3LRGA

Structure of anti-huntingtin vl domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
SQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVLSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords anti-huntingtin VL domain
total genus 29
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrgA00
4JRXD 3HAEA 3D18A 4TUKH 4FQ1H 4JR9H 2EDJA 4JCLA 4GQPH 2UVEA 1A7PH 3A6CH 2OS7A 3C8KB 2XFXA 1YMHB 2XRAL 2FYYB 1ZOXA 1Q9OA 3L3GA 5SX4I 5C0AE 3RL2A 1XIWD 3FN9A 1PKQE 2K7PA 4W6YB 1G9MC 1XF3A 1KN2L 5E2JA 3RVTC 1VHPA 2VXVL 4R96A 4Z7UF 3AROA 5CJOH 4GMTH 1QRNE 5CEXB 1PLGH 1BFOA 2OTWB 4O02L 2CPCA 4L3ED 4OLZH 3R4DA 4RZCB 5D2LE 4QXTB 4M61A 2CIIA 2H3NA 1WEJL 1NAML 3EZ8A 4HMCA 1B6DA 2UYLB 4WWKB 3VFGH 3QNYB 3SY0B 4N0UE 5LXGH 1UACH 2X9YA 3P30L 4ERSH 3MLSL 4YC2C 2EDBA 3QO1B 4G80B 1OQOA 3AB0B 3IT8D 1FZJB 3K1KC 2W59A 4OIIH 1TZHA 3BT2L 1P1ZA 2VDRH 4Z76A 2CH8A 5K59F 1Z9LA 2ZSWA 3REWA 1WT5A 3REVB 4ZNEA 4ZTPL 3P4MB 2NY4C 4ACPA 4OGAC 1W8OA 1ZWIB 1IAOB 2ICWA 4CUCA 2EIZA 1SJEB 5BW7C 1K4CB 3L95A 1K4DA 2PYEE 2IANE 5JOPD 4ZOAA 4XPGH 3BP4A 5KSVA 1TZIA 4PR5A 3GMPA 1AJ7H 3QO0A 2APVA 3JWDL 1S7SB 3HZYB 1QLEL 4G42A 4LPWA 3ARPA 3GIVB 3P77A 1N6UA 5F97E 4RMWA 3TNMA 1FBIL 5FYKH 1JRHI 5C71A 3ULUC 1FDLH 1LO4H 4PV9A 3VFSA 4P3CL 5T3ZL 5J13B 4Z9KB 3CXDH 1ZGLA 2PKDA 2MHAA 3CMGA 3MACL 3JV6A 1I9JH 1INQB 3B9EA 3ZTNH 2MQCA 2DQEH 4TVPL 4Q9RH 2ENSA 5EULV 1E6OL 3H9SA 3FZUD 1EHNA 3UPRA 3IS1X 1A6TA 4NHCL 4OF5A 5BS0E 3SGDH 5IB3A 2UWEE 4YDJB 2WIIB 4CMHC 3LRSB 2Z31D 2GAZB 3ARBC 3VD7A 2ZWLT 4HKJB 1YUHB 4LCWE 5FA4A 2F53E 1DE4A 1GZPB 4P2RD 1I1CA 1WK0A 4XAKE 3VRLF 4GAJH 1FZMB 1IGTB 2OL3B 4YDIH 3VCLB 1AGEB 3EYVA 5BZWA 4Z7VF 4DAGH 2VLME 4PJ9D 2EE3A 3HPJA 3ETBF 1UCTA 1JNHB 1DBAL 3PL6C 2LABA 5KVGL 3MNZA 4FTVA 1JPFA 5INDB 2DWEB 5E8EA 3LH2L 4NO0D 1G7QB 1NFIA 2MFNA 1HYSC 2Z92A 3GKZA 4PB0L 2BX5A 2F8OA 3L3IA 3UCRA 2PF6A 3WSQH 5BV7B 2JIXD 1LEKA 3I02B 5DGQA 3Q0HA 3CFBB 1M05A 4OCSL 5FF6A 5EIIB 3OR7A 1QSED 4U1HB 1MLBB 2P8MA 4P4KC 2A73A 3TO2B 2YKLH 4NN5B 3G6AA 4QKXB 5J1AB 3VFGL 4Y5YC 4P2QD 5LXGL 1PEWA 2QR0B 4YXKH 1JYNA 4OT1H 5L8JB 3M17B 5HVHC 3QUXB 1RHHB 5ESAA 4XCFL 3BQUA 1CDIA 3NCCB 5ADOH 4Z8FH 1UXWB 2P8LB 1T89C 5IV2B 3RGVA 1T4KB 2ZUQC 4J4PA 4NM8L 1Y0LA 1UWEH 4JFHD 1LO4L 4JFHE 3WIIH 4KDWA 3QDMD 4M6NH 4KI5E 5TPWH 2FEEI 2H2PC 3P9LB 5JHDE 3SKOA 1G9EA 1Q38A 2DQEL 3EOBB 5D7LE 4Z7WB 4NUGL 2IEPA 3FB7B 3PV6A 2Q86B 4M3KB 4J3SA 5CBAB 3B83A 3HN3A 5D2LB 5IMMA 4XMLL 1CFVH 2EH8H 1L0YA 2DS4A 5D1ZA 1U8JA 2FJFA 4E41E 1QBMH 3W0WB 2UY6A 1YEGH 2W0KA 2NY7H 3GI8H 3IDXH 2J5LC 3V0VB 4HG4K 1HSAB 5JO5A 5GRJL 4M1CC 1NCDH 1IEAA 5I8OL 2C3VA 4UDTA 1FFOA 1OP5K 2NY1B 3FO1B 5J7CC 1RZ7L 2A9NL 2FWOB 4MQSB 2ADJA 1A7NL 1QBAA 5CBEA 4X6BB 4HC1H 4TPRL 2VLJB 1A6VH 3RDTD 4DQOH 3RZCA 4PJBE 2AEPH 3VFTA 1JP5A 5T5FL 1GC1L 4OAWB 3HE7B 1VESA 1RK0A 2AEWA 1KTLA 4K3DH 1TVHB 4XAWL 3RVVD 3QUKB 4OM0L 5L88L 3GBML 2FECI 1X7QA 2O5YH 3I75A 1MHHA 3QCUL 3CH1A 2FD6H 1FFOB 1GGIH 1P84K 4LSSH 3C5ZB 3MV8D 4G9DA 1VKXA 1OARH 3BJ91 3CVHB 1YN6B 4NCDA 3SGJA 3C60D 4GAJL 4M6OL 1U8PA 4A2MA 4V1DE 1FGNH 4Q9RL 4N1HB 4UIKH 2R2HB 3WJJA 2DF3A 2V9RA 1M71A 1JHLL 2P4AB 1BD2A 2B4CH 3MGOA 5E8DL 1ADQA 3QUKA 3MUJA 2HG5A 2R4RL 3LKOB 4NC2B 4YQXH 3GSRA 1FGVH 5E2WH 2O5ZH 1J8HB 4X7CC 1P4LA 4ODVH 3MRQB 4XPBH 1XGRB 2HJKB 2YRLA 2CQVA 3OHXB 3DX8A 4TVSa 2J88H 2Y72A 4Z7WE 3TP4A 1X5ZA 1QBML 3ZL4H 1VEMA 3LEXB 4K94L 4ZFOA 1VCAA 4XVTL 1NCTA 3BI9X 5J13C 2NW2B 1AR1C 1I1AD 4ZS7H 5J11B 3PHQA 1CIUA 1MCCA 3LDBC 4QGYA 5BO1H 5FECB 5TF0A 5DJ6B 3RWGA 1A7NH 5I71C 3MRDA 1ZHNB 5IB1B 1OQXA 4FRWA 4K3GA 5FA3A 4OUOA 1YEEH 4LPTA 4TUJA 1MHCB 3K46A 3VG9B 1MFAH 1MIEL 5I1KL 1C5BL 5E08L 5K9JH 2VXSL 4BZ1L 1MEXL 4ZODA 3OKLB 4WGVB 1QG3A 1K5NB 3KR3H 5DWUH 4YK4C 2HT3D 2VZ3A 2HKFL 4Y2DD 2FECL 1WWCA 2OBGA 4Y2DC 5FK9A 4Z0XA 1ZHKB 1W72H 5AUMB 4MNQD 3WIHH 3NFPB 5CZVL 3OMZA 2CUHA 2PNDA 3SOBH 5I1LB 1FCCA 2AXGB 4KTEH 4K7PL 1INEL 4M7ZB 3TC9A 4PB9L 1FZJA 3RFZC 2CDGB 1N5YL 5MEPB 1AY1L 2IMMA 5SWSE 3QB7C 1WITA 1Q9LB 4LQ1A 4Q58C 1FPTL 4U6TA 1HZHH 1LILA 4YDJA 4NN5C 1D5BA 1LP9A 4PP1D 2I24N 2ZKHL 3NBNA 3WDJA 3FMGH 4JG1L 1CE6B 3CFEB 2HRLA 2VLJA 3O6MH 1P4BH 1MQKL 5GSRA 4KROD 4O9HH 4PRHB 5BMFL 3QIBD 4NKMA 1OLLA 4HC1L 3WFEH 4X5LA 4HWZB 1E27B 1MCDA 3WKMH 2XTJB 4PJDB 3TNMB 1F2QA 5CLTA 3KPMA 5IM7A 4RFOL 2XZAL 3VXRD 1HKLL 5MERB 4PJ9C 3B9KD 5HPMA 5D70L 3LQAL 2O5YL 4P23D 4BK5A 1UM5H 2DQTH 2QJDA 4LVNB 4H1LH 3I9GH 2V9QA 3KLAB 4NKOB 5GRZA 4JM2D 1MF2H 4JFQB 4JO1H 4LRNH 4F33B 4YWGH 4BZYA 1ZXQA 2A6KB 1YMMA 2CIKA 4D9QD 3J7HA 1FGNL 4X4YA 1GXEA 5TFSL 3QXTA 1CICA 5HGHA 4AZ8A 3O0RL 3BEWB 4HMEA 1L0XA 1YQ2A 2FX9H 3AXLA 4BH8A 4O2CB 3UBXG 2DBLH 4AENB 1ND0B 5DMJB 5IUSA 5MP6H 1WQVT 4LBEB 1F11A 4MDIA 2G5BA 4E0RB 1PG7W 3BGMA 5AZ2H 4HSQA 3T77A 4S10A 3O4LA 4DUWA 4KU1A 3NPSC 3BGFC 1IGIL 2VIRA 1YMMB 2CIKB 5L6YH 1E4XH 4K94H 4LLQA 3V6FB 3RPKA 1DQLH 1FSKC 4KAQH 4BQCA 3E3QC 2HVKB 2CUIA 3L3IB 4G7VH 3C8DA 5DK2B 1MCIA 1VGEH 4HWEL 5GGUA 2VABA 4C56D 1AO7E 5E2VH 4BSWA 3PWPE 1CZ8H 3IDIA 3KDMA 5EFIB 1I8KA 1WWAX 4QTHB 4JFOB 5SWSB 2VZSA 3H42L 4OQTH 2EKJA 2YC1B 5I1GL 5DJ0A 1AGDB 3UTTE 5L8KB 4PTTB 3SJVA 4NQCB 1KJ2H 4UDUB 1JZ7A 4QRPB 5T33H 3LKOA 4JRYB 5EPMA 1YUHA 3LPWA 1T89A 4HF5L 4CNIB 4PYGA 2SEBB 1TITA 4RDQG 4F7PA 3SKMB 5IK3A 3HNSH 3FHQA 4ZQKA 3C09B 1J86A 3QWQB 4YXHH 3G5VB 1KIRB 4XMLH 4R7NA 2BSED 1YNLL 1TZGL 2Y5TB 4L4JA 4NQTA 4O2FB 4P46B 3VXRB 5DA0B 2I60H 4OKVB 5DURB 5AYQA 4PLJD 1A6WL 1YEGL 3LB6D 3QIUC 5C2BH 5CEZE 1ZT4B 3MFFB 5F71A 3IDYB 5C7XH 2ZUSA 4NCC1 4ODUB 3PF2A 1ED3B 4TSCH 6FABH 1X5LA 1CXIA 3SDDD 1H15B 5KJRL 5CJQL 3HNVH 1MHEA 2NW3B 2OX5A 1HINL 2KH2B 1IEHA 5JOFB 5HHOA 3TO4B 2JJUA 3I2CH 2XWTA 3QFDA 3RA7H 4JRXA 4LVEA 4ZFFA 2CLZA 4BM7A 3MA9H 4OKDA 4FQQB 1DQDL 3MLWH 5D96C 1TENA 4X80H 3ZZ1A 1QSEA 2XN9E 2R0ZH 4KHTL 3WKML 5JW4M 2VDNL 5JPMA 1OPGH 1NLDL 3L3JA 3P11H 5HYJB 3VFVB 3SPVB 3ULSA 4XNMB 5DYOB 5ACZA 2NZ9D 3FRUB 4P3DA 1ZEAH 3D6GA 1F4XH 1UQSA 1CI5A 3KWWB 3WXWH 15C8L 1XF1A 4OD1L 1FN4B 2IANB 3L3HB 4HZLB 5E2WL 1PQZA 2C1PB 1Q9WB 1JNNH 3ULUD 3C6LA 1NGWA 3K1DA 3ULVE 3WJLA 1MRCH 1EIBA 4KKNA 4NZUH 4HPOL 2Q1EA 5FV2A 4ZYKB 4X99B 1IAIM 1YJDH 1RZKH 3WLWD 1I1AB 1BZ7A 1FL5B 4HH9A 2YPKB 2GI7A 3EJYD 2X4UB 2YPLE 4RFNB 5ALCH 3BD5A 2ZCKH 3ZKSD 5E7BA 2VRAA 3X11B 4R97C 3GSQB 3STLB 2R23B 5FFLA 2Q87A 2VLRD 1QFWL 5IHZA 1F4YL 3CLFH 4GAFB 4X4XB 4KV5F 3VFOB 2CKBL 5I6XB 5BRZD 3RA7L 2Q7YB 2YD1A 2JCCA 5CZXD 5K9JL 4Q9QH 4WO4A 3OL2A 1P7KB 3F7RA 5DJDA 4KDVA 2IC2A 4LDLB 2X4TA 3B3IB 3EJYC 4CBPA 1PKQB 2AQ3A 4JJ5A 5E8NA 4HCRA 1KJ3H 3VXSB 1UXSA 2R4SH 3UTOA 1UKTA 4PRHE 1NGZB 3SOBL 3W82A 1AHWC 2RGSA 2C3VB 4UDTB 5KZCB 5CZXC 5EB9A 4U33A 4J3TA 3B9AA 3EJZC 4QGTA 3IAPA 3TGXA 1JI2A 3RY4A 2HT4C 2W91A 2KZWA 5D2NC 4H1LG 4DK3A 5DDHB 1LK3H 4LLQB 3OWEA 3VXNA 4EEEA 4GKSA 1OTTC 4PFEA 4PTTA 3OG6B 3VXQA 3VA2C 1ZLWK 4F7MA 4M5YH 4AQ1B 1JZ6A 3RWHA 5D8JH 1GOGA 5IW1A 3ECBA 2G2RA 5CHNB 1MPAL 3HCVA 3KPQA 4PJAE 1H5BB 1XCTB 5F9JA 1QHOA 4JY6B 4K3EH 1NMCB 1FVEB 2IAMD 3ZYOA 3E2HB 4O2CA 3V7AG 3QWRD 2HFTA 2X2YA 4HIJB 3MGTB 4NJ9L 4JO4H 1T2XA 5C0CB 5FHBH 2ZCHL 3QEQB 1GGBH 1IM3A 3ET9F 5ISZB 3B9DA 5EORL 2F19L 2H2SC 2OR7A 2ZOLA 1A7RL 2X9XA 3MRBA 1A1MA 4XPHL 4FHBD 3VXNB 3MMEB 1KLGA 1J5OL 3T0DA 4KKBC 1R0AH 2Q8BL 4FFZL 5HHXH 3UO1H 5FYJH 5DD1H 1J1PL 2R9HD 2YD3A 4KWUA 1KEMH 4ZXBB 3D85B 1OL0A 2DM2A 5H35B 5JW5B 1BIHA 3KPRD 5DD0H 4MA3A 3QA3A 2NY3B 5I73B 5CZVH 2DIJA 1BQLH 3U0WH 4LCCA 1U3YA 3O2WH 3DV6B 3UBXB 3SJVB 1U3HA 1Q1JH 3EYOB 3QDGB 3TPUA 3VFMB 1ETZB 4BK4A 5GGSB 4IRSC 3FONB 4L9DA 2OI9B 3WO3B 3QI9D 3NIFF 4OGYH 4WUUD 1I1YA 4D0DB 2XXMB 4UILL 4JZJC 2NY4B 3DX7B 2XWBB 2IPKA 4UU9A 4GRWB 5DQDH 1QFPA 3VWKC 1R24A 2DM3A 2QQQA 1MQKH 3WL9A 5DUPL 1YEHH 3LB6C 2CR6A 4Q7DA 1GZQB 2FHBA 3LKQA 3HAEB 1K9TA 4AK1A 1Q9WA 1DQJA 4XI5C 3MSPA 5ANMB 3NFPA 1FZMA 1IGTA 4NN6C 5SX4H 3WHE1 2PXYB 4GW4B 2Q6WA 1NMAL 3H9HB 2V2XA 4IDJH 3QEUB 4ZS6D 2EDTA 5F96L 3F7YB 4HWUA 4LDOB 4RWYH 3VRJB 1KULA 3UXFA 1LEGB 4KJWD 1ZVSB 3D85D 4PJIB 5GHWH 2DMKA 4OLWL 4WU5B 3GBNH 3MZGB 5GGTA 4ZYKA 5IESL 3U30B 1T21A 5J12B 2AS5M 5HY9A 3K2UL 3ZKMD 2IH3A 1KEGH 5EUKB 4QEGA 1QRNB 2AGJL 2PTVA 4PRDB 4KI5D 5DLML 1NH6A 1I3GH 2BFVL 1UB5A 5IFAL 4LEXL 2ICWI 4JFZH 3UTQA 4P3WA 2ATPB 4CRPA 2AW2A 2XN9A 3A6CL 3EDKA 1JPTH 1OAYL 4M6AA 1NEZG 4ZOCA 1WWBX 5E8EB 5DJCB 2XZQH 2Z8SA 2YA2A 2NYYD 1WVZA 5M94B 2LU3A 1K2DA 1I1AC 5HI5D 3JUZA 4NFCA 4FN0A 4Y5XC 2A73B 1A6VL 3MRQA 3HE6C 2G60L 3QUZA 1FL6B 2LE9A 2D03H 4KKLD 3RU8H 2PW1B 2ZSVB 1WCBA 4GBXA 3C08H 1IAKB 3AS3A 3U9UB 1CDBA 2WBJC 3LRSA 2ZCHH 4BZ2H 3OTTA 3BYTA 2EDQA 3BMWA 4KMTL 5L8LB 1RJLA 2VKWA 3DIFB 1I4FB 4HFUL 2L0DA 3C9NB 4HJJH 1I3UA 1SHMA 4G6JH 5HVHB 3QHZL 4TSAL 4Y4HB 4NT6A 4KKLC 5KSBA 3G6JE 5JIIA 1IC1A 3HI6L 2EE6A 1E4WL 1NSNL 4JM2F 4JLRB 1FV1A 5HI5C 3VD4A 3V2AR 3BT2H 1JTPA 1H3WM 3IU3A 4U1KA 5E94A 1OHQA 4ZAKB 2OXGA 5FDWB 1MCPH 5JW4N 2FEEL 2HA1A 4XX1E 1KYOJ 2BNUB 4WI2A 1AH1A 3O3EA 4PGDB 3QCVH 4JPVH 4OKVA 4X83A 4LMQE 2P5EB 3KPPB 4HEME 1QRND 3O2WL 5C9KA 4HIHB 4LASL 2Y06H 4Q0XL 5EZOH 3SEPA 2UZIL 4C56E 1ZANH 3QIUB 3I75B 1CD8A 3A6BH 3ARYA 1SYVB 1S7UA 4JM2C 4XMKH 1P7QD 3LHPL 5IFJA 5F3HA 5IROA 5IMOB 5FUZH 4G6MH 1EFXB 5LJYH 4AH2A 3MRPA 3G5XA 1D9KC 2L4OA 4LCWD 5K9OB 4QRQB 5CCKL 2ERJB 1UH2A 1F13A 3MRGA 3VD9A 4HIXL 4ZS6C 1DLHA 1TCRA 3KG5A 3HC3H 3WS6C 4GRMA 1X5KA 2GK0A 4XHJD 2EXWD 2BCKA 5I66A 2HTKD 3QUXD 2WW8A 3SDAA 1KBGL 1NAMH 4PJCA 1GHFL 1MCQA 4WDIA 1Q9KA 2BC4B 3FO0H 3BZFB 5EU5B 1R3JA 4XPAH 3BZEA 4DJMA 4NHCH 3WIFA 5DMKA 3GMMB 3NACH 3RI5K 3K2UH 4JGUA 4LLDA 1KLUA 4GFTB 1BD2B 3TIEA 3UZQA 2R15A 4LVHC 5ALBH 1JHTA 2YD5A 4BQ8A 2EDDA 3MJ8B 1FAIL 3GSXB 5I8EB 4ODHH 1KFAH 1RZFH 43CAB 1XR8B 1FP5A 4HQQH 3VXRE 1CL7I 2O5ZL 1RJCA 2OJZL 1C5CL 1NBVL 1IGJB 2A77L 3S36L 3SDCD 2Q6WB 4KUZH 4HIIB 2DIAA 4C59B 32C2B 2Y23A 1V7NH 3WN5C 1IQDA 3PXJA 3MV9B 3BP7A 5C0BE 5F7MC 2VXTH 2F54E 2BERA 1N6QL 5DC0A 3EGSB 4ELME 1JGLH 1QA9B 2IADA 2HJLB 3MA7A 2DLIA 1KYOK 1WZLA 2BJMH 3WIHA 1G0YR 4J6RH 2F5BL 1A6AA 2HKHL 3U4AA 4YLQT 4LLAA 3IDNB 2XTJD 4YFDB 4M48L 2AERT 1Z3GL 1WIUA 1I3RA 1S3KL 4U7MA 1HHKA 5GRUL 3TIDB 2CDFA 3VFRB 4EDXB 5JLZA 1M7DB 2YUXA 4L9LA 2BVYA 4LAQL 3T0BA 2X4PA 3L1OH 4HFWB 5B4MC 5BV7H 1EPFA 3QDJE 3DVNA 4OZ4B 1OD9A 2EC8A 5DT1H 3MX0A 4JO1L 4LRNL 5FK9B 5T1KB 3MRHA 5BRZA 1I9RL 3FOMA 3JWOL 5C6WH 1KXQE 3BOVA 3PL6A 5TH2A 1JF1B 3S5LG 5I75B 2AQ1A 4BSWB 4Y19E 3QFJD 3QFJE 4Y16D 2VZOA 5D7LA 5D6CB 3N9GL 3OGCA 4ODTH 1FL5A 3TN0D 3LS5L 2CO7B 4P2OD 1JBJA 1N5YH 3THMH 1D5ZB 4D3CL 4HGMA 4G6AC 4XP6H 3QQNA 1T2JA 4G8GB 2E7LA 3RUGB 1XGPA 1SM3H 1AGCA 5H37H 1S5HA 2ZUVA 2X4OB 1IRAY 5H2BA 2LTQC 5C0JB 4HJ0C 2CR3A 5B8CB 1UCBH 3KPNA 4F8QA 3CPLA 1CGTA 2F54D 5EU6E 4EI5B 3PNWB 4PJXB 3QDJB 4AH2B 3WFBH 4LLYB 4BKLA 4M7LL 4NO2A 4WEUD 2APWA 5CIPA 1KNOB 3C5ZD 4GUPB 4WUUB 4E41D 3K0WA 1AE6H 3LSOA 2HKHH 3RUGA 1UJTA 5ICXB 3WJJC 3PWJA 1QEWB 1KELH 3KPTA 3L95B 4K94C 3RGVD 2Z35B 1FZKB 3HRPA 1CGUA 1P4IH 5GS0H 5I18H 1MVUA 2WINB 5EH1A 4ZSOE 1R3HB 5AEAA 5DD1L 3DUUB 4MJIB 5F3HB 2YK1H 3NCMA 4D9LL 2A0LC 5IG7A 3BMVA 4XX1G 1N0XL 3F7QA 4Y19A 5F6IB 2R2HA 5D7SL 4XC3L 2X70B 2EDYA 2PXYC 3OKDA 3FQWB 1A6ZA 1AGFB 4JFFA 2IFFH 3JVGA 1IC7H 4K2UL 1UA6L 5E6YA 3VFNA 5MEND 2FATL 5CSZB 1XMWA 1TVBB 4P2OB 3D25A 3SDDC 1HCVA 1C5DA 2X4SB 3KYKL 4ODWA 2IH1B 2ERJC 1RUKH 1R5WB 3VMNA 4XNQA 5ACMA 3V4UH 2JJSC 5DF0A 1LNUA 4LKCB 4KKAD 1U3HD 5E8PA 1RQ5A 1HYSD 3I2CL 1BJ8A 1A6ZB 1LMKA 1MH5A 1RJYA 4MYWB 5I8EA 2P49B 3RDTA 4W81A 1QO3A 2WWKT 3WUZA 4N0RA 4LARH 5ESVA 5JXAL 2E6JA 1D9KB 1KCUL 7FABL 5FYKE 1YPZF 3MA9L 3EO1B 4J6RL 4ZUTA 3TCXA 4OI7A 1WCBB 1U8LB 2LV4A 3NCJL 4QRPA 2APTA 2DICA 2FJFB 5EC2B 4A6YH 5CMAB 3TH4T 3OX8A 4X6CF 3FFDB 5IMLB 1YYML 4ORZC 4HWNA 3AY4C 4CN1A 3H9SD 1L0QA 1B4RA 1P4IL 3WMSA 4ELKB 1CBVH 3PHSA 4EOWL 1BP3B 1PAMA 3ARVA 4LSPL 1I8IA 3MRIB 3UPAA 2OZ4H 3FO2A 4L1HA 4HDIA 4EXPX 4PRIB 3D3VE 1FO0H 4P2RA 4ODVL 4XXDA 4MLIA 3SGEH 5H8DA 3BZEB 1TQCB 1Z9SA 4LSVH 5JIKA 3O2VL 5EN2B 2ZG1A 1YEFH 4ZFGH 2NY0D 4CU6A 1DJSA 4OV5A 1GGTA 4HXAL 4OD2A 1W0WB 3CD4A 3U7WH 5ID0A 2RIKA 1XCQB 4FTVD 4Z7QE 5DI8B 4UIMA 4DCQA 5LBSL 3SE9H 4F57H 4OLEA 1V5JA 5K9QI 4HS6B 3U6RA 1EGJL 2NX5E 3MLVL 5FYLL 2P8PB 5IVXE 3QFDB 2ZUQB 3H9HA 2CDFB 2WIMA 3OGCB 1AKJB 3PWPD 4GKZA 3AMLA 4QOKA 2VC2L 1K6QH 5EA0L 4WFGD 3QPXH 3HC3L 3FOLA 1AQKH 1RMFH 2CSPA 1EO8H 1DQML 3WD5H 5SWSD 3RUGE 4NQUA 4PLJC 1U92A 4F7PB 1MH5B 3QSKB 3U0PA 2GSIB 5KN5B 3AVEA 3RBSA 3C6SA 3MV8E 4K55A 5I9QB 1XGUA 2EDOA 4MHHG 4Z77A 1MAML 5AG9A 4R0LC 3RTQA 3T2PA 1RD6A 2YPVH 1N0XH 2QTEA 2XICA 1OGAA 1ZK9A 1JPGA 1U2HA 4I1NB 2RHEA 4HQQL 2DRUA 1BMGA 1IC7L 2F5AH 3EYVB 3KPRA 2AK4B 1UEMA 4ALAH 2QBWA 3PQYE 4X8JA 4X9IA 2UZIH 4UV7H 1DL7L 3R8BB 5I1CL 1IAKA 4N8VA 4MJIA 4I4WA 3VFWB 1MCLA 5E2TH 3FQTA 3V4UL 1KB9J 3CMOH 1UENA 4LRIC 4Q2ZA 4JCMA 1Z5LB 5ICXA 2E9BA 2VLJD 3RZCD 4W4OC 4J8RB 3MLVH 1PYWA 2FGZA 2ZPKL 5C6TL 4NNYB 43C9A 4P23C 5I15H 1U95A 3N50A 3U6RB 1KN2H 1I1RA 5GGRB 1D6VL 2I27N 3U2SA 1TTFA 1KENH 2C3HA 4F37F 3BD4A 3ILQC 4F37K 3AU1B 2GY5A 1MI5A 1QFUL 1BQUA 1ZLSL 1ZTXL 4P23A 2OI9C 1KIPB 3RRQA 1JZ4A 1IGYA 3G6JF 3QUXA 3GSOA 3C60A 2ATKA 3RWJB 4YBQD 1ZS8B 3TJHC 1GGIL 2WBJA 3M8OL 4HCRL 4POYA 2LAAA 2YA0A 2Y36L 1I8IB 3MRIA 4PJEE 5FF6B 3MJ7A 4JKLA 5IMOA 2BSRA 1MWAB 2JK5B 2VDML 2X4QA 3G5VA 1NCBL 3MLUH 3WFDL 4AL8H 4WHTA 2A74B 5E8DH 4JREB 3RI5F 4EI6A 3REWB 2PETA 2DQDH 2ITCA 3QUZC 4G8FB 5ADPL 3MV9A 4W68A 4HBCH 2XQYK 1OP5H 3VXTA 5EOQH 1S7VA 2HRPH 3RWDA 3KJ4B 1YEHL 2P8PA 3G5YA 5J89A 2C1OB 3QNZA 4WTZA 1S8DB 2J8HA 2V5TA 5FB8B 5KW9H 4OZHB 2OR9H 3HPJB 3CVHA 3S34H 4G9FB 5TE4L 3MZTA 2APBA 5CEXA 2F19H 3BIKB 1S7XB 4WUUE 2J12B 4I18C 5EA0H 2Q76A 4IDJL 1MJ8L 2D0GA 5IVZB 1SJXA 3X11A 1AC6A 4L5FH 2YD6A 2IGFH 1KLGB 1UC6A 3AMKA 4JE4B 4WJ5A 4ZTPH 2EYTA 1J1PH 1ZLUK 4OB5H 1IFHH 3OXSB 5A1AA 1BX2B 1T1WA 1YEDB 3O4LB 2AAVA 4HK0A 1J1OL 1WBYA 2ZNXA 1YDPA 3T0EA 3O6LL 2YBRB 3GMRB 3QNXB 1A3LL 1MRDL 5B8CC 5B3JF 5DK3A 3IFOB 4P4RB 4PJ9B 3GEWB 3KYOA 3NA9L 4MWFB 5F9JB 3QUMA 4WEMB 2I26N 4HZLA 1Q8MA 1GGCL 2BHYA 5DRXB 3D3VD 1DUYA 4B0MM 4R0LA 5JPNB 2KZ1B 3Q3GB 3BX7C 5D2LF 1P7HL 3QXAA 5EZLA 3B8YA 2FIKB 4GRLD 3UDWC 2C9AA 5I1HH 5IGXH 3FHAA 2R1XB 4N9GB 4QRTA 3EHBD 3RIAF 5D72H 3UYRH 3MV01 4IRJB 3PV6B 2V2XB 3HZMA 1DL7H 5GIRA 2RFXB 5E1AA 1TVDA 1XR9B 4CDHA 4QF1A 5CBAA 1A1NB 1N2RA 1JGEA 2D4DA 4L4VA 1JGDB 3OV6A 1JJUA 3BZ4B 1QBLL 5DUBB 4MA1C 4PTUA 2AJ3B 1FNSH 2EDHA 4N5ED 9CGTA 4JVPA 1OW0A 3X3FL 2OR9L 4PJHA 3SO5A 4Z7NF 5C6TH 2P47B 2XI9A 1ODAA 2FO1A 4H20L 5DJ2B 4UTBH 1BVLA 1RUPH 3M1BB 3RAJH 1T0PB 3OHXA 3V7AE 3VXRA 3T0VA 2QADC 5C0AB 5EO9A 2AJVL 4UQ3B 3R06A 1A4KB 3RIFF 5IEKA 2VQTA 1E6OH 4IEFB 5DD6B 2X70A 3GSRB 1BREA 5D70H 4KJPC 5I16B 1JZ8A 1UJ3A 5E9DE 5F9OH 5GHWL 4Z78A 4XB8A 4NN7B 1FH5H 3AM8C 1QD0A 4IMKC 2BY2A 4X8JB 1NUFA 3RBGA 2DQIL 5CJXA 4N0UA 5C6PB 1Q0YH 4FXKB 3QCVL 4XBGB 3K4DA 3CUPA 2J5LB 3MNZB 3FZUC 4NKIL 3MV11 3CFEA 4DTGL 5SWZD 1MUJB 2YXMA 4Z7UA 3UMTA 4JFZL 3ARXA 1S7RA 3SDYL 4B7LA 2JELH 5BXFB 5IEKB 1EVTC 2X5PA 3HE6A 4PS4L 3DV6A 3UTSA 1XH3A 5J6GA 5D2NB 1TDQA 1LK2A 5B21A 5DJ8A 4YXKL 4OCYL 5I8OH 4LDEB 1LGVA 3V0VA 4P9MH 4LCWB 1K8DA 1N3NB 4D8PB 2ED7A 2FZ3B 1ONQB 2H2PD 4L3EB 1T0NA 4JKWA 4CU8A 1E4XL 4J3UA 5DJZA 5IJKC 1S9XA 3QXDB 1NBQA 2RQ8A 2XQBH 4PP2B 4YE4H 1A7OH 1KCUH 4WFHE 5GS1C 7FABH 1NLBH 4U1JA 5DJAA 3VE0A 1IGYB 1JGEB 3R1GH 5J06A 4NQXB 1J05A 3HI1B 3LKSA 3MRCA 4MCYB 1IM9D 3JV4B 4OFIA 5D1XC 4FFYL 4QRUA 3VXUB 2NY3D 2PR4L 3BEWA 4OGAD 2J8UB 5TFSH 1ZAGA 1DLFL 2BY1A 3U7AA 1BQLL 2A6IA 2F8VA 2JCCF 4QRPD 3TO4A 5HHOB 4DK6A 1EDQA 1RURL 2QR0A 3EOYG 1H8OA 2XZZA 3I6GA 4TSBL 4RGOL 5F3BA 1BEYH 4OV5B 1LO0H 5C0NC 4IMLB 4D0CA 1J7VR 3Q5TA 5GS3A 3F58H 4LIQL 3MRKB 4N9OB 1AO7D 4DQOL 3TBVA 4EBQL 4HULB 1JNJA 2DQCL 3NCBB 2A1WL 4EQ3A 5JIPA 4ONOA 4DKDC 5E9DB 4WJ5B 1IL1B 2EECA 3HE7D 1QKZH 4NJ9H 4NQCE 2DLFL 1XF5A 4UT7L 2IAMA 1CFSA 3G08B 3FOLB 5C92A 1IGIH 2HN7B 1S9VB 1QZ1A 4B7IA 3V6ZA 4R4BB 4UQ2A 1RU9L 5I8CB 2GEEA 3CU7A 1VFMA 3BGFB 2ADFL 3QUML 4ZUVB 4XP9H 2OTPA 3C6SB 4K8RH 1JWMB 1KENL 4M00A 4XVSL 3PWVA 4X98A 4HF5H 3S9DB 3FT2B 3ARDD 4KKCD 4YBLB 2NPLX 3LMJL 4XTRD 2NTFA 4TRPH 5SWSA 3U48A 4JFEA 4KK9D 1JGVL 3QCTL 1QTYT 1YECL 2BDNL 4LPCA 4OLWH 3V6FA 1GCFA 4WI9A 4XBEH 1YY9D 5CGMA 25C8H 4W6WB 3O9WA 3P0YL 1I85A 2L7UA 3KPOA 2WBJB 4L4TA 3WCYA 1FZKA 4NFDA 3CSYA 1UWXH 4GW5B 5CWSB 1HH9A 1U9KA 3TESA 1UZ8A 4Y16C 1NCNA 3EYSH 1HWGB 5EBLB 2DKSA 2ADGA 2YC1A 3NIDE 4FZ8L 4KJYB 4Y5XB 2DQDL 4G43A 1OAXH 1U8OA 2VITA 5JW3H 2WUCL 1SJVA 4Z7QF 3AREA 2IG2H 1KB5B 3AFLA 1ZGLP 1AHWB 1FORL 5IBUG 1KJ2A 4KTYA 5IF0B 2I07B 3TBVB 4ONHB 1AIFA 2D03L 2G75A 2X1QA 4OCXL 4Z5RB 3TVMC 1P5VA 2RAMA 1I3VA 5LGKA 3QUZB 1GGYA 2JJTA 5CGYD 2W0FB 3NCYS 4J7RA 5DMYA 3QXAB 2VLRA 1G7LA 1ORQA 4RBPK 3WHE0 2VXVH 1A9EA 4MMZC 3BUYB 3VA6A 1TQBB 2VL5B 1RULH 4OZFH 5EOTA 3RUGF 4Q6IC 1N5AB 3VW3L 4YAQA 4NRYA 1KELL 5EU6A 1IZJA 4RIRA 1ZEAL 5CJ8A 1LO5A 5J56B 5IJKA 2WP3O 1UACL 3P30H 2IPUK 3IDGA 4PJ5E 1N64L 4NQDD 4EBQH 5J3HC 1DLFH 2JKXA 2NXZB 4HK0B 1DEEB 4YNYA 2BOBB 2B4CC 2MWCA 5E9DD 3FT4B 1OTUC 3ZE1F 3VE0B 1V3JA 5FO7B 4TSBH 2VXUL 5KVEH 3MLZH 2V2TB 3DSFH 4OF8A 1DDHB 1CGVA 2ZZUT 5EBMA 5ALCL 4JRYA 2AJXH 4MD0A 2XZQL 4UI2A 5DHYA 2GY7B 3GO1L 3GJFH 3T2OA 2AKRB 4MS8C 4X6DB 3QULA 3SDAC 4I2XB 5D5MA 5EBWA 1J10A 5GSRB 4MQTB 3PV7A 2X1XR 2CMRL 2OTUA 1KNOA 3MLRL 3DBXA 4BSJA 1K8IA 2X1WL 5ICZB 3HB3C 1MF2L 4G3YL 5ISZD 5FYKL 2EC9U 5FA4B 3EOTL 3NZHL 2OSLA 4YO0A 4Z7OF 2MOVA 4MGXA 2DQUH 4M43H 1FC1A 3LEVL 5EFIA 4J3VA 4QY8B 4RFOH 4HG4J 5CS7A 2Y9RT 4Y4FC 3LN5A 4AEIH 3MOBL 5D5ME 5DD3H 4XB7A 1A6UL 1G6RH 2OZ4L 1IJ9A 4YHKL 4UQ3A 3KPRE 1S5IH 3BEVA 4EOWH 1NGWB 3SCMA 1CK0L 2FB4H 1CCZA 3CDFA 4U6XA 3EO0B 5FGCB 2OJZH 3ZDZF 5DRXA 5EO1B 1A1OA 3TA3D 1YNTA 4CN4A 3O0RH 3PDDA 2YD9A 1KACB 2B2XL 1OB1B 1RUQH 4KAQL 2EZ0C 3V5KA 4Y5XA 1A6WH 3M17A 3EYSL 5CILL 4JFQA 3S37X 4OF3A 1CZ8L 2BRQA 1D5MB 3MRGB 4WY7L 3L6FB 5LCVH 4U1GB 3IDMA 3CNKA 5CP7B 1PW3A 2VDPL 3I3EA 1AIFB 2G75B 3VH8G 3O9WB 1G7MB 2ARJB 3TBTA 2HAZA 3HNVL 5T1LD 1MJUL 4OFPA 3I50L 3WD5L 4U6YB 1NAMA 4AEFA 5L88H 4KV5E 4CVZA 1V7MH 2ITDA 1YN7A 3RPIA 1EK3A 1BF8A 1NDGB 3HUJA 3T0EB 3MV7B 4MX7B 3S4SG 3QDGD 1KXTB 2NY5L 1I1FB 3F65A 3RAJL 5D9SA 3VXQB 5LAXA 3NZHH 3UAJC 3D2UB 1B0RA 4LHUB 2XT1B 1C5DB 4L4TB 1T20B 4KRPB 1NLDH 3BPOB 5BS0D 4BFIA 5IB5B 4Y4FB 1NBYA 3T4AA 4X6EB 5HVGB 1UADC 3D85A 5F9OL 3DROA 4FMKA 5EU4A 1WICA 4CVZB 4MQXC 5B3JE 4H5SB 5HGBB 4NQEB 5HGAB 1JPSH 5C70A 2E3VA 4Y88A 5HDBE 1CDUA 3ARGA 4F2MA 1HKFA 3CFCH 1UH3A 1YC7A 4JVUA 3BP7B 4TVPD 2N56A 3WEXA 5DR5L 2J88L 4DVBA 2GAZA 1MCHA 3QDJD 1NGXA 1F6AB 2VXUH 5KSBE 4XP1H 5ILTH 4WUKL 4XNUH 4MNHB 5DI8A 4DCQB 4P9HH 2DYPB 4JFXA 1LEIA 1DVFA 1AI1H 1FO0B 3QZWB 2FX8L 3RZCB 3ULUL 4QXUH 1S9YA 4IRSB 4XCYB 1D7FA 1T1XB 3JWDC 3GIZL 3BRGC 5EO0B 2P43B 3VXMB 3DX6A 3OB0H 2EDXA 4PGBB 1F4WH 1P84J 4C57C 4PJHF 2P1YA 2N1KA 4XCEA 1I7RB 1C16B 4LCCC 4I5BA 2FO4A 3VGEA 4X80L 1DBMH 1HDMA 2G9HB 3ZLQC 1KCLA 2DMBA 4PIRF 3PP3K 5GGTH 1S78D 1CFNA 3T4YB 5BQ7B 5DSCB 1OARL 1X5GA 2DL2A 5IESH 2QQLL 4Z76B 2PTUA 1Q72H 4RSVA 1NMAH 4Y2DB 5L7XL 2Z8VC 4FMFA 3VRIB 1U8LA 5FM4A 5GRWA 3SE8H 1CXLA 1OTSD 3OX8B 1ORSB 1PG7X 4RWYL 3WNNA 3MRRA 4D3CH 1V3KA 2NW2A 1S7QA 3HNTL 4JFFE 5HD8C 1FGVL 5EUKA 3EUUA 3MGOB 1F58H 4NNPH 1JPGB 3RWEA 2C4XA 4KJQD 3D9AH 4M1CD 2F74B 3CFKB 2BVTA 2UWEB 4PJCE 3P40A 4OFVA 1JYWA 1U93A 4I2XE 5BS0B 4YHPA 5JR1H 1XGRA 3QDHA 5DFWH 3T8XB 4KK9C 4KVCL 4FZEL 3C6LC 3UTTA 4WWKA 5C0GB 3VFWA 4E42A 3L5XL 4GRLA 2NQCA 4WFGE 3DVFA 5DMGD 3LIZL 4NNXA 3L3DA 4XCFH 5E6IB 3VD3A 5E1HB 1FNEA 4JPKH 5ICYA 5IB2B 3JV6B 5CLWA 1H3PL 2AXGA 3V4PH 4OFYD 1XF4B 3IJYA 1X9QA 5HYSA 3SDAD 2YWZA 4OBRA 1YQVH 2VDOL 4IDLA 3QEHB 5DHVH 3QULB 2R0LH 3V9FA 4ZUSA 1OTTD 1ZGLB 4LKXA 3T0AA 5LGHL 3D2UA 1LD9A 1YY9C 4PJXE 3HC0B 3MCKB 5EU6B 4HWBH 1RVFH 1OP9A 1IKFH 4I3RL 4S1DD 2O93L 1PSKL 2AJ3A 2AJUH 2DWDB 1AXSB 1PZ5B 3GHEL 4HUXA 5E24E 3G6JB 4J4PC 3C60B 5JORB 5I76A 3MTRA 4G8EA 2AABL 1TETH 1HEZA 4LSVL 3DYMA 1NDGA 4JFED 4WUKH 3A6BL 3CFDB 4KK5C 2FX7H 2NLJA 3RX5A 3MRJA 1IQWL 4Y4HC 4NRZA 3DGGB 4RQQB 4UTAL 3BW9B 3FO9A 3SDXF 5I74B 5E6ZA 35C8L 3ZSSA 4LVNC 4PB0H 2XXCB 3DTXB 4JG0L 1CGSL 4W6XB 4PRBA 3MRMA 4HUNB 4YBHA 4H1LA 5DMIH 1ZT1A 4LLUA 3AXLB 4NZJA 2YRPA 4L9LC 1RHHA 3G5XB 5ESAB 2Q8AH 1BM3H 3ARFD 5DVLA 4HLZG 4I4WB 4OT1L 2BXZA 1XT5A 1A47A 5EORH 5CJ5A 2CJUH 4GMSH 4WI4A 1T1YB 3ES6A 4RAUB 1I7RA 1ZLUH 3W0WE 4YHNB 1J5OH 3LKPA 1T4KA 3BZFA 4OZHE 3S98A 4D0BA 3MRMB 3KLSA 2DYPA 3B6SB 3HA0A 3HNTH 5MERA 1LEIB 1G7JA 3FB5A 2RJMA 3FJTA 2M1KA 2IQAA 2R4RH 3IFLH 5LGHH 4KJYA 3T0XA 2FYYA 1IM9A 1JN6A 1GSMA 3IAQA 4NZTH 3UP1A 5BW7A 2ADIA 3ORJA 3C09C 4ZFGL 4LCYB 2VJXA 4PJFE 1PX3A 4RAVB 3WS3A 4F7EB 3CC5B 1KFAL 2HFEA 2HJLA 3MA7B 5KS9F 4Y5YB 3T09A 4JAMB 2H41A 2DLEA 4NQDA 3SHSA 5I76B 1VSCA 1DN2A 1FVCB 1F8TH 5CEZL 5EBWB 1GIGL 4JO2H 1VKXB 2JB5H 2BSRB 2F5BH 5BV7C 1AO7A 3RZWA 1ZA3A 4KK8D 4TTDD 3G9AB 4TNWK 1N7MH 4X6DE 2VXTL 3ZDZE 1U8NA 2ARWA 1K2DB 1S7VB 4QOKD 1G6VK 4OM0H 4QOKE 2XQBL 3HE7A 4I9WD 4G5ZL 5B38B 4U3HA 2E7BA 1FFNA 1NAMB 5IW6B 4I0PD 1KCVH 2XOTA 2LQRA 4WI5A 4F9PC 1OWRM 5F9AC 5GZOC 1QYGH 5JW4Q 1S3KH 2P44B 2W60A 3ARBB 3MRRB 1KEGL 1Z9OA 4NM4H 4ZO7A 1SMAA 3U1SL 3P3YA 2F53B 1T6VN 1HSAA 3L1OL 4OM1L 5FOJA 3FN3A 3QO0B 5HHVL 1INEH 2W0PA 4XPFH 3X17A 3SKNA 1DBBH 5ITBH 2V9TA 3KHOA 1PSKH 2F74A 3CFKA 3HZVB 3T2NL 1CDYA 2GYSA 2X89D 4FQXD 4BA8A 4HXBH 1YNKL 2ZSWB 1KIUA 4NKDA 1G6RB 1JRHL 1REIA 3PGFH 4PP2A 2D0FA 2VDRL 5T1LB 4HKXA 3RY6A 1M1SA 1DN0A 3SKUD 4FQQA 3S97C 4WHDA 2ICWB 1IQWH 1NDMB 1EJOL 1MJJB 5D1XD 5K33A 2UUDH 1JPTL 2W38A 2CDEB 3DHJA 3MRLA 3CPLB 4GG8B 4FQ2H 5FA3B 1A2YA 5D2NA 3IJSB 4MNQE 2EIEA 3VFOA 4M93C 3ME0A 4EDXA 4U7KA 3V8CA 5C0RH 4RFEB 2PUQT 4POZD 4XP5H 4BH7A 1F6LL 1JPST 1S9WA 1A7OL 3INUL 5FGBC 1SBSL 1QLEH 4L5FL 4P49A 5IB3B 3HZKB 3T0EC 5TGBA 3FOMB 3WNLA 1OTSC 4JHWL 5BOPA 1H8NA 4FQLL 5DMGC 1B9ZA 1AXTL 1QVOB 4PGCB 5I30H 3O41B 1CFTA 3HG1E 4DFHA 1ITCA 2BNRB 1UA6H 4N90E 4OF7A 3WKNA 3VMOA 3MACH 5ICYB 4YIQA 4NZDA 4Z0XB 4Y19B 3L3OA 3SE8L 3H9ZA 4GKZB 2VR4A 4Z95H 1NCBH 2ADIB 4UDUA 3P77B 3BKMH 5DS8A 4OF0A 2OMNA 1JYXA 2W65A 3BXNB 4KVNH 5KAQF 1OAUL 3PE9A 4KGLA 2GSIA 3IXTB 2HJFB 3S36X 5FGCE 3STZA 1LO3H 3S36H 2AI0H 5EC1B 5ESQA 5C1MB 3TA3C 1YEFL 1BQHB 4EN3A 5JMRA 4HUUA 5J9PA 3ULVH 4YEEA 1RZKL 4HLZH 1J0HA 2VLLB 1KTKE 4G7VL 4CJ0A 3WJLC 1IM3B 2XKSA 3RIFK 3FO0L 32C2A 5C0BD 2VLRE 1SEBB 5EOCL 2PYFB 2VAAB 3PWPA 2Q3AA 1UM4H 2GKIA 2N7AA 1HILB 3BN3B 4JPKL 5ANME 1WFNA 1F4YH 5F88B 5KBNC 3RVXC 3OR6B 1TCMA 4LARL 4YPGB 1FFNB 4Y5VB 5IW6A 2DDQL 1HE7A 3JTTB 3X14B 5CWSA 1GHFH 4L8SC 1HQ4B 2VLMD 1KT2B 3FFCD 3QP3A 2LU4A 1GOFA 4TN9A 5AYUH 1ZMYA 1R5VB 1L9MA 5TDOA 3N06B 4KUCD 3UDWA 3W11D 4F33A 1JI1A 4D94A 4MJ4A 3JV4A 3G5ZB 5IJVB 3BESR 2F58L 5LGJB 1MLBA 2P8MB 1YA5A 3G6JA 1JV5B 3L3GB 4TUOB 4RMRA 3ALPA 4P5MB 3D3VA 3VGDA 5JDSB 5C07A 4KY1H 5T5NG 5JQ6L 4AEEA 3MYZA 2FSEA 3VU2A 2YRZA 5LWYH 3PDGA 5CIPH 4APQD 1JF6A 5DDHA 3QUYA 3H9YA 3V5DB 2ZUTA 3WHXB 2Y07H 4GG6E 1GZQA 1D6EB 2CMRH 4NRXA 1LE9B 3W11C 1OP3K 2ESVD 3TZVC 4LF3A 4IS6A 4QRRE 3O8XD 3U0TA 1MELA 5J8OA 1I75A 2EDKA 3AREC 5MEQB 4U05A 4HUMB 3SKMA 1RZ7H 2GJZB 5SX5K 4UNVA 1T2QL 1YMHA 3K80A 5KVDH 2D7TH 5C0DA 1AFVH 4HH9B 3MUHL 2A6DB 2VDNH 1BGXL 1ULVA 1UM4L 2BVEA 1CGWA 1I1YB 1TVHA 3TFKC 2AJYH 3BDYL 5L2KD 4HHAA 5FO7A 1JTTA 2EXYD 1CFSB 4LEOB 2OYPA 3HR5B 3DMMA 3VFTB 2BVQA 3NIGE 1QSFA 1UJ3B 1BZ9A 3OJ2C 5GS1B 4NZRH 3GI9H 1XR8A 3GBMH 2R2EA 1DCLA 2CDEA 3DO7B 4HBQA 2BNRA 4OSUH 2NNAA 3NH7L 4LVOC 4LNRA 4LSQH 4LGSB 1R3IL 2EZ0D 3T65B 4PLKC 4PGEA 1CD0A 4JB9L 1R3KA 3U83A 1UCBL 3BZ4A 3TYGH 5TDOB 2F58H 1Q94A 2LVEA 3HB3D 5ITFA 1YJDL 1UYWH 3KXFD 3SDYH 4L29A 2DQCH 5CP3H 1AGCB 3MREA 5D6DA 4N8VG 3SDXA 1EH9A 3UZEA 3MLUL 4AL8L 3PWLB 5IB1A 2PTTB 4P9ML 1CLOL 1FFPA 3WLBB 1HH6A 2H9GA 3S7GA 2EIZB 4XT1C 4YHIB 1NGQH 1MCKA 4P48A 5HBBA 4HBCL 2J6EL 4NP4H 4PG2C 3KPLB 5F1NB 3OKOA 1SEBA 4N1CA 3C8HA 4XHQA 1QPPA 4MB3A 5BRZB 4YPJA 5IOPB 3UTZA 3WFCL 3MREB 1SJHB 5KS9E 3MBEC 4ZAKC 3UYPA 1NCCL 8FABB 1K4DB 5A2JH 5J0BA 1AGEA 1MVFA 3CAFA 3UTSE 1D6VH 5ACLA 4QWWC 2R56L 3JXAA 3QCTH 1G7PA 4U1SA 2A6DA 2DBJA 3DETD 4PY7A 1NCWH 4PB9H 5ID1A 4ZXBD 1MCPL 2W07A 3O4LE 1CLCA 4JO3H 3KPRB 2W9EL 4L8SA 2XTLA 2R2EB 3RWDB 5IHZB 2BVOA 4M5ZH 4I2XA 5D5MB 5GJSL 1YNKH 1BIIA 5EOQL 2IQ9H 5D8JL 3PG2A 3O41A 3P9MB 3TVMA 1E6JL 1ZHKA 2VXQL 1BPVA 1M7IA 4HXAH 3RTQB 3EO9H 2DJSA 2NX5B 4J3WA 4HS8H 2JE8A 1ZA3B 3V4VH 2JB5L 4NWTL 2MCPH 1NCDL 5ID0B 2P5WB 2VNCA 5C0CD 2D9CA 1PGRB 4JDTH 1Z0NA 1MCJA 1XGYL 2NZIA 3TPUB 4ELMF 3LKPB 2VN4A 3R0NA 3K74B 5DJCA 1MCFA 1FYTA 1JTOA 3U9UA 5K93A 4YK4B 5HHMD 2ZG2A 3TBTB 3LEYL 5JQHC 3GMQB 1QRKA 4IIQA 4ODSH 3WNKA 4PJBA 5KW9L 3D3VB 5FUCE 4I0PC 4PV8A 3W9EB 3GSOB 1B0RB 3QRGL 3TEUA 5KVMC 1QSFE 3UTPE 1J1OH 1O5DT 3Q6FB 5F7YC 4BSVB 3DV4A 4U1IB 3UBXI 2VERN 2DLHA 1FVDB 5FGBA 2G2RB 4XH2A 3GI9L 4U1GC 1A14L 4I0PA 1CQKA 3LQZA 3UYOD 5DTFB 4QYOB 3GI8L 4L3CA 2DBLL 2A6KA 3QG7H 3S4SB 1EFXA 2E7HA 1Q1JL 4J1UA 4JZOA 5IB4B 5MEOB 1O0VA 3KLAA 4NKOA 2DM7A 1MWAH 1LWRA 3MQIA 1IBGH 5IV2A 3VXMA 4YFEA 4CKVX 3VXOA 5M7QA 4UOW0 5JPNA 1H5BA 1C1EL 5L6YL 2GK0B 4LFHG 1FNLA 4FZEH 4BFEA 4HIHA 4JR9L 5JORA 4FQIH 1W8NA 1AC0A 3CH1B 3W2DL 1WBYB 3C5JB 3IETB 3AUVA 1I3RB 3K4AA 2QV2A 1HHIA 4GH7B 2EE2A 5D1XA 3WV0A 2JB6B 3NN8A 5F7EH 1SBBA 1FL3A 1AD9A 4NGHL 4WHYG 2ICEB 4K3JL 4MJ6B 4QHUB 4G8FA 2Y7QA 2CXGA 3VMPA 3C6LD 1QBLH 1XZ0B 2R0LL 4KHXH 5HJ3A 4LAQH 4CNIA 2Q8BH 4OZGB 2Y1VA 1HSBA 4DGVL 1TLKA 1FCGA 2XNAA 4NO0A 2BNQE 1I8MA 2XIDA 3G5YB 1L7IH 4R2GD 1QLRA 4TNVK 3F12B 5H37G 1G7IB 3NVQA 4LCCB 3HE7C 4GS7C 1NCAH 1AKJA 4YHPB 5CINL 4M03A 3S37H 4O58H 3V95A 3PJSA 4U0QB 5JW5A 1C08B 1OAKL 3M8OH 2AJSH 2Z8WC 1E6JH 3CCHA 3VXSE 5LAXB 3OAYH 4X0KB 5E0QA 2OJEA 3UX9B 1DFBH 4ISVA 2BOCA 1U92B 4Z0BH 3S5LB 4TVPE 4OLVL 3G5ZA 4YQXL 2YD2A 4QTHA 1T0MA 1FNEB 2AJXL 1S7TA 1MFEL 1TJHL 3GMNA 4PRPD 5HPOA 1ZT7B 4UTAH 1RZIA 2E8ZA 5DJ0B 3NGBB 3DI2B 1MWAA 2JK5A 2X4QB 3FQRA 2R8SH 1SVCP 4JG0H 4JZOB 4LIQH 2GUOB 5FCSH 4JQVC 3ULVL 2J6EA 5TE7L 3UJIL 2A9ML 2GCYB 5C2BL 2V7HA 3P0GB 2G60H 3JWDH 5D1QD 5DGRA 4XWGH 1ERNA 5C09B 2OLDA 1NBZB 3MC0A 1CFNB 4QO1A 2ED8A 5IEHB 3U4BH 2XTJE 2XKUA 1T0NB 2GHWB 2GJ6A 4EVNB 3WBDA 1FDLL 1VFAA 2HKFH 2EXWC 4U4BA 3DJ9A 2CLZB 3HG1A 2HFGH 3WIHL 4HFUH 2DDQH 2VDOH 5HSFA 3CFDA 1MHEB 2NW3A 5IBLC 2CRYA 2HH0L 1G6RL 4X6CE 1QLFB 2I5YL 4D9LH 1LDSA 3V52L 2E5EA 3STZB 4FFYH 3VFVA 4IIQC 3GM8A 3CDCA 4X7TB 3WN5B 4W70A 3J8F7 4YUEH 4S11A 3NZ8A 4NQCD 1CLYL 3BPOC 3CFCL 1PZUB 3W0WD 2NLJB 4Y4KD 1B2WL 4L4TD 4YDIL 4JRXB 1Y18A 1QR4A 4I48A 4JDVB 4PRHA 1EBPA 1RURH 4KRLB 3H7BB 5CJBA 4ZUWA 3IFOA 5JW4R 1NFIB 4WVRA 3QIWB 4KY1L 3CVHL 1IBGL 4JFDE 4NN6B 3P9WB 4NBYB 1D6EA 3O3DB 3IFNL 2VL4A 4LSTH 2HRPL 4POUB 4JANB 2R8SL 3GSUB 3QNZB 4FOMA 5JW3L 2EC9T 3G04A 3PUCA 1IGJA 1BQSA 1FJ1A 3TWCH 2JJVA 3FFCE 3Q6GL 2A83A 2ZKHH 4PLKD 3LN4B 4U1KB 1CTOA 1F4HA 4PJ7F 5FM5M 1FHGA 1QKZL 4ODWB 5FO9B 3QUYD 2PW1A 3I9GL 4UINH 5FYJD 5DZLA 1HQRA 4MA8L 2Z4QA 3O8XA 5HJ3B 2IADB 1FAKT 2E9JA 3WS3B 4F7EA 4UUJA 3CZFB 4P5KB 1RUPL 1WFTA 4WUUA 3BHBA 3T3ME 3MNWB 3UJTL 3HMWL 4X4ZA 5FOBB 4TVPH 1WTGT 3O2DL 1RUML 3EBAA 4Z0BL 3MBEA 5MEOA 5E2UH 2IFGA 3F6IA 3C5JA 4LSPH 1MVUB 3EHBC 3JSSA 5MP6L 2OK0H 3DMMD 2QEJA 5AWNL 1J0YA 1E28A 3P4OA 2K1MA 1RIHH 1NC2B 2J2ZA 4HXBL 2LVCA 1T3FB 3IRZA 4BH8B 3VG0H 4LP4A 3HCVB 4N5EC 1CT8B 4G8IA 1EAPB 3KYNB 4NQSB 1EZVX 5E00B 5GGUB 3WNPA 4P46D 2EYRA 1IT9H 2W0FA 2XWJB 2EYTB 5BCAA 4OZFG 3MRPB 3X13B 5INCA 1CICD 3ZT7A 3NFNA 1KJ2B 4PJEA 4ZXBC 1F02I 3FFDA 4U6VH 5CCKH 3MV8B 4S1QL 1GYAA 3T77B 4JN1H 2V17L 4A2LA 1XGPB 2HJFA 1T3FA 3BIAX 4RRPG 4NYLB 1JIBA 4H25A 4AENA 2HH0H 5FDWA 3OJDB 1HH9B 5FHAH 4LIQE 5BJTB 4G80A 5DT1L 4FXLA 4F9LA 1H0DA 4R4FL 3O4OB 3QCUH 1MREL 2XFXB 5H94B 3GMQA 1EMTL 3RWIA 3EO1A 4XGZA 4LPUA 1WBZA 4P2CG 1Q0YL 4XPHH 3CU1A 1HQRB 1LP9F 3CK0L 3IU4L 4NQDB 1AP2A 3RNKA 1XFPA 1AXSA 1PZ5A 1QA9A 5KVEL 3I3DA 3VG9C 1NUDA 4N0UB 1TPXC 4OJFH 2DI7A 2H45A 4YZFE 1JUFA 3DECA 2UZXB 5AWNH 4KH2A 1QLRB 1GAFL 1FSKB 3D0VA 3PQYA 5GGQL 1BVKB 2QSTA 4A6YB 4XC1L 5BZDB 4MAUH 3RJQB 4TUKL 1VFOA 3MCG1 3V79C 4F57L 4IOFC 3ZHKA 4F3FB 2WMPA 4OCMC 5BO1L 4YDVB 2OM5A 4WTWA 5DRNA 3VGBA 1WAAE 2DTMH 3ZKMC 2X09A 1H3PH 3ZYJA 5HY9B 4G6KL 4M48H 4PJGE 4IRZH 5CJOL 4P2QE 3P11L 1WCQA 2XG5A 1QRNA 4X8XA 1QFWH 4Y8DC 4IOIA 5KSVB 3OF6D 1FG9C 5I18L 1J12A 1MJUH 3HI1A 2ZJSH 3NAAL 1XIWB 5HHPB 3U7YH 4CU7A 4FNLL 4Q9BA 1QSEB 1KOAA 3MLWL 4ODXA 1ZWIA 1N8ZB 3N85L 5EO1A 4LLWB 4M62L 1WTLA 4QRRD 1WIOA 3RHWK 2NCMA 3ISWA 5E95B 1ES0B 4LSSL 2Y25A 3KPNB 3RWFA 4WU7B 4EVNA 3OPZL 3QAZB 1M6OB 4KZDL 43C9B 1P9MA 1BD2E 1NEUA 1OAKH 2B2XH 3KYKH 4FQJH 3QYCA 2DTSA 3ULSB 3CZJA 3GUTA 3LN5B 4Q2ZB 3ZYZA 2AXFB 1PVHA 3HR5A 5IW3A 1MCNA 1NMBL 2P24A 1DQJB 4J3XA 5TDNB 4JM2A 3JWOC 4L1DA 1BECA 1BBJB 5AAMA 4U6VL 1HDMB 1X44A 4P46C 1CL7H 4QY8A 2AK1H 5HYEA 3OKEA 3DRQB 1FFRA 1BFVH 5C9JA 3LQAC 3CJJA 3DBXB 4PGEB 3PIQB 3CFJB 1MNUH 2GTWA 1IAII 2Z4QB 1NJ9A 1T04B 1SVZA 2XZCL 3LEXA 1W2KT 5F7HA 5KTEL 1KJMA 1EZVY 1MAKA 4JFDB 4CAGA 2DWEA 2J4WH 4G5ZH 4PJDF 3CLEH 1CDHA 2XACC 5C0AD 4ZG1A 3VWKB 4K9EH 4WFED 5FHBL 1FNGA 2W92A 3BDBA 2G5RA 4HPYH 5FXCH 5IIEB 3O45B 3RKDD 1INDH 1CD1A 5D7KD 3K8KA 4X4ME 5FYJE 3O9WC 2ZJSL 3VI3E 4P5MA 5HGAA 4L3EE 4OM1H 3KS0J 4GBXB 3U36B 1T66D 3RPIB 4QRSA 2YD7A 5KSUB 4N0YH 5E8PB 3N85H 2DYPD 4LCIH 4P59H 1DBML 1FYTE 4JB9H 5GGSY 5EZIH 4NNXB 3MBXH 5HDOA 3CC5A 1I7TB 3V8OA 3WHXA 2FHFA 2R29L 1W72L 3DIFA 1KPRA 3MLTB 4V1DB 1NKOA 4NIKB 1T1ZB 4PG9B 4ZUVA 3FCTB 3LVEA 5BJTA 4LL9A 4KI1A 4LU5H 3QEQE 4OCWL 3LAFA 3GJEB 5CBEB 4PJFB 1OF2A 4G6AD 5FKAB 4QCIB 1LK3L 5DRZA 5FYLH 3AM8A 4IMKA 5GRXG 5HYQB 3H7BA 4ZUWB 4L4VB 4PJ8A 4Y1AD 2QSVA 1QHPA 2UUDK 4ZUUB 4JKMA 4QT5B 2V5SA 4WU5A 1RZ8B 3TVMD 2ITDB 2XQYG 5D7LD 1W0VB 3QG6A 1KCKA 5IVXB 2IH3B 1S9KC 1EERB 4KGJA 2W1NA 3FCTA 4XMKL 4CW1B 1BQHA 4EN3B 3BQUB 1DQMH 3BUYA 5ESVB 1KCRH 2VLLA 3VH8A 5FCUL 3TO2A 5D1QA 4BFBD 4E9LA 1KTRL 1XGQB 1VGKB 1KV3A 3AREB 5HYQA 1E4XI 4FTVE 1SYSA 2H26A 3BIKA 4D2NA 4EUPH 3QQ3B 5CHNA 5HHOD 2OSLB 4Z7WA 1U91B 5C86A 3QXUA 2BVQB 5GS1A 3P9LA 4HV8A 2YPVL 3MNWA 3RKDC 3VJ6A 3H3BC 5CGTA 1X4ZA 4G43B 1F58L 4IRSA 4JO3L 3RGVC 4YWGL 5F8QC 3B9VA 4ZPTA 4LPVA 4RBPH 3C5ZA 3FKUS 3DO3A 4WW1B 4U1MB 3QIWA 1D5IL 4KDTA 4XVJL 3T3PE 4ENEC 4Y4KB 3UZVB 3FONA 3HAEH 3TH3T 3IXTA 1U8IA 4K7FA 4KQ3L 1X7QB 4GLRH 2VXQH 3DSFL 5F6HJ 4RZCA 3TBWB 4JFYB 3OJMB 5IB5A 2V5YA 1CFQA 4PBWD 2GJJA 1CVSC 2O5XH 4NO3A 4U31A 5ENWB 5E2TL 5IQ7L 2KQMA 5TQ2H 2EEDA 2Z8RA 5D72L 3MRHB 3R0MA 3VXPB 4B53A 4YEFA 3EAKA 3RKPA 3BH8A 3EW3B 4BH7B 1ZLVH 4H5SA 5HGBA 1JN6B 4V1DD 2DJ4A 1TJGH 4XCNA 1K8IB 3QR2A 3TWCL 2BVPB 5DQDL 4JFDA 2Y5EA 5DHVA 3QIUD 3ARFA 2ZG3A 4XAWH 2VSDA 4S1DC 4Z7VA 3OKOB 1MIMH 5FUOH 3D18B 2ARJA 2WWMC 4I9WE 3BKCH 4R2GC 2FCBA 4O51B 1P6FA 5J6HA 1I8LC 5DHYB 1KTDB 5TDPB 1T5XA 1OSPH 3AS1A 2CJUL 5A43C 1Z9MA 4P3DB 1DQTA 3A67H 3SE4C 3LKNB 3MOBH 3BH9A 1EUUA 4F9LC 2J8UE 1QQDB 2L7JA 2RR3A 4PJIA 4DKFH 3MXWH 1JHLH 2XN9B 5D7JA 5ECJE 1IZKA 4JPWL 1KB9K 4UOW1 5FYLE 4NOBA 3MOQA 1T83C 2NY3C 5I73C 3EJJX 5GRYA 3RL1A 1DZBA 1UJ3C 2B0SL 2NNAB 2J8OA 1EHAA 4I77H 3T08A 4OIIL 2APXA 3NIDF 1EXUB 5DYOA 3HZYA 5J11C 3UJJL 4MHHI 1N59B 1Z5LA 4GSDL 4NQXA 4PJEB 4EN3D 1LEGA 3CGTA 4X0KA 4ZDHB 3RVWD 1D5ZA 4YX2H 2EO1A 35C8H 2WUBH 2DI9A 4UT7H 3X3GL 3SGEI 4WV1B 3FN0L 1BHGA 4GLRI 5FUZL 4GMSL 4GW4A 5FIEA 5HI4C 4XPTL 1U8KA 1T1ZA 4M8QB 1JZ3A 4RMUA 1HXMA 4U6HB 2IGFL 1P7KA 4GKOA 3JTSB 5EZJB 3MNVB 3HMXA 5DQJB 3B5GA 1PKQA 5DHVB 3QUZD 4PJXF 1C7SA 3VGFA 1AQDB 5F9DC 4N0CC 3PXHA 4YHLL 2VE6A 1UWGL 3DURB 3FFCA 4RAVA 3HG1D 5C0FA 3QHZH 3G6DL 4TSAH 5I19L 4KXZH 3O6LH 5E8OA 3H3PL 3IF1B 3QWOB 4R90L 3FB8B 1QO3B 4FTVB 1MFBH 5KSBB 5MEPA 4DKFL 5K59E 5HYSB 1S9WB 4OZFA 3MV7A 3BWAB 5EZJA 1PFCA 4H8WC 1HIML 4HT1H 4OGZA 4WW1A 3HZKA 2QL1A 3DSNA 1GOHA 2HFEB 4PRID 2D3VA 3K8MA 4YXLL 1MRCL 3MUGA 2HTLC 2GT9B 3CDGA 1TQBC 4JLRA 3U79A 3H9SB 2VB5A 4LPXA 4KFZC 5I1AA 3RIAK 1P4BL 5D1QB 1WGOA 1ZSDB 3WE6A 1P2CA 1T6WA 2XZCH 4AMKL 1RJZA 2CRIA 1OGAD 4LBEA 4UV4H 1SYSB 2H26B 2HP4A 3QI9B 1NJ9B 3TIEB 2BSSB 3BO8B 1HHGA 3A67L 3O6FB 4FFVC 1U91A 4HIXH 4XHJC 3WIIL 1WJ3A 4R0LB 5F1IB 3S4SA 1INDL 1JZ2A 1VFBA 2XN9D 2EDFA 5B8CA 3FO2B 5HHVH 5T1MA 1SYVA 1JFQL 1FYTB 4OB5L 1J1XH 5HPMB 2DD8H 1U6AH 2R0WH 5J1AA 4KRMB 4P57B 4XCYA 4MNQB 3EDFA 3KYOB 4Y7MA 1U36A 5GQBA 1QSZA 4KJWC 5DK0A 5EZIL 2PYFA 1KJ3L 3B5HA 3GGWA 3SKNB 3VWJC 5CMAA 4NKIH 1FRGH 1N0LA 1OLZA 4H26B 4DFIA 5C08B 4FA8A 2DLGA 4X7SL 1EJOH 4YDLB 5T1DL 5IFJB 3GMNB 2K3TA 4PS4H 4Z7VE 5LBSH 3O81A 3SE9L 3WLBA 1MCWW 3MRFA 5FYKU 4NUGH 1B6UA 3SE3C 2FIRT 3NOIA 3ZT6A 4MAYA 1OAZL 1MI5D 3MRNB 2AJZB 4XCNB 4PRNA 1B4JL 4ELMB 4AM0B 1EEQA 1JRHH 4M4RA 4MZ3A 2YZ8A 1TJIH 3AS2A 3O2VH 2IWGA 4OZIB 4N8CL 4LEOA 2VOTA 4OCRL 2AEQH 4RMTA 3RVWC 4WW2A 4E42B 1WBXA 5F1OB 2NXYC 2R1WA 3BFOA 1QFHA 2AP2A 2FH6A 1KG0B 4LGPB 4P46A 1MFDL 4MA7H 4M93B 1Y6MR 4C83B 4DN4H 3Q1SH 5IHBA 3D39E 3Q6GH 1NEZA 4OZIE 6CGTA 4Z78B 3CIQA 2XRAH 1F4AA 4LNRB 4XMPL 2V2TA 4G3YH 4U3XA 5TE6H 1JF1A 1TTGA 5IIEA 4RA3A 1EHXA 4M7LH 2PR4H 3IJSA 3MOAL 2DQUL 4HK3J 2UY7A 4Y2OA 3BH8B 2CKNA 3VDAA 3M1BA 1F3DH 2HT4D 2JB6A 1RUMH 5A3ID 3DX9A 4X9FA 2I5YH 1G1YA 3DURA 3FFCB 1G1CA 5CP3A 5F7LB 5E99H 3IJHB 4Q6IA 1XGUB 4WEBL 4Z77B 5I2IB 1PY4A 1WLHA 3GIVA 3MBXL 2XNAB 4NO0B 4S1RL 4DVRH 2FR4B 3N0PB 4XPBL 3OKYA 1MAMH 1U8MA 2R2BB 3MRDB 3PIQA 4IHOB 3QIBC 1N59A 3HR6A 4XPGL 4AY0A 1FE8H 5ERWA 1YEIH 1C1EH 4PJGB 5DQ9A 5DRWA 3ZL4L 4IJ3B 2JELL 2XY1A 1HHJA 2WBWB 3KJ4C 4WV1A 5DVMA 3CMOL 4GS7B 2XA8H 1DSFL 4JDZA 1JNLH 5KSBF 3IFNH 5CEZH 5TQ2L 1PG7L 1B88A 5CFHA 4MB4A 4UV7L 1LO2L 2ESVE 4FQXC 5AG8A 3UC0L 2W9DL 1TJGL 5SV3A 5DXWA 1G6RA 2X42A 3HI5H 2CKBH 4F7TB 2OCFD 4X7FC 2VZUA 5CD5D 4PD4J 5DJZB 1FYTD 1ZLVK 4OIBA 5D7IB 3BW9A 4ETYA 4Y89A 4NNYA 3FQTB 1IAOA 4BQ6A 3L7FB 1FNHA 4UNUA 3ESUF 4TQEL 4YHOH 1B0GB 4N0FA 2NMSA 1HNFA 3X14A 1A5FH 1MCWM 3D1MC 1F00I 4YDVA 4FXGA 3I6LE 4TRPL 5I8KH 1TXKA 4JZNB 5JA8B 3CZFA 1A7BA 2YPLB 4NBXB 4RX4A 4AEIL 2BNRE 1DQQA 4E41A 4XNZB 1E28B 2P5WA 5J3HD 2Z91B 4KKBD 3HPLA 4OLVH 4QRRA 4WO4C 1LO0L 4OLXL 4DW2H 4KMLB 1E0OB 4JANA 2WQ8A 2NTSP 3H3KA 1F6AA 2C5DC 4HUUB 2OP4H 2IJ0C 4DN3L 1Q9LA 3VXMD 4K07A 1PX4A 3FQUB 1I3GL 5IFAH 4OZHF 4IJ3C 2A9MH 4G9FE 4H0HB 3BN9C 1LP9B 3WXVH 1CXHA 1S7XA 1MAJA 2EIBA 2MNUA 5IHUH 4JO4L 1JE6A 1T1YA 4Y16A 4HUKB 3O6KL 5E03A 3MMEA 2HVJB 2FSEB 4GKNA 4FABL 4KPHL 2WQRA 2B1HH 4G7YL 2WINA 2Q7YA 5C08A 1MCEA 3CLFL 3RTQC 2VLKB 3KGRA 4LLMA 4TTGA 3FB5B 3RU8L 3D0LB 5IP4A 1I1FA 5SWZA 3UO1L 4XGZB 2FEDC 4RGMC 2ZUUA 4F7CB 2AJZA 3U7YL 3OAZK 4U6HA 4UT6H 3UTSD 5ADOL 4Z8FL 1BGXH 2I9LB 2ZCLH 1JGVH 5SWQB 5D4QA 1ZHLB 1NGYA 3V5HB 3EDJA 5K9OA 3BPCA 2C4FT 1UXWA 2P8LA 3BZDA 1S7QB 2NY6C 1AKJD 4BELD 5I1IH 4ONHA 2HFFB 4F9PA 4R3SB 2X4RA 4N90D 3BISA 3MJ9L 3SE4A 2PTTA 4MD4B 4Y5VA 3QHFH 3SBWC 2VWEC 3NFNB 4PJCB 1HCFX 1WIPA 3O3BB 3TT3L 3TT1L 2X41A 3VWJB 1JNLL 1FO0L 5KOVC 5L9DL 1UZ6F 4HDIB 4WHYH 5ITFB 5IW1B 1DLHB 1TCRB 4TULL 4EUPA 2EDLA 4LASH 2JJTC 5DS8B 4MQ7A 4P2YA 4Z5RA 4KK6C 5E56A 3ZT5A 2AVGA 1AGBB 4XCEB 4JDZB 1A6PA 4P99A 1JCKA 4KROB 4ODXB 1VFAB 5HDLA 1XGTA 4QHNB 5DVOA 3H42H 1NQBA 5JXEA 2E7LC 5I1AB 4IHOA 1V3MA 3EFDL 2GSGA 2FHCA 2LTQB 3AY4A 4XP5L 4XBGA 2HLFD 3F7YA 5TGBB 1QNZH 2X7LA 5A40E 2JTDA 3D39B 4OLZL 2LAGB 1CF8H 3PHOA 5EBMB 3T1FB 3WFCH 4C83A 4N0YL 4OI9A 1EFQA 1F2XK 3KYAA 3BGAA 4ZQKB 1J1XL 2AK4A 3H8NA 3ZMRA 2UV3A 5I30L 5F72S 2J8UF 2BOBA 4RNRB 2JF1A 3BDXA 1UG9A 1N4XL 1RK0B 1YY8A 4NUJB 3B9KB 5CEYB 4ETQB 5C0GA 4NQCA 3TIDA 5C3LD 5I71B 3U9PH 5ISZE 3L3DB 1BLNA 1FH5L 3RTQD 4L8CA 2PO6B 2BSTB 4WENB 4LPYA 5IWLA 3W39A 1A6AB 4URTB 5IBTL 4ZNCD 3O6KH 1ORQB 2P24B 1PDKA 1TZIB 8CGTA 2HLAA 4MXVF 5I74C 4GOSA 1BFSA 3WNOA 1MJ7H 4R4ND 5MENB 4PRNB 4MB5A 1V7NL 3AU1A 3DRQA 2VISA 4O2EA 3PP4L 1I9IL 1MFDH 2X05A 4X6FA 4UINL 2VQ1B 1DUYB 3WFHA 3EO0A 4MJID 5CD3B 3IGAB 2PN5A 4UNTA 3KYMA 3OJDA 3QJHB 4G6JL 1K85A 1W72B 1DVFB 1FO0A 3QZWA 2A6JA 3T0EE 4P3CH 5T3ZH 4OV6F 3EYQC 5D7JC 5ANMA 3KLDA 1QNZL 4LMQI 4ODSL 4PJXA 5KS9A 4U0RC 2YK1L 3EYUL 4QHKI 4M6MH 2YN5A 5HHQA 1KJVA 4J8RA 3MUGB 4LOUD 3F58L 1A14H 4H1LB 2HT3C 4HX1B 3OR6A 4HKBA 1V8HA 4O4YH 4RISH 3KPMB 5IM7B 4QHLA 4XP1L 5ILTL 1P2CB 3C2AH 2R2BA 3D0VB 2B5IC 4MCZA 1R5IA 3KLHD 4PRPA 2XTJC 2HVJA 1AI1L 4NPYA 4P0DA 4Q6YA 5B39B 4YO0B 1A0QH 5JHDD 4APQC 4CADB 1CLOH 3BUTA 4YFLI 3RDTB 4Y4HA 4WW2F 3KJ6H 4P2RE 3WO4B 4OFKA 2ADFH 1GC1C 1RZJL 3R8QA 5E9DA 3S88L 3QH3A 5E70A 1LQSR 3DETC 1I4FA 3LV3A 3JZ7A 1JGUH 1EMTH 1HWHB 3B2VL 4LHUA 4NSKA 3S3SA 4MD5B 1YECH 2BDNH 3GKWL 2QKIB 4WIQA 3O3DA 3W5MA 3KNBB 1P6AB 3TYGL 1NC4B 3V5KB 4TUOA 4GG6F 3B8SA 4PLOB 1NANI 4O5LH 3ZKNC 4FXGB 3DPBA 3HKFA 4JY6A 2FGWL 3JTSA 4LSQL 2B39A 5HDQH 2FLRT 4IRJA 3OKNA 4PPTA 2QQNL 4EUPG 3RWHB 3W0WA 1NUNB 5HHQB 4K2UH 3MRCB 3RGVB 3MRBB 4MNGE 3VGGA 1UGNA 1DVFC 4PTUB 4PBXA 1NBZA 3NGBC 2BZDA 4RIRB 3VDBA 3NIGF 2G5BB 1TNMA 1FFPB 1HEZB 1T5XB 3VFUB 3FRPG 2FJHA 4J3OC 5EC2A 1OY3B 2ZNWA 3FB7A 4MXQC 1J0JA 1JVKA 4PRIA 3OAUH 3GJEA 4EQ2A 5FKPA 5IF0A 1KCSH 4UTBL 5F6HI 4JJ5B 4ONGL 4X4YB 1Z6JT 1RULL 3DX9B 3PP4H 3SDAB 1JHKL 1MPAH 3TA3A 2AJVH 4K3DL 1N8ZA 2GFBB 3L5IA 4YBQC 2UYLA 1VENA 3CH8A 2W9LA 5GSVB 1RJYB 3W9DA 5HHXL 2BRRL 3ARFB 3HUJE 3OR7B 4U1HA 2HLAB 4FXKA 4OQTL 3ILQD 4RWHA 2VQUA 4MA8H 1J87A 4TOYL 3AGVA 4PJBB 2GUOA 2QQLH 1A7RH 4M5ZL 4PP1C 1IKFL 5FUCC 1Q94B 3NCYP 2YS4A 3WS6A 5A2KH 4NHUB 5I16A 3ALWA 2R29H 3QFJB 4ZTOH 3UTTB 1VPOL 4EJ1C 4HEPG 5I1IL 4R90H 2GK2A 2OTUB 1I7TA 3MLXL 3R06B 4JQVA 4UQ2B 4JKPL 5MENE 3V4VL 2MQ3A 2VO5A 1H15A 3DXAA 4YR6B 3HNSL 4U1LB 1NC2D 3ULVF 4HV8B 4YXLH 4AEHL 3IDGB 3PWUB 2WBJD 3F7PC 4WHCA 5EO9B 3LDBB 2COQA 3GB7B 5CJQH 1KTLB 1DDHA 2E27H 4GXUM 2DQHL 2D2OA 4NN7C 3LEYH 4DEPC 1NLBL 4EI5D 5DUPH 5KN5A 3T8XA 3QHTC 3DUSB 4L8SB 5GS2H 4DKEH 3GHBL 5E4EC 2HTLD 3FN0H 5IK3B 3FTGA 1XEDA 3VDCA 2YMXH 1AE6L 1KGCD 3QDAA 3MV9D 1XGTB 2HTKC 3MNVA 2BMKA 1DEEA 4PY7B 3ARGD 4YNYB 3CXHK 2EDWA 4AM0A 4JFEE 1K6QL 4UT9H 5F7DA 3KPSA 2R2CA 4I3GA 3ZTNL 3DYPA 3NN8B 3HPLB 3CXHJ 4UBDD 5I9QC 1R5VA 2XYCA 3FQNB 1D9KD 1NAKH 5I75C 1AHWA 3QUMH 5ELIA 2ATPA 3LY6A 5FHAL 4JQXC 2R0WL 4HWBL 1T21B 2ZCLL 4EI5C 1A9BB 1NUGA 3RHWF 1AXTH 5IMKB 4M7KL 4L4VE 2A6IB 4L4VD 1RY7B 2E8YA 3BP4B 3RVXD 3MCLH 5FYLD 4XCCH 4WCYL 4O58L 2R9HC 4U1JB 5F7DB 3QEUA 4C58B 3IDMB 3ZDYE 1J05B 1F8TL 4ZFZA 3F6LA 5LQBH 2X4OA 1YEJH 1PYWB 4L8DA 1CYGA 3PQYD 1RZ8A 1WZMA 3BD3A 4PREA 4P5TB 2PXYA 3WSQL 2R69H 4N8CH 4PJAF 1YNTB 1JWMA 4KRPD 4PUBH 3W9EA 1CDCA 3ZHDA 4E5XB 3IDJB 3BKYH 3LD8C 4FG6C 4HWZA 4K23H 1G9ML 4MD5A 4XP4H 3BSZH 2WWKO 3MROB 4DZ8A 5KG9B 4F8TA 4Z7VB 1HI6A 5C3TA 1XF5B 4LHUG 4HJJL 1HSBB 1T5WA 1BF2A 2AJSL 4NDMA 2NY0B 2V5RA 1EEZB 5BZWB 2XZAH 1G7JB 1WT5C 3HE6D 4MXVE 5D7IF 5D7KE 3V5DA 4WNQB 4RA0C 3T3MF 1ROWA 3I02A 3RDTC 4M8QA 5E99L 4DEPB 5JUEL 1WBZB 4KKCC 1L7IL 3LN4A 4OJFL 1WZ1H 3KPPA 2P5EA 1R3HA 4WWKD 4ZOBA 2CLRA 1FZOB 1DBBL 2NY2B 3TM6A 4U1MA 1YY8B 4LVOB 4YJZL 2HN7A 4N68A 5CKAA 4ZPVB 3D25B 1U8IB 3CK0H 2R0KH 4NRXB 1LE9A 3ARTA 2E9WA 3NA9H 1A64A 2WWMD 4JZJA 2DQHH 3WFZA 3FQWA 1GVIA 4MAUL 4H0GA 4MDIB 1YN7B 1TTUA 5KVFH 3GMOA 2QQKH 3QIWD 4HX1A 1EO7A 1RUKL 4H88H 3WYRA 5KVGH 1ZLWH 4K3EL 1BWWA 4DGYL 3MLZL 1EGJH 3S35X 2YSSB 1MJ7L 4P2RB 3RP1A 3H9SE 4M5YL 4K8RC 2E27L 5IMMB 3VRIA 4OZIA 3BPLC 4G8IB 1CT8A 3IXAA 1W0WA 3ECBB 4L29B 8FABA 1OCWH 3LRGA 4R26L 4RGNE 2IBBA 4MXWH 4OZGF 3MLYH 2YMXL 3WFEL 3ARBA 2B7DT 3X13A 5L2KE 3O11B 5ETUB 4JHWH 4ZMAT 1OGTB 1K3ZA 4ZUTB 4F7MB 4MWFA 4KZDH 1KB5A 3U1SH 4ELKA 4DGIL 1LP9E 3PP3H 4N5UA 1NCWL 1P5UA 3KPQB 2GJ6E 1HILA 3UJTH 2XY2A 3ARWA 3C5ZC 4MZ2A 5FYJL 2DQTL 2NY6D 3GSNH 5EBLA 2QSCH 5I1DB 1UB6A 5D7JD 2R1YA 1BVKA 2F5AL 2BNQB 4JM4L 4G8GE 3LCYA 3TYFB 2IBZY 3QDMB 3T65A 3HS0B 1F3RB 1XH3B 4CVUA 3E8UL 3L5HA 3QISA 4LOUC 3ULUF 1NMBH 2Z31C 3WXVL 2WANA 3GJFK 1N6QH 1OSZA 3RNKB 2V2WB 4F15B 4TSCL 6FABL 3CLEL 2JLLA 5EU3B 4AMKH 2ZPKH 5D6DC 2CLVA 3L5WA 2GTWB 1KCSL 2EICA 4EIZC 1EJ6A 2JIXB 2Z31A 4FG6D 4PUBL 3BN9D 3N1GC 3CSGA 1AQKL 1RMFL 1II4E 3I50H 4X5WB 1QR1A 5GS0D 3LIZH 5GGSA 3QRGH 4X5XB 1J8KA 3BKJH 1S5IL 3MJ9A 3V6OA 2YD8A 5JXED 3UTZB 4HKBB 3IF1A 2VZTA 2VABB 3QWOA 1U6AL 5DJXA 1IEBA 2M26A 3IKCB 3MJ7B 3VGHA 2NY2D 4U1NA 3VG0L 3GUTB 4R8WH 4HKZB 4YHYC 1T66C 4K7PH 5LKNA 3IFPA 3TN0C 5TDNA 4QRRB 1F97A 3U2SB 4LEXH 4IMLA 4D0CB 4J2XA 4GG6B 4JKKA 1P53A 1S7SA 3PWNA 5FM8A 4PJ8B 4I3RH 1H3GA 1BEYL 1MI5B 3BJLA 2B1AH 3MV7D 4OBSA 3V6OE 2R0KL 4H0IA 1IAMA 1OB1A 3Q6FA 5GGRA 4JN1L 4HAFA 5JPMB 1ES0A 3BRFA 3UTQB 1IGFL 3GRWA 5FOBA 1HYRC 1K4CA 5DLMH 3DGGA 1D5IH 1M6OA 2AEQL 2RCSL 5ACZB 5CD5C 4EXKA 5C08E 1V7ML 3CSPA 1NCUA 3LKSB 5J9PB 3MXVH 1G0XA 2VDLH 3BEVB 1S7WA 3O8XB 2BSSA 2GIYA 3BO8A 5TQ0L 1T7VA 1J0IA 5SWQA 1XAUA 3MRJB 3I6GB 4ZAKD 3PL6B 4XNZC 2B8OT 1YEKH 1DUZA 1DEDA 1G7HB 1NC4A 3DUSA 5DEGB 4DOHB 5SWZB 1J0ZA 3TLRA 1QSEE 1U2CA 4EZMA 5D1ZD 1I9JL 4Y8AA 4NQVB 5ABDE 3IRPX 2VXSH 1MI5E 3I6KA 5C0EA 5JNYA 5KSAA 5FDYA 2VYRE 4XNQB 3VFPB 3FO9B 1S7UB 5FCUH 4HUWA 1AGFA 5CJXC 1V05A 1MCOH 1KJMB 4M62H 2GW5A