1FSKC

Complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
QVQLQQPGTELVRPGASVILSCKASGYTFTSYWINWVKQRPGQGLEWVGNIFPSDSYTNYNQKFKDKATLTVDKSSSTAYMQVNSPTSEDSAVYYCTRGARDTWFAYWGQGTLVTVSVAKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MAJOR POLLEN ALLERGEN BET V 1-A
publication title Dominant epitopes and allergic cross-reactivity: complex formation between a Fab fragment of a monoclonal murine IgG antibody and the major allergen from birch pollen Bet v 1.
pubmed rcsb
source organism Betula pendula
total genus 40
structure length 220
sequence length 220
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2000-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskC02
4M7ZB 2A73B 1XGRA 3B9KB 5ETUA 4PY7A 4F15C 2XKNB 3MV9B 1CLOH 1DBJH 3O6ML 4HPOH 4I5BB 5H35B 3HMWH 2XFXB 4LHUG 3GUTA 2VXQL 4XI5D 3V4VH 1AI1H 2UWEB 4E41E 2R2HA 2K7QA 3IU3B 5DS8A 3KYAA 2UV3A 2N1KA 1ZEAL 2AV7B 2ZG3A 3U0TA 3GSXB 3T0EB 4WHDA 1C5CL 4P4KA 3RU8L 5I1LB 3LKRB 4N0YH 1EVUA 3DMMA 4JDVA 5I8KL 43C9B 3O3BA 1Q0XL 2BNQA 1F3DJ 2YXMA 3K4ZA 5EIQA 3WL9B 2GY7B 4XCEB 1UB5A 1KBGH 2VDOL 2OSLB 4KGJA 2H2PC 3QIBD 3F5WA 4E5XB 5JORA 3KLSA 2YS4A 3N85L 4P5MB 2APBA 2XZQL 4BSVA 3MLPA 5CLTA 4S1SH 3RHWF 1NBYA 1MH5B 5SWSE 2PUQT 4MNQD 4QY8B 3QO1A 5FUCC 5IFJB 3D25A 1NGWA 4L3EE 2I07A 4CMMA 5I1DB 1RUMH 4Y5VC 1XIWA 3FRUB 5TPWL 5IHZB 1G9MC 3RIFK 4RCAA 3BPLC 3O2DH 3VG9C 3EO9L 3EJYC 3MC0A 4F80A 3UTQB 1EEYB 1YN7B 5KZCD 4UDUA 3Q0HA 1NGPH 3RVWC 1T1ZB 4UTAH 3O3EA 3VFMA 1Y18A 4JZNA 4HWBL 4WUKL 4LAQH 4MA1C 3TF7C 5DC0A 1TPXC 3GRWL 4DAGH 3DIFB 3NZ8B 1Y6KR 1PBYA 1YPZE 5TE4H 2DKMA 2XNAB 1UH3A 4PGCB 2RHEA 3QDHA 1HKLL 4J4PC 4Y4FD 1NFIA 4FXKB 3W11C 5AG9A 1U3HB 4G6JL 2LVCA 4ZUVA 1T20B 3RWJA 3VWJB 1A6VL 2V7HB 1ZT1A 4X8JA 4FZEL 3KYNB 1RZ8A 4MJIB 2X44D 3D18A 4H1LA 4HBCL 5DRZB 3UZEA 1M6OB 4YC2B 1G1CA 3OKMB 2ED8A 1C16A 3PV6A 2R4SL 3HTLX 4PREA 4IIQB 5FDYA 3MOAH 3R0MA 5C0RH 4LLYB 4R97B 3VFGH 1JRHH 3MLZL 1AO7A 1BX2B 1FCCA 1NDGA 3SKJH 4W81A 2NY5C 3IXTB 1NMAH 4GMSL 1T7ZA 3MNZB 5IK3A 5DJ8B 4MMXC 3SDAD 3K8MA 3V52L 5BRZD 3S37H 1NC4A 2HT3C 1MFAL 3D6GA 3JZ7A 3UTZB 1AH1A 1EMTL 3EOTL 4MAYB 2EDKA 2OR7A 1GH7A 1VACB 4U3XA 1BZ9A 3QJHA 3D1MC 5CJXA 5JW4M 3EDFA 1E28A 4LLDA 1BHGA 4OV5B 4UOW1 2B5IB 4CMHB 1EZVY 2ARWA 3O3AA 4LSSL 2PXYD 4HJJL 4LSTL 4UMGA 3O6FB 4RAVA 2XWTB 2EIZB 4PLJD 4EIGB 1NUDA 4KHXH 1P4IH 4N9GA 1AXIB 5ISZE 3G6JB 1FO0L 1KJ2A 4NZRL 4LPTA 1A9EA 5A43C 4LVOC 4JFQB 3P0YH 3QULB 4MX7B 1JHKL 3AU1A 1NBVH 4OKVA 2AAVA 3QEUA 5HHPA 2AQ2A 4X5WB 5F1IA 1ZVYA 3WIIH 2HFFA 3BP5A 2VERN 4G7YH 4W6XB 5IVZA 3ARGC 3UBXB 4NQUA 5DJXB 3HPJA 4PJBF 3QFJB 2N56A 4ZUSB 1AXSA 3R1GH 1QBMH 5HTSA 4FQLL 4OIAA 3MZTA 1PLGH 3FRPG 1OWRM 1ZVSA 1NC2B 4S1QH 4F3FB 1EGJA 1SYSA 3FQTB 3KPSE 5ADPL 1F4XH 4KAQH 2DQFB 2GT9B 2OZ4L 5E6ID 2G75A 1KXQE 4L1DA 1WC7B 2VQ1B 5LAXA 1YEFL 4Q7DA 4P2QB 2YUWA 3NOIA 2EDNA 4K2UL 2I26N 4GAGH 5CKAA 3KLHD 3KXFB 1OSZB 3EYSL 4NJAH 2ERJC 4RBPK 3IJHA 2UYLA 2YD5A 3G5ZB 4LF3A 5SV4A 4BYHA 4PGEA 3FZUD 1XR8B 3QIWC 3LB6C 4PJIA 2GQHA 1YNKL 3RA7H 2AS5M 1MCQA 1RI8A 4X9HA 1BZ7A 5J8OA 5MEPA 1TVBA 1IC7H 1WVZA 4G8FA 2VIRA 3CH1A 5IM7B 3ZLQC 1ZSDB 4CVXB 4GKZA 1W0YT 5FYKD 2F5AL 2J7LA 4Z7OE 4F9LC 2W9EH 5FKAB 5H2BB 5BVJA 2VLMD 4WW1A 1A7QH 3FB8B 2VDLL 2EO1A 5DJCA 3RWDA 2J8OA 1MHEA 2WLZA 1XF5A 5FGSA 2DLFL 5M7QA 1F6AB 4XP9H 4L3CA 2EKJA 35C8H 4PYHA 4LFHD 1DR9A 4HT1L 2AJUL 5EH1A 1LQSR 2HTLC 4QTIL 1BZQK 4MDIA 3EYVA 3QUZA 3O81A 3S3JA 1QOKA 2EEAA 3OXRB 3D3VD 5EU7C 3T4AA 3FO9A 3QUXC 3LHPH 4ONFH 3LKSA 4ZPVB 5E8DL 4GG6A 5J57B 4JRXB 1F6LL 1LEKA 2F5BL 3O8XB 3D39A 3UO1L 5ADOL 2ADJA 2JCCA 3GO1H 3B8YA 5FA3B 4Y2OA 4U6VL 2PETA 5BQ7B 1LD9A 3U7AA 4FQCL 3WJLA 4M7JH 3WFDH 2E5EA 1RZ7H 4PJIE 3VD9A 1MLCA 2GSGB 4FOMA 5MENE 5GRXG 3BOVA 1DFBH 5IB4A 4KRMB 2B1HL 4G6KH 1RIVH 1KB9J 5F9DC 4POYA 4FQXA 2EECA 1IQWH 1FAIL 1S3KH 1G6VK 5L8KB 3TJHC 4GUPA 3RL1A 4NCC1 2R2EB 2HKFH 5HPOA 1G84A 2ADGA 2PCPB 4MVBC 1QFWM 2GIYA 4Y2DC 1XCTA 3FB7A 3UTSE 4LEOB 1FFNA 4HX1A 4QRTA 3H0TB 1URLA 5JO5B 4K3EH 3AS2A 3TPUA 3UTPD 2R1YB 2DQDH 4GSDH 1UG9A 1BREA 1A7RL 4HK0B 4LCWA 1GXEA 1AQDA 2GFBB 1K5NB 3C9NA 5SX5K 2ICWJ 3BP6A 5DK0B 3K0WA 4XWGL 3GBMH 3S96A 1AY1L 3HI6H 4QXTA 1KCRH 2Y5TA 2WBJC 3D39E 2WIMA 2JCCE 5TDOA 3LQZB 3TBSB 2OMBA 4CL7A 4PRNB 1T6WA 4C59B 4NDMA 1NSNL 3D9AH 1ZLWK 4E42A 4B50A 1P7QD 1AGBA 3QXUA 4Y5YC 3SDXB 1OW0A 4U05A 5I8CB 1N59A 4M43H 4JPIB 5J6HB 2CLVA 4JFYA 4NO5A 3JWDL 3QH3A 4ZFGL 2I5YL 2FGZA 4NQCA 5HGBA 2O26U 4PJGB 1GHFL 5EU6E 3DROB 1R0AL 4Y5XC 1GAFH 3ALXA 1HYSC 1ZGLB 1WSST 5C9JB 4P46D 3SGDH 1NCWH 2K1MA 4NFBA 1EEUA 3QYCA 3KNBA 1YC7A 4GXUM 4PRHD 1G7HB 4MS8C 5C0CD 5IVXB 1NAKL 2ZPKL 2FR4A 4ELMF 3C5ZD 4Z7UF 4RAHA 3QCTH 4LCWE 5BVPH 4QRRD 4HW6A 1ZLVK 3GSVA 3V8CA 5I1HH 1OSPH 1U8IB 4UAOC 1AHWA 1KJVB 3VXNA 3B5HA 2DJUA 2MTPA 4WI9A 5D70H 3H9SE 5HI4D 2LQRA 3T65A 1RFDL 5K9QI 4HUVA 4DEPC 5KVEL 1UFUA 4GW5A 4YX2H 4ZNEA 3U48A 3HAEH 3TLRA 1HSBB 3MXVH 1B0GA 3GMLA 4O51B 1DQLH 4H20L 5DR5H 5GGSB 1QFWI 3IF1B 5I1AB 4H26A 3E2HB 2HFEA 4WHYG 2ZG1A 1LP9B 5CSBA 4ZD3H 1IC4H 1RU9L 1INDH 2E7HA 4X6EB 3FCTA 4DN4L 4DKFL 3V0WH 3QUMB 5A3IC 4IMKA 2KQNA 3MV8B 4RBPH 4NUJA 1PX3A 2DYPA 3F58H 5FUZL 1X7QA 3REVB 1MRCH 3RVUC 3CFEA 1LO2H 3OHXB 3V5DB 4I18A 1DE4A 3U6RB 3O9WC 1LE9B 1V5JA 1EJOL 4LASH 4FFVC 3QG6B 4Y4KB 3BGMA 1KPRB 4NNXB 1FFPB 4GKNB 3L6FA 4PJXF 1S5IH 3OG4B 2CDGB 1MWAL 5GISL 4X80H 3L95A 4GRLC 3TO4D 1SHMA 2DWDB 3V9FA 1DLHB 3OB8A 5J11C 1EEQA 4ZOEA 4X7SH 4R9HA 4HH9A 5J13C 4P23A 5CINH 3DTXA 4J7RA 4GBXC 5FK9A 2QEJA 1G9MH 3LMJH 1LNUA 3MOBH 4ZTOL 4KC3B 2A1WL 5M94B 4ZNEE 2BRRH 1HKFA 3EJYD 1F3DH 1AC6A 2AI0H 4XMPL 1CS6A 4ODWB 3C09B 5T1LA 3LKQB 5BV7C 3ULSB 2YPKB 5LQBH 5ACLA 2O93L 2ZKHL 4PJAF 2YPLD 5JMOC 1RULL 1KIRA 5GJTH 3FN0L 5HDLA 3DUHA 2KZ1B 2V2TB 3PHOA 4WDIB 4LCYA 3EYOB 1IGYB 4YEEA 1MI5B 2Q76B 3A0OA 4M8QB 3PWNA 4IRJC 3O4LA 2ICWI 1FZJA 5ANMB 5GGRY 3BKYH 4G5ZH 1DSFH 4AEIH 4K3JH 2MNUA 4KY1H 4H88L 5I1GH 5GSVB 2GI7A 1UYWL 1OF2A 1QR4A 2AK4D 3BDBA 1J1PH 3DXAB 1ZVHA 3KHQA 4PUBH 3SKMA 1U58A 1FNEB 3I84A 5D96B 3GSWA 3X13B 3L3GB 3BMWA 4Y7MA 1GVIA 1V7NH 5DWUH 1NMBH 5KANI 4KJWC 4WWKC 3VI4F 3CCHB 1A21A 2NY5H 4V2CB 4OLXL 2MCG1 1N5YL 2JB6B 3SDDB 4R4BB 1M71B 4L9LB 2M8XA 5ICYB 3QI9A 2L0DA 1YQVH 5I6XB 2VH5H 3FO1B 2XTJB 4Q9RL 1CFSB 5E8NB 4ZAKB 1WBXA 3QPQC 1VGEH 4ALAH 2BVPA 1ADQL 4OAWA 1IEBA 4OD2B 4ODUA 3EIFA 3OKEB 3RNKB 1NFDE 3RGVD 4Z7VB 4PJEB 3DO7B 5ITBH 2CMRH 3O0RH 2CXGA 3PXHA 3O45B 4HWBA 4JFDD 5CEXA 1T0NA 4HWEH 4FFYL 2FWOB 2X9YA 5AAMA 1BFOA 1R5WB 3PNWA 3GMMB 4KZDL 4JPWH 4NKIH 1LE5A 1U8QA 1HEZB 4UOW0 2Z92A 3QUYA 3WN5A 5FGRA 1GZPA 2V9RA 3VD7A 2J5LC 1ZLWH 4E41B 1HIMH 4XP4L 5I18L 2F58H 2UZYB 4NHCL 4L4VA 1X5HA 2EDTA 1YQ2A 2ZUQC 3ARGD 4OQTH 5DVOA 5E8EA 4J3UA 1CLZH 1JUFA 5K9OB 2VXSL 1QQDB 3PQYD 5IW1B 3VXME 1U8HB 1AGCB 4Y19B 1UQSA 2LAAA 4MB3A 3QEHB 1T80A 3DVNA 4N1HB 3K2UH 4KKCC 1Q9WB 1YMHB 1JZ7A 3O6LL 5HY9B 5L2JA 4JKLA 5IROC 4OGXL 4N5EC 3L3KA 1QBLH 3MROB 5C2UB 1BOGB 1JNLH 2J8UB 2VC2L 1EAPB 4MWFB 1F2XK 1WCBB 2NXYB 2H1PL 1BQHG 3KS0J 2AJYH 1TJHL 4HLZH 3RWHB 1H8NA 4CN4A 3SN6N 1MFCL 3ULVD 15C8L 3MV11 2HP4A 1U92B 2F54E 5MHSD 1XGRB 5ETUB 3IU4H 3TIDA 1CDBA 5JUEL 5T3XD 2HTKD 3FAWA 3SCMA 2MHAA 2QR0A 2IF7A 3AMLA 4ODTL 3LB6D 1FO0A 1P6FA 5D7LA 5DEGA 5FO7A 5CGTA 1I9JL 2I24N 4G42B 1IT9L 5FV1L 4FS0A 4IM8A 4MZ2A 3GBNH 5DS8B 1AXTL 1YEEL 1KTKE 3U0TB 5I16B 3P9WB 4OM1L 4G80B 1CZ8H 5E56A 1T89C 4P4KB 4LHUD 4WFHE 1KN2L 1VADB 3DMMB 3MUY1 3HPLB 4JDVB 3GHEH 3ALWA 1U3YA 2BNQB 4BELD 1CN4A 4YGAB 3FB6A 5FB8A 3P4LA 1JP5A 5IB1A 1UB5B 5KG9A 2HWZL 2XY2A 3F5WB 3UYPA 4L9DA 5JORB 2HTLD 4PG2A 1F90L 4CBPA 4BSVB 2VDRL 2D7NA 4BFGA 1NBYB 1NUFA 3EO0A 3MGTA 4ZG1A 4JHBA 3H7LA 1OGAA 1QBBA 1JN6A 5E4IA 4Y88A 1NGWB 1QO3A 2I07B 4CMMB 1WT5C 2Y5EA 1XIWB 3MRDA 2CPCA 1QFWH 1HI6A 5JR1H 3N9GH 4X6FA 1QG3A 2E7CA 4UDUB 2XICA 5F70A 5FO8A 5B39A 1W0VB 3O3EB 4XC1H 1Y18B 3QDJA 3VFMB 2D7TL 4JHAL 4JZNB 4JFFD 5HHNA 5E2WH 5A2FA 4OB5L 4P57A 3FQRA 4M6NH 4DZ8B 3L1OL 2A6KA 2FBOJ 5ICZA 2X70B 3WYRA 1LEIA 1B2WL 1LMKA 1DP0A 2OCFD 3U4BL 5F21B 5DTFA 5JW5A 3ULUH 1LEGB 4U1NA 3SO5A 4M03A 5F7LB 1NFIB 3TJHD 3RKDD 2P7TA 3RWJB 3S6CA 5D7IE 5EFIA 1ZT1B 5JOEA 1AD9A 4X8JB 3QIUD 1NGXA 1RZ8B 3ARFB 3D18B 4H1LB 3M45A 1I8LC 2NW2A 4OCRL 2F53E 5D5ME 3PV6B 1C16B 5H8DA 4QRPA 1CGYA 4H0GA 2WAHA 1JNJA 1AO7B 4YDLC 2ILLA 1NDGB 3DVGA 4Q0XH 4D9QD 4A6YL 5MEOB 4J2XA 1UJ3A 2AJVL 2MWCA 5EOCH 1YEIH 1FL6A 3EUUA 4XAKD 1NC4B 2WBJD 4MAUH 3WNKA 4KZEL 5L2KD 1JL8A 4ODSL 4POZC 1FNAA 1BZ9B 3QJHB 1KV3A 2FEEI 3IAPA 1WZMA 3T0AA 1E28B 5KVDH 2O5YH 1R3JA 2P43B 3QDJE 3DOSA 3DRQA 5F7DA 5C0ND 5J6GA 3O3AB 2FRGP 2YSSA 1GPOL 1JBJA 5K59F 3EFDL 3CPLA 3H8NA 3KPQA 2VITA 4L3AA 5GRUL 4N9GB 4PRAA 3PF2A 3VI3F 3B9AA 1KJ2B 1A9EB 4LSVH 3S7GA 4KKAC 3KVQA 2PF6A 5IHUH 5DUBA 3AU1B 1HYSD 3FO0L 4MXQD 5HHPB 1A4KA 3OWEA 5F1IB 1YMMD 2RCSH 3BP5B 5IVZB 4C56D 5EBLA 2GK2A 4O5LH 5ABDE 3DWTA 3HPJB 4NQEE 4TNVF 2QADC 4XX1E 1OAXL 3QRGH 3UEZA 3OL2A 1DQDL 4OLVL 5CJ5A 4S1RL 5DRXA 4HUXA 4XTRD 3JVGC 1CL7L 1AXSB 4X9FA 1T03H 2YXFA 2VZSA 4X6CF 4QRPE 2NPLX 3TVMC 3DI3B 1ZVSB 2VAJA 4NZDA 4Q6IC 1SYSB 4HXAL 1AP2A 2CK0L 1I8MB 4YHOH 3EDJA 1E27A 2E27L 3RZCB 4KK6C 2G75B 3WXWL 3K81A 4LU5L 1VGKB 3RDTA 2V17L 5DA4A 3TN0D 5DD3H 3F7VB 3MLVL 4RISH 1F02I 5DUMH 2VDNH 1WISA 1WV7T 1CFVH 4YPJA 5L0QB 2EYRA 1BAFH 3PIQA 3WBDA 1MJ7L 4F8TA 1WZ1H 2X1PA 4LSPH 4OLEA 2VMFA 2LU4A 4LCIH 3ETBF 1QYGH 5FM4A 3BH9B 4PGEB 3DSFH 3A67H 4QHUA 3S88H 1EHNA 1KEML 4O2EA 3IFOA 1BZ7B 4FQQA 1D9KA 1TVBB 4NQXB 4G8FB 4GKZB 4Y0GA 3NPZB 3RVUD 4FG6C 1I1AA 2MPAH 4KXZH 4M1CC 1V8HA 1W0WA 3Q3GA 5BVJB 3O9WD 1MF2H 2CKBA 3BZDA 3KWWA 5DJCB 5E2JA 2AXGA 3SKOA 1MHEB 1PQZB 1KC5L 1HSAA 1U91A 3HC4H 3MLRL 1XF5B 5EPMA 4GRLD 4L3CB 2XWJA 2NZ9C 3JV6A 1FNSH 3UTOA 5E8PA 4C83A 3X12A 4ZS7H 4P2CG 4MDIB 3EYVB 1ZTXL 1ES0A 3QUKA 1JFQL 3JBG7 3FO9B 2QTEA 4FRWA 3LKSB 4KUZL 3MMEB 4U33A 2AEQL 1H5BC 1YJDC 4GG6B 5B8CC 4ODVL 1LEKB 5TF1L 4Y1AE 3D39B 5E08H 1IBGL 5DFVC 2JCCB 4BFIA 1IRAY 2DMBA 4I0KA 1KPUB 1LD9B 1YEKH 4JHWL 1DVFC 3WFZA 3RIAF 5JOPE 1UWGL 3CH8A 2WUBL 4X6DA 1MLCB 5JXAL 1QSED 5E1AA 5HYSA 1Z2KA 4HAGA 4IRJD 2NTFA 3FJTA 2YD3A 4JQXC 1AQKL 1F3JA 4YUEH 5HHXH 2XXCB 1MCWW 1CE6A 2Y6SD 4YXLH 3WNMA 4U1IB 2Y7QB 2X09A 4GUPB 3WLWC 3RL1B 4APQA 3ZL4L 3JTSA 5D1XA 4QXGL 2NY0C 1M7IA 2ADGB 1MCSA 1UCBL 1NCDH 4ELKA 2AABL 1BFVH 4JY4A 3L5XH 5DHYA 1FFNB 4QRTB 2JJSC 4IJ3C 3GZKA 3TPUB 5TQ2H 1AGEB 4ZXBA 1KB5H 4LK4A 3L3OA 4NRYA 2VKWA 5INDA 4LCWB 5DMKA 2DQHH 1AQDB 2GJJA 3ARVA 3C9NB 1CR9H 1F8TH 2OI9B 5ACMA 1EFXD 4G43A 3BP6B 3QPQD 3GIVA 2MKWA 4OI8A 3S96B 1KFAH 1HQRA 1AI1L 2PN5A 2Y5TB 3OF6A 1KUMA 1ZMYA 5TDOB 5A2JH 4TRPH 1RD6A 4LRIC 2B20A 5F8RC 1I85C 5B3NA 1GZQB 1JWMB 1X5GA 3AREA 5GJSL 2VAAB 4WHTA 5DMIL 4E42B 2F9BT 4X6DE 3KPMA 5EZIH 3PL6D 1AGBB 1N59B 4LVNB 2I9TA 2A83A 1A6UH 4JFYB 4NO5B 1ED3A 3QH3B 5HYEA 4JRYA 1TZGL 2NY7H 2Q6WA 4NQCB 3GGWB 5HGBB 1AFVH 3NIGE 3NN8A 5F7EL 1R3IL 4S1SL 3A6OA 3RQ3A 3EO1A 4HJ0D 1MCPL 3NA9H 4K8RC 1UH4A 2R0KH 5IQ9A 4NO0D 3KNBB 2KH2B 3MBXH 3MLWH 1U9KA 2FR4B 1XAUA 2P8MB 3O2DL 3CVHH 2ITDA 3S34H 4M1GH 2DQCH 1UVQA 5CJQL 5C07D 1NGPL 3GSVB 4RMWA 4IRSC 5DDHA 1MNUH 1AHWB 4GAJL 2C26A 2G5BA 2W9LA 4LAQL 1ACYH 3PP4H 2X10A 4NN5B 3T65B 4HUVB 4N8VA 2KL6A 1YC8A 4GXVH 4K7FA 4GW5B 1CD1A 2XN9A 1B0GB 3GMLB 4YO0A 3UDWC 4OIIH 4NT6B 1TNNA 1KPVA 3VGDA 4Z95H 4AL8H 2HMIC 4RQQA 2QSCH 4JM2C 4MJ6A 3UBXG 1UB6B 2A74A 5KS9F 1MFEH 2NY6D 4H26B 1DBML 1GGCH 2HFEB 3M8OH 4JRYE 3KS0H 5CILH 3DJ9A 2E6QA 4L4TA 3W0WA 3MOAL 3FCTB 4NNPL 3PDDA 3L5WA 4MHHI 4ZYKA 3VFGL 3UZVB 2LTQC 4NUJB 3PWPA 1Q8MA 4JY6A 5E7BA 1NMAL 4M4PA 2G5RA 1BECA 1UA6H 1UADC 3I02A 4I18B 2W0KA 3JWOC 1DE4B 1NFKA 3S37L 4HUWA 5GGQH 3ZKND 3BGMB 3KLAA 1MPAH 3RVVD 1LO0H 3VRJA 3L6FB 4PJ7E 4OFPA 3WNPA 3VWKC 2R8SL 5ALBL 3IKKA 1LO4H 3OGCA 2NY4C 2CUMA 3OAUH 1MCOH 1J10A 4HH9B 4P23B 3AB0C 5FK9B 1RJLA 2BCKA 2R2BA 4KHXL 1LNUB 4NKOA 2FJFA 4WFEE 1I9EA 3ZZ1A 5LGKA 3MRMA 4JJ5B 3BSZH 4PTTA 2XN9E 3P0YL 1I3RA 5D6DA 2IAMA 4K07A 2I9LA 2B4CC 5T1LB 1B3JA 4F57H 2H6PB 5C0AD 1ZHBA 4YE4L 4P2RA 3LN9A 1AJ7H 1MLBA 3MREA 1X6NA 3B9KC 4FNLL 5F7FA 3HI5L 4L29A 1MAML 4PD4K 4G6ML 1U2CA 1R5IA 5C0BD 5IMLA 4G9DA 3PHOB 4L4TE 3R1GL 2LABA 4LCYB 1MIEH 1OL0A 2W0LA 3CXDH 5FHAH 5AZEH 3GKZA 3PWNB 1NCCH 2DQGH 3O4LB 4Y4HD 1FZJB 3OAZH 4S1QL 3WSQL 4LDOB 4KAQL 4PRDA 3VRLF 3RPIA 1OD9A 4F8QA 1OF2B 3RKPA 4HBQA 3RI5F 4NQDA 3K8KA 4GRWE 3GSNL 3I75A 3SKMB 1U58B 4XBEH 4PB9H 4G6AD 1EAJA 1KTLB 3S3SA 3ZSSA 1MRDH 4DOHE 3KR3L 3GSWB 2EXYC 3U2SA 3V6ZB 3ULUF 2EIEA 4X4YA 2B2XH 4NJAL 5I73C 3QI9B 1EO7A 5I75B 1AD0A 2FYYA 3U0WL 3HC3L 2EE6A 3MLUH 2Q8BL 1NCBH 3QWRA 3RA7L 2ESVA 1WBXB 5LJYH 3KPRA 5E9DD 5C6TL 2BVPB 3LKNA 4OAWB 3ARYA 4ODUB 3VDAA 4OF0A 5FYKL 2AEWA 1Y0LA 3T8XA 2JELL 4N8CH 2W9EL 2IFGA 2IGFH 2BNUB 3I3EA 3SE4C 1MFDH 5CEXB 1T0NB 1A7QL 1B90A 2CIIA 3U7WH 1BFOB 2R29H 5KSBF 1RIHH 3VXRA 1U8QB 4J6RH 1A1MA 1TJIH 5F3BA 2Z92B 1MQKH 5EZOL 3QUYB 1GZPB 4KJQC 1NAML 2Z4QA 1I1YA 5E1HB 3WNLA 1OQOA 3TBVA 5C86A 4L4VB 5HYJA 5JDJA 1U3HC 5E8EB 1JUFB 4NQDE 3VWJC 4LCCC 3LD8B 3T04D 1UQSB 1VFOA 3ISWA 3LHPL 4ONFL 4POUB 3DVNB 1G7PA 5T5NF 1PG7H 1QP1A 5CEZH 3OKNA 5L2JB 4UIMA 1H9VA 4A6YA 3L3KB 5T3ZL 1DQQA 1MQ8A 2P45B 1FC2D 1JVKA 4R97C 3MA9L 4M6AA 1N8ZA 3RFZC 4M7JL 1OD7A 2GUOA 2C4XA 2ESVE 1CE1H 2UUDK 4PJ5A 2FX8H 1V3KA 1NBQA 5HI3C 1PJ9A 3X11A 3ARSA 5ID1B 4JDTH 1HYRC 1TTGA 4G6KL 3QDGB 1EVTC 1IQWL 1S3KL 5DK2B 4D9RD 1MJJA 2O5ZH 2B5IC 1QSZA 1C5BL 3SCMB 3BXNB 2MHAB 1E4KC 4YK4B 2QR0B 1QD0A 2HKFL 2X05A 1A7OH 3VXRE 5DMGD 2VLRE 1FO0B 3O6FC 5D7LB 5FO7B 2JJVA 4NCC2 1WEJH 1MCEA 2WBWB 4LGRB 4U2YA 3BRDA 4K3EL 1PG7W 3DX7A 4PP2A 2CDFA 5C09D 4FG6D 1M1SA 5HYJE 4GSDL 3UZQA 4BKLA 2W38A 3LPFA 3MRHA 5A2KH 3MNVA 5DD0L 1ZHLA 4LLQA 4D0CA 1QRND 1QRKA 4YDIL 1JF1B 5HSFA 3GBML 4OZFA 1KCRL 4J23A 4PRPE 3QEGH 1RZKL 2NZ9D 4W6WB 2ZUTA 5IB1B 2NX5D 3IDMA 3HUJE 1H3PL 1S9VA 3HNVL 1ITCA 4PLKC 4XBPA 3OG6B 4MLIA 3AM8A 4M00A 3LN5A 3P0GB 1K6QH 4OCLC 1OGAB 5CS7A 3LEXA 4PJ5E 1YJDH 1NUNB 1BF8A 1JN6B 2YWYA 5MI0B 1QO3B 1C1EH 3VGGA 5F1NA 3UYOD 2DDQH 3I6GA 3MRDB 5HHMB 1HI6B 4L8DA 5D1ZA 4X6FB 5IBTH 3V4PH 1DVFD 4CN6A 5DVKA 5FO8B 5B39B 2YOCA 4PJGF 5E8OA 1NCWL 4JJHA 3OJVC 5HHNB 3WO3B 4XPGH 1EO8H 4OZHE 1PYWA 3IVKB 3FQRB 1RURH 1ZGLP 3BFOA 3V6FA 1JZ2A 3Q1SH 5ICZB 5EBMA 2PO6C 5LCVL 4D0DA 2YZ8A 1WZKA 2IEPA 5JW5B 5DTFB 1A5FL 2VOTA 1OGTA 3DARA 4XGZA 4AQOA 4U1NB 3UPAA 4R8WH 1MHPH 2F8OA 4X6BA 5I1HL 4TTDD 4GQ9L 3WLWD 5GS3A 5JXED 2H3NA 3KJ6L 5IR1B 5SV3A 2J4WL 1XGUB 1AD9B 3OAYK 4G8GA 3D69B 1NGXB 1BBDH 3G5XA 3LRSA 1ZT7B 2J6EL 4K3HA 4YX2L 2NW2B 5BZDB 4IDJH 3MXVL 1KLUA 4WGWB 1IFHH 3WFCL 3IRZA 1IKNA 3VGBA 4S11A 5DR5L 3DVGB 2C9AA 3W81A 4ELMA 4WFFD 1NLDH 2IADA 2R56L 4IOIB 1HHGB 4Z7UA 1M05A 1FL6B 2P5WD 3ILQD 2VLJD 3IJYA 4TVPD 1IC4L 1JPSH 5GS0C 1INDL 4YBLB 5ESAA 4W6YB 1JMXA 4MXVF 4OUOA 1XGYH 3O8XC 2KKQA 4OZGF 3OZ9H 5F9OH 1R3JB 3F58L 5B3JE 4H5SA 4X7TA 1JGVL 3RY6C 1MRCL 5F7DB 3DRQB 5J6GB 5ACZA 2YSSB 1LO2L 2VZOA 1XH3A 1SBSL 1CBVL 3CPLB 1A6ZA 3KPQB 4CGTA 2VITB 3T3MF 4WWID 4R90L 1S5IL 1DJSA 1T5WB 3HZYA 3HRPA 4Y16A 2BY3A 5E2TH 5DUBB 2ZNXA 4L4JA 4NJ9H 4WUUA 3N50A 4K8RD 1A4KB 4Z7NE 2GK0A 3C60A 3CLEH 5EBLB 1BGXH 2LAGB 2IANA 2YN3A 4GXUN 1A6PA 3LMJL 3MOBL 2PR4H 4ZODA 4HKJA 4F2MA 5DRXB 4KROB 1N6QL 4HUXB 1MREH 1NBZB 2X1QA 3TZVA 1BQLL 4H8WH 3B2UC 5JHDA 2NY1B 3OJ2C 2PW1A 4EDWL 4ELME 5KN5A 2LVEA 1AP2B 4RGOL 1CICA 4JFOB 1E27B 4PJXA 1P9MC 1TETL 4OI7A 5EWIH 3P9MA 2XZCL 2DBJA 3J7HA 3BT2H 1KTDA 5JOFA 3ARBA 4PJ8D 2EYRB 1RUQL 3SE9H 3PIQB 3BKYL 1JPGA 5BS0A 4G5ZL 2GTWB 5I1GL 4K3JL 2EO9A 3ABZA 5C0GA 2HMID 3E3QE 4FFZH 4JM2D 4K94C 1DN2A 2UUDH 3RJDA 4PUBL 2JE8A 3ZE2F 1WGOA 3AC0A 2XZAH 4QHUB 3EAKA 4O2EB 3OB0K 3IFOB 4JZJA 3NCJH 4FQQB 1V7NL 1D9KB 4P2OA 5DJ2A 3V7AE 2IFFL 2AVGA 2NY5L 3E6FA 3PUCA 4NWTH 2BNRA 5I1JH 3WFBL 2VXTH 1I1AB 3IETB 3O2WH 2WP3T 5E5MA 1V3MA 1QLEL 3JWOH 1W0WB 3LH2L 3Q3GB 4M5YH 4PG9A 2VH5L 4K3DH 2CO6B 3QWOA 4JM4L 3BD5A 2CKBB 2AXGB 3AS0A 3O2DA 5IOPA 1BD2D 4M62H 1HSAB 1U91B 4IRZH 2UZIL 3U7YH 1GGIL 2YMXH 2GHWB 3VWKD 5EPMB 3NH7H 5ITBL 2OR8A 2QHRH 2XWJB 5JHDE 2F74A 3DX6A 2NY4D 3JV6B 2DQJH 5E8PB 1A14H 3U36A 2ZUVA 1EZVX 5SX4I 4C83B 3X12B 5EB9A 2YRPA 1NDMA 4G9FA 1ES0B 3B4NA 4GKSA 3PWUA 4JPWL 4NKIL 4U0RC 4GAFB 4RGNE 4LRNH 1BVZA 3EJZD 1RZIA 2B4CH 3MRIA 4PIRF 2F58L 2Q86A 3ESUF 5F7NC 4ZOBA 3B9KD 3H7BA 4J3SA 2X6MA 2Y23A 1YY8A 2FJGA 3WKMH 2VE6A 2XG5A 3GJEA 2YPLB 3MRJA 4ONHA 2ADFL 5F8QC 3X3FL 1JE6A 3C6LA 1T83C 1YEHH 4X6DB 1RK0A 5ELIA 3LS4H 4UT7L 4PGBA 2YPVH 3E2HC 2NTFB 2BNRE 3TT1L 2A6JB 3T0ED 1CE6B 3WO4B 2ZCHH 3IGAA 5BRZA 1JNLL 3TWCH 5F88B 2NW3A 3TA3A 1XF1A 4APQB 3JTSB 5FHBH 5D1XB 3VXTA 4YDKH 2N4IA 3BYTA 1CD0A 2AJYL 5FXCH 4TPRH 5L8LB 4KRLB 4ELKB 4WFGD 4HS3A 5ALCL 3ULVL 1TTFA 2NY2B 1J0HA 2YD7A 4JY4B 5DHYB 2C5DC 5TH2A 2LU3A 4Y4KC 5D7JB 1BEYH 4GOSA 2BVYA 4LP5A 3RWIA 5T3XL 1YECH 1Q72H 3IU4L 4ZXBB 4NRYB 2IWGA 4WCYH 2CR3A 5DMKB 1HOCA 3T2PA 4BA8A 2CIKA 2YUXA 4G43B 2M2DA 1JPTH 2NCMA 2NXZB 3GIVB 5AUMA 5JW4Q 1WICA 1P6AB 1HQRB 2BJMH 4P4RA 4UNUA 1FGVL 4ZO8A 4QWWD 5I1CL 3C09C 3BW9B 4MQXC 4OKDA 3HZVA 3C87A 4K9EH 4NUGL 3F6LA 1B4JH 3WXVH 3AREB 1YPZF 4WHTB 2VZ3A 1W2KT 3KPMB 2D9QB 3GHEL 2JB5H 4HAFA 2I9TB 5LKNA 1QPXA 4I77H 5T33L 3V4UH 1ED3B 4OZIE 2Q6WB 1Z0MA 3CSYA 4M7KL 32C2B 5BRZE 1U3HD 2FECL 3NN8B 1JCKA 5DQJA 3VWJD 4UINL 3EO1B 2DS4A 2N7AA 3GSNA 1N0XL 1R3LA 1UJTA 3DYOA 3QA3A 3O6MH 4MJID 5DJYB 5C1MB 5I71B 1QLRB 5DGRA 3F6IA 5E99L 3N9GL 1NKOA 2ARJA 2I60H 3WDIA 1UVQB 1ZEAH 2V5YA 2WINB 4DW2H 3TT3H 1C5CH 5DDHB 5KTEL 1XEDA 3RU8H 4PLNC 2G5BB 2Z0BA 1U8OA 4NBYB 4HG4K 5EOQH 4JFHE 5I6XC 3AGVA 2XTJC 3QFDA 3CSBA 4ZAKC 2BMKA 4G7VH 2D0HA 4J3WA 4MAYD 4ZPTA 2HAZA 4K7FB 3BN9C 1WIOA 3VMOA 3B43A 3HS0A 5H37G 2ZUWA 1J8HB 4YO0B 2YC1A 3N85H 3MA7A 3SDCA 1KPVB 3ME0A 1P53A 4OFKA 3ZHKA 4LKCA 4YNYA 3U9PL 4Q2ZA 3O6FD 3C6SA 4DKAA 4RQQB 4MJ6B 3PXJA 3MRQA 2A74B 2E6JA 5IMMA 3UJTH 2BHZA 2J12B 4KTDL 3NCFB 4L4TB 3EO9H 3W0WB 3ZDXE 4X9BA 4ZYKB 4XB8A 4I2XE 1P84J 3PWPB 5EDXA 3FQXA 2V2XA 3PJSA 4UV7L 5JA8B 4TN9A 3KDMA 3I02B 5EOCL 5HHOA 4WUKH 3QFJD 1YEIL 4HSQA 5J3HD 4HUWB 3GRWH 3RZWA 4HC1L 4DOHB 4KI1A 5JQHC 3VGHA 1T5XA 2GJZA 2DIJA 3RTQA 2O5YL 2Z31A 3MZGB 1P7KA 1NC2D 4LQFL 1GSMA 4RAUB 4KMTH 2H2SD 1R3KA 5DFWH 5EBWA 1CT8B 3KGRA 3F12A 2NXYC 1RJLB 2BCKB 3IKCB 3IDNA 5FYKE 4HBCH 2DTSA 4X98A 1HH6A 4OLUH 4LSVL 4NC1E 3MRMB 4P2QD 1OVZA 1I3RB 1JTPA 2VLME 2P5EA 2I9LB 2R4SH 2VL5A 1ZHBB 3KXFD 3MLZH 4P2RB 3ARTA 4JGUA 1MLBB 2FNBA 3MREB 1FSKB 2Y9RT 4M93B 1L7TL 4BZYA 5CKGA 3AMKA 3CLFL 3QQNA 3QXDB 3TBYA 4QKXB 4JFFB 4L29B 4X5LA 3QRGL 4KHTL 4WEUD 1R5IB 5HYFA 3Q5YA 5IMLB 4M1DL 4G9DB 4Z7OF 5ID0A 5FF6B 1HXMB 3EOTH 2EIDA 3FAXA 1M7DA 1FE8H 2NMSA 3D3VE 2XKSA 4LSSH 4PRDB 4YHOL 5D1QA 3RPIB 4HJJH 2DQUH 4P4KC 4NQDB 2VDQH 3I75B 3QIUB 1JTOA 1I7RA 5E2UH 5SX4H 4HIIA 5DD3L 4NZRH 5LWYL 5DUML 5T3ZE 1Q0YH 4RNRA 1EK3A 1R3HB 4X4YB 4PJBB 1J88A 4LSPL 4KUCF 1AD0B 2FYYB 1QYGL 4KMLB 5C2BH 2A2QT 1A6TA 3A67L 3VH8A 5GS0H 2YD1A 3S88L 2FX7L 4JDZA 5D2NA 3KPRB 4YXKL 3LKNB 4JRXD 5HVHB 4I3RH 1IAIH 3O8XD 5CJOH 3GJFK 4V1DA 4FQLH 4PJIF 1CFQA 3CZJA 1Y0LB 3T8XB 4U3CA 1FYTA 4PRHA 5E00B 1F4YL 2CIIB 2OZ4H 1G6RL 5I1EH 4LSQL 3UTPE 1Q94B 3N1GC 3VXRB 5KSAA 5JDSB 5F3BB 1YEFH 3HC4L 2E7BA 5MP6H 1D5BA 5EC1B 1UWXK 2Z4QB 3VXSD 1FNSL 3P77B 3BZEA 4U7MA 1KNOA 1X5JA 2EDLA 1SJEA 3TBVB 5HYJB 3VGAC 3EYSH 3V7MA 5D93C 3VXOA 3RUGE 4D8PB 3NGBB 4CJ1A 2J6EA 1QLFA 3WFHA 5HI5C 4ZTPH 3HAEA 1YNKH 2AQ1A 1G7PB 3ARFC 5I0DA 5BV7L 2BP3A 1OOAA 3SOBL 3WMSA 5GHWH 4I13B 5GZNC 2XRAH 7CGTA 3GMRA 3OKNB 5F7HA 4UIMB 1K2DB 4NO3A 4A6YB 4G3YH 2F5AH 1DQQB 2GY5A 3MRFB 3D0LA 4NPYB 1N8ZB 4NOFA 1UKSA 4WI7A 3BH8A 3JV4A 2GUOB 5L6YL 4HGMA 3X14A 5D2NE 1D3CA 4XVUC 3MJ9L 1CU4L 2AGJH 2DLFH 3CX5J 3ECBB 5FYLH 2GJ6A 2DIBA 4HT1H 3LEVH 2BSED 4YXLL 3QQ9D 3OX8B 4PRHE 4K94H 2AJUH 4EVNB 3LPGA 3GB7A 3BGFB 4QTIH 4DTGL 1MJJB 3CMOL 4FN0A 3BO8A 4RA3A 4HKBA 4PRIA 3QDMA 1NCDL 4QF1A 1INQA 1BFVL 3NVQA 4QRRE 5E8DH 4BJLA 2F5BH 1OTSC 1O7VA 4PP2B 3DX7B 2CDFB 5ADOH 4TNWF 2NR6C 1KB5L 3K74B 2X41A 4MD5A 1CCZA 3UP1A 4U6VH 4BUHA 5IB5A 3VDBA 3MRHB 4K3GA 1PKQE 3MNVB 1CR9L 1F8TL 2VABA 4LLQB 1KYOJ 4D0CB 2FH6A 5CZVH 3PHQB 3V5HA 4KI5D 4P2YA 4U3HA 4OZFB 3HG1A 2BSSB 3DECA 4TUKL 1XFPA 2D9CA 4WVRA 3TBTB 1HH9A 1S9VB 3NFSH 2EXWC 1FAIH 4XBPB 2AERT 4I0PA 5DEZA 3B8SA 1IAOA 43CAA 2AJZA 3LN5B 1U8JA 3QISA 3IDUA 3RZCC 3LEXB 4J4PA 3QRFM 1KGCE 5E7FA 1VCAA 5F1NB 3I6GB 3ZYJA 2NY7L 3VD3A 1JYNA 1R6VA 4L8DB 4UQ3A 1BVKA 1DUYA 2OL3H 5D1ZB 1CF8L 2WWKO 4P5KB 4X7DC 4P9ML 5HGHB 2R0KL 4PRIE 3VW3L 1A7PL 3FQUA 1PYWB 4N0CC 5TE6L 3MBXL 5FOBA 1AY1H 3V6FB 3WLBB 1AKJA 4M6OL 5EBMB 4HXBH 3ZT6A 1IGMH 1D6VH 5I8OL 5DQDL 3IDYB 5DHVH 1OGTB 4XGZB 4M1GL 2DQCL 4O2CA 5F44A 3MV8D 1FN4A 4X6BB 5B22A 3I6LD 2ATPA 2H3NB 4AM0A 5DC4B 3AVEA 2FEEL 3PP4L 1ZLUH 1SMOA 4LARL 4N90D 1GIGH 3GHBL 4G8GB 4Y4KD 1GGBL 3G5XB 3LRSB 4GXVL 4ZFGH 2I5YH 3QAZB 3ARZA 1KLUB 2ZUXA 4LP4A 1IQDB 4WTWA 3RNQA 1GHFH 5EN2A 2HA1A 4OIIL 1R0AH 5F9WB 5C08A 4JO2H 3VMNA 4ELMB 1S7UA 2QSCL 2IADB 4ZO6A 2G60H 4Q58C 4Z7UB 1RHHB 5I1IL 4TULL 3IJYB 3JXAA 5ESAB 3ARGA 4OQTA 1QHPA 3ARXA 3BISA 4WV1C 1F97A 3CXHJ 2D03H 4FXGA 4H5SB 4X7TB 4NN7C 4YFLI 1N6UA 1LVEA 1UA6L 4KVNL 5ACZB 1XH3B 4J12A 1UCTA 3HC0B 4LVHB 4EZMA 1A6ZB 1QSFA 1N0LA 2LU7A 4LLVA 5GGQL 5CSZA 3GJFH 4KK5C 5KVEH 1MI5D 1LO0L 1T7XA 1KTRL 5DT1H 3HZYB 3DX9A 2LFGA 1IGTA 5DVNA 3IDXL 4WUUB 5CMAA 4HCRL 5MEQA 4G6FB 3OAUL 1WFOA 3K2MC 1IGIH 1WUNT 3HR6A 2YD2A 3BD3A 4QNPE 2GK0B 1FCGA 4CNIA 3IAGC 4X83A 3VFWA 4WO4B 4I9WE 3DXAD 5BOZG 2IANB 1KCVL 5DMJB 4HKJB 5D7KD 5CIPH 1UWXH 4F2MB 1A6AA 5I1KL 3M07A 3BSZL 4JFDE 4KQ4H 3CX2A 1S8DB 3O2VL 2X9XA 3TZVB 4DN4H 4DKFH 5IFHH 1D5XA 3SDDD 5C08E 5JHDB 3QIWA 1AJ7L 5E5UB 5DRWA 3MCKA 5DGQA 5FUZH 4DUWA 2PW1B 1FC1A 1T7YA 5KN5B 4UUJB 3S5LA 1NFDF 3E8UL 1ZS8A 4PJXB 3JSSA 4PJDE 5F3HA 1KJ3L 4ZNCD 2H32H 4EQ3A 1TQBC 3LEYL 3P9MB 4F9LA 3BN9D 4RGNB 4UDTA 3CXDL 1A6WL 5AZEL 1KTDB 1MWAH 3PQYE 4R7NB 5GISH 5JOFB 3ARBB 3TEUA 2AV1A 1SY6L 3VFOA 1KG0A 5BS0B 2W1NA 5TQ0H 5C0GB 4S0SD 4GAYA 3QEQA 4LSUL 4XBEL 1A3RL 4JG0L 1MRDL 1FBIH 5DI8A 2AJXH 1Y6MR 4JZJB 5A1AA 4PJAB 4P2OB 5DJ2B 4E41D 5JPNA 2B2XL 3C5JB 4TOYL 2BNRB 3QUXA 4U1GB 2XI9A 4N8PA 3OQ3B 1RULH 4KK9D 3ULVE 3QWOB 1NCBL 3FN0H 5FYJH 4UZGA 4EOWH 5IOPB 1TQCB 3VCLB 2DLEA 5T3XE 2RFXA 5D6CA 3E3QC 1NJ9A 4ZUWA 5F6HJ 2F74B 4LMQI 1U8PA 2E3VA 3U36B 2IGFL 2XOTA 1MFDL 2J8HA 1UYWH 2R29L 1HILA 1QFUL 2NXYD 1CYGA 4G9FB 4GKSB 3L7EA 1BIIA 3PWUB 1U3ZA 4FQ2H 5IEKA 1TJIL 1MQKL 1ZT4B 4NN5C 4K71C 1RZIB 1Q9LA 3CVIL 3MRIB 3FFCA 3FN9A 2Q86B 4F7EA 3O3DA 5KAQG 1N5YH 3H7BB 4Y2DA 4Z6AT 1YY8B 2FJGB 2KPNA 2VE6B 1CL7I 4M61A 4JCMA 2KZWA 3MRJB 4ONHB 1W8OA 1MSPA 3TYGL 3C6LB 1FL5B 4OFYD 1J0JA 1RK0B 4G8IA 3U1SH 3HR5B 2XG4A 4PGBB 1ADQH 1PG7L 5CEZL 4PRBA 4LLAA 3CU1A 5EU7E 3D87B 4BQ8A 3PWLB 1RJZA 3GNMH 3IGAB 4JAMA 4P4KD 4BUGA 2WBJA 2DQEL 2NW3B 3DMMD 5EULV 3TA3B 3VXTB 4TUOA 1CE1L 4XXCC 4XMKL 4AY0A 3CDYA 3DYMA 5GRWA 4KZDH 3WNNA 2BNQD 2P42B 3F7QA 5I66A 2VDPH 4HS3B 5AD0B 1B0RA 1E0OB 2YEZA 5TH2B 4GLRI 3MRCA 4XP4H 4Y5YA 5I18H 3QIBC 2A6DB 4JPKL 4NHCH 2XA3A 3ZDZE 3EZJB 4W4OC 1HOCB 2VXSH 2ICWA 3OKOA 4CAGA 4DZBA 1TITA 5T5FH 1LO5A 5ICXB 4Y5XA 5AUMB 2HLAA 5E9DB 1XIWD 4P4RB 5IF0A 2E7LC 3P0VL 3VFVA 3RWGA 1S5HA 4GRWH 4M3KB 2Z93B 3F7PC 3HZVB 1YN6B 4Z78A 3EBAA 1H3GA 1HDMB 2VC2H 3ARUA 1MJUL 2H1PH 5DLML 2B1AH 3TO2A 3VA6A 4D9QE 1IEAB 5D7IF 2HKHL 1IVLA 2CDEA 1NUGA 3EYQD 5AYUH 4BSWA 4YFDB 3CFBA 5JTWA 1FPTL 5J12B 4PV8A 4Y4FC 3A6BL 4XAKE 5DQJB 3T0VA 2DI9A 1S7WB 3TFKC 1R3LB 5D5MF 5HI5D 1YJDL 5I9QB 3UTTB 4HGKC 3WS3A 3ARFD 1C1EL 3D85A 1I9JH 5IBLC 4G8EA 2WP3O 2OXHA 2JF1A 1OARH 4KKNA 1AXTH 2ARJB 1KCLA 1WBYA 1YEEH 3EYFA 5IBTL 4D3CH 3V4PL 1AO7D 1NL0L 2XY1A 1UZ8A 1SJHA 3I9GH 3JUYA 1EIBA 3MV01 1EO8L 3C2SA 1U8OB 1T4KA 1RURL 1TIUA 1SMAA 1BMGA 1NC4D 3DSNA 3QFDB 3V79C 5DO2C 4P0DA 2BMKB 1YMME 4ZPTB 4WTXA 1S7RB 4C56E 1PZUB 3WHXA 4H0IA 1IC1A 2QKIB 3W9EA 3HS0B 3O9WA 1F90H 2VKXA 2YC1B 3QHZL 1XF3A 3MA7B 3SDCB 2VDRH 2OXGA 1VDGA 4LKCB 4YNYB 4Q2ZB 3X3GL 2PXYC 4RFOL 1BF2A 5F7WC 2VISA 1DTUA 4NZUH 5IMMB 1FZOB 2W91A 5F6HI 4PLJC 1OM3L 5EIVA 1T2QL 2WW8A 4C54A 3ROOA 1IFHL 1MVUA 4P3DB 1H3TA 4GBXA 2GCYA 1OCWL 4AG4L 2PTVA 3FQXB 4ERSH 2V2XB 3PJSB 4UB0L 1NLDL 4HS6A 4JHAH 1D5IL 3EOAA 4I1NB 5HHOB 3WKNA 2FO4A 3LD8C 4X99A 1R5VA 1B2WH 3QT2A 2EXWD 1XGYL 1T5XB 4HF5L 5EU4A 3RTQB 1ACZA 2Z31B 3U4AA 5EU3A 2EDOA 1R3KB 5EBWB 2GTZA 5IWLA 2Q3ZA 3ELAT 1DANU 2YA2A 3F12B 3CC5A 5E6IC 3KPNA 4IRJA 4NQVB 1IZJA 3IDNB 4X98B 1HH6B 2V6HA 4NC0B 3C8HA 1RK1A 2YR3A 2M1KA 5E2TL 2P5EB 2FX9H 2VL5B 4K8RL 2IQ9L 4YHKH 5BJTA 5CEYB 3KLHC 5GS2H 4HMDA 3SCMC 2C3WA 4WWKA 5EIIA 2EC9U 2PR4L 3TIEA 1MCJA 4HIJA 4R3SA 4RWHA 4XH2B 4OZGA 3FZUC 1MREL 2D4DA 5ID0B 4KZEH 3KPLA 4ODSH 1KB5A 2H41A 3QR2A 1M7DB 4XNMA 4YPGA 2MQCA 5IESH 1EFXA 4AEEA 3SE8H 3CFJA 1GPOH 5D1QB 4P48A 1GYAA 5D2LA 2PTUA 4CADA 1CDIA 5GRUH 1I7RB 4QT5B 4HIIB 1N4XL 4XPTL 1IAMA 1EBAA 3O11A 5DSCA 3DVFA 5JA9A 1NGQH 3SE9L 3WUWA 2HJLA 2L4OA 3MJ7B 3FO0H 1KLGA 5EA0L 1QSEE 1Z9LA 1L6XA 4JREB 5EUOE 4B7LA 2NQCA 1UXWA 4QHNA 4MXWL 1J7VR 4U6YA 1A6TB 2XZAL 4LSRH 4HMCA 4JDZB 1N2RA 5IKCB 2EE9A 3NCJL 1CL7H 3CIQA 3MGAA 1IARB 3D39D 3MV7A 2HT2C 4V1DB 1B88A 2VXTL 2WQ8A 4NO0A 4DWHA 3O2WL 2EDRA 1FYTB 4GMTL 2CK0H 3WEXA 3QQ3A 4K3DL 1HWGB 5LGJA 1DBBL 1KCSL 2FEDC 5IROA 5IHBA 4KK5D 4LU5H 3CVHA 2OJEA 4M62L 5KSAB 2W92A 4HUUB 3BDXA 3MLVH 2YMXL 2Z8RA 4MA8L 5C07A 3NH7L 1D5BB 2QHRL 4ONGL 3BZEB 1A14L 4FQXD 1KNOB 5CP3H 2DL2A 3CZFA 1SJEB 4YQXL 2ZUYA 5I74B 5ERWA 5D2LE 3VRIA 3VXOB 1DEEB 2Y4SA 5FGCB 4GLRH 5GRJL 4HWNA 1QLFB 4LRNL 3WFHB 3HAEB 1WCQA 2B4CL 1J11A 4PGZA 3FONB 1L0XA 4M7LT 4NO3B 4Y8AA 4QOKA 1PVHA 3WKML 3CDGA 3D0LB 4LCWD 1GC1L 3S8WA 4R2GB 5D7SL 2EDWA 4EDXA 1BQSA 3JV4B 1TZIA 4BFBD 3X14B 3LS4L 4WI4A 1FVDA 3DBXB 2YPVL 1KC5H 4BQ9A 3MLRH 1EHAA 4JKMA 1AGFA 4X6DF 2FJHA 3BVNA 1RZKC 2GJ6B 3M17A 1T0MA 4PJ8B 5CBAA 1RPQA 3UPRA 3RVXC 4HIXH 3GB7B 1NANI 4MGXA 4S10A 3BO8B 1MCRA 4HKBB 1MFBL 1JFQH 4PRIB 3QDMB 2DM7A 9CGTA 1EA9C 3NIGF 4QF1B 4E9LA 5C07E 4KUZH 4HULB 1A4JA 2AEQH 1FG2A 4ODVH 5TF1H 4NQCD 4HCRA 1BEYL 4X7EC 3WS6C 2JIXA 2OX5A 1IBGH 4R26L 1YECL 1Q72L 1IILE 1RZFL 5IB5B 3DLQR 4HK3J 1JGDA 4I3SH 4JHWH 4WEBL 1FZMA 1UWGH 3VG9B 1JPTL 2PW2A 2WUBH 3V5HB 2ENYA 3ROLA 5JXAH 2BJML 3VFPA 3HG1B 3QP3A 5FV2A 3EGSA 5C0AA 1CDHA 3CFCH 4XPFL 3WV0A 3MJ6A 1HH9B 3NIDE 1VB9A 4MD0A 4NHUA 1T1YA 3L5HA 4MA1B 5KBNC 4X4ME 1TPXB 4PR5A 3NCEB 1ZA6B 4F58L 5C0BA 4I0PB 1IAOB 3EOYG 5SWSA 2W9DH 3ZL4H 3OKKA 43CAB 2AJZB 1U8JB 2WANA 4QXGH 3LDBB 2JB5L 4NRZA 1UCBH 3F7YA 5CD3A 5HI4C 1XR9A 4L3EA 1JV5A 1WWWX 4UQ3B 4D2NA 1CIDA 1DUYB 1G0XA 3ARQA 3TH2T 1XMWA 1I8LA 4C4KO 1JZ4A 3FQUB 5DZNA 3R4DA 5FOBB 3ALPA 2DF3A 4TQEL 1CI5A 1YPZA 4Z7WA 2I60L 4KPHL 4O2CB 1B4RA 4DW2L 1FN4B 3H9ZA 2AQ3A 2FIKA 3TT3L 1RIUH 2ATPB 4O9HL 5GJSH 5DMIH 3T0WA 1JZ8A 2ZOLA 2V9QA 8FABA 1EJ6A 4PJ7F 5EOQL 4NM8H 4PJCE 1KACB 2WNGA 4IS6B 1G7MA 4O4YH 4OF6A 5C0AE 3KPTA 1X4YA 4G7VL 5GGUA 5KVFL 4M02A 1TZGH 4U49A 2UY6A 2EKSA 5EN2B 4YWGL 5C0BE 5F7EH 3TO4C 1R3IH 5C08B 3RX8A 1MCPH 4P23D 4LVOB 4BQCA 1S7UB 2OTPA 4XNYL 2BVUA 3UJTL 3S37X 1ZA3A 4QTHB 4P59H 5T1LD 4XVSH 3DV6B 1JWUA 1T66C 5KVMC 3HB3C 4Z5RA 1Z3GL 4N1EA 5CJQH 3JV5A 4FXGB 3PHSA 5MERA 3JVGA 3MRBA 3TBWB 1C5DA 4O00A 4GAJH 2AJ3A 3FT2A 3S97C 3BMVA 3SHSA 2WMPA 4MCYA 3TVMA 1W72H 1CXIA 4L5FL 1KIUA 1QSFB 4LLVB 2VUOA 5CSZB 5GIRA 2R0WL 5C0EA 4YGVA 5ISZA 3RP1A 4Z7WE 3F62A 3KYKH 4FMKA 5A40E 4WNQB 3BDYH 2ICCA 3O4LD 4GRWF 1IGTB 3MX0A 5BO1L 4CDHA 5I30L 5KS9B 1FRGH 5FM5M 3TFKD 4KMTL 5GGTL 3WO4C 4CNIB 4MMZC 3VFWB 1TCMA 5F6IC 1MEXH 2EYSA 5GRVK 5D1XC 5IBLD 4JG1H 3LSOB 4IHOB 4OLUL 1DBMH 1A6AB 4LL9A 1MOEA 4PS4L 1XZ0A 3SGDI 3MRPA 4Q9CA 2XPGA 5JPMB 4LQ1A 2G2RA 1G1YA 4N9OB 4NNPH 1D6EA 5D7JC 1DQML 1D5XB 3QIWB 5DRWB 3HHRB 3MCKB 3QI9D 4X4ZA 4ZXBC 3RWCB 4HZLA 3S5LB 3FO2B 3KPSA 4RA0C 3QWQB 5C0DB 4U1MA 1ZS8B 2CRIA 1J5OH 1X5IA 3BEWA 5DO2D 1RUAL 5C8JB 1UACH 3MRKB 1HHKA 4IEFB 2NXZC 4X0KA 3SE3C 1GOFA 4UDTB 5DD6A 5DEFA 5J89A 1FE8L 3L3HA 3RGVC 3CK0H 4XPHH 2R8SH 5ALBH 3VFOB 1KG0B 4OJFH 4GAYB 1JZ3A 3QEQB 5FECA 2DQUL 4NQSA 5CEZE 5EO0A 2FBJH 1S9WA 2P49B 2VDQL 2DLHA 5E2UL 4AYFA 2VR9A 3QUYD 3MBEB 2Z8WC 2DD8H 5DI8B 1Q0YL 3HZMB 5IQ7L 3INUL 4YFLF 1CDUA 5JPNB 4L8BA 1K3IA 4JQIH 5KJRL 3BUYA 1U42A 4L4VD 4YE4H 4R6UA 2X7LA 4FNLH 3HI5H 5B8CA 5GGVL 5C2BL 1MAMH 3FOMA 1OTTD 5GS0L 4G6MH 5IJVA 3RRQA 4D9RE 5IJKC 1GGUA 1IAIL 4I3RL 2B0SH 2FD6H 5CJOL 4XAWL 3IDIB 4QEGA 5LGHL 1U8PB 3H3BC 3BN3B 3WSQH 5DZLA 4NO2A 2APVA 1FJ1A 1XGQA 1HILB 2R1XA 3GIZL 5BMFH 5I1EL 1G7QA 1BIIB 1ODAA 2IQAA 3L7EB 3GSNH 4WU7A 1DBAH 5IEKB 2Z91A 3KR3H 1S7TA 4MJ5A 5MP6L 1Q9LB 1NANH 3FFCB 2D7PA 3QDGD 3ULVC 4F7EB 1QRNE 3C08L 2L7UA 4Y2DB 4HHAB 3NCYS 4U31A 5JIHA 3SCMD 2V5MA 4EIZC 4HUNB 2HTKC 1X5FA 4M61B 4ZSOA 4JQVC 3U0WH 3HC3H 4L1HA 2NX5E 2Q8BH 5D7LD 2JJSA 5D4QA 5A2IH 4ZTPL 4G8IB 1I4FA 3QXAA 5MENA 5C6TH 5GHWL 4MA3A 2XRAL 3IS0X 1NCAL 1DLFH 4PRBB 1IC5L 4JY5H 1MCNA 5FYKH 4EKXA 1RJZB 2VSCA 4G3YL 2JELH 5KSBB 5IBUB 1C7TA 2FDBP 1UM6H 4PTUA 5FGBA 4JAMB 3MLTA 1YYML 3HUJF 4TUOB 1QPPA 4TSCH 4XZUA 3AROA 4LRIA 5I66B 2AGJL 5EZOH 3UTSA 1IM9B 5FYLL 2HVJA 1B0RB 2YEZB 1IGJA 1NAMH 3MRCB 4Y5YB 3LEVL 4K94L 5J1TC 4F7TA 2HYMA 3BP7B 3OKYA 5EC2B 2YA1A 3AY4C 1ORQA 2ICWB 4DZBB 1OGAD 3T77A 4BZ2L 1LO5B 3Q48A 1OB1A 4Y5XB 2AKRA 5BZWA 4WGVB 5IF0B 3VFVB 2PKDA 2HT2D 3LKOA 3RWGB 1I9RL 1BPVA 1RUPL 1S5HB 3IXAA 5HHMD 5D6DC 1S9YA 5TDNB 4U1LA 4JHZA 1TENA 1F58H 4OZHF 5T1KA 2HRPL 5T3ZH 2R0LH 4YIQB 3GMPB 4ZSOE 3BRFA 4Z78B 3MA9H 2FEDD 3QDJD 1R24A 3RPKA 4LLUA 2A38A 4FTVA 4PJHE 4H25B 5CZVL 3K4DA 3B83A 4XHJD 4NP4H 2ZOKA 4MCZA 1CQKA 2HJKA 2H9GA 4LOUC 1SBBA 4AENA 4IRSA 5CZXC 3TO2B 4UAOB 2CDEB 4BSWB 1T3FA 3B5TA 4WFFE 1OT1A 3NFSL 3VXSB 3CFBB 5L88H 3RAJL 5EU6A 4PV8B 2P5WE 5EOCJ 3RKDC 1C5BH 1C12A 4EUPB 4KTEL 4DK3A 4FQHB 1KCUL 1OP5K 1CDJA 4AK1A 3MQIA 5F72S 3QIUC 3D85B 4R7DA 5IB3A 4G8EB 1T2XA 2XA8H 3BX7C 3HNSH 4E0RB 1H15B 2IPKA 5HBBA 2OL3L 4QRPD 1WBYB 3EYFB 4EN3A 1SJHB 3C5SB 5DD0H 1T7VA 2ZUSA 1T4KB 4CVUA 4YDIH 3SKNA 2VLLA 5AWNL 1OLLA 3H9SA 5B3JF 3ET9F 1IL1A 4HXBL 1IGML 1D6VL 1RZKH 3MUGB 5IMKA 4BK4A 1MHCB 4AH2A 3QUML 4R0LC 3HMXH 1H3PH 3WHXB 4O2FA 3RVXD 3SEPA 3VXUB 3W9EB 3HNVH 4B5EA 4BZ1H 1XF3B 4BH7A 4FTVE 4HEME 5C0NC 1YNTA 1GIGL 4PJFA 5I15L 2VISB 1DN0A 4EXPX 2Q1EA 4YDVA 2J3SA 5GGVY 4AT6B 2BHUA 4KWUA 1UEMA 3I3BA 4Z7NF 1Z9OA 3HE6B 3H6JA 5J13B 3ROOB 5BXFA 2WK2A 4GBXB 5DD5L 2GCYB 1X5KA 3SO3C 4JO2L 3ZTNL 4MXQC 3T1WA 4F9PA 1WTGT 3NFPA 1I7TA 2G60L 1D5MB 3EOAB 1J1XL 2APXA 3NGBC 5TE7L 2DB8A 2FO4B 3ILPA 4X99B 5HJ3A 4KROD 1DUZA 1R5VB 1CGSL 5FCUL 5LCVH 4XTRC 1A5FH 4JGMA 2P4AB 2XKNA 4U1JA 3RHWK 3MV9A 5EU4B 1HHJA 2D03L 2NY1D 4M9PA 5EU3B 5F9JA 4GQ9H 3FOLA 5H35A 5DJZA 3KJ6H 2CQVA 3C8DA 2FLBT 2J4WH 3TJEL 3QZWA 2ZP0T 3CC5B 2ICES 3D0VA 3RDTD 3KPNB 1X5AA 2FECI 4UNVA 3QHTC 1T1WA 2J6EH 3TN0C 1X5ZA 1RK1B 5DT1L 2V9TA 3WFCH 5I1LA 4CUCA 4OCXH 3B2VL 3LKRA 5IB2A 1IGIL 3V6OE 5BJTB 2NTSP 5JNYA 1BD2E 1SVZA 1WBZA 2BVOA 3BGFC 2FATL 1LILA 2R56H 4PJFE 5DQ9A 5L8JB 2OSLA 4WWKB 3LQAC 5EIIB 1FYHB 3TIEB 3O41A 4HIJB 4R3SB 1ZHNA 3O3UN 4OZGB 1CGWA 4DGIH 3I2CL 4P5MA 4KQ4L 1SJXA 2D0FA 1D9KD 3B3IA 2EIBA 1KB5B 1A1NA 2GYSA 5IFHL 4XNMB 4YPGB 1DBKL 1I1AD 2E9IA 1KT2B 1JGVH 3GK8L 5I1DA 3QCUL 3CFJB 4TUJB 1SBSH 2CJUH 1CBVH 2E8ZA 1Q9KB 3CGTA 4CADB 4BFEA 1CLCA 2WIIA 4Z0BH 5FUOH 3UTQA 2HLFD 4LLWA 4YZFE 4R90H 2X4RB 4L8SC 1FH5L 3O11B 5DSCB 3MV9E 2F8XC 2BSTA 1NMCC 4J3VA 1F4HA 3WUWB 4QGTA 3KJ4B 5TQ0L 4FQJL 1KLGB 3H9HA 2UWEE 2DICA 4ZMAT 2J5LB 4YFEA 3NACL 4U6YB 3T0EE 1FBIL 1LWRA 1N2RB 2DM4A 3QXTA 2AJXL 1N6QH 2ZUQB 5HDBE 1T66D 3HB3D 2D0GA 3VWJA 1BQLH 1NFDA 4OLWH 4LCCA 3MV7B 1U8MA 5D1ZC 3GSQB 4EDWH 4QHKI 4ZUTA 4RGOH 3O6KH 3DURA 2HH0H 3QQ3B 5FYJL 1TETH 1PX4A 4X5XA 4EOWL 1MCWM 3CVHB 4PP1D 4LLYA 4O02L 2OK0L 2XZCH 4HQQH 4KJYA 1I75A 4RMUA 1H8SA 1J0YA 3FN3A 3IXTA 4PYGA 5KSVA 2ICEA 3PDOB 5HYQB 4MQTB 1RUQH 3CZFB 3K46A 2Y6SC 3X17A 3UTZA 5ERWB 2IMMA 4APQD 2YD9A 3VRIB 2D7QA 4JRWA 5D1XD 2DN7A 3AAZA 5GGSY 2FSEA 3DX8B 1VACA 4FQ2L 3VXMA 3MNWA 1OAUL 1ORSA 2NY2D 4OV5A 5D7JD 1E4KA 1N7ML 2IFFH 3QAZC 4ZXBD 3ZKXC 3WFBH 2XWTA 4QOKB 1OP5H 2IPUG 2OTUA 1QLEH 3LH2H 4EJ1C 3Q6GL 4JM4H 1TZIB 2NXZD 3U1SL 4EI5A 3VFSA 1FVDB 3W5NA 2OLDA 4X5WA 2UZIH 1GGIH 3OF6D 3AXLA 1G7LA 1AGFB 2FJHB 3BVNB 3GNML 2F54A 3M17B 3S36L 5SX5H 5C6WH 5CBAB 4MJIE 3UPRB 3ARED 1C08A 3EYUL 4ZUSA 4OZIF 3GRWA 1JHTA 4WW2C 2MMXA 3PL6C 4LVHC 3RWFA 2VDPL 3B9VA 4LGPB 1A4JB 1U8LA 5J0BA 2BVEA 1FG2B 4JRYD 1U6AL 5C3TA 2JIXB 3KYMA 3PE9A 4ZO7A 1JGDB 2ADFH 1FZMB 4HJ0C 5T5FL 4S1DD 3VJ6A 3X3FH 3WHE1 2PW2B 2R1WA 4WO4C 2BC4A 4CRPA 3ROLB 2NY3B 3VFPB 1NGZB 4JR9L 4KXZI 4UT7H 3ARDA 3LAFA 3GI9L 2EDYA 3OTTA 3P4NA 3MRNA 3TT1H 3RL2A 4MD0B 1I7UA 4NHUB 1T1YB 3RX7A 4C55A 4EQ2A 3W39A 3G6JE 3HE7A 4PR5B 2PO6A 3PP3K 5SWSB 2C4FU 3OKKB 1WWCA 3GEWB 3VFTA 2QV2A 2R15A 4NRZB 4WEMB 2B1AL 3F7YB 5CD3B 4OLYH 5ALCH 1AGDA 1XR9B 4L3EB 3ULVH 5AYUL 3W2DL 5KVGH 3IT8D 1ZLVH 2C1OA 2XN9D 1JV5B 1DZBA 1J8HD 3QFJE 2ED9A 5T3XH 2ZG2A 1B6DA 4PY7B 4I0CC 1WZLA 5F7YC 3OR7A 4PV9A 4J1UA 3ZDXF 1KXVC 1FGNH 3LZFL 1FV1A 3GUTB 4XVTH 3T09A 2NY6C 1IM3A 4YDLB 4OI9A 1FGVH 2R2HB 4YHZL 1S7VA 3K7UA 1YPZB 3T0DA 4L4TD 4K7PL 3W0WD 5HGAA 1OARL 3D48R 4P2OC 5I1CH 3TESA 4D3CL 3PWPD 1KJMA 3I9GL 3OKDA 2XXMB 4NUGH 2C3GA 4LPVA 4U1GC 1CFNA 2ORBL 1EX0A 4JVUA 4P2QE 4YBQC 4GRMA 4ZPVA 2ZOLB 5D7IA 8FABB 4JRXA 4XXDA 3O3BB 1G7MB 3UAJD 3KXFE 3SBWC 1RHFA 1VENA 3RY6A 1TQCC 5T33H 3ZKNC 1FG9C 2F53A 3RVVC 5D5MA 4M7KH 3R0NA 5CP7A 1FORL 2OZ4A 3IB4A 2M26A 4UINH 1N0XH 1OPGL 3QO1B 3FMGL 5IHLB 5TGBA 4NZUL 3D25B 3A6CH 3BRGC 3AS3A 1T7WA 2IAMD 4NWUH 5E99H 3O4OC 4ZUUA 1YZZA 2R2EA 1JWUB 4Z5RB 2D7OA 4P2RD 2DMKA 1SM3H 3NTCL 1H8OA 4ERSL 5T1DL 5MERB 5KTEH 2AJ3B 3FT2B 4LEOA 5D72L 2YRZA 3QSKB 4MCYB 1SEBA 3TVMB 3H0TA 4RDQF 2DJ4A 3BQUA 4LHQB 3L9RA 4KK8D 4LOUD 5CZXD 1J18A 2P46B 5GIRB 4QRQA 2EDXA 4YGVB 5ISZB 4HK0A 2QQLH 1KENL 1ZHKA 1MY5A 4AQ1B 1P9MA 4RGMB 1EGJL 3LCYA 3IDGA 2OQJA 4ZUVB 4Y4HC 4JRXE 1FVEA 3U9PH 1BVLA 3OJMB 1L7IH 3ZE0E 3C8KA 4NQDD 2OMNA 5DUPH 4NQEA 3TBSA 3QNYA 2FH8A 2ZJSH 5GQBA 3MGOA 3RIFF 3G6DL 5JHLH 4G6AC 1XZ0B 4RX4D 2X4UA 4KTDH 3MRPB 4AEFA 2FX9L 4PREB 2X5PA 1D6EB 5CJ8A 1QKZH 4YHKL 4LEXH 4UV7H 4HZLB 5IK3B 2CXKA 3KPSB 4U1MB 3QWRD 3V5KA 1XF2A 3BEWB 1KIPA 1MELA 2QQNL 3KPRD 2WSKA 4HC1H 4X0KB 1RZJL 3GMQA 3GDBA 5DD6B 3R8BB 1J0ZA 3L3HB 1ZGLA 4WI5A 4LLDB 2EE3A 5IESL 3QDAA 3E0GA 3ZYIA 4OCWL 3SE8L 2X40A 4LQFH 1QUNA 5FECB 4J3XA 4NQSB 4RAVB 1S9WB 3VXRD 2YD8A 2YKLL 4MSWA 4ACPA 4AEHH 3RUGF 5ILTL 4MB5A 3ZYOA 4XRCA 1NGQL 4HUKB 4OKVB 1I9IL 3QEUB 1OLZA 3BUYB 5HYJD 2HFFB 5J12C 5DVMA 2VXUH 3UCRA 1L7TH 2X7LB 3CLFH 3EHBC 5FYLE 2QHLA 3EDKA 3FOMB 1XGPA 4KHTH 4LSRL 1PY4A 5GGRA 5IJVB 5I9QC 4M1DH 4O51A 6FABL 2OL3A 2EICA 3BHBA 3SDXE 2WZPD 1FLTX 1T83A 3L3DA 5FO9A 3VDCA 3R8QA 4NRXA 4NO2B 1LP9A 2YRLA 4IDLA 1XGQB 4QLRA 2R1XB 1QNZL 1G7QB 2JTDA 1II4E 2IQAB 1CXKA 5CLWA 4WU7B 5LAXB 5DHVA 5LWYH 5IFAL 4MJ5B 4ZOAA 2XQYG 4Y1AA 2NY0B 3BKCH 4KI5E 3V5DA 5IVXE 1BM3H 4K7PY 2MJWA 1LE9A 3LQAH 3IJHB 3U46A 2UYLB 4ZSOB 5GPRA 4NGHL 3IS1X 4LF3B 1NKRA 4KRNA 4GKNA 3CFIC 3IFNH 5DMGC 4PJIB 4XHQA 5GRYA 2FX7H 2DWDA 4KKLC 5MENB 2VWEE 4YXKH 1DANT 1OWWA 5MEPB 3FT4A 2RBLA 1UZ6E 2VIRB 3CH1B 1B0WA 3U79A 2VTFA 2A0LD 5IG7A 3HI1A 4HV8A 4PTUB 4M9OA 1HQ4A 3MLTB 4WW1B 1F4YH 1G6RH 1RVFL 3RWDB 4LSQH 2KDGA 5D71L 3LKQA 1LK2A 3PWJA 3UTSB 2EC9T 2HVJB 5A16A 4I4WA 1O5DT 4HIXL 2Z31C 4F7TB 2OP4L 1LP9E 3QUZB 5SWQA 4WDIA 3GJFA 2EH7H 2JKXA 3BESR 3T4AB 3T77B 5JZ7C 4OSUL 1J0IA 3MV8E 1OB1B 2AKRB 5BZWB 3I6LE 4FA8A 5ANMA 5BV7H 1PAMA 3SOBH 4Z7QE 4YR6A 3IXAB 1S9YB 4ISVA 2ADJB 3NCMA 4U1LB 5D1ZD 4PD4J 4UOJA 1G7JA 3EFFA 5L9DH 5T1KB 4N90E 4I3SL 3RBGA 5FM8A 4IBLT 1REIA 1R24B 2YZ1A 2RIKA 4FTVB 4LLUB 4OFIA 5CIPA 3T3PE 3L3GA 5C0IA 2EDBA 5L6YH 1HN1A 2ZOKB 4MCZB 3E6HA 4HPYL 2VN4A 3CCHA 4X7FC 3AUVA 5IUSA 2H9GB 5E24E 3MJ9H 3CFCL 1CU4H 4AENB 1M71A 4IRSB 1KIQA 5IB4B 5ICYA 1OAKL 1T3FB 1JGUL 4FQXB 4KDTA 4QYOA 5EU6B 4Y8DC 1EBPA 4ZAKA 4TTDC 3RBSA 4DTGH 3CMOH 1OAZL 2H32A 2W9DL 5JXEC 3PGDA 5D1QC 1GGTA 2FZ3A 1VFUA 4G8GD 4QRUA 2APWA 1XCTB 3FB7B 1MWAA 2VQTA 4R7DB 4RMSA 5IB3B 1NEZA 2CUHA 4HX1B 3BI9X 2Y25A 3BE1L 4XWOC 1DEDA 2FWOA 3VD5A 3UJJH 4EN3B 2IPUK 1MI5E 2VLKA 2VXVH 3LIZL 1CIUA 1LDPL 1XF4A 4JREC 2UY7A 1YNLL 3W5MA 5ANME 3H9SB 5J7CC 1IL1B 4QXTB 3ILQC 4ODXA 4QRSA 4TUKH 2Z35A 2XV6B 4YHYB 4AH2B 2CRMA 2DI7A 3S98A 5K9OA 1QQDA 2D31A 4NDMB 4O2FB 5B38A 3UXFA 1U8HA 4Y19A 1RIUL 1VSCA 3UYRL 5D7KE 4BH7B 3QEHA 1SEQL 1YMHA 4NM8L 1JK8A 4O4YL 4RFNB 1YNTB 4HLZG 5HY9A 1AR1D 4PJFB 3FFDA 1DN0B 2CLVB 4YDVB 4LDEB 4QNPF 1QFOA 3MACL 1JYXA 1S7SA 1S9XA 4JFPA 1E4JA 1PD6A 3AB0B 4Y16D 2XTJE 4MWFA 1F45A 4X9GA 5BXFB 1S78D 1WCBA 4WUUD 4G6FD 4PJ9A 1CF8H 4P9MH 3H42L 3C60D 3RWHA 5C70A 4CVZA 4EI6A 2CH8A 4GO6B 3NFPB 4WO4D 4Z7VE 3VW3H 1P2CA 4OBSA 2IBBA 2IAND 4PJEE 1A7PH 4NN6C 3S5LG 3TP4A 5TE6H 3ILPB 5HJ3B 1DUZB 4M6OH 2PYFA 4JB9L 4P59L 3TZVD 5DQDH 5I8OH 4XVSL 3WHE0 4PJ7A 4U1JB 2BDNL 1A1OA 4PJDF 5JHDD 1HHJB 5F9JB 4UI2A 3FOLB 2VLKE 4OFYA 5DJZB 3VXNB 1CICD 3LKPA 1KELL 3N06B 4G42A 4R2GC 3QZWB 1W72L 1ADQA 1BFSA 3D0VB 3NPSC 2VNCA 3GHBH 4LARH 4XB7A 1Z5LA 1GGBH 5I16A 4RGND 3VMPA 1T1WB 3AFLA 4G80A 4GW4A 3KYKL 3ARBD 3BDYL 4Y19E 5CD5C 4IOSD 5EBGA 5K9QG 5BS0D 1VADA 5FYJE 5IB2B 1FRGL 4PJ8C 3HPLA 4OCYL 5JNYB 1WBZB 3FQNA 2PYEA 2BVOB 4NCDA 1MEXL 5DQ9B 3P30L 4JO4L 1U2HA 4JG1L 3O41B 4RMQA 1ZHNB 5I1IH 4TULH 1T22A 3SGEI 1LK3H 5I73B 5CGYC 3B3IB 2IPTL 2J8UE 4P2OD 4XCCH 1OAYL 1EO5A 1A1NB 3ULVF 3DETC 4HIEA 3PV7A 2YWZA 1MUJA 2BNRD 1ERNA 4FABL 2DYPB 4HK3N 4YBQD 1X7QB 3GFUA 3D5OF 3CFEB 4KVNH 3QG7L 4WHYH 1P1ZA 1J5OL 3CDFA 2H8PA 1S9KC 3S4SA 1UACL 2WIIB 1O7SA 3PWVA 2AEPH 3V6OC 4N1CA 4N5UA 4LLWB 1BJ8A 1JZ5A 1W0VA 4MJ2A 1S7QA 2BSTB 3CK0L 4XPHL 3L95B 1EXUA 3IDXH 4OJFL 4HCRH 3RY4A 3HZKA 1YY9D 3H9HB 4DZ8A 2P47B 2X70A 1L6ZA 1XT5A 4G9FD 4I0PC 4TSBL 1IKFL 2FBJL 3DTXB 3BZ4A 4URTB 2OJZH 1LEGA 1CQYA 1KCVH 4TSAH 5F93C 3LDBC 1FLRH 5HPMA 3FTGA 4ODHH 2DD8L 5I1KH 4OGZA 3WFEH 2DL9A 2V5TA 3QNZA 3EJZC 3O2VH 1LO3H 1NFDB 4LCCB 4JQIL 4PY8J 1FIEA 4ENED 3NFNA 1U8MB 4M7ZC 3DHJA 2BNQE 1L0QA 4KKBD 3T2NL 1K4CA 2PYEE 4U2ZA 3QCVL 4D9LL 2NYYC 3CJJA 3MOQA 3ARFA 4ZUTB 1PSKL 5IBUG 1KIRB 3DURB 3E8UH 3EKCA 3C6LD 1GC1C 1A0QL 3DO3A 5EZLA 1KJ3H 3SGKC 1M7XA 4X5XB 1FNLA 2FIRT 2DAVA 4HFUL 3LEYH 2B0SL 2FD6L 3L3IA 4KJYB 4LPUA 4HKXA 4JE4B 1A6WH 5MEOA 5KSVB 2ICEB 2FLRT 3GSOA 4XPAH 3WIHH 1SY6H 3SJVA 3T0EC 4TNVK 1MCIA 3SGJC 4KVCL 5DJAA 3TA3D 5BMFL 4LSUH 3AAZB 3P3YA 5IVNA 1U3JA 5T5NG 2FSEB 1DBAL 4WHCA 3MNWB 3VXMB 1A3RH 1V7ML 4JG0H 1ORSB 1VEOA 3Q5TA 1BJMA 3ZDZF 5T1MA 5DC9B 4AMKH 4GG8A 2BFVL 3PABA 1PG7X 2P48B 4TOYH 1Q9OA 4KGLA 5KANG 2OTUB 3BEVA 3KYOA 2XT1B 5F1SA 1ONQA 3MLSL 1TLKA 4EI5B 4JFHD 2CLRA 3CMGA 3VFSB 6CGTA 4KV5E 1IEBB 5JIPA 3TYFA 1DLFL 2EDEA 3AXLB 5FOJA 4CU6A 3F8UB 1G7LB 1FL3A 5IV2A 3I50L 4JY5L 2QQKH 4CU8A 1QA9A 5I19H 2F54B 4QWWC 1UM6L 3D2UA 1C08B 3DYPA 3VGFA 2EH8L 1QFUH 1JHTB 3HRZA 4K23L 3PNWB 4EUPG 4AIXA 4TSCL 3OPZL 1LE5B 2VLRA 3RWFB 1O0VA 1AO7E 4WIQA 2O61A 3P9LA 3WN5B 1JHLL 1U8LB 3CU7A 3CVIH 5HVGB 3S3PA 3OJDA 3OR6A 4F7PA 3REWA 1I8MA 2Q8AH 3SJVE 3RZCA 3KYMB 4JFEA 3EHBD 1VGKA 5JLZA 2K3TA 3F7VA 4QGYA 1QZ1A 3VJ6B 1WFUA 1TNMA 3TYGH 3UTTD 4NOBA 2R1WB 1N64H 1WJ3A 2BC4B 5E6YA 5GS1A 2DLTA 2R69L 3OBAA 4NBXB 3VA2C 3ARDB 4PRPA 4YC2C 3P4NB 1MHHA 3MRNB 4JFZH 3RL2B 1F58L 2O5XH 1UM4H 3HUJA 4CJ0A 4DFHA 1I7UB 4IIQC 2R0LL 1ZV5A 1CFTA 3BH9A 3U4EA 4YHLH 4M48H 3W39B 3HE7B 1HINH 1CGVA 4PBXA 4YHPA 2PO6B 3QB7C 4Z77A 5JIIA 4RRPA 2DQEH 4NP4L 4ZQKA 4ETQA 4XMKH 3VFTB 4EXKA 4NQXA 4J8RA 2WWMD 1AGDB 4UT6L 4TTGA 4MAYC 2C1OB 1JTTA 2XQYK 5L88L 4KRPD 2CRYA 3FT3A 4ZO9A 3RIAK 3HCVA 4JPKH 3SDCD 3TIDB 5FAAA 4CMHC 2AJSL 1YDPA 1PQZA 3OR7B 4PV9B 1TDQA 2VYRE 4J1UB 1K3ZA 2IBGA 3MR9A 5C7XL 1I3VA 4KKLD 5DEGB 1FV1B 4OZHA 3ORJA 2X89A 3BPNB 1IM3B 2XA8L 3P0VH 3HNSL 3MBEC 1S7VB 1ZLSH 5A2LH 5HGAB 2DBLH 2EE2A 4JFEE 2R0ZH 1RAMA 2KUTA 4OT1L 1KJMB 2EZ0D 3OKDB 2B8OT 5GRVL 4DQOH 3GM8A 2HFTA 1CFNB 5F89A 3MMEA 4GRMB 4DN3L 5D7IB 3M1BA 5HHOD 1MJUH 4XXDB 5JW3L 2ARJQ 5DLMH 1NLBL 1X3DA 4WV1A 4Z76A 3GMOA 3FB6B 5J3HC 4PY8I 2NLJA 5FB8B 1JGLH 2HKHH 4BSJA 2PTTA 5KG9B 5T3ZD 1KPUA 3HMXL 2F53B 2V5RA 3RTQD 3CFDA 2Z31D 5D5MB 1FPTH 5CP7B 4BZ1L 2XQBL 3EZ8A 5SWZA 3A6BH 4UTBH 3EO0B 3MGTB 1X6LA 5JZ7D 2H2SC 1N6VA 5TGBB 1CGUA 3H9YA 2HRLA 3ULUC 2ZCKL 4MDJA 4OD3H 3BP4A 5CP3A 4U1IA 2Y7QA 2P5ED 1A7NL 4DCQA 4ZUUB 4YHML 4LMQE 4RMRA 5DJ0A 4XCYA 1NL0H 1BWMA 3SGEH 3RX5A 3Q6FA 3QDJB 2F15A 4FHBD 4P57B 1SEBB 3BQUB 3L9RB 2A6KB 4ONOA 1GJIA 3GM0A 1PEWA 4U1HA 4Z8FL 1AGEA 4QRQB 4GFTB 1LEIB 3MYJA 3DGCR 4HDIA 2IBZY 2YK1H 1ZHKB 3OMZA 5INCA 2CGRL 2DQTL 3QHZH 3IDGB 1FDLL 2OQJB 3WUWG 2P7TB 25C8H 4ZS6D 4GG6E 1NH6A 5D1QD 4R4ND 5EFIB 1FVEB 1BVLB 4JKWA 3X3GH 4RFOH 3C8KB 1G0DA 4OD1L 4F33A 4X9IA 3WE6A 4NQEB 3QNYB 1UWEL 3MGOB 1OM3H 4OM0H 1T2QH 3MSPA 1GZQA 1WTLA 1JWMA 4XWOD 3I6KA 2X4UB 5EUOF 2VAAA 1D5ZA 2X1OA 4OCXL 4KTYA 4QRPB 5SWZE 2VZVA 1ETZA 4XP1L 1OCWH 4AG4H 5J4MA 4UB0H 1UJ3B 3VD4A 4KQ3L 4UIKH 1D5IH 3V5KB 3BPCA 3C2AL 1XF2B 3GGWA 1N3NA 4JVPA 1KIPB 4TVPH 3QPXL 4DGIL 1VFBA 1MCFA 3GMQB 4OV6F 3EOBA 2ATKA 4V1DD 1JNHA 4HF5H 1AC0A 3E1F1 4H0HB 1FYTD 4JO1H 1FVCA 2CJUL