5DK0A 2E9JA 1RK1B 1T1ZA 1S9XB 1XFPA 5IW1A 1ZV5A 5E2TH 4PV9B 3WXWH 3VFUA 5D4QA 1CICC 2XIDA 2V7HA 4X7EC 2R4RL 3SKNA 5C09B 3TYFB 2PO6B 2A6DA 3ULUL 1JGUH 5T3XL 1F4XH 3AS3A 3AS1A 5HPMA 1J0JA 4DKFH 1JBJA 3QG6B 1PJ9A 4Q6IA 4JFPA 1K4CB 1NC4D 3V4VL 3VFRB 1CL7H 5MERA 4LAJH 4Z78B 4WU5A 1GGCH 2QHRH 3OJDA 3QG7L 5T1LD 3UZQA 4TRPL 3DX8A 5IW6B 1OTTD 2DDQH 5B38A 2ZCLH 4OV5B 1CBVL 2XYCA 3DVIA 5I2IB 4IOFC 2A77L 1U58B 3QRFM 1T7VA 2K7QA 3B2UC 1NPUA 3SQOH 1P7KA 4OTXL 3JBG7 5CIPB 1RUKH 1IKFL 3HE6C 5E5MB 4HQQL 5KJRH 3LSOB 1BZ9A 2E9WA 4OLWL 4F7MB 4RMVA 2VWEC 4ZSOA 3LKSB 4GT7A 2D7OA 1H15A 1FVEA 3W81A 3GZKA 3UDWA 1TZGH 1W0WA 1B88A 4S1SL 4YDKH 4N90D 4NT6A 1AQDA 2V7NB 3G6JE 3JWOL 5I1EL 3W39B 3RWGA 2Z4QA 2OX5A 2PW1A 3NPSC 4HV8B 4PJAF 2J8UB 1ZK9A 1UJ3A 5F9OH 4JKMA 5LBSH 2DLHA 3BQUB 5CSZA 4J3VA 1XGRA 4YXLH 1IEHA 5EH1A 2I07A 1DLFH 4G6MH 1I1CA 3VXQA 3ESUF 4YC2C 3VFMB 5MEPB 3FN3A 3DGGB 3MLZH 1O7SA 2YHGA 4EN3B 3HNTL 4JKWA 1SJXA 1YEJL 4QTIH 4HGWB 3VRLF 3O3BA 2J4WL 1VB9A 2DRUA 3FQXA 3DTXB 2F54D 4U6YB 3PABB 3P4MB 1OF2A 1WFUA 3QO1B 4O2CB 3T0ED 3CX5K 4BA8A 1U0QA 1UENA 1TZIA 5BCAA 4MB4A 3IDUA 1KB5B 4KI5F 1SBSL 1F8TL 2H32B 4F15C 4MNHA 4YH6A 3I6KB 3UJTH 1FH5L 2IBGA 1KB5L 1CK0L 1S7XA 4R96A 4H0GA 4OGAD 4XPTH 5D6CA 1QLEL 4JY6B 5CILH 3IGAB 5DR5L 2DQUL 4KK9C 1CQYA 2IH3B 5T1LA 3ARUA 4KPHL 1AH1A 1F6AB 4IRSC 2CUMA 4HJGB 1TXKA 3QNZA 1C5BH 5ISZB 1ZWIB 1A3QA 5JORB 4GAJH 5AZ2H 1R5IA 5C07A 4ETQB 2GTWB 1MY5A 1OAXH 2FL5A 4PJDA 4YWGH 5JW5A 3MBXH 4XBEL 4HEPG 1XGTA 3L3GB 5ITBH 3TT3H 3S6CA 3GJEB 3WHXB 1T4KA 4GQ9L 5I1GL 2P5EB 1K8DB 3B9VA 4W70A 3T77A 1WFOA 2ESVA 3NPZB 5E2WH 5HYFA 4JDVB 2FATL 1KN4L 4QXTA 3RVVC 1AGFB 3LN4B 1UEMA 3ARBA 4U1LA 3U46B 5IESL 1ZSDA 5GSRB 3NZ8B 5HHOB 3BZ4A 3HZVA 5GGTL 1XMWA 5C6PB 4KHTH 4WNQB 1PZUB 4WV1B 3EYUL 5DEFB 4YXHL 5GGVY 3UYRL 5DC0A 5I74C 5DJYA 3NA4A 3MBEC 4XBGA 3LVEA 3V5KA 2JK5A 1RJYB 2HRPH 5KZCB 3MNWA 3QDMD 5D7IF 3UJIL 4ODUA 1WFTA 1E4XL 1OSZB 1GJIA 4BFIA 4GAFB 4X80H 4ZTOH 4NCC2 5FYKL 3SE9L 4Y4KC 3ZKMC 3BKYL 2ZJSL 2EYSB 4ZAKC 3RGVD 2C5DC 3TO4D 2B7DT 1JPTL 1SYSA 4EZMA 5JHDE 5TFSH 4I0PD 1AXSB 4PJAE 1WC7B 4JFHD 4K55A 3PQYA 3VDCA 2DTSA 3W9EA 3SDXB 1AP2B 3QWRD 1AGCB 2YZ1A 5E6ID 5FA3B 1BX2B 3H9SD 3VJ6A 3IKCA 4HZLB 3TZVB 1GC1L 1D6VH 3AUVA 3ZKXB 1FORH 3B8YA 4FHBD 4TVSa 2BDNL 3Q3GA 1RHFA 3NCCB 3DVGB 3VRLE 5KVEH 1BAFH 1BGXL 1GHFH 5TE6L 2F58H 3BT2L 4WO4A 1FZMB 1MSPA 4FTVA 4QTHB 3CZFA 4RMRA 5IGXH 4NNYA 1JRHH 1BOGB 5CJOH 4HAGA 1ZHLA 5CJXA 3CH1B 4NRXB 4GRLD 3BP7A 1MCRA 3U4EA 2VC2L 1VACB 2VXSH 5DHVH 3SDAB 3VXSB 4AIZB 4M1GH 5GGVL 4F7PB 1B6DA 3VXOA 3IU4L 1LNUB 3HZMA 2HT3C 3JWDH 4RBPH 4XCCL 5ERWA 3NFNA 4X7SH 2EDTA 3NCBB 3P9WB 1D9KC 1X3DA 1NGWB 1S7VA 5ICXB 5CHNA 3HAEH 4PRID 2BFVL 2JIXD 4J3XA 1BFTA 1XF3B 1Q1JL 3S3JA 4M1DL 1YDPB 3LRSA 4LCYB 3VMNA 4OLYH 2VLRA 3B8SA 1IZKA 4Z95H 3NCYS 4G43A 5F1KC 5INCA 5ADPH 3D18B 4C57C 2IC2A 3MV8A 2YD4A 1T04B 4AT6B 3L1OH 4WDIA 5EO9A 4Z76A 2WZPD 1WZMA 4WEBL 4Q9QH 4L9DA 1IAIM 2MFNA 4I2XB 1FNFA 1I1AA 5LGJA 3EHBC 4FFYH 2NY5H 3BP4B 4JGJA 1F6LL 1G0XA 3EJZD 1BBJB 3O2WH 1KIRA 3O4LB 5KSUB 1RZJC 5JQHC 3B9KC 5C9JB 3RWJB 5C0DA 4CMMA 4QOKB 2F8XC 1T89C 2DQTL 4OF3A 5TQ2H 1SMAA 5E6IA 5CLTA 3VW3H 1X5FA 4MA1B 3RKDD 5KSBB 4OFDA 4PJHE 1HHKA 3CDYA 4I5BB 3BZEB 2NXZD 5DJXA 2RHEA 1BVLB 1NMAH 1T1WB 2OCFD 3NACL 2BCKB 1T2QL 1NFDB 3QIUA 1T3FB 3KDMB 3C5ZA 6FABH 1AXTL 3HMXL 4J1UA 2OYPA 3IF1B 2ZUXA 3SEPA 3U7YH 3BI9X 2VDQL 1I8MB 3MC0A 1FVCB 5DA4A 4DK6A 2MPAL 3OZ9H 4KRMB 3CMOL 3IJSA 1DUYA 2K1MA 1A21A 4Y5VB 1FNGA 1NFIB 3MRBB 4MGXA 1NSNL 3WL9A 2W07A 4HLJA 1T5XA 4FQIH 3STZB 4HX1A 3FO0H 4G3YL 1SJHA 4DUWA 4ONFL 1KB9J 1LE9B 1SEQL 4MCZA 5A2JH 2EYRB 4WW2A 3QFJE 4GRWE 2HA1A 4OCXH 4D0CA 1OAYL 1KACB 3QUMB 3PIQB 3I9GL 4PJIB 2HWZL 4NKDB 5JZ7D 3VG9B 4WW1A 1QBBA 4KKAD 5EBWB 2CGRL 5BO1H 2X09A 3QUML 3U7WH 1S7UB 2D0HA 4XP4L 3ZTNH 5HDBE 3BZFA 4DZ8B 2V9QA 4YEFA 4LCWA 4JJ5B 5FUCE 3TIDB 2XOTA 1MREH 3BO8A 4K3EH 4U6VL 2ILLA 3EYFB 2M8XA 2HFFA 7CGTA 4M4PA 3RNKB 1WWWX 3QIWC 4Q2ZB 3G9AB 4WGWB 3RWIB 4DGIH 5C0CD 2FB4H 3QQ4B 2WIIA 1YA5A 2QEJA 5ICYB 3ARWA 3LDBC 3RZCB 5I9QB 5CCKL 3O3AB 1M71B 3BRGC 1HCVA 1F11A 4MZ3A 5I15H 1P9MA 5GHWL 1I8KA 5HI5D 1FZKA 3QUXC 3KPOB 1FE8H 4WWKB 8FABB 1V05A 2OR7A 4YFEA 2EDRA 2GQHA 2FX9H 4FQLL 4GW4B 3BKJL 2GSGA 3F7RA 4PGDB 5GISL 3O6FD 5GS3A 1KCRH 4TULL 5IB3B 1OW0C 5HYJD 3SJVD 2ADFL 2YBRA 3TH3T 4I3GA 4LHJB 1N7MH 5D2LE 5CMAB 5FYJL 4XNQA 1UADC 3PDGA 1CDGA 4LOUD 5ALBL 2D9QB 3NA9H 4M7ZC 3UCRA 2RQ8A 4XVUC 1GRWA 3PWPB 5C0NC 1CLOH 4JZJB 3X14A 4POZC 1D5BA 5IV2A 3X12A 1HH9A 5FUOL 3I75B 4N0CC 5JXAH 2Q8AL 4LCCC 3PWJA 4G6JL 3BEWB 4LCIH 1GYAA 3DSNA 3OF6A 1WEJH 1LEKA 1XF5A 1ZA6B 3LMJH 2HLAB 3WFBL 1KNOA 3EZ8A 4RISL 2W38A 1L4IA 2WINA 2W59A 3LS4L 4ALAL 3PL6A 4GAGH 4LLYA 3OQ3B 1R24A 5JLZA 1YMMA 1RAMA 2ATKA 2KQMA 4XPHH 5BRZE 1R3LB 1B9ZA 1HKLL 1WBZB 2E7CA 1GXEA 4WTXA 1R3IH 3H3BC 1MRDH 3T8XB 4ODHH 5GJSL 3TVMD 1A3LH 3MACH 1S8DB 4MD4A 5B8CB 1T22B 3JZ7A 2FD6L 2IAMC 5IFHH 3IFPB 4R97B 4XCFH 5DQJB 5FM8A 3WFEL 2X1PA 3RTQA 3VFWB 4ORGB 3SDYL 1U36A 3MUY1 4QRTB 4I77L 2HFEB 4DCQB 1LGVA 3AU1B 4NC1C 3H8NA 3DARA 4LLDB 2XG5A 5MENA 5FDWA 3OKOB 1RPQA 5IROC 4CGTA 4M1CD 4TUKH 1JNLL 2X4QB 3V0VB 2R8SH 4MAYA 2UWEF 1S7QB 4I3RL 5T1KA 2VXTH 4Y5XA 3FO2A 2JCCF 4JO4L 1FG9C 3UPCA 4PJ8C 4PP1C 5F97E 1KTLA 4BZ1H 1KPVB 1FGNH 3HS0A 4Z7VB 4I3SL 3ABZA 4NKMB 4U49A 5HI4C 3TPUB 1EFXA 1UCTA 1BREA 3LH2H 4NKOB 3BDBA 5CJ8A 5IEHB 2AK4A 3VDBA 5DHVA 1IQWL 4NCC1 4HUXB 1EAPA 2VZSA 1UACH 3O6FA 5JIIA 2GJ6E 5GS0C 1MAMH 1OT1A 4M7JH 4U1SA 4CVXA 1Q72L 4OLZH 4M7KH 4BJLA 2XTJB 5F96L 4KUCF 5I17B 1RVFH 4Q9RL 4LVHB 1QSEB 1UB6A 5I30H 4JY4A 1FDLH 3QHZL 4XP9H 2JJVA 4EDWH 5FK9A 3HAEA 4NO5A 1D5XB 3D3VA 4JHWL 1HH6B 3HC4L 2OL3H 4PREB 1QSFE 1TFHA 2NYYC 3D0LA 1IL1B 2H26A 2J12B 1ZGLA 4L3EA 4LRIC 3O4OC 4P48A 3UZVB 2BY2A 4CADB 3D25B 1NL0H 1R3HA 5K9JL 4KJWD 1YEEL 5ACZB 1T1ZB 1XGPB 4XCNA 3GI9L 5IW1B 3U9UA 3X13B 4J2XA 2DQHL 1OAKH 3RUGB 1HZHH 1T03H 5I71B 1V7NL 2V7HB 2ZNXA 1QPXA 4XPGH 1XR9A 1Z9LA 3SKNB 2EECA 1UKSA 2A6DB 3TN0C 3K8LA 3SDCC 5HPMB 4JFZL 3TVMA 5FKPA 2Z31D 4Q6IB 2AJ3A 4JFPB 2QQKH 4RQQA 4XH2A 4YHOL 1J8HE 5MERB 4HWUA 4WU5B 5IMMB 5B39A 3V52H 3OJDB 1ADQH 3B5HA 3DX8B 1CD1B 3KR3L 4APQC 4RFEA 3E1F1 5B38B 4W68A 4J6RH 5DI8A 1ZAGA 3ULUC 3CVHH 2X9YA 3D9AL 1JF1A 4KI5D 4AIOA 2YPLD 2PO6C 3VGAC 4B0MM 1QTYT 1J9CT 5IOPA 3SBWC 4XNUH 3FONB 4HCRH 2VDMH 1U6AH 4XMKL 1TQCC 1A7BA 4ZSOB 3QEQE 3T04D 2K7PA 1LP9F 2H8PA 5A16A 1FVEB 1CGSL 1UM5L 4JHZA 4Y19D 1W0WB 4J12A 3MLVH 4LLUA 4NT6B 1AQDB 4OQTL 3V7MA 5E1AA 5E70A 2Z4QB 3PGFH 4IRJA 5D71L 5DRZA 2A0LD 4JLRA 1GGBH 1QLFB 2PW1B 3JVGC 2XKNB 3O9WD 1UJ3B 1NCBL 2DMKA 4PB9H 4M7LH 2D7TH 3H7LA 4GKZA 1U8JA 1XGYH 1MCNA 5CSZB 1XGRB 2I07B 4XVSL 4XPFL 4Z8FH 3VXQB 2UWEE 3JWOC 2LU7A 1F90L 3LY6A 4P2QD 5IJVA 5D1ZA 2ORBH 3FCTA 4KVCH 3S34L 2R23A 3O3BB 5MP6L 1MNUL 2FHCA 4MJ4A 1OF2B 1KEGH 1VFMA 4RFOH 4X7TA 4JRXD 1PEZA 2XFXA 3HFMH 5J8OA 3L5XH 4FQXD 4U1GB 1CYGA 3K3QA 3BQUC 4MNHB 4C59B 3UROR 3QPQC 4GSDL 1FGVL 1AC6A 5DJCA 2JJWA 2CMRH 4LHUD 4PJ5D 4R96B 2Z91A 5J9PA 5AYUH 1HKFA 1DBAL 5F7LB 5D6CB 4HS3A 4LKXA 1GPOL 3U9PH 4U6XA 2BJMH 2NY2B 4LGRB 1U8HA 4DFHA 3QNZB 4C54A 5IW3A 2BVUA 2FBJL 1UEYA 5BZDB 1JZ4A 4NHCL 1R5IB 5C07B 5GGUA 2FSEA 5FAAA 3L3OA 3L5IA 4JDZA 2Q8BH 4PJDB 2GUOB 5JW5B 5HHXL 2H2PC 1XGTB 2R0WH 1T4KB 1QOKA 3C60A 4X8JA 5SWZD 1H9VA 3IDIA 3N1PC 1NBVH 1OQXA 3HB3D 1HHJB 2KKQA 3GIVA 1KJVA 4K3DH 1SVCP 4KAQL 3RA7L 4FP8H 3VXRA 2HTKC 4QXTB 4NN5B 5KG9A 1NAKH 4JKPL 3ARBB 1JZ2A 1G7IA 1E4KA 3EOTH 1ZSDB 3MLRL 5DSCA 1BJMA 3U30B 3BZ4B 1VKXA 3L3JA 2HVJA 3BDYH 4LLMA 3QHFH 2YSSB 4HZAA 4POYA 2CRMA 3EFFA 5EN2B 1KBGH 4FS0A 4CUCA 4AEFA 5DJYB 1YZZA 4XBGB 5D7JD 4Y4HA 3KHOA 5ILTL 1JHKL 3V5KB 1J1PH 4P2QA 1XF1A 3QDHA 2JK5B 1FFNA 3VXPA 1A1NA 2DQJL 1WIUA 5J1AB 3MNWB 4ODUB 1MIMH 4PB0H 4BFIB 1BQUA 4QRRE 5L8LB 4HFUL 5F93C 3HNSH 1LILA 5AD0A 4QXGH 1IGJA 4LARL 4WV1C 4FQXA 3G04A 2Y36L 3FHQA 1SYSB 5DLML 5CLWA 3F7PC 1MCSA 1KGCD 5TJWK 5TDPA 2A6IA 3QYCA 1L7TH 4PJ5A 4ONGL 3PQYB 1K2DA 3BKCH 3N1FC 4X6EA 5F9JA 5GGQH 1QACA 2ZG3A 2G75A 4LSQH 1UGNA 4KC3B 3IKCB 3FT4A 1HILA 2GJZB 4JM4L 4MNGA 4OCLC 3V8CA 2VLME 1B4JL 1RU9L 4HIIA 1P1ZA 5IBTH 3LV3A 4X7DC 1FC1A 3TWCH 3IFOA 2DQGH 1G7HB 2W60A 3J8F7 4JRYE 4OZIF 1PW3A 4OT1H 1AHWC 2Z8SA 4WO4B 3E8UH 2CO7B 3OWEA 3QIBD 3CZFB 5GRJH 4NNYB 1EUUA 5GRYA 5J89A 4YDJB 1ZHLB 4RSVA 4ZO8A 4OZHF 3BP7B 4N0FA 1P5UA 3U4EB 2A6JA 5IQ7L 3UXFA 4RAUA 2FJFA 4LPUA 1FZOA 5IVXA 2MQ0A 4RGOL 2ZPKL 2GK2A 1AQKH 3KG5A 3VXOB 2MOVA 1CXLA 2LE9A 4JO1H 4AYFA 3DHJA 4G7VH 2EDFA 3WKMH 4NQCD 4MJIE 1DEEA 5ERWB 3U0PA 3NFNB 4KRPB 1EVUA 1ZTXL 4UIMA 1S7VB 1K8IA 4HG4K 3NCYP 4XP1H 3O0RL 5CHNB 4C4KT 2C1PA 4OCMC 1YEIL 3D39D 4NBYB 3BPNB 5CD5C 2A74B 2OL3A 3LRSB 3FOLA 4Y4FD 4WHCA 4PJXF 2VLRB 4ZYKA 3SDAC 1PBYA 4MNQB 1ZLWK 4CVZA 3W0WA 4HMCA 4NZUH 5J1TC 4LIQL 2WNGA 5D1QC 3VD4A 5INCB 1QYGH 4JRWA 3GBNL