2AQ3A

Crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor beta chain V
total genus 27
structure length 109
sequence length 109
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aq3A00
1KJ2L 3TBTB 4XGZA 5DS8A 4YX2L 3GBNH 1BM3L 5FDWA 4P57A 5C7XH 3TN0A 1PZ5A 4CVXA 1J0KA 1ODAA 4HXBL 3LDBC 3W9DA 35C8L 4DN3H 5A2FA 2VDML 3UTPE 1YY8B 2L7UA 3UTTE 2ZNWA 4HIEA 5I8KH 1RSFA 4S1RL 5DHVA 2H8PA 3GI8L 3L3DB 5E0QA 1I8MA 2AKRB 2NXZD 3BQUB 2VL4A 4PJHA 1LE9B 3VFUA 3IYLW 5BV7B 3O2WH 3X12B 4DN4H 4PJCB 2GFBB 3VRJA 5F89B 5LAXB 5E6IC 4YBQD 5I1LA 5FHBL 5TE6L 3BEVB 1FVCB 1ULVA 3MRRB 1JFQL 4JANA 5DK2A 5DUPL 2XV6B 3SJVD 3KGRA 2VDQL 2BDNH 2HA1A 1KEML 2EO9A 3BPOC 2PW2A 3EJYD 3VXRE 3THML 5J13B 2D4DA 1ZGLB 2W0KA 3K4ZA 1MIEL 2FECL 4YGVB 3SPVA 3KR3L 4P9HL 3AFLA 3IDMA 3U7WL 2FJHA 4QYOB 3QCTL 5D7JB 1YEIL 4HZLB 5TF0A 4YBLC 2KZ1B 5GRVK 5DEGA 2YMXH 3EFDH 4WI2A 1FFQA 4I48B 1RK1B 3GBML 3AXLA 3LMJH 2AXJA 4KK8D 3TT3H 1TVHA 4LNRA 1N7MH 4R8WL 4JAMA 4M8QB 2GITB 2XG5A 2NY0B 4X9GA 3T8XB 1UB5A 2BMKB 3ZYIA 2QBWA 1EEUA 4HPOL 1JNLL 4X83A 3D3VE 3GNMH 2LE9A 1MI5E 1WEJL 4Z7OE 4PRHE 3E8UL 4OZ4B 1VACB 3PP4H 4GRLA 3S37X 2DOCA 4LGSB 1AKJD 4RMWA 3ZTJH 4JHBA 4LCUA 3KPSD 3ULUD 4X4XB 4HS3B 4M6OH 3MRPA 1INDL 3OB8A 1V3KA 3H6JA 4BA8A 4WW2C 1F00I 5CEZE 1YNKH 1DVFD 5I73C 1OAYL 2VH5L 4NFBA 3LKQA 1R5WA 3TJHD 3DX6A 2YS4A 4GLRI 2VH5H 4X6CE 5FYKH 3FT3B 3TNMA 2B4CH 2JELL 3CVHB 1T22B 2DIJA 4N0FB 4JFYB 4QNPE 4WUUE 3SY0A 3PGCA 3RZCA 4FQ1H 4RAHA 4RAVA 4CJ1A 1KJVB 3ARWA 3GSQA 1UXSA 1BD2B 4FQ1L 3LKRA 3CZFA 3NIGF 5FYKD 4PGZA 5E8NA 1GGIL 1DANT 3RUGE 4ZUWB 2V7HA 3OWEA 4UV4H 2X4QA 4KKCC 5CJ8A 3LN5B 3A67H 1XFPA 5SX4I 1U91A 4YHZL 5I1IH 5DJYB 3P9MB 3U6RB 4NCC2 3IETB 2F54A 4JFQB 4JB9L 1BOYA 4Z95L 4JM4L 4MVBC 1KIRB 5BS0E 4D9RE 2NMSA 2PXYB 3NH7L 4YXKL 5D1QA 3SDDB 1XMWA 2WLZA 5B22A 4JFDE 1A02N 2CLRB 2DJ4A 3QT2A 3BDBA 2J5LB 1EVTC 1KJ3L 4LPYA 4JQXA 2EIZB 1HH9B 4G6ML 2IJ0C 4Z18A 3WN5A 3BW9B 2R69L 2Z9TA 1VHPA 4MS8C 2AXGA 3T3ME 1YN7A 4LDOB 1CFNB 2VZOA 1O7VA 4L1DA 3MGTB 4D2NA 4N90E 3CDGA 1CGXA 5HI3D 5I0DA 2XQBH 3HPJB 5F3BA 2HLFD 1RPQA 1WAAE 2NY1D 5EUKB 1OF2A 1EGJL 4I2XA 1WICA 5D93C 1T89A 1JPST 2FGWH 4GBXB 4PP1C 3C6LB 3HR5B 4KRLB 1KLGA 1AXTH 4HWBA 3C08L 2D3VA 4H5SA 4PG9B 3DLQR 2GTWB 3LRHA 1F3JA 3CLFL 1OGAE 2GAZB 4OI9A 2YD1A 4UT7H 2C3GA 5IW3A 1UFUA 4F3FA 2GJZB 4LVHC 2X9YA 4KAQL 3VE0A 2J8UF 4RA3A 2C5DC 2G75A 4G6FD 1XR9A 1XCQA 3WFCH 5C9KA 3ULVF 3I50L 4KTYA 4RZCB 1Q9WA 1DE4A 1Q94B 5F9JB 4O2FA 5HYSG 1AFVH 5C0FA 2RBLA 1AJ7H 3ZE0E 3V6BR 4S1DD 2DQGL 1A2YB 3TCLB 4JFEB 3BRFA 1INQB 1AQKH 4U7SA 2D0GA 3MLVL 4Y2DD 5CIPA 4PRPA 2DQGH 2P8MA 4Z7WA 2FX8H 1QQDA 1XF3B 4HUXA 1IGMH 3ZYOA 4ODSL 4DK6A 2BK8A 1RJLA 4RMQA 3U7YH 1S9XB 2ICES 3D0LB 5DMGD 3V52L 2HFGH 2VN7A 3MJ7B 4CU7A 3RWGA 4I3RH 1QSFB 2Y36L 3TBVB 4KROB 2MKLC 2DQJH 4PB0H 5C0GA 3T0VA 1I1YA 2FR4A 4PJDF 1MY7A 5J11B 5LWYH 4G8FB 2A6DA 3ZTNL 4BUHA 3BUYA 1UVQA 1AQDA 1LO0H 4OM0H 3MV7B 4EEEA 1XF4A 2Y7QB 2XY1A 4DZ8B 2QKIA 1K4CB 4A2LA 4HX1A 3WIHH 3CSPA 3Q3GB 2ZSVA 3JV4B 1A3RH 5GZND 5B8CA 3U36A 3FONB 3V6OE 4AIXA 1QFPA 1CXKA 5E6YA 1NCAH 5FV1L 3S5LG 3JV6A 5TDPA 5CGTA 1KIPB 1D5ZB 5GSVA 1I1RA 4B41A 2EDRA 1ZWIB 5FECB 4TRPH 3KHQA 4O4YL 1KC5H 2IAMD 2WNGA 1HYSD 2YRZA 5E2JA 5C07E 4UNTA 3CFKA 1JF5A 2KQNA 3PIQA 4XMPL 4M6ML 1A0QL 3OR7A 3TVMC 2BNUA 1YPZB 3MO1A 2XKUA 4GS7B 4MJ5A 2VWEC 1SEQH 4HMCA 1MI5D 4PBWD 1BFSA 2IANB 4WDIB 5DC4B 2FWOA 1M4KA 3DPBA 4GXUN 1GSMA 1QLEH 5HHXL 1JNHB 4ODXB 2GY7B 2HKFL 2GKIA 2QQLL 4JLRB 4EN3D 1PLGL 4QRPE 4AIOA 3DGGA 3QIUD 2AJYH 4WW1B 2QTEA 12E8H 3QQ4B 5H37G 4K23L 1YEHH 2ESVD 2V2TB 3E6HB 2F19H 3BGFC 1MFDL 4U6HA 3DVGB 5J1SC 4HAGA 5GGUA 1QBBA 1QHOA 5E9DB 4AK1A 5JW5A 3VXSD 5E00B 1ORSA 5EBWA 5HJ3A 3DHJA 1UM4H 2WBJD 4GBXD 3P40A 2APVA 2P8MB 4Z7WB 1PKQA 1FLRL 2IEPA 1YC7A 5E9DD 4FFZL 4M3JA 5DZNA 3OJDA 2BJMH 3S34L 3TCLA 2E6JA 5GGSA 5EZOL 1T1XA 2C1PB 3WS6A 2W91A 5KBNC 1KJ2H 4YDIH 2YN3A 4L9LA 2FRGP 1LP9B 2VWEE 2H1PH 3N1QC 5E1AA 1MHCA 5KOMC 2Q1EA 2ZJSL 2HT2C 3VXOA 1JYNA 1WBZA 1OPGL 5C71A 2YC1B 2R1XA 5BZWA 5A2JH 4KY1H 3HZYA 5CD5D 4UILH 1S7UA 2GJZA 1QFWI 4ZTPH 1F8TL 3FN3A 1E4XI 3PHOA 3RX8A 2Q86A 3HR5A 5BVPL 2GJ6D 2YZ1A 2V2WB 4RMVA 3W2DH 3SDDC 4K3JH 1P5VA 3QR2A 2A6KB 4NRXB 4YLQT 5EB9A 3GJFK 2IQ9H 2GHWB 3LS5L 2X05A 1KTLA 4NN6B 3DRQA 3GMMB 4P5TA 1FE8L 3MRFA 5HHMD 1U3YA 5D7LE 4LEXL 4N8VA 2UWEE 4PGJA 3VU2A 3UXFA 3KPRD 2OR9L 3EO9H 3L3JA 1BZ9B 1LO3L 5J12C 4V1DB 3QDGB 1HH9A 2VTFA 1FC2D 3LKSB 3DXAA 1JTTA 4U1KA 4LRIA 5JUEL 5FO8B 5DGRA 4ZPVA 2DTMH 4RNRA 4IS6B 4GOSA 1RZGA 3T1FA 4LBEB 2NY1B 1FO0A 4I0PB 4D9LL 4F9PA 5CZXC 5BV7H 5GRZA 1PZUB 1HINL 2WUBH 1YPZE 3QUKA 3RVVC 2XN9B 2VSDA 4TSAH 5L7XH 4XPGL 2EDTA 1HYRC 1DUZB 5L2KD 4LSRL 3ESUF 5DJYA 5EWIH 1A9EB 3ZKNC 1T03L 1UT9A 5HYJA 2CSPA 1AGDB 2E9JA 4ZAKA 3WKML 3LN5A 1DFBL 4OM1H 1SVCP 1A6TA 1S78D 1NL0L 2DDQH 1ZT1B 2EE6A 3BXNB 3BE1L 2GSGB 4KU1A 3RVTD 4ZTOL 3I2CH 5C0NC 2B0SH 4HH9A 4RFEB 4W6XB 3V7AG 4L3ED 5IFJB 1T0MB 3T4AA 5EA0H 1UZ8B 1RY7B 4CMHC 4XPAH 1NCUA 1XCTB 3IFOA 5E5UB 1JNNL 3TNMB 1VFAB 3KPTA 2EDKA 4TNVF 1KCLA 1YEGH 5TGBA 4NQDD 1S7TB 3KXFA 1F4WH 4OSUH 4ZO9A 1RIUH 5JOFB 5F7NC 4OZHA 1EPFA 4GKZB 1QSFE 2B2XH 2XG4A 2R2EB 3MRPB 3MRBA 2P49B 1ZXQA 4WU7A 1DEDA 1D9KD 4QHMA 5EU7C 1T7WA 4CU6A 1HNFA 5FO7B 4X80H 3U2SB 2EXWD 3GI8H 3GIZL 4JFEE 3V4UH 4Z78A 3VFPB 4KUZL 2P5EA 4JO4H 1YEHL 2GITA 2O93L 5EG6C 5IB4A 1R3KA 4LPXA 2PCPB 1BFVL 1VPOH 1KJMA 4MHHG 4W68A 3ARFA 4HH8A 3VXNB 1FNLA 1QZ1A 2CLZA 4E0RA 4I0CC 1FYHB 3DSFH 2R1WA 2NNAA 2EO1A 3HI5H 4XC1L 2FX7L 2ZCLH 1HHGA 4J4PC 1HILB 3MYJA 3IDMB 1I7RB 1KGCD 1JZ8A 4NNXB 1MJ7H 1U36A 5F97E 43CAA 3FAWA 2HJLB 3NAAH 1KELH 1JPTL 3S35X 3QIWD 5GGVL 3MXVH 4I4WA 5T33H 3VXPB 4QLRA 1E28A 3FTGB 5DJAB 4NGHL 1NMBL 5L9DH 2WSKA 2DM7A 3PWPE 2IG2H 1AI1L 1LD9A 4NRYB 1DVFB 4X6BB 5J3HD 5HI3C 2GFBA 3VRJB 4X6EA 4PJCA 2A9MH 2YK1H 2GK0B 2G2RA 3LMJL 1PAMA 1AO7D 2IPUG 4NCDA 5EU7E 4JZNB 3T2PA 2NW3B 3LQZB 2VUOA 3OTTA 3IKCA 3U9PL 1M7DA 2EE2A 5C07B 4K3DL 1R3IL 3MXWH 3Q6GL 3TJEL 3FO1A 4WNQA 4YX2H 4Y5VB 3FB7A 4N9GA 3NGBB 5CBAA 4YEEA 1OP9A 2DMCA 3W9DB 5CEZH 1D5XA 4L4TA 4YHZH 4XXCC 3C6SA 6FABH 1FRGL 1PYWA 2AJSL 1EZVX 3MRCA 2PTTA 4R0LA 1TZHA 4ONHA 4LHUA 3W81A 4Z95H 3K8KA 1FNSL 3EFFB 2V9RA 4BUGA 2J4WH 4OCRL 5D6DC 4CL7A 1UCBH 2IBBA 3PHQB 4Y2DC 3MBXL 2BSED 2ZUQB 3SE3A 1BECA 5BZDA 3VRLF 1AXIB 5LGKA 3IS1X 3IXAA 1T5XA 4YNYA 5EU5A 3MLRH 4M6AA 4U1NB 1MHPL 4CN6A 4R90H 5JIIA 3AY4C 3MRKB 4JO1H 2MKWA 5LG1A 4M9OA 5F7LB 1M05A 1AGBB 4XB8A 5DRZA 3T08A 2V5MA 2R8SH 2UZIH 4M7LL 5D7IB 5D2LA 4JN1H 1S8DA 1LWRA 4QRQB 3KDMB 4HXAL 3QJHB 3WFDH 5I1DA 1BP3B 3H9HB 4PRPE 4LLUB 4ELKB 5JW4R 2HJKA 1WC7A 4XP5H 3DVNA 4P99A 1EEQA 4KJWC 4L5FL 1CVSC 1DBML 5IFHL 4OT1H 1JZ6A 1N59B 4XP9H 2QSCL 2OJZH 3E8UH 4LARL 2DI7A 4ORGA 1QEWA 1YDPA 3RUGF 1UH3A 1XT5A 1CFVH 3PABA 4LEOA 3EYSH 3Q5YA 4YDVA 1MCIA 5SWSA 1N8ZB 3FB5A 5CINL 5JW3H 4HWBH 1KTKE 5F9DC 3VGHA 1G1CA 2F74B 5IIEA 3L95B 3GO1L 2B5IC 2EYRB 3MRGB 3ZE1E 3SDXF 2LVCA 1U8PA 1S9VA 1YEJH 2AABH 1A1OB 1Q9OA 1I1AD 2H2SC 4R2GD 2ADIB 2CXKA 2JK5B 3AAZA 1FZMB 4L3AA 3DX8A 4ZXBB 3BIKB 5IM7B 5D7LD 1INEH 3N06B 4U0QB 4K7PL 2R29L 5ESAA 2M8XA 4LCWD 3GMNA 4G80A 4J8RB 4EI5A 2XWTB 5GGTH 4O58L 4O4YH 3B3IA 1J11A 3SKJH 5J6HB 3QNXB 1E4XL 2X4SB 2UZYB 2DB8A 5FXCH 5L8KB 2CR3A 1QO3A 1CD0A 2BVUA 3MV9A 3KPMB 5D9SA 4Y5XA 4GG6A 2I9TA 4YE4H 5HXMA 4CMMB 1GVIA 4MQ7B 4PJBB 4OF6A 3KG5A 1UQSA 5E6IA 1QFUH 5ADPH 4WFEE 4N8VG 1JV5B 1PG7X 2ESVE 1SJEA 4F9LC 3DGCR 4JQIH 4NZUH 4FZ8L 3ULVE 1HSBB 2SEBB 1SM3H 4YWGL 3GSNH 4ENEC 2KZWA 1WCBB 4GAYA 4MQXD 4L8CA 4Y4FD 1YJDL 3FRPA 4QTIL 3QEQE 5CILH 1GGCH 1XGPA 2W0PA 5DD6A 2X4TB 2ERJB 3O4LD 4XNXH 3P4NB 4WV1C 4XNUL 3TFKD 5FGCE 4YHOH 1UG9A 5HHOB 4AEFA 2NY0D 4ERSH 1K8DA 1NCAL 1R3LB 2Z93B 1GOHA 3SDDD 4FQHB 1ZGLM 2FGWL 1EHLL 1NGYA 3MRIB 4U6XB 2GCYB 3RWDB 2G5BA 4ZD3L 3O6KH 4F57L 3BH9B 5EULV 2ZOKB 1JNJA 1CGWA 4Y2DB 4NWUL 3O41B 3O8XA 4FZ8H 4JFED 2XRAL 4OD3L 4C83B 4PG2C 3HCVB 2Q8BL 3ULVD 2BNRA 1MH5B 2DLIA 2J6EL 5KOVC 5K9KA 2XI9A 2OJEB 4P3CL 3K2UL 1QBLL 3KPQA 4QCIB 3U46A 2QHRH 2UUDH 1GGBH 3QI9B 4LSTH 4Z9KB 3DUHA 1X5IA 2RAMA 1IGTA 1L7IL 5BW7A 4QHNB 2FO1A 3RX7A 3SCMB 3FQTA 5HTSA 3LAFA 5KTEH 5C0AE 1U41A 3HTLX 3SBWA 5F9AC 2BHYA 1ORQA 1Q9LB 3ZKND 3HZKB 3DUSB 4D8PB 3NFNB 1XGQA 2IFFL 4D9RD 2HFFB 1NQBA 3DRTA 4YHIA 1WWCA 4YDKH 4HPYL 2L0DA 1S78C 3ELAT 3VWJD 5C0BE 3JTTB 3PWNB 1FIGH 1CL7I 4HGWA 3VXRD 1BEYH 1ERNA 3RNKB 3FZUC 3WDIA 5C0ND 4AENA 3NACH 5K59F 3JUYA 1GZQB 5EZOH 2ZUQC 1LO0L 4OM0L 1MFAL 2WLYA 1MUJB 4Z5RA 3C6LD 1CFSA 3KPOA 3TA3D 4K9EL 1BWWA 2WQRA 5JHLL 1FFRA 1T2QL 1IEAB 2ADGB 2QSQA 3QFJD 4RQQA 1PG7H 1J1PL 4LCWB 5EC2A 4KHXH 4RDQG 2P48B 1QLFA 2C3WA 1JI1A 4H20L 3IDUA 1LP9F 1EFXD 1NBYB 1P7QD 2GQHA 1TJGH 3O3DA 1L9NA 4KUCF 1FN4B 1KXTB 1TZGL 1DN0A 2D7TH 3QJFA 4M7LT 3U30B 1RFDL 1M7IB 4JDTH 2EXWC 1FQ9C 5IOPB 3VFSB 4UT6L 1L7IH 1A7RH 3BQUD 3S4SB 1FN4A 4LFHG 1MAMH 3OKKA 3ILQD 1NDMB 3SE8L 3BZFA 3LN9A 1EZVY 1W0VA 4Y5XC 5E4EC 3PHSA 5D1ZD 3GBLA 4X6CF 5ESQB 5LBSH 4BSVA 1OSZB 4JRYB 1FO0H 1I3RA 3C5JA 4J4PD 4UV7H 3PDDA 4P9HH 5DF0A 2R2BA 1MCNA 1G0YR 3RX5A 2AEWA 2LU3A 4ZS7H 4JREC 3BPCB 3LEXB 2VLKE 2EC9T 5C09B 3WL9B 1I1FA 5JLZB 3RNKA 4IRJA 4JRYE 1HQ4B 4YHNB 1BAFL 5DUBB 4HGWB 1GC1L 2QR0A 4R97C 2E3VA 3C8HA 1A14H 1WT5A 3GBMH 1F4YH 4PGDB 2D31A 4IRSD 4NN5B 5FO9A 3KWWA 2IPKB 1FSKC 5T5FH 5CBEB 3ARGB 4HF5H 2H41A 4YHIB 4HQQH 5AZEL 1V7NL 1NCCL 3K8MA 3ILPB 5DI8B 4MZ3A 1T6WA 3QZWB 5KVMC 4R96B 3H3BC 1G9EA 1WIOA 4CU8A 1JYVA 4HMDA 2RB8A 2OQJB 3RQ3A 4FQLL 2UUDK 1TVBA 5GJTH 5MEND 5DVNA 2IADB 5FOJA 5EOTB 4TVPD 2DQDL 5F1NA 4M1CD 3PWVB 3U46B 4ISVA 1D5IL 5DEFA 4YXLH 3SCMD 4LPVA 3MGOB 3AS1A 5F9OH 5IKCA 3W0WB 1AE6L 3HCVA 3IDYC 4OBSA 3V95A 5CIPH 3T4YB 3D3VD 3BAEL 4I8DA 3WJLC 1UXWB 1IJ9A 5HPOA 3QUYB 3QZWG 3V6FB 1TTFA 4PJCE 5L2JB 2BOBA 5KSBB 1AH1A 3KPSE 5I1KH 2EEBA 4UI2A 1KCSL 4P4KA 1JCKA 4FQHA 5GS3A 1A7OH 3G08A 5KTEL 4C55A 1HHKB 1INDH 1U8IB 3PL6A 1KPUA 4P9HC 5C3LD 3D87B 1YN6A 1TJHH 2CO6B 2X4PA 3G5YB 3IFNH 2A6IB 2AJSH 2W9DH 3HE7D 1FFNB 2DYPA 1CQKA 2WM0A 4OZFG 3FJTA 2VISA 1MI5A 4NC2B 5IW6A 1ZLSL 3NCEB 5A2KH 2FSEB 2X41A 1NC2B 5K9JL 3QHFH 4JHZA 3MFGB 4X8JA 3QXTA 1NEZA 2X10A 1I4FA 5T1LA 5IG7B 4U2YA 3TH2T 1MJ8L 3ARFC 2EDQA 3NABL 2FYYA 2CIIB 1ZHKA 3OF6D 3VWKD 2R0LL 1MJ7L 1FNFA 3BD5A 2BCKB 4WW2B 5DYOB 3GK8L 3OXSB 4XZUA 1X5FA 1J1PH 5I1EL 1H3PL 3M1BA 1DQLL 2X70A 3S96A 4NRZA 1JZ2A 1FNAA 3QXDA 1J05B 2H9GB 2CK0L 5D1ZB 3L3GB 2R8SL 1KPVA 3TO2A 3QNXA 2Q87A 5FM4A 1QFWL 3B3IB 3QUZB 2A1WH 3CH8A 5BV7C 1EFQA 4XWGL 3BN3B 5B3JF 1JNNH 3TZVD 3D69A 4KGJA 2H2SD 4R2GC 1MF2L 2C9AA 3U48A 4MAUH 1MFBH 3HNTH 4M4PA 3IXTA 3HNVH 2VDLL 3L7EA 1U2CA 5IV2A 1II4E 1XAUA 3L3KA 3MYZA 4LLDB 4WEUD 3MRNA 3NPZB 2Z8VC 3C09C 3QIBC 3CLEL 5IHUL 1YMHA 2A0LD 2NCMA 3H7LA 2DRUA 2PO6C 4KQ3L 4K71B 4YDVB 1MNUH 4LLWA 4WWKC 1I1CA 4PRNA 3OR6B 1ADQL 5A2LH 3SKOB 2E6PA 2OS7A 1QNZH 5DFVD 2NZ9C 3WLBA 1GHFL 4R0LC 4YXHH 4PJBE 4G7YH 1MCCA 3LKPB 5GIRA 4YPJA 1DLFH 4WW2F 2DQCL 3KJ6L 4Y1AA 1AP2A 4AG4H 4LLUA 4ELKA 4EUPB 3QFDB 4E5XA 5C6WH 5C86A 3PXJA 2N7BA 4K2UH 2OL3L 4PJGB 1YEFL 3WFBL 3QPXL 5JQ6L 5DK0A 3FT4B 1X7QA 2VXSL 4O5LH 2APXA 3FO0L 5FDYA 4PTTB 2CK0H 4LRIC 2WUCL 3FRUB 4HS6B 1OGAA 2DJSA 5DK0B 1HWHB 3O2VL 3RKDC 3H42L 3UBXI 1P6AB 5KSAA 5EU5B 4MNQD 2OCFD 3QFDA 4FXLA 1T5XB 1T1YA 2FX9L 3ECBB 1WTLA 1V3LA 1KXVC 3RWEA 5SWZD 4KRNA 2NY0C 1KTDA 2FX9H 2MQCA 1W0WA 4M7LH 1ZHLA 4NOFA 3MACH 4JJHA 1UH2A 4H25A 4J23A 3V6OA 1ONQB 2OXGA 4Y4KA 3OR6A 5IB1B 5CLTA 3K3QA 2D0HA 3WFDL 3QXAA 4EUPG 2ZCLL 4Z7WE 1G6VK 1LO4L 4ZDHA 4LHUG 1UCTA 1T7XA 1TZHB 4X9FA 1YJDH 4AMKH 3EDEA 5IW1B 1SY6A 1PYWB 3F7YB 3C6SB 1KCUL 2I5YH 2HFTA 3D2UA 3L7EB 1RHFA 4RBPK 3GHBH 5I8EB 3TO4C 1I9RH 4N9GB 2WWKT 3IFPA 3R1GH 3GUTB 4JY5L 3SDCB 1DLFL 3RAJH 3WSQH 4JZOA 4LQFH 3V4PL 3F8UB 3LQZA 5ANMA 3V4PH 1J1XH 1RJZA 4XCNA 1HNGA 4O58H 2ZJSH 2CMRH 4X6EB 3ARGD 3L3GA 3ARQA 3WS3B 2NX5D 4MXWL 5DJ6B 3QXDB 3EOTL 3OHXA 1UACL 1ZK9A 4EBQH 4UIMB 1F8TH 2FATL 3QEQB 2A2QT 3FTGA 3G5VA 2MHAB 3N85L 1U8NB 3DX7A 5I74C 2HLAB 4HLZG 2QADB 1OW0C 3SO5A 4NT6B 5LWYL 3MRDB 3MRMA 4EIGB 3SO3B 3T0BA 4MX7A 4A6YL 5DD0H 4HCRA 1HHGB 4U31A 5ERWB 5JR1H 1NEZB 5F7KC 2R1WB 4GRLD 1QFWH 4P23A 3RPIA 2VDOL 3UJTL 5HI5C 5D5MB 2FSEA 4U2ZA 2HN7A 3V52H 1A7QL 3HG1E 3RKPA 4IRZH 1XR8B 1QR1A 3IDXH 3CX5K 4LMQE 1LEIB 2A6IA 3O6ML 5TH2A 3EYSL 1YN6B 1RQ5A 3OJMB 1CLOL 5DJCA 5E5RB 1FZJB 4XX1G 3DV4A 4QRRB 2VDNL 3LQAL 1YYML 4WI5A 4F7EB 4F9PC 3T0EE 4PJ9B 1G7LA 4J3OC 3IAPA 3PDOB 1I8KA 4C56D 1WUNT 3K81A 4UIKH 1NEZG 5FYLD 4HXAH 1S7TA 1LEKB 4N8CL 4W70A 1LE5B 4Q9BA 5IF0A 3QCVL 5HI4C 3K2MC 3BJLA 4OD3H 3MGOA 1IGIL 3B9KC 3V5DA 4OB5H 5CP3A 2P8PB 2XWJB 5DVKA 4YHYB 1ZAGA 3DXAE 3C2SA 3LB6C 2VZTA 2AP2A 2CDGB 4QXTA 3O9WC 1MVUB 2ZUSA 3UJJL 2GSGA 2Y06H 3FB8A 2OQJA 3OKOA 5GRUH 1QBML 3CPLA 4L3CB 1IC1A 4K07A 5E24E 2DN7A 5IFAL 3AUVA 1J5OH 4PGCA 3QZWA 4XVUC 3IDGB 1JGLL 1FLTX 4P4KD 3DI3B 3NA9L 4HS8H 2PO6B 2GSIB 5GHWH 1QP1A 1I1FB 4HS8L 2CH8A 1EGJA 3ZZ1A 3RWHB 1T2XA 2DQDH 5ELIA 3LIZL 4DKFH 4U1HB 3AM8C 3N50A 4HCRH 4IS6A 5EA0L 5D72H 4FFWC 3EGSA 4QRPD 2NY3B 4TUJB 5IJKC 3C60D 4JRYA 4JO3H 1YECH 5HY9B 4AH2A 2QQKL 4D0CB 1ZLUH 1CS6A 3FKUS 1C1EL 4MJ6A 3EDFA 4RFOH 5HHQB 2H32H 5CSZB 3NVQA 2Q76A 2NXZC 1MVFA 4LGPB 5CMAA 1CGSL 2ED8A 3T65B 3K8LA 3L5HA 3MRFB 1RUAL 4WU5B 3QO0B 2EYTB 3OB0H 4MSWA 2APFA 4N90D 4OB5L 5E6ID 2E27L 5I30L 2EDLA 3UPCA 1QSEB 4NPYB 5DQ9B 1VFBB 3PHOB 1MAML 5T3XE 3D2UD 3MNWA 3L7FB 4WO4B 3EJYC 3Q1SL 5GGQH 1HQRA 4N0UE 4PRAA 1G9MC 4M3KB 1RZJC 3VFWB 3ARUA 1JHTA 3UMTA 3GMRB 4RISH 3AMKA 3O4OC 3MODL 3DOSA 3VXTA 2VZ1A 3G6JF 3I6LE 4L9LB 2F9BT 4XC1H 2VABB 4HIXL 1HDMB 3CSBA 4R9HA 4UNUA 5I1AA 5E1HB 1F45A 2CLVA 4UNVA 5CZKA 3D3VA 4LEXH 3UTQB 3LN4B 3BDYH 4G42A 1W72A 3NCFB 4B5EA 4N0RA 1BQLL 3GB7A 5HHNB 2R0KH 3VWKC 4Y0GA 2QHLA 4KK9D 4PJDA 5T33L 4PJBF 1ORSB 5E00A 1AGFB 5EBWB 4OF8A 5HJ3B 4JFFE 1IAKA 2P5ED 2Z31D 1P69B 4IDLA 3LRGA 2BXYA 1X5LA 2DJUA 4M5YL 5TDNA 2Z4QA 1CGVA 2HFFA 2JIXD 1CE1L 4Q6IC 1E6JH 5D93B 5EU6D 1XZ0B 4IMKC 1J12A 5LQBH 3KPNA 3WDHA 4K94L 5KSBE 2JJWA 3QDHA 2HTLC 5JA9A 4YDIL 2J8HA 5J06A 2B20A 2GJJA 4QHNA 3TJHC 4AL8L 4OLZL 1H5BC 2L4OA 4PJ9C 1RMFH 1OAKH 5E2WH 1I8LC 5I8CA 3QIUB 5EPMA 1VFUA 1BLNB 2FWOB 4KKBD 5IVNA 3SJVB 1HHHA 2HWZL 3S37H 4L4JA 4Y4HD 3SQOL 2OZ4A 5EZJA 1MJJB 3MO1B 1DBJH 1Z9SA 2QADD 4G43B 5HGGS 2FJGB 2NY7H 1MREH 4Y2DA 3WCYA 4HWZB 3BH9A 2CRYA 3VGAB 5CD3A 4KKCD 4Y19A 1OP3K 2GCYA 4U6XA 2ENSA 5TDPB 3VWKB 3TJEH 5MEOB 2Y25A 3SHSA 4ZS6D 1T0PB 1K9TA 4L3EE 2FBJL 25C8L 5CEXA 1DFBH 1IAOB 5KW9H 3SDYL 4MVBD 1JF1A 4MD0A 1IC5L 1XGPB 2Y7QA 4DZ8A 2J8UA 1QG3A 3HPLB 1T7VA 3HMXL 1NAKH 1DEEB 1UVQB 4PJIE 5CINH 1EJ6A 3LKOB 4DVRL 3VW3H 1BJMA 3BP7B 4ZO7A 4ZUTA 5IMOB 3OV6A 3KPNB 4ELMB 2D7TL 3MBEB 2W9LA 4GAGH 3VA6A 5C0GB 3D39D 4YHPA 1N6VA 2A6JB 3IDNB 4C4KT 2YMXL 4GAGL 3C9NA 4EQ3A 2DBLH 3WXWH 3CC5A 5EWIL 4CVUA 3UYRL 4P2QD 4YC2B 2XXMB 1NLBL 4MQ7A 4PJBA 5DRXA 4R8WH 1IAKB 4RMTA 1FL6A 4KHTL 3MZTA 4LLAA 1QQDB 4GG6B 2I9TB 4PP1D 3ULSB 5B38B 1D6EA 1RJYB 4MAYA 3GJEB 4BSWA 1QSEE 1XF2B 1R0AL 1GXEA 5JOEA 2X4NB 2W9EH 2X4SA 2VABA 4OLVH 3I3DA 2ZCKL 1Q94A 5F9JA 2ZCHH 4RZCA 3EYOB 2G9HA 4DN4L 4ZAKC 3SJVE 1VB9A 1VGEH 2IFGA 4LVNB 5MERB 5E95B 4Z7VA 5HYIA 2VITB 3CH1A 3O11A 2VLRD 3TO4D 3DX8B 4ZXBA 5IM7A 4EOWH 4ONFL 4D9QD 4GMTL 3BRGC 4CKVX 3TBYA 4RWHA 3EHBC 5CEYB 1FYTE 3NCBB 5GGTL 5CEZD 1FH5L 4NQCE 2HKHH 1KLGB 3MV7D 5KVDH 4OSUL 4XHJD 3WFEL 4QXUH 4XNYH 2C4FT 3ET9F 4GBXA 5DHYA 1P4IL 1G7HB 5ITFA 1OF2B 5EUKA 4YWGH 5BMFH 3GSVB 2CDEA 3CFDA 1EXUB 1UWXH 3INUH 3QWRA 1CD1A 2OTPA 4IOSD 5GJTL 3MSPA 4JKLA 4MNQB 5IB5B 1NBVH 5CSZA 2EZ0D 4MJ6B 2HAZA 3NCMA 3BW9A 2BXZA 2NXZB 1RURH 1OAYH 3QXWA 2VDKL 4IOIB 1ZEAH 1M1SA 3P0VL 4TUJA 3RGVD 4X7TB 5DR5H 1JWMA 1B2WH 1HSAB 2XZQH 4L29A 4S1QH 3DURA 3SDDA 5D1QB 1D3CA 2Q7YB 3RWHA 3WHXA 3TC9A 5DJ0A 1F90H 1VFOA 4YR6A 3SGDH 4GRLC 3TH3T 1BVKB 4X9HA 3WNLA 1CDUA 3ZDZE 5DRZB 3T2NL 1ZLVK 1U3ZA 3R4DA 5B4MC 3O81A 3KYNA 1A6UL 3ARTA 2FZ3B 2X89A 3MR9B 4FG6D 3WFZA 1ZV5A 3LPFA 4XP9L 3TA3A 5IEHA 4YNYB 1B0RB 1CDJA 4YHLL 2IAMC 1U8LA 4UDTB 5IHLB 2BZDA 1IARB 1I8IA 1JP5A 5GS2D 3QDJB 1G7MB 1XGYH 3N9GL 5JXEA 3WNPA 5KANI 1X4YA 1X44A 2CJUL 1ZLSH 4JE4B 1KC5L 2N7AA 1JJUA 1JMXA 1MHHA 3EKCA 1RU9H 1XGUA 3FQXA 4XVSH 3LV3A 3G6JB 1I9IL 3RTQD 2XTJE 3DX6B 1QTYT 5KSVA 4QOKA 3NFPA 5F7DA 4XP6H 5D8JH 1MHPH 5ESVA 4OCSH 2OI9C 2KH2B 3B8YA 1U8HA 4NN7B 2HT4D 5L6YH 3TLRA 3PNWB 4EVNB 5DQDH 4FN0A 1H5BA 2OX5A 1FORL 4Y5VA 4LCUB 5FM5M 4LQFL 4WFHE 3QWQB 1Q8MA 1VACA 1ZMYA 2VLJE 2E7LC 4DUXA 1EV2E 3C5SA 1NAMA 3IKCB 4HIHA 5CJOL 3E3QE 4IMKA 2AI0L 1IGML 1NLDH 2WBJC 4NKOA 1H8NA 1KFAL 5DWUH 1Z9OA 2VLME 1NLDL 5MHSD 1E4JA 2Q3AA 1LD9B 4I3RL 2A74A 5EU3A 2YBRB 1BEYL 5IJKA 4GAFB 4EXPX 2ERJC 4MAUL 5GS1A 5DJAA 1FVEB 2YUZA 2EDDA 2ADJB 3H7BB 5C0BA 5EFIA 4BQ6A 2VZVA 4F37K 1L0YA 4ZODA 2EECA 5ERWA 3B6SB 4RDQF 3FHAA 4FS0A 4DKAA 3ZDZF 3UDWA 4Q9QH 5GGTA 1IGYB 3IDJB 4FFWD 4YGVA 4HDIB 2B39A 4QRUB 3RBSA 4ODWB 3PV6B 4EZMA 3DX7B 4PJIB 4ODSH 3G5VB 1DANU 5C0RH 4W4OA 3B9DA 3SKMB 5MI0C 1LVEA 4PBVC 2FIKA 1N5AB 2VE6A 4MAYD 3LS4L 4YC2C 3MJ8B 4ETQB 2PCPA 4AEHL 3EYFA 3BJ91 3S97C 1RIHL 1S7QA 4G8GA 1E27A 1PJ9A 3JV5A 2FEDC 5K93A 3VFPA 5AWNH 4P49A 3TF7C 1IGFH 2AKRA 5FO7A 3R8QA 5J0BA 3STLB 3C8DA 1C08B 1IT9L 3W39B 4QHMB 4HIEB 1YQVL 1PX3A 3ZL4L 4MA7L 1N0XH 3QISA 3EO9L 4R7NA 4E41B 4L8BB 4PJAB 3TN0B 4KK5C 4M1DH 4OZHB 4Z0BL 5FDWB 5ESVB 2EEAA 4P2CG 3TBTA 4LVNC 5IQ9A 5KSVB 1EHXA 2P24B 3RVVD 5GRWA 2P44B 3G6JA 3LV3B 2DQUH 5F6HJ 4S1RH 1X5GA 3LQAC 1ZLUK 2NY2B 5IT2H 1SBSH 4JCLA 3T0EC 3IT8D 5BJTB 1ONQA 2EDNA 5D7LA 5IUSA 4HH9B 3S35L 1I8IB 1ZHLB 3NN8B 5AUMB 2Z31C 3FN9A 2UVFA 3ECBA 4QRTA 4NDMB 3NTCL 3C8KB 3HG1D 4M7KL 1C5CL 2XZAH 2YWYA 1GOFA 2VLRB 3BT2L 3RVTC 4OV5B 1D9KA 5JW4N 1FZOB 1JRHH 3MR9A 4P59H 3BUTA 1JRHL 3W5MA 3DYPA 3QCUL 4NQEA 5TF1H 3C60A 4JRYD 3JXAA 1BJ1H 1U95A 1ZVSB 2F15A 2XICA 5ITBL 4PJGA 3MCLL 4LBEA 3ZKQD 3DURB 2FLBT 4RNRB 1VGEL 1HSAA 2JIXB 3LD8B 4L29B 2AXFB 1PY4A 3B9KA 4G6AC 3S35H 4OF5A 4OKVA 5K59E 4Y4HC 4HHAA 3LKPA 5GIRB 3GSNA 3JZ7A 3WLBB 1AKJA 3NIGE 4XCYA 1QRNB 4FQ2L 5EUOF 1NUGA 4Z8FL 3MLPA 2R1YA 1UA6L 3P11H 1MFEL 5F72S 2ICCA 3RWJA 3DRQB 4P5TB 5GGRY 1K8IA 5JHDD 5JXEC 4X7SL 5DHYB 2UY6A 2XXCB 1DBAL 4ZFZA 2R0KL 1UWGH 5FM8A 1I9EA 5JXAL 3L3KB 3U1SL 4X7CC 4YZFF 3GK8H 1BF2A 3HC4H 4HJGA 1DQML 5I66B 1NMBH 1LDSA 3WFHA 1FAIL 1RUAH 3ARYA 4PP2B 1TIUA 1FFPA 4U1MA 4ZSOB 5JOPD 3BVNB 3HMWH 2W59A 4PR5B 2YC1A 4HIJB 1BZ7B 5BXFA 5D6CB 2A9ML 2YK1L 2DBJA 4ODVH 3E0GA 1MHCB 4XB7A 3UYPA 1B6UA 5DJDA 1WGOA 3TO2B 4YPGB 4Y4KC 2DWDA 3NABH 1Y6KR 2WV3A 5TF1L 1GRWA 4MAYB 7CGTA 1JPTH 1N2RA 3ULSA 1PKQB 1F4WL 1G9ML 2D7PA 4XNQB 2VERN 4Y4HB 3OXSA 5DRWB 4YJZL 2WBWB 1EX0A 3W0WE 3HB3D 3RWFA 3O3EA 4L3EA 4NN7C 3ARDD 1OAQH 2YD3A 3KLHC 4YQXH 4EKXA 1IL1B 5EBGA 2D0FA 4J3UA 3E6HA 2V2TA 3P73A 4A2MA 4MDJA 1ZANH 4I3GA 4QGYA 1JWUB 5ACZA 5IMOA 1NC2A 4M4RA 4HV8A 2IQ9L 4ZG1A 4WFED 1FGNH 4WEBL 4I13B 1GIGH 2V5RA 1TQCC 5JDSB 4J1UB 3SDXE 1J9CT 3HPLA 3MV8D 5T1DH 2J8UB 3MA9H 1JZ4A 1ROWA 3IGAA 4DGVL 1UM5H 2CD0A 1VCAA 4WJ5A 4DFIA 5ABDE 3EAKA 3O3AA 4MDIA 1NDGA 1H9VA 3H9SD 3KNBA 3UTZB 5DK3A 2AJXH 3SE4C 4UILL 1QA9A 4H8WC 3NA9H 3MLZL 4G7VH 4OZIF 4S2SB 2X42A 1YPZA 2BNUB 1TQBB 3W82A 2YEZA 2B0SL 2F8OA 5CD3B 3X11A 3GM0A 2AQ3A 5FOBB 3WUWB 4XPTH 5D2NE 3QIWB 1D5ZA 1BQUA 1KIPA 5GSVB 5F8QC 4O02L 4G43A 5D2LE 1R5VA 1J86A 5KSUA 4LNVA 2VLJD 5IKCB 5JIHA 3FT2A 1A9BB 5B8CB 3VFTA 2UV3A 3SE9H 2F8VA 3NCYP 1BLNA 3WXVH 3RVUD 2J6EA 1DQLH 4Y1AE 5E2UH 5GGRB 5E2TH 1XF4B 1EEZA 5D5ME 4AM0B 1TVBB 3JWOL 4W4NA 4BFBD 1FO0L 4PJ5E 3IRZA 3GIVB 2B1HL 1X3DA 3VI4E 1PQZB 4LRNL 2EDBA 4UOJA 4GRWE 3HAEA 3CU7A 3H42H 3VH8B 3VXRB 3KWWB 5CBEA 3KPPB 5FO9B 3WLWC 1JGUL 2NXYD 5I17A 1QSFA 4FQXD 5EOQL 2ORBH 4P3WA 1CG9B 3PWPA 2DQHL 5JLZA 1FNGA 1KEMH 4MNGB 1EFXA 3R0NA 4KDWA 5EBLA 2L7JA 3GB7B 5HHNA 3NA4A 3G04B 4WVRA 2X1PA 4W81A 1EO8H 4JFEA 2VR9A 3KVQA 3UTQA 3KPLA 3H0TA 2ZUYA 4Y19E 1JBJA 4Z7OF 1EAJA 1OSZA 3MLWH 5IB3A 3OG4B 4Y88A 2WP3T 5FYJE 2CKBL 5H35A 1W0VB 1WBYA 4RGND 3VFWA 5E70A 2VAJA 3BZFB 3MOAL 3RAJL 3WSQL 1K85A 3VRIB 2APBA 1BHGA 3S4SA 2X89D 3TNNB 2Q6WA 3VFSA 5EZLA 4GMTH 5DSCA 3QUXA 4XWGH 2Y5EA 4NO5A 4BK5A 1RU9L 4NKIL 4QGTA 5FCUH 4M00A 4YO0B 2UZXB 5FYKU 2V6HA 1Z2KA 3REWB 4I2XB 1OD9A 2HVJB 1G84A 4NZJA 3QO0A 3O3DB 3ZDYF 1CE6A 1MF2H 1UZ6E 1NBYA 5HHOD 2BVQA 3T65A 1AGCA 2VR4A 5C7XL 1IEAA 3S3PA 5L6YL 3TH4T 4FQQB 5AYUH 2X44D 3WN5B 4AH2B 4D0CA 5J13C 5DJ8B 3AREB 3NIDF 4Z5RB 2MCG1 5CJXC 2GEEA 3WE6B 3O2VH 4MD5A 4UTAH 5K9JH 3M45A 4NBZB 4PY8I 4MJIE 1P4LA 4XPFL 1I9JH 2F19L 2F54B 2PTUA 4OCWH 2Q8AH 4QTIH 1C12A 4MQTB 5AAMA 2AJ3B 2HJFB 1B2WL 2XZQL 1U2HA 1MPAH 4HJ0C 1A3QA 3DRTB 1KCUH 1G9NC 2A73A 1WZLA 3DUSA 3HZKA 3D0VA 3L3HA 4BH7B 2BY2A 5INCB 2FEDD 3ETBF 3AU1B 1CDIA 3PG2A 3SGKC 1FNEA 2ICEB 3CPLB 1BGXL 3SCMA 2NLJA 3FB8B 3FO0H 1ZHNA 1G0DA 1U8QA 1VEPA 3D5OF 1UXSB 1A7NH 1W72H 3GSQB 5HD8D 1MVUA 2VLJB 1ADQH 3KYAA 3PGCB 4LSDA 1NMAL 3MRQB 3NPSB 2X4OB 5K9KB 3V5DB 3MFFA 2W0FA 1A0QH 2NTFA 1EEYA 5ALBL 3NCJL 4NZDA 1I75A 4XPFH 4P3DB 4BQBA 3LKQB 3TN0C 4AEHH 5I9QB 3CVHH 1LEKA 1ZLWK 3EJJX 1RZ8A 3HC3H 5C07D 1F11B 3A67L 3DROB 3S36H 2R0WL 2ZOKA 5C0JA 5EIQA 2F54D 2VDLH 4MA3B 1B3JA 5I8OL 1G7LB 3T0ED 1X5HA 3MRIA 2BY0A 4DQOL 4NKMA 1XF5B 1H3GA 1C7SA 1KUMA 1FZJA 5E8EA 1AGEB 3TIEB 4ZNCD 3GHEL 4EBQL 2FLRT 5IBTH 5TPWL 1KB9J 2AABL 4LF3A 4NKDA 4TSCH 2HFGL 1ES0A 4M8QA 4F58H 1TVHB 4LNRB 1G0XA 2AGJH 3OPZL 2YXMA 4X5XB 4H8WL 4XNZC 3U4EB 1BQHA 4Z0XB 2MPAH 2HN7B 4PJAF 4XBPA 1KV3A 5JTWA 5C0AB 4P48A 2QQQA 4CN4A 4OD1H 2YD6A 4FQXA 1I1AA 5FYJD 3PQYB 3BZEA 1E0OB 4MX7B 4WUUB 4EDXB 2X7LB 3GI9H 3MLTA 1H15B 2VLLA 1P9MC 3MRDA 1E4WH 2LU4A 5T1MA 1PX4A 4F8TA 1G1YA 1U8NA 2PW2B 4UU9A 3K2UH 4R26H 1EERB 3MV9B 3QEQA 1P7QA 5ENWB 2HRPL 3I6KB 3SDAB 5D2NB 1XIWB 5L88L 1R5IB 1U3HC 3ULUH 5CCKH 5F89A 4GQ9L 3BQUC 3QO1A 4PJIF 3I50H 3X12A 3ILQC 5J6HA 1RJZB 4XCNB 1CFVL 3S6CA 1JGVL 4ZD3H 1ZA6B 1LE9A 3VXUB 4P2QB 5HHOE 3OAYH 1A64A 3QG6A 4JZJC 1MWAL 3ZMRA 2QSTA 1FZMA 2XN9D 1VA9A 3IFPB 4PRIA 4XVTL 4YBLB 1JTPA 3EYUL 4ZOCA 1X6LA 2K3TA 2ITDA 5HDQL 3D2UB 3CMOH 3HAEG 4OAWA 2BFVH 4P57B 1VFMA 2R56L 4XNXL 4OUUB 2B2XL 1MCJA 2P7TB 4K7PX 3H2WA 3VGAC 4ZDHB 4JVUA 4DUVA 1KCSH 4H1LH 1U8KB 3DMMC 5SWSB 2Z35B 3FL7A 4RGNE 2GW5A 5T3XD 3U30C 1SEBB 2CUIA 4Y4KB 1JHKL 1TJIH 1W0WB 4MNHB 3DVNB 2AVGA 3FMGH 1ZOXA 2F58H 1FPTL 1QKZL 3VXSA 5IBUG 4AEIL 5GS0C 3UPAA 4LHUD 4F2MA 4Z7UB 1QVOA 4BH8B 3BHBA 3UTTA 4QRQA 1IGJA 2MCPL 1A6AB 4M93B 1S8DB 3MX0A 3KHOA 4MJIB 1B4JH 2PN5A 3FRUA 4RGMB 2BJML 4U1LA 1I3GL 2VSCA 4BZ1H 5IB2B 4YEFA 3L3OA 2CRZA 4U1LB 3BDYL 3KYOA 3VFOA 1HEZB 3I2CL 4JFFD 3RDTD 3AM8A 4JM2B 1YNLH 4NO0D 1A47A 4LVOC 4U1NA 2HT3D 4PFEA 3TYGL 4F2MB 4ODHL 4Q9CA 1MRCL 2PYEB 4EUPA 3HFML 1T04A 1F4YL 3N1GC 3L5XL 5FA4A 3QULB 3MCG1 3X3GH 1EUUA 5J1AB 3SOBL 4DTGL 2X1XR 1G7IA 4UDUB 4XVJL 4GXVL 1SEBA 5FA3B 1IKFH 1TPXC 4K94H 4KRPC 1URLA 4TUOB 1Q0YH 2XFXA 2HKFH 1QFWM 4IRSB 5J7CC 1KYOJ 1IKFL 4JFDB 5E7BA 1A1MA 1A6ZA 1N0XL 5C0AD 4ONHB 1S7VA 5F70A 4F15B 4JHAH 4R4BB 1T5WA 5CGYC 3BYYA 2ESVB 3L1OH 4LLDA 2DD8L 3RFZC 1KCRL 4FQ2H 4JO4L 1J18A 2ITDB 5L8JB 1UENA 2HH0H 5E8OA 5LJYH 3T09A 4HUMB 3I6GB 3OKEB 3QUZD 1FG2B 1W2KT 5I1CH 5LVEA 1PKOA 3BKYL 1DQMH 5GRVL 2CO7B 5DT1L 3FAXA 3VXUA 1S3KL 5HPMB 1BJ1J 1TLKA 5JXAH 2NW3A 1RFDH 3HI5L 4NQEE 3QUZA 1YMMA 4JZNA 7FABL 3DWTA 4K3JL 4DFHA 2WAHA 2I25N 3W2DL 4JFZL 4GXVH 5C6TL 2YPLD 1SY6L 3MRJA 2W60B 1FAIH 2H9GA 1J05A 5JZ7D 1DVFA 2IMNA 4NRYA 2ID5A 4H88L 4X6BA 3WLWD 3SEPA 3LEYL 1BFVH 1VPOL 2X1QA 3QWOB 2JJSC 1P7QB 5ENWA 3WJJC 4JHAL 5I9QC 3DBXA 4CDHA 4I4WB 4ZSOE 2W1NA 4Q9RH 1LDPL 4B7IA 4ODBD 3QUYD 1GZPB 2HJLA 4FTVA 1TJGL 1NH6A 5T1MB 1G7JA 4OIIH 3VXUE 4OGYL 1ITCA 1X5JA 1OAZL 2WIIA 2VZUA 3BO8B 4EDXA 2DQJL 3B2VH 4P0DA 4PB0L 5GPRA 1HILA 5T1LB 3X3GL 5KN5B 4QXGH 2JB5H 4PV8B 4EDWL 2KKQA 5EBMB 1RZFH 5C0DA 5FUOL 4P5TD 4X7EC 2VIRA 4KUZH 5MP6L 4XBPB 4JRXE 3DYOA 3O2WL 1QSZA 3PV7A 4U49A 4PJDE 1KJMB 4JFFA 4NNPH 4NUGL 3RDTA 5IB4B 1GAFL 3SGJA 2G5RA 1SJHB 2DQHH 2X4PB 2XZAL 4PD4K 3RJDA 2AK4B 2YPKB 3KPRB 4Q9RL 1EMTL 3UJIH 3ZE0F 3BRDA 4HFUL 3BKML 2Z92B 1HKLH 5DFVC 3QDGD 1WBXB 1M6OB 1R3IH 3QUXC 1J7VR 2DS4A 2FB4H 4LRNH 1IAIM 5L2JA 2O5XL 2PYFA 2RCSL 4F9LA 3MZGB 5C0JB 3MV8A 5FUCC 3PJSA 3NCYS 5I1HH 5JOFA 3V6FA 2ARJA 1JE6A 1GC1H 1JHKH 4JZJB 3WKNA 3BOVA 1VFAA 4IIQA 3K80A 5H2BB 2Y72A 4ZO6A 3O4OB 2W0FB 2CPCA 4NNYB 4ODVL 3U0PB 1NCCH 2Y07H 5MEPA 3MRQA 4ISVB 5DEFB 3NOIA 4BZ2L 3PXHA 2NX5B 4XTRC 4I0PC 1X5KA 3MCKB 2AERT 3P0YL 5IBLD 3HI1B 2A9NH 1A21A 4FMKA 1DLHA 1WZKA 5BS0B 3G9VA 3AU1A 4OF7A 1DBKL 3OMZA 3BIAX 5AD0A 4BH7A 1RUPL 2DF3A 4R4FH 3FHQA 4KXZH 3MLRL 3CXHK 3HG1B 4JRXB 1Y0LB 2W9DL 4X0KB 2O61B 1A9EA 1PSKL 4JG0H 2MWCA 2D31B 4AT6B 5TE7L 1TZIA 1DUZA 5JUEH 4GO6B 3L5XH 5FHBH 5TE6H 1DTUA 4ZUSB 5T1KA 5C70A 2ITCB 4KQ3H 3KYMA 4KDVA 4U3HA 4E9LA 4MD5B 4RX4D 1NKOA 4OCYH 3VWJA 1A1NB 3HR6A 3BPCA 4OGXL 2XQYG 1A4KB 4P4RB 1WFUA 1TXKA 5FO8A 5FF6A 4N5EC 1I3RB 3DXAB 5DJ8A 2WANA 4IOFC 2W65A 3IDXL 1X6NA 4V1DA 2PNDA 3RZWA 4KPHL 4P5MA 4YDLB 4MJ4A 1T21A 3NCCB 1AGCB 1ACZA 2XIDA 1EO8L 3V8CA 1CE6B 3O6FD 5DR5L 3KAAA 4RSVA 1G6RL 4HMEA 4F8QA 2BVEA 2A6KA 4NRXA 1NMCC 2VZSA 4YO0A 1DCLA 2PTVA 4LSPL 2EH7L 4NO5B 3V0VB 1WJ3A 3CVIH 4WWKA 5EOCL 3GJFB 5EZLB 3MC0A 3J8F7 3TNNA 1V3JA 4NC1C 4NO0B 1DN0B 1GHFH 2HG5A 1Z5LA 3MV9E 2VXUL 1IQWH 3HS0A 3S36X 1QLFB 3VXOB 1N5YH 1TCRB 5H35B 5J57B 3TFKC 1PW3A 1L7TL 1S7XA 1LP9A 2ILLA 3UBXG 5IB3B 1IKNC 1K3IA 2YUXA 5I8OH 1FYTD 4RBPH 3E1F1 2NQCA 3QNZA 4LOUC 1CFSB 3KPOB 5TE7H 5CS7A 1AQKL 1H3VA 1DBBH 1MUJA 3U0WH 1AHWB 3QDME 1IM3B 1YA5A 4KMLB 3B43A 1HINH 2WUBL 4C58B 5SWSE 3VXMB 4LLYA 1FNGB 4UIKL 1A5FH 4OZGA 4WI9A 4ONOA 3QEUA 1WZ1L 4Q0XH 1BX2A 1U92A 1B88A 5I17B 1BQHG 2B4CC 3DVGA 5IJVB 4RAUB 5CCKL 5DJ2B 4DVBB 3SDCD 2H26A 2MFNA 3HAEB 5L0QC 1Q9LA 2FHCA 4NQXA 5ISZA 4CNIA 3RVXD 5FGBA 4KKAC 5DJXB 4WW1A 3GIVA 4ERSL 5I71B 3ZT7A 4JVWA 5I2IB 1U8OB 3BD3A 1MNUL 1YQ2A 2OTWB 3I9GH 3GFUA 1QD0A 2J8OA 4NZRH 1XGTA 4Z7QE 3VFRB 3HKFA 3HA0A 4XMKH 2IANA 1A9BA 2IPTH 1G9NL 3FT2B 1XEDA 3W9EA 4PLJD 3AS0A 3HN3A 2Z31A 2VZ3A 3FQNB 3O8XB 2BVPA 4V1DD 5FM5O 4CN1A 1AD9A 3WUWA 3RWIA 3OX8A 2I26N 2QQNL 3BP4B 2O26U 3C6LC 2G5BB 2PKDA 4Y19D 3RWDA 1XGRA 1KFAH 2BVOA 2V2XB 3BPLB 1NCWL 4S2SA 5B21A 2D9QB 3IKKA 1RI8A 2H32B 4UQ3B 3X14B 5HHOA 2QL1A 1ADQA 3L6FB 3U36B 2ICWA 3UTZA 3WIIL 4NHCH 1NDGB 4LGRB 3TYFA 3CIQA 5E8DL 4KJQD 2C4FU 3Q3GA 2X4TA 5F71A 4Y5YA 2QKIB 2NY5H 4KTDL 3OKMB 4OZGF 1IGCL 4TVPH 4Q6IB 2NW2A 4HJJL 1AQDB 2AXHA 1OAZH 1Q38A 1F13A 2BVTA 3BUYB 2EIEA 3ABZA 5HGAB 1BBJB 1SBSL 3C60C 2FR4B 1I1YB 4LHJB 3GSOA 5IMKA 4IJ3C 1KENL 3TBVA 5F88B 3MUGB 2FNBA 5E6IB 4AMKL 4ZFGL 1FPTH 3ZT5A 3OBAA 3D0LA 3RWFB 2GYSA 3CZJA 4J3VA 3ARBD 2HRPH 32C2B 2YKLH 3VD4A 4PRPB 1OLLA 1GGUA 4XAKD 4KRPD 5FIEA 3MUHL 3MACL 4CW1B 1KPRA 2R39A 4G6KL 2ZG3A 1E4WL 5DD3H 3F58L 5C0FB 3EW3B 4ZXBD 3VMOA 4PV9A 4PY7B 2HP4A 4CMHB 1DE4B 1BOGA 3OL2A 4ODHH 4GRWH 4UOW1 2G75B 5DD1H 1BZ7A 5BXFB 1RAMA 3QDGE 4Z76B 1OHQA 3EYQC 2AK4D 4L4VB 4OFYD 1MQ8A 2GAZA 3UZQA 4APQD 5CILL 1A1OA 5KZCB 1ZLWH 5FYLE 3LRSB 1L7TH 4X4ZA 3C6LA 4IRJD 1CTOA 1L6XA 4HK3J 3BISA 4KZDL 4GSDL 1K8IB 1DL7H 2WINA 4UB0H 5KS9E 1N8ZA 3FB5B 5DMYA 3BGAA 4OLWL 4ELME 3CGTA 1UWGL 4RIRA 1MRFH 2ARWA 1QEWB 1YDPB 3MGTA 4BFIB 4F58L 2BNRE 1N59A 4O51B 1AKJB 1S7SA 3BKCH 5CUSH 1FVDA 4WCYH 3E2HB 3S9DB 2DLFL 1JUFB 4HHAB 3QUYC 4M1GL 2APWA 4OZFB 2HWZH 3MNZA 4RFNB 3S37L 5IVXF 5JNYA 2D7OA 4WFFD 2JIXA 3S5LA 2XNAA 1CFTB 5IQ7H 4HC1H 2BRRL 4TTDD 2CIKA 4P5TC 3K1KC 4HULB 1RHHA 4KUCD 3W5NA 2DM4A 3U6RA 2PXYC 3T0DA 1C5DB 3MJ9A 2I60L 1U91B 4XAWH 3HUJB 4WV1A 2GUOB 4NZRL 4RISL 3PWJB 4PRBB 2X4QB 4PYGA 5TPWH 1LK3L 3EOBA 4WCYL 5E8NB 5DTFA 2V7NB 2R0ZL 2P43B 1QBLH 1PEZA 4XCEB 3D9AL 5BJTA 3T04D 1XH3A 4LP5A 4MZ2A 3R8BB 1FAKT 2FJFB 3T77A 1F6AA 5TJWK 1IT9H 5JW3L 2VXTH 2ATKA 4U1GB 4XVTH 4H88H 2IH3B 5L7XL 1IGFL 5HHME 3L5WA 1HH6A 1HHIB 3BP6A 1R5WB 2BNQE 4M62H 4QF1A 3VMNA 3HE7B 3WNMA 1T03H 3FO9B 3GSWA 3KLSA 3SGEI 5AG9A 4BZ2H 1JNLH 1D5XB 4E41A 1CCZA 3S98A 3REVA 4W6WB 4XTRD 5E2TL 5E2UL 5CBAB 4TVPL 3BP6B 4XBGA 3S88H 5KS9F 3FO1B 1C08A 2NPLX 2IH3A 3O8XC 2ATKB 4MA8H 1Y18A 1YNTA 5I8KL 3ZSTA 3CFJA 4KMTL 4DKFL 3D18A 3LZFH 4TYUA 2BMKA 1XH3B 1N6QH 4WTWA 4TNWF 4GMSH 4HWEH 4U1IA 2KDGA 1JRHI 2VDKH 2FIKB 2BY3A 3EOBB 4CJ0A 4E41E 3DSFL 4AJ0A 4Z77B 3VGFA 3SKMA 1S5IH 4PRBA 3PWJA 5CZVH 3ZHDA 5KANG 1AD0A 3ESVF 3LY6A 4PJIA 3HUJA 3HNSL 4LIQE 1MFEH 4BELD 5FB8B 1T7YA 4QYOA 2A0LC 3ARRA 43CAB 1C5DA 1MCLA 5HGHA 1NAML 4NQCB 4ZAKD 3IDJA 4NNXA 4NQCA 1I7RA 4JFPB 1OVZA 5HGHB 2UYLA 4A6YB 5BVJA 3C5ZB 3I3BA 1NC4A 4G9FA 5B39A 2CIKB 3TYGH 1IKNA 2VYRE 2NNAB 4JFHD 2ADJA 3H7BA 2UVEA 3TVMB 5I1LB 2A77H 3HRPA 1MCWM 3MCLH 3DNKA 4OZIB 4H0HB 1UM6L 4OZFA 5LAXA 2JELH 3V7AE 1GL4B 4LCCB 3PWLB 5B39G 1OARL 4NKOB 1CE1H 4LIQH 1RIUL 4MD4A 4OD2A 5L2KB 4HIHB 3RTQB 3D18B 3P0GB 4K3DH 4KV5E 5DVOA 2KQMA 3C5SB 4EJ1C 1I8MB 1Y18B 1YNTB 5SWSD 4WGWB 1PLGH 1IAMA 3T3PE 3NPSC 5DHVB 4E41D 1TNNA 4MHHI 2B1HH 4XBGB 2I07B 5MEQA 5D71L 4WU7B 4EVNA 3PNWA 4KMTH 1U8JA 4KPHH 4KGLA 5KAQF 4OGAC 4H1LG 3HE7A 4X7FC 4NUJA 3NFPB 3KXFB 2HLFC 2VXQH 4YHLH 4L4VA 2IG2L 1HH6B 4KDTA 4LCWE 4Z76A 5HGDB 4TQEH 4JY5H 1F3DH 1XGUB 3FQXB 3IFOB 1XCTA 3FB6A 2X6MA 2GTZB 5EU6E 4NKQB 2FJFA 5B4MD 3HMWL 2AS5M 1BOGB 4N0YH 4UTAL 3MJ9H 4J4PA 1FP5A 5BCAA 1G7MA 2XWBA 4OIAA 3VGGA 5EUOE 1TQCB 1YEEL 2YWZA 1S5HA 1KT2B 5DTFB 4OCWL 3VFMB 1ZTXL 1HWGB 4RWYH 1ZT1A 2M1KA 1B0RA 5K9QI 2H1PL 4PREB 4PS4H 3TO4B 1WSST 3SDCC 4WV1B 2XTJB 3THMH 4XPHH 3BPNC 4YFLF 1YEFH 3F65A 4JFXA 2E7CA 4JFOB 3BI9X 1OM3H 4LSQL 4P2QE 3RVXC 3KYNB 3N0PB 4JB9H 1YC8A 5LXGL 4C56B 4U6VH 5D7SH 3GSUA 1LO2H 2OMBA 3QI9C 5CP3H 5F88A 5FUOH 5HDOA 5EOCJ 4WHCA 1MEXL 1L0XA 2IGFL 3WHXB 5EUOA 5DMGC 2E6QA 4AIZA 1BBDL 4WUKH 1RZGB 5HGAA 3T1FB 2YD9A 1H8SA 4WFFE 1PD6A 3OKYA 5C0RL 3UO1H 3ARBB 2BSRB 4POZD 3MNZB 4IIQC 4L4TE 5D71H 3LD8C 1BMGA 1H3UA 2X5PA 3OKMA 1FVDB 1KF9B 3CCHB 1CFBA 2F5AL 4YH6A 4BFIA 1OWRM 1S9YB 3L3JB 2D03L 1CD1B 2P5WB 3QH3B 1CFQA 3CFDB 2CDEB 1KTLB 5T3ZH 5A40E 2WINB 2X4RA 3SE3C 5CP7A 1B0WA 1MRFL 4HD9A 1AXTL 4MLSA 4OLVL 1PEWA 4JEGB 5D6DA 1RD6A 3LRSA 5DMKB 3NGBC 3MREA 4IMLB 5INDA 1HOCB 1AD9B 3T0WA 3WXWL 5TFSL 2X4UA 2X1WL 4KAQH 3LEVH 4TULH 1T6VN 3ZKSD 3PWPD 3EO1B 1RJCA 3BGMB 4UT7L 4MXQC 1INEL 5I75C 2G9HB 1JGDA 1H3PH 1NCBH 5DHVH 1H3TA 5E2VH 5DQDL 1NAKL 2OTWA 3HI6H 3GMOB 4MLIA 1MIEH 4NC1E 3O6LL 1QRNE 1OAUL 5GGSB 1AXSA 2ZCKH 4MCZA 5ISZB 1F58H 3QWRD 3NH7H 4YXKH 1QACA 4HKBA 4ONGL 4U6YB 1FL6B 1N0LA 5HYQB 1ETZB 1CLCA 1SJVA 2DQCH 3KJ6H 3QIUC 4XHQA 3WO4C 3V6ZB 1BGXH 3QEUB 4ZUUB 4OZGB 4O00A 1HXMB 3W0WD 2DQTL 2A6JA 5F44A 3DYMA 4LLYB 2VKXA 2Y36H 4PJXA 3S7GA 3IFLL 4ZUTB 1NCBL 5I1JL 3AS3A 3HLAB 1FBIL 2DM2A 3LKOA 3QUMB 1T80A 1Y6MR 2BX5A 4RX4A 3WIHL 3QQ3A 4MYWB 4MD0B 1JF1B 5D1XA 2R2CA 4Y5YB 5JA8B 4YXLL 1REIA 4F80A 3VI3F 1FFOA 3FQRA 4KKLC 5CEXB 2BNQD 3SE4A 4QRSB 3Q6FA 4HJJH 3ALWA 4P2RE 3DI2B 3CDCA 4GUPA 4PTUA 4XH2B 1A3RL 3BAEH 1I3GH 3BD4A 1Z5LB 2HG5B 1XGRB 2VKWA 4P5KB 3O9WA 3WUZA 3CFKB 3PIQB 3QDJE 3U4BL 4XX1E 2ICWI 2HT2D 2ADFL 3MLYL 2A1WL 4HBQA 4FQJL 1R24B 3OX8B 4N1HB 3WBDA 1YY9C 2VN4A 1ZWIA 4PRHB 5DMIL 3FQWB 4HUNB 3FQNA 4PYHA 1A7OL 5F8RC 4TOYH 5DRNA 1YEKL 1K2DA 5EU6B 4OCNC 5F21B 2V5YA 3FONA 1MCHA 1P1ZA 3O3BB 2OI9B 1T21B 3RHWK 2ZSVB 3DJ9A 3JV4A 1LILA 3MLXH 3RY6A 3KYKH 1GGYA 3QHTC 3R1GL 5EIIA 5IEKB 5I2IA 3QCUH 12E8L 1HIML 4U6VL 4G8FA 3CDFA 3LHPH 4CNIB 1RZ7L 1ZHBA 2PW1A 1T0NA 3L1OL 4NYLA 1J8KA 3BKCL 5CUSL 3UBXA 1ND0B 1AY1H 4ZUSA 3L5IA 5TDNB 2IMMA 2BHZA 5IJVA 3DO7A 5F7MC 1IFHH 3JVGA 4H26B 1U92B 1BX2B 2IH1A 5JDJA 4LL9A 4X0KA 1YYLH 1OB1B 4O2CA 5CZXD 1AGFA 5DT1H 4JPIB 4M5YH 2CXGA 1W8NA 5JXED 1XF3A 4HUXB 4UTBH 1MY5A 2OXHA 4FFYH 2I27N 4ZYKA 1KENH 4JN2B 1W72B 1INQA 1MFCH 3VFVA 3D3VB 4WFHD 3IU3B 3LQAH 4JFZH 4Q97A 4KI5D 3QNZB 4X7SH 2ZUWA 5GS0H 1YNLL 4KK9C 5I30H 2QQKH 5I76B 3QPQC 1Q9WB 2MOVA 1TCRA 4Z0BH 5MEPB 2RJMA 2VQTA 4I18B 4NQDB 1JHTB 5MI0B 4FA8A 5JPNA 3U82B 4ALAL 4IRZL 3ZO0A 1HQRB 3T1WA 3D1MC 3BDXA 4JZJA 5TQ0H 4IM8A 5J9PA 4U1SB 4H5SB 2OMNA 5DQ9A 4Z8FH 3PJSB 4JO1L 4HWUA 3V0VA 1SMAA 4X6DB 1ZT4A 2PYFB 1SJXA 3MJGX 3OAUL 2HTLD 4B50A 2FGZA 4F7CB 5BW7C 3T3PF 3UYOD 5HVWA 3SE8H 1T83C 1CXHA 4WU5A 3JWDL 4NHCL 3HPJA 1DN2A 4G8GD 4UB0L 4NNPL 4NM8L 2Q76B 3DTXA 5EDXA 4P5MB 4PRIE 5HHQA 3GHEH 4LLQA 3Q5TA 3QQ9C 5ICYA 1D9KC 5I1GH 4DAGH 2QADC 2EIZA 1V8HA 1CTNA 2EDOA 5FF6B 1MCRA 1U8MB 3ARZA 2E9BA 1CLZL 4XC3L 2BNQB 4OD1L 4UAOB 5IVZB 1G7PB 2B8OT 3VWJB 4XC3H 4XPGH 2E8YA 1T7ZA 2GSIA 4PV8A 2BRRH 5T1KB 1UB6B 3KPSB 5D72L 5I16B 4JFQA 3H8NA 3ZL4H 4AT6A 3OZ9L 4PJGE 3P9MA 1G7JB 4OLZH 1H3WM 2IQAB 1GZPA 4FTVB 1CXEA 1Y0LA 4JRXA 5FAAA 3TPUA 1BPVA 1FV1B 3EDKA 3IDGA 3PGFH 5LCVH 1MWAB 3ALPA 1CICB 4KJPC 2RIKA 3BZ4A 3U0TB 3V5KB 4OFDA 1A6PA 2NY5C 2V7HB 4X5WB 2E7MA 5IVXA 3F6IA 1CVRA 5A2IH 4PJFE 3D25B 5M7QA 3IF1A 2E8ZA 2CDGA 4M6OL 1YMMB 3VD7A 3ZDXF 5DQJB 1NJ9B 1U58A 4N0FA 2XWJA 2P8PA 3JWDC 4G9FE 4OGAD 3RVUC 3U0PA 2APTA 3TZVA 1U3HA 4AYFA 4QY8A 5BQ7B 3CXHJ 5E56A 5IF0B 3OKEA 3I6GA 1F97A 4YHML 4D0BA 2RGSA 2ARJB 2Y07L 4PUBL 1LO5A 2EDEA 1PG7L 2YPLB 3C09B 1XIWD 4Y16B 5K9OB 4KROD 4HKJB 1Q0YL 3V5HB 4W4OC 4X4XA 1S7VB 1M6OA 1QFUL 1JTOA 3H9SE 1IM9A 4FQXC 3LHPL 4TUOA 3GBNL 1J10A 3LVEA 4QRPB 1T20B 3QXUA 3T8XA 3P30L 3TESA 4XMPH 4JAMB 2OYPA 3UTSA 4DEPB 3O4LA 4XWOC 4KVCL 1QPPA 3EHBD 4LLVB 2XYCA 3S4SG 3N85H 4OFPA 2JCCA 3MLSL 5D5MA 3O45A 4P23B 3BEWB 5IHBA 1AIFA 3MLUL 4HZLA 4X6DF 4JM2A 2EKSB 3RZCC 5ICZA 5BVPH 3VFOB 5ETUB 3N1FC 3D85D 2WIIB 4RGNC 3SPVB 2LVEA 4M7JL 1QYGH 4UBDD 1KIQB 1NAMH 1IQWL 1UEYA 3MMEB 3ROOA 5ECJE 1A6AA 4QEGA 3MUZ1 2AQ1A 4J3TA 3BEVA 4I1NB 3UTTD 3UX9B 1NGWB 4ZTOH 4LLMA 4JQXC 4YQXL 3WS3A 4MNHA 1VENA 2WW8A 2XY2A 4X5LA 2M2DA 1R0AH 2ZNXA 5IMMA 4DOHE 5FYLH 3RGVB 2VDPH 1T1ZA 3MROB 4XPAL 3VFUB 1CDBA 5D1QC 5ANMB 4EQ2A 1ED3A 1SY6H 5IBUB 1U8KA 1BFTA 4LPWA 1JGUH 1DQDL 3SDCA 2D4FA 1BFOA 1T2JA 3VGEA 1WFOA 3EYVA 1KBGH 1GCFA 4KTEH 4HUUA 5DURB 3P4MB 2XT1B 4D3CL 5DS8B 4FXGA 4CRPA 1T5WB 2Z0BA 4LFHD 2RFXB 5HHVH 5TDOA 2UZIL 2DWEA 1Q1JL 3CK0H 4NBYB 5D1XD 5ADOH 2AJUL 4NQSA 1U3JA 3CK0L 4P9ML 1F2QA 5FA3A 4OLUL 3BESR 5F96H 3SN6N 1FHGA 2FX7H 5IMMB 3CLFH 3QULA 2JTDA 3QO1B 5FA4B 3KJ4C 4DUWA 2BSSB 5CJBA 3VD5A 5DUPH 4PJAE 5C0CB 5CSGA 5EO9A 5BOZG 3PWUB 3M8OL 5GJSL 1CLYL 3C2AH 1TJHL 2GT9B 1FG9C 3DO3A 5D7KD 3U7AA 4HFUH 2HKHL 3OXRB 2ZZUT 4L8SA 1JVKA 5FK9A 3JWOH 2VRAA 2CK2A 2I24N 2VLLB 4QTHB 4PTTA 4FZEH 4YHKL 3DIFA 2JB5L 3RHWF 4DVRH 5IB2A 3PGDB 3T2NH 3F6LA 2EKSA 5ICZB 4MJIA 1CI5A 1GYAA 1OQXA 5ILTL 4OKDA 2XZZA 3BEWA 1LEGA 4ZFOA 4PGBB 5AEAA 1FCGA 2FBOJ 4KKLD 3VD9A 1OM3L 4X5XA 2D7NA 3O4LB 4GMSL 4HWEL 5T5NF 1G6RH 3UTSB 1ES0B 1OAXH 5SWQB 4X6CA 1JPFA 3HNVL 3AB0B 1NBQA 5C08B 4PRNB 1FH5H 5T3ZL 4MQXC 1KB5L 1VADA 1YY9D 5LGJA 4NKMB 1JHLH 4X4MA 1FZKB 4M61B 2W9EL 3RI5F 5I19H 2HYMA 4LKCB 3FQUA 1RZJL 4JR9H 3MRNB 4OUUA 4LVEA 4HKJA 2OP4L 2Z91A 4TSBL 1IBGL 5IV2B 1UCBL 2ZCHL 4XP6L 2DLTA 4DGYH 1PGRB 4XMKL 3QEHA 1IE5A 4L8DB 4MAYC 1FGVH 4D0BB 3MOAH 4V1DE 4WY7L 1L0QA 5ID0A 4EOWL 2YN5A 5BQ7A 2NTFB 3MFFB 4KK6C 4P2QA 1A7NL 4FMFA 2B4CL 2ZOLB 3GKWH 5DQJA 4OGXH 3FO2B 1YEEH 1EBPA 1AY1L 5D1ZA 3D25A 1ZHNB 5C08E 1R5IA 1E4KC 2X70B 4TUKL 2ZSWA 1OAUH 4CAGA 1GH7A 3L3HB 1D5MB 4UU9B 4MXVF 4GLRH 4BKLA 4YBHA 3TPUB 2IQAA 5CAYB 4WRLA 2CIIA 1C12B 2O5YH 1MQKH 2X7LA 3RL1B 2P5WD 4TN9A 1VGKB 5I16A 1I4FB 1UB6A 4RCAA 2VDRH 4RMRA 1I1AB 4X8JB 1MLCA 5JHDB 1CN4A 2YD4A 4FQXB 4YFLI 1DDHB 3FCTB 1KCVL 1LNUB 4GG8A 1CR9H 4KH2A 2EC9U 3QPQD 1NC2D 2MMXA 4NM4H 2VISB 1U8MA 2C3HA 4NN5C 1RZJH 2DTSA 1DQDH 4JR9L 1FFNA 5ICYB 3HNTL 5DO2D 4JKKA 5IESH 2C3XA 2C1OA 3G5YA 4LLQB 5IGXH 3DTXB 1WZMA 4L4VD 2YPVL 4C59B 1ZT7A 2LFGA 5E8EB 4RGOL 1DVFC 4J3SA 4J3XA 1DL7L 1XF5A 1WFNA 1ZA3B 2EDHA 1RZ7H 4F7CA 4PJEE 3UROR 4LPTA 2BOBB 4YK4C 4EN3A 3BN9D 3JV0A 1ZT4B 4GKNB 3QXVA 2I60H 3U7YL 4WI7A 5DSCB 5CJOH 1T1WA 5DLMH 2Q6WB 3QUYA 1IAII 5J9PB 4N8PA 5FV2A 4QOKE 1RZ8B 2CMRL 1QNZL 3VDBA 2NY6B 1BBDH 4WUKL 5HGBA 4TVSa 4S10A 5GZOD 2DLFH 4P3DA 3K7UA 1QSED 3L9RB 4JDZA 3I75A 1EEYB 2IANE 4WIQA 5CJ5A 2W0LA 4OCSL 1KLUA 1EHAA 2Y5TA 1JZ5A 2X40A 3GHBL 3ARVA 2VLJA 1I9RL 2YZ8A 1YPZF 2IADA 1BREA 2HT3C 2HTKD 4PJXE 1U8QB 2VXTL 1OT2A 1KACB 1Q0XL 5EO0B 4HSQA 1F58L 2R4RH 4PJ5B 4I77H 3G04A 5INCA 1LO3H 3OSKA 4MNGA 3QP3A 4JPIA 2ZKHH 4N0UA 1OB1A 4O2CB 1CG9A 4U0RB 3VG0H 1KSRA 3ORJA 2XRAH 5F1KC 6CGTA 2QR0B 3DO7B 1P4LB 4S0TD 3EUUA 1YJDC 5D7IE 3ZE2F 3MV11 3ALXA 1ND0A 1WT5C 3UBXB 4OT1L 3RA7H 4LCYA 4NHUA 3SBWC 4HIIA 1CQYA 1PVHA 1ZHBB 1I7TB 4EXKA 2COQA 1BAFH 4IRSC 4Q9QL 5HSFA 4JY4B 1SYSB 3C5JB 3QUZC 1ACYH 5FKAA 5EIIB 4FQQA 4BM7A 4QRRD 4JY6A 1CXFA 4MJ2A 4PRDB 1LK3H 2BVQB 5ACMA 2OL3A 2XZCL 2FL5B 4BYHA 4ZQKB 5KSUB 1OTSD 2HVJA 1JZ7A 1J8HE 1R5VB 5JPMB 2VLKB 3FQWA 5BRZB 1BD2D 3CSYB 4OQTH 5JZ7C 3BIBX 5GGSY 1RK0A 3SCMC 1JYXA 3X11B 2VAAB 2C3VA 4FQPA 3LIZH 4KKNA 2F53A 3AS2A 4UT6H 4PJ7B 2DL2A 4MA1B 5GISL 4ACPA 2NR6C 4GUPB 1KNOB 4ZOBA 3Q6FB 4QRSA 3KNBB 3MOQA 3VGBA 5FHAL 4OJFH 4S1DC 5B38G 1NCDH 1DUYA 3WIIH 1YEDA 2ADGA 4KZEH 4EI6A 1JGLH 1A6VH 5D1XB 4NM8H 1P84K 2KUTA 1WAAF 3RZCD 4J1UA 4OGYH 3P9LB 3H0TB 3JWDH 3IB4A 5SWZE 3QUMA 2J7LA 3SGEH 1GZQA 5SX4H 4QNPF 5F6IB 3WIFB 5A43C 2VUYA 5ACZB 4LU5H 5AYQA 1P84J 4EIZC 3PWPB 4AY0A 4ZUUA 5B8CC 1QBMH 3JTTA 3BPNB 4M48L 1QKZH 5JMOC 2IBGA 3TIDB 5FYKL 4QWWD 1RZKH 3BT2H 1UWEH 4WUUD 4U3XA 3DVFA 4F33B 3IRPX 5DRWA 4XNQA 4Y4HA 1PQZA 2LU7A 4CADB 1UM4L 1OGTB 3GMLA 3QUML 5D1QD 1P9MA 1AXSB 2CDFB 3FQTB 4TNVK 4Y89A 5EC1A 2V17H 3RL2B 15C8H 5IT2L 5GGRA 4M62L 4BQ9A 4EI5C 2Z8RA 4JG1L 5DD3L 1FJ1B 1S7RA 3K74B 3VFTB 5ID1B 2AK4E 4HIJA 1NGXA 3Q1SH 5GGQL 3EO1A 1FFPB 2HVKB 4U1MB 4YFDB 2AK1H 4F7MB 1N7ML 3GMQB 1OSPL 4HEPG 2B1AL 1NUDA 5I66A 4HLZH 4HJGB 3SE9L 2BOCB 3GKWL 3D9AH 2DI8A 5INDB 3TV3H 5DMKA 5DFWH 1F3DJ 3I6LD 5F96L 5JMRA 5JORB 4ZFZB 2YEZB 4P46C 3KS0H 4S0SD 2XN9E 4MWFB 2MTPA 1KB5B 1NGYB 2X4RB 5JHDE 1DZBA 4OFKA 1R3LA 2Z93A 1KXQE 2BRQA 2P5WA 3QH3A 1VEMA 4M43H 4NO2A 3X3FL 2VQ1B 4LU5L 1G7QA 4KTEL 3N1MC 4WWID 3EO0A 1MRCH 2R23A 2GJ6E 4WJ5B 5DD6B 4XCYB 4HBCL 3CCHA 4XPBH 3RI5K 4KHXL 3CD4A 2OR8A 3DUUB 3G5XB 2PO6D 1X4XA 4LCCC 2WBJA 3VFNA 2FEEL 4WWKD 5DEZA 4ETYA 4HV8B 1LO2L 2DQIL 1DQQA 3ULUF 4GRWF 4PRHD 3NZ8A 4DZBB 5EUOB 1SJEB 4APQB 5F93C 3P73B 1JV5A 4CBPA 1U95B 3OAYK 4DW2L 1WIPA 3BX7C 4M6NH 3TBSB 4JRWA 4LK4A 3SGKA 4YIQA 5TE4H 4DOHB 3IJSB 1VESA 2NY6D 4EUPH 4KI5E 3O3EB 3OF6A 4L3EB 1C8PA 2MJWA 4CMMA 1J5OL 2VDMH 3EJZC 3TO4A 2VLRA 4LSSH 1JPGA 1OCWH 3M17B 3NFSH 2CRIA 5C6PB 4NDMA 4ZOAA 2DWDB 3QA3A 3VFMA 5DC0A 1YMME 1EGJH 1MELA 4X8XA 3TM6A 3BYTA 5AUMA 3AREC 4NP4L 3RKDD 2XWBB 3LZFL 1QLRA 4DKEH 3DSNA 5DJDB 5ILTH 1JZ3A 3ZE1F 4BSJA 1PY9A 2FX8L 4FTVD 2ZP0T 5D6CA 2GTZA 1UADC 3BVNA 5HGDA 4TSAL 4ZSOA 4YHMH 1KJ3H 4QHLB 2IAMA 1VEOA 2P24A 4MB4A 2ADIA 2RR3A 1S5IL 3I85A 1YUHA 2UWEB 1WISA 1NBZA 2YUWA 4M43L 4ZPTA 1N5YL 3V0WL 2VDPL 1MHEA 1P2CA 5JQ6H 4XBEL 2EYRA 4R7NB 3HHRB 1U8JB 1Q1JH 1Z0NA 4LSSL 2I07A 5C0IA 1HKLL 4X7DC 5J6GB 3HMXH 2H2PC 3O6LH 3QEGL 1UJ3A 1VERA 3STLA 3VGDA 1KG0A 3GO1H 1DBAH 3QEGH 3CJJA 2D9CA 4M7ZB 5I1HL 3INUL 4LKXB 4GH7B 3D85B 4H1LA 4X80L 1E27B 5DVLA 1QRNA 2A77L 4MD4B 4G8GB 4OD2B 5L2KA 4Y5VC 4YDJB 5FUZH 3EYFB 3TN0D 2Q3ZA 5HHVL 3FRPG 4FABH 2VE6B 3WNNA 1LHZA 2BP3A 3B9KB 2AXFA 2AV7A 3BPOB 4YAQA 1J0IA 4RFOL 3MLUH 3ZT6A 1CDGA 4DJMA 5BRZD 3BZDA 4PJ5D 3P3YA 1E4XH 3GGWA 1IC4L 3QUMH 4QRUA 4JFPA 4KJYA 2WUCH 1JI2A 1AO7B 4O5LL 1LK2A 4PLJC 4GS7C 4J7RA 1P6FA 1UYWL 2NXYB 3MRKA 3UPRB 5I15L 1B0GA 1YNKL 5E2WL 4OV5A 1AD0B 1FVEA 3EDDA 5GRYA 4XNZB 4HEME 4ESKA 3FFDA 3C8KA 2YBRA 3RNQA 2JJUA 1RURL 1CU4H 5HHPB 4HG4J 3IXAB 5B3NA 4DEPC 3RBGA 1MLBA 5D7LB 2ATPA 3OB0K 2EYSB 4OZHF 3GNML 4I5BA 5HI5D 5IK3B 1O5DT 3MLSH 1YZZA 4G6JL 3QB7C 1B6DA 3BN9C 1KTRL 3MRHB 1NAMB 1KB9K 4FQCH 4KV5F 3CFJB 5LKNA 1KULA 4M5ZL 5FGCB 4I9WD 1FL3B 2I9LB 4LHUB 4G3YL 5CHNA 3BWAB 4OIBA 1JWSB 5HVGB 1U8HB 3WFCL 4FRWA 3FO9A 3GSWB 4XPHL 4PJAA 2Q20A 3DVIA 2CKBH 2QHRL 3CMOL 3LPWA 1U3HD 1U42A 4JG0L 4QOKB 3E6FB 5DZLA 3HZVB 2ZPKL 2ORBL 2DKMA 1FL3A 1QHPA 4XP4H 3GMPA 1CGTA 3UTOA 3T77B 1E6JL 1MHHB 3FOMA 4I77L 3F58H 2BY1A 2AEPH 4I2XE 4I5BB 3CXDH 3ZDYE 4HKXB 2ATPB 5E6ZA 1S7QB 2GK0A 3ARBC 2W38A 1A5FL 3U9PH 2ZG1A 4IHOB 4WY7H 3QFJA 3MJ8A 4ETQA 1I9JL 1MJ8H 1LO4H 2YUVA 1DBMH 1I3UA 1U8LB 4UDTA 4XP1H 5EU4B 2JKXA 1RUPH 3LB6D 4U0RC 5GRXG 1CLOH 1U6AH 3VXPA 1B0GB 3IFNL 4ZXBC 4WO4D 3TP4A 5E2VL 2PF6A 3PV6A 2H6PA 3QG7L 4HDIA 5HYFA 1IGYA 2WBKA 1HIMH 2WMPA 4GRMB 3MYJB 1BVKA 3DMMB 4JO2L 3ISWA 4WHTB 2VDOH 3UJTH 5DJ0B 4JM4H 4JJ5A 4P4KC 5C0BB 5TFSH 1H3XA 4P2RB 4KI1A 1L9MA 4E0RB 4JQIL 2W07A 1OP3H 1FL5A 3QRGH 3S5LB 2AV7B 2J88L 2A74B 5EU3B 2NX5E 1GJIA 1LP9E 1SYVB 2AGJL 4IOIA 25C8H 5E99L 1OTSC 2R0ZH 1S7SB 4XCCH 2P5EB