3LRGA

Structure of anti-huntingtin vl domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
b'SQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVLSAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-huntingtin VL domain
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrgA00
1OL0A 4GRWE 2VABA 4NUJB 5JORA 1XMWA 3QG6B 3CFKA 3MLZH 3QFJE 1CLCA 5ILTH 4RNRA 4WENB 4KJPD 3OZ9L 5F1IA 4HF5L 4Q6IA 5IV2B 2H1PH 1K4DB 2EDFA 3GMMB 1JZ7A 1R5IB 2NTSP 4G8IB 4MA8L 1U8QA 1YEHH 5F21B 4QHUA 2C1OB 2PUQT 1E4KA 3I6KA 3P4LA 4PJEA 1JMZA 1I7ZB 5D5ME 3ARXA 5EBLA 3MJGX 4HBCL 4JRYD 4Z7VF 3VFTB 4ODBD 3U9UA 1VGEH 5IVXB 3L9RA 4PG2A 1K5NB 5D1ZD 4XPTL 4KFZC 5DJCA 5EIIA 3N1GC 3GI9H 3V5DB 4OTXL 1NFIA 4Y2DA 4HCRH 1RJYB 3OXRA 1AE6L 5D2LB 1BQLH 4F9LC 2XPGB 5F6IB 4U6XA 1CLOL 1WT5A 1NGWB 5D7IB 4PV9A 2AQ1A 1BBDH 1S9YA 1BQHG 5FO9B 1TNNA 5I8EA 1I8IB 2Y6SC 3E6HA 4NO5B 3C6LC 2FR4B 1NUNB 2AJXH 4OIAA 5TE4H 2X70A 1FRGH 3OKEA 4XNZC 3U0PA 1AD9B 5F88B 5C08A 2WUCH 4X6FB 5CJQH 3QUMH 3VXRA 2ENYA 3H9SA 4F3FA 1QLRB 3WS3A 4RDQF 2SEBA 5D7JA 4PJIF 3SO5A 4M62L 3VJ6B 2KUTA 3OAZK 5HPOA 3I50H 4HDIB 5DD5H 1AKJA 3HE6C 4NWUH 1LO5A 2DJUA 3GSVA 4UOW0 3T0EA 1RZ8A 2VAAA 5ISZD 1DANT 1NLDL 4P2RA 1FZJB 4DFHA 2E7HA 4FQPA 1NEZA 2VDKL 3I9GL 4J12A 5DVKA 1RVFL 4X7TA 1U8PB 3DYOA 4P9HL 5D1ZB 5C0AB 1VEMA 3O45B 1MCWW 3MREA 1B3JA 4PRNA 1CG9A 5JQ6L 3UJJL 1JUFA 4JKMA 3E6FB 4XPFL 3QUZD 3VG0L 2RFXA 3V0AC 3D3VB 3EJYC 4X6BB 2A6JA 3OBAA 2IANE 2CJUL 1I85A 3O4LD 1KTRL 4YEEA 3TP4A 4GW1A 5JOPD 5DRZA 3SQOH 4Y16C 2FZ3A 5DUBB 5E03A 3VH8B 3SGDI 1YEGH 2YRLA 4KU1A 5FECB 4G6KL 4N1CA 4DQOL 3AS2A 4ETQB 4XCFH 3QUMB 1FV1A 2V5TA 1CZ8H 5HYJB 1URLA 4KXZI 4NDMB 2B5IC 1NPUA 4QHMB 2DWEB 4JJ5B 3EOTH 5CLTA 2VISA 1AC6A 1AXSA 2YPLE 3QEUB 4WHCA 4OCMC 1JE6A 3RZCA 4EIZC 3DX9A 5I1DB 1EFQA 3CSYA 1F13A 3C2AL 3P0GB 5JZ7C 5GGVH 4R96A 5CILL 3HG1A 5B39A 5EZLB 1X5FA 3U82B 4U31A 2KL6A 3NCFB 4HGWB 1NH6A 5ISZB 1MSPA 4XVSL 3S97C 1BLNB 5J9PA 1X3DA 1U6AH 3I3EA 4L9DA 1CK0L 5GRJH 5SWSB 2HT2C 1Q9LB 4R8WH 1GAFL 2ICWB 4WUKH 1IILE 4OD2A 5DJZB 1G7HB 3CCHA 3QXWA 4WHDA 1YYLH 4JRXE 3ARBB 4ODVH 4H26B 2LE9A 1EAPB 3V52L 5F9DC 1I3GH 5J8OA 4JDTL 4JO4H 1ZGLP 4IOIA 3QUZB 3H42H 4LSUL 4H5SA 5IVOA 1G6RA 4R7NA 4F37K 1U8KB 2YPVL 4Y4HB 4MD0B 5F3BB 4M7LH 2QQKL 4HK3N 1UWGH 5JPNA 1S7WA 4M93B 5IMOA 3VFSA 4OZHF 2AV1B 1KV3A 1U42A 1E28A 3X3GL 1FL6A 3ULVC 1IRAY 4P5MB 5D96C 3EAKA 2EECA 1UWXK 3BJ91 3Q6GH 4HUXB 1KFAH 2AI0H 3NIDF 1LEGB 3HAEH 3O8XC 5B8CA 5KS9E 3IDJB 4M5ZH 1QQDB 2XQYK 1BM3H 3O3AB 4P46C 1MWAL 5C09D 5E1AB 1AD0B 1UG9A 3TZVC 32C2B 2X09A 4MZ3A 2JB6B 3AB0B 43C9A 3SKMB 1EGJH 2FB4H 1FC1A 1SYSA 3BPLC 5C0BD 3PP4H 4Q74A 3IXTA 3CFBA 2IPUG 3PWUA 1J0IA 4J3VA 4Z7OF 3AXLB 4RSVA 3VD9A 3VXPB 4RAUA 5CIPH 3T1FB 2JK5B 4OKVB 4WI5A 5L2KB 2B4CC 2I60L 5CSBA 3PGFL 3QWQB 1YEKH 2E9JA 2FEEI 4TNWK 3O4OB 4YAQB 2OTUB 1LO3L 3GDBA 4EI5C 4OFDA 1OP3K 1MVUB 2DM2A 2Z31A 3S4SG 3MRPA 3RIFF 3ARFB 5LGJA 1UEMA 1VFBB 4ZFOB 1YY9C 5DI8A 1QRNB 1TTUA 3H9HB 3GSRA 3K7UA 4FXGB 4ZAKA 4P2QB 3P11H 2GAZB 2C7UA 5KSUB 3LMJH 3OPZH 1A6TB 1AFVL 1TMCB 3EBAA 4HPOL 2Z8SA 3W2DH 4W81A 3MRJB 4NHUB 3HAEB 3S5LA 3QPQD 1A9EA 3TNNB 3L3GA 5IBTH 5FM8A 1T20A 1OOAA 1ZLUK 3WJJC 5ILTL 5GS2D 2V2WB 1P2CB 2JTDA 1MY7A 3ULUD 3WUWB 1HCFX 2R0KH 3FFCB 2VERN 2H1PL 1UENA 2BSTB 5GS2H 2YSSB 1L9MA 1JI2A 1FH5H 3BHBA 1YEHL 1T2QH 3JWNC 5C0BB 3BKCH 5CIPB 4NKQB 1CXHA 3PGDA 5DK0B 3ZKMC 3GJFA 3EYFB 2YD4A 2J88H 1FL3B 2R1WA 3V4UL 4ELMB 1VGEL 2ZOKB 3MV9A 1IGTA 3IVKB 2H2PD 1A21A 2F54D 5I1CH 3BWAA 1FLTX 3GI9L 2Q7YA 1B0RA 2WLZA 4F7MA 1O7SA 5BVPH 1RZKL 4DW2L 1X5JA 2VDLL 1IKNA 1LQSR 1EA9C 4HCRL 1F02I 4I3SH 5GGUB 1G9MC 3QDJA 3L5HA 3QIUB 2APWA 3TBVB 2BHUA 2F5BL 3VFPB 4HEPG 4KI5E 4UV4L 5DMKB 1H15A 2Z93B 1A6ZB 4U0RB 1B2WH 3K1DA 1RQ5A 3CIQA 4JPIB 1QA9A 4LLYA 2AJXL 4OCRH 5TE4L 3HE7D 3DUUA 4UINH 3TN0C 5J12B 2VYRE 5C3LD 2WUCL 2CDFB 3PDDA 3DETC 5CJQL 4DGIH 5E6IC 5GS0H 1EUUA 1HILB 3B43A 2ZSWB 2OXHA 4L8BA 1BVKA 4PRAB 3MRDA 1UXSA 3BOVA 3SDXE 3LOWA 3I50L 3F7YB 2G60H 1QHOA 1U3HD 2Y72A 4CKVX 4WU5B 4NJAL 3DVIA 4ZO7A 3LHPH 3VWJC 3NIFE 2FJFB 3L1OH 5A2FA 1HEZA 1LGVA 3O2DH 2MQ0A 4JFDD 2OJZH 1E4JA 5EU6D 3H3BC 1MJ8H 2N7BA 1AC0A 1Q9KB 4G9DB 1NAKL 5MEOB 5I1GH 5FGCB 1MI5B 1CLZH 1TVHA 4HJJL 5I1IH 5IIEA 3B9AA 5GGRA 4P4KB 2XNAB 3VXMB 1AQDA 1HHKA 2PR4H 3SQOL 2MJWA 3ZKSD 2AJZA 4F7PA 5FGSA 4XCYA 2N4IA 3CUPA 3IDYC 4XCFL 4KVCH 4RQQB 2D3VA 3HE7B 5J6GB 1CZ8L 5JXEC 4WFGE 3WNLA 3ZYIA 4GSDH 2O61B 2DBLH 4MNQB 3VFUA 4NKOB 5K9OA 2PYFB 2BVPA 4FZEH 1I1FA 3OHXA 2FO4B 4JKKA 3OKDA 1JNNH 4HX1A 5GGSB 1QTYT 2X4UA 5D6CB 2CH8A 3TT1H 4QF1B 4FN0A 3PWVA 4PGBA 1FVEB 4WW2A 1DLFH 2Z91A 4P23A 4PREA 2F5AH 1QSVA 1U3HB 3ZLQC 1PGRB 4MXVE 5D8JH 3TJHD 2QEJA 3KJ4C 1KPUA 3D0VB 4D0DA 1FJ1A 2JE8A 4NFCA 4RWYH 1J05A 3DMMD 4KPHH 4LVOB 2EDJA 1A4JA 1D9KC 1U6AL 5DYOA 5GRJL 1MCPH 4KMQA 3Q6FB 4JFDB 4R8WL 4WUKL 3WIFB 2GSGA 4YHPA 1R3IH 5F3HA 1YYLL 1A2YB 3OXSB 5D2LF 2D4FA 5FYLH 1CXKA 4OFPA 4FXKB 1WFOA 3VDAA 1I3GL 3NFSH 4JO4L 1WZ1H 1U9KA 5D2NB 1VFMA 5D7IF 4YWGH 3H42L 1RK0B 3P4NB 5C9KA 3MRHB 3FT2A 5DEZA 5E6ZA 2NLJB 4M7LL 4L8DA 1UWGL 2ATPA 3JV6A 1ZHNB 4U1SB 4ZFOL 3BX7C 2FATH 4I9WE 1FZOA 4NRZB 3FB7A 4H0GA 4XCNB 4ZS6C 4R4NC 4PRHA 4FQXD 1KGCE 2E27L 3Q6GL 4IRJA 1KFAL 4J3TA 3R1GH 4L9LC 1T1YB 2IH3B 1BMGA 1NDGB 4QTHA 2Q7NA 4M5ZL 3MROA 1BM3L 2X1QA 4PRDB 4CBPA 4ODWB 1UKQA 1XF4B 2ZJSH 3BI9X 2MKLC 5JHDE 5J7CC 1EGJL 2FB4L 2VLMD 1JZ3A 3PP4L 2Z31D 1WCBA 4Y88A 5AZ2H 3SBWC 1ONQB 4N8CH 3C87A 4WRLA 4FABH 4UB0L 1CU4L 3MA9H 1J10A 2OJEA 2AERT 2OZ4H 5ESQB 4PY8I 4R3SA 1D6EB 3LRSA 5EC1A 4NZDA 4Z7WE 3G08B 2OK0H 3PHQB 4UDTB 1TTGA 4R90H 4MQSB 4W4OC 1A6UH 4PJ5A 2GK0A 4OQTA 1S7QA 4KI5C 1CFQA 3IFOB 3G5XB 3LZFL 4K3GA 4LLDB 1WVZA 4YHZH 3HMWH 3P11L 3AROA 3LMJL 3OPZL 4RGMB 2OSLA 1Q1JH 3NIGF 5J13B 3W2DL 4ZODA 5JW5B 4K3HA 1Y18A 3PV6B 3OB8A 2Q6WA 1G7QA 3LKNA 3QDME 5IBTL 5D7LA 1SYVB 1IT9H 1FNAA 4WV1A 3IDGA 3RKDC 4PGDA 3I6GB 1KELL 5BCAA 2MMXA 3QEQD 4DN3H 3HHRB 3LQMA 4Y5VC 2R0KL 3ZT7A 2ADIA 3CFEA 4KQ3H 1U8NA 3V7AE 3CMOH 5HHNB 1FH5L 1FDLH 2X4TA 4PP1C 1T2QL 4XPAH 4OGAC 2HVJB 3IFPB 3U6RA 2J88L 4NZJA 2BX5A 5INDB 3SDCA 1I1YB 2YN3A 3EGSB 4XXDB 3O8XA 1QLFA 1EZVX 1ADQA 3QFJA 3O3EA 2JJVA 5I1CL 1OY3B 1GOGA 5CP7B 1K2DB 4P46A 4JZJC 3NABH 5BVPL 1QVOB 4U1JA 4I0PC 3EOAB 2DD8L 4X9HA 1HSAA 1D3CA 3DO7A 2Q86A 1XF1A 1MJUH 1KCKA 1I9JH 2VXVH 5EZJA 3HLAB 3PXHA 3WFCH 4LRNH 3DJ9A 1NFDF 4N68A 4OCRL 4PGCA 3RGVB 1T0PB 4UINL 3MLPA 3MO1A 2IADA 2WQRA 3GB7B 4OZIE 3OQ3B 5CSGA 4PRPE 3GMOB 1QZ1A 1KB5A 5GS0L 4TUOB 5T5FH 1HN1A 1AJ7H 3LKQB 3WXWH 5D1QC 3DTXA 2AXGB 2G60L 3I3DA 2JIXA 2GKIA 4GRLA 1LP9F 2IG2H 4YXKL 3W5NA 2R1XA 2F15A 4AIZB 2DIJA 3ESUF 1I3RB 3LHPL 2KZWA 3KNBA 4PJ8A 3T09A 5BQ7B 5GS1C 3L1OL 2C1PB 5D7SH 2VDQL 4MZ2A 3OV6A 1II4E 4PY8J 3O2DL 4GAYB 1QBLH 3RWCA 4LLUA 1MJ8L 4G3YL 4JPWH 3AY4A 5IP4A 1QSED 2D7NA 2XXMB 2ZCKH 5D7KD 3RDTB 5I1GL 2XICA 4KUZL 3OG4B 1FSKB 3BPNB 4G9FE 4QRPD 2DM7A 4XXCC 1T1XB 1AXIB 5I1IL 3WIHA 3EW3B 5KSVB 2DB8A 4HKJA 3ZKNC 2MSPA 4LOUC 3GSUB 5DZNA 2PR4L 3DXAB 4ZFFA 1MHHB 3LPFA 4RX4D 5FA3A 5JOFB 2KPNA 2ESVE 3EDFA 3T0DA 3V6ZA 3WSQH 1CT8A 1N5AA 4KVCL 4ONHA 4CVZB 2Y6SD 4GSDL 5HYSB 2DBLL 3C6LD 5I18H 2HFEB 2EIZB 4UU9B 4EVNB 2NX5E 4FZEL 1A5FH 1T7YA 1JNNL 2MKWA 2IFGA 3MRBB 1MJJB 3QO1B 2IANA 4Y4KC 3L3KA 1G7MB 4LCWB 4Y4FB 4LFHD 3UBXG 4UZGA 1FQ9C 1IZKA 1DLFL 3ARPA 2F5AL 5FO7B 1IL1A 1BF2A 5D8JL 1F2QA 4QYOB 5HHMB 2LVEA 3THMH 1N6UA 3UYRH 1BPVA 4NQCD 4RWYL 5DMJB 3HE6D 5ACZA 4KPHL 4ELMF 1F3JA 4I18C 5HGBA 2P8LB 3RNKA 3S5LG 5KAQG 5MEQB 3SEPA 1KB9K 1OAUH 1TXKA 4JPKH 4LHUG 4YC2C 1MCPL 5CKAA 5I1AB 4DVBB 2QHLA 1SJXA 4N8VB 2AVGA 4ZOCA 4C56E 1Z2KA 1QSEB 1U8LA 1NMAL 2YPLA 1F6AA 4TYUA 5I1KH 1YN6B 1G7JA 3RL2B 5DXWA 3SQBA 3IS0X 4UMGA 3VFVB 4PRHD 3LIZH 4AEIH 1D5MA 3Q1SH 3PV7A 4QRPB 1T2XA 4YHIB 3BD3A 1RURH 1JYVA 4I4WB 3E2HB 4MJIE 2DYPB 5HDOA 3WNPA 3EJYD 1GRWA 1X6LA 3CVIL 4OLEA 4Q9CA 1A1NA 1G9EA 3D0LB 4WWKB 4PG9A 5T1KA 1OGTB 3GSNA 4Y16D 3FJTA 3FOMA 4OZFG 4JRXA 5DJ6A 2EYTA 3HRZB 5AWNH 2JCCF 4K94C 3O9WB 2EO1A 2P42B 3HC3H 1CGUA 1EO7A 3IJHB 2AEWA 1ED3A 2PCPB 3OB0K 3EJJX 4OCWH 1SEQH 4LCIL 4BH8B 4MQXC 3ALXA 3C8KB 4BSVA 4U1GB 2ZJSL 1KJ2H 4X98A 1QSFB 4HW6A 4GG6B 1WZLA 2ZWLT 5SX5K 4X6DE 4NC2B 1R5VB 1NCDH 3IDXH 3F6LA 4PJBE 2HWZH 5JZ7D 5TDNA 5ICYB 5AZ2L 3RVWC 4FABL 1FHGA 2VE6B 3MA9L 2ERJC 1T2JA 2OZ4L 5EORH 5LJYH 3KXFD 3G6AA 5FYKE 4L3EE 15C8H 1FNFA 3FQUB 2HT2D 1OARH 2OK0L 2NTFA 2UYLB 2G5BB 3SO3B 4Z77B 2HRLA 1X5IA 1ODAA 4LPVA 1QFPA 1L0QA 3ZZ1A 2ZUUA 3HCVA 5EN2B 4PTUA 2EE6A 4N0CC 2EC9U 3K8MA 4BQ9A 2IPTH 3QH3A 1NL0H 1JZ8A 1W72L 3G04B 4R26H 1UJ3C 1DR9A 3VG9B 1Q9OA 4YHZL 3HMWL 5IEKB 3FQRB 1UKSA 5JTWA 1Q1JL 2AKRB 1XZ0A 5BS0E 4NQDA 1U8OB 4OI9A 4Y16B 5GIRB 3S96A 1IM3B 4JZNA 3FONB 2VLKD 2CKBH 3MFFB 3MV7D 5E00A 3ULVD 1T1ZA 1MEXL 2VQ1A 1DQJB 4MNHA 4DN3L 3IJSA 1I8MB 4JDVA 5I1LB 3T3PE 3O8XD 1KJ2B 1D5BB 3EO0B 4KQ3L 2WW8A 3QFJD 3CMOL 3HN3A 5F8RC 1HKFA 3UJIH 1MCOH 4WEMB 4P46D 5HSFA 2IQAB 2HH0H 5HD8C 3TZVD 5EU3B 5IBUB 2XG5A 1LDPH 4ONGH 4XPAL 5DJAA 4MB5A 3EOBA 1INQB 5DJ8A 3HUJB 2LTQC 5E56A 4K7FA 3O11B 4JDZA 3MLWL 5LGKA 1U8MB 2YRPA 5KSBB 3VI4E 1KJVB 1L6XA 2R29H 4FZ8L 2ED7A 3K2UH 5EBWB 1DEDA 3QA3A 4X80H 4YR6A 5ITFA 1P1ZB 4P3CL 3NABL 2OLDA 4LPCA 3KPRD 3RU8H 3RWFB 2VKXA 3DX7A 1IFHH 1ZSDA 3SJVD 3U0WH 4EI5D 1MJUL 1I9JL 2VXVL 3VFNB 1P84K 1GC1L 1U58B 2D31B 3WFCL 1KUMA 1NDMB 3OKMA 1UACL 2BNQB 5L9DH 1ZVYA 1YY9D 3BP6A 1CGVA 1AHWB 3PWJA 2CKBB 4HIJA 5HDBF 1VA9A 2O5YH 4S1SH 4JY6A 5EIVA 4NJ9H 3BWUC 3ZTNL 5EG6C 4YDLC 2HRPH 3MV7B 4NN5B 2YRZA 2Q8AL 1N8ZB 4Z7NE 2FJHB 5T5FL 2WIMA 5F7MC 5F7DB 1ES0A 2AK4B 1FC2D 2EYRB 1S9WA 1AGFB 4X6CB 3RUGB 4Q0XH 2A9NH 3QXDB 3V5KA 2G75A 1OT2A 3F12A 4JFEE 1RUKH 4W68A 3UO1H 4QHLA 4D8PB 2R0WL 1CQYA 5D7SL 3H7BB 1QBLL 3OR6B 4K7PX 5DQDL 2ORBH 2CLZB 3TPUA 2X1XR 1LD9B 2IFFH 2JJWA 2NY5H 3ZKMD 4OGXH 2ZCKL 4PJ9A 5TF0A 2P5WB 1B4JL 3K74B 4WFEE 3VRIB 1MCFA 4O51B 5HY9A 1IMHC 4L1DA 4R4BB 3C9NA 3SDXA 3WDHA 1U95A 2A77H 3IJYA 4NWTH 1REIA 3KPRB 1ND0A 4X4MA 4AEHH 4YPJA 4RMSA 1G7LA 3PDOB 4MLSA 1A3LL 4BKLA 4YO0B 3C5ZB 2IAND 1OP9A 2ATKB 4U1NB 3DVNB 2DF3A 3L7EB 1UZ8A 2YUZA 3FB6A 4OGZA 4D2NA 1SM3H 1QSZA 1QFHA 4EI6B 2UZYB 5I18L 5DHYA 1TENA 5DMYA 3CFDA 2BC4B 1YC7A 3L95B 4MD4A 3TBSA 3TN0D 3OX8A 3LSOA 1S7VA 3ARYA 3DETD 3DOSA 3OR7B 4XP4H 1AIFB 5E6ID 5JR1H 4KZDH 1TJIL 2H3NA 2X89D 4LCYB 3SKNB 3THML 3UYRL 1G9NC 4N90E 1T3FB 4CW1B 3BZFB 1DUYA 1RIUL 3QNXB 5FB8A 5HGDA 1OAUL 2QL1A 5EZIH 4O2FB 4HD9A 3VWJD 2BY1A 3VFOB 3IU4L 4ORGB 4NO2B 3QQNA 4Q9QH 4P57B 5DJYB 4RAHA 1T5XB 5DUPH 5I1KL 1T7ZA 1GZQA 5E8OA 1YECH 4PJGE 5IMLB 1KCVH 3FAXA 4AEIL 3Q1SL 4HZLB 4CADA 2A83A 1RURL 1AO7E 1JN6B 1UM6H 5EUOE 2DBJA 4GMTH 3IRPX 2VR5A 4K9EH 3ARDB 4M43H 4PJFB 2XKUA 4V1DE 1JGDA 4LCCB 2DRUA 4E0RB 4U7MA 2VUOA 1VB9A 2DL2A 1DBJH 4OLVH 2D0FA 4U1LA 5FOBA 5K9KB 5FUOH 4H8WH 5AWNL 3LKRB 2A1WH 5BJTB 4H1LA 3GSXA 4TVPH 4Z0XA 4XNMA 1QHPA 3HC3L 5MENE 1G1CA 5JXED 5I66B 3L3JA 5EULV 3TN0B 4O5LH 4OCWL 4O2CA 5BOZG 5EU7E 1ZA6A 2XACC 1KBGH 2OCFD 2XWJA 2G9HA 2B8OT 2C5DC 5ANME 3BP7A 4EN3B 1DP0A 4AEFA 4NKDA 1MREH 5MERA 1Z3GH 4NCC1 2UZIH 3FT3A 4R7DA 1NCDL 1KCUH 4JQXA 1WK0A 2HWZL 5IJVA 4NM8H 5EZOH 1CFVH 3CU1A 1U2CA 2HJKA 5EORL 1TZIA 1S3KH 1R3LA 1T0NA 2YKLH 3VWJB 1BJ8A 4QOKD 3CVHL 4NZUH 1D9KD 15C8L 1KENH 4IOFC 2EC8A 2OMNA 4Y4KA 4RBPK 1OARL 3R06B 4WW1A 4RGNE 3UTSD 3HI1B 5JHDA 4L8SA 2H41A 3MRKA 3PGCB 2NNAA 2H26A 4FP8H 4XNUH 1NL0L 2H8PA 4Z9KB 3BXNA 2Y4SA 3FB8A 3BZ4A 4R26L 3TO4B 2IH1B 3LCYA 4OLXH 1FE8L 4XBPA 3UTPE 2BNRE 4PV8B 3A67H 3HNTH 4Z7WA 1MCCA 2CKBL 2W60B 4EDWH 2XQYG 1G0DA 1T80A 3T04D 3DI2B 3LAFA 4RAVB 4ZS6D 4R4ND 3MRIA 1MQKH 3PL6C 4Y5YC 3QIWC 3B2UC 1HOCB 4XNYH 2GTWB 3NZ8A 2BK8A 5TDOA 4JQVC 3WBDA 3CFCL 4QRTA 1A7PH 1V8HA 1ZHLA 2HH0L 1K4CB 2G2RA 1LDPL 4GUPB 4ONGL 5J11C 5I2IB 4K71B 3S4SB 4JFHE 3D18B 1KXTB 1C7TA 1DVFC 3KJ4B 4NN6B 1MF2L 2QKIB 1JJUA 1R5WA 2ENSA 2XWBA 4M8QB 1A8JH 1F6LL 3K2UL 4X80L 5EUKA 3SKJH 1WV7T 2R39A 1WBZA 3HR6A 2R0LH 2AXFA 1E27A 1UB5A 2XV6B 5C0DA 3RU8L 4BK4A 3UTSB 1OGAE 4EDXA 4F33A 1IFHL 2PXYC 3U0WL 3MXWH 1ZVSA 3BQUB 1YEIH 4ZO8A 5B3NA 5AUMB 4NRXB 1FVDA 4MMZC 5EOTB 4MA1B 4KI5D 5SV3A 1XGPB 5JNYB 1RHHA 1IAKA 1LWRA 4NBXB 1DZBA 3HI6H 2QJDA 2C9AA 2O5YL 4NCDA 4S1SL 2ZKHH 3MOBH 2A6DA 2VLJA 1D5ZA 2HRPL 2CR3A 3SN6N 3U4EA 1PQZB 3TH3T 1A4KB 5EC2A 2QQNH 3EDEA 1VGKA 1WJ3A 2R2HB 3RKDD 2QR0B 3D85D 1RZJH 1P6FA 1M7DB 5DO2C 4Q0XL 2A9NL 3PJSA 4PJHF 5IUSA 1YPZF 5CFHA 3WLWC 4IJ3C 5E8NA 2DLGA 2LU4A 1RUKL 5KVDH 3UO1L 1DBMH 4KKBC 5EOQH 4HG4J 3H6JA 4PP1D 4XX1G 5HHVL 4D9QE 2ORBL 4OZIA 3U9PH 2YD9A 3CAFA 4OGAD 4PRPA 1U3ZA 2W91A 4PRIB 2XZZA 3VA2C 3ZDZF 5JLZB 5I8OH 3OKYA 5H94B 4NO3A 1P4BL 5BVJA 3MRRA 3MRQA 2X4QB 4PJCE 2LAAA 4M6NH 4NWTL 5E9DA 4AEHL 3GMRA 1DBBH 4I0PD 1J0JA 3HC0A 1WGOA 3BP5A 3DGCR 2J8UB 1R24A 3P30H 2E6PA 2EIEA 3FQXB 3QUXA 5FCUH 5E08H 1OT1A 1G9ML 3TCLB 1UGNA 3RPIA 3OF6A 1SM3L 1R3JA 1HH9B 3RWDA 1WFUA 1NKRA 3C6SA 4PY7B 3Q3GB 2A73B 3B8YA 4U1KA 4BFIA 4XP4L 1IEAB 5EU7C 2FBOJ 2ICCA 1AGCA 1FNSH 4LSTL 1UM5H 2PW1A 1VDGA 2F58L 4KZDL 4FQHA 4GXVH 5TFSH 1NLBH 3F5WB 5D1QD 2D7TH 3D2UD 3HUJF 2YD8A 2WUBH 4Y5VB 4ENEC 2ESVA 5FA4A 5KSBF 4ODUB 1VACA 5GJTH 3P9LA 3MRLA 5EZIL 4PJAF 1MPAL 5D1XC 1YMMB 2HG5B 5HYFA 4YJZL 3U1SH 1T21A 3JVGA 4Q9QL 1MVFA 4BZ1H 2Z92B 2MTPA 4GW5B 1KLUA 1YECL 4PJIE 1RK1B 1KCVL 2D7PA 3IXAA 5IQ7H 2R2BA 1F6FB 1VKXB 3X11B 1CTNA 4IDLA 3T0VA 4JZJB 2BY0A 4I0PB 4GMTL 1SBSH 1SVCP 3ZKXB 1XGQA 3ZKND 2WSKA 4LOUD 5MHSE 3BDYL 1ULVA 4XZUA 2D4DA 3UPRA 2VDOH 3QHFH 1S7SA 4C55A 5FUOL 4H8WL 4I9WD 5IB3A 3CDGB 4JHBA 3X12B 1U36A 4TVPL 4F7EA 1JNJA 4HFUH 2JJSC 1TVBB 5E4IA 4LNVA 1XGRB 1OB1A 1KGCD 1A7BA 5C0FA 5E6YA 2VABB 1WC7B 3SE3A 4L3CA 3VWKA 5JORB 3CFKB 4HV8B 4RNRB 3CC5A 2KH2B 5ITBH 2P48B 4Q6IB 4Y4KD 3L5JA 3WN5A 2GTZB 2UZIL 5IFJA 5L0QB 3JBG7 1KCUL 1B88A 4GH7B 1U8QB 3SPVA 1CVSC 4QHUB 3L5XH 4GO6B 5EZOL 4JFOA 1NAMA 2LAGB 3I6KB 3MC0A 5IK3B 4I2XE 5D5MF 4PJEB 1S3KL 3BSZL 1JGVH 5GS1B 4NZUL 5EBLB 1X5YA 2OI9C 1NCNA 1MCWM 1A7RH 1WITA 3U9UB 1EBAA 4Z5RA 3L9RB 3ET9F 4FQIL 4YHNA 2Y5TA 5DJCB 4NT6A 3HI5H 1EFXA 4EKXA 4XB7A 4PD4J 4DKFH 1EIBA 2QSCH 2ITDA 2NXZB 1NFIB 4FP8L 4X6DA 3OXRB 4YDVA 5SWZD 4XNUL 3T2OA 4PJBA 4U6XB 1W8OA 1F4HA 5KG9A 1CBVH 4OLXL 1UXWA 4N1HB 5C0EA 2VMFA 5LWYH 1KTLA 5H2BA 3QO0A 5JA8B 1TZGH 3C60C 4L4TD 3EYOA 3A67L 2R23A 3H0TA 4U3CA 1FZKA 2BXZA 4NFBA 3DLQR 1BHGA 3QXUA 2RJMA 1FFPA 3LS5H 5C08B 1MQKL 4N8PA 5IT2L 2VOTA 3QDMD 4F3FB 3WS3B 3QJFA 4XNYL 4HK0A 4UIKH 4HXAL 5D7JB 4K94H 4WTZG 3MZGB 3RX5A 3VGAC 1A7PL 1IAII 1KLGA 4MQXD 1IQWH 4K3JH 4AH2B 5LBSH 3VGEA 1AKJB 3WNKA 1MFEH 1YQVH 2R9HC 3GSVB 4OZHE 4OLZH 3T0EB 1RZ8B 4LARH 4JM2A 2FCBA 1KG0A 3TIEA 4P2RB 1AI1H 2F19H 5ENWA 4Q7DA 4G7YL 3RVWD 1MCJA 1FNEA 4I18B 4HS3A 5IWLC 3MGTA 4HQQH 4W6XB 1IC7H 3SKJL 3WS6C 4NGHH 5BRZE 2R0LL 3TYGH 4X7TB 3AM8A 3MREB 2QHRH 3CH1B 4PRNB 1CG9B 3SE9H 4HKZA 1P7KA 3MXWL 1AH1A 3CLEL 4PJFF 1YEIL 5IESL 1RULH 2A6JB 1JNLL 4J3WA 1IGYA 1OAQH 4XP1H 1N4XH 4Z7OE 3QUYC 7CGTA 5J56B 3ARGA 4IDJH 3DYPA 4JY5H 4GW1B 4N0CD 4PP2B 5DRZB 5FUCC 1KN4H 1I3VA 2V2XA 2VB5A 3HI6L 1ZS8A 4L4TB 1CDBA 1PKOA 5C0JB 1JWUB 2ZKHL 3MOBL 2HFGH 4LCUA 1FV1B 1J87A 4MCYA 3RL1A 1OWWA 2WAHA 4XMLH 3PHOB 4MQTB 4PRPD 1MNUH 3RJDA 5KANG 2IGFH 2E8ZA 4I48A 3A6BH 3MLUH 1RZJL 1XGUA 1AXSB 4MWFA 4NN7C 3RZCB 4BZYA 2VXQH 5KSAC 3CSYB 5KVDL 4FMKA 3GUTA 1CCZA 3RBSA 1DBML 2FX7H 5EOQL 2ZUWA 1K8DA 4R96B 5HD8D 4JVWA 1CFSB 3FQNA 3HG1B 3QJHA 5B39B 1H8SA 5IFHL 1KN2H 4H1LG 5JUEL 3D39A 5IB1A 3CSGA 4K7PH 4OLWH 1EBPA 2ICES 5J9PB 4I0KA 5D93B 2XRAH 5JPMB 5I8OL 1F3RB 2PNDA 4ZO6A 4GLRI 1HQRA 3CCHB 3QCTH 3OF6D 3KR3H 1YEEL 2F53E 3OJDA 1L0XA 1RV6X 2VTFA 5T5NG 1DBBL 4G9FD 4J4PA 3UCRA 3WHXA 4IOIB 5TE6H 3WXVH 5FO8B 2Y23A 5GGQH 4X7CC 4JHWL 5D9SA 2XWTB 4H5SB 2NQCA 4M9OA 5FCUL 5E08L 1W0VA 2VZ3A 2HKHH 5IW3A 1ZLSH 3HR5A 4X7FC 3U48A 4UNVA 1UJ3B 5K93A 1HXMA 1E28B 1FL6B 2WQ8A 5FKAA 4V2CB 5C0CB 2FHBA 1RZ7H 3IYLW 3WFEL 5E2JA 5KS9F 4NQSA 2NX5D 1FNSL 4R9HA 1UM5L 5DD1H 1PBYA 2JJUA 3VXSA 4GXVL 5TFSL 1NLBL 2PTTA 1N3NA 3UTQA 4DKAA 4G6AC 2JELH 2MCG1 4Z6AT 2D7TL 2FD6L 1BX2A 3FFDB 3GIZL 4HS6A 4E41A 3IFLH 3L7FA 3A6OA 1GGUA 3IXTB 4NYLA 5GJTL 2DTMH 1JWSA 3PWUB 4F7CB 1O5DT 4HEME 2D9CA 3KYAA 1HHGA 3QCUH 3ZHDA 3U1SL 3FKUS 4JG1H 4RAUB 4X5LA 4BZ1L 2CIKA 4OF7A 3GJFH 4FQ1H 4NQEE 1U8HA 4C56D 3QWOB 4BUHA 1ACZA 5C70A 5IQ7L 3DGGB 1FGVH 2CLVA 2X42A 3QT2A 4OZGF 4OLUH 4OI7A 1LK2B 3FRPA 4Q58C 3MRPB 3QAZC 1YZZA 1SBSL 4FQLH 4MNGE 5LGJB 1E6JL 2BOCA 4MJID 3UBXB 5I71B 2YK1H 2VDOL 1P5VA 3GSRB 1GXEA 4ZAKB 4FFWC 1MCBA 1CD1B 2XTJB 1XF5A 1UB6A 4XWGL 4NSKA 3FO1B 1UM4H 4HFUL 3OG6B 4APQA 4PJGA 4KMTH 3FOLB 3MUJA 3S5LB 1PEZA 1RUPH 2WBJC 4IRSA 4TUJB 5ADPH 4LHUB 1WLHA 1BFVH 3REVA 1AO7A 2GJ6B 3GK8L 4LASH 1F5WA 4XVJH 4YDLB 3UXFA 3WO4C 2ITCA 3V6FA 5ETUB 5DF0A 3VGGA 4V1DA 3BD4A 4QWWC 2W9LA 4D9LH 4AT6A 4G80A 4AIOA 3SY0A 3HZKA 5GGVY 3L5XL 2NW3B 1JNHB 1T5WB 4KDTA 4GS7B 1JP5A 3MV01 1QFWM 1MRCH 3GJFB 1JGVL 2IALA 3MNVA 3FL7A 2R1WB 1A7RL 5ESAA 2CGRH 2YD3A 3MV9B 2QQLH 5BXFB 2N56A 4EBQL 4L3ED 4K2UH 3RWGB 4IHOA 1T7XA 1CDGA 3BWAB 3F62A 5ANMA 2Q7YB 1B0RB 5DEGB 4M5YH 1ZK9A 4DKFL 2QSCL 5EO9A 3KLHC 3WE6A 3QDJB 1IGMH 5ERWA 5CHNA 5I74C 1IGIL 1CBVL 2X9YA 2EDOA 4MAYC 5IVXE 4AMKH 5LWYL 1H15B 1NUFA 1YJDH 2VJXA 1V7MH 2OL3A 5F6HI 3HZYA 4LLYB 2GJJA 3DUUB 4LLQA 4JN2A 4K3DH 2L7UA 3GSOA 5D2LE 3FT4A 5BS0D 3QNZA 3QEHB 5DJDB 5HHQA 3SDDA 1J5OH 3AUVA 3NMEA 3WEXA 3PWPD 5D7IE 5E8DL 3TA3A 3MBEC 1CDHA 3BEVB 4M4RA 3VXNB 4UIKL 2FJGA 4GMSH 1FNGA 4HIEB 3E0GA 4K94L 4Y1AD 3TBYB 1N6QH 3BKJH 1BVKB 3MRDB 1UXSB 1IQWL 4K3JL 5LBSL 4P3WA 4WUUE 4GW4A 1MFEL 4DKEL 3MJ7A 4EOWL 5JMOC 4RRPA 4FNLH 4OLZL 3NIFF 1VADA 2X4NA 2JB5H 1AI1L 1NKOA 3DNKA 3PABA 1HEZB 5ALCH 2X7LA 3Q5TA 2H6PA 4P48A 5IEHB 4HLZH 2EYSA 4XMKH 3HA0A 4LSPH 2ADGA 3CMGA 1IC7L 5F89A 4U6VH 3KGRA 3SOBH 1H3VA 4Q9RL 4OZ4B 5FF6A 3NN8A 1J1XH 4ZFZA 3KPTA 4B7LA 3EO1B 1WIUA 4HWBA 1RULL 5IR1B 2AJUH 1OAQL 3GBNH 4XP1L 5IIEB 4UQ3B 5GGRB 4IDJL 1HHKB 1DFBH 1KN4L 5C0AE 3AS1A 2AP2A 5FYJU 2FGWH 2E7LC 5HVFB 3KDMA 3CUPB 2HFGL 3FQTB 2XFXA 3RI5K 2WNGA 1ZOXA 1MIEH 4XMLL 1OGAA 1MNUL 1I1FB 3KLAA 1YMHB 3U36A 2W65B 3OKDB 2IGFL 3PWPB 3A6BL 4X8JB 3PL6D 4NNYA 4LVHB 2VXQL 2X4UB 5SX4I 1NGXA 4LKCA 3QIWD 4M6MH 3B2UD 3QXVA 1XCQA 2FRGP 3TLRA 4MXVF 5DA0B 2Z91B 4P23B 1YY8A 5HYJE 4JFED 4D0DB 1KN2L 1J05B 3QNYA 3QPXH 4OLWL 3FB5A 3AGVA 1A4JB 5H35A 5DDHA 3NFNA 1OF2A 5CWSA 5DYOB 2XRAL 5CJOH 3FN3A 4YZFE 1DVFD 2DN7A 2GSGB 3V8OA 3V5HA 3QCTL 3KR3L 3IGAB 4IIQC 2M1KA 4X7SH 4UUJA 3GBLA 1MCNA 3V4VH 5ISZE 3GNMH 5TE6L 1XF3B 4KKLC 4FS0A 1WUNT 5GGQL 5I30L 1Z9OA 1CDUA 4YXHH 5C1MB 2PXYD 4MD5A 1OSZB 2HJFB 4KC3B 4AL8H 1BVLA 4OQTH 5F6HJ 2HKHL 4YUEH 2ATPB 1F8TH 3GM8A 3JV6B 1NC2A 4OF5A 4X5WB 2NY4B 4M9PA 3ECBA 3GJEB 1DBKL 2IAMC 1Z0NA 2BHZA 3SE8L 3TYFA 3TO2B 5DT1H 5I6XC 1F4YH 3ROOA 3MX0A 3S36X 2ZSVA 4QTHB 1U8IA 2EO9A 2W0KA 3F7RA 5JOPE 3QRFM 1N59A 2JELL 2BVOB 3BAEH 3PL6B 5GGSY 4Y5YB 4ZMAT 2NY3C 3ZYOA 1HWGB 4MLIA 3DUSB 5DO2D 4ZYKA 4LEXL 4Z7VA 1T83C 3IFLL 3ILPB 1JHLH 3WLWD 1I4FB 3BW9A 4TRPH 2DTML 4N90D 4KKBD 2GY5A 1AGDB 1WCBB 3QCUL 1PSKH 3P73A 4JG1L 4LIQH 5FEBA 2O5ZH 3C2SA 4QXWA 4KTDL 3BT2H 3BH9A 5C92A 4BZ2H 5C6PB 1ZLWH 4L3AA 5T1LD 2Z0BA 3L6FB 5EC1B 2C3VB 4QRSA 4J23A 1XGTA 5T3ZD 1FGVL 1C5CH 1L7TH 1LP9E 2X05A 4X4ZA 4OV6F 3HPJA 4NKIH 4PGEB 2Z4QB 1I7UB 1JHTA 1OD7A 4OF3A 5DSCA 4PJ5B 1NFKA 1IEHA 3FO9B 2YK1L 5CEXA 5FV1L 3OJVC 3M17B 5IFAL 4LLMA 4KKCC 4V1DD 5E94A 5GRYA 4GRMA 4XH2B 2OSLB 1UM4L 3RY6C 4PJIA 4WDIA 4KMTL 3V95A 4L1HA 1Y18B 3QI9A 2Q6WB 5GRVK 3CDYA 1G7QB 1UFUA 3LKNB 5GQBA 5ADPL 3IDGB 4PGDB 5MEND 1BIIA 4ZUUA 1LO0H 4LASL 3OJMB 4J1UA 4XVJL 3HNSH 4TVSa 1LEIA 2ADIB 2FBJH 3CFEB 3KHQA 4P2QE 1U8NB 3DRQB 3FO2B 4LPYA 1X9QA 4D9LL 3MLTA 3BO8B 2X10A 1D5XB 2X4TB 3TESA 3CZJA 3MMEA 5BV7H 2AXHA 3IU3A 2OBGA 4IJ3B 3VRJA 4ENED 1MRCL 4G8EB 2DM4A 4HH9A 1GJIA 3I02A 3U6RB 5ICXA 5DJ2B 1G9NL 3DX6A 2OMBA 5D1XD 5TH2A 2GEEA 1J86A 3O3EB 4JREB 1NGZB 1LE9A 4JB9H 5J1SC 4FFYH 4M5YL 4ZXBA 5C0BE 1Z9LA 1PKQB 5HGAA 5JHLH 4ZFGH 1HSAB 1A7OH 3BN9C 3KPLA 3HAEG 1DQTA 3DO7B 4BFEA 4ELME 3HZMA 4AMKL 4B0MM 1CGYA 1V3MA 4I2XA 5HI5C 2A74A 4K8RH 5FUZL 2J6EA 5EZJB 4FOMA 5DQJB 1V7ML 5F1OB 1XIWA 5IB5A 4PGCB 2WINA 1DN0B 3UTPD 2BNRD 2C4FT 4K3DL 4AJ0A 3M07A 5I0ZA 2P8PA 1J5OL 1FPTL 4LQFH 5EU4A 4Z76B 1KIRA 4TNVK 1EVUA 5I16B 1BD2A 4GMSL 4HWZA 1T89A 1N6QL 1SEBB 4XHQA 3DTXB 2JIXB 5BV7B 2R1XB 5F1SA 3KNBB 1P4IH 5GSRA 5ALCL 2JCCE 5IW6A 4R6UA 4P2OA 3WKMH 1MFDL 2BOBA 3C5SB 4OM0H 3SOBL 3RBGA 1MCRA 5KVMC 2YHGA 6FABL 4P2YA 1J1XL 4OFIA 3BPCB 3U0TA 5A2JH 3BKMH 3NFPA 1NC4A 1FNLA 1T1WB 4J2XA 3ILQC 3OKLA 4OZHA 2HKFH 3GBNL 5K9QI 4HKJB 4Z0BH 3GGWB 2H9GA 1VFOA 4OAWA 3ARBC 5FGCE 1FORH 1EXUA 1S5HB 5FA3B 1N7MH 5KAQF 3MUGB 4GXUN 1FFOA 3B9DA 1HHJB 4G6JH 3C60D 3V6ZB 1KTKE 5BRZA 5D70H 1N5AB 4N5EC 1EPFA 3MJ8A 4PRBA 5FYJD 1HQ4B 1YN7A 2N1KA 2FX8H 1X4YA 5JW3H 4G8GA 3WNNA 4Y4HC 2NY2C 1PLGH 4HC1H 3UTZA 4P5TA 2EZ0C 3VXME 4HAFA 4PFEA 1ZVHA 3TVMA 1B9ZA 2JLLA 4KTEH 4M93C 2X1WL 1KEGH 4M6ML 3L3KB 2AJ3A 3SCMA 4DEPB 5J1AA 2ARWA 4G8FB 3MQIA 1KNOA 2ICEA 1MCIA 4POUB 4RIRA 2E9BA 4MNQE 4Q9BA 1SJEA 3QPXL 5ACZB 1F3JB 5HGBB 1IEBA 2R9HD 3WDJA 1CFBA 5IM7A 1SMAA 1A6VH 3W0WA 2YPKB 1QPPA 4D9QD 4R4FH 1CL7H 4S11A 1AGBA 4CVXA 1ORSA 1G7PA 3VRLF 2E6JA 4AENA 1BOGA 3AB0C 3MBEA 3OKKB 3AREB 3L5WB 4MDIA 5J89A 2YPLB 5TF1H 1F6AB 4OD1L 1U3JA 4X7SL 5IHZA 2QADC 4ZUTB 1G7JB 2BVUA 3V4VL 2VITB 4RMRA 3ARRA 1MRDH 2DQDH 3MNZB 1D5MB 1W0YT 2OR9H 5JIHA 5CLWA 4JFDE 1A1MA 4YHYC 4OQTL 4QHNA 4YUEL 4YE4H 1F8TL 1JV5A 3QUYD 5CZVH 1H3TA 1A1NB 4TSCH 4ISVA 2D0GA 4PG9B 4Y0GA 3FOMB 4JGMA 2AABH 5D2NE 5DJ6B 2XYCA 2EYTB 2F53A 4UQ2A 5KVGH 3ARFC 5DT1L 1ZAGA 1RJLB 3A6CL 3M1BA 4AEEA 4M1DH 1IM9A 1BZ7B 1DL7H 1JPSH 1ED3B 4OQ1A 3NA9H 1JGUH 4WI3A 3BAEL 4KROB 2DQFB 4YGVA 2OR7A 5GISH 4X98B 4ZPTA 1AGEA 5DD0H 2I9LA 1N2RA 5KSAD 3VCLA 4TRPL 4DN4L 5TPWH 1D6VL 3DURB 2YBRA 2ARJQ 4D0BA 3RWIA 5TDNB 3VFMA 1PSKL 4C57C 1E4XH 4LIQL 2O5ZL 1TETH 2GFBB 3VMPA 3RWHA 1P9MC 4BZ2L 1U2HA 3MUY1 3G6AB 5EBGA 3QIBA 3QWRD 1C5CL 1NGQH 1L7TL 1O7VA 1T6WA 2VLRD 4YQXH 2NTFB 4Z7QF 4HULB 4NKIL 5T3ZL 4HHAB 1WZMA 3BZEB 2R56L 5CGTA 2I5YH 4PTUB 5CJBA 1NGYB 1H5BA 1OLLA 4NQVB 1JRHI 3QH3B 3INUH 1FGNH 1W2KT 3O6MH 4MVBC 2V7NA 1Q9OB 1GCFA 1FVCA 4WEBH 3S35H 4QY8A 5FXCH 3F8UB 3UPCA 4O02H 4NQDB 1M4KA 2COQA 3QIUC 4JZNB 3MV8D 5C2UB 2KZ1B 5E00B 1BQUA 2DLIA 3P0VL 1T1ZB 3T3PF 1LO0L 3IJSB 2EKJA 3DROA 3VW3H 2CUHA 5EOCJ 3HNSL 1PYWA 2FBJL 4UT9H 4MNGA 5D6DC 2P24B 1CFNB 4LK4A 4X4XA 5F7WC 3T4YB 2XZAL 4YBHA 5LAXA 4OUOA 4G6AD 2X4RB 1XAUA 5IB2A 5F71A 4LGSB 5B38A 1LE5A 5DJAB 3EOBB 5DJ8B 3ARVA 2BVQB 4ERSL 3NCEB 3B9KA 4ZNEA 1ZT1A 3ZSTA 4LL9A 4JDZB 4MJ5A 2Z9TA 2BRRH 1NBZA 1QLEH 2XT1B 4FQQB 4ZG1A 3LN4A 3PNWA 3QA3B 5INCA 1PG7X 3QUKA 3ES6A 4JB9L 4QT5A 4FFYL 5L88H 4NRYB 1Q0YH 3TBWB 1IAMA 2HYMA 2VLME 2ZOLB 3PQYD 5EH1A 3SDAA 3WFZA 1N0XH 2VLRB 3FHQA 4ZFGL 3MR9B 4U49A 1T83A 1A7OL 2D0HA 1JPTH 1TPXB 1MWAA 5DRNB 4I3RH 4K8RL 4YPGB 5EB9A 5IJKA 2I07A 1VFUA 3JWDC 3BP6B 3I2CH 1K4DA 4XC3H 1R5IA 2LU7A 1UCTA 5DTFB 3N85H 4HH8A 4FFWD 4GAGH 4LQFL 1DQMH 2C1OA 4JY6B 4LNRB 1KC5H 4LPTA 4WO4A 4P4KC 3OTTA 5DLMH 3ZMRA 2WBJD 1FYTA 3QRGH 3STLA 3OAUH 4M00A 1VFAA 1AP2B 3GEWB 1ES0B 3VFTA 3RIAK 3VXQA 3WV0A 1IQDA 3P40A 2P1YA 1K5NA 4AK1A 3MA7B 1CLYH 4LGRB 4PS4L 3F12B 2FGZA 5GS0C 1P4IL 2IBZX 4ZUWA 1ZXQA 4QWWD 5B3JE 1NCWH 3SHSA 1YEFL 4EJ1C 1RJZA 4YFLI 3TPUB 5D7IA 4HS8L 4OM0L 4PJ9B 1QFWH 3X3FL 4OFVA 2A0LC 4S1RH 5BRZD 3BKML 3C9NB 2ZUSA 3WHE0 3MOAL 2FR4A 4RA3A 3IETA 1U95B 4LVOC 4WUUA 2VSCA 4JANB 1PEWA 1AD9A 4X6FA 1G7LB 4HSQA 1MHPH 4XBGB 3KLHD 1QLRA 3B3IB 4LSVH 1V7NH 4ZOBA 2W9DL 2AEIT 5HHXH 2EDWA 1QEWB 1N7ML 4MAYD 5HDQH 5HBBA 1UZ8B 3FB6B 4G6JL 1NGPH 5D70L 4V2BA 4M1CC 2RB8A 4YNYA 3DVFA 4KY1H 1M7IB 2FX8L 5JOEA 1T22A 4MQ7B 4JO2L 4QXGH 2PO6B 4HC1L 4MD4B 3TBSB 4H1LH 3BYTA 1I7TA 3OX8B 1J0YA 5FYJL 3DXAE 4F9PC 4JQIL 1DCLA 4KTEL 1KEGL 3MBED 1C1EL 2ARJB 4JRYA 1KIQA 4C83A 1FBIL 1U8PA 4ODSH 5D1ZA 2FWOA 3O45A 3WO4B 4KKNA 3E6FA 2RIKA 1DUYB 5EO1B 1A6VL 5HGDB 2VN4A 3W81A 5B4MC 4R4FL 1CL7L 3QQ4B 1QBAA 3RVVC 4LCWE 3VE0A 2GI7A 4N0UB 5ID0A 2AEPH 1S9XB 4LBEA 3S37X 1DN2A 1GZQB 2DLHA 2VDML 2EXYC 3VH8A 3U7AA 2YD5A 2M8XA 1MRDL 2DQDL 2Z35B 4ONFH 4Y89A 4ETQA 1MFAH 2A83B 2OR9L 1LO4H 5EUOF 5HYJA 1P5UA 3N1MC 3ZHKA 5HYSG 5CD3A 3CJJA 4QHMA 2DWEA 5ACLA 5E8EB 4YIQB 5FYKU 1N64H 1QSEE 3O81A 1C5BH 1PAMA 3MRGA 2DAVA 5D7KE 5CZVL 3V6BR 3JV4B 1DANU 4TSCL 1JGDB 5DHVA 5I74B 1PX4A 2LU3A 4NNXA 4IS6B 3GSWB 2AABL 3SGKA 5FOBB 1F42A 1I1RA 4QRPE 3EFDL 5IROA 3CLFH 5KVGL 4H1LB 3GSXB 3LQZA 5EZLA 4XNMB 4WI8A 4H0IA 4M1DL 5ISZA 1DL7L 3P0YH 4DK3A 3DI3B 4NM4H 1JPSL 3L3JB 4WHYG 5E5RB 5J6HB 1BLNA 4OT1H 3NA9L 1JGUL 2IMMA 4O2CB 3RHWF 1ZA6B 4TQEH 1Q9LA 4RGMC 2G9HB 5DJZA 1G7HA 5GISL 3P4MA 5J13C 3BP7B 4NKDB 3ARBA 5DD0L 2V17H 3RVTC 2VDPH 4X9IA 1EERB 1S9VB 3BYYA 4H26A 1CD8A 3GJFK 5TPWL 3FT3B 4R7DB 3GM0A 1WISA 1XEDA 4WI2A 3U4AA 4ODXA 4OLYL 2CK0H 1E4XL 4R2GC 4H20H 3QUZA 5AG9A 3I3BA 2OTWA 4WI6A 5GRUL 2HJKB 4TN9A 2NY6C 1R3LB 1T0NB 4HGMA 4HZAA 3O4LA 4U1MA 4MD0A 1QSFE 5CGYC 3UTOA 2IEPA 2NY7L 4L4JA 2J12B 3B9EA 4NQED 4BM7A 4YQXL 4WW1B 2IJ0C 4L4VB 4NQCE 3MRKB 1RZFH 1NFDA 1JFQH 2H26B 1PJ9A 2I5YL 4Y5XA 1LEGA 4M61B 1T4KA 1QKZL 3BZ4B 3O3AA 3O6ML 1G0YR 1OM3H 4F7TB 2DTSA 4XBPB 3HTLX 5E1AA 1AD0A 3PWLB 3S35L 3O2WH 4JFFB 3ZDZE 2JB6A 4TNWF 4O02L 3SKMA 4D9RE 2I26N 1B0GB 4HWUA 3CDFA 2IAMD 1LP9A 4JY4B 1U93B 2VRAA 4LPWA 1DEEA 3VXPA 3T1FA 3M8OH 4UT9L 4PIRF 3NZ8B 4MJ2A 3RGVC 3BMVA 1EJOL 2IWGA 3FZUC 1ZHLB 4JKWA 4GT7A 1C16B 3WD5H 2NY3D 5F9WC 5FIEA 3MTRA 2IMNA 1OTUC 2VXUH 1MVUA 4TUKH 2AEQH 2BRRL 2W0LA 1R5WB 3RWEA 1QLEL 2DDQH 2XWBB 5L6YH 1PFCA 4ZFOA 5GHWH 4YDJA 5EUKB 4HT1H 2E9IA 3GRWH 4IMKC 5L88L 5C7XL 1WBZB 4P2QA 1UB5B 3K46A 3ORJA 1N0XL 5C0DB 1A6TA 1FL5A 3HUJE 3MRJA 4NHUA 5JA9A 3MRMB 1F11A 1ZVSB 2DQEL 4WVRA 1T0MA 5KSBE 5DMIL 1TZHA 3MRNA 4I3RL 2VLLB 3F6IA 4P9MH 3RDTC 5SX5H 3WUWA 3T77B 1FSKC 5C09A 4OCLC 3I2CL 1EGJA 2BSTA 4XC3L 1IAKB 2YSSA 1KPRA 3N85L 5T3XH 2E7MA 4KKCD 1CN4A 3GSQA 3K3QA 1KC5L 5C0BA 3VFWA 2A6DB 2VLJB 5DLML 4MYWB 2IAMB 1R3HA 3EYFA 25C8H 2GUOA 3QRGL 1NJ9A 3OAUL 4G5ZH 2BNQE 4ELMA 5I6XB 2ZOKA 3IVKA 3PJSB 1CLYL 2ZCLH 5E8NB 3KPOB 2ZCHH 1X5ZA 4XTRC 3MV7E 3RFZC 4JVUA 1Z5LA 2J5LC 1KCSH 1BFSA 4HG4K 2AK4E 4Y4FC 5C07B 2PTVA 3LB6C 4GQPH 3RUGE 2Z93A 1QFWL 1A6ZA 3EHBC 4F58H 4JPIA 4PJCF 4S1RL 2GITA 3MRCA 4NO3B 4Y8AA 3MRQB 3GMQA 4JKPH 3W82A 1JZ2A 5E9DB 1JYWA 3GMRB 2UVFA 3MBXL 4NO0B 1S9KC 4JGUA 2EDYA 3BP5B 1HILA 2JCCA 1R24B 1V7NL 3BN9D 2FH6A 3QUXB 2ZSWA 5HHXL 1HSBB 1YNTB 5HDQL 4ZTOH 5F93C 4P99A 2CKNA 5HI5D 1NGPL 3RPIB 2CRIA 3F7YA 5CJXA 2BDNH 3EIFA 5C0AD 4WU5A 1R3JB 3KPRE 4KY1L 2BXYA 5FGBC 3RWDB 4FG6C 3E2HC 1HXYA 4QXGL 2DI9A 3SJVE 3D3VD 2FJFA 5E8PA 4BFIB 1VEOA 5D72H 1AGCB 2V2TB 4POZC 2PW1B 4WWKC 1FO0H 3WDIA 1H3GA 3DVGA 4ODSL 4XBEL 2F54A 3REWA 3O9WC 3LS4H 2ESVB 3NPZB 4KRLB 3WFHA 1WAAE 1AR1C 2DQCH 5FA4B 1TVDA 1KSRA 5HYJD 5E5UB 1EEQA 4NOBA 1YNKL 4HGKC 4U1GC 3VXMA 3CK0H 5CJ8A 5I19H 3MGOA 3MCG1 5DQ9A 1KLUB 1JZ6A 3IXAB 5E0QA 5I8KH 5TQ2L 1MFAL 4RQQA 3HE7A 2O61A 2D03H 4MJ6B 2PYFA 4QRRB 2EH7H 2FO4A 3RVXC 1N64L 3ILQD 1C5BL 4FTVD 1ETZB 5SWSD 2V5YA 4U1IA 1XGQB 5IQ9B 4EQ2A 3LEYH 1RIHH 1UQSB 3VGDA 3SO3C 3ARBD 3CXHJ 3UPRB 3W9EA 2OP4H 1U3HA 4X99B 5IB3B 3CLFL 4UDUA 5FYKH 4N0FB 4R0LC 1SVZA 1JVKA 4F7EB 3O2DA 4Y8DC 4N5ED 4E5XA 5TE7L 3P0YL 3VG9C 4PJFE 4U1HB 4L3CB 3VWKB 1EEZB 2BFVH 1FO0B 2XIDA 4Y4HD 3Q6FA 2FHFA 2NY2D 4JFDA 4TQEL 5EU6A 3IF1B 2EZ0D 3WIFA 3KYKL 3L3DA 4J6RH 3CZFB 4NBZB 2FX9H 3S3SA 2V17L 1KEMH 2VDPL 1A2YA 3OXSA 3EUUA 4ZD3H 4FXKA 4M7ZB 5IFJB 2PF6A 3JTSA 3O6FB 1ZLWK 5JIIA 2CK0L 5D2NA 4H20L 4NZTH 4JFOB 5KJRH 2VWEE 2H2SC 4MHHI 1HDMB 2NLJA 4OIBA 5K33A 1ZHNA 4Z5RB 1J11A 2DQHH 4NRZA 4YHNB 2P49B 5HVWA 2D7QA 2WV3A 4NT6B 3BRFA 4XCNA 2YR3A 1EFXB 4K3EH 2QADD 2DKUA 1RZFL 2KDGA 1H0DB 4UTAH 3DPBA 4YDVB 1FN4A 1NDGA 3HC4L 4QXTA 4JG0L 4PD4K 1UXWB 4FTVB 4ODWA 1WFNA 5C0EB 5L2KD 2R2EA 1XF4A 5H2BB 3V0WH 3O2WL 2IBGA 3NZHH 3G6JB 4FFVC 2AJSH 1FZKB 3JV0A 1I8LC 5HYQA 3TIDB 1DJSA 1I75A 1JPFA 1KIUA 4ZPVA 1FFPB 3RA7H 3D6GA 2DM3A 3DMMA 3ARFD 3JXAA 1A9BA 3M8OL 3QJFB 1EO8H 4HK0B 1CQKA 3RHWK 1QO3A 1UZ6F 1QRND 1IC5H 1AHWC 1ZMYA 2NY2B 1RZIB 3BIKA 3SGEI 4TVPE 4XB8A 1KLGB 4PJXB 4P2QD 3AMKA 3WD5L 3G08A 2X1PA 4NN5C 4CNIB 3PHQA 4UDTA 2VXUL 3BIAX 4JM2B 1KG0B 4ODTH 3TIEB 4TUKL 2AEQL 5ENWB 3IFOA 5L6YL 3IFNH 5GHWL 1FNEB 3LRGA 4HS3B 3MGTB 1AXTH 3FFCD 4HT1L 1Q8MA 3EJZC 3GRWL 2MQCA 2FYYA 5DGQA 1A7NH 1SMOA 3FN9A 3T0XA 4DWHA 4HPYH 3BVNA 3BRGC 1A3QA 4ZNCD 3UPAA 4HMEA 5JW5A 3PV6A 1F4WH 1HHIA 4HKZB 3OGCA 1P7KB 5ESVA 2QADB 3J7HA 4OIIH 4FQXA 1SYVA 2HP4A 3V79C 2V6HA 1ZV5A 3D9AH 4P9ML 5M95B 2OR8A 3ARGB 4QOKE 4HXBH 3MOQA 5KZCD 4MS8C 2Y9RT 4YHYB 2V2XB 1SJVA 1Z9SA 3MODH 4MVBD 5T3XL 3UTSE 3VFRA 1ZS8B 5KOVC 4GBXB 4MCZB 4WY7H 3FHAA 1DQLH 1NBYB 4MCYB 1UH3A 3TM6A 4WU7A 4ELKB 2HVJA 4OZGE 3C5ZC 3QIUD 4G5ZL 5INDA 4RBPH 1I1YA 3C8DA 3EGSA 4XXDA 5T5NF 1XGUB 3MCKA 4JAMA 5CMAB 3S9DB 5AG8A 1ZTXH 1K2DA 3GUTB 1T04B 1SJHA 2ZCHL 1QVOA 3NACL 5DK2B 2PKDA 1EHLH 1IAOA 1K8DB 3EYSH 3FQNB 3QJHB 4XWOC 5F97E 2VL5B 3D39B 5LXGH 3N0PB 2DLEA 4X6EA 1W72A 4H88H 3MLZL 2V9QA 2YC1A 1LHZA 5L7XH 4CMMA 5CD5C 2VDNH 5TQ0H 1WFTA 2L7JA 4F58L 2YWZA 4LRIA 3RTQC 3OJDB 4JKPL 3IRZA 4KWUA 2NY5C 1U0QA 1J0ZA 3WHXB 5IVZB 5BW7A 3KPQA 3D5OF 1V3KA 5D9SB 2W0PA 4PRIE 2FHCA 2W59A 2X4PB 4MAUH 4PJDB 3QEQA 1PZUB 1W0VB 3C5JA 5EWIH 4ZTOL 5BO1H 1RMFH 5GRWA 1FFNA 1JPGB 5DJ0B 4G43B 2BDNL 5KZCB 1I9EA 1MI5D 2ZUYA 3LDBC 1GOHA 5TJWK 1ZEAH 1HXMB 2FECI 4O2EB 2C1PA 3ARDC 2J8UE 4UBDC 3JWDH 3S6CA 1BQLL 5D72L 1FZMB 4LCCC 4P4KD 3VXMD 2DI7A 1KIPA 3BZDA 5I8CA 3VXSB 1FO0L 3ESVF 1BECA 4LMQE 3UTQB 1BBDL 1Y6MR 1D5IH 4JR9H 2LVCA 5IGXH 3UTTD 3LS4L 3SGJA 5ID1A 4YH6A 3W11C 5DHXB 3CSPA 4HS6B 4XAKE 4E41B 4EXPX 1FRGL 2DQCL 4M3KB 4MNQD 5GS0D 1X4XA 2EXWC 3BGMB 2VWEC 3QUML 2CQVA 5KSVA 1HHGB 3RP1A 3GSUA 1O0VA 3CK0L 4EN3C 2CIKB 5J57B 1MHHA 1JTTA 5T33H 4AM0A 1U8HB 1NCAH 2G5RA 3NCYP 1A7QH 5DD5L 5I8KL 3V6OC 4CVZA 1W8NA 4NWUL 2CLVB 2Y36H 3VMNA 4GQ9H 1U8JA 2AJVH 4HJ0C 2A0LD 2D03L 3G5YA 3BP4A 2EIZA 4UU9A 1YMME 3DRTB 3KHOA 4KRNA 4G42A 3EYQC 3KLDA 5E2UH 1JCKA 3LEYL 4LEOB 5IF0A 3KYNB 1RIHL 2LABA 4OF8A 3LV3A 3NPSB 2VIRB 2APTA 2OP4L 1UB6B 2OL3H 4K9EC 4APQB 4HUWA 4UIMA 4M1CD 1OAYH 3K0WA 4IRSB 2P8LA 3DUHA 3TO4C 3RAJH 1NUDA 3A0OA 3DSNA 5KVEH 2CSPA 4H8WC 3G6DH 4N8VA 4J6RL 4M48H 1QSEA 2FX9L 3V6FB 1KEML 3TBTA 4ZD3L 1YEGL 1YN6A 4M6OH 3UTTB 3SY0B 3VFVA 1Y0LB 3QEGH 4UV7H 4NZTL 4QRPA 2EDRA 5KJRL 4DOHB 2DQUH 4K7PY 1INDH 3EOTL 3MNVB 1WWAX 5B4MD 2CDEB 3RVVD 4F9LA 2W9EH 1MFBH 4RX4A 2VQTA 2DQHL 4WI4A 4W4NA 1EMTH 3LD8B 2QSQA 5H8DA 4TTGA 4K71C 1CFTA 4O4YH 3C08H 4K3EL 4ZQKA 5GGVL 1TQCB 2EXYD 2APXA 4NN6C 5EO9B 3PDGA 3MJ9A 3C6LA 3WE6B 1IBGH 5IG7A 2X4SB 5DJXB 2J1KA 3IJHA 5IVXF 4H25A 4HWBH 5CHNB 5DFVC 4P2CG 2I9TA 2BHYA 5GSVA 3C8KA 4ZSOA 1EH9A 3ULSB 5FYLD 3X14B 2FIKB 2OL3B 1QSFA 2EE2A 1INEH 4JE4B 4ODVL 1BVZA 3BQUC 4JN2B 3GSOB 4PJHA 3FT4B 1YPZA 5HHQB 2ICWI 3UP1A 4NQCA 3RA7L 3T65A 5ICYA 3HE6A 4MA1C 3TA3B 4FQ2H 4JFXB 1EO8L 2FJGB 1BF8A 5C2BH 4LVEA 3O6LH 3K8LA 4DFIA 3CGTA 4GW4B 3MJ7B 2UYLA 4E42A 3RVTD 4P4RA 5C08E 2X4NB 4ODTL 3GKZA 4WNQA 2AI0L 3PABB 2KQMA 4JZOA 3IFNL 4R2GD 4HUUB 1ZT7B 2RQ8A 2EYSB 4PLKC 1IZJA 3GMNA 3ZTJG 4KKAC 1AXTL 2ADGB 3G04A 2BCKA 4XPGH 2CPCA 2NY6D 1YEJH 4GAJH 4HPYL 2XKNB 3T0EE 2AKRA 5CGYD 3BH8B 3NN8B 1U8OA 4Y16A 4ZFZB 2E5EA 1F4WL 4KZEH 3FN0H 3FONA 3GMPA 3MFFA 4OIIL 4HIIB 1Q0XH 3M45A 3FO0H 4BH7A 2YA0A 3D9AL 1QR1B 4QLRA 1UH2A 3BD5A 3G5ZA 5I1LA 2V7HA 3MLYH 1D5BA 4HXBL 2P46B 1YEKL 3QDGB 3MODL 4G6MH 3UJTH 3CD4A 3KDMB 4WY7L 5EU3A 1YDPB 1FNHA 1OPGH 1I1AC 3HUJA 5D4QA 5SWZE 5A43C 5C71A 3TV3H 3MNWA 1U8MA 2GT9A 3CVHA 4TSAH 3QYCA 4G6FB 4NNYB 1X5HA 4PJAA 1NEZG 2EH8H 3KXFA 1NGXB 4LKCB 4L4TE 3WKNA 2DMKA 1XCQB 3RGVD 4AY0A 4CRPA 3FZUD 1EHLL 4WWID 4F15B 2ZZUT 1F58H 4YDKH 4NPYB 3EYSL 3ZE0E 1EVTC 1J1PH 1RZJC 4LSDA 3VDBA 3QNYB 2GJZB 1WICA 4H88L 4YZFF 1OTUD 3NFNB 2NW2B 2ZUXA 3H3KA 3VFNA 5CWSB 2EDXA 5L7XL 4R2GB 1U58A 2D31A 4H0HB 5TQ0L 1GGCH 2HJLA 4YHMH 1NDMA 5GZNC 4RZCB 2NY6B 5MI0B 3ZYZA 2YN5A 2WBWB 4UUJB 3HG1E 3GMLA 4XCEA 5C86A 1OW0C 3BKCL 5TGBA 2P7TA 2VLKA 5HPMA 3MV7A 4RFOH 1N8ZA 3U2SA 4LSRH 1S7RA 2ZPKH 2YEZA 3DV4A 2J4WH 3G6JF 5EWIL 5BO1L 4HMCA 2EYRA 1G1YA 3P9WB 3RDTD 3RGHA 5GGRY 4QRUA 1NC2B 2HT3C 1ZEAL 4WIQA 2B1AH 5HJ3B 3TZVA 3TYFB 2Q1EA 4I3SL 3JWDL 5GS3A 3ZKXC 12E8H 3ROOB 5HHPB 2A6IA 5B39G 4PJXF 1U8IB 5CBAB 3DXAD 3NCYS 1C08B 5C8JA 4YK4B 1BQHA 1N59B 1DBAH 2HVKA 4OUUB 5D71H 1B2WL 3ARTA 5D5MA 3UC0H 4JR9L 3V0VA 4ZYKB 1CGSH 3G9VA 1SY6A 4MSWB 4Z7VB 3TF7C 5C0CE 3BW9B 4K23H 3KPRA 3X13A 1I7RA 3S88H 4XTRD 4DGIL 4ZUSA 5F9WB 3PG2A 3SJVA 5CCKH 4JLRB 3T8XB 4EI5A 2CUMA 1HHHA 4YO0A 5T33L 4Q6IC 2ATKA 4LCWD 4Y4FD 5K9JH 3DVNA 5L0QC 5DFWH 3LB6D 1NCAL 4AYFA 3QPQC 2R69H 5HHMD 1E4KC 1E6OH 2AJVL 3EHBD 4GQ9L 4EI6A 4XMPH 3MCLH 4OCXH 2WIIA 4IEFB 5DSCB 5JDJA 2GSIA 4U6YA 1QD0A 2OJZL 3OR7A 4WHYH 4NCC2 5CEXB 4I77H 3CFJB 2C3XA 3WJJA 1BEYH 4LLMB 3O0RH 1CS6A 2QLVB 4GRMB 1KT2A 2NXZC 2OL3L 1CLZL 1OQOA 4Y2DC 1K8IB 1YEDA 1HYSC 4WDIB 1OSPH 1OAYL 1T3FA 4N1EA 3BKYH 3QI9B 3BZFA 3QNXA 1WT5C 4FG6D 2X2YA 1RI8A 1JF6A 2DYPD 5KVEL 4JRWA 5CGMA 1BIIB 1SQ2N 4ZUUB 3G6DL 5I15H 4M48L 4NO2A 1LEIB 3GI8H 2R2CA 2XTJE 4POZD 4WWKD 4ZUVB 3UROR 4M6OL 3MLTB 5IMLA 3UMTA 2B20A 3QEGL 4UV7L 4HZLA 3MMEB 4QNPE 3IU3B 3O9WD 3VRJB 1S7UB 2DQUL 2DQIH 1JN6A 2GJ6E 1MJ7H 1INDL 5TDPB 4KDVA 1AR1D 3I02B 5D7JC 1A22B 3NGBB 5AYUH 2BSSA 2J5LB 3DX6B 5TH2B 4PJFA 2W9EL 3TT1L 2AXJA 1EMTL 1QSFD 4O4YL 3C08L 3T0EC 4KUCF 4ZXBB 4D0CB 3QFDA 5IW1B 3LKRA 2Y07H 5HGAB 4PJDF 1HNFA 4PLOB 5L8JB 4FMFA 3LH2H 3TN0A 3MV9E 3HZMB 4TTDC 3IAGC 1J88A 3RVXD 5E6IA 3VRLE 1R3IL 5IB5B 1INEL 2WINB 3CPLA 1KJMB 2X89A 5FYLL 1CDJA 2DICA 3KYMB 3QDJE 3NFSL 4D9RD 4MA8H 1WZ1L 4DKDC 4YWGL 1I85C 5EU4B 1KIRB 2AJYH 2XN9D 4FQ2L 1WBYB 1BD2B 2MNUA 1J8HB 3VWJA 5C2BL 4HWZB 4JFYA 4JCLA 4KV5E 5HVGB 3O6LL 1GH7A 2FATL 4BYHA 5MP6H 5GZOC 5J0BA 1EUTA 4X9BA 1DUZA 3HI1A 1X5AA 1VSCA 2BVTA 3O41A 4NQXA 3PGCA 3KYOA 3P77A 5GSRB 3R1GL 2E3VA 1JGEA 3FTGA 3LPGA 1AE6H 5IW6B 3RZCC 4XNXH 4YBQC 1SBBA 4S1DC 4P2OB 1ZHKB 2H2SD 3SGDH 1YEJL 2BOBB 5L2JB 4GAJL 2M2DA 5IB4A 4PV8A 2UUDH 1KACB 4KQ4H 3U0TB 4KXZH 1CICB 3FN0L 2PYED 4N0RA 3NFPB 1Q0XL 3FO0L 1YC8A 4JVPA 4IOSD 5D93C 1I8KA 4N8CL 5JXEA 3IDMB 3AU1B 3MLYL 4Z78A 3JUYA 3DBXA 1HOCA 4OAWB 2GTWA 3PWNB 3UYPA 1EXUB 5KS9A 5JW4R 4G6ML 4BQ6A 1MCSA 3UJTL 4UT7H 2XI9A 1K4CA 1AY1H 4HJGA 3WNMA 4MX7A 1OPGL 3IS1X 5I2IA 3MJ8B 4FFVD 4PRBB 1YN7B 5CP3A 4Z7QE 3ARUA 4R90L 1A6UL 3AAZA 1HH6A 1V3JA 4G8GB 1GOFA 1NLDH 4PJ7B 3UTZB 4R0LB 4TSAL 4J3XA 2XN9B 1MY5A 2MCPH 4C58B 2VDKH 3STBA 2EH8L 2LQRA 2AJ3B 1CGWA 4QOKA 4BSWB 2BNQD 5J1AB 1D9KA 2CIIA 2MWCA 4RMVA 4XRCB 5HTSA 2ICEB 1RVFH 5DEFA 3JWOH 4WFFD 5EBMA 1F58L 4YDKL 4RIRB 3UTSA 1JF1A 1J1PL 1SJEB 5B8CC 1IT9L 3PWPE 5IM7B 3W0WB 4NRXA 4OZGA 3HS0A 2CJUH 1AGBB 4CVXB 4Y1AE 2AK4D 4AENB 1BOGB 3JZ7A 4MDIB 2BERA 4CN4A 3ZE2F 2D2OA 5IHZB 1FDLL 3TH4T 3EJZD 4LU5H 2A9MH 4QO1A 3TPKA 4OSUH 2PYEB 4X9FA 3R4DA 4RFOL 1PQZA 1A4KA 3IDIB 2ZPKL 4M7KH 2J4WL 4EUPA 3W39A 3E3QE 5DS8A 4FXLA 4QHNB 1FIEA 2P5WD 4L9LA 1PG7W 3R0MA 1JV5B 4Y19D 3PHSA 1U3YA 3O3BB 1M05B 3MFGB 4CDHA 4MS8D 1MLBB 2B1AL 3WLBB 5C3TA 2Z31C 4BQBA 12E8L 1WSST 5ICZB 3OKOA 2YMXH 3L3HA 4Q2ZB 5I71C 5CEZH 1IM9B 1LO2H 4HLZG 3C5ZD 2VSDA 4RFEA 1DBAL 4ZAKC 1CK0H 3SBWA 5D71L 3FRUA 2XTJC 3UC0L 4LRNL 1UWEH 3NCBB 5H94A 4YGVB 4KJYB 3EOYG 4PB0H 4ZPTB 1AGEB 2X4QA 3OKNA 1N2RB 2DLTA 4JFPA 4EZMA 3RX7A 3VCLB 3KAAA 4K23L 3FCTB 2EDTA 3S88L 3V52H 3VFMB 5JDSA 5ADOH 5CCKL 4C54A 4X7DC 1CXIA 3RWHB 1X7QB 4XWOD 4X4YB 3FQXA 1AJ7L 3WXWL 2NY0B 4W4OA 2R1YA 5K9JL 2V5MA 3WJLC 4PYHA 2IF7A 2V5SA 1NMBH 2H32A 3TCLA 4I5BB 3JSSA 1LK3H 2W07A 2IG2L 5CD5D 2CO6B 2GCYA 2R69L 4GS7C 1E6OL 1GGYA 4OCYH 3RTQD 3MCLL 1EEYA 4DCQA 3Q3GA 3PP3K 2A73A 4OCXL 5EPMA 3ZDYE 1IJ9A 3D1MC 5CZXC 1JK8A 1IEAA 2HMIC 4JPWL 4WGVB 4I77L 3ELAT 3D85A 1MWAH 3H7LA 1BEYL 3F5WA 3O0RL 1RPQA 1FVCB 4Y19B 4QY8B 1IKNC 4Y5VA 2XOTA 4QCIA 2R8SH 2DMCA 1OSPL 3BKYL 1W0WB 4PJ5E 4LPXA 4U2ZA 1Q38A 5DR5H 5IOPA 2NXYB 2HG5A 5H37G 5I15L 3ARDD 1DQQB 3T2PA 3GI8L 1MLCB 2HFFA 1A64A 2XY1A 2B7DT 5LAXB 1NCCH 1S78C 1RY7B 4B41A 1VEPA 3WSQL 5JW4N 1XF2A 5B38B 1LE5B 2DQIL 3W11D 1MJ7L 4JZJA 3B4NA 1A5FL 4I0PA 4Y7MA 1ZT1B 5AYUL 2EXWD 2QSVA 1NBZB 3UYOD 4KGLA 2P44B 3QUKB 3WNOA 4EN3D 3ES6B 1CDCA 3F7QA 3T0WA 3SDAB 4LIQE 1BZ9B 3RTQB 1V5JA 2VR9A 4HJ0D 1G0XA 1DDHB 2DIAA 3LH2L 1WC7A 5C0GB 4JPKL 1MWAB 4HFWB 4HV8A 3EYQD 2I07B 4CU7A 2UWEB 3C8HA 5T3ZE 1PKQE 2GTZA 5D1QA 5HYEA 3D2UA 3LEVH 1P7HL 3LIZL 4HBQA 5DD3H 3LDBB 2AJYL 4WO4B 1YJDC 43CAA 1MFNA 5IK3A 1OTSC 1FYTB 5GS1A 1P7QD 3STLB 3TO4D 1VFAB 3WHE1 5F9AC 3V4UH 3VXQB 3HMXH 1IQDB 5MP6L 2P8MB 4XAWH 1CD0A 3SKOA 4TVPD 1ZT4A 3VXUD 3JTTA 1VCAA 5B3JF 5DGRA 4ZUWB 1RZKH 4DW2H 2DJ4A 5DD6A 5DMGC 1ACYH 2VDLH 3AMLA 3GIVA 4JFQA 5IKCB 3WL9B 1MCEA 4XNXL 4LVHC 4XXCA 1RJZB 2EIDA 4X5XB 2F5BH 1WIPA 3GO1H 1SEQL 4UV4H 1M6OB 4WW2C 5ABDE 4P23C 1KJ2L 1MH5B 1BBJA 5J4MA 4KQ4L 3LVEA 3MLVH 3IETB 4O58H 3VD5A 4WUUB 4K07A 3IDXL 1OP5H 4CDGC 4UOJA 4P5KA 4EIGB 2IPKB 1EX0A 3E3QC 2VZSA 2YXMA 4OGYH 3TEUA 5DFVD 1FLRH 4UT7L 5CBEA 4AH2A 1AY1L 5DHVH 4NJAH 4YNYB 3RVUC 3LN9A 1T22B 1Q9WB 3T4AA 3BQUD 4IMLA 5F96H 3U83A 1PVHA 1I7TB 2MCPL 2IPTL 3QCVH 3I6LE 4I18A 3QHZH 1P7QB 2NY4C 5CAYB 1UT9A 3KWWA 5HHOD 4JRYB 1KIQB 4C83B 2Q8BH 2DL9A 5EFIB 1NAKH 3JWOL 2FWOB 2QV2A 4IRJC 3I75B 1DSFH 3VXUB 4Q6YA 3CH1A 1DE4B 4HJJH 2A38A 2FO1A 4UNUA 1J1OH 5SWZA 4FRWA 4GKZA 4PP2A 3UAJC 4P3DB 3VE0B 8FABB 4PLKD 1ZKAA 4GOSA 5ID0B 3UJIL 1MCOL 4KKAD 1MFCH 4OV5A 1K3IA 4LBEB 5DRWB 3T0BA 4LU5L 2HLAA 3PUCA 4L4TA 2A9ML 5C0JA 1JWUA 4OSUL 2OQJB 5GRZA 2Y5EA 2P5ED 1X6NA 5EU5A 4JO3H 5CKGA 3KPSD 3PHOA 5CD3B 4M7KL 1TCRA 3LRHA 1TNMA 3QDMA 2CK2A 4PRID 3MRGB 1LEKA 2R29L 1BJ1J 5DHVB 1A6WH 4LHQB 4NNXB 3MLRH 2W92A 3WFBH 1M7XA 3LQZB 1BOYA 1CFSA 2CXKA 2DWDA 5BMFH 2YMXL 2BNUA 1WZKA 5CEZL 1LO2L 1I1AD 5E2TH 4ZDHB 2ZUQB 1TTFA 2FEEL 4MA3B 3MRFA 1J9CT 2AK1H 5JPMA 5GGTH 2D7OA 1EAJA 1UWEL 4M7LT 3CX2A 3P4MB 5L9DL 5K59E 4PB0L 3LEXA 1JTOA 4XX1E 5HHOB 3QXAB 2CLRA 3LQAH 3BGFC 4WV1C 5FYJE 2GK2A 4XAKD 1GHFH 4NJ9L 4ODXB 5FO8A 1NBVH 3ARQA 5ADOL 2FSEA 2PW2B 2XWTA 2WP3T 2OTWB 1CR9H 3EDJA 4P49A 3O4LB 4U1MB 4ZOAA 4GG6F 1NMBL 5AAWA 1LK3L 3QBTB 2CMRH 4BELD 2Y7QA 1HK6A 2YZ1A 3WUZA 1UJ3A 5AEAA 4OCYL 5GZND 3KS0J 4Z7UB 2MHAA 1NFDB 2C4XA 1C5DB 2P5EB 2E27H 3MYZA 3SDCC 5C0CA 4Y5XB 3R8QA 1YMMD 3NBNA 3KPSB 2UZXB 1WIOA 1T4KB 3BESR 4JREC 2IFFL 2NY5L 4CU8A 4TPRH 4OGXL 4WGWB 5F1NB 4MGXA 1UC6A 3RNQA 1UVQA 2R8SL 3FFDA 5JW4M 4PJ7F 5IMMA 2HT3D 3ZKQD 4DZ8A 2A77L 1N26A 4FQCH 1LP9B 4F7CA 1QBBA 1JBJA 5DR5L 1JWMB 3RX8A 1DEEB 1I1AB 3FQWB 4UB0H 1CU4H 3MGAA 5FK9B 2FECL 2W0FA 1NCCL 3QWOA 5FUCE 4NQDE 3QULB 4MB4A 3DGGA 1Q72H 4X7EC 2K7QA 1GZPB 5IMKB 4KDWA 1LK2A 4CL7A 4G9FA 4TSBH 4KK5C 2ILLA 3LKSB 4ONOA 1RZGA 5SWQA 3RWEB 4GRLC 3C09B 3UBXA 3BIBX 2VXTH 3LZFH 3ZE1F 5BV7C 5JR1L 4YDJB 3DO3A 5FKPB 2A6KB 1P4LA 1S7XA 4PJ8C 2VZVA 2W38A 1CD1A 2Y06H 2V9RA 2R4RH 2C3HA 1FL5B 3FO1A 3FOLA 1IGJB 1F11B 1DLHB 1ROWA 3AY4C 4TUJA 1FG2A 4LHUA 1T0MB 3Q5OA 2GJ6A 3B9VA 1TZHB 3MRNB 4KAQH 2NX5A 1KELH 2P47B 5L8KB 2Z8WC 1MHCA 4HIHB 5ETUA 5C09B 5DUPL 2VLRE 1KTDA 5JIKA 3WJLA 3LEVL 1KPRB 4C4KT 3ULUH 2NW3A 3GSQB 1JNHA 1T5WA 5DD3L 4K8RC 2NXZD 3N06B 1BJMA 1LNUB 4Y2DD 3VFWB 1GPOH 2HTKC 1HYSD 1X44A 4XP5H 1UM6L 1U92A 3F7VB 2XA8H 3KPPA 1R3HB 2GUOB 1NJ9B 4K9EL 3U46A 1YUHA 4L8CA 4M43L 3HMXL 3ZTJH 4EUPG 5BZWA 4XAWL 5BXFA 4OZFA 3RWGA 4C56A 4OLVL 1DBJL 3Q2CA 5DEGA 2VZUA 2A1WL 1ACYL 2DD8H 3MV8E 3ROLA 3NOIA 5JO5A 1Z5LB 5C08D 3VXRD 3B2VH 4PLJC 5I1EH 4DEPC 4X6CF 3H9SD 4O5LL 3RUGF 3GO1L 3VDCA 5E95B 2WWMC 5D7JD 3H9ZA 1KBGL 4MJIA 2EDNA 5GRVL 1MREL 5F1IB 2GITB 3MRCB 4N9GA 3MLVL 1AKJD 4HUVA 1Z3GL 3GMQB 4O58L 4X0KA 3T0ED 3TNMA 4DZBA 3QEHA 5DJDA 5E5MA 4DUXA 4NM8L 4P2RD 1CFVL 5F7LB 2CRZA 5I1JH 1KYOJ 4C59B 3EYVA 4PTTA 3BEVA 2EEDA 3VXNA 2JCCB 2YKLL 3AREC 4OGYL 4HIEA 3TBYA 1KENL 2XZQH 2NR6C 1A1OA 1FLRL 2GIYA 4TTDD 3PQYE 3STZA 4CN1A 4X4ME 5EIIB 2MQ3A 4YXKH 3SE4C 1HXYB 3QISA 3NAAH 2EE3A 5F96L 5E8PB 3QZWA 4Y2DB 2VDQH 4RISH 3QCVL 5IEHA 3QHZL 4G3YH 5DC4B 2Q8BL 4PV9B 3WMSA 3DVGB 5FM5O 1S9YB 4KUZH 2F54B 4L3EA 3REWB 3W5MA 4OZ4A 2VH5H 5I8EB 4B7IA 3E6HB 1DSFL 3HNTL 1HWHB 4UI2A 1WAAF 4S1QH 1JMXA 4WHTA 3WFHB 4EDWL 2ADFH 3EO1A 3RI5F 2X70B 5GZOD 3OKEB 3B6SA 1J1OL 2DKSA 5IR1A 3U0PB 3VXRB 1XT5A 4KROC 4UQ3A 2WZPD 2PN5A 3H9SB 5F9OH 4NC0B 3RZCD 2SEBB 4YBQD 1MFCL 4S1DD 3MGOB 5E2VH 5LGHH 1UZ6E 5DQ9B 1EHXA 2FEDC 1JIBA 1RUMH 4HUKB 1IAIM 3FQTA 5FDWA 1LO5B 3HG1D 3FAWA 2BRQA 4JO3L 2VAAB 5BS0A 3IDNA 2BMKA 2UWEF 1YMHA 3E1F1 2W65A 1WQVT 3PWPA 4N0UE 4CN6A 1NEZB 4X8JA 4U1IB 5GRXG 1A6WL 5CINH 4Y1AA 2XKSA 2YXFA 3MLRL 3N1FC 3W9EB 1XCTA