3LRGA

Structure of anti-huntingtin vl domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
114
Chain Sequence
SQPVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVLSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-huntingtin VL domain
publication title A Disulfide-Free Single-Domain V(L) Intrabody with Blocking Activity towards Huntingtin Reveals a Novel Mode of Epitope Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrgA00
1BF2A 1VADB 3LH2H 1AD0B 2O5YL 1Y0LB 5GGQL 2R1XA 1LEGA 3B2UD 3OKEA 3WJLC 1N5AB 1U93A 4KK5D 4PR5B 4ODSL 4NZTH 4HLZH 4CVWA 4FTVA 3FMGL 1AGCA 5HPMA 5MENA 1NFKA 1MWAL 3VRIB 2MQ3A 3WN5A 5L8KB 4U0QB 1MCWM 2YKLH 5IFAL 5JNYA 2NX5E 1MREH 1IVLA 3VH8G 1DR9A 2NY1B 1CLOH 2NY2B 3O6FD 2AJUL 1M6OA 4KJQC 1MCPH 1Z2KA 2X4SA 1HH6B 3DSNA 2D7OA 2DLTA 4G7VH 4P23A 4I0PC 3L6FB 4ONHB 3SJVE 2WBJC 2A9NL 5IK3B 4NKMB 2C7UA 1KJ3L 2VXTH 3GSXA 4N5EC 1C5CL 3MV8B 5DR5H 1JI2A 2FH8A 5GRJH 5AEAA 4NHUA 1GSMA 3KLHC 4HH9B 1T5WA 5GRZA 5JO5A 4KDVA 2PTUA 2H2SD 5F9DC 4ETYA 4C58B 4RNRA 2VC2H 3HRPA 2ED8A 3IJYA 5E8NB 2Q6WA 2LTQB 3FO2B 1CLOL 4I0PD 5DURD 3GM8A 3C5ZA 3IAGC 2VQ1B 2VTFA 1MCPL 3QP3A 4PRIB 1OSZA 4U0RB 2C1OB 2IAMC 4A6YH 1K3IA 3T0ED 1ZOXA 4WI5A 3O2DA 5DYOA 2JJSA 4EVNB 1DBBH 3GBMH 4LHUD 4HGWA 3UTSA 3P77B 2IFFH 4M7ZC 4B5EA 3P4LA 5DR5L 4AY0A 5J6GA 3IXTB 1CU4H 1HQ4A 1QBLL 5D7JB 4YC2C 3Q3GB 2DL2A 5MEPB 4JPVL 4LSRH 1M7DB 4E0RB 3PF2A 4HEPG 3LKOA 2FD6L 5C1MB 1QSZA 3REVA 2EZ0C 3JTTA 4MA7H 1YY8B 1DUYA 3OB0H 5E4EC 3S35H 3WFBL 5MEQB 4H0IA 2I9TA 3MR9B 5HBBA 3OJVC 4Q2ZB 4ODTH 2AK4A 2BNQE 1QR1A 2VAAA 1R5IB 4MAUL 3AS2A 3V6OE 4WUKL 5CIPH 1T1YA 4WFEE 1GH7A 4KDTA 5DD1H 5GS0H 5CEZD 1IAKB 4K9EC 4KI5F 4Y4KD 1OAUL 3K2UH 5B3JF 3WHE1 5D8JL 1VCAA 1DVFD 3VFPA 3VXME 1DBKH 5DJCA 1A7OH 1X44A 2YC1A 1IM9D 2E27H 1I7UA 3SDDB 3S3JA 1MJ8H 1ZGLM 5C0FB 1SEBB 2EZ0D 5I1GH 5LJYH 1V3JA 5IUSA 3KPSA 4LSQH 2Y6SD 3RI5F 3TP4A 1KJVA 3S36L 4KMLB 1S8DA 2ARJA 1BZ7B 2MKWA 4LNVA 5EG6C 5MHSD 3KWWB 3U30B 3BKJH 3KJ6H 3W0WE 2NR6D 4BZYA 3N85L 1XMWA 5CJOH 3TCLA 2VXSL 3QQ4A 2J4WH 5IMMB 1U8NA 2W0LA 4F7EA 5BV7H 5GS0L 3K0WA 1RZJL 3ZL4L 3TJHC 3TYFA 3O6MH 3HR5A 3NCFB 3O3BB 4XNYH 4JHAH 4U3XA 5JTWA 5ESQA 4ALAH 1K9TA 1IL1B 5HDQH 4TVPL 1B0RB 5C0BE 1EVTC 3GMNA 1QSVA 3SEPA 5EIIB 3LS4L 3RWEA 1G1YA 4NQEB 2ICEA 2W9DL 3MRGA 2VDLH 3O3AA 1EV2E 4QXUH 4Z76B 3OV6A 5B8CC 5CZVH 2BVPB 3MRDA 4XMLH 3NABH 3QWOA 4EQ2A 2F53E 5HI4D 5DLML 4NO5B 3CSBA 2L4OA 1A6WH 2CH8A 1WBYA 3SCMB 4WI3A 4UTAL 4U1KB 3REWB 2FHFA 5CJOL 3QO1B 3IU4H 4UT9H 1JGVL 3GSQA 2MPAL 4H0HB 1IM3A 5E2UL 3VD3A 3PGFL 3N1QC 5SV4A 4CMHB 1CGVA 4ZSOA 5EO0B 5T1KA 1DEEB 1JZ8A 1G9MC 2J88L 3OXSB 5HJ3A 1A1NA 5JW3L 3CK0L 1M7IA 1MCOL 4OZIB 5HDQL 2P49B 1HHJA 2VDNH 5I1IH 3EYSL 3KS0H 5HHOB 4OLVL 2IPKB 4XMKL 1NAKL 3G6AA 4MA3B 4NCC2 4NZRL 1FGVL 4MCZB 5SWQA 4KUCF 1A6WL 2I9LB 3CFDA 3ROLA 3TPKA 4GRLA 3VE0B 2MJWA 1HIML 2OL3A 3HPJA 3CMOL 4M1DL 3IU4L 3IYLW 4NSKB 1FFNB 4P46B 1NEZG 4N8VB 5IWLC 3L5XH 4R7DA 4XT1C 3OPZL 4OGXL 4PRDA 3ZYIA 1QBBA 2WV3A 4LQFH 3LRHA 4FQPA 4TN9A 5D96C 4HCRA 5FA4A 3TFKD 2OBGA 2PTTB 3D3VE 3HC3H 4ZG1A 3TO4A 4PP1C 2R1WA 4KV5F 3ZDZF 5GISH 3HMWH 2Q86B 1GGUA 1MAMH 1RQ5A 4ORGA 4PJFE 1RMFH 2AV7B 3LHPH 5HTSA 2DQJL 5FFLA 1CVRA 5EWIH 2CLZA 4L4TE 5JHLH 1YY9C 3L3KB 1XZ0A 1YYMH 3OSKA 4G6FB 1DUZA 2VDKL 3QDGA 5GGRY 3UBXG 3D9AL 3Q1SH 4UQ3B 4LSVH 2DD8L 4UMGA 3UPCA 1KUMA 5EZJA 2ZSVA 5SWSD 4LVNB 4X8XA 3OKNA 3KNBB 3PL6A 4HAGA 5IBTH 1LE5A 1KPRB 3L3OB 4MJIE 3VXRB 1J05B 3DARA 1X5KA 4MA8L 2FX7H 1A5FH 4GMTH 3UPAA 2V9RA 1X9QA 1P4BH 1P4LB 1URLA 4PP1D 5FGSA 3IDNB 5HHQA 2BNRD 1OD7A 4YAQA 3M17A 4LQFL 1LEKA 4YK4C 5T3XD 4Q9BA 5DJ6A 3RWHA 3T77B 4CMMA 4GFTB 5CSZA 4AZ8A 3QUML 3FRPA 1KPVB 5A2JH 3HMWL 4KZDL 3D1MC 4HFWA 3VWJA 5KN5B 4EOWH 4U1JB 3G5ZB 4MX7A 4Q6IB 4PJBB 4NHCH 5ISZD 5FDYA 1WISA 2XY1A 3NPSB 2ESVB 5KJRL 1YQVL 4DAGH 4HIJA 4OD2A 4NJ9L 1EVUA 1P53A 2GJZB 1PD6A 2YWZA 2QR0A 3PGDB 5D5ME 3O9WB 3STZB 4ZNEE 5ICZA 5DQDL 1INDH 1Z3GH 5F71A 3V5KA 5J7CC 4IMKA 4G5ZL 1I9RH 3QZWA 4K7PH 5CCKH 1NLBL 2FIKB 5I1AA 5IHLB 2YD1A 1G0XA 4QRRE 1TZIB 1WVZA 3GSVA 5I1DA 1MFEL 4XVUC 3DUSA 3OJMB 4PJ5D 3RZWA 1LNUA 3V0WH 4JPWL 4C59B 3B3IB 1GHFH 2EIZA 3STLB 1HH9A 3ARVA 4NFBA 5E2TH 1CXKA 5DZOA 5IM7B 5J1AB 5F97E 1BQHG 3FO9A 3IFNL 3F7VA 3OKEB 4U6VH 2V5YA 3L9RA 5EU3A 3BWUC 4X5XB 4DGVL 5HPMB 1UZ8A 3CH8A 2JCCF 3QCVH 3O81A 3MOAL 3WN5B 5IOPA 4OCSH 1I9RL 1C7TA 4XVUD 3VXSD 2G5BB 4GW1A 4AT6A 5FOBB 4P59H 2CKBH 5JHDA 2ITDA 4TVPE 5FUZL 3W5MA 1S9VB 1CDJA 4IJ3B 2YRLA 1IAIH 3QHFH 4JVUA 3PP4H 3ZYOA 3O2WH 4XPBH 1RZIB 5F96H 4D0DB 3S37X 2X4QB 1LO2L 5I66A 4PP2B 1FYTA 43CAB 1MRFL 3EOAA 1PX3A 1KELL 3MLZL 2X6MA 3LKPA 4UNVA 4KROC 3VGFA 4LLVA 1BIIB 3LDBB 2HVKA 5E2WH 4E41E 3MLPA 3HUJB 3MRNA 2R69L 4FS0A 3O4OC 4HS6B 1N3NB 1D5BB 3NCJL 1PJ9A 2PCPB 3HZVB 1S7VA 4OZFH 4XXDA 4PJEB 1FVEA 1GOGA 4JFQB 4FMKA 4LPWA 4C56D 3ZZ1A 3F7QA 3O8XD 4PJ7B 5TJWK 2Q7YA 4QHKJ 3PWVB 3CFJA 3C5ZB 4DVBA 1PGRB 2NXYB 3MLRH 3V7MA 7FABL 4NUGH 4FQLH 5T1DL 1W72A 3BW9B 4HIIB 4OLUH 3ZHKA 4I9WD 3U9UA 4KROD 1LO3H 1L7IL 4HGWB 5FUOH 3NMEA 3NIFF 2DQGL 5J6GB 2EIEA 5ACLA 4U7SA 3DBXB 2IPUK 1QRKA 1KLUA 1G0YR 5JQ6H 5EU7E 3BFOA 3ARYA 2DQDL 1I9JH 1NAMB 5D7SL 2VLJB 4PIRF 2OQJA 2NPLX 4QF1A 5E0QA 3HC4H 4P9HL 1S7XA 4ZUVB 2YD7A 4EI5B 3G6JB 1JHKH 1FO0B 1NCCH 4F57L 3S9DB 1FH5H 1HSAA 4OAWB 3MREB 1N0XL 2PNDA 4MYWB 1B2WL 3H7LA 2YPKA 1JGLL 3SKJL 1ZLSH 1KC5H 4F9PC 2XA3A 1FIGL 1JMZA 3U4BH 3T4YB 1LO3L 1PKQA 2D7QA 4NFCA 3HZMB 4OKVA 5JXAH 5DHYA 4I3GA 3NCBB 2C1PB 5DJCB 3BX7C 4Y4HC 5TF1L 1QOKA 1UH4A 3U82B 3FAWA 5K59F 1MCNA 5AUMB 3RDTD 1F4AA 4KKAD 4U3CA 1B0WA 2GSGB 3B8YA 4CDGC 2E8ZA 3EW3B 4N9GB 1JHKL 1CDGA 2BSTB 5HYJD 4X6CF 3FQTA 5FHBL 3WV0A 1KB5A 3QEUA 2H45A 3ARDC 3P4OA 5DRZA 4X6DF 5T3ZL 2R2CA 2ZPKL 3RA7L 4N5UA 1OHQA 4EDWL 5BZDB 2EDYA 4NKOA 3VXNB 4HWBA 4K9EH 4BUHA 1FN4A 1DSFH 1LVEA 3OB8A 5IG7B 4OV5A 5D70L 5ESQB 5CEZL 4JDTL 4L9LA 5IB1A 3KS0J 1KN4H 5SWZD 5DK0A 4U1IA 1PG7H 2I07A 4YQXL 1ZA6A 1KPUB 5HHVL 4IIQC 2FJGB 2H6PA 3NAAH 3FOMB 5C9KA 3L5WB 3V95A 3MRGB 1TZHA 2J1KA 1CICA 5BZWB 1T04B 3MRIB 5DTFA 4O9HL 1I75A 5DHVA 1MI5D 2IH1A 4X6BA 5I8KH 3ARDD 4LKCB 1JWSB 2VL5A 1DQTA 3QFJD 4CVXB 5C09E 2F5BH 1NGZB 1BFSA 4AH2A 4AL8L 1IM3B 1Q0YL 3B2VH 3FONA 3Q5YA 2AAVA 4YFDB 1PG7W 3UTTA 1P4IL 4TOYL 1I1FA 4HD9A 1ZHNB 3LEVL 3QXUA 2DJ4A 4HPOH 4ZSOB 3TIEA 3PNWA 1CF8L 5JQHC 2Y23A 1YEEL 3WMSA 12E8L 2V2WB 5HYSG 4WUUE 4P99A 5H2BA 1CD9B 2BX5A 1LDPL 5C6PB 1C12A 2I60L 5EBLB 3W9EA 3X3FH 1IARB 1YNTA 4L8BA 5F7DB 1UGNA 4X7TA 4JDVB 3BUTA 3BGFC 4NKIL 1CXLA 2QADB 4NO3B 3G6AB 1RU9H 4LCWA 1AE6H 2X05A 2JB6B 5D2LB 3JSSA 3KXFD 1JNHA 3PE9A 4JZJC 4E9LA 4FABH 3IFPB 1IGTA 2LE9A 1Y6NR 5IB3A 4ZTPH 1A9BA 1XF5A 1M05A 4ELKB 1BECA 1QQDA 3FB5A 3FQRB 1VB9A 1NGXB 1LE9B 4CL7A 2J6EL 3ZTJG 3QUXA 3HI1B 3TN0C 4H26A 1R3JA 2XT1B 5IB2B 2BMKA 1U8OA 3MRLA 1KBGH 4JO2H 4FFYH 3AB0C 4MD4B 1G9MH 2ZG1A 1RV6X 5I74B 2YSSA 1IGMH 2R1WB 3NCMA 4OCYL 2CK2A 4OM1L 2APBA 4UOW0 4XC1H 4ZOEA 4NN5B 5CD5D 4ORGB 4ZS7H 3MLYH 4X6CA 3WLBB 3EJJX 4PB0L 3PXJA 3VFWA 3T4AA 1NMAL 4CKVX 5FEBA 3K4DA 4X6DA 2QQLL 3EHBC 1LO0H 4LHUG 3WNPA 2E7LA 2EEDA 3F7PC 3NIGE 5CBEA 1UWEL 3VXQA 2Z93A 1EERB 3CXHJ 5D1QB 5F7EL 3SKMB 4FABL 5H37G 1I3GH 2YD8A 3IAPA 3OKNB 3WFEH 3TN0D 1X5YA 3G5XB 1FP5A 1KTLB 4BZ1H 3W2DH 5LWYL 5DEGA 4MNQE 4C55A 5DMGC 1P2CB 5KSBE 5KAQG 1MFCH 3EYFB 3GJFA 4NM4L 2V17H 3MXVL 5IGXL 4NQCB 1I85A 3CH1B 3RWHB 3C2AL 1G9NC 1OM3L 2EXYD 4KHXL 5LAXB 3IDXL 1VEOA 5J56B 2DM7A 1S9XB 4HFWB 4YHZH 1B4RA 3KPLB 2DQFB 4MX7B 2XN9A 3MRPB 4ODVH 3N50A 1RJYA 3VFTA 2XRAL 2RR3A 1UM6L 3MLXL 1NGPH 1UEYA 1U92A 3RHWF 5KSVA 4HX1B 1HILB 1RJZA 4RMVA 4PRPA 2YEZB 1YN6A 2BXZA 5ICZB 4GUPB 1I1YA 3VRLF 4UINL 1BAFL 1MELA 2C4XA 1KCLA 1XF4B 5I73C 3AGVA 1NANI 3K4ZA 25C8L 3T0EE 3UC0L 2A6KB 5I1DB 4X6FA 3MMEA 3ARGA 5GJSH 4ZAKC 4PRAB 2VRAA 3TA3C 5GS1A 3WFHB 1HCFX 1U91A 4YDVB 4YDLB 2OSLB 2ZCHL 4Y16B 2YPVH 2HRPL 4YHKL 4BQ6A 3KPQA 5M94B 5T3XL 2AABL 1JZ4A 3D2UA 1ZE3C 4YR6B 3WDIA 3CZFA 4OZHB 2VR4A 3N1MC 5T3ZE 2Z4QB 5KVEL 4GBXB 4PJ9B 4F37K 1IEBB 2B20A 4M6ML 5JA8B 3S96B 5ERWA 3QUZB 3BQUC 2NY7H 4JCLA 2IQAB 4K7FB 1LO5B 1MJUL 2F58L 4U1SB 1C7SA 2HFGH 5TE6H 5CEZE 4WWKA 2VXUH 3TA3D 1A02N 2XZQH 5IV2A 4Y1AA 4WI4A 4MMZC 1EGJL 1T2JA 1RZKC 4CW1B 1A6AB 3QXDA 5L2KD 1LD9B 1ACYH 4KQ3H 4MMXC 2OR7A 4B41A 5I66B 3GIVA 5E1AB 3D85A 3DOSA 5I1JL 1U3HC 1W0YT 4OV6F 5ALCL 3QEQD 1G6RL 4F58H 1CD1A 1Q9LB 2HVJA 4P2OD 2YRPA 5IB4B 2UV3A 1FZMA 1HWGB 3TIDA 5SV3A 1EO5A 3RVVD 3RGVA 1CXFA 3TBWA 4P48A 3WEXB 5GGTA 1FVEB 4PFEA 8CGTA 4QHMA 1KIPA 4PREA 3E3QE 4K71C 1EO7A 4HKXB 3SDCC 3O45A 4XRCB 5HY9A 4DEPB 3FN0H 3OKKB 4JFED 3CFJB 3ZE0E 4MLSA 2VB5A 1A6VL 4PLJC 4M02A 5JOFA 4YHLH 2GTZA 1TTUA 4ERSL 3MYJB 1U3HD 3PWNA 3EO9L 4KQ3L 4WHDA 3VFMA 4KUZL 3GHBL 3ESVF 2H1PL 4OFKA 1NC2B 1G9EA 3V79C 2R29L 5TFSL 1ACZA 1A3LH 1CFQB 4M7LT 4OQ1A 3UAJC 5DI8B 5IVZA 3MA9H 1A8JH 4LL9A 4LPVA 3SDCD 2OQJB 4ZXBA 2I5YL 5DVOA 2Y4SA 1S7XB 4TRPL 4PLJD 4LSPL 3QXWA 2QKIB 1HSAB 4NC0B 1RIHL 3NOIA 2QSCH 1CI5A 2ZUUA 2QLVB 2MTPA 4KMTL 2LU3A 2E6PA 3FO0H 2EYTA 3C5SA 2ITCB 1YMMB 2DQHL 1VACB 2G75A 2JCCB 4LSTL 4JZNA 4HFUL 1H5BB 3WD5H 4G8GD 3UAJD 5CHNA 2P45B 1KT2A 1F4WH 3B5HA 5F1IA 3GMQA 2D0GA 4HS8L 3V5DA 4CVUA 1ZGLA 3IDMA 3C08L 2DQUH 4XI5C 3FT4B 4NPYA 3CVHH 3ULUF 4FFZH 4W70A 3TVMC 5FF6A 4G43A 1YEJH 2QQKH 4TULH 2A0LD 1KLGA 3K7UA 4JO4L 3RUGE 2FJFB 5IEKA 2QSCL 2VN4A 3O4LD 3AS0A 1UXWA 3X17A 3I6LD 2H9GA 4PJHF 4DKEH 2WUBH 2X89A 1F6AA 1QSFB 3MLSL 1HHIA 1KTKE 1FN4B 3C8KB 1KCSL 3MYZA 5AWNH 5T5FL 3BH8A 1D7FA 3KPNA 1GGCH 4J4PC 1M4KA 5I1KL 3VWKB 1KJMA 4Z7UB 4XI5D 5DSCA 4KRPC 1Q38A 4U1IB 2YBRA 1C5DB 5MERA 4LPYA 3TVMD 1VERA 3U0TB 5SWSE 5L2JA 2Y25A 3HB3C 5ALBL 1Y6KR 1LP9E 2X9XA 3RVXD 3KPTA 1QUNA 4FQ2L 4U7MA 4EBQL 4FP8L 2XQYK 4EIGB 2WUCH 2XKNA 2FL5B 3CFCH 3MSPA 2JIXA 5C0RH 4KTEL 4Y5VA 3EO0B 3QXAB 1ZLVH 1FDLH 1JP5A 3T2OA 3WDJA 4ELMF 1OCWH 2ZCLH 2BNRE 1RUML 1HDMA 5T3XE 4U1LB 4DKEL 1MIMH 2XZAL 3ARBA 3NCYP 4BELD 5FHAL 1MHCA 1A0QL 4IS6A 2EEBA 4OQTL 3WLWC 2XTJB 3EOTL 4KRPD 1QSED 5ISZE 1FZKB 1XCTA 4WCYH 4UB0L 3IXAA 1C12B 3CFBA 3HB3D 4LRNL 5JIHA 1INEL 2BERA 3RKDD 1S5IH 4Y5YA 3GRWL 4ZFOA 3BWAB 1ZT1A 3BKCL 4HQQL 2MCPL 4RISL 2NW3A 3QAZB 4PB9H 5JR1H 4N0YH 4BUGA 1WK0A 4LSDA 4QRPB 1R24A 1SY6A 4P4KC 1OTSC 1M05B 3CNKA 1QQDB 5KG9A 1JZ6A 2MCG1 4QTHA 2M2DA 3RL1A 5DK3A 4WU7B 1G7JA 1MIML 4RAVB 2WWKO 5FK9B 3DXAB 4DKFL 5SX4H 3K74B 1EEQA 1U8OB 2VQTA 5C3LD 4HWZA 4YO0A 5TDNA 2JJVA 3O11A 1JPFA 3ECBB 2ILLA 4BH7B 5I17B 2OLDA 2QHLA 3QHZH 4G6FD 4WHYG 4X6CB 3MRHA 4OGYL 4XWOC 5EC2A 4YXHL 2W59A 3GMMB 4P4KD 5GSRB 3MOBL 1OTSD 3VXSE 1OAZH 2B0SL 3ZE2E 5CBEB 3QIWD 2VLRD 4PTUB 1FG2A 2KUTA 2GSIB 5IBLD 1I3RB 5KW9H 2WWKT 4ENEC 2ZUTA 4YZFE 4JFFA 5T1LD 4M00A 4V2BA 3F7YB 1TJGH 2GTWA 3VXUB 5DEGB 5ITBL 4GW5B 4M8QB 4YDIH 1H8SA 5EU6B 4O2EA 1ZSDA 3LKNA 1UEMA 1AJ7L 3BMWA 4ODWB 5D6CA 3RPIB 2KQNA 3DSFH 4HS3A 1T22A 5LBSH 4AM0A 3DIFB 4NZUH 2GJ6A 5F3BA 4KPHH 3PIQB 5BS0A 2CPCA 3QQ9C 35C8L 3E2HB 4MJ6B 4X7FC 4G6JL 5E70A 1BVLA 3U36A 4ELMA 1VGKA 3MCKA 4KVCL 4LHJB 4JGUA 1J87A 1GZQB 3RY6C 1WAAE 1TXKA 4HKJA 4JANB 3FB6B 4MQSB 4XH2B 5C7XH 2DM4A 4LPTA 5JW5A 1IILE 2F74A 3AREC 1S78D 2OJEA 3BPLC 1OT1A 2PO6B 3EZ8A 3WDHA 1EO8H 4ODHH 4DFHA 2YUWA 3ESUF 3A6CH 3UJTL 3GEWB 5KSVB 2YD3A 3BAEL 3OAZK 5ANMA 2A6IA 2NNAA 1HZHH 4XPGH 5F3HB 5FB8B 2FDBP 3DVIA 4APQC 2YMXH 1OAXH 1RFDL 4HDIA 3EUUA 3MMEB 4RGNC 1PVHA 4YDIL 4UAOC 3T2NH 4WHTB 1U8IA 3WL9B 1RIVH 4BSWA 2VSCA 1RK1A 4R4BB 3L7EB 3QQ9D 2BSSA 4NC1C 1NCAL 4M1GL 4PGCB 5E7FA 4P23C 4XP4H 4JFXA 4Y4FA 2R8SL 4PD4J 3L3GA 5DVNA 5KS9F 1G9NH 3QRGH 1PY4A 1MHHA 2DWEB 4K8RC 1EJ6A 5ITFA 3D2UB 4FTVD 4Z7WE 5C7XL 5MEND 2VUOA 5C0JA 4GAJH 3GSOA 3IDGA 3HMXH 2X9WA 3JUYA 1OARH 3ZE1F 4O58L 4FXGA 1E4KA 3VGGA 4NRZA 4KTDH 1EZVX 4HGKC 3QG7L 1AGDB 1CTOA 1ZMYA 1TZGH 4CRPA 2RBLA 1QBML 4JDZB 1MNUL 1QYGH 1W2KT 2PW2B 4WWKB 4Z6AT 3BO8B 1JNLH 5IV2B 4P23D 5JXEA 3Q6GH 4GG6E 3MX0A 4H88H 5C0CA 4XCFH 5CKAA 1H0DB 3QI9A 2DLIA 5HHXL 4LCYB 4XP4L 1EX0A 5C0IA 2JJTA 2X4RB 1TJIL 1A7NH 4JPIB 3ZHDA 1A4KB 1AGEA 1PBYA 3H0TB 2DQIL 3C60A 3D85B 4UNUA 2IANA 3CSYB 1UB6B 3F7RA 4KAQH 4D94A 3RFZC 1OQOA 4Q6YA 2XOTA 1T6WA 3TZVB 5ID1B 1VHPA 4NN7B 1JPTH 1WFUA 1AHWC 1MLBA 2OJZL 2YD6A 4MHHG 5FYKD 5JORB 2DM3A 3MJ8A 5IQ7H 2GW5A 1NCUA 4V1DE 4JRYB 1E28A 4F7CB 1I8MB 4QHMB 2PXYB 4L3EB 1TZGL 3S5LG 4G8FB 5DD3H 2AQ2A 4LLDB 3C5ZD 2DIBA 1EXUA 4X9GA 2HFFB 3O45B 5DS8A 4HKZA 1JNLL 4AIZA 1T0NA 1CGXA 1OTUD 1I7ZB 2F54E 3ZDYF 3HPLA 3UTSD 2A2QT 1RZKH 4QHNB 2APXA 4HIHA 5SWZE 5DDHB 1QEWB 5FXCH 3VFMB 3OGCA 4F7PA 3PWPE 3OKDA 3RTQA 4KAQL 3LS5H 1U8QB 4GOSA 2EYSA 1MI5E 3RZCB 5JZ7C 1JPST 1U8JA 3BI9X 5IW6A 5T1MA 4HGMA 2NXZC 1WBZA 3QFJE 3BESR 1WCBA 2XFXA 1MRCL 1CL7H 3VFGL 2BHYA 4UNTA 4JFDB 2AK4D 3VJ6B 3QNXA 3H42H 4UBDC 4R6UA 5IIEA 1BBDH 3JWOL 1FAKT 4S1RH 1CCZA 4P2RB 3FFCA 4MNHA 4F8TA 4MCYA 1FVDB 5FGCE 3TPUB 3LZFL 4RFOH 3U2SB 3B83A 4NT6A 3TBVA 2ZUQB 3MJ7B 4R4ND 3C5SB 4XP5L 2E7HA 1CIUA 4A6YA 4KJPD 3ARXA 4ONFL 4K3EH 5JZ7D 2BVOB 2ATKB 1RI8A 1KT2B 4DVRH 3GMQB 4PRHB 4XVJL 3KPSD 5HYQA 1ONQB 1NUNB 1FBIH 2B1HH 2VXQL 1NBYB 2WIIA 3KXFE 4XNMB 4YGVB 3V5DB 1DTUA 1N6UA 2PN5A 4F15C 3IDMB 1Q94B 2A1WH 4UBDD 1T4KA 3PWLA 1HINL 3BE1L 5GGVY 4ETQB 1IEAB 5F7NC 5IMKB 1VFBB 2K7PA 4M93B 1KCVL 1ORSA 3RBGA 5C08E 3SGKC 3MRQB 2LVEA 3SKUD 4LSSL 3VI4E 2V7HB 2H9GB 3MCLH 5IJKA 4N0FB 1BFVH 4HIEA 2HN7A 4KK8C 5I1CL 1L0QA 1MJJA 1Q0XH 3FRUB 3IDIB 4M6AA 1WZ1H 4P2QE 2A6DA 1FRGH 3L3JA 4Z7OF 2XWBA 5DRNA 4XP1L 1FPTH 5E6IA 1JGEA 1RIUH 1U6AL 4I48A 4QOKA 1KJMB 3FZUC 1QFWM 2H32H 4S1DC 5MERB 1JIBA 2D31A 1CFSB 4CADB 4JQIH 4OBSA 5KSAA 1YEHL 2EDRA 1DLHB 2YPLB 3QDMA 3TBTA 2XICA 5FM4A 3RIAK 4YXLL 1Q9OB 3GSUB 1FZJB 3LD8B 3HFML 4TQEL 2XKNB 4KI5C 2IWGA 2JIXB 3CU7A 5IB5B 4Y5VB 3IKKA 1EPFA 4WU5B 2DJSA 3VGAC 5D1ZB 4E42A 4GRLC 5D71L 3MCLL 4YX2L 4I4WB 2HKHH 2Z31C 1J5OH 3FQUB 5T1KD 5FO7A 1A1OA 2N1KA 3I9GL 3SGJA 2BY1A 4MNGA 4ZQKA 2XY2A 4N0CC 3GI8L 4JO1H 1KIQB 1PSKH 1JI1A 4NNPL 4XNUL 4HJ0D 4HV8B 3OAYK 3FZUD 3TM6A 3VG0L 3VA6A 2DQCL 3RNQA 1XCTB 4JFPA 3TO4C 1RIUL 4DGYH 1ZA3A 5C8JB 5D7LA 4KJWC 4WEBL 3C6LA 4RMSA 5F9WC 1KYOJ 1D5ZA 5DVKA 3WXVH 4LNRA 4KI5D 3T8XA 1NBZB 4XNQB 4MZ3A 4NKDA 3IJSA 1BBJA 4OCWL 5TQ2L 3MRJB 4GRLD 4ZD3H 3AXLB 1R24B 1SMOA 5I76B 4PJIF 1CFTB 2NY6B 3O41B 4Y2OA 3WUWG 2IALA 5CSBA 5KVGL 3WS6A 3PL6C 5GS2H 4Y2DA 5AD0A 4N0CD 3FL7A 4NYLA 5AAMA 5HI5C 3LY6A 5HHMB 1DBMH 1X5FA 3VH8B 1G7JB 2OS7A 4M5YL 1KNOA 2W0FB 4RZCB 4PJGF 3P9LB 3TO4D 5T5NG 5A3ID 2Z92B 4KJWD 3V4VH 2VOTA 2Z8WC 3LIZH 2HJFB 1JPFB 1V3MA 1A7PH 5BO1H 4AJ0A 3FTGA 3PDGA 3BVNA 5E03A 5I6XC 3VWJC 3MBEA 4XGZB 3QDGD 1G7HA 4KKBC 4M6OL 4PJHB 1FNGA 4G3YH 1UVQA 2VDOH 3LQMA 1S7SB 3BZFB 3PL6D 1J8HB 4KQ4H 4R96A 1MCJA 1FG2B 5FGBA 4ZD3L 2DRUA 3SQOH 4PV9A 4W4OA 2A9ML 4ODXA 1F3JA 3P4NB 3B5TA 3VXMB 1DBAL 2ICCA 3QPQC 4JFFB 2YK1H 3D0LA 3O3DB 2Y5TA 1DQDH 4IMKC 1WEJH 3QNYA 1ND0A 1YQ2A 5L2KE 3KDMA 3S6CA 3MV8E 4BFIA 2BHUA 5E2JA 4NBZB 1DBJH 4P2CG 4PLKC 4A2MA 1WZLA 4O2EB 3CXDL 1J1PL 1TVBB 4ISVB 2XNAA 3VWJD 4HS3B 3H3PH 4JY4B 5C0AA 1V5JA 1S7UA 15C8H 1IC5H 4F33A 2X4NA 1NDGA 4PGBB 1XH3B 3OKMA 5CS7A 4MXQC 4P5MB 4P9MH 5I30H 4L8SB 5F8RC 2ZSWB 4EIZC 4HKJB 1FORL 1NCWL 4R0LB 2VITA 4OFIA 3QPQD 1EFXA 1VFAB 3JV5A 1OGTA 1EEYA 2ARWA 2IPTL 4NWUL 4XXCA 1FCCA 3RWFB 2AEPH 2GI7A 1B0GB 5DWUL 1P5UA 3EYVA 1WEJL 4PBVC 1AP2B 4PJAA 3V5HA 2NQCA 2JELL 5C0BB 4OFDA 3W11D 1R3HA 4HDIB 5IEHB 4M9PA 2J3SA 3HAEG 2RFXB 4JKPL 1TLKA 2OMNA 2XA8L 4OF5A 1T03L 1FJ1A 4HF5L 3WE6B 2ZUWA 2EDQA 4MXQD 2ZOKB 4TUKL 4XC3L 5DUBA 2C26A 2FO1A 4PJIA 1JK8A 4O5LH 3LRSA 3DURA 5ITFB 5CEXB 3OHXA 2P5EA 4L29B 1OB1A 3IF1A 3RNKA 5C0JB 5TDPB 2F19H 3IDGB 1RZFH 4ZUWB 4GG8B 4PJGA 3ARPA 2HT2C 2X1QA 2ZNWA 3RBSA 2FO4B 2CK0L 2AJXL 1MWAB 3BXNA 5JW4R 5JHDD 2DI9A 3X14A 3GIZH 4OD1H 3GKWH 1P7KA 4AMKH 4RDQG 3UJIH 1MCFA 3ZT6A 4I3RL 1T0MA 3HE6A 1FYTD 3RL2A 1A64A 4JFOA 3MLWL 5DJ0A 5LQBL 3IVKA 4EN3B 4WI2A 4OFYA 1KOAA 3LPWA 4K8RH 3NTCH 2AKRA 4U6YB 1VFOA 2IH3B 3LQAL 2F19L 3ARFA 1K85A 1J7VR 1RZFL 3NN8A 3QIUB 1KCUH 1P1ZA 3VFOA 1MLBB 1NLDH 3BPCB 1RUQH 5C71A 1A2YB 4MXWH 2W92A 3V0VA 2BOBA 4MWFA 5FYLH 1DQQA 3I6LE 3B9EA 3U7WH 1P9MA 1XGYH 4DZBB 4I77H 5GGVL 1EJOH 1NQBA 1R3IH 1R5WA 5H35A 5FYKH 4HKZB 4QNPF 4PJFB 3BHBB 4LLQA 2AXJA 3RWCB 1T0NB 4OF6A 2GJJA 4N8VG 4L4TB 1MF2L 1WWAX 4NQEE 1FZOB 4JKWA 1MH5B 4NQXA 1ZT4A 2H2PC 2RB8A 4PJ8A 4ZFGL 2P4AB 4DK3A 3WJJA 5IR1B 3U0WH 3MUHL 4MJIB 4QRSA 1A6ZA 1I4FB 1BFOB 1A1MA 1FC1A 4PJCF 1T7YA 5T1MB 4U33A 4G6KH 3WJLA 1CDBA 4UT7H 3IFOB 2XFXB 5MP6L 5T33L 3QJFA 4ZDHA 3L95B 5CEYA 4OZFA 1WBXB 5ESAA 4U2YA 1F02I 3U4AA 3QUYC 1P69B 4TSCH 3RQ3A 1IGCH 2DLFL 5KS9B 3O3UN 1R3IL 3I84A 4Z8FH 4MLIA 5C0GA 3FFCB 2YHGA 1X7QA 3BOVA 1TMCB 1NEZB 1QSEE 1JHLL 5HHOE 1D6EB 2YOCA 4UDUA 3WSQH 5L0QB 5FDWA 2JB5H 4Z7QF 5DO2C 3WHE0 3TESA 2APVA 1JMXA 2W38A 2XXMB 5EZOH 3O2DL 3E6HA 3SY0A 4XB7A 3IU3A 2WBJA 3MJ9A 5FO9B 5K9QG 3B9KC 3BUYA 1LK2B 1K3ZA 4X4YA 5F6HI 4QRRB 1QA9A 1XGQA 3VD9A 3X11B 3BKML 4X8JA 5GQBA 1AXSA 3KLSA 4MJ5A 1K5NB 2FHCA 3UBXB 1HKLH 4UU9A 3X3GL 1CICC 1ORQB 5DJXA 1R0AH 1C5BH 4NQSB 3IDYB 1MLCA 4GT7A 3S98A 1ORSB 4N8CL 4P3CH 3MROA 1CXHA 3SKOB 4JG1H 4K3DL 4ZUTA 1PEWA 4UUJA 1T20B 1UJ3C 2EYRA 5DO2D 3VFUA 5CIPB 3MO1B 4JE4B 3WIHL 3HHRB 1GGTA 1BVKA 4U1MA 2JB5L 4DUWA 4OJFL 3CLEL 2IAMA 5EZOL 3ETBF 4I48B 2VLRE 3IS0X 5L7XH 1CICD 3HG1A 5D1XC 3F12A 4O2CA 5DJAA 1N5YL 4DUVA 1QRNB 4XTRC 4LLWB 5TE7H 4NO0B 2BHZA 4GKSB 3KYAA 3UTZB 1D9KC 2J8UA 1MCCA 3LV3A 5F6IC 3UTTD 3PGCA 2BJMH 3U46B 1EUTA 4RIRB 2Z0BA 4YBHA 1CLZH 1A1OB 4PJCA 5BV7B 4OCMC 3QUXC 4MNGB 4NJAH 4YHIB 3CC5B 4D8PB 5K93A 1IZKA 5EPMB 3KLAA 3MNWA 1JYVA 4O4YH 5TH2B 4JRXA 3CAFA 4RAUB 4HMEA 3GMOA 5I8EB 4YHML 4LCUB 4QXTA 3CFKB 5HDBF 1ZA3B 3FKUS 3MPCA 5ECJE 5E4IA 5DZLA 4XTRD 1KN2H 4JFZL 4LCWD 2B7DT 4CU8A 1D5ZB 5GZNC 5D2NA 3HZKB 4JY5H 4WEUD 4IOIB 2EDJA 3U48A 4Q97A 2Z35A 1VEMA 4KTYA 3EIFA 2IALB 5DRWA 2JJUA 4J6RL 3QUXD 3VDCA 4NQUA 3LSOB 5LGHH 3QA3A 3MV9A 5IMLA 2MFNA 4F8QA 3GSNA 4TNVK 3MJ6A 2OL3H 1GC1L 4YNYB 3ULSB 1AIFA 4IMLB 3DYOA 2DDQL 3D25B 1V3LA 3RWIB 2D9CA 4KKCD 5B21A 2W65B 2FGWH 1AXIB 2FEDD 2RCSH 2BCKB 1LILA 5MENE 3F65A 4TSAL 2O5ZL 4P4RA 3ULVC 2W9EL 2BVUA 4NWTL 2R23A 5FCSH 3QWRA 1QO3A 3UJJH 4KHTH 3DO7B 1SYSB 2NY1C 3L5HA 1UVQB 3S37H 4NZDA 1CGSL 5KSUB 3BP7A 4R96B 5KTEL 5B8CA 1FLRL 1FV1B 2MHAB 2W91A 1IQDA 4OKDA 3LMJL 1JGDA 1NFIA 4FQJL 5GZOD 3ARGC 2IBZX 4OGAC 2OZ4A 1E6OH 3ULVD 1JTPA 5GS1C 3OAUH 5E5UB 1FNEA 1T1XA 1HXMB 1Z5LA 5MI0B 2ORBL 2XN9D 5CJQH 5J1TC 5GRVK 4HCRL 1JN6A 5L9DL 1JRHL 3QUMB 4OD3H 4PJEE 5DMIL 5E8EB 3MNVA 4LOUC 3CVIH 2BSRA 4KHTL 2N7AA 1D6VH 4DKAA 1LEIB 2DL9A 4IRJA 4IDJH 4L3CB 2NY4B 4PRPD 3VD4A 2CGRH 1VESA 1EEYB 1OGAB 1A4JB 5A16B 2VZ1A 3INUH 4QRUA 2XPGA 3GI9H 4M6NH 3R1GH 4TTDC 1VGEL 3EYVB 3BDBA 3QFDA 2HG5B 3ARGD 2BC4B 1F4XH 1TITA 5D7JC 3FT3B 2GKIA 2OI9B 5MEOB 3D39A 4LASL 1T1ZA 1FNAA 3PHQA 5F7HA 3G04B 4K94L 1H3UA 3U79A 1FJ1B 4JFYA 2B39A 1S7RA 3KPOB 2EH7L 5F89B 4LGRB 1IKFL 3D2UD 1U3ZA 4WO4B 1XT5A 3JTSA 1CK0H 3G6JE 3QH3B 4HJJL 2XKUA 2JK5A 3VCLA 1JWUB 1K4CA 1HNGA 1YEFH 2AK4E 1RK0B 1KV3A 2VDPH 2OXHA 1RZ8A 4WWKD 1U8PB 1AD9A 4WUUB 1EHAA 4Y1AD 4HUUB 4G8EB 3NFPA 4XNXH 1MFNA 4GKOA 4HWEH 4RBPK 5GS3A 3SDDC 5IROC 1YEKH 3QPXL 3X13B 5I15L 3T0DA 4H8WC 4LMQE 5IVXA 3I2CL 4BQ8A 1GGIH 1GPOL 3EJYC 3D85D 2GFBB 3QWQB 3S88H 3U0PA 4LAQL 5GGSA 4W4NA 3ZKMC 1DFBH 1DLFH 3U30C 3RGVD 1ZS8B 3TH3T 5ACMA 5HGHA 2ERJB 1TETH 4NQDA 4CJ1A 3VFOB 5TQ0H 1FL5B 1DQML 2FX8H 4LARL 3SOBL 1DL7L 1MFBL 1U0QA 2APFA 2LFGA 3TYGH 3FFDB 3U1SL 1MJ7H 3EJYD 3DVFA 4R26L 5DRXA 1YDPA 2CKBB 1JWMA 1UQSB 4B7IA 1FFOA 4LF3A 4HBCH 2EDWA 4ZFFB 3K8MA 5FCUH 1SBBA 3LN5A 4JY6A 4JAMB 5IHBA 3ZKMD 5HHNA 4NNXA 3QEHB 3RVTC 1M71B 4XPTL 1W72H 5D7IF 4HK0A 2PR4H 3T09A 5EOTA 7CGTA 4HZLA 3QCTH 2A83B 1DFBL 3O6FB 1KXVC 2Y5EA 5HGAA 2NMSA 1U58A 1LQSR 4GKZB 1CD8A 3NFSL 4IDLA 4DGIL 4XCNA 4X80L 4ZXBD 1CQYA 1LWRA 2R1YA 5F9OH 1TETL 2Y06H 2DF3A 5I18L 3TJEH 2BK8A 3VFRA 1G0DA 4ZDHB 5HSFA 4G7YL 2VABB 3QCUL 4MXVF 1WC7B 4ZSOE 4UILH 5E99H 2OYPA 3FT2B 3U7YL 2NX5A 2FR4B 5DD5L 3RAJL 3HZYA 4ZTOL 4QLRA 2CJUH 5HYFA 4ZFZA 3NZHH 5L88L 5GHWH 1N64H 3MLTA 2ENSA 5HPOA 4QHLB 3SJVA 2ICWA 4I0PB 3GZKA 5DURB 5B3JE 4R97B 4WW1A 1T66C 3BZDA 5EUKA 1AC0A 3FRPG 1BX2B 2X4UB 1U3YA 4RRPA 4X8JB 1ZVSA 3TJEL 1XR8A 5I8OL 1GAFL 1C08A 2CDEB 5IBUB 2ZUYA 1NANH 1RUAH 4J3UA 1A7RL 3M1BA 5K9JL 5F7UA 4Y88A 1XF3A 1KCKA 2XWTA 1JZ5A 2X89D 4YJZL 2VDML 3P73B 5IFHL 4XAWH 2J2ZA 3GJEB 3QZWG 4PRBA 4ZUTB 1MY5A 1ZHKB 3BT2H 1KB5H 2XQBH 3JWNC 5KVFH 3ARBC 1T66D 2A6JA 2ADGA 4U1MB 3QDGE 3V4UH 4KKNA 1BMGA 4HWBH 3SKNA 4NP4L 2X2YA 4XPFL 2VE6B 4WFGE 3NZ8A 5HYIA 4X4ZA 4M7ZB 3UDWA 4Y4KB 1KJ2A 4XAKD 4Y5YC 3VXOB 3KPRA 1DN0A 1JNNH 4QXGH 3MCG1 4YC2B 2G2RB 3FB8A 4N90D 1X3DA 2JIXD 4RMQA 5JUEL 4ONOA 1IM9B 1MFDL 4GRMA 1S7TB 3V6FB 5D7IA 5BVJA 3MLVH 2UVFA 1UCBH 4C4KO 2HWZL 4HT1L 3FHQA 3OXRB 3ARBD 5E5RB 4Z95H 4XAWL 5HHPB 4Q6IC 2BNQA 5AZ2L 4PJCB 4DFIA 4KU1A 3NPSC 3BP4B 4FZ8L 3QUKB 2HA1A 4F9PA 5HYJA 1A6UH 2A77L 1Z9OA 2R0WL 1BOGA 4ZUSB 5FECA 4JB9H 3DUUA 1N8ZA 1FAIH 3GO1L 6FABL 4WIQA 4DWHA 3SN6N 1QVOB 5I16A 4ZNCD 4Y4HA 1HHKA 3CSPA 3QDJA 3EOYG 5IT2H 3GMRB 1X4YA 5DJ8A 2HFTA 3DNKA 4C4KT 3HA0A 1AGBB 3VGEA 1I1AA 1BLNA 1OAYH 1CYGA 3BP5A 4ZOCA 2Z35B 2AJZB 2ZJSL 1PW3A 5HHMD 5EULV 2I27N 1YEGL 4UT6L 2BXYA 2VWEC 3I50H 3CPLA 1BP3B 2K7QA 4XPHL 5J12C 4U1NA 3W82A 3W0WA 1D5XA 1GGBH 2VISB 3RIFK 3ULUD 5B38A 3QQNA 5F88B 1SM3H 5DXWA 1ETZA 5BOPA 1J0IA 1IGFL 3P30L 4RFEA 4I1NB 2AI0L 5KVDH 4G80B 1JCKA 3K1DA 3LKQA 3F5WA 2OP4H 4LVOB 4QEGA 1S9WA 5IQ9B 3OJDA 3EO1A 5EN2B 1CD0A 3ZDZE 1QNZL 4NO2A 3C2SA 1N26A 5JHDE 5GIRB 4IIQA 2DQTL 5HGDB 4JFFD 3DVNA 4LBEA 4BFGA 3DJ9A 1E27B 1AGFB 1UM5L 5CWSA 2DLGA 2CIKA 4AIXA 4HMDA 4Q9QH 2F53A 5DUMH 3X12A 3IKCB 4I0CC 5DEFA 3VFSA 4MVBC 5E8DL 1GGBL 2H26A 5F7WC 2P48B 1YJDL 3FQNA 1NJ9B 1T83C 4XVTL 2GJ6D 1E4WH 3I6GA 5BS0D 2FX9L 1U8MA 4RQQA 1A7QL 4Y4FC 3ZYJA 1ZWIA 2HRLA 3DTXA 1YPZF 1RVFL 3PDDA 1HQRA 3RUGB 3OZ9L 1CR9H 2FATH 4NGHL 1BM3H 3EYOB 3ULVH 2HT4C 5IP4A 1ZANH 4OFVA 1MAJA 3MRBA 2NXYC 4UV4L 3HI5L 3OR7B 1E4KC 2V9QA 4MVBD 2YRZA 4ZUUA 2HLAA 2XPGB 5EO9A 2GITB 2G60H 3BIKB 5D9SA 4JZJA 1LK3H 3OJ2C 3CUPA 1F2XK 4P3WA 3NACH 1KFAH 4M7LH 1SBSL 4ODUA 3D39B 4NOFA 5JXEC 1MUJB 2DTMH 4Y4FD 5SWSB 1MIEL 3WIFB 1CDYA 3TN0A 3U4EB 2V2TB 1HSBA 5FUCE 2JJTC 3D3VA 4EI5C 3DYMA 4PV8B 4LEXH 1NBQA 2BNRB 3R0MA 1Q9KB 2Y72A 2Q8AL 1K4CB 2H3NA 3L7FA 1DANT 4U7KA 3GM0A 4MD0B 1Q9WA 2YWYA 1WZMA 1RZ8B 3VU2A 1U8LB 3T0WA 1YMME 4MSWA 2JCCE 4M7KL 1QFWI 1PKQE 1F90L 4OSUH 5JXED 4JO3L 1FVCB 5D7KE 3WFCL 4HBQA 4XZUA 5C0CD 1ZHLA 3QI9D 4HXAH 4U1HA 2AXFA 1OTTC 2DTML 1FL6A 3RVWC 1QHPA 2HYMA 4UDTB 2NY5C 5E8PB 2WLZA 2NY3D 2MOVA 3C60D 2IAND 1YYLL 5E08L 3MZGB 2XWJA 4PJ5B 4LU5H 1W8OA 3RTQC 5BJTA 4LCIH 1AO7A 4JPKH 5E9DA 5EOQL 4WV1B 2HP4A 1G6RB 3P4MA 1U8KB 4EI6A 3LKSA 4MD5B 4HULB 1A3RL 1TVHB 5LCVL 3HRZA 4QHUA 3N9GH 1XGPA 4GMSH 2ZUVA 4ZNEA 1QSFE 4YUEL 3P0YL 1IC4L 4MS8C 5GGTH 1A6TA 2MKLC 3EGSB 1KIRA 1YPZA 3RVWD 3SE9L 5IMOB 2NW2B 1CFVH 3C8HA 3PXHA 1JV5B 5D6DC 1S3KH 1MHPL 4J3OC 3QG6A 1OPGL 4YE4H 1AXTH 3VXSB 4H8WH 4MQ7A 3PDOA 2N56A 3W5NA 3ZKXC 3RTQD 4ZAKA 1ROWA 5I1EH 3KYKH 4YWGH 1HCVA 4LSUH 4RAHA 1U58B 3HCVB 4DCQB 3U7AA 3ZKND 4LLYA 1N7ML 3EYUL 1UA6L 5E8OB 1CBVH 1DQJA 2R4SH 3NIFE 3N1FC 4PRNA 3Q6FA 2R1YB 3OG6B 3WXWL 3MRRB 1J0JA 5KANG 4B0MM 4BKLA 1NMBH 5EUOF 3UTQA 3QEGH 5FYKU 3VFRB 1T1WA 1SQ2N 3D0VB 3OAZH 3AUVA 3DROA 3G5VA 3QEQA 3UTTE 4LCCB 4N1HB 2D4DA 3FFCD 2XTJE 3BQUA 4JQVA 3CLFH 1GIGH 3ET9F 1CFVL 1GRWA 1TQBC 3OWEA 2P24A 4FQXC 1B9ZA 4PS4H 3SDXF 3PQYA 3HZYB 5DD0H 5IJKC 4ZFZB 4EDXB 4Z77B 4C56B 2VLLB 1S7QB 1AXTL 1QBAA 2QADC 2OR9L 3O8XB 4IOFC 4OUUB 4PG9A 3QULA 4QTIL 4XHJC 5LG1A 1Q72L 3CMGA 2OX5A 1AY1L 4QRPE 1IT9H 1SJEA 3D69B 5F7KC 2AJYH 4P5TA 5JIPA 1CBVL 4D9LH 3SDYH 3RKPA 1DDHB 1H3XA 5IW1A 4KROB 4ZPTB 5K59E 4E41A 5JPNA 2X4TB 3QEGL 1XF1A 5J1AA 3WIIL 4ZYKB 3R8BB 1YN7A 1T21B 4FQXD 4H5SB 5IJVB 1ED3A 4FQCH 3O4OB 4J1UB 4Y5XC 4BK5A 4CNIB 1BEYL 2QHRH 3L1OL 5D72L 2APTA 4G9DB 8FABB 3ISWA 4KZEL 4EUPA 1BQHA 1A9EB 1UG9A 4J3WA 1XCQB 1I7TB 4X6CE 5ICXA 5HXMA 3ARWA 5F7FA 5CZKA 2P8MB 3SGDH 5E6ID 4X6DE 2AGJL 2UYLA 2UZIL 2YUZA 4QOKD 3LKRB 1E6JH 4OLZL 2GY5A 2EH8L 2AP2A 5J11C 1G7IA 4DN4L 3HE7A 3NZ8B 1OF2B 1MCSA 5KSAD 4M43L 3WCYA 3C6LC 3QDMD 5FO8B 2ATPB 2JLLA 4I5BA 1B90A 1NEUA 2DOCA 4IM8A 4GG6B 1KTDB 5LXGH 3D18B 4TUOB 3CVHB 3OX8A 4HUMB 3EFDL 4WJ5A 1RPQA 4JG0L 1RHHA 5DJDB 3ELAT 1NKRA 1MPAH 2BRQA 3BKYH 2DB8A 4PGEB 5EC1A 2O26U 3RDTB 3E6FA 2QSQA 3WS6C 3V4PH 3S36X 4WFFD 5FKPA 3UMTA 1FGNL 1CLYH 3S35X 3O3EB 1QTYT 3P0VL 4N0UA 4DK6A 5EUOA 5CUSL 5D7LD 5C9JA 5HYJB 1FNSL 4D9RE 3C6LD 1D5IH 5CILH 1N4XL 4H20H 4F7MB 3BEWA 2E7BA 4WDIA 4PRPE 3RX5A 5DK2B 3MBEC 1R3KB 3L5IA 4OM0L 2HJLA 4NBXB 5EORL 1F58H 3E1F1 4DN3H 3D87B 3RWGB 3HNSH 3MNZB 1BD2A 1X4XA 5F21B 2HH0L 1CG9A 5FGBC 5SWZB 4Y2DD 5C0DB 3RJQB 3V6BR 1M1SA 1O0VA 1IGJB 1A47A 3AU1A 5EBGA 5EU4A 4WTZG 4JHZA 1SY6H 2IMNA 2XZZA 5TE4H 4OB5H 5E5MA 4FNLH 3NA9L 2IBBA 2IG2L 1MI5B 3VFNA 1VSCA 5ETUB 1ZLUK 1YECH 2CDFA 3C5JA 3UCRA 2GIYA 3ARDB 4QT5A 1K6QH 2R56H 5DQ9A 4LFHD 3QFJB 4XP6L 3VXPB 2Y07H 4UTBH 4GSDH 1Q1JL 2AXGA 4HUXA 3MBED 2X5PA 1NFDB 3FOLA 3JV4A 1Z0NA 5EA0L 3O0RL 1N59A 1YEDB 3EDKA 3GMLA 4X4XA 4L8CB 4J4PA 3UBXI 4Y19A 1OOAA 4OLYL 3MA7B 2R2BB 4R9HA 2PYFA 5KSBF 4PGDA 4ZFOL 1PLGL 4K3JH 4O02H 2P8LA 4Y1AE 2WAHA 3FCTB 3QB7C 1BZQK 4HUKB 4GXVH 3P11L 2CIKB 2CLRB 4Q0XL 4FA8A 4XXCC 3S5LB 4QHKI 5EBWA 5F1NB 3B9VA 4JN2A 4XP9L 3LEXB 1IQWL 3DX8B 4M61A 5C09A 4R90H 3TT3H 5FA3A 3DUHA 3WBDA 3KXFB 4LP5A 1T2QH 3FQNB 5C0AD 3F58H 1SYVA 1MEXH 3GBLA 3I6GB 4RQQB 2R2EA 3CFEA 2AV1A 3ULUL 2APWA 1G7PB 2KZ1B 4HH8A 2NTFA 2VH5L 4JRYE 1KIUA 2EC9T 5IF0B 1P7HL 1HQRB 1CFBA 4L3EE 3OB0K 1AI1H 4JN1H 3BZ4A 1EFXD 1MRDL 1TIUA 3W9DA 2Y1VA 5FM5M 2YS4A 3BGFB 3MRBB 4K3JL 3KG5A 5BVPL 4M62H 2WINB 4TUJA 1B88A 5BOZG 2CXKA 3BEVA 5IKCA 4GKNA 4GXVL 2DTSA 2XKSA 2DAVA 1S9YA 3Q5OA 1WCQA 3IETA 3VRLE 1XF2B 2BFVH 1FFPB 4ODUB 4GW4B 1JPSH 4DQOL 3F58L 2V5MA 1T7WA 3EDJA 3MRMB 2RGSA 4FQIL 5J1SC 2EDLA 3HE6C 5DT1L 3OAYH 3TN0B 5CJ8A 5CGMA 2R0LH 3LN4A 1HSBB 1SJHB 4RMWA 4YHOH 1FNLA 2P5ED 3Q5TA 3AB0B 2GHWB 1EAPB 3O2VH 3GGWA 3KGRA 4R4FH 1KCRL 1I1RA 2GAZA 2AQ1A 4BQCA 4OCXH 1GCFA 4G9FA 3DVGB 1P6FA 4P2RE 5LGJB 2YN5A 4M62L 2B1AL 2B2XL 4NM8H 3GNMH 3JV6A 5DFVC 5HYSA 2O5XL 3DV4B 2ZOLB 5FKAA 1HI6B 2BNUA 3HE6D 1ZHLB 5IW3A 4YXKL 2AXFB 4MNQA 5FOJA 3Q48A 5KSBA 2EKSA 5TDOA 1NGWB 2R0LL 4YHOL 5J89A 4OFYD 1TJHH 2XWJB 1X5JA 3H9SA 5I1HH 4BSVB 3ARFD 5CMAB 5BJTB 5F7MC 1FO0H 2X4OB 4PUBH 5DFVD 2DICA 1RUKL 1XR9B 3P4MB 4DZ8B 1S7WB 4EI6B 4PTTA 2OXGA 5DVLA 3RY6A 3N0PB 3AREA 2Q20A 1ZEAL 3TBYA 3KPPA 3OKLA 2FWOB 3T1FB 3U9PL 3HI6H 4OT1L 3GHEH 3LVEA 4NRXB 1HHHB 3MFFA 3I75A 3VWKC 2EE6A 1RJLA 1PZ5A 3KYNB 3AAZA 3ARUA 5I73B 1E4XH 2UWEF 3B4NA 4APQA 3IFLL 1N6VA 2X40A 4PJ8D 2ZG2A 3OR6A 4MQ7B 1K4DB 4GLRI 1BQLL 3UXFA 2NY5H 3GB7A 1HOCA 2YPLE 1MFAL 3GSRA 1YUHB 3HNVH 1DQLH 4XAKE 3TA3B 4Z0BL 2HKFH 2BOCA 1JFQH 2YD4A 2F5AH 2WW8A 1MHEB 4JM4L 4CAGA 1NGQH 5L6YL 32C2B 5L2KB 2PYEA 3LH2L 4QCIA 3VFVA 4BKLB 3I02B 2HJKB 2NYYC 4J8RA 2GUOB 4AIOA 1DE4A 3MUGA 1G7LB 4GJTB 3QEQB 4NZTL 1N2RA 5CLWA 1AQDA 4P2OB 2VLME 4GO6B 3WUWB 4X98B 2Z91B 1J0KA 2YKLL 1UB5B 1BZ9A 1MREL 3CZJA 1E4XL 4KJQD 5H94B 2A74B 3BP6B 4KK6C 4LIQH 3TO2A 4FQHA 1XEDA 2WBJD 1ZGLP 1OWRM 4G7VL 4JFEB 2VAJA 4N5ED 3JWDC 5GGRA 1C1EH 1F11B 1XGRA 2NYYD 3CSGA 1BJ8A 5CD3A 3MRCA 2VXTL 1IAOA 1U3HB 1WUNT 3KLHD 2ADIB 4RFNB 5IW1B 4XCYB 2E9BA 5HHME 4X99A 1X5XA 5GRJL 3MLUH 1FNHA 1R3LA 5INDB 1AHWA 3HC0A 2VLKA 1S5HA 2R0KH 3ULUE 3H3KA 4K7PY 1OY3B 4L1DA 4RGMB 4KK6D 3C6SB 3DETC 4EXKA 1XGTA 1EUUA 1YA5A 3MUZ1 4XCEA 2VC2L 3SDCB 2L7JA 3F8UB 3QIBA 3MGOB 1AQKH 1TCRA 3RVUC 1QFPA 5C6TH 1RZ7H 3B6SB 2UY6A 3IJHA 5DJYA 2IAMD 4PJHE 1K8DA 4BK4A 1MCBA 2UYLB 3TV3H 1OSPH 4ZS6C 1J8HE 4XCCH 3PABA 4A6YL 1MVUA 3HG1D 4O51A 1DBBL 3GBML 4D0CB 4JFFE 3MZTA 2IFFL 2FEEL 1QHOA 3V52H 3VGBA 5D2NC 1CU4L 4I3SH 1GJIA 2UWEA 5C0EA 2DQEH 4G8GB 4LSRL 5JDSA 3DETD 4QYOB 5C92A 3C9NA 1F4YH 1RJCA 4G8IA 5I2IB 3UPRB 1QPXA 4MA7L 2X1XR 5EC1B 1T0PB 2FBJH 2GK0A 2CDGA 5ILTH 4FXKA 3S35L 2GJ6E 5BS0E 5J8OA 1ZKAA 4ELME 4ODTL 3HAEB 4ZS6D 4HJGB 4JRXD 4LLMA 4WI7A 4HUWA 1LHZA 5CBAA 5DD1L 5K9OA 1JHTA 3O4LB 1VFUA 1VFMA 3MV11 1CFNA 3K2UL 2ADJA 3N1PC 2VDQH 4XPAH 3BEWB 3BGMA 1FNFA 4WDIB 5ANME 2QTEA 1DBKL 1A7OL 3SDXB 2JKXA 3SDAA 1GZPA 1PZUB 1TCMA 2H32B 4MDJB 2E27L 1H3WM 4F7TA 2BDNH 1U95A 1MJ8L 5I1GL 3BPNC 3J7HA 4P2YA 2D03H 4LSQL 3DX7B 3MV9D 2OTUA 4C83A 4HLZG 4YHNB 1U42A 1I8IB 3TVMB 3VG9B 2EDOA 5AYUH 2YN3A 3KR3H 4JLRB 4KRMB 3S4SA 5TPWH 2XG5A 3BKJL 3KJ6L 3SGKA 4WGVB 3VFNB 3B5GA 2M26A 3TJHD 4KY1H 3DX6B 2J4WL 4WVRA 3CGTA 5DQ9B 5BV7L 1WIOA 3ALXA 2AXGB 1UM4H 3O6ML 2F8VA 3QWRD 3PWUB 4XNYL 4JHAL 4TSBH 3I6KA 3G6DH 1N59B 3PJSB 2B4CC 2FJHA 2C3VA 1JF5A 3GMLB 4AEIH 1U8HA 4ALAL 2ZP0T 1F42A 4Y0GA 1FFQA 3E8UH 4JGMA 2O61B 1BWWA 4KRPB 4OLWH 1QSEB 4IRJC 4BH8A 1V7NH 4GAGH 5ICYB 4NNYB 3S97C 2VDLL 2DWDB 4QXUL 1IGIH 1INQA 2IGFH 5F9JA 5CZVL 4JREB 4WENB 5ACZB 5J6HB 4XWGH 2CR6A 4XMLL 3NABL 4L4VA 4OZ4A 4L5FH 5I9QC 2IANE 3BIAX 3T0VA 5I1LB 4UT9L 2Z31A 4U3HA 2X7LA 4HWNA 5FIEA 3DRTB 4Z9KB 4MA1B 4XBEH 1G7QB 4POYA 2CRIA 3WHXA 1LGVA 2PXYC 1Y6MR 4P3DB 5AG9A 1EMTH 4IRJD 3BZ4B 1I9EA 4OLWL 2VDNL 2OTWA 5I1IL 4X6EB 5ABDE 5K9KB 1EGJA 2VDRH 5BRZA 1BGXH 3GFUA 3GK8H 3RY5A 2R0ZH 1MCLA 1F8TH 5KBNC 4P4KB 1ZVYA 3D39D 2YA2A 4AK1A 3QIWB 2VLRB 3O6LH 4U6HB 3WKMH 3RJDA 4YDJA 3RZCC 2F9BT 1UENA 3MACH 4FQQB 4UQ2B 3L5XL 5T1LB 1N6QH 1MQ8A 3MGTB 2Y9RT 4P5KA 2CUMA 2HTLC 3HC3L 2SEBB 4Y8AA 2FB4H 2P8PA 1CGUA 1KACB 3TT1H 5KS9E 5GISL 1MAML 1W0WA 4MQXC 5DMKA 1YY9D 2DS4A 4KJYA 3FFCE 1RMFL 5C07A 3CCHA 3LHPL 3ZKQD 2ZUQC 2NZIA 5EWIL 1H15A 2EDXA 5JHLL 4J3XA 1YYML 5E24E 1IGYB 4H0GA 1V7MH 3N1GC 3Q1SL 4LSVL 3ZE1E 1VA9A 1WT5C 5JW4M 4M7JH 3ES6A 1CN4A 3CDYA 4TPRH 5IBTL 1C16A 3TH4T 3L3DA 1QLEH 5DD6A 3TF7C 1ZXQA 4WW2C 4NDMB 3NA4A 2E9IA 2FX7L 1ITBB 2HTLD 1A5FL 4GMTL 2NLJB 1P4BL 4QY8B 3L3HB 2Y36H 3QSKB 1IBGH 1ADQH 2DLHA 3R06A 4PJXF 1K2DB 5CP7A 1SEQH 3SE4A 1R5VA 5ADPH 4NQDD 2ED9A 2IF7A 1WAAA 4EOWL 1UC6A 4BJLA 2R1XB 4LRIC 4NHCL 1LEGB 2KZWA 3AREB 1NL0H 3BPLB 3WO4C 1CT8A 1JZ3A 4DAGL 3DHJA 1U93B 2XZCH 1U2HA 4KH2A 4OCLC 2E9JA 3OKLB 4FTVB 1AGCB 5MENB 2FYYA 5EFIA 3I75B 1INDL 1Z3GL 4MAYA 3M45A 1RJLB 5JNYB 5CCKL 4K7PL 4QOKE 3DX9A 2FZ3A 4F37F 1CE1H 3G5YA 5F93C 3R0NA 4RGNB 1QRNE 4UAOB 3DHMA 1M6OB 4L9DA 3QDME 3OKOA 3GSRB 3EFFA 3LD8C 3QO0A 3NFNA 3CFIC 4NC2B 3V0WL 2X4SB 3ZDYE 3KVQA 2VQUA 4P23B 3HNTH 4JJ5A 2EDFA 3SE8H 1GHFL 4LVHC 4LFHG 1DEDA 5E2TL 2C7UB 3GSXB 5DFTA 4Z7WA 3VW3H 3VFVB 1YNLH 4HC1H 4PG2A 4U6VL 1AKJA 3MUGB 4NHUB 2NX5D 1IRAY 4YGAB 2IBGA 3S34H 4MNGE 4X9BA 4WFFE 1T5WB 5ADOH 3NCYS 5JO5B 3QCVL 3ARZA 2C3WA 2VKWA 4OCSL 4RNRB 5D7LE 1RULH 4YFLI 3IJYB 4P59L 1PQZA 2CKBL 2AEWA 3MXWH 2Q6WB 3SJVD 3V6ZA 4K23H 1YNKH 5A2KH 1YEIH 2ZUSA 1HXYA 1SMAA 1IAIL 3QHFL 3KHOA 5IESH 3PP4L 1OSZB 4HZAA 2PW1A 3O2WL 4XPBL 5F96L 2NY6C 3HNTL 4R3SA 2CLVA 5DYOB 3M8OH 5EBMA 5E94A 5BW7A 3UTSB 4U6XA 3VI4F 1IAOB 3MJ9H 3BZEA 3UDWC 3GUTA 3A67H 5DUPH 5I8CA 5IHZA 3VMPA 1HQ4B 2G9HA 4NQVA 5E2WL 3S3PA 2BRRH 3EDEA 3HC0B 3LKOB 1EHLH 3EOBA 1S5HB 4OQTA 4G6MH 4V1DA 2GCYA 1NSNH 3REVB 3CX5K 1JUFA 3JTTB 4RBPH 1DUYB 3MV7A 4PJXA 1CDIA 4M4RA 4OTXH 1II4E 2I9TB 1G7MA 1P84K 4UV7H 1IKNA 2Q3ZA 4PY7A 2AK4B 1U2CA 1UKSA 4K23L 1QR1B 5DJYB 3V6OC 2VAAB 1X4ZA 2F54A 3TLRA 4HXBH 5GGSY 5ENWA 3MLRL 2FSEA 5LGKA 2V9TA 4NUGL 4FQLL 1T1YB 1Q8MA 1TTFA 4ZOBA 4DUXA 4OLUL 4HPYH 1XGUA 3CDGA 3CX2A 2FH6A 3KPRD 3JWDH 4Z7OE 4MDIA 3VFPB 5FUOL 3FQXA 2YC1B 5J06A 3TNNA 1I7UB 2R9HC 5F72S 4I18A 5JQ6L 4IRSA 1KG0A 4X7CC 1I1AC 2CIIA 4QGYA 5DMJB 1I9JL 3KPSB 1KJVB 3KYMA 4X5WA 2BNQD 1S8DB 5C0AE 3HC4L 4GQ9H 4X7EC 2ARJB 3QUYA 2LVCA 5C2BH 4S2SA 1NCCL 4OBRA 4L8SC 5AZEH 1DN2A 1FH5L 5F1SA 1EBAA 4R0LC 3TCLB 3QQ4B 1U8NB 4HXBL 4F7EB 1ZLSL 1KC5L 5CBAB 3GMPA 3WS3A 4Y4HD 3TYFB 1OGAE 3BIBX 3HR5B 3QDJD 2ADJB 3U4BL 2GT9A 5JXAL 2R9HD 1B4JH 1HEZA 1JF1A 4HKBA 2VIRA 1A14H 1ZVHA 1ZLWK 3B9KA 1GZPB 1OAQH 4OGZA 1I1AD 3ZTNH 3GMNB 1RURH 4YIQA 4H1LA 3RWEB 1QKZH 3MBXH 4F15B 2ICEB 4URTB 1FL3A 3LN9A 3O3AB 4KWUA 1XIWA 3W0WD 3KAAA 4IBLT 1QFUH 1UH2A 2AJVH 4JRWA 3MRDB 4U49A 3QWOB 4PJIE 5C08A 3ULVF 1ZHBA 3VI3F 2QSTA 1WBYB 4UIKH 2KKQA 2P5EE 3GSNH 3GSQB 1NPUA 3IDJA 1UJ3A 1Y18A 4L8DA 4R8WH 4P2QA 4BFBD 3SBWA 2V7NA 5DQJA 2E8YA 3W39A 5T1KB 3IGAA 4K9EL 1K8IA 1DSFL 4WI6A 4ACPA 5HJ3B 1A1NB 1UACH 1M7IB 1OAKH 3ZLQC 3T65A 1JGUH 5DZNA 3SPVA 1KN4L 2D7TH 1PG7L 1HHJB 5D1XA 3NAAL 1L7TH 2F53D 3MBXL 4Z5RA 1QLRA 1QFOA 5E2VH 1QFUL 2YUVA 3G08A 4YHPA 2PF6A 5I8KL 1UXSA 4OZFG 4QRQA 2W0KA 3SHSA 5SWQB 2HT3C 1IC7H 1D9KA 3CFDB 3ROLB 3VGAB 4GRLB 2OL3B 5AG8A 3HPJB 5EZLA 3T2PA 3OKYA 2F5BL 3DMMA 2DJUA 4POZC 2FRGP 3B2VL 2CUHA 1YMHA 2EECA 4R7DB 1EEZA 1JPGA 4ORZC 4R8WL 5GGUA 4S1SH 2OZ4H 2C9AA 4HPOL 4PRDB 2ADFH 4RGOH 5FA4B 3DRQA 4R7NA 3TO4B 3X3FL 4RSVA 2DBLH 2MNUA 4NRYA 1TPXC 5F9WB 5CINH 3UTOA 5HVHC 2X70A 2CLZB 1RU9L 2HT3D 1AE6L 1XZ0B 3O6KH 1DUZB 3QDGB 4JM2A 1WWWX 5IBUG 4BFEA 2V5SA 4K07A 4POZD 5EZJB 2A73A 1SVZA 2R2HA 2ZSVB 3D6GA 4FZEH 4MZ2A 3PL6B 4ZTPL 1VADA 1LE5B 5IFJA 1Y0LA 4S1QH 3CIQA 2VZSA 1TDQA 5DGQA 3D3VD 5FYJH 1N5AA 5ELIA 4S1SL 4PR5A 5HHQB 1KBGL 4JO2L 5E7BA 4FFYL 4YAQB 3M17B 3GSWA 4KXZI 1LEKB 3VRIA 3LEYH 5DJ6B 4CMMB 1G9ML 5CSZB 1IGML 4XC1L 3EHBD 5DMKB 5I6XB 4KJYB 2DI8A 3VWJB 4LLAA 4ZS7L 3MLYL 3CCHB 4GQPH 3HR6A 4GRWH 4J12A 1LO0L 4ESKA 3O6KL 4HIJB 4OD2B 3UZQA 1HH6A 3P40A 2QR0B 4ONHA 1I3GL 4K55A 1CDHA 3WFEL 5DMGD 5IK3A 3V5KB 4FHBD 4NKMA 2OK0H 5DVMA 5I1AB 3QZWB 4BZ1L 3W2DL 3MV8A 2D9QB 3I3BA 4YDKH 3S7GA 3GSVB 1MFCL 1EH9A 4HIXH 3DUSB 2V17L 1LNUB 4HH9A 1WZKA 5ESVA 1D3CA 5E9DD 1AO7D 2DN7A 1VDGA 1MY7A 2EIZB 5FM5O 1HH9B 4MHHI 2VKXA 4YHZL 1JYWA 1W8NA 1ZLVK 3FO9B 2VL4A 5E8NA 3F7VB 3FO2A 5I75C 4ODVL 2VQ1A 1KTRL 2G5RA 1NBVH 4BA8A 5GS0C 1PDKA 1RZJC 3L9RB 5EU3B 4PRIA 3WFDH 1NGPL 5EIVA 2C1OA 1UZ8B 4ONGH 2WMPA 4LHQB 2RJMA 2MWCA 4JQVC 4EVNA 5IOPB 3QXTA 3C09C 3P77A 5JDJA 4GW1B 4AT6B 3IXTA 4ZAKD 5JHDB 2ITDB 5D7JA 3Q3GA 4QNPE 5MEPA 4NBYB 2V6HA 1M7DA 2P44B 4I0KA 4E0RA 5GJSL 3OGOE 2Z8VC 4N1CA 3HN3A 3NGBC 4X7SH 1YY8A 1IFHH 2YPVL 4CU6A 4OZIF 1FYTB 5JOEA 4P49A 5MEQA 4P5TC 3EOAB 5BMFH 2IQ9H 3MR9A 3B9DA 5EZIH 43C9A 4Q2ZA 3RU8H 3LKPB 4LLVB 2DMKA 1R5IA 2HVKB 4PJCE 3BQUD 1NH6A 3MRNB 5MHSE 3PQYD 2X41A 1IAKA 1S7VB 4JRXE 4XXDB 1LO4H 2NY7L 3NIDE 2J7LA 4GAFB 1Z9SA 2HFGL 5TE6L 2PETA 2Q7YB 3SDDA 2VXUL 5IROA 1BOYA 2XZQL 5C0FA 1SEBA 5D2NE 3EJZC 1VPOH 4FMFA 4DVBB 5HD8C 1W72B 2Q8BH 4P5TD 4X7SL 1ACYL 2PW1B 2FECL 3U9UB 2CLVB 3HE7C 4E41D 1BZ7A 4Z7QE 2BP3A 4R2GC 5E94B 4U6XB 3EYQC 2CO6B 5BMFL 2D7NA 3KWWA 4DTGH 4UZGA 2M1KA 3MV9E 4F58L 4XMPH 2R4RH 5IMMA 4WGWB 1KLUB 5EU7C 4FOMA 4I2XA 4FQ1H 3O3BA 1LO4L 3AMKA 3BN9C 4K3GA 4QF1B 5B39A 1A3QA 4D3CH 2QQNH 4QKXB 2OM5A 1WGOA 2UUDK 1X5HA 1OP5K 5I19H 1IL1A 3I3EA 3FN0L 1B0RA 1NCBH 5EIIA 2YPKB 1BVZA 4NQEA 3HE7D 3D48R 4JHWH 4R2GD 4YHLL 1UWXK 4F3FA 4Z76A 3CDGB 2BVPA 3AM8A 1PKQB 3K81A 4OKVB 5CZXC 5DHYB 2BVQA 4NO5A 3SCMA 1M7XA 3QO1A 4PJBF 1KJ2H 1A3LL 4JR9H 5GRWA 1QFWH 2K9UA 3OL2A 1MQKH 5GRUH 2FCBA 3MA9L 2V5TA 4WY7H 4FG6C 1FIEA 5EO0A 1DEEA 5EOCH 3OXSA 2F8XC 1JJUA 4JQXC 5DA0B 4S2SB 3BDYH 4OZIA 2B5IC 2P5WA 2VXVH 2MSPA 3FQTB 1KB5B 3QEUB 3P4OB 2JF1A 5HHOA 5DRZB 3TBSA 2IPKA 1WTGT 3BGAA 3GMPB 3FO0L 1WJ3A 5CZXD 1ULVA 4MA3A 4NKOB 1MCEA 3PUCA 3WD5L 1HEZB 1O5DT 4MCZA 4OV5B 2I9LA 1BD2D 5HDBE 5IVOA 4M5ZH 1F4WL 4L9LB 5IB1B 2OI9C 5DK0B 1FFNA 2ZUXA 2I07B 3AS1A 2ZZUT 4LDEB 1ZA6B 4FG6D 4N8VA 4P46A 3UO1H 2K1MA 2H6PB 3D39E 4XNZC 1F6FB 4B50A 2DQUL 5GRUL 1TZHB 3CVHL 1CICB 4FFZL 3CU1A 5DTFB 2AERT 4WO4C 5DHVB 1YEJL 2QQKL 4TULL 1BIHA 2IH1B 2PTTA 2XV6B 4X6BB 2WANA 1EDQA 2ZKHH 1F2QA 2VL5B 2KH2B 1ZHBB 2Q86A 3QDAA 4MGXA 2AV7A 1YC7A 5EDXA 3RIAF 2WUBL 4AH2B 2DLEA 3FONB 1HYSC 1KENH 1AFVH 3UTTB 1HNFA 4J4PD 1I1FB 4Y19D 3TIEB 3NH7H 3T3MF 3PNWB 1TNNA 4BZ2H 1K8IB 1UYWH 5AWNL 5H2BB 1QLFA 3ZT7A 1GGCL 3KNBA 3CJJA 3W9EB 1KPRA 3L3OA 1YNTB 4L8BB 3BRGC 3VXRA 4X7TB 3SO3C 2DIAA 3HUJF 1J1XH 4LGSB 1P4LA 3IDNA 5GS2D 4LCWB 5C09D 4KVNH 4KC3B 3G08B 2CMRH 2WUCL 3T77A 3CFCL 5C0RL 4AEHH 1JNHB 4F9LA 1KPVA 5CJBA 1IGTB 4BQBA 4PJ7F 4PJ5E 5IB3B 1FDLL 1A9BB 1OCWL 1XF5B 1HYSD 2X10A 2ZCLL 3FB5B 5KN5A 4U1JA 3G5ZA 2O5YH 4Q6IA 5GGQH 1GVIA 3WUZA 4PJBA 3WLWD 2V5RA 3W81A 2ESVA 1JPGB 3QUXB 5GGUB 4H26B 1R3JB 4NQDE 3BD3A 4V2CB 1WWBX 4ODSH 3SO5A 2BMKB 3MRLB 3FMGH 2GJZA 3PGDA 4F2MA 3O9WA 3STZA 1UYWL 4WCYL 4R7NB 3SE3C 4KK5C 2VMFA 2YSSB 5IFAH 2FIKA 3QISA 1S5IL 5DC4B 3H3BC 1TZIA 3VFWB 3T4AB 1JZ2A 4PJDF 4RRPG 2AJUH 2BVEA 4X6DB 5GXBB 4OZGF 4PB9L 5JR1L 4N0YL 3VXQB 2Z93B 3MRFA 3B3IA 2LQRA 2WLYA 1BHGA 3STLA 2A9NH 5IM7A 1KJ3H 4FXLA 5IFJB 1C5CH 3UYPA 2UY7A 4M3KB 3GJFB 4X5XA 2XIDA 1EBPA 3GSWB 4G9FD 4P9HC 1TQCB 4XWOD 1X5ZA 1R6VA 2G5BA 2H2SC 4POUB 5FOBA 3QHZL 2X1WL 2XN9B 3VGDA 2DBJA 4C56E 1S9VA 1OW0A 1OAZL 1RJYB 4ENED 3VFTB 4Z7NF 1L9NA 1U92B 2KQMA 4D0DA 1RZIA 3MUY1 4MNQD 2X4QA 5KW9L 4R97C 1RJZB 3V9FA 4PRPB 1YN6B 4PP2A 3TGXA 1I1YB 43CAA 3FQWA 1U41A 2JTDA 1FYHB 5JPMA 1ZLUH 1MCRA 3NVQA 3T0EC 1TJGL 3AC0A 4I9WE 1BIIA 1QBLH 3H9SD 4JPVH 4X6FB 2CRMA 3ARGB 1T83A 2RQ8A 3HUJA 3FJTA 1WICA 4HS6A 1N3NA 2FD6H 5ESVB 1D5BA 4FFVC 2PCPA 3HZVA 5GS1B 3JBG7 3DSFL 1A21A 1U91B 3BD5A 3LRGA 5LBSL 3IS1X 4PJEA 4HW6A 4JFQA 1U9KA 4NZUL 4KPHL 2DMBA 2X44D 3WFBH 4PJ7A 3C8DA 3ARED 3KPQB 1BWMA 3PWVA 5J13C 3CZFB 1UZ6F 4MAUH 3TC9A 1HE7A 1EO8L 3JZ7A 4WUKH 4ODHL 3BW9A 3A6CL 4HIIA 4J3SA 2Z8SA 1OAUH 4QO1A 5ERWB 5C0NC 5D8JH 1J0HA 1L9MA 4APQD 1HZHL 4XPGL 1BQUA 5KZCD 2CXGA 4RGND 5HVGB 1J9CT 2EDNA 4Y4KC 3DGGA 4RA0C 3DBXA 1A7BA 1DVFC 2YMXL 4FFVD 1OAXL 4Y1AB 3KPRE 5B38G 3T2NL 4PJDA 4LVEA 1RIVL 4BYHA 3QXDB 1NAMA 2ICWJ 2VLJA 4FN0A 4OZGA 4ZPVA 2PYED 3S36H 4K8RD 5C86A 5D7IE 4YBQC 4ZUVA 1G9NL 5T3ZD 3QRGL 4EI5A 3GIVB 3G6JA 2NTSP 5DGRA 2Y6SC 1FO0A 3IDUA 43C9B 4OAWA 3MREA 5FYLD 3N85H 5DFWH 4EZMA 3Q0HA 1CD1B 2HVJB 2VXSH 4GAJL 4U05A 2VNCA 3OTTA 4ZO8A 5C0ND 3HMXL 3WIHA 1FZMB 1OARL 3TIDB 2NR6C 2AJSH 3ZL4H 1RZJH 3RGVB 5D2LF 1GOFA 5HYJE 3TBWB 4JVPA 4KTDL 3T4YA 3E3QC 3P3YA 4MXVE 3HZMA 2X1PA 1KIPB 4PREB 2C1PA 4I8DA 4GS7C 1QYGL 2D2OA 3QIBC 3SGEI 5HY9B 3QDJE 1H9VA 4TVPH 4LPXA 3Q6GL 5AUMA 4YBQD 3LS4H 5K9QI 5JOFB 4H88L 4XCFL 2DYPD 4Q9RH 2W9DH 2GTZB 2GSGA 3PWNB 1J10A 1A7NL 1BF8A 4N9GA 1FE8H 1KB9K 5DLMH 2BSTA 4UTAH 1LMKA 2VLKD 5HI4C 5JIIA 1JGVH 1JPTL 2MPAH 4X0KA 5IVZB 5E2UH 3PGFH 2BY2A 4OF0A 2AJSL 3K3QA 4I2XB 5EOCJ 5BZDA 3VXNA 4EKXA 5IQ7L 1RSFA 4ZXBB 5B39B 2IFGA 3QIBD 2J88H 4LVOC 5IG7A 5DD3L 1NFDE 5JW3H 3CK0H 1MCOH 4EUPH 2C4FT 2YA1A 1KPUA 5D6DA 3UYOD 1DZBA 2FJGA 3FOMA 3EYSH 1F5WA 1FFRA 2L7UA 4OLVH 4Q9RL 4XMKH 2WNGA 3L5WA 1NAKH 2EYTB 1RZKL 4F3FB 3EAKA 5BZWA 1T04A 3MRIA 2G75B 4NZRH 1FGVH 1WFOA 4LPCA 4JZNB 4GAYA 1FE8L 4LKCA 4JJHA 1JWSA 2BVQB 1CE6A 4RMTA 4CVXA 3LS5L 2NXZD 5CHNB 3SDAC 5F1IB 1HIMH 4M1DH 3CMOH 3BD4A 1F45A 3ILPA 3JV0A 1NGZA 4JKKA 1ZGLB 5CJXC 4MQTB 4TVSa 4NPYB 3OPZH 4OGXH 1ZHNA 1CL7L 5FF6B 3NPZB 4G43B 2V2WA 1KLGB 3H42L 2R15A 1HHGA 1BBDL 4FQXA 5EBLA 5IEKB 4S1RL 2X1OA 2P5WB 5F7DA 4JDVA 3TFKC 1UXWB 2D3VA 1U36A 5F7LB 2DQJH 3TBSB 4DOHB 4RFOL 1F6AB 4NO3A 4ODBD 2VDKH 3SDAD 3V2AR 2JB6A 3D9AH 1HHIB 5D2LA 5FGRA 2DD8H 4K3EL 3IFPA 4CJ0A 3BH8B 3KPNB 4DVRL 4ELKA 3FQRA 1NGXA 1LE9A 5DSCB 1FBIL 2B1HL 2YBRB 4OZHF 3PG2A 4MA8H 3HI1A 5L2JB 2A1WL 5IB2A 2D4FA 4Y5XA 4MD4A 4G6AC 3QUMH 1S9KC 4GLRH 4KZDH 4KK8D 3WLBA 1HDMB 1BFVL 3QXVA 2EXWC 3ARBB 5KJRH 1YQVH 1Q0XL 1MHCB 2GYSA 4PGZA 1WZ1L 4IS6B 4NJ9H 1FRGL 3SKMA 5D1QA 4S1DD 1FPTL 4B53A 1QLFB 5DQDH 3IXAB 4PJAF 2GEEA 3G5XA 3CFBB 4G5ZH 1KTLA 1NLBH 4Y5YB 4ZFOB 1P2CA 1MFEH 4JQIL 4G6AD 4RCAA 3EYFA 4L4VD 1ZT1B 1ES0A 1CXIA 2NW3B 4NQCA 4TYUA 4JPWH 5H8DA 3CH1A 2GY7B 2Z31D 5LAXA 2EXWD 1S9XA 5KG9B 4WV1C 4QTHB 3KPLA 2DQFA 5E9DE 1AO7E 3MRPA 3RL1B 2HKHL 3IFNH 1J5OL 4GXUN 3FAXA 2EDHA 4X4MA 5F7YC 5I71C 2C3XA 2XXCB 4JO1L 3RP1A 1PSKL 4DGVH 5C6WH 3I85A 5AYQA 4HWZB 4F2MB 4YO0B 2MQ0A 4HX1A 1HILA 3MOAH 2YEZA 5TDNB 4LMQI 1N0LA 4GUPA 4YHYC 3O11B 4TNVF 4DGYL 4E5XA 4OI9A 1YPZE 5BRZD 1NKOA 1XF4A 4U1GB 3C87A 3WXVL 3MRHB 2A6KA 5EC2B 5FUZH 1HN1A 4O2FA 4EQ3A 1FCGA 4PRAA 3MRFB 3WFHA 4YDVA 2OSLA 5HI5D 4Y16A 4ZO7A 1LO2H 2K3TA 3HLAA 3UTPD 5J12B 4KRNA 1MRFH 1TTGA 2D7MA 4EUPG 1KELH 3MLZH 1DBML 5F9AC 2GTWB 2EDTA 4YR6A 4OZHA 2Z4QA 4HMCA 4GBXA 4PJ9A 2R69H 2J5LC 4LCCC 5KOMC 1IEBA 1ZSDB 3LKNB 3V4VL 3NCJH 3QEQE 3S96A 5D6CB 3QUZA 1T22B 3LIZL 4AM0B 4KKBD 2IQAA 4K7FA 5C07D 4P0DA 1A7PL 2GJ6B 5BO1L 5F3BB 2IMMA 1LO5A 5E1HB 3SE4C 5CJ5A 5BS0B 4U1SA 3U36B 1BVLB 2GK2A 3PQYE 4ELMB 1VGKB 3MCKB 5JW5B 3RPKA 5J9PA 3O8XC 2DM2A 4G3YL 2F74B 2OJEB 2VDOL 4CW1A 1A6AA 7FABH 5T1DH 4KQ4L 3SQOL 1LD9A 4XB8A 5FYJU 1CDCA 4JFEE 5ANMB 5GRYA 3WNOA 2A6IB 2NNAB 1JVKA 1L7IH 5E1AA 2YK1L 2VO5A 3FQWB 4MAYC 1F4HA 4PLKD 1DQDL 5JPMB 2DQGH 2P47B 3P9MA 1Q9LA 4HWUA 2UZYB 1DBJL 5IB4A 1U8IB 5C3TA 4BSWB 1RK1B 2BSSB 4G42A 2DQDH 5D7SH 3WEXA 3H3PL 4JFXB 4Y4FB 1DCLA 3L3GB 4P9HH 1J18A 15C8L 1IC5L 2BVTA