2AQ3A

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aq3A00
3VWJC 4QXWA 1U8JA 2WUCH 1P84J 3WFEL 5FGCB 3T77B 1ROWA 4GG6A 4P4KD 5KTEL 2H32H 5KVFL 5L0QB 5DEGA 4J6RL 1F11A 3A67L 3IJSA 5T1LA 4F15C 3VW3H 1AY1L 2VLRA 1AO7B 5GQBA 3MLZL 1DDHB 1MUJB 2YA0A 3BPCA 3WKML 3W2DL 1NBYB 5FXCH 3L1OH 1VFUA 3MJGX 4Q6IA 3X13B 4H25B 2XY2A 1BBDH 5JHLH 3QCTH 5IB4A 3IJHA 4Z76B 2BHZA 1RZ7H 5HY9A 4Y5XC 5IB5B 2M8XA 2BSED 5D7JC 5K9QI 5C09A 1AQKH 3PWPB 5JIHA 2FCBA 1CGSH 2EXWC 2WW8A 3PABA 1QNZH 1L7IL 5GIRB 2R4SH 2GSGB 1EUTA 4P2YA 4RFEA 3KPSA 4PTTB 1FYTE 5I18H 4F2MB 4CW1B 3RWGA 1RIUL 3BP7B 4L5FH 5E8NB 3KPOB 2DYPA 3WSQH 1U95A 2A0LC 1BBJB 3IRZA 3ZHKA 3UTOA 5FO9B 2XG4A 1S5IL 4ZFOL 2ZZUT 4X7TA 1DN0A 3VE0A 5DJDA 2I07B 1KNOB 1UGNA 4HHAA 2V9RA 2FHFA 3QDME 4H26B 1ZSDB 4LF3B 4ELMA 3MRDB 2EXWD 1G7JA 2DYPD 3PHQB 2HFEB 2ICES 3T3ME 2E6PA 5I1JL 4AIXA 4NBXB 1ZVSB 1DBML 3TA3B 2XTJC 3QUML 4JFHE 4DN3L 1IL1A 5FEBA 3QEGH 5IB2A 1KJ3L 1BZ9B 1KELL 2X09A 5FHBH 2ZG3A 3L3JB 4XNMB 4P2RE 1UA6L 1RUPH 4HKJB 1K8IA 1CD9B 4WWKC 4MD0B 3CFIC 4OLZL 5I66A 1R5IB 4L8BA 5ICZA 2W92A 5KN5A 2GJ6B 2EE6A 5KW9L 4IHOA 1HH6A 3HI6L 4U6VL 5AZEL 4PRPA 5EB9A 4C83B 1RZKH 4H20H 5I19L 5C0IB 1K3IA 4P3CL 2HFTA 4QGYA 4ZG1A 2EH8L 1FZOB 2QEJA 4J3TA 1S9WB 3FB5B 3BOVA 1Z9MA 2H32B 4O2CB 2J6EL 1UT9A 3GMOA 4PRPD 4XNUL 4HFUL 3TWCL 1MIML 5E5UB 2GTWA 1M7XA 2XN9B 3U4AA 4EDWL 4Y4HA 1DBBH 5CZVL 1LO0L 5IB1A 3WEXA 5FUCE 4PJBB 4YIQB 3C8KA 1CE6A 3OKMA 2ESVB 1U2HA 1D5MB 1DEEA 2WZPD 3FAWA 1KC5H 3PP4H 1P1ZA 4JG0L 1MVUA 4U1JB 5B8CB 4L3EA 4G9DA 1X5ZA 4GBXA 3NIDF 3EDDA 5DA0B 4NZUL 3MRIB 4N1EA 1MCRA 4D9RE 4FNLL 3T4AA 4JZNB 1N64H 1T1XA 5BQ7B 4YDVA 3SOBH 3HMXA 3OV6A 5ABDE 1JZ2A 1HXMB 4GBXD 4L3ED 4ZXBC 1SJEA 4QF1B 4XNXH 3HLAA 3SDAA 3WFDL 5D1ZC 3C6SA 2EXYD 1MAML 2D31B 2MCG1 2W60A 5HYJE 4L4TE 4NQTA 5DRXA 2X89A 5KZCB 1XGTB 3TLRA 1F4WH 3TNNA 1UYWH 4WHCA 5D1ZA 2GAZA 2RB8A 3SDAD 3TCLA 4OLVL 2DLFH 3O9WA 2C1PB 3BVNB 3RHWF 3SCMC 3P3YA 2X89D 5F44A 3V8OA 1I7ZB 1KFAH 3DUHA 2Z31B 3MUGA 4ZO8A 4PJEF 5CEXA 3VD5A 4HBCL 5D1ZD 1QA9A 3O3UN 1NLDL 3MUJA 1OAXH 3SO3B 4ZNEE 1PVHA 1DLHA 3ZSSA 3ARXA 3LRHA 4JN1H 1RUMH 3Q6GH 5GS2D 3O9WD 4HIIB 3V6ZB 1KTDA 3IFNH 5K9JL 3MOAH 3GO1L 4EUPH 4HWEL 5E2VH 1XF2A 2EH7H 5ICYB 3VA6A 2E9JA 4V1DE 4ZUVB 4JKPH 4DVRL 5JPNA 2ZPKH 1ZE3C 1RAMA 3RPIA 1FRGL 1NUNB 4ZUWA 5C0CA 4X6DB 3BZDA 3CCHB 4NSKA 1NCCH 2HT2C 2YEZA 1ITBB 4HZAA 4X4XA 2JELL 1V3LA 3BZEB 3GB7B 3HRZA 5BW7A 4GRWH 4XMLH 5C0BE 1CYGA 1KCLA 1UM4L 1MLBB 5C0CD 3KNBA 12E8L 4YHML 4M8QA 1S3KH 4PGBA 3VXRA 4LPXA 3V8CA 3IU3A 3N1FC 1I1YB 5LQBH 4POYA 1SJXA 4YPGA 1KG0A 3IXTA 4QKXB 4DW2L 3OKKA 4XPAH 4OF5A 3UTZA 4K7FA 3U36A 2AAVA 4NRXB 1YQVL 4XH2A 1KCSH 3CMOH 5EU6A 3VXRD 3STLB 1ZKAA 3PE9A 4NJ9H 2IFFL 3MRGB 2ZUQC 2YRPA 1NDGB 1SEQL 3GSNB 3SBWC 2HT4C 1PKQB 3IGAB 5DRNA 5EU6D 3P0VH 3MV7A 1ZS8B 1OP5K 1IM3B 3B5GA 3ZYOA 1UWGH 4PJXA 2OZ4H 1R3IH 4DAGL 3MV9B 5F7WC 4Y16C 1W0WA 3F7RA 3MRPA 5EU7C 5IVXF 5IEHB 4MAYB 4HUUB 1OTSD 3MV7D 3H3PL 2A9NL 4YBLC 3L3HA 1CFSA 4KY1H 2GTZB 1D5IH 2H6PA 2C1OA 4EIZC 5E1AA 3EW3B 3T2NL 2E6JA 2XIDA 5GSRB 2HT4D 3TBYA 1A9BB 2HKFL 5GISH 2VLKE 1CDBA 4FQHB 2AV7A 5TQ2L 1Q9WA 1FNFA 3QH3B 4HF5H 3BZFA 4APQB 3NIDE 2BHUA 3HB3D 3P9WB 3RVXD 1DZBA 2XTJE 3DXAA 3IFPB 4IRSB 2DMCA 4IMLB 4N8CH 4EUPB 1D5XB 4NKIH 3HAEA 3DUSA 2GK0B 3MFGB 1LD9A 2G2RA 5KSAA 2VQTA 3ZDYF 2HWZH 4XBGA 1SYVA 2Q76B 1QD0A 4G8GE 2AI0L 5IT2L 4WI5A 2HTKC 2Q7YB 3S96A 2X4UB 3I85A 5KSAD 2EO1A 4C57C 5F3BA 1WZMA 4P3DB 4Z7VB 2GJJA 4IRJB 3PXHA 1DUYB 4GRWB 3WFBL 3PG2A 2C3VA 3Q5YA 2ENYA 4JM2A 3JVGA 4LMQI 4R8WH 4OI7A 3BPLC 2NXYC 2ZG2A 3AM8C 3FCTA 1HOCA 3UC0H 1NFIB 2GFBB 2G9HA 1A7QH 4PJEE 5SX5H 4YH6A 1NGPH 3OKOB 3GMMA 5KSUB 1J86A 1MF2L 4N9OB 4MA7L 5CIPH 3S7GA 5FKAA 2ERJB 4YGAB 1ZGLM 4YPJA 3AM8A 2AXHA 2YUVA 3D6GA 4PD4K 3IDYB 1PY4A 4I0CC 3TGXA 2B4CL 5DR5L 1NCAH 2AEQH 4J4PC 4E5XB 3L3OA 3SPVB 2AXGA 3QIUA 1F8TH 3OKYA 4HS6B 5D7IF 2PETA 4LCUB 4EDXB 4HWNA 4U1HA 5C9JB 2OL3L 5I15H 4NZTH 1L6ZA 5CP3A 4IOIA 5EN2A 4EBQL 5JW4Q 3AS1A 5JDSA 2W9EL 1RSFA 1R6VA 3T0XA 1YEGH 4ZUSA 3QIUD 4DCQA 3IAGC 5IFHH 5F7YC 1LNUA 1IQWH 4GH7B 4ZSOA 4B41A 4Y5VC 5FO7B 2VSDA 1A3QA 1TVBA 5INDB 3NACL 4XP5H 2RFXA 2CR6A 3QJFB 4HWBL 4M00A 4K55A 4KTYA 1FVDB 2P24A 1IGYA 1KPRB 4LVOB 5D6CA 3WE6A 1OB1A 3QCUH 3BN9C 1YEFL 2AK4E 2EIZB 2B2XH 1TZGH 1KPUB 5ERWA 3WUWA 2NTFB 1MWAA 4E0RB 1YNLH 4IOFC 5IBUG 1KCRH 4MCYA 3E8UH 1RQ5A 3B3IA 5F89B 2R0ZL 1JK8A 5D7KD 3MUY1 4NFCA 4AG4H 1BM3H 5EA0L 4KUZH 1IILE 4HCRA 4PGZA 5H35A 5FYLD 2YD6A 3SO5A 1QHPA 4HXBL 5I71B 5ADPH 3EGSB 4TTDC 4HFWB 4JGJA 4NP4H 4BQBA 1G7PB 4G9FA 4HS8H 4OLUH 4DGVH 3BKML 2KQNA 3L5IA 3QPXL 4HMEA 5LGJB 1NFDF 4WV1C 3ZKND 2A6KA 1K3ZA 3KLAA 3PQYB 5IVXE 2FX9H 5DVNA 1Z0MA 4KVNH 4WI6A 3CIQA 5CHNA 5E9DB 3VXUE 4HULB 1X3DA 4G9FD 4O58L 2VWEC 1DUZB 3FB8B 1TCRB 5IOPA 5T33L 4TTDD 1LO4L 5TFSH 4AM0A 2JF1A 5CIPB 2YKLH 4XGZB 5E6IB 1N5YH 3P4NA 5EU3B 3E6FA 1M7IA 5DVOA 3I9GH 3W0WE 1H3VA 3MBEC 1N6UA 5CJ8A 4JQXA 4R97C 1I8KB 4KVCH 3UTTA 1CD1B 5TGBA 3ZDYE 1XF5B 4G6MH 3QXAA 4KV5F 5D2LA 3PGFH 1YYML 4GW1B 5MI0B 4B7IA 3D69A 3MA9L 5GPRA 3MBEA 1IAIH 5KJRH 2KL6A 5M95B 5ITBL 2EICA 1HN1A 1CGXA 3UTTD 5HYEA 4OCYL 2PUQT 4KI5C 3KR3H 2E9WA 3PWNB 3RWCA 2MNUA 3E0GA 5CUSH 4OD1H 3FB6A 1ZLUH 3HZYB 4OSUL 4Q0XH 3MBED 3MCKB 3P9LA 4TUKH 5SWSB 2AKRB 1KV3A 5EU7E 3VG0H 3RY4A 4JO1L 1Q9LB 2ITCB 3CZJA 2WUCL 2VAJA 3THMH 1S7WA 1E4JA 2NLJA 3FO1B 2DJUA 5F9AC 1JWSB 3FT4B 3C6LA 5AYQA 1QLEH 3ROLA 1XGUA 4GLRI 3VW3L 2IANA 3OTTA 1FAKT 3VRJA 4DFHA 4GXVL 3MZTA 2DQGH 4KI5D 3MODL 4KTEH 5DRZB 4YHYC 1X5YA 1T22A 3SDYH 3L1OL 3C2SA 3W9EA 5JOFB 5EDXA 5D7IE 2P43B 2IAND 2WUBH 5KVEH 5GGQL 1BBDL 4ODVH 5JHLL 1H3UA 4P23C 3DX7A 4K8RH 5IHZA 4I18C 5EBWB 3SGDH 4D9LH 2EYSB 4KWUA 2QSVA 5IHBA 1NGXB 1AQKL 3KPLB 4EJ1C 1CGSL 1QNZL 4OV5A 2VTFA 3JWNC 1ZHNA 2R4SL 2BNQB 3W81A 4NO0A 3TEUA 5I18L 4KI5F 4P59L 3HZMA 4LCWE 3OSKA 4FG6C 4RZCA 4XHJD 2O61B 1QSEA 2Y25A 3QNYA 3D0LB 3N1GC 1VACA 1CDJA 2R0LH 3MJ6A 2W65B 1KLGA 3DGGA 4TYUA 2EYTB 1U8HB 4MJ2A 3FOLA 3MNVA 4YNYA 2AQ2A 5D93B 3VJ6B 3I6KB 5DK2B 5HPOA 1RU9H 2XA8L 4F7TA 1I3RA 5F72S 5L7XH 4FG6D 4NT6B 5DURB 1G7QB 3MV8B 2I5YH 2XKSA 3QEGL 1T66C 5E8PA 3TJEH 1BWMA 1RUPL 4KKLC 4FTVE 2KZ1B 4JGUA 3ARZA 2C4FT 2J8UE 1LO5A 3DETD 4E9LA 1U8IA 4WW2B 4MSWB 5IIEA 5I30H 2VABA 5D7KE 3S37X 2D0HA 1AE6H 1C8PA 5C6PB 4JLRB 4Q74A 1TNMA 43CAA 4QRPA 4FXLA 5JLZA 2MKLC 2DLIA 1H3WM 3AS3A 1RIHH 4O2FB 5KOVC 4PGEB 1Z5LA 3FL7A 3L3IA 3NZ8A 4M5YH 4F33B 1RV6X 5ENWB 3QG7H 2AERT 3CFEB 1DBBL 4EI5C 1AKJA 2FGZA 3B2UD 4QRPD 2P49B 3F7VB 4PRID 1A0QH 4C4KO 1OGAE 4KV5E 4X99A 1E6OH 3PP4L 1F6LL 1SJHA 4TQEH 2IEPA 1D3CA 4POUB 4UZGA 3PWVB 3W39A 4OZFA 1AKJD 4QHLA 1AGEB 4EXPX 4W70A 1M4KA 4P9HC 1NBVL 1T4KA 1N64L 2AJ3A 4K07A 4UB0L 1JHLH 1BF8A 5ISZE 1ZVHA 3SOBL 4B53A 4U1LA 1G9MH 4RFNC 3GSNL 4B0MM 1K4DB 4X7CC 5DC9B 2CRMA 4MNGE 3RI5K 3KYMB 4EI5D 1FLTX 5I75C 1F4HA 4FQIH 1NUFA 4FFYH 4EN3A 3UJJH 2VWEE 1OAUH 1TXKA 4PJ9C 5E8OA 1AIFA 1JNJA 2JK5A 5DA4A 43C9A 1CK0H 1LDSA 1PGRB 1F4WL 3MROA 1UYWL 4M1CC 2HJKB 3RVTD 4X9GA 1JF5A 2HG5B 3DRQB 2BNRE 4DGYH 2W91A 4EN3D 4XB7A 5CD3B 1KUMA 2DLFL 1HXYA 4F7CA 3QA3A 2JIXB 5I8CA 3O6FC 1XF4A 2GCYA 3RVUC 2BC4A 4K3GA 3FRUB 1OAXL 1MHCB 4PJ9D 1W2KT 1CIDA 4JN1L 1RUML 1IKFH 3Q6GL 4QO1A 4Z6AT 5DUBB 4JQVA 2OTUA 1NMCC 1KF9B 1C5CH 3IFNL 4M1CD 5DQJA 3O6FA 3MOAL 4PJAA 5E2VL 4RMRA 1OARH 2X4SA 3WDIA 3KLHD 3PWJA 1FVCA 2EH7L 4YHOH 3ARGA 2NY1B 3FQXB 3WUWG 2BHYA 3NGBB 4JKPL 4KI5E 2ZPKL 3B6SA 4HUVB 3CVIH 1P4IH 3UBXA 1FYTB 3PDOB 3U0WH 3QHFH 1TQCC 3O6FD 3NOIA 4RGOH 4KKAC 3MRNA 3CFDA 1FE8H 4PP1C 4TUJA 3V5KA 3G04B 4XMLL 2OR7A 5IM7A 3EYQC 3QDMB 2YSSA 8FABA 5E4IA 5FAAA 1S3KL 1S8DB 3R8BB 1FH5H 1T0NB 2OJEB 1W8NA 2B8OT 3P30H 4MAUH 3DYPA 1MH5A 5LQBL 3V5DB 4C56A 4XB8A 3RWHB 3WMSA 3C5JA 3SDCC 4XPAL 2RHEA 4P2CG 4YEFA 5E00A 3QO1A 4ZOBA 1EFQA 4NC0B 2ED7A 2F19H 3BKYH 3GSVB 3L3KA 1ZEAH 4NJ9L 5HGBA 3NTCH 3BW9B 1C5BH 4Y4KA 4YE4H 4OGXL 4QHMB 4C56D 4P2RB 5C8JB 4X5WA 5F7HA 3EYQD 5GHWH 3A6OA 5LAXB 1VGEH 3O6LH 2DTMH 2ZSVA 2WWKT 3P0VL 2A6JA 4H8WH 5CZXC 1JE6A 1E27A 4Y4KD 4MB3A 1UWGL 2OZ4L 5TE4H 3AREB 1YQ2A 2CDFA 2DWEB 4G80A 1EO5A 4XZUB 3P9MA 2R1WA 4Y4FB 1DVFC 4JFDD 2CH8A 3A0OA 1FL6A 3CVHA 3TESA 1CFNA 3EYUH 4KY1L 2P5WA 1D5IL 6CGTA 2J88H 3SJVA 5IR1B 3SE8H 3IS1X 1BLNB 2VXQH 4I2XB 3QNXB 4LEOB 1CTOA 4HF5L 2DN7A 4WUUD 3L95B 3HPLB 2EE2A 5HD8C 5I1CH 3RP1A 1FFPA 2P5WD 1MJJB 4U1KB 4LVNC 2YXMA 4NQEB 3SJVD 5KANG 5T3ZD 1N5AA 1XFPA 2KBGA 4N8CL 4NKIL 2X10A 4X4MA 2DQUH 3VGAC 4ZS7L 3OJDB 2HWZL 4JAMB 1WBXA 4MD5B 2YD3A 4DKEH 1U8KA 4PRIE 3Q3GA 1EK3A 4UI2A 2FL5A 1SY6A 1YPZA 2WP3O 1HINH 5CJXA 4J8RA 3ZKXC 2OBGA 5HD8D 3HE7C 5SX4I 1I9EA 3CZFB 5I1AA 3BEVA 3CX5J 1F58H 2IBBA 4XCEA 4YXKH 3CDYA 5ID0A 4R8WL 4MNQA 1OWWA 1YEDA 3O2WH 3UC0L 5D96C 5F96H 5C0FA 2LFGA 1NGPL 1LP9A 1Q9OA 2RR3A 4X9IA 1ONQB 4MNQD 2VLLA 1BEYH 4JANA 4ZD3H 4MLSA 4JB9L 2WBJC 3HE7D 2ZCKH 3BZ4B 3QEQA 1NCAL 2AEQL 4LLMA 4P4KB 1E4XI 3ILPB 1F8TL 2FLRT 5HGGS 2UUDH 3V4VH 3CFJB 2PO6A 4LPYA 5J1AA 5I15L 5A2LH 1U8JB 4LCCC 4NZTL 1Z6JT 2CDEB 3QEQD 1BGXH 4Y2DA 4WHDA 3SKUD 3BUTA 4GG6B 3MYZA 4Z78A 3NCFB 4G6FD 5FGBC 4DZ8B 5DEGB 5IFHL 2R0WH 4JZJB 5DJZA 1IQWL 4LSPH 5JPMB 3BP6B 2PO6D 1RURH 4QHNA 1FCCA 5C0BB 3F6IA 3X14B 1C16A 2HKHL 2KPNA 3QCUL 5IEKA 4PJ8A 2B2XL 2WSKA 4LPTA 3FQWA 2H9GA 2V2TA 1YNLL 5TJWK 2EDBA 1MELA 1KCRL 3VGHA 3E8UL 1NCDH 4LSQL 4OV6F 3WFHB 4TPRH 1RJZB 4AG4L 1BM3L 4WGVB 3BH8A 4PJ8D 3CU1A 3V5HA 1NJ9A 5ALCH 2J5LB 4HLJA 4Y5YA 2V9TA 4LLVB 3CC5B 5ADPL 4I4WB 4Y5XB 2PTTB 1EHLL 4X6BB 4NP4L 1LK3H 3P2TA 3NPSB 1BIIA 4HS8L 4OLUL 1F90L 4O5LH 4DGVL 2DYPB 1U95B 3WHE1 1B0RB 3CFBA 3JSSA 1DTUA 2GQHA 3GSRB 4N5ED 5TDNA 2FX9L 4KVNL 4PJGF 2WINA 4OIAA 1T3FA 3GMNA 4HK0A 3H9ZA 3U2SA 5FK9A 1G7JB 2WM0A 1ZGLA 5IMMA 5GS3A 4K2UH 2LV4A 3D85A 5BRZA 4PRBA 5EWIH 4XAKD 4IEFB 4LCYA 2UVEA 1DANT 1CL7H 2P8MB 1HHGA 5TFSL 1GJIA 1NL0H 4JHAH 5I17A 1B9ZA 1XZ0A 2AGJH 2YKLL 4MJIA 1G1YA 1N5YL 1HE7A 3FQRB 3P0GB 3D85D 1WIOA 4NYLB 5BRZD 3I9GL 5C0JA 1VFAA 2XTJB 2OS7A 3T0DA 4YHLH 5I66B 4L8BB 5ICZB 5J1SC 3MNWA 4JFDE 4IHOB 1HH6B 4MJID 5GRUH 3MJ8A 1WF5A 3PGFL 3FQUB 4MCZB 4PRPB 4G6JH 5C0NC 4WWKB 2VR9A 1IAIL 1LE9A 1DR9A 5KJRL 3RDTC 4G8GB 5HHMD 3ARTA 1YDPB 3S3JA 1T1YA 2E7LA 4QCIB 3KR3L 5CEZD 2CJUH 2ZNXA 3GMOB 5CUSL 4HIHA 4NNXA 4OD1L 4HS3B 1DBAH 4WUUE 5EOQH 4BFIB 4FMKA 1YMHA 4Q0XL 2GTWB 1CT8A 3VXMA 3LHPH 2N56A 2YPLE 3WEXB 1UB6B 3C8KB 1CE6B 3IETB 3OKMB 3UZVB 5L8KB 3THML 1DEEB 1TDQA 4Y0GA 5C0ND 4OZ4A 4PJEB 1QLEL 3E1F1 3MRMA 3SDXA 1GCFA 3DX6B 4D8PB 4L3EB 3VXMD 1JVKA 1X9QA 1IC7L 3UP1A 3MCLH 1T1XB 2APVA 5IVZA 3TC9A 4ODSH 4BFGA 4YDVB 3SDYL 3L3DA 3S6CA 5GGUA 1KBGL 4MHHI 2WUBL 5KVEL 4ODVL 5BVJA 4AH2A 3VCLB 4XVJH 4ODTL 2CIIA 2AK1H 2W60B 1PBYA 4D9LL 4ZUTB 4GKNB 3WD5H 4ZXBB 3TNNB 1ZTXL 4CAGA 2V7HB 1MCIA 5D1ZB 1D6EB 4R0LA 5B38G 3BT2H 4NN5C 1LEKA 3TCLB 2VL5A 3O9WB 4CADA 4FQLL 3BN3B 1TZIA 2EDKA 1MQKL 4FXGA 1JPSH 5DJAA 5CEXB 3CD4A 2R0LL 2AK4B 3CPLA 1DLHB 3SE4A 3SCMB 3O4OC 1E28B 2RCSL 2EEDA 1H8SA 2Z8WC 4LGPB 1JWUA 4RMUA 1K8DB 3HAEH 2VRAA 2FBOJ 2MPAH 1RK1A 4LVHC 1CGUA 4HJ0D 5L7XL 3CFCH 3MREB 5C3LD 1HNFA 2I5YL 1IGIH 5DD1H 4ZUWB 1BFOA 5C0CB 1YUHB 4UIKL 2FWOA 3W9DB 4NSKB 3VFSA 1VDGA 1U93A 3E3QC 4PJGE 4ZMAT 1PQZB 4X4XB 4AY0A 4F9PC 2YC1B 5C07D 5I30L 1WJ3A 4M8QB 3G9AB 1FBIH 1GIGH 2XFXA 1MFNA 1MY7A 1FVEA 2X1OA 1AE6L 4KHTH 1BJ8A 1GZPA 2GY7B 3IU3B 4RWHA 1KIPA 3OKKB 5FHAH 1RIHL 5E5MB 3T0EA 1EH9A 5DTFB 3UTZB 4K7FB 4N8PA 4YJZL 1MI5A 3W5NA 1OW0C 3UTQA 1NC4B 4M5YL 2R2EA 3QG7L 1A6ZA 1HH9A 4RQQA 2DLGA 3W0WB 4QXTA 3B43A 1HHJB 1A0QL 3GNMH 5GGSB 3T0ED 1E6OL 3MMEB 1JHTA 4X4ZA 4G3YH 3WKNA 3FT2A 1JNHA 3MV7B 4OFVA 1IGMH 5CP3H 5MHSE 5AAWA 3O41B 4QY8B 4K94L 1N6VA 2QR0A 1W0WB 1JHLL 4CJ0A 3U46B 4PP2B 2XZAH 1G9ML 5HHQB 4HGKC 1IC5L 1FIGH 4Y16B 3BE1H 5B22A 3SKMA 2W0FB 3L3HB 2X1PA 5GSVA 4FQIL 4FFYL 1DP0A 5E1AB 4L3CB 3UJJL 5EORH 2XA3A 2AEWA 2AV7B 2AEIT 3LMJH 1Q9WB 1CK0L 5BZDB 4YBLB 4GAJL 1VERA 4JKLA 4K9EC 4OM1H 4BELD 3BH9B 5HYQB 4HXAH 2D03H 1CDUA 4HIJB 3QFJE 3GM0A 2B1AH 2ED9A 4HCRH 1C08A 1U8OA 3HAEB 1C12B 5CEZE 1LD9B 1PSKH 5T3XL 1OTTD 3H9HB 3CX2A 1U3YA 3HNSH 1SYVB 4XBGB 4HJJH 5D7IB 3TT1H 2YUWA 4HT1L 1IKFL 4NFBA 1RVFL 1D5ZA 3F58H 2KZWA 1QRNA 4XPBH 3S36L 1C5CL 3V0VA 1H3PH 4IDLA 5D2NE 3AVEA 1OARL 4AIZA 4PRHE 1PZUB 3H6JA 4YHOL 5HDBF 1A3RH 1S7RA 1A1NA 4JFZL 4M43H 4IS6A 2C3VB 5JXAH 3V52H 2WP3T 1R3KA 5CJ5A 3CVIL 3RJQB 1P4IL 1QRND 3FCTB 1HOCB 1BVLA 1IAMA 5JORB 3IKCA 3QHFL 2QLVB 4ZFFA 1NFKA 1BX2A 3LS4L 4RGOL 2DQTH 2B39A 3UO1H 1AGBA 5FM5M 2VH5H 1A7OH 3QFDA 3SY0B 1FE8L 4M61A 5HGDA 1F5WA 2MSPA 2ZSWA 3BPLB 1WZLA 5F9OL 2Z8RA 2Y7QA 4MYWB 4C54A 3PDGA 4RSVA 5MERB 3K4ZA 4FZEL 4KRNA 5GS1A 3L3OB 1IAOA 1FH5L 4Y8AA 2AXGB 3P30L 1AHWC 3G08B 3QIUB 4MAUL 1FJ1A 5TQ0H 4WFGE 3ULSA 2F9BT 4LLDA 2GW5A 3FZUD 4JKKA 1Y0LA 4ONHA 4LAQH 1NGQH 2VNCA 2DQJH 3WLBA 4TSCH 3S88H 2F19L 2MWCA 3D0VB 2FYYB 1NFDB 3BKYL 1C5BL 3HZKA 2CKNA 5FDWB 3HC3H 1WCBA 2YPKA 1NGYA 3RUGF 1IGTA 1YEEL 4FTVB 1TVBB 1JZ3A 5GHWL 3S34L 2DQHH 1VGEL 3UTPE 2RFXB 3LS5H 3U0TB 1I7UB 4M03A 4ZFGL 4H8WL 2P24B 2HMID 1N26A 3I3EA 2PW1A 3WE6B 1CBVH 1MJ8H 5TE4L 5DO2D 3A6BH 4N9GB 4F7EA 3U0PB 3WUWB 1MWAB 1FL5A 1LWRA 4OGYL 1NQBA 3QXVA 4U2YA 3B3IB 1KB9J 1JK8B 3HN3A 4GAGH 2DICA 3EYUL 1NANH 1T5WA 3DURB 2J88L 4EQ2A 4MLIA 4PRDB 3NH7H 4B50A 1IM9A 3SE8L 3UJTH 2DQIH 5ICXA 3DIFB 4G9FB 4NZRH 4HPYH 5I1CL 1JL8A 2Q8AH 2A6KB 4YHZL 5FIEA 1XMWA 4LSUH 4TNVF 3QDJA 3DOSA 5JO5B 2V7NB 2C3GA 1CICA 2NY3C 2GEEA 2VN4A 1T2JA 5ISZB 1VADA 5ID1B 1X6NA 3E3QE 4WV1B 3OZ9H 5IOPB 1FGNH 2VISA 3MRKB 3TVMA 5IV2A 4MNGB 3D2UA 4DKEL 4UQ3A 3QDJD 1UCBH 3MYJA 1CICD 5IK3B 4X6CA 1HINL 4AEIH 1QR4A 4AM0B 3TYFB 3MR9B 4R3SA 4Z95H 1OP3K 1UJ3C 1ZHBA 4WTWA 3I75A 3TVMD 5F9JB 4S0SD 1F58L 5HVHC 3VFMA 4YXKL 4PRNA 4FA8A 1PYWB 2BNRB 2EIDA 3BP4A 3O2WL 3U1SH 5CS7A 5F96L 3OBAA 3QXAB 5J11C 4X9HA 1T2XA 2HH0H 3MBEB 4AENA 1ULVA 1MLCA 2OXGA 4R97B 2PR4H 4RMVA 5CGYD 2J1KA 1P69B 4E41A 1BEYL 1EPFA 4ZD3L 4GRLA 3JV6A 3UPCA 5CSGA 2ZCKL 4XMKH 3RWCB 3VXOA 1U8MB 1CGYA 3O2DA 1W72H 4JRYE 4GW4B 5JNYB 3AY4C 4NO5A 1GRWA 5BS0A 4E41D 1CCZA 3V4VL 5E2UH 1HKLH 3AUVA 3VFPA 4GRLD 3FN3A 1J0KA 1Q94A 1QZ1A 5DXWA 1BGXL 2NLJB 3BWUC 5BMFH 1OY3B 5HHVH 3QWRA 2R0WL 4O9HH 4R4NC 2IANB 4ZUUA 4LSPL 1NEZG 5BS0D 4RNRB 5DMKA 1XEDA 3GUTA 1RURL 1IT9L 3WIHA 4JJ5A 3GSWB 2GT9B 1VPOH 4M7ZB 3LEVH 3QWRD 1AC0A 4NQCA 2D0FA 4D0DA 5ITFB 1S9VA 2X4NB 1F00I 4HUWA 4M48H 4K7PH 1AGFA 1JGLH 3SEPA 1EFXD 5DQDH 1NCDL 2J7LA 3FKUS 4OZFH 5IMOA 1JYVA 4U0RC 4GAYB 2YD4A 4TPRL 3L5XL 3I6LD 1JF1A 3JWOC 3TBWA 4TNWF 2QV2A 4NQCD 1UQSB 2XQYK 4M1GH 1CFVH 4P23B 3RUGE 3VI4F 1XCTA 4M7LT 4ZO7A 3HMXL 3HE6C 4CJ1A 3DVIA 3LN5A 3JUZA 3W11C 4ZFZA 4ELKA 1LK3L 3RL1B 4P9HH 3BPOB 1ED3A 3HS0B 3OB8A 5SV4A 1V3MA 3MRLA 2B7DT 1UXSA 3QNYB 5GS0C 1AR2A 4JZOA 1X44A 3ZE2F 3OXRA 1F3JB 1L0XA 3BUYB 3QQNA 2EDHA 1VFMA 4ODHH 1KLGB 5AUMB 1O5DT 4G42B 2BVPA 3FOLB 4WFFD 4YNYB 4J7RA 5GJSH 3BHBB 1YMME 1F42A 1ZA6A 1CXLA 5EWIL 4OCLC 1QSFE 3K8KA 1CL7L 5IQ9A 4LHUA 3T8XB 2I9TA 1NL0L 4JHAL 5GGTH 4JFYB 2O5YH 4PJIA 5D9SB 1S7VB 1FL3A 2Y72A 3PHOA 5GS0D 3X17A 1JFQH 4GXUN 4NCC2 4R7NA 2OR8A 5LJYH 2LTQC 3B5HA 2W9LA 3J7HA 1W72B 2CDGB 4XP1H 4YHLL 1LO5B 1MNUL 4ZO9A 4N0UE 5GRUL 4S1SL 1MCSA 4G6JL 4PJFF 4Z7WA 4NQSA 1MCHA 1JYWA 3N50A 5IF0A 3OMZA 2HJFA 1JGVH 43CAB 2NXZD 4R7DB 4PRIB 5SWQA 2GHWB 3TH4T 1EVUA 2CJUL 4YDIH 3L7FA 1Z5LB 5EOQL 3NZ8B 5I16A 4U05A 4WHTB 5DJ2B 3ZYZA 3LKOB 5T1DH 3LKNA 1FN4A 1NH6A 3UXFA 4PGDA 2BVOA 2VDMH 3SDDA 4X99B 3N85H 4DTGH 5BV7C 1N3NA 1BF2A 5GZOC 1K2DA 3FTGB 4EI5B 1P84K 4OZFB 5B3NA 4QNPF 3D3VE 4G43A 5F7LB 3DNKA 4LFHD 4M7JH 4P9MH 1UZ8B 4Z77A 1A6TB 3MCLL 1I8LA 3SDDD 1UKSA 4ODSL 5D72L 3NMEA 3MFFA 1KEGH 2HT3C 3KYNA 5E08H 2HLAA 5KVDH 3O11A 3ARDA 4ODXA 4J23A 5E4EB 4XVJL 4EN3B 2BOCB 3IXAA 2AK1L 3QHTC 5E8OB 4CNIA 1EX0A 1AIFB 1OT1A 2JK5B 43C9B 1P7QB 3WD5L 2YD1A 4JKWA 2DWDB 2P7TB 3MOBH 5I75B 1KGCD 3MV11 4DQOH 1TIUA 1T0MB 4MQTB 5HYFA 3QIWC 4PJ9B 4XC1H 1PY9A 3CVHH 4ZYKB 1A7RH 2VZSA 2Q7NA 3QA3B 5I8CB 1JPSL 1MIEH 1TQBC 5FOBA 2BSRB 3ZHLA 3ORJA 1D7FA 1ZA3A 2OX5A 2F53A 5CBEA 1CFTA 2X40A 4GOSA 5DD6B 4NO2B 3MRHB 2NMSA 5DQJB 1L0YA 3O6FB 1Y6KR 3EYSH 3VI4E 2FIRT 4JFPA 2VLJE 2EZ0D 2X4QA 4YHIA 1R3LA 2C9AA 2HFFA 4OZGE 3SGJA 4DN4H 2F53D 2MPAL 5EU5A 1G84A 1NUGA 1NMCB 3CFCL 5EPMA 5I6XC 1PDKA 5DD1L 4RMWA 1MCLA 1QFPA 2QSCL 3CFDB 2YUZA 1SY6H 5IROA 3ZE2E 3IDIA 2Z93A 3RTQC 3KPPA 4FS0A 2IG2H 2WQRA 4KHXH 1TQCB 3N1QC 1KJ2A 4QOKD 3O8XA 4MNHB 2O5ZH 4U1NB 2YSSB 1FBIL 1GIGL 3DBXA 5EZIL 2CO6B 4KHTL 3CNKA 5GJTH 5JQ6H 5C08E 1ZT1B 4DK3A 1VCAA 2Y4SA 3C5JB 3H9SA 1CVRA 4OLXH 1I7RA 5FHAL 5SWZD 4NQDD 3IAQA 3EYFA 3WLWD 3KXFA 4ZPVA 3U82B 3U4EA 1NCTA 3B9KC 1NCNA 1IARB 1RZFL 5HGBB 2ADGA 1RZGA 5IW3A 3SDCB 5EOTA 4X5WB 4U4BA 1IAKB 3H9SD 2FSEA 3GNML 4G8IA 5FFLA 1U9KA 3KYOB 4PJFE 3KXFD 1TPXB 3OKNA 4YHNA 5EFIA 4JFDB 2B1HH 4HC1A 1R0AH 4G3YL 3NCJH 2A6JB 1NUDA 1P7HL 5J3HC 1IGML 4F57H 5ANMA 1KT2B 2GIYA 5GGRA 2CDFB 5F7NC 4Y19A 4YLQT 2R1WB 1I1RA 3B9KD 1KB5H 3C60C 2XZAL 4KRPC 5MEPA 1MAKA 3DPBA 2Q8BH 1FL6B 4B7LA 4WUUB 4I9WE 4OUOA 3CVHB 3FRPA 1FIGL 1CFNB 2F15A 3LQZB 2BY0A 2P5WB 3QUYC 2FGWH 4KU1A 2YPLB 3KLDA 4Y19D 4KJQC 5EORL 3FN9A 4UBDC 5JZ7D 1DVFB 3CFKA 5IUSA 3RZCA 5ACLA 1H5BC 2CO7B 4BSWA 4X7SH 5J3HD 1MWAL 4FQ2H 4ISVA 4OM1L 5K9QG 3QRFM 4HXAL 1X4ZA 2D03L 4QNPE 5DZNA 1FFPB 3IDNA 5F1SA 2B4CC 4HDIB 4IM8A 1HCFX 2B1AL 4CVUA 4HCRL 4RAVB 1BQLH 3QXUA 2BK8A 5T1MB 1PSKL 4LGSB 2HYMA 4WI9A 5F3HB 3HNSL 4HJJL 1WBXB 1U8LA 3QUYD 4OIBA 1EEZA 4AMKL 3TT1L 2IMNA 5F1NA 3EDFA 1BHGA 3F58L 3ULUC 4HW6A 3VGAB 4DUWA 5TDOB 4FQQA 4HUXB 5DHXB 3GIVA 3BEVB 3OKDB 1H15A 1EEYB 1ZK9A 4YDKH 4JPWL 4XNYH 1QO3A 5JXAL 1NCBL 3PJSB 2D9QB 3NPZB 4LVEA 5JW5A 1YEDB 5E7BA 3HE7B 4JDTH 2DQTL 3UO1L 3OAUH 1NKRA 2VH5L 1A7OL 4PJ7A 5L0QC 1LP9B 1MCPH 2VQ1B 3ELAT 1Q9OB 4UUJA 3D1MC 3ULUD 5CEYB 2UYLB 5D96B 4KDVA 3UTSE 5K9OA 4JANB 3JWDL 4TVPD 1MFDL 4I3SH 1RIVH 5C0GA 3MLYL 4G6FB 4LLWB 5CEZH 4WI3A 2PO6B 2WBJB 2Z4QB 4LAQL 3GJFK 1NGQL 2DQJL 3K2MC 4TSCL 3S88L 1LGVA 3FQNA 4W4OA 3FQTA 3HC3L 4NO3A 1BIHA 4PJGB 3KPMB 1KB5B 1Z9LA 5I1EH 4JCLA 2DM3A 3GSQB 4LCCB 3ULUF 1U92A 3RGHA 3VXNA 1I1FB 3LS5L 3NABH 4CU7A 4UDUB 3ULVD 3REWB 1MJ8L 4F9LC 1CBVL 2PNDA 5KSBF 3A6BL 3QDGA 1ORQA 4WDIA 4AL8H 1MRDH 4G5ZH 3IFOA 4D9QE 5DJ6B 4JE4B 2NW3A 3Q5OA 1G1CA 4GAGL 4BSVB 1PZ5A 2EC8A 1RUKL 3HKFA 1G0DA 3G5YA 4NHCH 2CPCA 3QXDA 3QDGD 1UH4A 1NJ9B 3HZVA 3STZA 1G6RH 3NH7L 4KROD 3MRRB 4QOKE 4L9LC 4RBPK 1BIIB 1G7IA 3UPRA 4LRNH 4NZRL 5AD0B 1ORSB 4HPYL 3WNPA 2Q8AL 4QYOA 3CFBB 1U3HA 4P5TA 3BYTA 4LSUL 1B3JA 1LEIB 1XIWA 5SWZE 4NQDE 5TE6H 3D9AH 4HK0B 4MS8D 1VESA 1ZGLB 3OZ9L 4PLOB 1FGNL 3D85B 1P5UA 1RUQH 4PRBB 5C71A 4P5TD 4XXDA 2WBWB 4LCYB 1SYSA 1UCBL 2AV1B 1OSPH 2X4OB 5J12C 4ODUB 5EO0A 2VITA 2DKUA 2PXYC 4AEIL 2KH2B 2WWMD 3P40A 2PW2A 2VZVA 4Z95L 2QQNL 1XF1A 3RAJH 1F13A 4PR5B 5C0EA 1HHKA 4XVUC 1X5IA 2HVJA 3U1SL 3QQ3A 3MNWB 2H8PA 4IOSD 5EOCJ 2Y1VA 1RY7B 2AXFA 3DI3B 2HH0L 5EZOH 5EUOA 1TTGA 1LE9B 4L29A 1RPQA 5F1OB 1I75A 3LN4A 3BQUA 1A4KA 4MVBD 4AEHH 1C1EH 2F54E 2WMPA 1T1YB 1R5WB 2FR4A 4L8DA 4XMKL 3ARPA 4HGWA 4YBQD 1W72L 4HIHB 2DDQH 1S9YA 1CQKA 4I0PA 4PRHB 3PDDA 4BFBD 5CILH 1JGEB 1PG7H 1IBGH 3VXMB 4XVUD 2VR4A 5E2UL 3V79C 1HKLL 2ICCA 4KMQA 3L5WA 3T65A 2V2XB 1FZKB 1P53A 5BMFL 5HHVL 4P4RA 4I0PD 3MLUH 4O9HL 1B4JL 3BP5A 4WWID 3G9VA 4WUKL 5I8OH 4WI2A 2LQRA 2VAAA 2YBRB 3TH2T 3P4OB 2Z31C 1VPOL 3LEVL 3QUKB 1NDMB 4WNQB 5GGUB 1JRHH 3VGBA 3TH3T 4K7PL 4AH2B 5L8JB 1QLFA 1H8NA 5DQDL 4NIKB 4HKZA 4HKXA 3MXWL 1M05B 3VXQA 5HVFB 1VENA 3DROB 2IAMA 3GDBA 4M1GL 1CFVL 1PW3A 2FEEI 3BMVA 4XBPB 4JFQA 3B8YA 3TO4A 4KI1A 3RL2A 2Y9RT 4R0LB 4U6YA 3ULUE 2VE6A 1PLGH 2SEBA 1LEKB 4UT9H 4ZS6C 3B2VL 3PGDA 4P9HL 3F7QA 4OF7A 5IW6B 3WNNA 5KSBE 5JIPA 3RX8A 4NN5B 3U7AA 5EUKB 4UDTA 3TF7C 1TCMA 4FQCH 3QULA 3GIZL 5FDYA 3F5WA 4ODHL 3C5ZC 5CLWA 1INQB 1BAFH 4OB5H 2AP2A 4H1LA 4K9EH 4NRYA 5GJSL 3IDXH 2FZ3B 2X1WL 3NA4A 4PGCA 1RUAH 3QQ9C 3LIZH 5GGTL 2JJUA 5HI4C 2O5YL 5C07B 3MGOA 3VRIA 3VXTA 3ZSTA 4DGIH 1JFQL 4ODBD 1U93B 2VDKH 1WUNT 4LVHB 3OR7A 5EOCL 3C5SA 1BJ1H 5K93A 4XP1L 5CJOH 1B0GB 2NY4C 3BRDA 1KEMH 2VDOH 3P11H 4K3DH 4P0DA 2ATPA 4QEGA 3QQ9D 2R8SH 1GZPB 3RNQA 1KIPB 1OF2A 3UBXI 1CF8H 1KXVC 2HJLB 1QFWL 2NTSP 2Y5TA 4OD2A 4YDIL 4XXCC 5C92A 1DSFH 1UM5H 1MREH 1QFWI 3EIFA 3WNLA 5K33A 1A6ZB 5T1DL 2JLLA 4BFEA 3M8OH 5FO8B 4RQQB 2IPKB 4XMPH 3TPKA 4HG4J 1SM3H 3GMPB 3JTSB 1AP2B 1LDPH 4G6AC 4PJHA 2VDML 3N85L 1JHTB 5HI3C 2X4PA 1FNGB 2JCCA 4DTGL 1BD2E 4QWWD 5TDPA 3ILQC 5B4MC 3FT2B 1JNHB 1DE4A 2CR3A 1A7PH 1RK0B 1HIMH 5IHUH 1WFNA 4BUGA 4IRSC 2QR0B 3QJHB 3BIKA 5JDJA 4S2SA 2HTLC 4HH9B 1KEGL 5KVDL 3SKMB 4G6AD 5BO1H 2ATKA 3FO9B 4UQ2A 1OGTA 4UNUA 5DFVD 2YZ1A 5B4MD 3QI9C 1KN4H 3FFDB 5K9KA 4KDTA 4BQ6A 3G6AA 32C2B 1BFSA 2GY5A 1X5XA 3MOBL 2ZCHH 3EYVA 1W0VA 2ADIA 4DQOL 3CDGB 5IW1A 2HTLD 3WS6C 1LE5A 3CVHL 1QBLH 5DYOB 4XI5C 4WU7A 1C08B 1A7RL 4G8FB 3FO2A 1MIEL 3LH2H 4MXQC 2BDNH 4LCIH 1XF3A 1P2CB 2ZUWA 1ZWIA 4N1HB 3QEHB 3AAZA 1D5ZB 3CH1A 2DLHA 1F4XH 3EYSL 4ONOA 4AIZB 1MPAH 2AJUH 3RUGB 4PJDA 3ZL4H 5KS9A 4DN4L 4ZOEA 5DVLA 3ETBF 1I1CA 2Z35B 1R3KB 3S98A 3LSOA 4JFED 1VSCA 1BX2B 1AGBB 2XWJA 4AEEA 1N0XH 1SY6L 3DO7B 1S78C 4M61B 5HGDB 2JJSA 1A8JH 3HNTH 4A6YA 2IG2L 3OKLA 3RKDD 2CGRH 3DO3A 3LCYA 4KHXL 1Z9OA 3GBLA 2IC2A 2O5ZL 2A77H 3A67H 5GS1B 4RRPA 2A6IA 1IAOB 1Y18B 1YN6B 3AU1A 3D25A 1FJ1B 1YMMB 3ULSB 5J13C 2BP3A 2D7TH 5BVPH 4OLXL 5E7FA 1QSFB 1TVDA 2E6QA 4P2OC 5ESVB 1KPVB 3W2DH 2A83A 4ONHB 5AYUH 1TMCB 2QHLA 3WLBB 1S78D 1AHWB 4MXWH 3ARBA 2UWEA 4WFHE 3L7EB 3S9DB 1F45A 3HZKB 1WCBB 1ACYH 4PGJA 1IGTB 4NNYB 5B3JF 4DKFH 5J57B 5C7XL 4N0UB 1T04A 2B1HL 1R0AL 3NCJL 3ARBD 3VDCA 1P5VA 3DHJA 4QRSA 3VI3F 2PW1B 4P2OD 4U2ZA 4XRCB 1S7UB 3TYGH 4F7EB 1NSNH 1RIUH 3L9RA 5EBGA 2GI7A 1A6AA 1BREA 3DMMA 3QRGH 4P46A 3TJHD 5DHVA 2HLFC 1A2YA 1HHHA 2IMMA 3Q6FB 1MHEA 3GMRA 1UJTA 2FGWL 1FG2A 4F37F 2JTDA 3QCVH 4LLUB 3O4LA 4EQ3A 5ICXB 3NIGF 3DMMD 1A1MA 4P46D 4F37K 4FQ2L 4ETQB 4BKLA 1ZHKB 1HQRA 1QSVA 2MJWA 5IWLA 1E4WH 5L2JB 1QFUH 3D3VB 1QVOB 3QDJB 5HYSG 2QL1A 3O4LD 1BQLL 1KJ3H 2OP4H 1HWHB 4JY4A 1YECL 3TV3L 3OHXA 5MI0C 4JFXB 2KDGA 3TVMB 2VISB 4OZHA 5IV2B 3JWOH 1Q9KA 3RWEB 4PB9L 1N8ZA 2ICWB 4J3WA 5LCVL 5LG1A 2QADD 1I7TA 4R4BA 5F7FA 1OHQA 4N8VG 4LAJH 4GKZA 4M6OH 4X6CB 3T3PF 5ETUB 3EBAA 2FH6A 1GL4B 3MV9E 1M1SA 5A16B 1OT2A 3O45A 4HJGB 4YDKL 1YC8A 4Q58C 3RZWA 3ZDXE 5GS0H 4Z8FH 3BP4B 1MRFH 4XNUH 2D0GA 1UJ3B 4HFUH 4MDIA 1YNKH 3WN5A 3VGFA 3OAUL 5DHYA 4EDWH 1VKXA 5CZVH 1MCPL 3NCYS 4PS4H 4U6XB 2HN7A 2BVQA 4AENB 3LDBC 5C9KA 1Z2KA 4E41B 4HAFA 1QRKA 5FYKD 4GRLB 5SX5K 3EKCA 1CLZH 4LIQE 1HHIB 1I1AC 5J11B 4I3SL 1RIVL 1QLRA 3TPUB 5JR1H 3TN0A 1KLUA 2VLJB 2PYEA 5CEZL 5BS0B 2JE8A 5KG9A 1CS6A 4XCYA 3SE3A 3HG1D 3VFPB 3ZZ1A 5BXFA 1QFOA 4WIQA 2YA2A 4N90D 4HIEA 3TN0D 1UKTA 1NKOA 2EDYA 2NR6C 3MRBA 5I1EL 1WQVT 3PWLB 1I1AD 3FFCE 3EUUA 1EFXB 2ARJA 4QRRA 3NABL 4ETYA 4RISH 5J6GA 2DJSA 4JCMA 1B2WH 2OJZH 4TN9A 4NQCB 1I3GH 4AL8L 4U6HB 5DJXA 1MRDL 1ZT7A 4G5ZL 5C08B 2IALB 4QRRD 4JFEE 5IJVA 5IMOB 2E8YA 3IF1B 4HBCH 4K71C 5C0AD 3TBWB 4Z0XA 1JF1B 3STBA 2DQDH 3MRJA 1OVZA 1TTFA 2AJYH 4X6EA 5BV7H 5B3JE 4OLWH 4QRTB 4F8QA 4P5MA 2OQJB 3F7YB 3V9FA 4ZFZB 4NKMA 4U0RB 1FC1A 3VMOA 4PJFB 4WW1B 2Q20A 1U8PB 3FOMA 3VI3E 1J8HE 1I85A 4LRNL 4PRAB 1XGPA 4HSQA 1AGCA 2UV3A 3HE6B 1C5DA 3HC4H 4XPTH 3VXPB 1UVQB 2FX7H 4C55A 2B20A 4JKMA 4JZOB 1PX3A 2NY0D 4POZD 4D0CA 2N7BA 1JTTA 4WW2C 3G6JA 5TE6L 3D9AL 2EKSA 4FOMA 2BVPB 3PV6A 2EEBA 5FUOH 2IBGA 1RUQL 3KDMA 2E7HA 4BQ9A 2DQFA 4E42A 3O3EA 4WU5A 1OSPL 2G75A 4FFWC 4JFFA 2I9TB 4FP8H 5DZOA 1GSMA 3BAEH 5E2JA 3OAZH 1FL3B 4OAWB 3ISWA 1WBYB 5IBTH 3PWUB 2DBLH 1CDGA 2XNAB 4UTBH 5L9DH 4MWFA 3V6BR 3RAJL 4ZPTB 5D1XA 1FGVL 4JFFD 3KG5A 2NXZB 3ARFA 1TJIH 4NUGH 4P5KA 4OI8A 3CX5K 4LQFH 5C3TA 1BJ1J 2GYSA 1A6WH 2HVKB 5HHOA 4NQSB 3KVQA 2LTQB 5EZOL 5IF0B 3DWTA 3GMQB 5D1XD 5AAMA 1RJLA 2HJFB 3T3PE 1SBSH 4N5UA 1Q1JH 1C1EL 4AEHL 5SWQB 1KCVH 3A6CL 4PY7B 5D8JH 4ZAKA 3WS3B 2DDQL 1D9KA 2NYYD 5HHOD 2IQ9H 4RGND 5I16B 5CILL 5D1QA 1PG7L 1IBGL 2C3WA 3QT2A 5IB3B 4LSRH 2R39A 1GOFA 3ARSA 4PGDB 4YFDB 2N7AA 2BVOB 5HDQH 4WW2F 2QQKH 1JGUH 4ZTOH 5F88A 1T1WA 1ZLUK 3JTTA 4ZAKD 5IBLC 3TIDA 3PXJA 1D9KD 3MLUL 4EZMA 1K2DB 1RZIB 4HKBA 5D1QD 1QR1A 2MQ3A 5D7LA 3KPQB 4G43B 4NDMB 1DQLH 2Q86A 2HA1A 3UTSB 3K1DA 5D71H 4OZGA 5BV7B 1T83A 2NZ9D 3RVVD 1JRHL 1VEMA 5DEFA 4YHPA 5D7LD 3O11B 4NKDB 1UCTA 3GSOA 1WICA 4XCNA 3CXHJ 1U3ZA 1EZVX 4GG8B 5IBLD 2GSIB 1QPXA 2O93L 4G8EA 5T1KD 4KK9C 1TLKA 3MGTB 4LNRB 4PY8I 3RIFK 4A2MA 3NGBC 1PLGL 5MEQA 4I13B 4OLYH 1N2RB 2K1MA 4AQOA 2NY6D 5SWSE 4R26H 3E6HA 1A5FH 5FYJD 3WFBH 5A3IC 4R6UA 4ODWB 3AC0A 3QUMA 4RWYH 2VO5A 3F62A 1ZA3B 3NFNB 2F53B 5CBEB 4FQCL 4WHYG 4QTHB 2YK1H 1MHPH 2JB6A 1TQBB 4LBEB 3HUJA 5GZNC 3IJYB 4N90E 4JFPB 2P8LB 1BAFL 4BYHA 4K9EL 2X4QB 4YHIB 4M3JA 4B5EA 1RUAL 2HFFB 1IQDA 2VR5A 3LIZL 4NWTL 3GJFH 4Y89A 4FABH 2VN7A 4QOKB 3X12A 4K94C 4H88H 1WLHA 4Y7MA 4DGIL 2ICWJ 4ZQKA 3BIBX 3H42L 5EZLB 4PD4J 2VDKL 1IJ9A 1UXWB 3IDIB 2J6EA 2Z93B 1AD0B 3LKPB 5I6XB 3PGCA 5CJOL 1ETZB 5SWZB 4NQDB 4YK4C 1KEML 2VDOL 3P11L 4K3DL 3ULUH 1ITCA 3QUXC 3DBXB 2G5BA 1PKOA 3DX9A 3VH8A 2BNQE 1G9EA 1HQ4A 4UNTA 1HSBA 2R8SL 1S5HB 4LASH 3PL6A 4Z7OF 3ARQA 2DI8A 1A14H 5EULV 2WNGA 2XICA 3H9SB 2IGFH 1CF8L 4Z18A 5CD5D 15C8L 3EOBB 2OI9B 2VKWA 1I7RB 4Y4FC 4YQXH 2Y06H 3VFNB 2CLZB 3KXFB 4ZPVB 1UM5L 1MREL 4GUPA 3HC0B 3S4SG 3T2QA 1IZKA 1VGKA 2BNUB 3PL6D 3H8NA 1SM3L 3KJ4C 1N0LA 1S7QB 2FSEB 3LKRA 1HI6B 4YFLI 4EKXA 3B9KB 1J12A 3MLWH 5EFIB 1G6VK 2EE3A 4KJPC 5DJ0A 3U9UA 1HIML 5IHUL 3BEWA 5ANMB 1LHZA 3LN9A 4LPUA 1XGRB 5DEZA 4WCYH 1OSZB 1NC2A 4Z7UA 2F54B 4I0KA 1I8IA 3H2WA 4L8SC 3MUHL 3RWIA 5MEPB 2X4TA 3K8LA 4JY5H 3AGVA 2R56L 1KTKE 1T7ZA 3NFSH 5DJYA 5I0DA 3S5LG 5BO1L 4S1QL 4NUJA 5DJ8A 3RPKA 5DRWA 4JPVH 5L2KE 3MXVH 1E6JH 3CFKB 1KN4L 2V9QA 1YNTB 1CG9A 4KRPB 2LABA 4QTIH 4AQ1B 3HHRB 4L4VA 4ISVB 3L6FA 2XKNA 2ZCHL 3QUYB 5ESQA 3HFMH 4FN0A 3QQ4A 1A3LH 3EJZD 1H5BB 1QBLL 3V2AR 3KPNA 1IKNA 3CDFA 4LLQB 4L4VD 4Y88A 2DL9A 3LH2L 2BDNL 4LCIL 1TVHA 3RVWC 1INEH 1EEZB 4AJ0A 4JVWA 3AXLB 4OFKA 4TOYH 2P8PA 4X0KA 4J1UA 3OG6B 5CBAA 1AXIB 1P4LA 4LRIA 1F4XL 2UZIH 4WO4A 1WIUA 4UINH 2IQAA 2DM2A 1NAKH 2AJUL 3GIVB 5LGKA 3NBNA 4KGJA 1VEPA 5ITBH 1H15B 3ZL4L 2P5EA 35C8H 1MFBH 3BYYA 1XR8B 5JW5B 2EDRA 2EYRA 1JPTH 4YUEH 4WO4D 1CE1L 4K23H 1LK2B 4ZOAA 5FF6B 4EI6A 3IVKA 4PJ7B 1N0XL 4PJCA 2P5ED 3HNTL 3QIBA 3ZE0F 5FKPB 4GLRH 2CGRL 4ZDHA 1NMBH 5FM8A 5DMGD 2A77L 2IH3B 3FN0H 4I5BA 4ENED 4Q6IC 1G0YR 5C0GB 4F7MB 4GXVH 4CVZA 2DKSA 3MODH 4HWUA 3QIBD 2D7TL 2H2SC 5BVPL 2ARWA 1HYRC 4UOW1 3KHQA 2EDLA 1EDQA 5AYUL 5T1LD 5CJQH 3EOAB 5I1LA 5GGQH 1MFCH 4MXWL 2VLRD 5JUEH 3RGVA 4KJWC 2FJFB 1CTNA 2J5LC 4NO3B 4U7MA 1ACYL 2EDXA 4ZODA 1XH3A 1U92B 3VU2A 5CGMA 3VXNB 3SGEI 4DKFL 3NPSC 5CGTA 2WAHA 1BVKB 4Y1AA 5CWSB 4YR6B 4S1DD 3HR6A 3RGVD 3FB7B 4Z7OE 2H2SD 1CLOH 4U7SA 3TYGL 3QDGB 2B5IC 5D5MA 4U1SA 1NSNL 4P59H 4KROB 5J9PA 3P77A 1M6OB 2NW3B 5C09D 4KAQH 1EZVY 5J06A 1JIBA 3QRGL 4KJWD 4GG6F 4Y1AD 3MOQA 1PZ5B 5D4QA 1ZANH 4MHHG 3WHE0 5J1TC 4HBQA 2IFGA 3KPSD 1MCJA 3QCVL 5FOJA 3O6ML 4N0YH 1JUFA 4YC2C 2XA8H 3TFKD 1BD2B 5GRYA 1W0YT 2EO9A 2EC9T 3ZKMC 4QYOB 4M6NL 3MJ7A 1NGWA 1E4WL 4YO0A 1AFVL 1QFUL 4L9LB 1RULL 1J18A 2R0KH 1J8KA 2OP4L 1D6VH 4TSAH 3T04D 1T1ZB 2QBWA 3ESVF 1QFHA 3JWOL 2Q6WA 4ORGA 1GXEA 2Z8VC 4N0RA 1KULA 4OI9A 1SYSB 1EMTH 3OX8B 3WIFA 4LHQB 4M6OL 3JV4B 3ZKMD 3WJLA 4NFDA 5MENA 2FHBA 3EFFA 3VFWA 5MEOB 2CQVA 2DI9A 4Y4HC 4PREB 2XZQH 3DVGA 4WTZA 1MCBA 4KXZI 3D39A 5GS0L 5J12B 4Z8FL 3DV6A 1T20A 2BFVH 5C0EB 2PXYB 4H1LH 1MRFL 1PFCA 2HVJB 2FLBT 3MNZA 4ELMF 1YNKL 4XCFH 2I9LA 3V6FA 2OR9H 3BD4A 1HILA 4WEUD 1K5NB 2AXFB 4GBXC 4NQXA 4Q2ZA 4PS4L 3QZWA 3U6RA 5T3XE 2OL3A 3RY6A 1QFWM 4JJHA 4L29B 2PCPA 3C9NB 1S7TA 3D39D 4I2XE 2EXYC 4KUCD 5I1HL 1A4KB 3NIFF 1CLZL 4Q7DA 4BZYA 2IJ0C 1JN6B 4HGWB 1NAMA 4GQPH 4Y4HD 1RJYB 4NKQB 4UTAH 1A6UH 3FONB 5JR1L 4NQEE 1G7HB 1NBVH 1X7QA 4HWBA 4UB0H 3SDAC 1E4KA 2DQEL 5HYSB 1JJUA 3GSNH 3T65B 3RWJB 3TBTB 4KPHH 3MA7A 4P4RB 3SHSA 3ZE0E 3NFPB 2UUDK 1AO7A 3BP5B 4L4JA 4PG2A 2CK2A 3ESUF 1F6AA 4N8VB 3O9WC 1DDHA 1MUJA 4CRPA 2VAAB 4JM4H 4UILH 1NBYA 5DFTA 3V4PH 4RISL 4X8JB 1EGJA 1B2WL 2OJZL 1VA9A 5GGSY 3MLTB 1I3GL 1AO7D 1MCNA 1HK6A 4H0IA 2D3VA 4DFIA 2JB5H 4Z76A 3HI1B 4NCC1 4XPFH 5EC2B 4BK5A 3RHWK 1RZ8A 4IIQA 5IB5A 3PWPA 2DQDL 2AJYL 5BV7L 4JFQB 4LIQH 1UKQA 5INCA 3RL2B 4U6YB 3OAYH 4OLWL 1KB9K 2SEBB 5DUMH 3OWEA 4PTTA 1QQDB 1NBZB 4CW1A 3PGDB 3BP7A 5E8NA 3K8MA 3LKQB 3Q0HA 1BBJA 3PWPD 4HWZB 4H5SA 5FO9A 2HFGH 3HC4L 4XPTL 2FX7L 2YR3A 2I07A 5BW7C 5E24E 5E56A 4GG6E 4RA0C 2ZWLT 3C08H 4H26A 3F5WB 1ZSDA 1BQSA 2R2BB 5B39G 1U8NA 4QT5B 1GZQB 5E1HB 1L0QA 4NKOB 2VLRE 2HFEA 2YD7A 5FUOL 3V6OA 4H1LB 4NRYB 4X7EC 1Z9SA 5JMOC 3GJEB 4CL7A 1KENL 1EEQA 4EOWH 1ZVSA 3C5ZB 3TA3A 4FP8L 4LKXB 5H94B 3BAEL 2XWTA 3MGOB 1R3HB 3BSZH 5IBTL 3UEZA 2DBLL 3L3JA 4UTBL 2EDQA 5L9DL 4XNMA 1BOGB 4HKJA 2Y5EA 4QXUH 4MD0A 1KTLB 3LV3A 3C5SB 2ZUYA 1TJIL 4NUGL 1RZJH 3GI8H 5C09E 2GJ6A 4LQFL 1OTSC 2H3NB 4LP5A 4BUHA 4C83A 1A6WL 2IPTH 4OGXH 3FMGH 5C0IA 5GGVH 4OZIA 1FZOA 3KPSE 1A9EA 1S9WA 3FB5A 4OKVB 1L9MA 1SBSL 2NY4B 3DRTB 4HUNB 1Q1JL 2H32A 5DK3A 1UWXK 2VQUA 1KCVL 5D8JL 1GAFL 2C26A 3HB3C 2IQ9L 4EVNB 2XN9A 3RVXC 3LEXA 3AROA 4LSRL 2C4XA 4PJBA 4OBRA 2ESVA 4ELME 3BDYH 2MCPL 5HDQL 1YY8B 2QQKL 2I24N 1JGUL 4X7DC 4ZTOL 3GBNH 3FT3B 1IGJB 1TJGH 1JV5A 5F93C 2X4PB 2JCCB 5TDPB 5DK0B 4U1JA 5B8CA 3C2AH 5ECJE 1BQHG 1DQLL 3NIFE 2ESVD 4JZNA 2LU3A 4OTXH 5D71L 4S2SB 4MQSB 5BQ7A 5TPWH 5KSAC 3TBSB 1CLCA 3TNMA 4WHYH 3WO3B 5A2IH 3LEYH 4K7PX 3O81A 1IEAB 1OGTB 2D31A 2OMNA 4PRPE 1KLFA 4ZS7H 1WWBX 2ITDA 2YMXH 1KCUH 3QG6B 1CDIA 3V4UH 5I9QC 3DXAD 1QKZH 4PJXF 3VWKA 3DHMA 5M94B 3TO2B 3EYVB 1W0VB 4JM2C 3JVGC 3BO8B 5SX4H 3FHQA 4U1GB 4Z7NF 1MY5A 3QI9B 3QPQD 4OLYL 5DHVH 2ZOLB 2IH1B 3FFCB 2C1PA 4WU7B 4LPWA 3GRWA 4ZOCA 4F7PA 1I7ZA 3FO2B 4R26L 3RRQA 3FJTA 3KPRA 5C0DB 1A5FL 3VWKD 3DARA 5J56B 3T2OA 4RWYL 3QISA 1SVCP 5AG9A 5C2UB 2CUMA 3H3BC 1TETH 4M02A 1ZWIB 1RMFH 5FCUH 5HHNB 4X5XB 1HEZB 2V5MA 1YYLH 3EZJB 2YK1L 4JFEB 1MHPL 5F6IB 4L3EE 5KSVA 3IDJB 3KPRD 2E8ZA 5HHXL 4JM2D 3QIUC 5KS9B 1E4XH 2BY1A 4ZUVA 4JB9H 4PV8B 4WRLA 1A4JB 4R96B 2I27N 4FABL 1J11A 4H88L 2X9XA 1P7KB 1A22B 4X6DA 4BH7B 3CCHA 2XWJB 1UACL 2E27H 1J8HB 3JUYA 2WBKA 5J7CC 3AS0A 4BZ2H 4L3AA 3GK8H 3OKLB 1II4E 5F9DC 2XT1B 3RX7A 4X98A 4DJMA 3CXDH 1ADQH 3UZQA 1S7XB 3ULUL 2WWKO 3S35X 5FYKH 1FO0H 3ZO0A 2E5EA 3AU1B 2YN3A 3D25B 1I1YA 3QAZC 4JM2F 4LASL 1A14L 5F7MC 2IGFL 2R2HB 2A83B 4YQXL 2Y06L 2XYCA 2IF7A 2HKHH 4YXLH 4NRXA 1YEKH 3VD9A 3ARBB 4IMKA 5J13B 3MRGA 3ZKNC 2NX5A 2PF6A 4P2OB 5FM5O 3QB7C 3DVNA 3VD4A 5ACZB 4LSQH 1NDGA 4JN2B 2DB8A 1WZKA 1WAAA 4YAQB 5JW4M 1AJ7H 4F3FB 4XP6H 1RFDH 1PKQA 1F4YL 3MLWL 3TIEB 1SJVA 1ZS8A 1IM3A 1YEJH 2NX5D 1XCQB 4GKSB 1EHLH 5HHPA 4WCYL 5C0CE 1A6AB 1F90H 2A6DB 3DMMB 4MAYA 4RMQA 2RBLA 3WL9B 4JY5L 1R24A 3DTXB 5MP6H 5DHVB 1K4CB 2BMKB 1HHHB 3NFSL 4X6FA 2GTZA 1G7LB 2IPUG 1FG2B 3VFGH 4JPVL 4PIRF 4MDJA 1A9BA 3MXVL 1E6JL 4FQHA 3VXRE 1UH3A 4QTIL 5DVMA 1A1MB 3WHXB 3QH3A 4APQA 4P2QA 4BKLB 3EAKA 3JWDC 3HFML 1S9XA 3LD8C 4GRMB 1A3LL 2ADJB 5HPMB 2QADB 4JQXC 3X3GH 3IFPA 4EUPA 1HNGA 4NBZB 5EU6E 4XWOD 1FPTH 2R9HC 1HSAB 4APQD 4JY4B 2ZCLH 4P2QD 3S4SB 3GSXB 3BISA 3EO0A 5F7DB 1INEL 1N8ZB 5ILTH 2AEPH 4TOYL 1I7TB 4R4BB 2DIJA 1NCUA 1O7VA 3EFDL 3MV7E 4GKZB 2UZIL 2X4UA 4UINL 4PJXE 2V2WB 1WT5A 2BSTB 4Z7VA 1NAKL 1DUYA 4HMDA 3O45B 4Z7NE 3ZE1F 35C8L 1MFBL 1F97A 3QWOA 2R9HD 3RFZC 1JPTL 4YUEL 3T0BA 5IKCB 4OT1H 1NFIA 5F70A 1FO0B 4K23L 2GFBA 4U1IB 3P73A 3WN5B 3C6LC 5DHYB 3OKOA 2MHAB 5KSUA 2NPLX 2BOBB 2HN7B 3S5LB 1KIQB 2YD8A 2YPVH 1T03L 3D18A 3HG1B 4J2XA 1NMBL 3CGTA 1BFTA 2XRAH 3FN0L 4M7ZC 4E5XA 4PLKC 3DXAE 3MJ9H 3SPVA 3SKNA 2J3SA 1KLUB 1IC7H 3LDBB 5JHDA 2VIRA 4HS6A 4LCUA 4EDXA 4U3CA 1I1AB 3C6LD 2NW2A 3ZT7A 3CDCA 2FJHA 2OZ4A 5D2LF 1KBGH 5CJQL 1NGZB 1KJMA 4XHJC 1MFCL 2VZUA 2AJZB 2EEAA 5JUEL 1LILA 3BKJL 5JHDD 2J8OA 4ODTH 3MRBB 4JEGB 5FO7A 5IP4A 5INDA 3HNVH 4XTRC 3OB0H 4PLKD 2F58H 2B0SH 2Y36L 1J7VR 3BPOC 1S7SB 4RA3A 4XPGH 1ZTXH 3QNZB 4XNQA 5J6GB 5C0AB 1MCFA 3WIIH 1W8OA 1CLOL 1FCGA 3VD3A 1KPUA 5DJCB 2FJGA 3AS2A 4E0RA 2V17H 1GOHA 4FQLH 4K7PY 1MQKH 4CUCA 4KAQL 4Z0XB 3ECBB 4LSTH 1ZANL 2DMBA 4MJ6A 4K3JH 1JZ7A 1EAPB 4NO0D 4XTRD 3WJJC 4FZ8H 2RCSH 2NY0B 1FFOA 3DETC 3EGSA 4NKMB 4K71B 1G7PA 4N0YL 1QSED 1B88A 4M7KH 2GJZB 1XGPB 3WJJA 1Q38A 4JRXA 1OP9A 1F4AA 3PQYA 5FYJH 1MCCA 4GKOA 5C6TH 3VRLF 1NFDE 2R0KL 4UIKH 5E9DA 1D6VL 1EAJA 3KS0J 4TSAL 1DUZA 1X4XA 5DC0A 4ZSOE 3OL2A 3PV6B 2FECI 1VFBB 4P57A 4JRXD 3PQYD 3B2UC 4WU5B 1MCWW 3LQAC 1EMTL 1LEGA 4JFFB 1X5LA 5E9DD 5L2KB 4MA3B 3RX5A 4M7LH 2XWBA 4XGZA 4ONGL 4MMXC 5EBLB 5E6IA 5F7KC 4J3XA 5FYLE 1T0PB 4D3CH 4HIXH 3I02A 1NEUA 5E2TH 4MWFB 2XZQL 5HVGB 5D1XB 5GRVL 4GSDH 3HAEG 1YN7B 2BFVL 2ICEB 4FRWA 4UIMA 4KMLB 3IAPA 1UB5B 1XF5A 3CUPB 4XCFL 3S97C 5JOPD 2OR9L 3IDMA 1QSZA 3S37L 3AMKA 4GW1A 5HHOB 4RGNB 4HGMA 3BMWA 3JV5A 5E2WH 3CSGA 1N6QH 1CI5A 1RJLB 2A74B 2C4FU 4G9FE 2YOCA 4BM7A 3WNKA 2YRLA 3PWNA 4IRZH 2MMXA 1L4IA 3IDGA 4UTAL 3AB0C 1A6UL 4ZAKB 4LKCA 4K94H 3HZYA 3RVTC 3MCKA 3SQOH 3I6GA 3ZE1E 2AKRA 2CLVA 5E4EC 4MX7B 4EN3C 3SE9H 2ITCA 2R23B 3U7WH 4XHQA 1T1WB 5HSFA 1IC5H 4KPHL 3CH8A 3JTTB 3TIDB 4KFZC 1SVZA 2F74B 4R2GD 1BZQK 4MMZC 4GAJH 2L7JA 5DRZA 2FO4B 4BQCA 4JM4L 3FAXA 4UILL 4UV7H 3V4PL 3QEUB 5JOFA 3KLHC 5T1KB 4M62H 5DEFB 3UTTE 4LSSH 2VLMD 3MRQB 3ZKQD 2JB5L 4JQVC 4HPOL 5D2LE 3WXWH 1X5KA 3P0YH 5T3XH 4XPFL 2EYSA 4HK3J 2CRIA 2EIEA 2NY6B 1NGXA 4G8EB 1XGYH 4HT1H 2P47B 3ARGC 1F2QA 4Y2OA 4LIQL 3ALPA 1ZLWH 1RVFH 3MLXH 5DGQA 3S36H 5DUML 5MEQB 5DC4B 1VHPA 2FATH 2XQBH 3B9VA 3E6HB 4JFZH 1TTUA 1WISA 2BSSB 2HFGL 2O61A 3D0LA 4A2LA 4QXGH 3RNKB 3GGWB 3HI5H 3LS4H 2W65A 3C08L 3OXSB 2APWA 4HQQH 1I3UA 2IANE 3ARGD 3QHZH 5J89A 3VJ6A 3I6KA 5DK2A 2Z91B 5F9OH 5EO1A 3M17A 1U8QB 4EOWL 2NY2C 1T6WA 5IG7B 4FZEH 1WBZA 1FYHB 3MV8A 3P4MA 5TE7H 4P99A 3X12B 5ALBL 4CVWA 5JA8B 3BSZL 2KUTA 4L8CB 4Y4KC 4ZQKB 1JF6A 1XGQB 1MCDA 4QXUL 4WFED 1FNEB 3VRLE 4LL9A 3MTRA 1IGFH 4M1DH 3MV8D 1RZJL 3GI8L 1TPXC 1YA5A 4PJAF 3PNWA 4KK6D 4FXKB 2IPTL 3FMGL 2G5BB 5GGVL 3VH8B 5IFJB 1YEEH 2NY2D 1HSBB 3S34H 4TUOB 5DD5H 2ZP0T 5SV3A 4YK4B 5H2BB 4ZFGH 3QUXB 3BPNC 1QSEE 3L3GB 4PGEA 1QBBA 4URTB 3T4YB 4J3VA 4F33A 1VGKB 2A38A 3S3SA 2CUHA 3CFEA 4DUXA 1T89A 4OGYH 1PG7X 3MBXH 3MO1B 2WIIA 3VXSA 1P9MA 3IRPX 3BDYL 5IHLB 1DQQA 3GBNL 4U1MA 4PJ5A 1TJGL 1T2QL 5B39B 1AR1C 1HZHH 2E7CA 2DMKA 3C2AL 3KJ4B 3TCXA 2W59A 3VXSD 1GGCH 4L1DA 4OTXL 1V8HA 2NNAB 3L5JA 4PJ5D 2XPGB 5TPWL 3MGAA 4M4RA 4TTGA 4BZ1H 4K8RD 1WGOA 2X4TB 4GAFB 1C7SA 2J4WH 4YHZH 3KYMA 1H8OA 5I74C 1AXTH 3LEYL 5DJ8B 3OGOE 4LU5L 3UROR 3RIAF 1E0OB 4L8SB 3GSUB 1AR1D 2YMXL 5CJXC 1CN4A 1KCUL 5ESAA 3V4UL 4JQIH 4QRQB 3L6FB 1QKZL 4QRPE 1T5XB 2HJKA 5ESQB 4IJ3C 2M26A 2HG5A 4PG9B 3DRQA 5CD3A 3MACH 2OSLB 3KPNB 4LEXH 2VZ3A 1WEJH 1Y6NR 2A73B 1TVHB 2BCKB 1KCKA 2DD8H 4HUMB 3GMLA 1UWEL 3FRUA 5D70L 3HTLX 3G5ZB 1TETL 5TH2A 3RWFA 1RMFL 1ZT4A 3WNOA 5FCUL 2NCMA 1WTLA 1YYLL 1IRAY 1MHHA 1JPFB 3BXNA 1SBBA 4WO4B 4J3OC 4LDOB 1H0DA 2CSPA 3VDAA 5ELIA 4YGVB 3OKEB 2DL2A 3FQXA 1E4XL 1YEIL 2P5EB 1BQHB 4LK4A 2PO6C 4PYGA 1J1PH 1CLYH 1FYTA 3PDOA 4Y2DC 3K4DA 4NJAH 3DX8B 2E27L 5KAQF 1DBKL 4BZ2L 2Y07L 3QIBB 3G04A 1AI1H 3GK8L 4CVXA 8CGTA 1YPZF 1FYTD 2A1WH 3EO9L 3QDMA 3CXDL 1ADQL 4LSDA 3S3PA 1F11B 1A21A 3IJSB 5T1LB 4OJFH 2VLRB 2OJEA 3BGMA 5FYKL 1FO0L 4PJ8C 1JGDA 4CVZB 4X9FA 3BPCB 4P3WA 3BJ91 1IT9H 4Y2DD 3MUZ1 2P44B 3QDMD 4Q6IB 4YXLL 1YEKL 1LP9F 1N4XH 4OKDA 5J0BA 3GSVA 5GRZA 5IB4B 2ZUXA 3BW9A 3IJHB 4P2RA 4Y5YC 5C8JA 4N5EC 1NAMH 2CIKA 5HY9B 1HDMA 1AJ7L 5LAXA 2KKQA 3L5XH 4JFHD 4XP6L 1JBJA 5C09B 1RFDL 3SGKA 3PABB 4Y1AB 4HG4K 3IS0X 3HMXH 2D7NA 1YEJL 3DYOA 4DWHA 3AREA 3KYAA 4P2RD 4KKBD 4RFEB 2EDNA 3KPSB 5D5MB 4U1SB 3RWGB 4XZUA 2Z8SA 3P77B 4X7TB 1DN0B 3VE0B 5MP6L 5DJDB 4HHAB 2B5IB 3ARED 4XP9H 1I4FA 4NZDA 1X5HA 5E0QA 2OTPA 3VFGL 2VL4A 1PAMA 1BLNA 4ELMB 4OD3H 5GS2H 4LEOA 4C56E 4OZFG 3L95A 4TRPH 3HPLA 1YEHH 3MJ7B 2C3XA 4YO0B 1IL1B 3X3GL 5BZWA 1EHXA 3HR5A 5IB2B 3TZVA 1B6UA 5JW3H 1FPTL 4YC2B 3N0PB 2ZCLL 3OJDA 4JAMA 1K8IB 2YWYA 4MD5A 3EYOA 3CSPA 3VFTA 5ILTL 3GFUA 2AEPL 1MNUH 5KN5B 1CDHA 4FFVD 2ZNWA 4S1SH 1UWXH 2E7LC 3TZVD 1V7NH 5HYJA 5F7EL 1ERNA 1QP1A 4KK8D 4L4TA 1DEDA 3EFFB 1D5BA 1DANU 1T20B 4HZLA 1J05A 5HYJD 1TNNA 4OT1L 3MNZB 4L4TD 1JYNA 1YY9C 5F9WB 1L9NA 1TITA 2A9MH 2P5WE 4Y4HB 5IB1B 1TZHA 3SJVE 1BP3B 1F3DH 3N1PC 5T3ZE 2D7PA 1UEYA 2YPVL 2PCPB 4ZNEA 3R0NA 5JIKA 1P1ZB 1MEXH 2XRAL 1MVUB 2VMFA 4G9DB 2HP4A 4GBXB 1NAMB 4P4KA 3ILPA 3MJ9L 1UFUA 3T4AB 1U6AH 4NM8L 1X7QB 3UBXG 4V1DA 4X4ME 3CFJA 5D72H 1YY9D 1J1OL 4JVUA 7CGTA 2CDEA 1Q0XH 1SJEB 4JO2H 3MA7B 3SDAB 3HLAB 4DZ8A 4JZJA 3C6SB 4R0LC 5JPMA 1YPZE 4KK5D 4V1DD 3VWJA 3BP6A 3HNVL 5DRXB 2AS5M 1FG9C 4ESKA 1F6AB 2F58L 2B0SL 5C0BA 5E6ZA 4XPGL 3X14A 4JREC 2GAZB 3WIIL 4MNQE 3KPTA 5I1IH 3SE4C 3VWJD 2V17L 4HJ0C 1SMOA 4GJTB 3ZLQC 1FFNA 1LP9E 5C0BD 3MUGB 3WFHA 1RZ8B 4IIQB 1QA9B 1RJZA 4LSTL 3SDXF 1JHKH 4K3JL 2W07A 5INCB 4YFEA 4LLVA 4FZ8L 5LXGH 1KTDB 3QEQE 3CC5A 3C09C 3WCYA 4I4WA 4Y5XA 2PTTA 4X6BA 5D7JA 1XF2B 4KMTH 2VB5A 5DD3H 4M7KL 1GGIH 4KZDH 1DQJA 5TF1H 2R15A 4H5SB 2H1PH 3KAAA 4MJ4A 1B0RA 3U30B 5JPNB 3GSRA 5FUZH 3RPIB 1A1OA 5FYJL 5C6TL 3X3FH 4W4NA 2QSCH 5D7JD 3I3BA 2YEZB 4YEEA 1U8NB 1UM6L 4R90H 2CKBA 4DVBA 2G60H 5IQ7H 5EH1A 1SQ2N 3HRZB 3GRWH 4WY7H 2P8MA 3DJ9A 3GBML 3LZFH 3ME0A 3GEWB 3KNBB 3T0EC 2VLKA 4PGBB 5EZIH 2A0LD 3VXRB 2XWTB 4M7LL 2P48B 5IFAH 1CGVA 1KSRA 4JHWH 4D3CL 4HIXL 3FQRA 4NYLA 5E2TL 4NPYA 3ZT5A 4YPGB 1KG0B 3IXTB 3OJVC 3LV3B 4GSDL 3EDKA 5AZ2H 3U36B 5L6YL 2APFA 2VLKD 4XH2B 3UPAA 5EU6B 2DOCA 1RZFH 5KAQG 3FQUA 4MCZA 4U3HA 4OUUA 4WWKA 5FA4A 4OZIB 1J87A 5E2WL 4ORZC 1HWGB 1A9EB 1N6QL 2XTJD 4G8GA 5I1DA 1MI5D 5DRNB 1YDPA 4QCIA 4IRZL 4M6MH 4PJXB 1YJDH 4HS3A 2NY5L 4PFEA 4BFIA 4XAKE 4WWKD 3WFCH 3SQOL 4UU9A 3LEXB 3MRPB 4G8GD 2WIMA 4XNZB 1UB6A 3SE9L 3IETA 5I8KH 2W1NA 3U7WL 4KKNA 1GGTA 1JV5B 3O0RL 3ROOA 2GKIA 5BRZE 4PJEA 1OTTC 1CFSB 4CN1A 2H6PB 3DX6A 4D8PA 2C1OB 3TBYB 2L7UA 4RFOH 5FYLH 4MJIE 1FLRH 1MWAH 3BZFB 4UV7L 3WO4C 2EDTA 2F5AH 4M62L 3DXAB 3TNMB 1X5JA 5HHME 3CSBA 2X9WA 4LSSL 3VCLA 2VXVH 3DUSB 3WXWL 2G2RB 5KSAB 3P0YL 2ITDB 3T09A 4ZUTA 4GKNA 4W6XB 4ZXBA 4PYHA 4V2CB 4AMKH 1XGYL 2V7HA 3VWKB 4M6AA 1D6EA 1UENA 3MLXL 2R1XA 5H37G 3S96B 2BY3A 3DLQR 5F3BB 2FATL 2XQBL 4GMTH 1NLBH 1KYOJ 5I9QB 4ZXBD 4F7PB 3VXME 3KPRB 4JPWH 3MRFA 4JM2B 1NCBH 1DFBL 4F58H 4QXGL 2X9YA 2AK4A 2YWZA 4DUVA 4OCWH 1IEHA 3HI5L 3SCMA 4HLZG 4WVRA 3FZUC 5AWNH 2G9HB 1E28A 4JVPA 4HQQL 4UT7H 4XPHH 1Q72H 3SDXE 2R1YA 3GMMB 5GS1C 5KSVB 3QHZL 5FKAB 5CSZA 1K8DA 1OTUC 2AK4D 1MCKA 3JWDH 5I1KH 3B9DA 3SCMD 1MFDH 4NZJA 1PEZA 5FYKU 3MREA 5TE7L 2M1KA 5FV1L 3MLYH 5DS8A 1WITA 1YUHA 3W9DA 2HMIC 4U1HB 5DO2C 3SKJH 1PQZA 5LBSH 5DT1H 1Q0YH 5IVXA 4HD9A 5EN2B 1IGFL 4IOIB 2YC1A 4LSVH 4M1DL 2XZZA 4X98B 5JDSB 3VXUA 3QWQB 1WZ1H 4ZUSB 3AFLA 3FO0H 4DCQB 2YRZA 4I1NB 1LNUB 1V7MH 1OTUD 3BX7C 4ZSOB 4PB0H 5DD5L 4W6YB 3M07A 2JJTC 4BSJA 2VZ1A 5E5MA 5EZJA 3VXUD 5DTFA 1I3VA 1IGYB 2HT2D 5D6CB 1NC4A 1OB1B 6FABH 3QAZB 5ERWB 4S10A 2NX5B 3MBXL 3KGRA 2JJTA 3W0WA 4MCYB 2X5PA 3DVNB 1HHJA 1OD7A 5IESH 5GGSA 3MMEA 1RUKH 3F12A 4YFLF 1EJ6A 4JPKH 4FQXC 1NC4D 5H35B 1HZHL 3QXTA 4N68A 1GPOH 1L7TH 3SKOA 3O41A 4D2NA 1GVIA 4QY8A 3W0WD 3SBWA 5C07E 5HTSA 5HHPB 1QUNA 1GGCL 1CICC 2XKUA 3DUUA 4FQXA 4HUKB 3U46A 4PP2A 2OLDA 4BZ1L 2ZKHH 3H9YA 3LKSA 5HHQA 2J4WL 3LPWA 3TVMC 1R24B 1IEBA 4OCXH 2AQ3A 3KLAB 3BWAA 4NNPH 4Y16A 5I2IA 1AXTL 1IM9D 2W0FA 4X6FB 4D0BA 5CHNB 5F8QC 4L3CA 4TNVK 4MDJB 4FQXD 3D48R 5BZDA 2DJ4A 4JQIL 4P2QB 3BH9A 5HYQA 4U7KA 3MQIA 3X11A 3CXHK 4Y16D 3MSPA 4HIJA 4OQTA 5CGYC 1S9XB 3T0EE 1MI5E 3KYKH 5CFHA 3MACL 4LEXL 3QXWA 4F80A 1C12A 3P4NB 2QQNH 3E6FB 4AT6A 1M7IB 3OPZH 3H7BA 1WEJL 3D2UD 3H9HA 3EO0B 3LD8B 1MJUH 2DD8L 5D7IA 2W38A 3T0AA 5A2JH 3OJMB 2AJVH 3UTTB 2FDBP 5TGBB 1FORH 4GRLC 3UMTA 5D2LB 1ZAGA 3D69B 3WV0A 5EG6C 5FB8A 3GZKA 3QWOB 1IZJA 1CLYL 1J1PL 3BGAA 5HDBE 3ZDZF 5JORA 3FB6B 1CXKA 4NJAL 3P73B 3P9LB 4LCWA 3K1KC 3SY0A 4X83A 3RY5A 2V5YA 2Y23A 5DGRA 2HTKD 3T0VA 1V3KA 1AI1L 1F3DJ 3D18B 1S7WB 4R4FH 4X6CF 2A1WL 3C6LB 3LQAH 5MERA 3ROLB 1XGUB 4LCWD 1MFEH 4OJFL 1B4JH 3VRJB 5E5RB 3SKNB 3T2PA 4AIOA 3G08A 5EO9A 4LQ1A 5HGHA 5JHDB 2VDPH 2VIRB 2NXYD 1JCKA 1FSKC 2UZYB 4WUKH 5D7SH 4JPIA 4AZ8A 1PEWA 1T22B 1N7MH 2NW2B 3CSYA 4J4PA 1XAUA 4YHKH 3W9EB 2FJHB 2AABH 1KJMB 1N4XL 2FYYA 3D0VA 1NFDA 3DX7B 1FNLA 5IHZB 3VDBA 5FDWA 3W82A 1NAML