3LRGA

Structure of anti-huntingtin vl domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
SQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVLSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-huntingtin VL domain
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrgA00
1IQWL 1VADA 2ERJC 1OAXL 4O51A 1IL1A 4LLVA 3BKCH 1KPUB 1A6AA 5D2NC 3SE8H 1T83C 3A6CL 4XPAL 3LY6A 1MJ7H 5FA4B 3B83A 3DX9B 4XBGB 4X4ME 1FC1A 3IF1B 1RVFL 3QDGE 4LU5L 3FMGL 3HA0A 3VJ6B 3F5WA 1X4ZA 1RK1B 3FHAA 3VXMA 3HR6A 2D0GA 4JFFE 4J3SA 2DQFA 3DMMD 3FOLA 1TNMA 1LK3L 4U1GB 1MEXL 4C56B 4PJAF 1MCWM 1UA6H 3KXFB 4XB7A 5AD0A 3Q0HA 2GSGB 2OX5A 5IESL 3DMMA 4W81A 5BRZD 1A3RH 5E1AB 3MJ9H 3UROR 3VU2A 4NCC2 3PQYE 3JV0A 2X70A 4RGNC 1DQDL 4Z9KB 5T1LD 3D0LA 2VQTA 4YR6A 1PW3A 3LKOA 1TXKA 4J1UB 5BRZA 1MHHA 4RISH 2R29L 3M07A 5D1QB 2MQ0A 2HG5A 1CGWA 1BFTA 1UXSA 5T1LA 2O61B 5FYLH 5F1NB 5MENB 3T77B 5HYIA 1I1FB 3I3DA 1VPOL 3OPZL 2UY7A 2DYPB 2C1OB 5EBMA 2IH3A 5L6YH 4KPHL 1CK0H 1OL0A 3QPQD 2F5BL 4UILL 3HZVB 3V5DB 1J1PH 1K2DB 4BQBA 3KS0J 3KJ6L 2XZCH 3DETD 3OKYA 4TVPH 4PJ9A 4WI2A 1ZLSL 2UUDK 3STLB 5CMAA 5J6GB 3WDHA 2R69H 3KPPB 1CGSH 2V5RA 3IXTB 4NKDA 3IFLH 1CL7H 1IARB 4PJCE 1NGQH 1YJDL 4YHKH 3RDTA 2YPLB 1NLBH 4JZNA 3BKML 4X6FB 1EEYB 2NY7L 5EN2B 2WLYA 3SJVE 3ZHDA 4IIQA 3C09B 5ACLA 3KG5A 3W9DB 3K0WA 2IG2H 4KQ3H 2EIZA 3SGJC 3MFFB 5DWUH 1A9EA 2BSTA 4Z7UB 1VADB 4O51B 3MUY1 3QWQB 2OR8A 3DUHA 3E0GA 4NZTL 1QFHA 4LLVB 5FO7A 4JPVH 2PYEE 3NCFB 1UJ3C 1A6AB 4PJCF 4TQEL 4Z7NE 4HUVA 4J8RB 2BCKA 4XP6H 3MRFA 4BK4A 5L7XL 4GXUN 2HKFH 4M5ZL 5J11C 3I6GA 5L8LB 1X5ZA 4HUUA 4KK6D 4LNRB 3WXWH 1MCPH 1IC1A 3RWDA 3VXMB 4K23L 2LVEA 3D69A 1OB1A 2IQ9H 3DPBA 3FOLB 3UZQA 2ZNXA 1CIDA 1ZT7B 4FQQA 5AG9A 4F3FB 1PG7H 2X4SA 2P1YA 1EAPA 5AD0B 1KELH 4Z7NF 4WFFE 3JV5A 4GAFB 1R5WA 3HHRB 5TE6H 1UT9A 4M62H 1T6VN 1WIPA 5DRWB 1FL5A 5FF6A 4YHYB 4YR6B 5AEAA 3LKOB 1W72L 3AFLA 1I3GH 1HWHB 1MHHB 4P2RD 4GT7A 5C0CD 1DEEA 4GBXB 5FYKL 3NPSB 1XIWC 2AJYH 2HG5B 2ZUVA 3RAJL 1FLTX 2Z8WC 2DKSA 3FO1A 4Z76A 3LQMA 4NKIL 5DJAB 1G6RA 2DQEL 4P2RA 1ITCA 4YC2B 5C0CA 3O3BA 5IT2H 1DCLA 3PWVA 4G6KH 5KVFH 4FQ1H 2A77H 1RJLB 4PTTA 2IH3B 3OF6D 2P47B 2WUCL 1FDLH 1RHFA 4MWFA 3MTRA 4J6RL 4YHLL 1Z6JT 4R4NC 5E7FA 2EYRB 5JHDE 1KCRH 4M6OL 1E4XH 4WFEE 3KYMA 4HDIA 3OF6A 4PJ9B 1JI1A 2ICWI 5CMAB 5D70L 1WC7A 4ZFOB 4QXTB 1ND0A 4HK0B 3U1SL 3K4ZA 3WHE1 1H8NA 4W4OC 3RDTB 1DSFL 4NC0B 4JZNB 4XAKE 2HT4D 5C0RL 5I71B 5C0JB 4LSQH 4OF6A 4IIQB 4NDMA 4YFEA 4KWUA 2DICA 5C0GB 1NFDA 4AQOA 2BSTB 1ADQA 1S7TA 4NZUH 4PJBE 2VXQL 3S5LB 4PJ7A 3MLPA 2NLJA 4RRPG 3MLYH 4ZQKA 1MUJB 3O6ML 2Z8SA 4LCCA 1NCWL 4OZGB 4EIGB 3ARFA 4PB0H 1P4IL 2BCKB 3O0RH 3MRFB 4ZTPH 4N0UA 1VKXB 2WWMD 2ITDB 5LGHL 2B7DT 3I6GB 4WW2A 3F58H 3QBTB 5IF0A 2I27N 2HAZA 5KSAC 3IS1X 3RWDB 4PJBF 4XC3H 4L9LB 3D69B 4L8BB 1OB1B 3B9KC 2VDKL 1NCDH 2B5IB 4LRNL 2NY1D 1F4XH 3FB6A 2HKHH 4OBSA 5C0FB 4P9HC 4JHWH 1CE6A 1R5WB 4G8EA 4DQOH 4N8CL 1NDMB 1DUZB 5IM7A 1EUTA 4P5TC 3INUL 5FF6B 2XKUA 4P4KD 1AFVL 1C08B 1EHNA 4PJIA 2FJFA 3CDCA 5FHBH 3BEVA 3EGSB 1LVEA 3QNYA 4EXKA 4LSSH 5F7FA 4OSUH 4P4KA 4XPTL 4X7FC 5I9QC 3ZE2F 1KBGH 2GHWB 1G6RB 3BPLB 4F80A 2D0HA 4NQSA 1J86A 4YHOH 4ZUUA 4PTTB 3OGCA 4WO4C 4N9GB 1FYTD 3X3GH 5LWYH 1QLRB 4P2YA 3WJJA 1Q1JH 3RNQA 4LHQB 2VLRB 5ALCH 2VERN 4YX2H 3KYMB 4UTAL 3AU1A 4HDIB 3QUML 3VGFA 3QXUA 3S36L 3TH4T 4OV6F 1DBJL 2W0FA 4UOJA 2M2DA 4XCCH 4YO0A 3SBWC 3TGXA 4JN1L 4KI5E 3IDGB 1JWSA 1D5MA 3MLXL 3VXRA 2BSED 1U8OA 3F65A 1OGAA 5KSBE 1BPVA 3KPOA 3BAEH 3IDUA 3BKYL 5D7LE 4LQFH 1BQUA 1INDH 4RFEB 5T1DL 3DRQA 1XGUA 1IM9A 4I3SH 1NFDB 3U4BH 2NXZD 2VLJE 4NCDA 3QH3A 5C8JA 4PJ7B 5FV1L 5I1IH 2N4IA 4L4VE 1J8HD 4U1KB 4DOHB 1IEHA 2NLJB 2FEDC 3FO9A 4ZQKB 4KI5F 4KHXH 4LCCB 5C71A 1XCQB 3ARFB 2ED7A 2DQDL 5C2BH 5KSBF 3UCRA 4N0UB 5F3HA 5B22A 4PJEA 1R3KA 5DUPL 3CVIL 1N8ZB 3RFZC 1AGFA 2OJZL 3ELAT 3PWUB 1ZGLM 1HKLH 2VDML 3WKNA 5IVZA 5IF0B 1ETZB 3EJZD 4G8IB 2VO5A 4Q0XH 3C5ZC 4OCWL 1QEWA 4UT9H 2L7UA 5F70A 1LP9F 1IC4H 1VSCA 3LS4L 2XZQL 3BKJL 4NO0D 4YBHA 3FB6B 3EZJB 5F7EL 1IMHC 3ZT7A 3CXDL 2ITCA 4G8EB 3WFHA 1E4WL 8FABB 3FRUA 5IM7B 4TUKL 5HGHB 5TFSL 5HVFB 4M8QA 4NO0A 4JRXD 2PTTA 4D9LL 4MAUH 3KPTA 1CDJA 3ECBA 3T0AA 4LP4A 4PJIB 3X3FH 4DJMA 5DR5H 4NZRL 3O2DL 3LRHA 2EICA 1FSKB 4N1CA 4XMPH 1XF4A 4DFIA 1NL0L 3KYOA 1UM4L 2VAAB 3GB7A 2ORBL 4LDEB 4G5ZL 5K33A 3IYLW 4HGWA 4YDKL 1KC5H 2G2RB 4NQSB 1UZ6E 4Z7VF 3V0VB 4OUOA 1FRGH 4BQ9A 4YDJA 5KBNC 4HGKC 3LN4B 1R3JA 1B90A 3RNQB 3B5GA 4BKLA 3QDMD 2RFXB 5T5NG 3AU1B 1UXWA 3NH7H 3GSQB 5EO0A 1YMMA 2WLZA 4R7NA 1EIBA 4EN3D 5HDBF 4G9DA 2IANA 2MHAB 1F3DH 3QDMA 3LEXA 3QUMA 2XNAA 4HKBA 5MEOB 1EZVX 3B2UD 3VXRB 1V3LA 1U8OB 1OGAB 3KPOB 4L8SB 4DVBA 1G6RH 2EDKA 2AEQL 4GKSB 3DRQB 5HXMA 2EDDA 1IM9B 4APQD 1G6VK 1RUMH 2EZ0D 4YUEL 2HN7B 1UCBL 3EFDH 1TJGL 2WINA 3I9GL 2HJKA 3BPOB 4M9OA 1G7MA 1A7PL 3FO9B 1U3JA 1H15A 4ONHB 2VZ3A 4MDIB 4UIKL 5I1JH 3WFEH 3AMKA 2ADJA 5C08B 1RJCA 2VITA 1PGRB 1R3KB 1YUHB 4PJEB 1XZ0A 1HNGA 1OAQL 5DMJB 3VWJD 1H3GA 5GS0C 3GMNA 4YGAB 1KJ3L 1CU4L 3QCUL 3O4LE 1QEWB 3ARQA 1MFNA 1WFUA 2FATH 4TSCL 2AEWA 2W1NA 2C4FT 5CJ8A 5SWSA 1ADQH 3BJ91 3ZSSA 1FVCA 2BNUA 3L3DB 4PRPE 3VXUD 1CICD 4JO1L 2ITCB 3MLRH 3T1FA 2J3SA 3TT3L 1RJZA 1I3RB 4KTYA 4OGZA 3FRUB 4OLEA 2KQMA 4M8QB 1CICA 3H9SD 6FABH 3ECBB 1YDPA 4M1CC 1XF4B 3V6FB 3FCTB 3KYOB 3OKMA 4B41A 5E2JA 1AQKL 2CUMA 1FE8H 2BX5A 3H9SA 4H0GA 3PHQA 4Y1AE 3U36A 4JZJA 1I3UA 2CD0A 4DKAA 5GHWH 3ARWA 4I0PC 4BZ1L 3SQBA 4YDJB 3ZYJA 2BK8A 3W11C 2HLAB 3N85L 4GW1A 1R3JB 3IDYC 3GHBH 3BISA 1C5CL 2E9JA 5IVOA 3NA9L 1FNGB 2MFNA 4QOKE 5FGCB 1FO0B 1UXWB 3P4LA 1E4JA 1YMMB 4XP5H 3JVGC 3WSQH 1CD0A 3BWAB 1BOYA 3HE7C 2IANB 2WWKT 3LEXB 3QRGL 4NQCD 2XNAB 4HKBB 4NUJB 2B2XH 2F53D 5C9KA 4QHLA 2FDBP 2DD8L 1J1OH 4Y16D 1WK0A 4HBCL 3L1OH 3VDCA 4KRPB 1IGML 4DVBB 3AS0A 1HHJA 4NQCA 1PQZA 3DIFA 5HYEA 3BSZH 2F53A 4OCSH 1LDPL 4Y16A 4QRTB 4EUPA 3LKSB 4HS6A 1G7MB 1BF2A 5F9AC 1MHEB 5GRVK 1H15B 5ECJE 3T09A 3B5HA 2WQRA 4HWZA 4FFVC 4UB0H 2CK2A 3OAYK 2FBJH 2IC2A 4OZHE 1XZ0B 1VCAA 4H1LA 4CAGA 5DJCB 3GMQA 4EIZC 3PXHA 5EPMA 5EU6E 3VFUA 5DD0L 1W8NA 2UVFA 4E41D 1JBJA 2EKJA 2AK1H 4X4XB 4LLUA 3T2OA 2JJUA 2CKNA 5SWSB 2OMNA 5GRVL 5EZJB 1L0XA 5A43C 3QZWB 4Y88A 5D1ZD 3IDXL 2DQJH 3C08H 1MPAH 1NFIA 4XNMB 4E41A 2X41A 4F15B 4F7EB 1RJZB 4RMTA 3QYCA 4Y0GA 1D5ZB 5CCKL 2K1MA 4LL9A 3VDAA 5M95B 2EC9T 2N56A 1FNAA 3QEGH 5KG9B 1CFVH 5F1SA 4F8QA 4ZMAT 1N7ML 2BVYA 3MC0A 1MI5B 4TOYL 1AXSB 4I0CC 1UACH 1F13A 3DVIA 1UM5H 2DQHH 1KB5L 3DUSA 3VD7A 5CUSL 1QTYT 2QHRL 3I84A 5D71H 5JZ7C 4XPGH 1B4JL 1L7IH 4Z7QE 4XVSL 5F7NC 4UOW0 5DTFB 4Q58C 5I8EA 3LCYA 1CDGA 3IRPX 5TDOB 4GW1B 2HLFC 1FL6A 4BSWA 1I9RL 2A9MH 5FGSA 5I6XB 1S9VB 1LK2A 2B4CH 5E4EB 5L9DH 5GSRA 3QI9C 3TV3L 3DLQR 3GKWH 2A9NL 2FH8A 1XGYH 4BQ8A 3AMLA 5C0DA 4MZ3A 1PX4A 4HD9A 2IH1A 4B50A 1MFCL 3EHBC 3ARBD 3AROA 1RY7B 4UV7L 4U05A 3OR7A 5T5FH 3VFGH 4Z7QF 4HUKB 1QFWL 3VFRA 1KIQA 3QDHA 1I9JL 2HYMA 2QADD 1MFBH 4G7YH 2Q86A 1BFSA 5AYUL 2Z91A 3WDIA 3GI8L 3ARBA 4LGPB 2HTKC 2CXKA 1JTPA 2I26N 1XMWA 1MRDH 5EO1B 1Q0YH 3WS6A 4JRYE 5J3HC 1EBAA 1OAZH 4PP1D 4Y5YC 1FO0H 4XNUH 5JOFB 2YUVA 4HWZB 2W91A 3IETB 3TC9A 4D0BA 2Y5TA 4ELMA 2GITA 4ORGB 4YXHH 3PDGA 4LBEB 3GM0A 4NJAH 4V2BA 5B38B 2YRLA 3AS2A 5J06A 1N6QH 2HJLA 1WAAE 3B8SA 5I8CA 4JFDE 2VDLL 4RQQA 4TUJA 4LLUB 4CMMA 2VISB 2PYFB 2EECA 3Q5TA 2LTQC 1B0RB 3CZFA 1HHHA 5IB2B 4MNGE 5FYLL 4NUGH 1A1NA 2LABA 5DUML 2H8PB 2BNQE 1WAAF 2P24A 1A6UL 2BHZA 5GSVA 3QIBC 1IGTA 2FNBA 2FO1A 4P23B 4JFPB 2JJTC 4Y4FB 3DUSB 3MV7B 5GRWA 1J1PL 2Y23A 3ESUF 5E5MA 3MBXH 5I76B 5E1HB 3R8QA 2BP3A 1BGXL 1EO5A 5TE7H 3S36X 4U1MA 1AGDB 2EDYA 5EU7C 1FL6B 3MGTB 4BSWB 2BDNH 1I7ZA 1CL7L 4JO4H 1LK2B 2C4FU 3T0WA 2FX7L 3U7YL 3R0NA 1ES0B 4JKPL 4J12A 4LCWA 5ESAA 2IG2L 4NN7B 5DWUL 2COQA 2IH1B 2C1PB 1XGQB 1N5AA 4HUWA 1IGJA 1OHQA 2DQIL 3VGAB 3MCLL 5HHOB 4D9QD 4CMHB 5T33H 4LSTH 3H7BB 4LASL 2G75B 1A7NH 2X1QA 3WFCL 2W59A 4BFIB 1OCWH 1HXYA 3ZE0E 5GGRY 3V8OA 3RU8L 4GJTB 4WFGE 1Q38A 3FFDB 2QHLA 3B8YA 5LGJB 4AQ1B 4U3HA 3WXWL 2ED8A 4L1HA 1MIMH 2IQ9L 4Z7VB 4ELMB 3TPKA 2GITB 4CJ0A 2YS4A 4X6CE 3RQ3A 3G6DH 1J12A 2NR6C 1KELL 3MV9A 5E2VH 1HHIA 3VWKC 1I9IH 3ZE0F 1HHKA 1NMCC 2HJLB 3L7FA 5I8CB 4QWWD 5FM5O 5TE6L 4M62L 4RQQB 1T89A 4U3CA 5E8PB 3KLDA 4TUJB 4X7SL 2WBJC 5F3BA 4QCIA 3U2SA 1I3GL 3EO1A 1CLOH 4JVWA 2R4SH 4X6CF 3WUWG 5E9DA 2WQ8A 4XHJD 2X05A 1HHHB 1BIIB 1RZGA 1A1NB 1Z9MA 3BYTA 3L3KA 4H25A 2B0SH 1XR8A 5IT2L 1JYXA 4PRID 4FQ1L 3WFBH 1OP5H 3EAKA 2I60L 2FJGA 3QFJA 5F7UA 5EBGA 3NAAH 1N3NB 4J3XA 1BWWA 4MNQD 1EDQA 1FNLA 5GJTL 1KCRL 3QDJB 1E4XL 1JF5A 2OM5A 4C83A 4PRIA 5FKAB 3V8CA 5B3NA 4PBWD 4MNQA 1U41A 4OKVB 4H0IA 5I1KH 1FL3A 1UYWH 5EU4A 2PETA 1MCJA 4HUMB 4LCWB 4WUUA 1KJVA 3FT4A 1N59B 3RX8A 1CD1A 4QT5A 4L3EE 2GEEA 2GFBA 1N5AB 5I74C 3C5SB 4FQXD 3SDDC 3BX7C 1B0WA 4NWUH 5GGSA 4ZO9A 2ICEB 2YC1A 1CGTA 1C5DB 4DUWA 2F19L 4FXGA 1GPOL 1BVLA 1HXYB 1WT5C 3O0RL 2X1OA 4ZTPL 4FQXA 1TVHA 4MVBC 3U9UA 1INEH 3HC4H 4G80B 4O5LH 3QXDB 4ZS7L 2UZYB 4WENB 2EDOA 3OKNA 2APXA 3EOTH 2A1WH 5DEGA 3WXVH 4RA3A 2CRYA 2D7OA 4HGMA 3TVMB 1BJ1H 5I66A 4M03A 4XC3L 1I4FB 3RVUC 1EXUA 3ZDYE 1DQTA 2J1KA 5DVMA 1OAYL 5ETUB 1IAKB 1AO7A 2ZG1A 3E8UH 5I1HH 3BEWB 5EC1A 3MV9B 5IOPB 1F4XL 2VJXA 1YQ2A 1HHIB 1IAOA 5CILH 3WLWD 5J4MA 5IMMA 3LQZA 4YHZH 3L7FB 2D7NA 3D39D 4IRZH 4X8XA 5J12B 1PSKL 3QQ4B 3EOBB 3BDYL 5ILTH 2QQKH 2JE8A 1BFOB 1RHHA 4QHKI 5F3BB 2AEPH 4QCIB 4XP1H 5FO8A 3U2SB 1CLCA 2X9XA 3EO1B 1YN7A 3W9EB 3D39A 2PUQT 4MD4B 2R1XA 1E4KA 1WUNT 3MJ7B 3MLZL 5E9DB 5FAAA 5IKCA 3JTTA 1RZGB 2QSCH 4K94C 2UZXB 2F58H 1OAUL 4IOFD 5DLMH 4RNRA 5C0BA 3L3KB 5IB4A 4H25B 4KJPC 4XWOD 2V5SA 4N68A 2FH6A 1S9XA 3E2HB 3QFJB 4WY7L 4DTGH 5BS0E 3BP7A 5LWYL 4LVOB 4PY8I 4KRMB 4OFPA 4HLZH 5IEHA 5T3XE 1J0JA 3VRLE 3K2MC 2DDQL 4EUPG 2G60H 1CR9H 2ILLA 4OZIE 4LSRL 1LO2H 2KZWA 4WTXA 1QBAA 1C7TA 4K71C 2FR4B 2ZZUT 3AVEA 1TZHA 3BUYA 5F8RC 4D0CA 4ZODA 1EZVY 1U91A 4F2MA 4XT1C 5IB5B 1FL3B 5EU4B 1M7IA 3V52L 5T3ZE 4JFZL 3WFZA 4HH8A 4WUUB 4H1LG 3FT4B 3C87A 4AMKH 5LVEA 3VRLF 2VDRH 5K9OA 3U4BL 1DQMH 2GFBB 5J89A 4KVNH 2X89D 1NEZB 2E27L 3CDGB 4HKXA 5I8OH 3RWJB 1QNZH 3W0WE 4ELKA 4KHXL 1OY3B 1YYLL 1HHGA 5F6IB 1MCWW 1QSED 3DXAD 2R4RH 4FXGB 4YXLL 1BVLB 5KS9A 4QGTA 4IOSD 1H3TA 1TVHB 3EOYG 4ZFOL 5GGQL 2R9HD 4Y5XC 4N0YH 5BZWA 1GHFL 5DEGB 3VGEA 2CR6A 5JXAH 1QSEA 1FZOA 2XWJB 4JFHE 3ZTNH 3G5VA 5E6ZA 3EDEA 1EXUB 1G9NC 3RWCA 4UT7H 1NKRA 5DJ6A 3TN0C 2R8SH 3Q6FB 1BZ9A 2QKIA 4LDLB 1AO7B 4LDOB 1AE6L 2VSDA 1V3KA 4WVRA 3WN5A 3PWPE 3RVWC 2PXYA 1IAOB 1HZHL 1U2CA 4NRXB 3BGMA 4AIZB 4RGNE 1VESA 3DYPA 4WHYG 5FCUL 2FSEA 1WFNA 4XH2A 2X4OA 3REWB 4G9FE 5SWQB 1U3HD 3SDXB 1RHHB 1CGVA 15C8H 3X3FL 4PJGB 4MXQD 1X5XA 4XMPL 1EEZA 3CPLB 4HJ0C 3GI9L 1KSRA 3E3QC 3GHEH 3VD5A 3GBMH 1U3HA 2O5ZH 1PEZA 5KTEH 1F58H 4I18A 4P46C 3OHXA 4QNPF 4PRAB 4RNRB 5C0BB 4ZUSA 1U42A 4OQTH 5IB4B 2YKLH 3HG1A 2RR3A 5DMKB 2BSRA 2RAMA 1SBSL 5IQ7L 4QRUA 1HWGB 1JPSH 3A6OA 3K2UL 2PO6A 4GLRI 2XTJD 3BRFA 2XQBH 3NH7L 3P73A 1YY9C 4GBXD 1WCQA 4PJ8B 4LVNB 3V6OA 1OARL 1TZHB 3BUYB 3WIIL 1G7HA 4U6YA 4FOMA 4D0CB 3IFNH 4HMEA 1U91B 3L5HA 2DQTL 4F2MB 12E8H 5IB3B 2V9QA 4CDGC 2ADIA 3NACH 2CLZA 3MGOB 2J6EH 1F3DJ 3MROA 1MCBA 5J9PA 1CN4A 4XNZB 4MJ6A 2AK4B 2NZ9C 1WICA 3OJ2C 4PJHA 3FO0H 1IT9H 5A3ID 1AXTL 3HMXL 2ESVB 2OL3A 4IHOB 3PDDA 2D7PA 2P8PB 3UTTD 5FGBA 1FCCA 2P8LA 3S96B 2VXSL 2WSKA 5CZXC 4FP8H 1HHGB 3D9AH 1I7RA 4PRHE 4NO5A 4W6YB 5A2JH 3FFCD 2OQJB 3UTTA 5J57B 4DVRH 4ZS6C 1JRHL 2YEZA 5BZWB 4YFLF 5HDQL 3MV8B 1FZOB 2X1XR 3GSUA 3C60A 3G5VB 2FX8H 3MLSH 3RWCB 1NCTA 2YD1A 3SN6N 5DJ6B 2H2SC 1A47A 4K9EH 1U8QA 2FATL 3T8XB 1RURL 3EIFA 3OGOE 3KLHD 3ABZA 1DVFC 3HUJE 4OCYL 3NZHL 4QLRA 1WZ1L 2PXYB 5HBBA 1IEAA 2VR4A 4PV9A 3NN8A 3Q5YA 1QR4A 3BGMB 2IQAB 5CP7A 2C3HA 4PGDA 2FSEB 1KFAL 2IAMD 1ZHKA 1I7UA 1X9QA 2OI9B 1N0LA 3RTQA 1KN4H 1RFDH 3MRMB 3ULVH 2V9RA 1HCVA 2VDNH 5IHBA 1CLYL 1EEZB 2GTWB 1N26A 3KPRD 1LE5B 3L5WB 2IAMA 5IMOA 3VW3H 3QA3A 3HUJF 3WIHL 5HTSA 4DW2L 5KJRL 4Z0BH 4I18B 2E7HA 3CAFA 1D5XA 4J3TA 4ZOAA 4ZUSB 3D18B 3HG1B 3PG2A 1G0DA 4OM1H 3UBXG 3KPRA 3TNNB 2BSRB 2NMSA 5I1EL 3O3EB 4QRUB 3RKDD 3BZFB 2XWBB 3MRCB 4ALAH 4XCYB 3FONB 4AG4H 1KEMH 2PO6B 4DZ8B 3P73B 1YNLL 4XP5L 1QSFD 4X99A 3STBA 3C8KB 3QXVA 5DA4A 3CH8A 3V5KA 4U6YB 3MFGB 1QFUL 3ZMRA 2B2XL 4R9HA 3W39B 1ZWIB 2WK2A 3VDBA 2CLZB 1QSFA 5A1AA 3MROB 4C4KO 4WTWA 3NGBB 4WU7A 5BW7A 5KSUA 1MCKA 4YHNB 3C6LB 4MJ6B 2W65A 4OCSL 4OGXL 2O5YL 4TSBH 2P43B 4JLRB 3M1BA 3U46A 4X9IA 1P9MA 1FN4A 1I7RB 5IROC 3MRBB 1RSFA 3DHMA 5HD8C 3PP4L 2YEZB 3VXPB 2JKXA 3OXRA 4HXBH 1VFUA 3GSUB 3C60B 3HC3L 4JR9L 4XXCC 4Z5RA 2CO7B 1GC1H 3MV11 2P5WE 1T5WA 1HQ4A 4PJ5B 5FGRA 1F45A 1NQBA 4X6DE 2AI0H 2R0ZH 1J88A 4ETQB 1NCCL 2YRPA 4PJXB 4U1GC 4PV9B 3ZKMC 1RZ7H 2DL9A 2EDHA 3HE6D 3NN8B 1K85A 4MZ2A 4FQIH 5CP7B 3TBSB 2CGRL 3I6KB 1E0OB 3O2VH 4PGDB 1EV2E 1ZHKB 1I7UB 5A2IH 3CMOL 4XRCB 1YEIL 2CLVA 3RTQB 4NM4L 3P30H 5D93B 2LU7A 5JHLL 4WW1A 3HRZA 1WISA 3BD3A 4CVZA 2HTLC 3GRWL 4X6DF 1RK0B 2YZ1A 4FTVE 4NQEB 1D5XB 4OLXH 3BN9C 3DI2B 4P3CL 4LFHD 2BZDA 5D1QC 2FECL 3VI4E 5D71L 4HMDA 4BH8B 1JE6A 1FCGA 3EFFB 4UDUA 4OM0L 3UPAA 3TFKD 2QL1A 5GRUH 3D25B 2D03H 4PPTA 2A74A 4YIQB 1IGCL 4PR5B 4LIQE 1JJUA 1F5WA 2A9ML 2E7BA 3WHXA 4OZ4A 1C5BH 5LQBL 3WV0A 5BV7L 3UTQB 4S1SH 2B4CL 2P7TA 5L9DL 2VZUA 2IFGA 1TCRA 3CMGA 3IAPA 5INDB 1T4KB 1JK8A 4TTDD 4MAYA 2GW5A 3CFEA 4NFCA 1DR9A 1GVIA 2O93L 1MFBL 3L6FA 5FV2A 1P4LB 2XWTA 4JJHA 3VD9A 2W65B 1NLDH 4MNHA 1JYNA 1JGLH 3QQ9D 4P3DB 4QRPB 1H0DB 1Z9OA 5I1AB 4P3WA 4WCYL 2W07A 3OAZH 3U46B 1FO0L 5DMIH 1IJ9A 1K4CA 5GISH 3EYQD 3L3GA 5GRXG 2NY4B 4Y5VB 4J3UA 4PRBA 1JHKL 2X42A 6CGTA 3QDGD 5DJYB 2PCPB 1KACB 3HI5H 1D5BB 2OTUA 5H37G 3OXRB 5F1KC 2ZCHL 4X98A 5CGYD 2MOVA 3ARDD 4JFFD 3MJ8A 2VABA 4GXVL 4Z5RB 5JORA 1Z5LA 4LHUD 1T04A 3ULUH 1FZKA 2A6JA 4CADB 1KG0A 3CSBA 1PAMA 2JCCE 4ONOA 4M1GL 4NFDA 3ARDA 4JFFA 2Q6WA 1MLBA 5DZOA 4HKZA 3V0WH 3G08A 3IJYA 3NZ8A 4R6UA 2ZCKH 3PQYD 3DO7A 4YJZL 5DQJB 1V7MH 3RP1A 5ERWB 2NY5H 3DMMC 4BQ6A 4LOUC 2OJEA 3ARYA 1JNLH 2CLVB 5ALBH 2QR0B 5HI3C 2AS5M 1A02N 3BN3B 5HHXL 4OAWA 4YHYC 4WNQA 1ULVA 5IJKA 2JCCF 3VG0L 4RWHA 4O4YL 4KKBC 4QHUB 1KT2A 3BPNB 1MCCA 1OWWA 1WCBA 1HKFA 3NPSC 1QO3B 3SCMD 3TBWA 4M6NH 4I48B 1M7DB 5E8EA 2VB5A 4G6FB 5KZCB 1KB9K 2W60A 4YC2C 2BDNL 4U1HA 3WHXB 5B21A 3WLBA 5D2LE 3H9HA 4HKJA 3LRSB 4JO4L 5DMGD 3NFNB 3UYRH 3UDWA 2CIKA 4UU9A 2VDPH 3L5JA 3WNOA 5D2NB 2P7TB 3NCYP 5C07E 1D7FA 3OJDB 1QA9A 3SDAD 5IMKB 5LCVH 2VLLA 3MZTA 4LPCA 3KPNA 3BO8A 4POYA 2R2BA 4PJ9C 5DRNA 1NCBL 1RPQA 1U92A 4MAYB 3S37H 1P7KA 1FVEA 1SY6L 3SJVD 2BRRH 4L4TE 3H42L 4NFBA 3L6FB 3VXTA 5D2LF 2XWTB 4PJCA 2VWEC 3RDTC 5DDHA 3OZ9H 4E0RA 3DX8A 4M4PA 3CD4A 5I71C 3SJVA 5E2WL 3VCLB 2PYED 4IIQC 1KB9J 3PL6D 4JY5H 5ANMB 5GIRB 5LG1A 3EYOB 2X7LA 1HH9A 4MS8C 4WEBH 1MIML 2X4TB 4LEXH 1BQHG 3UJTH 3L3GB 3KPSA 3PL6A 3RZCD 4PFEA 1IAMA 3BVNA 3LQAL 3OMZA 5JXED 1E6JH 2QSTA 1QP1A 4LCYA 4X5LA 3QJHB 1I9IL 1OP5K 4B7IA 3KPLA 3S34H 2ZOKA 3MJ8B 2XYCA 1Z5LB 2CR3A 3NABH 2NX5E 1FZKB 1IFHH 3SKUD 5JXEA 2GQHA 2QBWA 4WFFD 4L9LC 5FDWA 3C2AH 4HC1A 4JG1L 2R4SL 3O6FA 5F97E 1F6LL 1WBXB 2B5IC 3G08B 1ZVHA 1OD7A 4K55A 4P2QA 4D8PB 3DO7B 1NC2D 2IBZX 4KKLD 2R2CA 3LEYL 3FQWA 4U6HA 2OJEB 4H20L 1TQBB 1ZAGA 5HJ3A 4HIEA 5HGAA 2G5RA 4ONGH 4Y4KD 1BWMA 4GW5B 4WNQB 4XMLL 3GBNL 1SJVA 4DN4H 1KT2B 5EUKA 1WCBB 1EO8L 4ZPVB 3MNVA 2E7LA 1QYGH 3TBWB 4Y4KA 1AHWB 1IC7H 3FQTB 2ZJSL 3WBDA 1CTOA 4LLWA 4FABH 3BPLC 4G8GB 1NANI 4R8WL 5JHDD 5I1KL 5DJDA 3H9HB 4HKJB 2VDQL 3O8XD 4WFED 1EVTC 5GGVL 1P1ZA 2CIKB 1ZK9A 4JKLA 5DQ9A 4H0HB 3IU3A 2J88L 1MJJA 3VFPB 1QA9B 4XBPA 5K9JH 1HN1A 5JHDA 4BFGA 1MNUH 4EOWL 3IJHB 2EDFA 3KPNB 3O8XA 4L8CA 1A1OA 1DBKL 2LV4A 4UQ3B 1FC2D 1FVEB 4FQ2H 4XAKD 4ERSH 4KK5D 3RUGE 5C70A 1LEKB 1F02I 4NKOA 2EEDA 3VXTB 4BZYA 2XI9A 1PDKA 3C8DA 4O5LL 2D7TH 1INQA 2X2YA 5LAXA 4EQ3A 4P2OD 1S7XB 2X7LB 1EFXD 4K07A 1EK3A 1WJ3A 1HH9B 5JPNB 3UYOD 2V2WA 4FQLL 3QPXH 5IFHH 1PBYA 3KPSB 3RUGF 3GSWB 1A9BB 3E8UL 4P2OA 1BJ1J 4R96B 4NSKB 4LCCC 4CN1A 1EFXA 3ARFC 3GJEB 4LCYB 3L3JA 2VIRA 1YEFL 3D2UB 4GG6E 3MR9B 1S5HA 3K80A 3KPLB 5DURD 4YHZL 2ZOKB 4IRZL 5FYKE 1RZKL 5C3TA 2C4XA 5D8JL 4OJFH 1I75A 1LDSA 4XI5D 3TA3A 5ILTL 2QQKL 3O9WD 4GUPA 1YPZA 2AEPL 1PKQA 1QBLH 2AJ3B 5FDWB 4XP1L 35C8L 1NH6A 2E7MA 3DSFL 2CDGA 3O6FB 3EUUA 4H26A 3ZLQC 2XRAL 3FZUD 4P2QB 2BNRD 4UBDD 4ZYKA 2QSCL 3GMOA 4PJDE 2F58L 4JM4H 1FYTE 4GG6F 3H0TA 1YQVH 1IGFL 4WHDA 3NFPA 5HI4D 1Y6KR 4HIEB 5HGAB 4N1HB 4YXKL 1FAKT 1VDGA 1A0QL 1ED3B 2DM2A 5TDPA 3IRZA 5EUKB 1RU9H 1FSKC 2G60L 3ALXA 3MNVB 1LO2L 5IGXH 1JZ3A 3W2DL 1ZT1B 3V5HB 1ZHBA 5L2KB 1S5IH 2ICWA 4YQXL 4GW4B 2UWEE 2O5XH 4HSQA 3O11B 5DQ9B 3WJJC 5FOBA 2YD7A 2HFTA 3QISA 4NPYA 1T0MB 1GCFA 4AMKL 1KTLA 4ODWA 4KI5D 2VDRL 5KN5B 1YC7A 2FHCA 4L8CB 1A1OB 3HB3D 3MYJB 5D7LD 1BJ8A 2YR3A 2E6QA 3KYNA 4LMQI 3JWOH 2VLJD 4L29A 4I4WA 4PV8A 3B2VL 5GQBA 4GO6B 4X5WA 4L8SC 5DJ2A 4GRWB 4L4VD 5D7LA 5EUOE 1HEZB 4ESKA 2APVA 3ZTNL 5IIEA 1Y6NR 4P59L 1R5VB 2VLJA 5A16A 2HT3D 1REIA 3BPOC 4KH2A 3U30B 3P3YA 4LARL 2VZSA 4HBQA 2ZCLL 4R4FL 2R8SL 1G0YR 2C3VA 5DI8A 1OTSC 1U36A 2FWOA 5BVPH 4Y4HD 4ZXBB 4Y2DD 2Q1EA 3MZGB 1D5IH 2AJSH 1CXHA 1C16A 3MOBL 4G7VH 4CNIB 3RVXD 1S5HB 4OTXL 4H5SA 5D7IA 1G7PB 4MYWB 3BT2H 3GDBA 5I9QB 3WKMH 3CFBA 3E6FB 5EUOF 3TA3B 4Y4HA 4GUPB 4KJYA 4R0LA 4X6BB 5C6TH 2GJJA 1YPZB 4LFHG 4LGSB 1PKQB 3LKNA 4CW1A 1DQLL 2X6MA 2X1PA 2CDGB 5E8NA 4H26B 1A6VH 2V6HA 4Z95H 4RDQG 3ZKNC 3HNVH 3MODL 4F58H 3THMH 2B20A 2Z4QB 3GBML 1F58L 4JFXA 4NOBA 4N1EA 1RULH 4R2GD 4JY6A 4EI5B 3D3VE 4XBEH 4ZFGH 4M6ML 3NFPB 4ODVL 2YK1H 1N4XL 4G6MH 3P0VH 4MD0A 4PG9B 2VC2H 2XN9E 1R0AH 2B4CC 3ILQD 3MXVH 1JPSL 3IB4A 2VMFA 2ARWA 1X7QB 5DMYA 3QHTC 2HFFA 3OR6A 4Z7WA 3UYPA 1LO4H 3VFOB 3GO1H 5C86A 2I25N 4XVJL 1G1YA 3IXAB 3TBTA 3P0YH 5EU7E 3DRTA 1EMTH 3QNXB 4NP4L 4WV1B 4JGUA 3O6KH 5T1KD 3AXLA 5B8CB 4N5ED 2YA1A 4M43H 4HPOH 3DHJA 2ZOLB 3KHOA 2J6EL 3UTSE 5HHNA 5FOBB 2EEBA 2XQYK 5T1KA 4LMQE 4NPYB 3MREB 4NHCL 1KPRA 4ODWB 3SDYL 1RIUL 1X44A 1IT9L 4HV8B 4UUJB 3RIFK 1JVKA 1ERNA 3FN3A 3HTLX 1NC4D 1CS6A 5D7JD 1VFAA 5TGBA 5LBSH 4KXZH 3C5ZB 4AEHL 1OF2B 3KYNB 4LHUG 5JLZA 3TIEB 2AABL 4MSWB 3PABB 4X5WB 5FKPA 4MB5A 3TYFA 2EDBA 4WI6A 1AGCB 5C09E 1RZIA 2IPUG 1GZPA 1II4E 2W9LA 1ORSA 3JWDL 2FX8L 4GRMA 4ODHL 4BFBD 3HCVB 3QHFH 3ROLA 4U7SA 1EEQA 1BM3L 2YUWA 4G8FB 3FQXB 4K9EL 5DI8B 1CFBA 2FWOB 5CIPA 3UC0H 1C16B 4KGJA 1K8IA 3TO4B 5D7IB 4YK4B 1B6UA 4JM2A 4A2LA 4WIQA 3CFBB 2F74B 5F21B 1YEJH 3ROOA 2VNCA 3DROB 3V0AC 3WUZA 1UC6A 2AKRA 4KJYB 1H3PH 4HCRL 7CGTA 3PWJA 2X4RA 4GRWH 2YD2A 4PRPD 1F2XK 1R3IH 2JB6B 4CW1B 4ZNEA 1CBVH 1KN4L 2EDTA 3MLWL 4XAWH 5J1AB 3O4LA 4WHCA 1RD6A 3MJGX 5DHVA 5JMOC 2DI9A 4FFZL 1JNNH 1P4BH 3VW3L 3BP4B 5B3JE 1MFAH 4Z0BL 5JW4M 2G5BA 4K8RH 1OQXA 4F15C 1A14H 3KPMA 4OM1L 4MD0B 3S7GA 4ZUWA 5E2TH 1T20A 4P5KA 1Y6MR 3NCMA 5CS7A 1S7RB 4Y1AD 2AGJL 1FHGA 1BZQK 3OG4B 4AG4L 4Z7WB 5DD1H 2A0LC 1L7TL 1LO0H 4PBVC 1GGIL 3MBED 4FFWC 3B9EA 3TBTB 5B3JF 3VFMB 3DRTB 1DQJA 4Y1AA 4JZJC 2DLHA 3MRQB 3BD4A 4ODTL 4QOKD 5GZOC 3D5OF 1N64L 5C0ND 3MBEA 2CH8A 2ZSVA 4GRLB 3VXSB 2NY2D 2HMID 2CKBA 5I6XC 2N7BA 4OLYH 2AQ3A 4QOKA 1ZTXL 5DD3L 2D7QA 3HFMH 5E4EC 4GFTB 2C3GA 3VRIA 1IILE 5TGBB 3DTXB 1XAUA 5DC9B 5AZ2L 3FT3B 5EOQL 2N1KA 3ARGD 4MCZB 2I5YH 3WYRA 5FB8A 4K7PH 5CEZL 4YDLB 1X5HA 5DVLA 2PTVA 3MOAL 5ENWB 4I3RL 1GZPB 1FLRH 4GKZB 3ARGA 1IKFH 2DBLL 3QG6A 4GRMB 1A7QL 2AJZA 1H3VA 5FYJE 1EGJA 3D0VA 1N2RA 5HGBA 1J5OL 5F6HJ 1IKNA 1F6FB 5B39A 3SDCA 2GTZA 2AXGA 3PV6B 5FUZH 4N90E 5EU6D 1OLLA 4OZHA 3QNZA 4GAJL 4JM2B 4FQIL 4P4RA 2FD6H 3ROOB 5DRZB 4KAQH 1OSPH 2IPTH 4AEIH 3NMEA 4WHTA 2X4RB 3OKKA 2JJSA 2Y06H 1T3FA 4PLJD 1BBJB 1ZANH 5EU6A 1KUMA 3O4LB 5DHVB 4HW6A 3OBAA 4E5XB 4PS4L 1HYRC 3EYFA 3HR5B 3GJFB 2AJUL 4NNYA 2G5BB 4K7PX 2NY3B 4CN6A 4UZGA 3QFDA 1MY5A 4M61A 3KYKH 1D9KD 5GRUL 5EZOH 5CEYB 1KN2H 3MRRA 3B43A 3VH8B 1NBZA 5I19H 1QZ1A 2PF6A 3I50H 4Y8DC 5HVWA 2B1HH 3CFDA 4ISVA 4P23C 4S1SL 1D9KA 4LCIL 3OAZK 4Y4FC 5JW5B 3FRPA 3QEUA 1SJHA 3DVFA 2P5EB 1OTTD 5F9WB 2WWKO 3S4SG 5D6DA 3UBXI 4ZFFB 2YA0A 1PKOA 2ZSVB 1OGTA 3T4AB 1QFWI 2CKBB 3K74B 1YYMH 1CQKA 1G9ML 1DZBA 3D85B 2VXTH 4CVWA 3JXAA 2ZPKH 4OCRH 4IRJB 4JO2H 2YMXL 4NN7C 3K4DA 1YN6A 3T0DA 5CEZD 1XGPA 2FGZA 3VGAC 4GKNA 5GISL 1MJ8L 1MOEA 4CMHC 4UI2A 4KMQA 4F7TA 5FB8B 5IBTH 3KPQB 2BVEA 1FORH 4FNLH 2CUHA 4JRYD 1JN6A 2EC8A 1ACYL 4MJ5B 1AQDA 4Q6IA 1A7OH 1RZFH 2I9TA 5EZIH 3R8BB 5HYQA 3MLVH 4DGYL 2QJDA 1OOAA 3JUZA 3D0VB 1HYSD 4JRYA 4TPRH 2ARJA 5HGBB 2EH7L 1J1XL 2Q8AL 3QUXA 1Q9OA 2VQ1A 1TLKA 3SDCB 2GTZB 3U0WH 1BAFL 1IEBA 3OAUL 5K9QG 4OZHB 5TPWL 5ABDE 3Q3GA 4JFDD 3ZKSD 4QF1B 4WFHD 5CBAA 5BMFL 1R5IB 4KQ4H 1VACB 3P9LA 2Y6SC 3CX5J 4R26H 3CVHA 3OKKB 4GMTL 2W92A 1ZS8B 4U1IA 3S35L 1TMCB 4JFDA 5JUEL 1I8MA 1I1AB 2WNGA 3BQUD 3EYFB 4OD1L 2HWZL 5EOTB 5HHVL 2JB5H 4NNYB 3BDBA 2BNQD 3V7AG 3MUGA 4NO2B 5HYSA 4N0FB 5JNYB 3IAGC 4OGYH 3QFDB 4M61B 3BQUA 5BVJB 3OSKA 4MNGA 3IFOA 3MRRB 5E00A 4WU5B 1S9KC 1EPFA 4JEGB 2NY6B 3QG7L 4MA8L 4O9HL 5KVEL 2VDPL 1FFQA 3CFDB 4ISVB 3ZKXC 1LMKA 4A2MA 1CL7I 3LD8B 3QQ3A 2H9GA 3V4UH 5TF1H 4D9QE 4IRSD 4HPYH 5DHVH 1SJHB 1A5FL 1YEGL 1WQVT 3S37L 2BJMH 3GJFH 1JWMA 1GL4B 2XY2A 1OGTB 4NQDA 3UO1L 4GQPH 3IDNB 4DN3H 5ESVA 1XF2A 1K6QL 2WIMA 3T0EA 1NGYB 3OZ9L 1QSVA 4I2XE 3AC0A 3PWNB 4ODUA 1FGVH 3S88H 1FPTH 1GAFL 5M94B 1NAML 5IW3A 1YN6B 4FHBD 2JF1A 5CSZA 4GKNB 5HHQB 4LEXL 5SX4I 2VOTA 4O58H 4WFGD 4U33A 4Z0XA 1JN6B 3EYUH 2LTQB 3VGGA 5LJYH 4B0MM 1AQDB 3MRHA 4Q6IB 4KJQC 4XZUA 1E6JL 1AKJB 2I9TB 3LSOB 1UVQB 1LWRA 4F33B 3S34L 4LSPH 4MJ2A 2XZAH 2CKBH 5AYQA 3Q6GL 1F8TL 1MRFH 3ARUA 4WWKD 2ARJB 4UT6H 3QUXB 3H3PH 5FYLE 2OK0H 2XICA 4XB8A 3QIBB 1KLFA 5DGQA 4HJJH 1DL7L 2EXWD 3RGVB 5EU5B 4X6CA 5HYJE 1DBBH 4KDWA 2EYSA 4XNQA 2K7PA 1JHLL 5CBAB 3HMWH 3P9LB 1SEBA 3R4DA 4FZEL 4OKDA 3CVHB 5J12C 4YAQA 1ZEAH 4DZBB 3VFSA 4U1IB 5F88B 5GS2H 4KROB 5IVXA 1T89C 3BP6A 3LB6C 3LOWA 1EX0A 4PJ5D 3WNPA 1DBML 4DN4L 3GSNB 5ISZE 1JUFA 1BD2E 1EGJH 3FB8B 3MXWH 4KRNA 3RBSA 3IFPA 1HINH 3MUGB 5HYSB 4HIXL 5DD5L 1E4XI 4Z8FH 3TIDB 2BVOB 3O45B 1QUNA 1MLCB 5E0QA 2YPVH 4FABL 1NAKH 5E00B 3I02A 4J3WA 5I75C 5HDOA 1T7YA 3E2HC 5TQ0H 3ILPA 5T3XL 5F9OL 4LVOC 2WIIB 1B6DA 3QQ3B 1YZZA 5EOCH 4DGIL 4HEME 5GS3A 1UEYA 5FYJU 2H2PC 1JV5A 1HOCA 2BVPA 3ZE1E 4HZLB 3WDJA 1GIGH 4ERSL 3S3SA 1DANU 1JWMB 5T3ZL 4NQDB 3LN5B 1ACZA 4RFNB 3U4EA 3T0EB 2CK0L 4L3ED 4ZTOH 3GMMB 1LO3H 3ARED 4Q9QH 3SE9L 5ICXB 2R56H 4KDTA 2R0LH 3IU4H 1FBIH 3RPIB 2I07A 3GK8L 1OPGH 3P4NB 1QRNA 1XH3B 2AV1B 3MV01 3FN9A 1PLGH 1NMCB 3P9MA 4F7PB 4L3EA 4LF3B 3ZE1F 1QG3A 3HAEB 4F37F 1ZA6B 1AI1H 1J10A 4W68A 1NAMA 2DMKA 3G5XA 4Z0XB 5CJOH 5F7YC 1KIPA 3MRHB 5DEFB 5F6IC 4XZUB 4ZAKA 5JDJA 1MFDH 1NUNB 1I7TA 4ONFH 4RAVB 3ALPA 5JR1H 3OXSB 5FUOL 5GGTL 1IE5A 5IBUB 4FMFA 4OJFL 4JAMA 4XPHH 3ULVC 2CQVA 3CFCL 2FIKB 3CFJA 2Y7QA 5I8KH 3JZ7A 4C56E 2W9DH 1MAMH 3KXFE 1S7QB 3TF7C 2IFFH 2NW2B 3DUUA 3DOSA 1C1EH 1RIVH 2VE6A 1ZLUK 3U7WL 1SEBB 5CINH 4K7FB 1LGVA 4OCMC 5TH2B 2ATKA 1CF8H 4U1SA 2J8UB 1MJUH 5ADOH 5IR1B 3HZYA 5IVXB 3BP6B 1W2KT 1QSZA 1U8KB 1FNEA 4XMKL 4JO3L 5JW3H 1TPXB 2BFVL 3NCBB 3WLWC 1KCVL 3CC5B 4PGBA 4ZG1A 4WJ5A 1B9ZA 2Y07L 1NGWA 5D1XB 3IFPB 4TULL 1OAKH 2CRMA 4ZO6A 1F11A 3WFDH 1HK6A 1E4KC 3KHQA 1LEIB 1AD9A 4HH9A 5MENE 1Z9LA 4I3GA 1SJEB 5L88H 3SY0A 4RMVA 1U6AH 1U8PB 2DWEB 4HWEL 4M1DL 1V7NL 4OIAA 3GSXA 1S5IL 4OF3A 5T3XD 5CP3A 43CAA 2YXFA 4LAQL 4YNYA 2HRLA 4HS8L 5BS0A 1ORQB 3CVHH 4OLVH 5FA3A 3U83A 5I1CH 4PYGA 1KCSL 3QUYB 1JV5B 3BHBA 3QIUD 4MA7H 5EZLB 4OZIA 5IBLD 1RJYB 2VXVL 5T3ZD 3DXAE 4QHNA 1Y0LB 2GJ6B 2OR9H 4KMTL 4LVNC 3QEHA 3GSNH 4PJ8C 1K9TA 3FQRB 5B39G 4XCEB 3B9VA 1AC0A 2YPLE 4R90H 1D6VL 3QIUA 3UTPE 1MCQA 3TPUA 3EO0A 3UTZA 4XXDA 3SHSA 1U0QA 2ADFH 4MXVE 3LH2H 1NEZG 2I07B 1T1WA 1QRNB 1GC1C 4PLOB 4XNZC 4Z7UE 3W0WD 5C7XL 3BH9A 2XXMB 1JZ7A 4Z77A 4MDJA 3QIWB 3QT2A 4YHML 4LVHB 1TJHL 3G5XB 5I30L 1VGKA 3RHWF 3PJSA 1KEGL 4ZPTA 3W0WA 2A6DB 1VFMA 1O5DT 4KVCH 3Q1SL 5BVPL 4ZAKB 3A0OA 4NHUB 4JFHD 4MXVF 5E56A 5IFAH 3BT2L 3QXTA 3WKML 1VFBA 3SKMA 3RVTC 1J9CT 3X11B 4JHZA 1PYWA 4Z78A 3O41A 3VXME 4FQCL 4Z7UF 4YZFE 3CFJB 1FFPB 2Y7QB 3BXNA 3PWPD 3HC0A 5GGTA 5KVMC 2ZNWA 1U3ZA 3SKOB 1A6VL 4Z95L 4DGVH 3HNVL 4G6JH 4RGOL 3BE1L 4RGND 3BIKA 1KV3A 3DUUB 4ZDHA 3HAEH 5ACZA 4G9FD 2PXYC 3FOMA 1RULL 2NZIA 4XBEL 1P84K 2CLRA 2ATKB 4G6ML 4YZFF 1JGDA 2VC2L 2YRZA 3HRPA 3U9PH 5L0QB 2OI9C 3K7UA 2AV7B 1J18A 4JB9L 4WJ5B 4RAUB 4IDJH 1F11B 1ZLWH 1AD9B 4I18C 3SY0B 4NZDA 4OD2A 3GSXB 4HK3N 3ARZA 1FQ9C 1ZA3A 2Q8BH 4D0DA 5F72S 1K5NB 4JJ5A 5I73C 1I85A 1MCOL 4YNYB 7FABL 5BS0B 1IBGL 5KVDH 1T0PB 1WZLA 1ZOXA 2A83A 3S98A 4OUUA 5D5MB 1P84J 2PO6C 4Y5XB 1FH5H 3SOBH 1HILB 1YEKH 3MNZB 5E8DL 3T3MF 3QEHB 4JZOB 4LKCB 3V6OC 4TTGA 2PR4L 4BQCA 2VDOH 3MA9H 1M71B 1XF3A 2DOCA 4JDZA 5E03A 3CK0H 2VWEE 4U6VL 3TPUB 5F7KC 3UTZB 4ODSH 4QRQA 3T2QA 3NGBC 4KTDL 2NXYB 2WBKA 4WWID 5CJBA 3ULUC 4RCAA 5GGUA 1KOAA 1JRHI 4L5FL 2R2EA 5CSGA 4Z77B 3P11L 1U8MA 4MDJB 5FFLA 4PRHD 3QHFL 2CRZA 2WP3T 5FGBC 1UJ3A 4OZGE 3PJSB 3DURA 4ZPTB 4O02L 1CFQB 5DVNA 3UC0L 1J0IA 5A3IC 2NY5C 3OKEA 4PRHA 2NNAA 3SKMB 1QKZL 4GH7B 1PYWB 4Z78B 3O41B 4HT1L 2AVGA 4V1DB 4P0DA 1U93A 2IADB 2Y5EA 3EO9L 1VHPA 2BY1A 3C60C 2EXYC 2DIAA 4F9PA 3BXNB 3T3PE 4KHTH 1R3IL 2DM3A 1CBVL 3DNKA 4P9HL 4E42A 4GAYA 1A6WL 3KNBA 1JNNL 4OZGF 1LD9A 1P4BL 3G6JE 3HUJA 1MFAL 3FOMB 5E4IA 4X9HA 4JN2A 2CLRB 1A14L 2M1KA 1XIWD 5JA8B 4Q74A 4Y7MA 4FQPA 4AL8H 5GPRA 4HS3B 2L0DA 3T3PF 4XVTH 3RTQC 1QLFA 2X4QA 1WWBX 5DD1L 1XIWA 1DFBL 5GGVY 4HK3J 3OB0H 5CJXC 5JW4N 1FP5A 4R4ND 1S3KL 1D6EA 3PGCA 3TZVB 2OZ4A 4OD2B 4NBYB 4LP5A 1MWAB 1W8OA 4TSAH 1ZA3B 4GKOA 3D48R 5HPMA 1WF5A 4JJ5B 3NCJL 2VLRE 3WO3B 4EVNA 2A73A 4FFYH 1I9EA 5IEKA 4LLYA 2GYSA 4JPWL 4M02A 3HFML 4QRRB 4U6XB 2E9BA 4OF7A 1UWEH 5BJTA 4RAHA 5CWSA 1XF3B 4JDZB 4WUKH 1G0XA 3N1QC 5DVOA 5ID0A 2I5YL 4IOIA 4UQ2B 3QULA 2QQNL 2BRQA 4QRQB 4Y19B 3F6LA 4XNXH 5BW7C 1NFDE 4JFEA 5CP3H 4NQUA 3IT8D 5GGUB 2F54D 1IKFL 1U8IB 4DOHE 1U8MB 2XG5A 5EO9B 2ICWJ 5ESQA 5TQ2L 1T22B 5E6IA 1MHPL 4MJ4A 1P9MC 1RUAH 1J0YA 5JPMA 5KSAD 1S7UA 3NIFF 3RJQB 3B9KD 4ODXA 4Y5VC 1A6PA 2P5WD 1NFDF 3QUZD 5DUBB 1MFEL 4PJ7F 5L8JB 4AEIL 1BJMA 2JIXD 1GOHA 5EWIL 1QQDA 5ICZB 2EDEA 2P5WA 4MQSB 4FG6C 3KNBB 4P5TD 1P7QD 1LD9B 3QUZA 2P44B 2Z8RA 4X6DA 3B3IA 4FZ8H 4JANA 3VFVA 4M48L 3K8KA 2J4WL 4OF5A 1G7LB 4S2SA 3HNSL 1CXIA 4JN2B 2YN5A 1YEDA 5DT1L 5FHAL 4GSDL 1R24A 2FECI 4PJIE 1T03H 5J7CC 3RVVC 3UJIL 1LQSR 3BESR 3VMOA 4FTVD 1FFRA 2X4QB 2F8VA 4WO4D 4EBQL 1X3DA 5BXFA 3PGCB 3K4AA 3BPNC 1J05A 4FTVA 1RZJH 3SGEI 5HPMB 2VXUL 2IWGA 4P2CG 4S10A 3REVB 2C9AA 3SGDI 1G7QA 3D87B 4PJIF 3NFSL 3QR2A 4ZO7A 4EVNB 2A73B 2GJZB 5DQDH 1YY8A 4LLYB 1QLEH 4CU8A 4PJAE 4BSVB 1XR9A 4PG2A 3MRPA 5CD3B 4KUCF 3CSYB 3SGKC 2HP4A 2ZUWA 1QFPA 5D72L 1CG9A 1WTGT 4OCRL 1KJMB 5CWSB 5JQ6H 2VYRE 3SPVA 4FS0A 1CT8A 4U1NB 1MF2H 3ZDZE 3A67H 3O3DA 5IW1A 4MAYC 5ID0B 3I75A 5IHUL 3SKJH 3QULB 2OTPA 3A6BL 1MWAH 2AJXL 4JFEB 5C9JA 5EORL 1RZFL 3LV3A 1FIEA 3JV6A 1X5GA 5ESQB 5SX5H 3MACH 5GGRB 3MRGA 4NM8L 4TPRL 5F96H 2FZ3B 5E6IB 5INCA 4YHPB 2UZIH 3GKZA 5HYFA 5JPMB 4JFYA 3LVEA 3ZDZF 1IAIH 5F7HA 5C08E 4PJEE 5GS0L 5IMLB 1TIUA 3ZT6A 1RIHL 1GSMA 1EO7A 4YGVA 2Y72A 2QQLL 4JPKH 1ITBB 5JQHC 3KWWB 1CDYA 2JELH 2M26A 5AWNL 4Q7DA 2JCCA 3VFVB 3B3IB 1MQKH 4JANB 1EEUA 3ARDC 1S8DA 2EDLA 4PJEF 5F89B 5TE4H 5AUMA 4S2SB 2FL5A 3WMSA 2BMKA 3ARRA 2BOBA 3GJFK 5EIVA 5EU3A 3V4VL 5E99L 4LLDA 2RCSH 1KIRA 2HFGH 3QEQD 4QXGH 1IZKA 1TQBC 3LS5H 4PYHA 4XP4H 2NTFB 5BQ7B 2EYTA 1C8PA 4XPBL 3FQUA 3L5IA 1F00I 3ALWA 5IJKC 2V2XA 3F7VB 4A6YL 1J05B 2Z92A 4U6TA 4YE4L 3I6LE 1LEGA 4W70A 3N50A 1CZ8L 1AHWC 3JWOC 1G7QB 1U8LB 2L7JA 3QUKA 5C07D 1IL1B 2BVQA 4M7KH 1T1ZA 4DN3L 5FGCE 3VFWA 1T0NA 1XR9B 5D2LA 1RMFH 5HGGS 5E7BA 2HFEA 2KH2B 3IDIA 4NRYA 2IANE 1UWXH 3S88L 1JYVA 1E6OH 5DJ8A 4L4TD 4EDWL 4TRPL 4NWTL 4MQTB 3SPVB 3HI6H 4WGVB 4D3CH 1J8KA 3O3DB 2FX9L 3F5WB 3I75B 5DJ0A 1T66C 4O58L 1X5LA 3WL9A 2DQFB 3SQOL 1SVCP 4KZEH 1AXIB 1EJOH 2MCPH 3UAJC 3JV6B 2D4FA 4LSPL 4D94A 3MRGB 4NGHH 5K9KA 1OP3H 4OCXL 3DMMB 4UT6L 3R1GL 5DHYA 3T0XA 3H3PL 4JFYB 5GS0D 2OK0L 2OCFD 1P5UA 1NCAH 2X70B 3D0LB 4XPFH 4HG4J 8CGTA 3D6GA 1GGUA 1DBBL 2NX5D 1KF9B 2DTML 5BRZB 3ARTA 3NA4A 4YGVB 4HJGA 3HMWL 4HWBH 3DVNA 3V4PH 1UXSB 5T1LB 2VH5H 2Z35A 1ZEAL 3DV4A 5SWSE 1TVDA 1FGNH 2C3XA 4C54A 3OL2A 3GMPA 4XP9L 5EBMB 2XA8H 3MSPA 4M1CD 3O6FC 5AUMB 5IWLA 2BMKB 5K9QI 3TESA 4JHAL 2BOBB 2EO1A 2LU3A 2FJHA 3K3QA 1JF1A 1MIEL 4LLDB 2DLEA 2EKSA 1X5KA 1MI5E 3WNMA 4K3DH 2EYTB 4I0PD 5TQ0L 2Q3ZA 4NKDB 3W11D 2V2XB 5JA9A 4NJ9H 4U49A 1EBPA 1GGBL 2EDWA 2Z92B 2UYLA 5CSBA 5DD6A 3CXHK 1TTGA 1AD0A 1LEGB 2EH8L 1DBAH 2E7LC 5EOCJ 2EIZB 3QHZH 2DAVA 1A9EB 3HE7D 2V9TA 1MREL 2APBA 3QUKB 4ZSOE 3TNMA 2BVQB 5FO7B 1T1ZB 2MMXA 4ZTOL 1T0NB 4IM8A 4NKMA 2NY0D 2HFEB 3JVGA 5E70A 2IBBA 5I1DA 4HUVB 2DF3A 1UG9A 1X4XA 5D7SL 5ICYA 3OX8A 4OIIH 4AEFA 3FN0L 2UVEA 3C6SA 3GIZH 2FLBT 4OFVA 3T2NH 3TH2T 4HUUB 5DJ0B 5GRJH 3BMWA 1K4DA 5CJOL 2CMRH 3P40A 1WVZA 3NTCH 4FFVD 3CXHJ 1MFDL 4FQQB 2X4SB 1JTTA 1EAPB 3K8LA 4JCLA 1KLGA 4JDVA 3ZE2E 4XPHL 2AJVH 4OD3L 5DHYB 2BNRE 2W0KA 2RHEA 1FL5B 3U30C 2NYYC 1JPGA 1QHOA 1OM3L 3VI3F 5ELIA 1FAIH 4K8RC 4P2OC 5FYKD 4XC1L 1GJIA 4AM0A 4ZXBC 1DEEB 4BZ2L 2F8OA 1RIVL 3BH8A 2VLKD 5CINL 4G6AC 1W72A 4GG6A 3GNML 3VE0A 3LKQA 3FO1B 5SWZD 1U2HA 4Z76B 5ADOL 3TA3C 3STZA 4P2RB 3KLAA 5C0CB 3GMPB 3O3BB 1VFOA 3PWVB 4JREB 4K3JL 3TT1H 5JW3L 4IS6A 3O4OB 4MWFB 3F7YA 5MEQA 1UENA 3WFDL 4O2FA 1A3LH 2ZUQB 3QO0A 1QHPA 2DB8A 5K93A 1JF1B 1CFTA 2DIBA 4PJDA 2EKSB 3V7AE 4EI5C 1FYTA 1NPUA 4MGXA 3LMJH 5JZ7D 3KLSA 1WC7B 2DQGH 4J4PD 4POZC 4Q2ZA 1U3YA 2Z31D 1ND0B 1LO5A 3MV7E 3CLFL 2HLFD 4OLVL 1I8IA 2P46B 9CGTA 4GQ9L 4GAGH 3IKCA 2ATPA 2UYLB 5HI4C 4J4PA 1AD0B 4MA7L 4NDMB 4MXWH 2Z31A 2R39A 3QI9D 2OR9L 2DWDA 1SEQH 3GSNL 1XEDA 3ARVA 3SO3B 4WV1C 1VGEL 1S7TB 5B8CC 3TNMB 4N8VA 4I5BA 1UWGH 1MCHA 3EHBD 4R90L 1LP9E 2UWEA 4NKMB 4EQ2A 4UNVA 3PGFH 2ADFL 1AGBA 4IDLA 4M7ZB 1JZ5A 1P6FA 5ICYB 1J8HA 5F1IA 4ZO8A 5C0AD 5HHOE 1NSNH 1AJ7H 4PB9L 2HTKD 4WW2B 4JDTH 5BO1H 5F44A 1T2XA 4QYOA 4JQIL 5J3HD 1EHLH 4KVCL 2EDXA 4C55A 1VEOA 3O3UN 4I8DA 1WEJL 3P4MA 3W82A 2CDFA 4IMKA 3TJEH 3UJJH 4DKEL 1BOGA 1PZ5A 3BIAX 5IFAL 1KLGB 4JDVB 4Y5YA 1Z3GH 1TJIL 1QPPA 1IQWH 1CE6B 4I13B 4Z7VE 3ISWA 4FRWA 2NY1B 1ZLWK 4LSVL 3CIQA 1JI2A 4OZFA 4D9RE 5FK9A 3TJHC 2FJFB 2D31A 4AM0B 2LU4A 1WZKA 3BEVB 5FM4A 2HT3C 5MERA 2PW1A 3TO4C 3QNYB 1W72B 4JRXA 4YK4C 3I2CH 3RY6C 1RVFH 4P4KB 5HDBE 4BK5A 4FQHA 1HXMA 3KLAB 3DGCR 1BEYL 4ELMF 4ZUUB 5HI5C 3OGCB 4IS6B 4JG0L 1LK3H 1MEXH 3F7YB 4LLMA 3RVXC 3CH1A 3D3VD 3RWIA 4WDIA 1C7SA 3QO0B 5CAYB 1L9NA 5IESH 5KVGL 1AP2A 1N0XL 1TVBA 3G5ZA 2XN9D 3WJLA 4XNYL 3DX6A 3WUWA 4PJDB 3R0MA 2GSIA 4U1LA 4XWGL 1FYTB 5IW6A 1DLFH 4B7LA 2MSPA 2W0FB 3D3VA 4WI5A 4YO0B 4Q2ZB 5D7KE 1DQDH 2IJ0C 1JWSB 2FHBA 1D5MB 3QDJE 1FV1A 1QBML 5H2BA 4EN3A 2ATPB 4KKAD 3SOBL 3G5YA 5CJQH 2PW2A 5ADPL 2GT9A 3B5TA 1XGUB 3QH3B 5HVGB 1GZQA 4PRDA 5KOMC 3UTSD 5C8JB 3GGWA 3MA9L 4QY8A 1AY1L 3KR3H 1I1RA 4YPGA 2R0KH 4I5BB 2UWEB 4KPHH 4LCWE 4APQA 4PY7A 1JYWA 1KJ2L 4GRLC 4UILH 2NXZB 3UTSA 3KJ6H 1BP3B 5F3HB 1J8HB 2VL5A 3JWNC 3MRLA 1ZLSH 1HIMH 4NCC1 3AM8C 1UGNA 1AGFB 2OSLA 1TNNA 5IVZB 3WNLA 2I24N 3WE6A 3P77A 4LCUA 5C09D 1YJDH 3BKMH 3IVKA 2ICCA 3K1KC 4ENEC 4LPUA 4YDLC 3VWJA 5MHSE 4LLQA 2NR6D 2IGFH 5FYJL 5C09A 3VWKD 3WFHB 4NZTH 4KHTL 3FTGA 4NO0B 3OB0K 2PTTB 3VXUA 3JTSA 4G3YH 3MV9E 5FK9B 3T65A 4TQEH 2WBJD 4JQXC 2OLDA 5L7XH 3RZWA 3GB7B 2R1YA 3P4OA 1KGCE 2PW1B 3LHPH 4M5ZH 1B3JA 3O2DA 4JRXB 5HHMD 2YD3A 4JM2C 4HGWB 2DBJA 1I8LA 4FQHB 1E28A 4NC1E 4UINL 1F4WL 4JY4A 5E24E 2WBJA 4K23H 3GMLA 4K94L 1JPST 4LLMB 5CLWA 1XGRA 2AAVA 3O81A 2VQUA 3CFIC 1EHAA 4BKLB 2MNUA 4XVUC 3G5ZB 4JHBA 3LRGA 3WUWB 1NGZA 1MAKA 1IQDA 2M8XA 4U1LB 4R7NB 5EO0B 2NY3C 3QFJE 4G9DB 5DFWH 3QDMB 5GZNC 3QUMB 2FLRT 1H5BA 1W72H 1FV1B 4YFDB 3PHSA 4KUZH 3QCTL 4OCNC 5DFVC 5FYKH 4LSUL 3QJFA 4EN3B 1PJ9A 4XCFH 4HXAL 3G5YB 4FXKA 2B1AL 3VFNA 3L95A 1UWEL 5I16A 4NKIH 4F7MA 2DQEH 4PRDB 4F8TA 2WINB 2HJKB 4WUKL 4RFOL 5DA0B 1MHCA 2WUCH 2IALA 5F9WC 5L8KB 1S7SA 1N5YL 1T21A 4YLQT 3SDDD 4J6RH 4YHLH 4WUUE 4APQB 2HRPL 1JPTH 3TYGL 3PIQA 4M6OH 1FNSL 2ADJB 2FRGP 3MRLB 1NGPH 2VITB 4KZDH 2P49B 4MVBD 1BQLL 1NANH 2F9BT 4ZNCD 4WEMB 1JIBA 5F6HI 4R3SA 3G04A 3VFTA 3GMNB 1V3JA 4IRJC 5GS1A 3P77B 4TVSa 4QTHA 1WT5A 3E1F1 1DSFH 3O2WL 3RVUD 5C0RH 3VWJB 5FYJD 1FVCB 2BNUB 1G9NL 3FJTA 3RIFF 2Q3AA 2QEJA 2GAZA 5E94A 3T1FB 1S78C 2VXQH 3ARGC 5JW4R 4PGCA 3N9GL 4FA8A 2FGWL 2FB4L 5FEBA 4N90D 3VXUB 3H7LA 3JTSB 1CICB 5D1ZA 3SE3C 3T65B 1YDPB 1P4IH 3SDCC 3X13A 3OKMB 2YHGA 2R1YB 5LGHH 5DGRA 5MP6L 2V17L 4HUNB 3ULVF 3H9SB 3PHQB 3U36B 3SDXE 4QKXB 2Y4SA 4JZJB 4JY4B 3WNNA 3LZFH 4UMGA 4PJGE 1RUKL 2JJSC 4KJPD 4LRNH 3AAZA 1B0GA 4Z6AT 1I1AC 3D1MC 1IC5L 3DYMA 1HH6A 3SDXF 2C7UA 2G9HA 1AFVH 2APFA 4KFZC 1H5BB 4PJGF 4QHLB 5J8OA 5DZNA 3BKCL 1QLEL 3QJFB 3WCYA 1FNFA 4NNXA 2NY6C 5CD5C 5SX5K 3MQIA 1HHJB 3VFNB 3BW9A 1D9KC 4NQCB 3LD8C 4XPTH 1PQZB 3SE8L 5CEZE 3DIFB 4URTB 4X7CC 2F53B 5I16B 1T5XA 4F7MB 1MJ7L 4Y16B 4EUPB 4ZOBA 2R1WA 4HS6B 1DJSA 3A67L 1T21B 4GS7C 3QQNA 5D6DC 3SKJL 4NIKB 1MWAL 5DC0A 3QCVH 4PY8J 2AK4E 3F12A 4UTAH 2IPKA 5AAWA 3QUMH 1UA6L 1OTTC 2ESVE 3S36H 5TJWK 1DBJH 4MQ7A 4H1LB 1A6ZA 3MACL 4JN1H 1YA5A 1QPXA 1S7VA 3GMQB 4R3SB 3G04B 5F96L 3RWFA 5EPMB 5GS1B 3MLXH 1A3RL 3VFUB 4NQTA 1CCZA 2J7LA 4QTHB 3MJ9L 4M93B 4WFHE 5T1MA 3VD4A 3CSGA 3TN0D 3MV8E 4RISL 4Q6IC 2GAZB 1NFIB 2A38A 3RVWD 4E41B 3BZDA 2HVKA 2Q7NA 4X4YA 1TQCB 2RQ8A 2BHUA 3QUXC 4EJ1C 2DQDH 4M7LH 1ODAA 3X13B 5L6YL 5TE4L 1CK0L 3RGVC 5DUPH 5EFIA 1JHTA 4HJ0D 4ZUTA 4JKMA 2MQ3A 2XACC 2VDMH 4AH2A 3QXAA 2XZCL 3B9AA 4N8VG 4P46D 4TVPL 2RCSL 4FQJH 1KB5A 4OCWH 2R69L 4QXGL 3LS5L 5I8EB 2W9EH 1CGSL 3LS4H 4KROC 3AAZB 3BKJH 1KPVA 3IFLL 4F37K 1NGQL 4YHKL 1HH6B 1NLBL 3HG1E 1A6TA 5IUSA 5GSRB 4TUKH 5TFSH 5C0DB 1YY9D 4KQ3L 2C7UB 3BQUC 4D9LH 3OR7B 4NZRH 3O2DH 3EYVA 3VFRB 4JPVL 3BFOA 1KIQB 1C12A 3UBXA 1NL0H 1UM4H 2Q86B 2ORBH 2Z91B 4G5ZH 3V6OE 1OW0A 3BW9B 4WI4A 3ARBB 4XP6L 1T5XB 5DS8A 1LILA 1JNHA 2HKFL 2HJFA 2NZ9D 5I15H 2R1WB 3MCKA 3HI6L 4OZFG 2QADB 4D3CL 2FO4A 1HDMA 3W5MA 1JWUA 1MCPL 3AY4A 4D0BB 4XGZA 2Y5TB 3ME0A 4RFNC 5CZXD 5SV3A 3PWLA 3T0EC 4AT6A 1SYVA 1EJOL 2MCPL 1PG7L 4QXWA 4B5EA 4MQ7B 2BSSA 1A6ZB 4YBQC 2A6IA 1S7VB 4NGHL 4ZS6D 1ZLVH 2DLTA 1T2QH 4TUOA 4LGRB 1NCAL 3VXQA 1U58A 3V79C 2H2SD 2AEQH 3RY5A 4CMMB 1FJ1A 4EUPH 3ULUF 4NO3A 3CZFB 1DVFD 1PVHA 4YUEH 1UCBH 4HWBL 5FYLD 1TJGH 2AJYL 4ZOEA 2H3NA 2VH5L 4PJ5E 1J87A 1DDHA 2Z9TA 1MQ8A 5HYJD 4UIKH 4F57H 2P24B 5KVFL 4G6KL 5IG7A 2XIDA 2A77L 4PJXE 5GSVB 1BX2A 1IGTB 4H1LH 1FDLL 3ZKXB 1KENH 1D3CA 1OAQH 5HYJA 4ZUTB 1TITA 4G42A 2HT2C 5E5MB 1BBDH 4MJID 1KJ3H 5FM5M 1CU4H 1KB5B 3QCUH 5CZVH 5ISZD 1BD2D 2EXWC 4U1MB 4YWGH 3ZT5A 3JBG7 5FO9A 4HIIA 3OKLA 1I7ZB 1TPXC 4PJXF 4UTBH 4NQEE 2NPLX 4OCLC 4JO1H 4X7TA 5ISZA 3X14A 5D1XC 3RHWK 4LSQL 2XKSA 1FFOA 4PD4K 1OTUC 5ESAB 4X9FA 4NQVA 2DI8A 1Y18A 4NZUL 4HUWB 4AJ0A 1IGJB 5FOJA 3PGDA 2VRAA 4J3VA 3L3OA 1C12B 3MLYL 3UBXB 2ICES 1AQKH 4LRIC 4L9DA 1VEPA 5H35A 4PB0L 4LAJH 4RZCA 1T7VA 1KNOA 5DS8B 3RL1A 4WHYH 4IMLA 1JNHB 3VGHA 3QUYC 2HJFB 4BZ1H 3F58L 2FO4B 4OI9A 4F7CA 5GRJL 1C5CH 5KANG 3NA9H 3PWLB 3NTCL 4AT6B 1NCDL 2C5DC 1SYVB 4PD4J 4QRPE 3DARA 3QAZB 1CVSC 5HD8D 3EDDA 2HKHL 4K2UH 4X6EA 3QRGH 4JHWL 1HHKB 4DQOL 4KK9D 2DD8H 1KPUA 3QIWC 5GJSH 1U58B 1IGMH 4LVHC 4HAFA 1FJ1B 2JK5A 1UB6A 4NO3B 5J0BA 1MRCH 4ZAKC 5FHBL 5FA4A 1LDPH 2JTDA 3DX9A 4C56D 2H3NB 3ZKMD 4LSSL 1KTKE 3IF1A 3M45A 4OSUL 1DDHB 5BOPA 3KXFD 1DN0A 1NGXA 3VJ6A 1DP0A 1KBGL 1RK1A 1XR8B 5I75B 2EIEA 1IRAY 4YHOL 1BX2B 2FJGB 3X3GL 1Q9KA 3WHE0 3MRDA 4U0QB 3MPCA 3KXFA 2HTLD 1Q1JL 4PIRF 1A3LL 1YEEH 2XKNA 5ALCL 4C83B 4YX2L 4PRIB 2P42B 1CDIA 3BN9D 5DD0H 3QSKB 1QBBA 5E1AA 5D1QD 4MNQB 4XCCL 4DKFH 3QXWA 1W0VA 3ZTJG 3BDXA 2WANA 3OKLB 5L0QC 3N1MC 5MEND 3T1WA 1M05A 4BYHA 2DYPD 1A8JH 4X7TB 3BAEL 1KJVB 1JTOA 4LQFL 4M3KB 1INDL 2O61A 1FVDA 1CD1B 3HI1A 4QT5B 5CCKH 5F1NA 1CYGA 4I3SL 4NQVB 1SEQL 2ZUXA 5MI0B 1I1FA 5I1IL 5GGSB 3L3OB 5D2NE 4TOYH 2YC1B 4S0TD 1P5VA 1YECH 1PG7W 1KB5H 4F9LA 3HZVA 3J7HA 4RZCB 3V5DA 5CUSH 5C2BL 4FQXB 2QHRH 4YFLI 3U9UB 4IMLB 3BGFB 2X89A 4JQVA 2YPLD 1G7IA 3OKNB 4XVSH 3UTPD 5F9DC 5BO1L 1HKLL 2DIJA 3DXAA 4F7CB 3KPPA 5I66B 5CHNA 1I9RH 1JGEA 3IXTA 4Q0XL 1IVLA 2YPLA 4UT9L 4X6FA 1IC4L 5EN2A 3TV3H 2A9NH 5EC1B 5ANME 2NXYC 4X6EB 4QNPE 5IMMB 1Z3GL 3MFFA 3LQZB 1MFCH 4Z7UA 4P5MA 4WGWB 4UV7H 1QFWH 4LK4A 2ID5A 1I9JH 2FHFA 1F97A 4N0CC 4MAUL 5AYUH 2JK5B 2EDNA 1UB6B 5FO8B 5DR5L 4KDVA 1EH9A 4J8RA 1YN7B 1U95A 3GI8H 1EERB 3D39B 3VXMD 3NIGE 2R1XB 2AP2A 1BQHA 3U79A 5IKCB 3JTTB 3I2CL 3BOVA 1L4IA 4CJ1A 1DN0B 1NGXB 1CIUA 1NJ9A 1KC5L 4LNRA 3MO1A 4S11A 1FRGL 1S9XB 4GG8A 4HEPG 4LOUD 5JIIA 5HI3D 2QLVB 1IZJA 3BP7B 1Q9KB 1ZT7A 3MRDB 4F3FA 1A4JA 4NOFA 1RZJC 5IEHB 2XKNB 3NIGF 4KKBD 1DLFL 4MLSA 1WBZA 2VDLH 1GXEA 5DRWA 1N6UA 3UXFA 2K7QA 1W0VB 4M3JA 5DVKA 1M05B 1NMBH 3ULSA 1M7IB 4GBXA 2J5LC 3U7AA 1G6RL 5CJQL 1FVDB 3HI1B 1PEWA 5K9OB 5DUMH 3GBLA 1RUML 4G8GE 3TZVC 5DJAA 5J13B 3EFDL 5HSFA 1A6UH 1RJLA 3KR3L 3AGVA 2R0KL 1JMZA 4PJ9D 3G6AA 4HKXB 4ELKB 4KXZI 1I85C 3HNTH 2EYRA 5I1JL 3WFEL 5LXGH 4LPXA 3NPZB 5KS9B 4Y8AA 4ZD3H 1BGXH 3RDTD 1HIML 1G7IB 3PF2A 1OSZA 3B6SA 1QSEB 3DXAB 4QXTA 4U1JA 4ZFOA 2CRIA 3MCG1 5CHNB 4HK0A 1JGEB 2ADGA 4BA8A 3FFCA 3BWUC 2YD9A 4MS8D 1BZ9B 2QKIB 2FX7H 3U7YH 5C0JA 4JKPH 1ADQL 3WN5B 5C0GA 2IGFL 4UAOB 3ESVF 3MLRL 2EE9A 4P5MB 3UP1A 3S5LA 2DQIH 3MCLH 2D4DA 3KPSE 2B39A 4XH2B 2X4OB 4BSJA 1MUJA 4LASH 4G3YL 2XT1B 6FABL 5EG6C 4KK8C 3WFCH 4OZGA 1U95B 5I0ZA 1VKXA 1BQHB 3RU8H 2ITDA 3LHPL 1FE8L 1U3HB 3KJ4C 1T7XA 2P4AB 3OHXB 1NJ9B 5SX4H 3MO1B 4L9LA 4E9LA 4L8BA 5GHWL 4F9PC 4HZAA 4GG8B 5I73B 2J8HA 4P2QE 4LPVA 3CGTA 1A4JB 3GHBL 1MCDA 2X10A 5C0FA 3G6JA 4AEEA 4KTEH 1JCKA 4PJFA 4KJWD 1NDMA 1WBZB 2Y25A 2NW3A 3WSQL 1DUZA 4XTRC 1G7HB 4X7SH 3NVQA 5KAQG 1ZGLP 2XTJB 1B2WH 1C08A 3ULSB 4KUZL 1J1OL 2ADIB 3L1OL 2Z0BA 3EGSA 5H37H 4XCFL 2KKQA 1W0WA 5J9PB 4TNVF 5FUCC 2MTPA 3BSZL 2VLRD 5L2KE 4PJHB 1PY9A 5CBEA 2OL3B 1L0YA 2LQRA 2I60H 3G6AB 4NT6A 1EA9C 2P8LB 4N9GA 1QLRA 2F54E 1K3IA 3HMXA 2YXMA 4UB0L 5EIQA 2VLRA 1JPTL 5GJTH 5FXCH 5DF0A 2FBJL 4NO5B 2F15A 3UTTB 1NGPL 4KZDL 1G1CA 4RMSA 1H8SA 3C9NA 1PG7X 1OSZB 3B6SB 4HULB 4U1JB 3IDGA 2CSPA 2Q20A 2ADGB 4CU7A 3KVQA 2WP3O 3FFCB 4JCMA 4X9BA 1ZGLA 2AK1L 1U8QB 3CDFA 4GRWE 4S0SD 1T1YA 3UMTA 2DI7A 4RFEA 1J0HA 4RGMB 2PTUA 1IEAB 3OKOA 1NDGA 2DQJL 3C08L 1MPAL 3ARFD 5J6HA 5EH1A 4PUBH 4U1KA 3V6ZA 5GRYA 5DO2D 4K3EH 3QEGL 5E6IC 1CDCA 2F19H 1CFVL 1XCQA 3HE6A 1GPOH 1S7WA 4DEPB 3UPRA 1UACL 4GRWF 5ITBH 2H32A 4ZS7H 2IAMB 5IMOB 1UM5L 1WLHA 3QA3B 4MA3A 2DQHL 1N8ZA 3PWUA 1KXQE 1GOFA 1YPZE 1ETZA 4BJLA 4LSDA 3LZFL 1OVZA 1PKQE 3WIHA 4G8IA 4CKVX 4XPGL 1OAYH 1L7IL 3KPRB 2DLGA 1ROWA 3QUZC 4LLAA 1QD0A 1AR1D 3G6JB 2VLMD 1WIOA 4J23A 3GM8A 4PJFB 3GKWL 1PSKH 4X99B 8FABA 2NW3B 1XGYL 3V5KB 5HGHA 3BDYH 1YPZF 5J1SC 4KUCD 3TCXA 1UCTA 5KW9H 5T5FL 3NCEB 3VFGL 4OIBA 1J0ZA 1QSFB 5SV4A 3MLZH 4WU7B 2VAAA 4G7YL 1SBBA 1W0WB 4HIJA 5KSUB 5AZEH 1NCNA 1OAUH 2G2RA 3X12A 1BMGA 1MRDL 5DEZA 5CBEB 1Q0YL 3ES6A 3V0VA 3DI3B 1A21A 1NUFA 4NT6B 1OAZL 1Q9LA 3M1BB 4WY7H 4U0RB 4XNUL 3EJYD 4IJ3B 3LN4A 4TNWK 1FN4B 5HVHB 5L2JA 1RUQH 4KKCC 3QCVL 2RFXA 2DDQH 3VXRD 4YXHL 3UZVB 4LSRH 4PJAA 3GSQA 1OGAD 4PG2C 4S1DC 4S1RH 4NJAL 3C9NB 4RWYH 4HFWA 3WO4B 2MHAA 2NCMA 1B88A 1NFKA 3GUTA 5F7MC 1N6QL 5MEOA 1XT5A 1IM9D 3CSPA 1KTDA 4QTIH 3LEVH 4X4MA 4Y89A 2Q87A 3V52H 3KGRA 4QGYA 1T5WB 4JFZH 1HQ4B 1ZGLB 3QDGA 2K9UA 4U31A 4L8SA 1T1YB 4GKSA 2OL3H 4MHHG 2DQUH 1OTSD 3RIAF 3OKOB 2DMCA 1NDGB 2DKMA 4PGEA 2HN7A 1A7RH 4LHUA 5J6HB 1I3VA 3V6ZB 5C08D 2E27H 4NUGL 2VKXA 4ONHA 1YYLH 4MDIA 4YH6A 3SEPA 1MVFA 3HE6B 4WW1B 1S7WB 3HRZB 4YXLH 3RI5F 3BRGC 4CVZB 4M7LL 5D7IE 3UPRB 5H94A 2H32B 3PQYA 5GGQH 5C08A 4MA3B 1YUHA 3QEQE 3ZKND 4MX7A 5C0IA 3N1PC 1GHFH 1SHMA 1TENA 2XV6B 4P9MH 3MBXL 3VA2C 4JGJA 1SVZA 5D4QA 3GRWA 1ZVSA 4FQJL 5TE7L 4UDUB 2H41A 5E6YA 2W9EL 2A74B 1AE6H 3V95A 2R2HA 2DJUA 3L3DA 4OZ4B 3SCMA 5D7IF 1HZHH 4IEFB 1I3RA 1TCRB 5I2IA 2E8YA 5FCUH 1CQYA 3VXOA 3FQNA 1JK8B 4Z7WE 3MYZA 3CFEB 3QPQC 3ZKQD 3V6FA 3FCTA 3M8OH 5T33L 4LSTL 3QDAA 3GI9H 3I6LD 3SDAA 4HIJB 1A7NL 2CDEA 1ZLVK 3DETC 1OCWL 3X12B 4MNHB 1U8NA 3IAQA 3ES6B 5I15L 1WSST 1Q9LB 1SBSH 1YMMD 5IQ7H 2HLAA 2QTEA 3VXSE 3VMNA 2IAND 5L2JB 3EDFA 1K4CB 4Z7WF 4OBRA 1FNGA 3MRIA 3K2UH 5C6PB 1FO0A 2PYEA 3G6DL 2DM4A 2A6KA 4PJAB 3BIBX 4PRBB 4MD5A 2JJWA 5C1MB 4KRPD 4HFWB 2OTUB 1OARH 3BWAA 5E2VL 3WIIH 4PLKD 4X98B 4NUJA 3GUTB 3P0GB 1HNFA 1JFQH 1U8HA 1UZ6F 2DQTH 1KTDB 2FBOJ 2VABB 3IJSA 1T2QL 5JORB 3RZCA 1T04B 2A6JB 3LDBB 3QDGB 1NMAH 1KG0B 4NNPH 1XF5A 4OGAD 3ARDB 2D7MA 4JFFB 4EXPX 1CLOL 2Q6WB 3TWCH 1MLBB 4AZ8A 4HKZB 4PGEB 4QXUH 3IJYB 4LHUB 3NZ8B 1AXTH