1FSKC

Complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
b'QVQLQQPGTELVRPGASVILSCKASGYTFTSYWINWVKQRPGQGLEWVGNIFPSDSYTNYNQKFKDKATLTVDKSSSTAYMQVNSPTSEDSAVYYCTRGARDTWFAYWGQGTLVTVSVAKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR POLLEN ALLERGEN BET V 1-A
publication title Dominant epitopes and allergic cross-reactivity: complex formation between a Fab fragment of a monoclonal murine IgG antibody and the major allergen from birch pollen Bet v 1.
pubmed rcsb
source organism Betula pendula
molecule tags Immune system
total genus 40
structure length 220
sequence length 220
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2000-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskC02
2HTLC 1IAMA 2N7BA 1N59A 3HAEG 2OJZL 4U0RB 4U1IA 5CP7B 5F44A 5FM8A 3I3BA 3NPSB 4WFED 1ZHLA 4PY8J 1AQDB 1BOYA 1MCSA 3DVGA 4PJ7E 4TSCH 3D39D 5EIQA 2B2XH 1QHPA 3K2UL 5FOJA 4MQXD 3K4DA 3GMRA 4LLVA 2NTFA 2BNQE 5SWQB 1TLKA 4XPFL 1F90H 1FJ1A 1OARL 1I9JH 4WGWB 4QHNA 3U48A 3EOTH 5C70A 4MAYC 3H9SE 1UKQA 1RPQA 4Z7UE 4PUBL 3WKMH 5FYJL 3JV5A 4PRAB 1OTSD 3QULA 2VQ1B 1N8ZB 1Q9KB 3MRLA 3IAGC 3MO1B 1WC7B 1V7NL 2HFTA 2NXZD 4J3UA 1B6UA 3QH3A 5CEYA 4P2QB 3PL6B 2AJ3A 4X99A 1F3RB 5ICZA 1RUQL 1JWMA 4M61A 3RVTC 1T89A 4OIIH 4WJ5B 4OQTH 1FHGA 3GSNB 3NIDF 2ESVE 2GQHA 3LKRB 4DZ8B 3CXHJ 5JW5A 2DQHH 4P4RB 5JDJA 3TA3C 4PB9L 5C09A 3SN6N 3TCXA 1HN1A 2D2OA 1IAKB 4LRIA 2NXYD 3LKNA 1E4JA 2AJZB 2DMCA 4OZHE 2PNDA 3FRPA 4DK6A 4MAUL 4PJ5E 2H9GA 5JDSA 4HFUH 4NKMB 3G08A 4O9HL 1D3CA 1H5BC 3GUTB 1TCMA 1OCWH 5EO9A 4XWGH 3WYRA 4L8CA 4XCNB 5E2WH 1LEIB 1A1OA 3PWLB 3TGXA 4EUPB 2EDFA 3SCMA 5HVWA 2ATKA 2NY4B 4XVJH 1QSZA 4HIIA 3LPGA 5ECJE 4D94A 1JWSB 3BQUB 2EYSA 5E8PB 5FGCB 1T7YA 2PTUA 1S9VA 3QCVL 2I25N 2BVPB 3A6CL 2WBJB 2DBLL 2NY2C 1MFEL 3R06A 3QIBD 4RFNC 4WHYH 3SGKA 3FKUS 3TWCH 1CLYH 5LXGL 5AAMA 2C7UB 1SMAA 3BKML 4JY4A 3EHBC 3V52L 2A0LD 3FQXB 3L95A 4G8EA 1U8OA 1P7QB 4ODTL 3LS5H 4RMSA 1KJVB 5F7UA 3MLUL 3N85H 5DHVB 3G6DH 1JGLL 1TPXC 2Q8AL 3V0VA 1NCCH 1TFHA 3KHOA 5TFSL 3LKSA 3RHWF 1CI5A 3OKKB 2IJ0C 2CLVA 3H3KA 3U9PH 1ORSB 4HIHB 1H8OA 3ZO0A 5GGSY 2OR7A 4GW1B 2CGRL 2B20A 3L5XH 3EJYC 1H3UA 4W6YB 4OCWL 2DQGH 1MHEB 3RUGE 1NMAL 2VMFA 3CDGA 2J6EH 1KELH 1VESA 3E3QC 5F96H 1X5IA 4AIXA 4LSSH 3P77A 2YPLE 1R24A 1IQWL 3SY0A 3ZLQC 4QRRB 4DAGL 1IZJA 2OTPA 2V7HB 4UQ3A 4UAOC 3MLSH 1VACA 1KB5A 3BMVA 4XP5H 4Z7VA 5FUZL 3CDCA 5TE4H 2F54B 1A02N 2GCYA 4U1GB 5ERWA 3SE3A 2GAZB 4KGLA 4GOSA 2C3XA 2ZCLH 5CZKA 1JWUA 4LQ1A 3IFNL 1U6AH 3VWKA 3VW3H 4B7LA 5T3ZL 4NN6C 1G9MH 2ZCKL 3EJZD 1ZOXA 4LCIL 5ESVA 1JN6A 1NGQH 2DQEL 2HWZH 2A6KB 2FIKA 4FABH 4QRTB 1IGCL 5EU6D 3ARBC 3TV3H 2N1KA 43CAB 3BZFA 1UWEL 1EV2E 1QLFA 5IJKA 2XRAH 1CXIA 4F2MA 3ILQD 4Y4FB 2CJUH 1XF2B 3N9GL 1WZMA 1QBLH 3ZE2F 1FGNH 4BSJA 3WIHH 4ISVB 3RGVA 2X4QA 1PBYA 1KIQA 1CFVL 4ONHB 4PRDA 5HHXL 1TQBC 3TN0D 4X4MA 1I1AB 2CLRB 3K8KA 1IEAA 3N06B 5EDXA 5JOFB 4H5SA 2VUYA 2Y7QA 2ZOLA 3GM8A 2NW2A 3O2DH 1HQ4A 5EPMB 3SO3C 5D5MA 2AJVH 5KSAC 3KPTA 2R29H 3QCUH 2HRPH 3IAPA 5HD8C 4POZC 5CMAB 3WV0A 5FO8A 1KLGB 1TZGH 3LKQB 4EI6B 1X6NA 4NBXB 3BKYL 4PV9A 4NQXA 5B38B 1YNTB 4RRPG 3C5JA 4NT6A 5I2IB 4NKIH 3GMLB 1YNKH 3JZ7A 5EBMB 3SKMA 2Y07H 5FO9A 4HS3B 5F72S 5D70H 3MTRA 4JDVB 3HR5A 3W9EB 2YRZA 3IDGB 3IKCA 4XMKH 3G5YB 3DVFA 3B9KC 2AEPL 2P4AB 2ZUWA 4FRWA 4EXPX 3QPXL 5F6HI 5EZLB 5HDQH 2AXFA 3LEVL 5J11C 1EHLL 1LHZA 1NCWL 3IDYC 3JVGC 5H37H 1KLUB 5DZOA 3O11A 3SKJH 4YXHL 3H42L 1CLOH 3HKFA 3MRNB 5IMMA 4F8TA 2AKRA 1IAOB 4G8IA 3G6JA 4NSKB 2OK0H 1J7VR 5B21A 4RWYL 1T1YB 1WEJL 1NL0H 4HK0B 1X5JA 2Q8BL 1ORQA 4YC2C 1UB6B 4U49A 2FRGP 1KENL 1NAMH 3G04B 4FZEH 1DTUA 1IT9L 1JPGB 1U8LA 3GSVB 1VENA 3I9GL 4NQDB 4NPYA 5LKNA 2DJUA 2EEAA 1MVUB 5GGRA 3FONA 5E5MB 1N6VA 5KVEL 4OJFH 5GISL 4LVHB 4HIJA 5GGUB 3IFLL 4C54A 3QXAA 2XWBB 3ZTJH 4QF1A 4ZUTA 4IOIB 1KPVA 3EDEA 1UADC 3DURA 3EDDA 2ESVD 1WBXB 1P9MC 2VQUA 4ZAKB 4K3JL 5KS9E 4X7TA 3KYOA 4XAWH 1ZLWK 2VLJB 2YMXL 4GRWB 2WBWB 1B0RB 4G80B 4IMKA 4EI5D 3MRGA 4NCC2 2J4WL 4JG1L 5FYJE 4IJ3C 3S96A 1S7XB 4K71C 5DWUH 3B6SA 3S5LA 5I1IL 4IRSD 4BQCA 5D72L 5KJRH 1EXUB 4PJ5D 1I8MA 4XMPH 3V5KA 5FYLL 2F58H 3BISA 2Z31D 3QUXB 2AK4B 2IAND 3I50L 4LCWA 4NZUL 4KU1A 1ETZA 2CQVA 1J8HB 3C9NB 3SDDB 3L7EB 1BMGA 5E6YA 3SDYH 1T83C 3ZT5A 3HG1D 4Z7VF 3VDAA 5F6HJ 1NCTA 4KK6D 1R5WB 1FVEA 4AEHH 2GT9A 2ICWA 2YWYA 1J1XH 3BDBA 4TVPL 2KBGA 4BQ8A 5IFAH 2AGJH 3DYOA 3RWDB 1QRKA 4D3CL 2YN5A 4ETQA 2ADIA 2KKQA 1RZ8A 3U0PA 4FP8L 4N0FB 5DK0A 2OL3L 4QHKI 4RDQF 4NHUA 5DF0A 1B3JA 3VFVB 2NY3C 4YFLF 1IM9B 4LCCA 1UCBH 5I8OL 1EX0A 2VDML 3BN3B 4QEGA 4QXTB 5DMGC 5F3HB 3E6HB 3FQNA 5F7LB 1L7TL 4GXUN 1I8IB 5E6ZA 4EOWH 1ERNA 4NZRH 2XI9A 4UOJA 3VWJD 1QFOA 3C5SB 4K3EH 5F1KC 4PTUB 2VIRB 1OTTD 3MRDA 3QIWC 2V9TA 1JGVH 4K3GA 3RY5A 3T3ME 1NCBH 1U92B 2AXHA 2WZPD 1ZVSA 4KUCF 1T03H 3HUJA 2BMKB 3MV7B 1OOAA 3IDMB 4MCZA 5HDBE 5D5MF 1WF5A 5BOPA 2ADJA 3NFPB 5F1IB 2GJ6A 4LDEB 1AO7E 4K8RD 4YE4L 3SKUD 3VXOA 5HHQB 1YY8A 4PRPE 2L7UA 2CIKB 4GBXD 3WD5L 4DWHA 1KG0A 1I7ZB 4JREC 2X9WA 4XX1E 3QDMA 3RVUD 5ANME 1RZFH 1EHAA 4O2CB 1Z0MA 4X83A 3TO2B 4NQCD 1ACYL 1P7HL 2BY1A 2V5TA 1MRFH 5EUKB 3BGMA 2YPKB 4LSTH 3ULUE 3W39A 4OM0L 5GGVY 4WTWA 3RX5A 5I30H 2FBJL 5IOPB 4XP4L 4QCIA 1L9NA 4WUUE 3JXAA 4EUPG 5I8CB 1GPOH 5I6XC 4TRPH 3WJLA 4MNQD 1U2HA 1U95B 2XZQL 1BBJA 5IEKA 1BOGA 3FB8B 2BP3A 3G6JF 4UIMA 4YGVB 3WXVL 1L4IA 5KOMC 35C8L 4KRPD 3JTTA 4QHKJ 2N4IA 3VDCA 4V1DB 5T3ZE 5HVHC 5DD6A 4NJ9L 3TH2T 5T1KD 3TPUA 5AYUH 4ENED 1XF5A 1MFAH 3REVA 3TJHD 4NBYB 1QG3A 2XKSA 1YQVL 4LVEA 5B3JE 4G7YH 5BS0B 1GGIH 1KXQE 3HPLA 4OT1L 4FQLL 4KKBC 4HDIA 1G7IB 3VXRD 4LHQB 3KPMA 3SDCD 4U6VL 3B5HA 2IPUG 5DD3H 2VERN 1KTLB 1H3VA 2HP4A 3GSRA 2WUBL 1BD2E 3BD4A 3DSFH 3DUSB 3HC3H 3NTCL 4J4PD 4AENA 4Q9RH 4PRNA 2AQ2A 3UTTA 4ZFOL 4N5UA 3F58H 2VH5H 1QA9B 3DRTB 4NN7B 4O4YH 3ARGD 4HW6A 5EOCH 4YWGL 4D8PA 1ZT1A 4J8RA 2JELL 3OB0K 1GYAA 4PJIE 3BH9B 3DX9B 3IFPB 4XBPB 2X1PA 2DL2A 5HHMB 4Z9KB 2BVTA 5HGAB 5EIIB 5KVFH 3ARDC 1JPFA 5ENWA 5DJCA 3EYOB 3D3VD 4M03A 3T65A 3PHQA 4XP9L 6FABL 3FQUB 4F7PB 1I9RH 5JMOC 2GYSA 1EH9A 4YR6B 1A64A 4YBQD 1D5IH 1C5CL 1E4WH 5TQ0H 1MCKA 3HN3A 4G6MH 3DBXB 4MLSA 4F7CB 3IVKA 5D1ZA 4XHJC 5DJ6B 3VJ6A 1ONQA 3WIIL 4ZUUB 1FBIH 4XP1L 5D1XB 5FGSA 2W9DH 4GSDL 4PJCE 1A5FH 2Z35B 3PDGA 5L2KA 5D2NE 1CDGA 3BO8B 3JWDL 3P4MB 1BJ1H 1U8HB 2ZKHL 1VEOA 1KN4H 1OB1A 4DCQB 4UIKL 2X4UA 4JM2A 1YN6B 2R1WA 5IB3A 2CMRH 3FQTA 2F74B 1IVLA 1JV5B 5JW3H 4LAQH 3IF1B 4OFIA 3BP4A 4LLMA 3MRKB 2O5XL 1AGCB 4Y8AA 1DANU 1KGCE 1TZHB 2E9IA 2YUZA 3OBAA 4QT5A 4CADB 2HLAA 3L9RB 2OR8A 3PWUA 4KJWC 3W82A 2V2TB 1ZHNA 4J23A 1D6VH 4OI8A 1CK0H 5B38G 1NC2A 3VFGL 1T3FB 4XGZA 1UM4H 4LFHD 2DOCA 4PJ9A 3W11C 5FHAL 2P5WB 4JANB 3C8KA 3PXJA 2HKHL 1ZEAL 4KDTC 1H5BB 1MAJA 4I0KA 1BJ1J 4XTRC 1LDPH 4X8XA 3IS1X 4D2NA 4BSWA 1RZJL 4JN1H 5SV4A 5LBSL 1IKNC 2OTUB 2HVJB 5FGBA 4O2EA 4GQ9L 3MRIB 4Y4KA 1FLRH 3O2VH 4GRLC 4K9EC 2OBGA 5FYLE 4P46A 2EH8H 3LD8B 3RVWD 5BZWB 2C3WA 4RFNB 3NAAL 4OV5A 2HTKC 3M1BA 4WO4A 2ZOKA 2I5YL 1RJZB 1R3KA 4P49A 1OLZA 3SE9H 1FNLA 4X6BA 4ELMB 4UOW1 2NPLX 1HHGB 3NCBB 2IFFH 3KG5A 5JR1H 3MNVA 1R0AH 4ETYA 4J3VA 3TJEL 4L8SB 4TVPE 2IQAB 2V5SA 3JWNC 3GMNB 2DQFA 4U3XA 1DEEA 1RIUL 1KCVL 3I02A 4M6NL 4WDIB 3GMMA 1C08B 3OF6D 2CK0L 3OKNB 3UEZA 1ZSDB 2F5BL 1KC5L 4NO5A 4DJMA 4G6AD 5GGQL 1HHIB 3QUKB 5EZJA 2EE2A 4PRPD 4YHIB 1LQSR 4QRUB 3MBEC 4I48B 5CBEA 1GZQB 1MJJB 4ZUSA 4PJEE 3SKOA 4JLRB 2XG4A 3ULSA 3SE8H 5JW4N 3STZA 5H94A 4FQ1L 2X4NA 5D1QB 3AUVA 2QEJA 3QI9D 2BOCB 3FCTB 4LLYB 3MJ8A 1XEDA 3O6LH 1AGFB 2UUDK 3AS2A 3ULUD 4NQVB 1LO5B 3E0GA 3AMKA 1JHKH 1XIWC 1UM6H 4BSVA 3FO9B 4YDKL 4ZFZA 4JN2A 4NUGH 2R56L 4WUUD 3D0LB 2LV4A 4AT6A 2NX5E 3QUYB 2X40A 3TBTA 4DTGH 4FFVC 5SWSD 4FQ2H 1I1YA 2CDEB 2BSTB 4NRYA 4OZGA 3ZT6A 1AFVH 2DF3A 3BHBB 3E8UH 1S9KC 1YN7A 2GTZB 2SEBB 1QBML 1CXFA 1HNFA 4U7MA 5IP4A 4B41A 1IC4H 3SDAD 1PG7W 3LEXB 4Z76A 2Z91B 5IMLA 4O5LH 4JO4L 1BZ9A 1TNMA 1LO4H 4NWUH 4R90H 3HZMB 5C0AB 3CFBB 4TULH 5A2FA 4I2XA 1OSPL 1VADB 5FB8B 5SX5H 1BWWA 4RGNC 3VA6A 1L0XA 2G5RA 3SO3B 4NKDB 1FO0B 3LSOB 2J5LB 5L6YL 4G8GB 5GHWH 4XVUD 1HWHB 2OSLB 1PD6A 5JHLH 3CMOL 2VDNH 4XCYB 2R2EA 4DGVH 4I0PC 4HKZA 4K3DL 1EIBA 5SWZA 1WZLA 3BJLA 3KPNA 1SM3L 3QQ9D 4JHWL 1VSCA 1T80A 5HHOD 1PKQA 1LO3H 1FNGB 1S7SA 4JQVC 5IB2B 1KBGH 5ID0B 3IDJB 3T0WA 2AABH 4DGIL 3FB7A 3T1FA 1AKJD 1DQJA 3I6KA 2X4TB 1JPTL 4JFXB 4JHBA 1YEFH 4FFWC 2BXYA 4HHAA 5T3XL 3VFRA 4PB0L 1NFIB 2YEZB 5IIEB 1Q0YL 2COQA 5JNYB 4E42B 5D2LB 3SPVB 3WS3B 5KZCD 4C58B 5JOPE 2HMID 3RWEB 1FSKC 3QDJB 5GS1B 1HIML 4PJFA 2FD6L 4OLYH 4XZUA 3EUUA 4WI2A 1N7MH 3UPRA 1DE4B 2A1WL 2FWOA 4KUZL 5I1JL 4YC2B 4ZPTB 2H1PH 3T2QA 3UJTL 3TPKA 5L0QB 2FZ3A 3DETD 1XGQB 4W70A 5KVDH 4X4ME 1R3JA 2D7PA 4TTDC 4I18A 5DR5H 1E6JH 4MMZC 3QUZB 4F7TB 3MNWA 2C1OA 4L5FH 5GGTA 2WLYA 1ZT7B 1HEZA 4PJAA 5ISZE 2AQ3A 3ZE0E 4P48A 3GKZA 1QSED 2FIRT 3LZFH 1SY6A 3AMLA 5E00B 4Y19B 5FA3B 4P4KA 4NGHL 1T04B 4AQOA 4NP4H 1OT1A 5E6ID 3BIKB 5ITFB 4IJ3B 5I75B 3O8XA 1UZ8B 2FX7H 5I17B 1TXKA 1II4E 4OGYL 5EORL 3F7VB 1MCEA 5HVGB 3CSGA 3ZL4H 3DVNB 4KZDH 5E2TH 3UP1A 5DUPL 5E9DA 3AAZA 2CDFB 3MV01 4IMLA 4QWWD 1QLEH 3CZFA 1K6QL 4Q6IA 1MREH 5DZNA 3TVMB 4PV8A 1BIHA 1JGDB 2GFBB 1HYSD 2A9ML 1ZHBA 4PLOB 4OCRH 1D9KB 4B50A 3STBA 2HFGL 2VDLL 3AREA 1A9BB 5IFJB 1HHHA 2DJSA 4LEXL 1DLHA 5DLMH 3WL9B 2L7JA 3QXWA 3G6AA 4F8QA 1S5HB 4HGMA 2IAMA 3H6JA 4PFEA 3SJVA 4TTGA 3G5ZB 1CDHA 3GSXB 2FH8A 3ORJA 4YGAB 2NY3B 1J10A 5EU5B 3NCEB 5JPMB 4FTVB 4C59B 4JKPL 1KSRA 1EFXB 4NO0A 4J3WA 2ZG3A 1VGKA 2VLLA 2FYYA 3RZCA 3O0RH 3WLBA 4NWTH 3CU1A 2EE6A 3RIFK 5EZIL 3TBSB 4OF3A 4WWID 1R3HA 3UTSA 3MFGB 1DSFL 1UWXK 4D0BB 5LG1A 3JBG7 4GUPA 5ILTH 3OR7B 3ULVF 5DA4A 4UI2A 1MI5B 1F4WH 4YPGB 3RU8H 5CBAA 5C09D 4QOKB 1KJ2L 1WT5C 3OGCA 1UCTA 1MCOH 5INCA 5IFHH 4OTXH 4JG0L 3H9YA 1JTPA 5DJ8A 1V3LA 4FHBD 3MRBA 5TQ2L 2NZ9D 1I3RB 4E0RA 25C8L 2XY1A 1MCCA 5I0DA 3NMEA 2QQNH 1TQCC 4GH7B 4JREB 2B7DT 3HMXL 1PLGH 1A3RL 2XYCA 2PR4L 3SCMD 2F53A 3OKDA 1KULA 4K8RL 2JB5L 4M9PA 4OI7A 3GHBH 4GMTH 4RAHA 1CFNA 1NJ9B 1QFWH 4EVNB 5F9OL 3S37H 5FKPA 2XZAL 3JV0A 2X4PB 3CFDB 5ESAB 4UUJB 2R1YB 3HRZB 4FXKB 2ORBL 3CH8A 5DK2B 1HXMB 5J56B 1NFDE 2PW2B 1BX2B 4PJFF 4QXGH 2BERA 3ZDYF 1AQDA 3CXHK 5TDPB 1H0DA 4KVNL 2UYLB 3OZ9L 4EN3C 5HVHB 4FFZL 5C0ND 5SWQA 3TBVA 5IVXB 4PRHA 1H8SA 4DVBB 2IH3B 3ZZ1A 3QEGH 3WNPA 1XGYH 2R4SL 5I1EH 3WFEH 1JZ4A 5C8JB 1OGAA 3HUJE 5ADOL 3GRWA 2JIXA 3EDKA 1DQQB 5F7MC 4P57A 5CGMA 4PJAF 1NLDH 1MLBB 4X5WA 2YD7A 1K4DB 4YHKH 3L6FB 1Q94B 4YZFE 2DLIA 2YSSB 4RMTA 2IQ9L 4HEPG 1W72L 2HN7B 3DX6A 5DJ0B 3DRQA 4GG6B 4RGOH 1P7KB 4I9WD 1BF8A 4P2QA 2MPAH 3DWTA 4JFDA 3CH1B 4GKZB 3VWKD 3DGCR 5CILL 1F4AA 4QHUA 1FORH 1PG7X 4LARL 2YA1A 1AGBB 2ITCA 3MA7A 3TT1L 4AMKL 3MLRL 3E6FA 4OQTA 4XPAL 4Q9QL 4HXAH 5IG7A 5CJOL 1BWMA 3QFJB 2XN9B 4JRYA 4LEOB 5IQ7L 4NRZB 2X70A 4X4YA 4JVWA 1J1OH 1HI6A 3LEYL 1NMBL 3B5TA 1FZJA 2NY6D 3RGVD 3OAUH 4R96A 4OD1H 5MERB 4N9OB 4X0KA 2XKNA 2BCKB 4PR5A 4U0QB 4I0CC 1VGEH 3I2CL 3VXQA 4EBQH 3KPLB 1KNOB 4EKXA 4RFEB 4ZO9A 4JQIL 2AJXL 3PNWA 2VZ1A 5T3XE 5KTEL 3PQYE 3QNZA 1MQKL 5IR1B 4ZO6A 5DEFA 1AH1A 3C6LC 1T66D 4HUMB 4XPGL 4HPOH 2A6DB 2IH1B 2WBJA 3C8HA 5J3HC 1K2DA 3PWPE 1U3HA 3BFOA 5C0GB 2HJKB 2Z92B 1CYGA 3OKOA 3KYNA 1Q1JL 3S97C 2PYFB 2APBA 2DM7A 4C4KO 3OKEA 1OAKL 2IPTH 4JFZH 3LH2H 1JTTA 1NBVH 4BK5A 4OLXL 5MEPB 4HIHA 2K7QA 3VI4F 3VU2A 1N6QL 4KROC 4WTZA 3VFNB 5C0EA 5FDWB 2B4CL 4JFOA 3QEUB 5D6DC 4Y5VA 1A14L 4FQHA 2ZZUT 2GK2A 3OKLB 4B0MM 1FVDA 2BJMH 2EDHA 3MOQA 2ZCHH 1G6RH 1RVFH 3GBML 3NABH 1FNSL 5KSBE 2J6EA 4K9EH 4JJ5A 1HH6B 5TGBA 1CGSL 3K46A 4GAGL 4GKNB 1G0DA 1P4BH 4ZMAT 1J87A 4AYFA 5DI8B 3VXSA 4NRXB 1KTDA 5MI0B 3NVQA 1JF6A 1QFUL 3LRSA 3O6FC 5JZ7D 3WO3B 1OAQH 5JQ6L 1AHWA 5GSRB 3MGAA 2VR9A 1AE6L 4G6FB 3RL1B 4YK4B 4U1HB 3UAJC 4F58H 5L2KE 3SEPA 3WN5C 1A8JH 3VFTB 2DQDH 2V5YA 3R0MA 5CD3A 2H32B 3MZGB 4MA3B 1YJDH 4IDLA 1Q0XH 5IMKB 3QZWB 1LP9F 5F9JA 5A2IH 2W38A 2UVFA 4JZNB 5EFIB 4GFTB 4J2XA 4ZOEA 4CUCA 1F13A 3K7UA 4LCWD 1T2JA 1IEBA 2ED7A 4HWBL 2A6JA 4BZ2H 2DMKA 1ACZA 5I8EA 4MB4A 2PXYC 2LVEA 5EBLA 4ZNCD 1TJIH 3NZHL 2V17L 5K93A 3MRJA 3O3DA 3IAQA 3TO4B 3O2DA 4PTTA 4POYA 4AL8H 5BV7L 3D6GA 2FBOJ 3KYMA 2X2YA 3O81A 5GGVL 1R3LA 3O4OC 4K7PY 1EAPB 2VLME 4H26B 1AGDA 5ALBH 2VISB 2OCFD 1HSAA 4RMQA 1A4JB 4NNYB 2MWCA 5I19L 4GLRI 1DBML 2F5AL 4AY0A 2MCPH 3BOVA 4G8FB 2NW3B 5D96B 1P4IH 4G43A 4N5EC 5J6GA 2V2WB 4H1LH 3GSOB 5D2NC 5EZLA 5AZ2L 3D2UA 4WVRA 1JRHI 3K0WA 3NCFB 5CJXA 1RUAH 4JO2L 1UGNA 2RCSL 3EYFA 4CMHC 2BNRE 2P5EE 3P11L 4PGDB 5BQ7B 1RAMA 1J8KA 1SJHB 2WSKA 3GM0A 3FO2A 1UZ6E 1MIMH 5JHDA 1Q72L 5EBGA 5F1NB 4HUNB 4ZG1A 4JRXE 5CWSB 2YXMA 4M1GH 5E8OA 1NCNA 4WEBL 2NZIA 4KTYA 5I8KH 3QJHA 2GJ6D 4OZ4A 5K59E 2QL1A 3O9WA 3PHSA 5GS2D 1YYLH 5BOZG 3GSVA 3MRCB 4FQXC 2W07A 2HKFL 1CD1B 4HBQA 1AP2B 4G6JL 1NAMA 4P2OA 4UV7H 5IBTL 4APQA 3TBYA 4GAYA 3VXTA 1PG7L 4WWKA 1QTYT 5E5MA 3HC4H 3JWOL 1QEWA 3QDMD 3V5DB 1K4CA 3RKPA 1S9YA 3QIUB 2DQJL 3NCYS 4PJBA 3PV6B 5GSVB 1G7QB 1JRHH 3V7MA 3ZDZF 3MJ6A 1Y0LA 1E28A 3TNMA 4PJXA 2FO1A 5IEHB 5A16A 1J0HA 4QTIL 2GSGA 1FNFA 1QPPA 4MJIA 1A7RH 2DIAA 3B2UC 4NYLA 5IW1B 3FT2B 5EN2B 2DLFH 3C6SA 3GSWB 5E2UL 1C12A 5FV2A 1BIIB 5GZNC 2P43B 4DGYH 1FQ9C 3TYGH 3TLRA 4L4VE 1NCUA 4UILH 4OGAD 4OZGE 3Q0HA 3C9NA 1B4RA 3T77A 2DLTA 4GRMB 2ATPA 1LD9B 3L7EA 1KCRH 4HLZG 3FFCA 1I7RA 4JO1H 2D03L 3WNMA 4X80L 2E3VA 1R5WA 5HPMA 3S88H 2BHZA 5D71H 4DKEH 2HT2D 1Y6MR 2W65A 1NLBL 1KLFA 4PJHB 1C1EH 5EULV 2FATH 4XWOC 1EHNA 5I1KL 1V3KA 4Z7OE 3GSNL 5FO7A 4WU5B 1NGYA 5EOQL 5FKAB 2EC9T 4RAVA 3C08L 4OCYL 2Y72A 4PG2C 5C0BE 1KPRA 3UTTD 3U7YL 4HUWA 4ONOA 2J88H 3A67L 4M4RA 4HK3N 4ODUA 1DVFA 5T1MA 3CVIL 5F7DB 2FJGB 5DEZA 3TEUA 4LSUL 3EW3B 5HYSB 5E7FA 4X6EB 1UVQB 4NJAH 4WV1A 4KI5E 3IDIA 5MEQA 2J8UE 2L0DA 3UTOA 1A2YA 2H26A 1B4JH 3DECA 5JOEA 2X9XA 2JCCA 4U6XB 4O51A 3H3PL 5H35B 1IGYB 4M8VA 4WENB 1VFAB 4L1DA 1FH5L 4R7NB 1CGUA 1MFBL 4CVZB 3KPQA 1NEZB 3FB5B 1WICA 5D1ZD 3I75B 3WJJA 2D7NA 4PRIB 4ZS7H 1YEJL 3IJYB 3WS6A 4P5TA 1DQMH 1G9NL 1S9WA 1IL1A 2NY1C 3GGWA 1MCPH 4YQXH 5L2KD 2R8SH 2YPVL 4PGEA 2VNCA 2CK2A 2YUWA 1WFNA 3QEQA 3GKWL 3QDGE 1A6TB 3FT4B 3AM8C 4ZOCA 1RIVL 5IJVB 4MXQD 4JM2D 4PYGA 1E27B 4XNUH 4OF0A 3W5MA 4ZS6D 3RWJB 4QGTA 4IRJA 3T09A 1G7PB 3RPIA 4EIGB 4I5BB 1E4XH 3BRDA 4U1MB 4ZTOL 3RDTC 1ZT4A 3VRJA 1A7OH 3WIFA 3PGDA 4P3WA 1RUML 1C8PA 4JY6A 5IB1A 4WI9A 3QO0B 3HNTL 1CF8L 3AXLA 3HE6C 1ZGLB 1MIEL 3ZKND 1JF1A 1A9EB 2FJFB 5LWYH 4K23L 3TFKC 1NC2D 5E8EB 3UO1H 1CT8B 3HI6H 4PJ9D 2DD8L 3BZDA 4JFEA 3M8OL 1HKLL 2BVOA 2PTTB 4M8QA 1UM5H 4NCDA 3BN9C 4WI5A 5C07E 3QNYB 1PQZB 3EO0A 1Z9LA 4PJBF 3TF7C 2RBLA 3HC0A 1KTLA 4JVUA 5AWNL 1TZIA 3FQWB 4Y4KD 5JUEL 2A6IB 1HH9A 4HCRA 4PJXF 1FN4A 5DXWA 3D85B 2VUOA 4OB5H 4P46D 1WAAA 4LLWB 1UJTA 5L8LB 5HHVL 3WBDA 4S1RH 5D7IB 3G5XA 3BSZL 3VD9A 2Y5EA 4WO4D 3ARPA 2ENSA 3LV3A 4PJ8C 4ZXBC 2YD8A 3P4NB 4PBWD 4X6DE 4Y1AB 1D5BA 3UTQB 1TVBA 3SKNB 4PJGA 1N5AA 4N0CC 5KAQF 3MJ7A 3N0PB 5FYJH 4EN3B 1WTLA 4JRXD 2Q6WB 4PBVC 3MACL 4M6ML 4BKLB 1QRNB 4BK4A 3NIFE 1V7NH 4MAYA 2W0FA 1S7TB 4OLWH 5GS0H 4JZJB 3ZKMD 2NYYC 5D7JC 4L3CB 3MV8E 1RUQH 2WWMD 1FYHB 3JWDC 4XPHL 3QZWG 2HRLA 1JYVA 2DLEA 1S7RB 4TOYL 4OLVL 4ZUVB 2NQCA 2X4RB 1TVHB 2X9YA 1M7XA 2VRAA 2D31A 4WHTA 1QFHA 4PB9H 3VXNA 4ZSOB 3WHXB 1JCKA 3R4DA 4MDJB 4R2GD 1OAXL 3BEWB 2NXZC 1DN2A 5F9WC 1I7UA 1J1PL 1U8KA 2F53E 4O58L 5EBWB 3H9HB 1ITBB 5J1AA 3K81A 2BSSB 3TA3A 2R1XB 3T0EC 1D5ZB 2EZ0D 4O9HH 3K1DA 5L8JB 2YZ1A 3C5ZB 2JCCF 4OKVA 5EIVA 2I9TA 4IDJH 1YMHB 3UC0L 1NSNL 1IGML 2GTWB 4RAUA 5I15L 2P44B 5ACZB 2HJFA 3TCLB 1RZJC 1LEGB 1UYWH 4NKQB 2OR9L 3ULVD 3DGGB 3QCVH 2DJ4A 1YMMA 2EKJA 2YUXA 1HSBB 2JJUA 4J3TA 1MFEH 5HYJB 1IBGH 2OP4L 3KDMA 5JPNB 3KYKL 3KXFA 5LXGH 2WNGA 5T1LB 5HJ3B 1INEL 5BCAA 4QHMA 3C6LB 4NZJA 2X4SA 4MA7L 5KN5B 1JGLH 4QNPE 4XNYL 4RSVA 3WEXB 2PW1A 5SWZD 5TFSH 3W0WB 2V2XA 1F11A 5EUOA 4YHLL 4NO2A 1BM3H 1XGRA 4ELMA 1INDL 1DBAH 5T5NF 1HHGA 3ULUH 5E4EB 3HI5L 4F9PC 1EHXA 2CKNA 4P2QE 3MXVL 1RURH 4KQ3L 5ICYB 1NMAH 3GB7B 3WO4C 2IQAA 2A0LC 4M4PA 1QR1A 3GI8L 4TUKH 1WZ1L 1AD9B 1N64H 5CEZL 3O3EB 4KROB 3L3OA 2Q7YB 5FUZH 5F6IB 2OJEB 2AXGB 1U93B 2DWEB 2EDRA 5FUCC 1S7QA 2O5YL 4X4XB 4Y4HA 5T3ZH 2ZCKH 4W68A 2O61B 4PYHA 1W8NA 1JGUL 2W0KA 2BY3A 5DQJB 3U4AA 4XBEL 1IGCH 1WAAF 4EEEA 3ROLB 3QP3A 4NKOA 3O6FB 2IBZY 4R4FH 4GW4B 1GC1L 5C08B 3QDGD 1XR8A 4MJ6A 2X1WL 3KPPB 3PABA 1L6XA 1NGZB 3QHFH 2V9RA 1CTNA 1N5YL 1CGXA 3VFUB 1I7TB 4PJGF 1XF4A 5FGCE 4OFYA 5L2JB 2ID5A 4S1SL 5HHXH 1CFVH 1VB9A 3ARBA 4P4KD 5K9JH 3OHXA 1Y18B 2P8PB 2XFXB 2CKBH 3P73B 4KAQL 4HD9A 5SX5K 2GTZA 2GSIA 1CG9B 3KAAA 2DYPB 3O8XD 4JFQA 2Q3ZA 1PX4A 4E41B 3MRMB 1F3JB 2VDRL 3BXNA 5HI5D 4KHTL 4WCYH 3VG9B 1N0LA 3LAFA 4OIBA 5DJZB 5E9DD 3ZYIA 4AH2A 1CL7L 1UJ3B 2ADGA 5L9DL 2VWEE 2XA8L 4TSAH 4UTBH 3MGTA 4M6OH 5H37G 4KWUA 4JR9H 1EGJH 2IPKB 2CR6A 2Z8SA 5KSAA 5JLZA 1KIUA 4G8GA 3TN0C 5HYSG 4DZBA 3BD5A 3QDAA 3IXTA 4GKSA 3DIFA 2VZVA 3T4YB 4XCYA 3ARED 4I13B 3QPXH 3HNSH 4QRPB 1M05A 3LEVH 3MCKB 3U1SL 4DW2H 3DXAA 1NCWH 3X13B 4K7PX 4QRRE 4GMSH 2IAMD 4KY1L 4P2RB 3SJVD 1IFHH 4JPWL 4KV5F 4XAKE 4GO6B 3H42H 5K9KB 1QSFA 3B9KA 4LF3A 3VXSE 2VLKA 3MYJA 1NEZG 2JJWA 1KEGL 3IDJA 5DURB 4NO0D 4C56B 3UPCA 5DFTA 4RWYH 5L88H 4LLQB 3JVGA 5MEOA 2XTJD 2G5BA 3RZCD 2BNUA 2Q8BH 5C2BL 2CLZA 3UTSD 1KENH 3O45B 1F6AB 5J9PA 3QQ3A 4PGJA 1AXTH 1MCBA 5F93C 3I9GH 4M48L 1T0MB 4OZFH 4X6FA 4UINH 4OSUL 4P23C 4FQQB 3IU4H 5GRVK 1X7QB 1T22B 2VZUA 4YIQA 4HX1B 1AC0A 1VCAA 2VDQH 4RCAA 2VLRB 4K3JH 2GUOB 4LSPH 1OL0A 2YBRB 1F3DJ 2YMXH 3EFFA 4N0RA 5H2BA 3TIDB 4JG1H 5ALCL 3SDXA 3IXAB 1MLCB 1B0GB 3MLTB 2F53D 5D72H 4YO0A 1P9MA 5E00A 4ZFFB 1EEQA 5FYLH 3MCLH 5DJYB 1XGTA 3DX8A 3I50H 1X6LA 3D18A 7FABH 2DQCL 3R1GL 4ONGL 1PSKL 2P24A 3LMJL 5K9OA 2VKXA 4UDTB 1J18A 4YHNA 1LWRA 1WCBB 3MNZB 4LKCA 4RQQA 4K2UH 3Q6GH 4X7CC 1F2XK 2EDTA 3U46A 1KIRB 1FE8L 1HHKA 1MRDH 3M17A 3LQZB 1EO7A 4TVPH 5ID1B 3QG7H 5I71C 1T83A 1YY9D 4XC1L 5FECB 4UNTA 3MUGA 3EO1B 1FC2D 2DM2A 4FP8H 2QR0B 4FQJL 4PRHD 3QCTH 1A1NB 1OAYL 1M7DB 5I8OH 1K8IB 4MD0B 4PS4L 1DL7H 2OL3B 1D5MA 4CN6A 1OGAD 3CXDL 5EO0A 4M7KL 2JIXD 5ESQB 1L7TH 2J8OA 3M45A 3OG6B 5EA0L 2X1OA 2XY2A 5F3BA 5IHZA 3RA7L 3KPRA 3NIGE 4L3EB 2I07A 4G9DB 3VG0L 3GMPA 4NQDE 4XNZB 3BEVA 3HB3D 3CCHB 4P2QD 4JFDD 5DJAB 4LPYA 5KSUA 3OJDB 3CLFL 3OAZH 1EERB 4YXKH 3D9AL 1XCTA 4YE4H 2IFGA 4P5KA 3QIWA 5F7HA 1KPUA 2ZP0T 3UJIH 4F33A 4G6KH 2WUCL 2EXYC 2VLJE 1FNEA 4GRWE 4XVTH 1U2CA 4EDWL 4JRYD 4HLJA 1SBSL 4HT1L 2P8LA 3DUHA 2QQKH 1M4KA 3BWUC 1KT2B 4NQEA 2FO4B 2IALA 5H8DA 3NOIA 1I4FB 1ACYH 1T0NB 2AK4E 3PHOA 4Y2DA 5HY9B 4IIQA 4MXVF 1QQDB 4M02A 4WI3A 5F1OB 4K8RC 2CIIB 4OGXH 4QRQA 1V3MA 3O3AA 2R0WL 1K8DB 3OTTA 4AIZA 2EE3A 1IC7H 1NBZB 32C2B 4XP4H 1FL6B 1HNGA 2NY1B 3ES6A 5CEZE 5I66A 1FL5B 2AK1H 5IT2L 2E6PA 2MHAB 4Z5RB 3RVUC 4CDGC 5C6TH 4UTAH 3WXVH 2HG5A 2WBJD 1FVCA 35C8H 3R0NA 1BVKA 3V4PH 1QLRB 1EEYB 2R1YA 1W8OA 1U3HD 5IUSA 4FXKA 4Y16C 4OD2A 3RDTB 3KLSA 1I3GL 1OY3B 2APTA 5CSGA 3RAJH 2Z93A 1KCUH 4HZAA 4HGKC 2W60B 3DX7B 3FHQA 5IGXL 5BVJA 1SQ2N 4FQLH 3FQRB 4YPJA 1D5XA 1RJLB 4HF5H 3QG6B 4POUB 3ECBB 2K7PA 15C8H 4Q0XH 3BE1H 5BMFH 1VFMA 3ISWA 4K7PL 4Z0BH 5GZOC 4KRPC 3HPJA 3NTCH 3QQNA 5FYKD 1G7JB 3WNKA 5ITBL 4WW2C 3MV7E 4KJPD 4M7LL 3SDXF 4YDVB 2YD6A 5IVZB 4ZFOB 4YWGH 4PJDA 1NGXB 5C9JA 4X5XB 2M26A 1YEGL 4QRRD 3KPSA 2RFXA 2ARWA 3LKPA 4HJJL 3P30H 5CSZB 1ZS8B 5TDOB 1UB5B 3VXSD 4DKDC 4GG6A 1U8QA 1C16B 3GNML 5DT1L 5HYFA 2VZTA 5J13B 2XQBH 1UXWA 1WTGT 1BFVL 3U0WH 6FABH 5E99L 3BAEL 1T1ZB 4HUVB 3JSSA 3WHE1 4PJ8B 2ILLA 1CGWA 2FEDD 4LAJH 5BRZB 3LB6D 3S4SA 1T1WB 1LEKA 3ARDA 1MWAL 1MPAL 1FZOB 4XCFH 5IKCA 4L4TA 3WUWB 1FO0L 3W9DB 4CU8A 3MFFB 3VE0B 3WIIH 2D0FA 1MCWW 1G1YA 1X5AA 1CE6A 4GW5B 3D39B 3KLAA 3EOAA 2P47B 5C0FB 2C1PB 5DJXB 5EU4B 1DBBH 3BP5A 3DNKA 4F3FA 2ICEB 2BRRL 5IK3B 4I8DA 3JWDH 5CEXB 4Z0XA 3ZE1F 1A7QL 4WI4A 1KXVC 4W6XB 5DRNB 3CVHA 1WWWX 3IRPX 1IGFL 4V1DE 1MH5B 5E24E 2V7NB 2O5XH 1PKOA 3MLZL 2QKIA 4L8DB 4Y5YC 1JHTA 1BGXH 3RWFB 3HE7C 4MCYA 2A74A 2BFVH 1OP5K 5L8KB 1YEHL 1JPSL 5JO5B 2NXZB 3VFGH 4A6YA 1AD0B 4J3OC 3QB7C 3BP7B 2AAVA 2WM0A 3R8QA 5E8DL 2HKHH 5CCKL 3T0EB 3LIZL 4JRWA 4KVCL 4TUOB 3QWQB 2ICWI 2ZPKL 3D2UD 2B4CC 4ZOBA 2VXUH 3BMWA 5D9SA 3I3EA 1RZJH 5C0IB 2NY7L 1Z5LA 4J6RH 1FL3B 3MBXH 3HCVA 2K9UA 4N8CL 2NXYB 5HHME 5DYOA 4GQ9H 4JKMA 4KDTA 4R4BB 1CDBA 4DN3H 1FYTA 4O02H 5LCVL 4YDJA 3MRPA 2A77H 1VFBA 4ODXB 2HFFA 3QQ4B 1W0YT 5JHDD 1QPXA 3S8WA 4OUUA 4CW1A 2D4DA 3VRIA 2I5YH 1IKNA 1TJHL 3MLVL 1P1ZA 1G6RA 1K5NA 3LOWA 2F15A 2OZ4A 3O9WD 5TDNB 2FEEI 4KK5D 3S3SA 4D0CB 4GRLA 1PY9A 3OKMB 4NNXA 3RGHA 1JGEA 5KVGH 3IU3A 4Y5XC 1S7VA 3MUJA 4P2OD 5I1DB 4APQD 4WWKD 5F89A 2FR4B 3VXUA 3HFML 4ORGB 4PLJC 3TJEH 3ULVL 2Q86B 2VL5B 5CIPB 5IWLC 1N26A 1RIUH 2AQ1A 3ZKQD 4Z77A 4M6NH 4UNVA 4FQCL 4F15C 1T6WA 3LQAH 1BP3B 4TQEH 1FIEA 1TCRB 1UH2A 5IBLD 1EVTC 3QIBB 4RWHA 1S5IL 3LVEA 3BWAB 5J0BA 1MFCL 2GK0A 4HPYL 4PD4K 3QXDA 3WO4B 3TT3H 3IJHB 3BP6A 4MJID 3UCRA 2H2SD 4QHLA 1RMFL 5FF6B 2H2PD 5T5FL 3VFSB 1T2QH 5E1HB 1YUHB 4K3HA 3MBEA 4G42A 3FOLA 4CVXB 4E9LA 1RHHA 3IGAB 3V6ZB 1GZPB 3BPCA 5BV7C 3NBNA 4PJ7A 3JTSB 4HH9B 1YEEH 3BJ91 4PJDF 4OLUH 2HJLB 2VDPL 3FFCD 3P9WB 2P5WE 2BNQA 2R56H 3EYQC 1OVZA 3CFCH 4YHPA 1NUNB 4WFHE 2VABA 1ZANH 1YMME 2Y9RT 4QXUH 4J7RA 7CGTA 1U3ZA 3VRLE 1XIWA 4DVRH 3H9SA 1CBVL 4Z7UA 4GKOA 1BZ7B 2IBZX 1HHJA 5GJTH 3PJSA 1ZA6A 5GS2H 5CGTA 3V79C 3PWNA 3SO5A 4PIRF 4AIOA 1AJ7L 5E0QA 3U7WL 2K3TA 1IM9D 1WBYB 2AV7B 3VCLA 4ZUWB 1KCSH 2HLFC 5AAWA 1NBYA 2VSDA 4TUJA 4JZOA 5EUOE 1DVFD 4H1LA 5TJWK 1FIGL 5EU6B 3T3PF 4HUUB 1FV1B 1N0XL 3BDYH 1A3LH 4ELME 1PW3A 4GXVL 4HS6A 4MD5B 3L5HA 1U91B 3CMOH 1J5OL 1SY6L 4MNHA 4MZ2A 1BVLA 4U3CA 2DIBA 3O6KL 2BRQA 1EEZA 2VXSL 3S36X 3GJFA 3QA3B 4WFFD 1KCKA 3NACH 5IF0A 5JA8B 3ZT7A 1ND0B 3TN0B 2ZSWA 1P6FA 4OZHA 4JHWH 3OX8A 4GG8A 4JPVL 3RNKB 1XR9B 3PP4L 3JWOC 2I9LA 5DD0H 1JVKA 1F4YL 2NR6C 1TMCB 3NPSC 3EIFA 4I0PA 3E3QE 1DP0A 3ARFA 2CPCA 4N0YL 3UTPE 4WU7A 2OMBA 2VXQH 4XVUC 3VFMA 1YA5A 4P5TD 1GAFL 5DMIH 5T3XH 2UZXB 5KSVB 1S7UB 2PCPB 2EDNA 4Z7NE 3VMNA 2QADD 4KK9C 1HIMH 3QEQD 1LO0L 4LOUC 1YDPB 3LKOB 2Z4QA 5MHSD 2KQMA 2A1WH 1AY1L 4XXDB 1AIFB 4IRJD 3N1PC 4CU6A 1QYGL 5DC9B 4OZIB 3H0TA 3P40A 3UJTH 3BIAX 5E1AA 4ELKB 1SEBA 1MHCA 4K07A 4LHJB 4ZDHA 2FSEB 1WUNT 5D8JH 1QO3A 4HXBH 2R9HD 4R7DB 1OF2A 3CFJB 2LQRA 4PGBA 3L3KA 1JUFA 3PL6C 4M43H 3QSKB 2EECA 1QVOB 1UQSB 3FZUD 5J06A 1QUNA 4JFED 4Q6YA 4MNGB 5C0AE 1KJ3H 4IM8A 4NGHH 3MGOA 5CJQL 4R3SA 4UDUB 4PJHA 1E6OL 3DV6B 2J3SA 5DS8B 3HLAA 4G8GE 3MZTA 2E7LC 2YPLA 4KHXH 1MJUL 4RBPH 4PLKD 3KPOA 2EXWD 1VDGA 4XI5D 2I60H 2WIIA 2DWDB 3T2NL 5LAXB 3FMGL 3T4AA 4UT9L 1K6QH 1FFNA 2HTLD 5F7DA 5C0CA 4X7SL 3Q2CA 3IETB 5HDOA 5M94B 1HILB 1AXSB 2NY4C 4FFYL 3TBWB 4BFIA 5IHUL 2VDLH 4Q74A 1C5BH 1OPGL 2BC4A 2E9WA 3BQUC 1P5UA 4KJYB 4PJ7F 4IRSB 3NCYP 4JGUA 4PJ5B 4YBLB 4OF7A 2Z31B 2IANB 3CMGA 2D7TH 3CFEB 3DV4A 1MCQA 5D2LE 3P9MB 4YX2L 4AJ0A 3QDJE 1G9NC 3WLWC 4MAYD 4XCCL 3HG1B 3RWIA 5B39B 2PTVA 3DHMA 3I75A 4Z7UF 3WUWG 3FRUA 2VWEC 1I1RA 5FXCH 4TPRH 2KL6A 4M5YL 3QXUA 4TSCL 5DVNA 5EZIH 5CJ5A 3L5IA 2FGWH 4X6CB 1DLFH 1WGOA 2B2XL 4Z7WB 2ADFH 2D7MA 2I26N 2R4RL 2AJUH 1GHFH 4L8BB 1G7HA 4KGJA 1A6TA 2FECI 1GH7A 3ZDXE 3GBNL 1HKFA 4LGSB 5JORB 3EOTL 3RVTD 1KJ2B 2DDQH 3DROA 3MXWH 2H45A 1YPZA 4NCC1 3IDXL 3L3JB 1PDKA 1C5DA 2NLJB 3TA3D 4U1GC 1JK8B 3VWJB 2EYTB 3OL2A 1WT5A 1T89C 2XOTA 1EAJA 4GAJH 4GQPH 3OGOE 5E94A 2GY5A 5FA4B 3L5WA 1NFKA 1VEMA 4OZHF 2PR4H 3RUGB 1DUZA 4NDMB 1FG2B 1Y6KR 2ICES 1I1CA 1I9IL 1FP5A 4JHAL 1I1FB 2B8OT 4CMMA 5F8RC 4OIIL 4OQTL 1YMMD 4RZCA 5F9OH 2X7LB 4TNVK 2DQHL 4MZ3A 5IQ9B 3V5HA 3KXFD 4XPBH 2ORBH 4Y4FC 2YD2A 2JJSA 1AGEB 2W59A 5DTFB 1UWGH 1MFDH 2A6IA 2G75A 1MCIA 2I27N 1M6OB 1FGVL 3MOBL 2VSCA 4HAGA 4WHDA 2NY2D 5F7NC 3FFDB 1HWGB 2FL5B 4NQCB 2YK1H 3OZ9H 4HFUL 1I1AC 1CS6A 4FFZH 3FTGB 3INUH 3EHBD 1MELA 2HFEA 4XWGL 3RWGA 3S36L 2OI9C 2IGFL 5E2WL 5LGKA 3U6RB 4FTVE 3UTQA 2R4SH 4FXGA 1EO8H 1LO2L 3SQOL 1IM3A 2BVQA 2VB5A 1OP3K 4XVJL 2V5RA 4MNQB 4X9GA 5KS9A 1I8KA 3EO9L 2Q6WA 3C2AL 4N8PA 1OWRM 4YDLB 4ODWB 4L9LA 3VFOB 3Q5TA 4KRPB 4ERSL 3EJYD 1P4LA 1MI5E 1CLYL 2IQ9H 5C0NC 2CRZA 4QOKE 5EH1A 3U0TB 1U8IA 5DQDH 5T1KB 3RUGF 3L3IB 4Y4HD 3UDWC 4NUJA 43C9B 1YEKH 4ZYKB 3GO1L 3S98A 1WBZB 4IS6A 3G6DL 3L1OH 3MROB 1IQDA 2R2HB 1NCCL 3BGAA 3V6FB 3VXRB 12E8H 1B88A 3MLRH 3TT1H 5C92A 5DDHB 4XPAH 3SDCB 4Q9QH 3U9PL 5CJOH 2B1AL 1CXKA 4F7MA 3ZHKA 4ZPVA 1FFPB 4AG4H 4YAQA 4MDJA 1IKFH 4HS8H 5IQ7H 6CGTA 4HWZB 2DQGL 2RHEA 1EUUA 3G5VB 3SE3C 2W91A 2G9HB 3IJSB 1NMBH 4FNLH 2JTDA 3ALWA 5F96L 1B9ZA 5SV3A 3ARGB 1LK2B 4LSSL 1PYWB 4OFYD 5GJSH 3STLA 4W4OA 3ARBD 4N9GB 4XP5L 3EYVA 2EDYA 1Q9WB 5C6WH 3I2CH 3RVVC 4L29A 4JQIH 1KYOJ 4MD4A 2ZCLL 3WCYA 1J0JA 1U6AL 3RWCB 3D3VB 3VW3L 2VR5A 1MQKH 2H3NA 1G9ML 1O7VA 3R8BB 4LPCA 1UH3A 4ZAKC 1NGQL 3C60C 2HWZL 4IOSD 4X98B 5I0ZA 4FABL 4U1JB 5IVXE 1ADQH 5KSAD 1CFSA 4G8GD 4Y5YB 5EOTB 5HD8D 3V8CA 5BO1H 4PG9A 2FX8L 4BFGA 1AO7A 4POZD 1G1CA 1Q1JH 1PZ5A 1QBLL 3D0VA 3QUXC 1WZKA 4BELD 4CN4A 1OAKH 2QBWA 5L7XH 4M00A 3BPLB 1FGNL 3WIHL 3DXAD 2NNAA 4OLXH 3DMMA 3GMOA 3HZVB 4MA8H 3SDDC 4R0LB 3MRQB 3V6BR 3BESR 5DGQA 1QSFD 3CU7A 2B4CH 3B9KD 3PWVA 2VLKD 3U4EA 4GG6E 1A14H 2MQCA 3W5NA 2DKMA 3FAWA 1UACH 3CSBA 3GB7A 3QCUL 5DHYA 5EU3A 3DLQR 1BLNB 1AD9A 2IADA 3OXRA 2X42A 1FFRA 1X4XA 1T20A 5GIRA 2Q7YA 4P3CL 3VGGA 4WUUA 3VFPB 1H3PH 5D6DA 2IEPA 1DDHB 3VGFA 4NKIL 3HI1B 3X14A 1YNKL 1S9XA 1U93A 2C26A 4YDIH 1TDQA 3B2VH 5D70L 2R2BB 5JIKA 3BZ4A 4XMKL 3GIZL 5JQ6H 3P0GB 3V4VH 1GCFA 1RZGB 1XGUB 1GC1C 1YQ2A 5B8CB 2LE9A 4NO3B 3VI3E 5HDQL 2CUIA 5FOBA 4Z8FH 5IROC 4HUXB 1KIPA 4HC1H 3U9UA 3ZKSD 4UU9B 3SKJL 1BHGA 1WITA 2PUQT 4LSVL 4TNVF 2PF6A 3FB6A 4F15B 1FZKA 2BSRB 5DEGB 4XXCC 1QKZH 4OF8A 1H3TA 2EKSA 4BH7B 1HZHH 5F88B 3WN5A 1NL0L 1NDGB 1BD2A 3PWJB 3F6LA 5LGHH 5IW6A 4HWBH 5KS9F 1NAML 1MHPH 1ZA3B 2V17H 3ZYJA 2CKBA 5HGHB 3EKCA 3MREB 4PJIA 2VZ3A 4IMKC 4M5ZH 1IGTA 1JYNA 4F7EB 4NM4L 1BAFH 2Y6SD 2W9LA 2PXYA 1U8NB 3EGSB 4PRPB 5DRXB 3TIEB 2GJZA 2NY0D 3U36B 4XAWL 5HHPA 3CX2A 1EGJA 1DBMH 5HGDA 4R26H 2F5AH 2OXHA 2V9QA 5I1HH 5DWUL 3WMSA 3QI9B 3B5GA 3MCKA 5KJRL 1PZUB 1Q9LA 1CU4H 2OMNA 5GRWA 1XF1A 2F58L 4JO2H 2RCSH 5LGJA 1U8PA 4LLDB 4E5XA 3KPRD 2ED8A 4Z78A 1JNHB 1IGJB 1SYVB 1U58A 4PY7A 4H0GA 4P9ML 3QJFA 4PJCA 5DMGD 3SDYL 3K4ZA 5D2NA 3VXUE 1HCFX 1Z2KA 3CC5A 5B39G 1GGCL 3VFWB 5BZDB 4HWEL 4AEHL 1L6ZA 5SWSB 1AXIB 4WEBH 2OQJA 1DBKL 1N4XH 3DOSA 3O45A 1MSPA 2AGJL 3HZYA 3QIWD 4JJHA 5DD5H 1Y6NR 1HOCB 2BZDA 5ELIA 1MI5D 5IBTH 1OWWA 2XWJA 3MR9A 3T3MF 1PG7H 3SDAB 4LPXA 3TZVA 4QLRA 2P8MA 5HYQA 3MOAL 1FPTL 1CDYA 3D25B 2EYRA 1G7LA 3KNBB 2C9AA 5HDBF 4D0DB 4NQED 4HKBA 3ABZA 2DQJH 5A1AA 2EDJA 3BPNB 3PGCB 4FQXA 1JZ7A 5J6HA 3F12B 4XRCB 2C3VA 4I4WB 4Y2DD 5DJ2B 3M07A 2OTWB 3U79A 4K3EL 4JPIA 4JO3L 3Q3GA 4QTIH 1A6ZA 2XQYG 3RRQA 1T7ZA 3QUMB 1NCBL 1YYML 3VXPB 4MX7A 4TVSa 1T03L 4LQFH 3LN4A 3L3GB 4ZOAA 1RZ7L 4LK4A 2CDGA 2UZIL 1FFOB 1XCQB 3GRWH 3BVNB 3VH8A 4QTHA 1HQRB 2X4OB 3ULUF 5HHOB 3I6GB 1D7FA 4RIRA 5C7XH 3P4OA 4U6HB 1NDMA 2Y5TA 1R5VB 1AKJB 1MUJA 5D1XC 4HMCA 3RL2A 2QHRH 5HI3C 2D03H 4X80H 5LJYH 1N6UA 3PIQB 1OM3H 3UBXA 3UTZA 4Q9CA 3NH7H 1RZFL 3MRRB 1UA6L 3U83A 3ZTNL 3O2WH 2EIDA 1JI2A 1NLBH 1FZMA 4KZEH 5KZCB 3WFHB 2Q20A 1W0VA 1LE9B 5DRWA 1MRFL 5ACLA 4LSTL 3T0AA 4TSBH 4OGAC 2CRIA 5I30L 1A1NA 4HV8B 5GRXG 4OCYH 5HGBB 3X11B 2XNAB 4MD0A 4N8VA 2Y06H 1GPOL 4RGNE 5B3JF 3BZEA 1A7PH 2VITB 5DJDB 1GGBH 4KKBD 1CFTA 5EWIL 4PJEA 4P5MA 4LSUH 2P48B 5I16B 1ULVA 3OAZK 4G5ZH 3KPSD 2R39A 1TTUA 3AGVA 1IJ9A 3EDFA 1A3QA 4PG2A 1SYSA 2YC1A 5E8NA 2J1KA 4KMLB 1QNZH 4KXZH 4PRBB 1QSEB 5AYUL 1YEIH 3FOMB 4N0UB 4J3SA 3H3PH 4H8WL 2E7HA 1PY4A 4LVNB 4JDZA 4G7YL 1GGIL 5E6IB 4PJIF 3V8OA 1FH5H 3BIBX 1DCLA 1Z0NA 3ARDD 2NX5A 1N59B 2FB4L 2IG2L 4U1IB 4L4TD 5FM5M 5DD3L 5EU7C 3CPLA 3DSFL 3LD8C 5BVPH 4WW1A 1ZHLB 3HC3L 2ED9A 5ETUA 1QFWM 3SGJC 3DVGB 3WE6A 3TYFA 2VH5L 1LK3H 1ZVHA 1AR1C 3GMRB 4LLVB 2NTFB 5DHVH 4WFGE 1BFOA 3GKWH 1ZLUH 1RIVH 1FJ1B 4CN1A 4FN0A 2F19L 3F7YA 2DRUA 4KK8C 4QHNB 4L8SC 3B3IA 1K8DA 5MENA 1ZGLP 5KVFL 4JY5L 3I6LD 4RISH 3QFDA 5FYKH 4PJCF 5BJTA 1I9RL 2E9BA 1CF8H 3QULB 4UB0H 5D7SH 3MRLB 1D5IL 4PJHE 1E4WL 5TQ0L 4MDIA 1KJMA 4U6YA 3I84A 3QH3B 1NGWB 1PJ9A 4OCLC 3RDTA 4HQQH 5CEYB 2AJ3B 4X99B 5ICZB 5D1QC 2JJVA 5FCUH 3BRGC 1F42A 3M8OH 1FBIL 1JWMB 4M61B 3HE6A 4KJWD 3OQ3B 2W9DL 4NC0B 1RJYA 1S78D 5JXEC 4WIQA 1A5FL 2DI7A 5EC2A 1D6EA 2FHBA 3FN0H 4HZLA 5C0CE 5I1CL 2Z9TA 5JW5B 1T5XA 4BH8A 1KN4L 1ZLSL 3W11D 5C09B 1GRWA 5GS3A 2CMRL 1X5HA 3LKNB 4HIXL 5JUEH 5JW3L 1FYTD 3QUYC 1UEMA 1SHMA 2NY5H 2H9GB 5JDSB 5ICXA 4A2MA 4ZFOA 1JBJA 1L0QA 3G08B 3WNOA 1FDLH 1D6VL 5EO9B 5I76A 4L8CB 4GRLD 3PGFH 3NGBC 2LFGA 4LFHG 2M1KA 3HNVH 3SCMB 4HGWA 2ATKB 2PO6A 4S1QH 3VXUD 4PRIE 4HIIB 3WNNA 2X5PA 2HTKD 2LU3A 2EYSB 3RTQA 3JUYA 1S9VB 1LDPL 4ZXBA 3U7AA 2OI9B 2DB8A 1KEML 2J5LC 5ISZA 1EMTL 3R06B 3N1GC 2OLDA 5IW3A 5DMKA 1OGTA 1SJVA 4JY4B 1RQ5A 4QRSA 3L95B 4G8EB 1U8OB 1FLRL 3O2VL 4LPWA 3MV9A 1WCQA 2JF1A 4KJQC 3FO1A 2EH8L 3VGDA 4TOYH 3AROA 1YPZE 4RMVA 3V0VB 2IWGA 4TN9A 4DUVA 5D6CA 3LKSB 2VE6A 3MBED 3DI3B 2CLVB 5D7JA 1EA9C 5T1DH 3HRPA 1U9KA 1N3NA 3SE9L 3FT3A 3OAYH 1XH3A 4PJEF 3PDOA 1OAXH 1OAUH 8FABA 1DBJL 3CDGB 2BNQD 3ZKMC 2IC2A 5DD1L 5I18L 2AJYH 1JNJA 3P77B 5FHBL 3SY0B 3LDBB 4R97C 4UQ3B 1T5WA 5GS1C 1FNHA 1A7BA 3QO1A 1VACB 1KB5B 4Z7VB 5FAAA 1XIWD 3H9SD 2GCYB 5E7BA 1XZ0A 5ERWB 4OF6A 1SMOA 3H7BA 1NSNH 1IGMH 4KTEH 1RZKL 4U1SA 5CZXC 1JWUB 5I15H 1A6WL 2H8PA 3VXMA 3VWKB 4FFVD 5L0QC 4R2GC 1V05A 4NOFA 2XACC 1A1MA 3CNKA 3SE8L 5ESVB 1QSVA 1JN6B 1TJGH 2AI0H 5D7IE 4IBLT 1U41A 2FIKB 2FX9H 2FNBA 3MLYL 3O6LL 2WIMA 1J12A 5EO1A 3QUZC 2OP4H 4KC3B 4Q97A 1INEH 2QV2A 3BZFB 4Y1AE 1JHKL 1QLFB 4ZD3L 2FCBA 1UM6L 4F2MB 3C09B 3L3DA 1H3GA 4W81A 4GRWH 3C60B 4MA7H 4NUGL 4K7FA 4RGND 2VZOA 4XNYH 3RGVB 3MC0A 2X4QB 4FQ2L 2J7LA 1KIQB 4PRDB 5I75C 3ULVC 5E03A 1QRNE 1TETL 1MCRA 3P0VH 1IEAB 4H5SB 1RK1A 2Y7QB 5CKGA 2ZOLB 1HQ4B 3HI5H 4I0PD 5D5MB 3MXVH 3LPWA 3ARFD 1IC4L 1IEHA 1FNAA 3IFOA 1J0IA 1LE5A 4OIAA 3S37X 1LO4L 4NWUL 4R90L 5T33H 5FO8B 5KVMC 5BW7C 3TVMC 5TPWH 5CEZH 4PV9B 4NQXB 4QYOA 2UZYB 3C5JB 4NT6B 1EZVX 4U1LA 1SJEA 1D9KC 3PE9A 3SE4C 4ZSOE 1ED3A 1JJUA 3SKMB 1J86A 5FO9B 1WISA 5GHWL 5C9KA 3SHSA 3DO7A 3HR5B 1RZIA 1XT5A 3IKCB 4X8JA 4FFWD 4DGVL 2E8ZA 2AXFB 4LSDA 1WQVT 2VAAA 5IMOA 1DUYA 1T7XA 1NFDA 4H25B 1J0KA 3NZ8A 3NA4A 3O11B 4HWNA 3JTSA 1LO3L 5IMMB 2G60H 4LKXA 2F8XC 2AKRB 4WHCA 5FEBA 4G8IB 3G6JB 1XF3A 2AABL 3BT2L 2C3HA 2A73A 1YEFL 3GJEA 1ORQB 4PP2A 1CE1L 5HYJE 2KZWA 1U8LB 4KAQH 4LCYA 3IT8D 3MRHA 1F45A 4S11A 4BUGA 4NPYB 2YPLD 2VDRH 1L9MA 5GGRB 3RKDC 3FONB 3ZE0F 1NCDL 2PYEB 4KHTH 4P2CG 1S7WA 4WEUD 4HIJB 2P7TA 2JE8A 4C55A 4QF1B 4ZUTB 1KPVB 1ZHKA 2LU7A 4O2FA 4OD3L 5KVDL 5C0CD 4X7TB 3KYOB 4W6WB 3HHRB 2AXJA 4JFFA 1E6JL 5AYQA 5GRVL 3MRGB 4Z7QE 3NFNA 3EFDH 1KXTB 3S96B 4L5FL 3O8XC 2WINA 2AV1A 5DUMH 2ITDA 1URLA 3B6SB 4IHOA 4MYWB 3S5LB 3BX7C 3U1SH 3RNQA 1I8MB 3KWWA 3V5KB 1RULL 4LCWB 5CD5C 4NP4L 4JPWH 5I9QB 4AM0B 1X4YA 1WFUA 1ETZB 3GDBA 3AB0B 4OZFG 5IB5A 2FX7L 4Q6IC 2G2RA 3DYMA 3BUYA 4XNMA 3L5JA 3ZL4L 3S35X 5E2TL 3TESA 1FVEB 2GT9B 2ICWB 4HKXA 5C2BH 3GK8L 1KTKE 1QLEL 2PCPA 2AP2A 3CLEL 3D1MC 4JQXC 3PQYA 3NN8A 3OR6A 4M48H 1T4KA 2ADIB 1RZ8B 4KV5E 5DK0B 4K94L 3REWA 5HSFA 2UY7A 4OCRL 1BBDL 4NHUB 4M1DH 3LKOA 4J3XA 4LCCB 1BQHA 3PWPA 3FQNB 3OKYA 4HCRH 2R23A 2J8HA 4AEFA 5IM7A 2MKWA 4KKAD 4P23A 4QY8A 4NQSA 5FIEA 3V4UL 4YHML 3AS0A 3AU1A 3CDYA 3MRDB 1P53A 2IBGA 4ZFGL 1BEYH 4E41E 2V6HA 5LQBL 3KGRA 4LLUA 1ZVSB 4U7SA 2BK8A 3O0RL 4NWTL 4MCZB 4CNIA 2ADJB 4RBPK 4ALAH 2GJ6B 2DQCH 5BXFA 3VXOB 4FXLA 1YY8B 5F9DC 4Y0GA 5IV2A 5AEAA 1A6AA 3RU8L 5C0JA 1U3YA 3ZKXC 5KSBA 1T21A 4YUEH 1KG0B 1CXEA 4D9QE 1MCOL 1QOKA 4LPVA 5IFHL 3QDMB 4OTXL 2C4FT 3MRFA 1QZ1A 4QRPE 1RUKH 3FRPG 1VKXA 4L1HA 3BGMB 5EOCJ 3W39B 4MMXC 3Q5YA 3DUUB 3RIAK 1HXYA 1PLGL 1ZWIA 4WY7H 1CFBA 5DSCA 1NFDF 4G3YL 1OAZL 4QCIB 1EDQA 4FOMA 1CIUA 4MXWL 4C56E 3CXDH 5GQBA 4M7KH 4Z6AT 5EA0H 1BBJB 1CD0A 1BOGB 5IEKB 1CZ8L 1E4KA 2VXVH 4RMUA 4AEEA 4UIMB 3RA7H 5FYJD 5F9AC 4XP6L 3E2HC 3P9MA 3S37L 3JTTB 3VGEA 3UJJH 5DD6B 3DJ9A 3TPUB 3HUJF 1XF5B 5GS0D 4WEMB 5FV1L 5KW9H 3CLFH 4JFYA 3REVB 4QXGL 3D9AH 3GMQA 3WXWH 2AJSH 4BFBD 3HPLB 4HULB 1PAMA 1UXSA 2VLRE 5GGSA 3ARTA 4HDIB 4YZFF 1LNUA 3KPMB 2WUCH 4XBGA 1BQLL 4MA1B 3U2SA 4Y7MA 4EDWH 2CR3A 4JFPA 4R4NC 3GSRB 3QEGL 4S2SB 4ZQKA 4HT1H 1NAKL 1P84J 4AENB 4PRNB 3HAEA 3UTTB 1F5WA 4WNQA 5HTSA 4OM1L 2A83A 2E8YA 3S3JA 3CSYA 4MQ7B 4NM8H 4D8PB 1ZT1B 4J8RB 4JAMA 4MJ5A 1NLDL 4OAWA 5MI0C 5AD0A 2WQRA 3S3PA 2MQ3A 5DVKA 1W0WA 4RGOL 3V7AG 5ENWB 5DJCB 1BZQK 1ZLVH 1X5ZA 2BNRA 2P5EA 4AEIL 3T65B 3PHQB 4YK4C 3JV4A 1FORL 4ZNEA 2JK5A 3O3UN 5DO2D 3SOBH 5A3IC 3BW9A 1VERA 1A4KA 1NUFA 2C5DC 4RDQG 4JRXA 4C83A 5T1LD 3IVKB 5D1ZB 2YKLH 1AO7D 1XGPA 1CDUA 3B43A 4KTDL 3VJ6B 2UWEA 1ONQB 1DQDH 2DS4A 5MP6H 3HMWL 4HH8A 1VFUA 2Q76A 3B9VA 5IGXH 5J3HD 1GOFA 5L2KB 3OAUL 4OD1L 3PUCA 3QEHA 4Y16A 4LMQE 2ICCA 2F8OA 4DQOL 3DMMD 5KG9A 4L3EE 1OB1B 2X4UB 1RIHL 4JM2B 2R1WB 5IB3B 4Z18A 4K7PH 3FQTB 4HJGA 3HZKA 3TO4C 1HINH 5TE7H 3THMH 2BOBB 1CFQB 3BP4B 5CLTA 4LLMB 5ITBH 3L7FA 1CQYA 1INQA 2W9EH 4NBZB 4QT5B 1YEGH 3DTXA 3S35L 4HPOL 2QHLA 5IB4A 1ZHNB 4P3DA 2FJHB 1KYOK 1CVRA 4LPUA 1NC2B 4XGZB 3NCJH 1SEQH 5D96C 2F8VA 3GNMH 4WW2A 5DT1H 4PJ9B 4L4VA 1W72A 1JIBA 3C8KB 3QWOA 3L3IA 2CSPA 1BFVH 3BAEH 4MVBC 4M7ZB 4MQTB 4CRPA 5KSBF 2IPTL 5T3ZD 4JFZL 4BSWB 3NGBB 4UMGA 4CBPA 4ACPA 3ILPA 3EOBA 5HI4C 1NBVL 2UY6A 4I3RH 3KYAA 4RX4A 5DDHA 3O6FD 1FO0H 4O2EB 1PEZA 4Y4KB 1MWAB 5MENE 2EO9A 3V2AR 2P1YA 4P46B 1I3VA 4X9BA 4LBEA 3UAJD 1CGTA 1H8NA 1RVFL 5CUSL 4OV5B 1PYWA 3M1BB 2HVKA 1NMCB 4WO4B 2ZOKB 1BD2D 1R3KB 3O41A 1A7QH 5C0BA 3DHJA 1P4BL 4JM2F 1NUGA 2FEDC 3IDNA 1G9MC 4IOFC 4MSWB 4X6BB 2GW5A 5FUOH 2ARJA 3RWHA 3GSUA 3MNVB 4PBXA 1AQKH 3RWCA 3RIAF 3QIUC 1P2CA 1HDMB 2DQFB 1DEEB 4RFOH 4P0DA 3I02B 1M71A 3GMMB 1U8MA 1QBBA 4LASH 4NO5B 2J8UA 4F58L 1YEHH 3GHEH 1JPSH 1H3WM 2WBKA 4Z95H 2PXYD 3O4LA 5EZJB 5IESH 4XH2A 4UQ2A 3T8XA 4DUXA 5CBEB 3Q6FA 5C0RH 4ZUSB 1C7TA 1YJDL 1ADQA 5FM5O 3SKOB 1Q0XL 1QP1A 4NZTH 3LIZH 3UZVB 3HE7A 3ULSB 4R97B 3VD4A 2ZUVA 3MUHL 5H94B 2XWTA 3FL7A 2X4NB 2DLHA 4MWFA 3S5LG 1J88A 2ZPKH 5E2VH 3MJ8B 4Q2ZA 4PREA 2O93L 2NY7H 4U1KA 2L4OA 5AG9A 5JIHA 2FHCA 4R2GB 1TJIL 1LGVA 3JV6B 5LCVH 4N5ED 4BSVB 3OJ2C 4ZFZB 4JN2B 5I73B 3QDGA 4EDXA 1P5VA 2ZSVA 4HKJA 1YEDA 4AT6B 3TBTB 5EB9A 3RBSA 1I1YB 5IBUB 1TJHH 5I1AA 4NRYB 3QRGH 5BRZE 5ALBL 3VFPA 4LNRA 1YN7B 4G9FA 1KGCD 5CJXC 4OLZH 4M62H 4U1NA 3TZVD 4WFEE 3HFMH 4Z76B 1UZ6F 5EC1A 3BH8B 5IMLB 3P9LA 4JKLA 2MCPL 1BZ9B 3FAXA 3MV9E 4BZ1L 3D39E 4I2XB 5K59F 1UG9A 3KLHC 1RUAL 4FQXD 5DRZA 4Y5XA 4LCUA 1MFCH 1DN0A 1NCAL 1YZZA 4KH2A 2B5IB 3L3HB 5IWLA 8CGTA 4RRPA 4HC1A 4J1UA 1J05A 3F5WA 4PGCA 1RMFH 4XCEA 5DEGA 4P2OC 5C07A 2R2EB 4HKZB 1N2RA 4YEEA 2EDKA 3O3BA 5SWZB 4LU5H 5K9QI 3CIQA 3GIVA 1X4ZA 1EJ6A 3KPNB 3MODH 3K1KC 5I8KL 1GGTA 4RNRA 5FYLD 4EQ3A 1PKQB 1YYLL 3EDJA 3B2UD 4NNPL 2Y25A 1CDIA 1MF2H 1S7SB 2YN3A 4HWBA 4UV7L 3VXME 3FB7B 3T1FB 1DQJB 3I6KB 1REIA 2DI8A 3T0EE 1RK0A 4JM4H 1OD9A 5IVOA 1NGPL 3KS0H 4X6DA 4ORZC 4WW2F 4HHAB 2VDKH 3K80A 3BGFC 1F02I 4OZGF 4HG4K 1JRHL 2JB6B 3AY4C 3Q48A 4TVPD 3MA9L 4S10A 4JKKA 4K55A 4PJFB 1CXHA 1T1XA 4XZUB 1A7RL 1QFWI 3RY6A 3UPRB 1OSZA 5A40E 2FWOB 2EICA 3K8LA 5D7LB 3X12A 2DLGA 2DLFL 1GSMA 4JHZA 2FZ3B 1NC4A 3MV8A 5C3TA 3TYGL 4ZTPL 1GJIA 5C0DA 4Z7OF 4KPHH 1F2QA 4UILL 4HFWA 1R3JB 1N0XH 5GGRY 4I18B 2AEQL 2M2DA 3HS0A 1Z9OA 3CFKA 2FDBP 3MNWB 2C1OB 1U8JA 1J5OH 3C8DA 1HEZB 1A6UH 4PJAB 5TH2B 3O6KH 4NN5B 2VXSH 3S88L 1M1SA 5D71L 3QT2A 5AUMA 4DKEL 1HYRC 3VGBA 3CUPA 4P4KB 4UV4H 2FATL 1F4YH 3O8XB 4KI5F 3T3PE 2J8UF 5FK9A 2NX5D 5INDA 4LDLB 4HLZH 5E9DB 3AAZB 2WQ8A 2YHGA 2Y36H 2J88L 2YD3A 3LHPL 4IMLB 1V7ML 3MV11 5CP7A 3CZFB 4Q6IB 5TF1L 3F12A 5FUCE 1IGIH 1A0QL 4PV8B 1LO0H 5CP3H 4H0IA 2WWKT 2YR3A 3V9FA 3QISA 5MEND 4G7VL 3AREB 1QYGH 1B4JL 2NY1D 1DLHB 3V0WL 2WW8A 3G6AB 3X3GH 2IAMB 3SJVB 4BYHA 1RUPH 1B6DA 1U0QA 4JZJC 4F57H 3I6GA 1RSFA 4RA0C 1DQLH 4PRAA 3WFCH 1TTFA 2VQ1A 3RDTD 1N8ZA 1Q9KA 4NO0B 1JI1A 1GVIA 1VGKB 1WC7A 2VLLB 3MO1A 1MRCL 5B22A 2FYYB 2XTJB 5CINL 3RZCB 1DQML 3WLBB 2DM3A 2RIKA 3HE6D 2B0SH 1R3HB 3UTSB 3TFKD 3PL6A 4YQXL 4GUPB 2R8SL 1E6OH 5EU6E 4LSQL 3VDBA 3TP4A 5CBAB 4JFFE 3K8MA 4WJ5A 1QR4A 4M7JH 3GSNA 3OGCB 4XNUL 4ZO8A 3ARXA 3LKRA 5INCB 3X11A 2XNAA 4DZ8A 4DUWA 3DARA 4P4RA 1JP5A 3T2NH 1S3KH 4KQ4H 5JOPD 4U7KA 2EH7L 1F4XL 3BN9D 3FZUC 1A7OL 5DJ8B 3C5ZC 1IAKA 4R8WH 2WP3T 3MRBB 2E7LA 2AJZA 3ZKXB 1OQOA 3ALPA 4E0RB 4R6UA 3VMPA 1A6VL 5LWYL 3ALXA 5IHUH 4P9HL 4H8WC 3BRFA 4NKMA 1OPGH 5DC0A 3ZYZA 5CZVH 5F97E 3CVHH 2F53B 2PO6D 3GUTA 3OKDB 4N0UA 4XCNA 1LEIA 4PLKC 3RTQD 4HEME 4XI5C 3PWLA 1CFNB 2DM4A 4WUKL 4AK1A 4EUPA 4ZXBD 1UM5L 5ISZD 1Q38A 5FKPB 4Q7DA 4X6DF 1JWSA 3BQUA 1IAIH 5E8PA 4N0CD 4XCCH 1OW0C 4O00A 3T0XA 4A6YH 2BVPA 1ZLUK 1BJ8A 5HDLA 4OZIE 4M9OA 2QQLH 2IPUK 4OB5L 3MV9D 4M5YH 3E2HB 1H0DB 2C7UA 4S1RL 1TVDA 3FQXA 2R4RH 3NIFF 3BPOB 1P7QA 3H9ZA 1FRGH 2NYYD 3TBVB 5D7JD 1KJVA 1LP9B 4PRHB 5E4EC 2CRMA 1OP5H 4FA8A 1ZTXH 3GBNH 5DHVA 4RGMB 1YC7A 3QYCA 3OKKA 5J12B 1OGAB 4FMFA 4FZ8H 3RIFF 1ODAA 1ORSA 3MJ9H 2JIXB 4MNGE 4GW1A 3IDXH 4P57B 3V6OC 5F6IC 1HK6A 1MHEA 2AW2A 4X5WB 3HA0A 4XC3H 3OJVC 4JB9H 2OZ4H 4UOW0 3CSPA 3DX6B 1KB9K 4OLWL 5GS0L 3DRQB 3AFLA 1NGWA 3RBGA 4QRRA 4MS8C 2V7HA 1FLTX 4JFDB 1TTGA 3VXMD 4YXLL 2F54A 1I9IH 3T0ED 1EO5A 4JHAH 3DSNA 4QHUB 4ODSL 2GAZA 2ITCB 5EZOH 3MA7B 3A6BL 4XPTH 5AG8A 3E6FB 1UENA 5IG7B 3OSKA 4I3GA 2A6KA 4JRYB 4URTB 2X70B 2H32H 4QRTA 4X4YB 1HI6B 4EQ2A 1FGVH 3MOBH 5IHLB 1RFDL 43CAA 5JQHC 1FZJB 4CDHA 2IANE 2XXMB 4R96B 4UT6L 3P0YL 4Y4FA 4X0KB 1XF2A 5IBUG 2XKNB 4PR5B 3S36H 4FG6D 2IGFH 4I3SH 3VXQB 5ACMA 4ISVA 3CX5J 4IDJL 3VG9C 1LO2H 3HG1E 3SQOH 4ONHA 4NIKB 1UJ3C 3PNWB 3UYRH 1I1AA 2CLRA 4QNPF 3QNZB 3EO9H 2QSCL 4LSRL 1UYWL 4W4NA 5DEFB 5JOFA 2YXFA 3C2AH 4X6CE 4HIEB 5EPMA 5KOVC 4Z7WE 4LGPB 1X5XA 5I1GH 2C3GA 4ERSH 1IBGL 1DFBH 1K2DB 2DTSA 3CK0H 5CMAA 1U3HB 1QHOA 4X7FC 1KLGA 3LKQA 3LN5B 4EI6A 2Z8RA 3OKOB 1CGYA 4LRNL 4KKCD 1T0PB 3KYNB 5B38A 1YNTA 5I2IA 2HT4C 3OAYK 1GOGA 3GMLA 3GO1H 5EBMA 3OKEB 4DOHB 4HS3A 3OV6A 4JDVA 3P3YA 3W9EA 4HSQA 3IDGA 2CUMA 3LS4L 3G5YA 4PD4J 1BM3L 2B1AH 1I85C 2R0KH 3EAKA 3UDWA 5C0EB 1G9EA 2DIJA 4JFOB 1DBAL 3ULUL 4Y5VB 4FQHB 1KLUA 1RURL 2GEEA 1FVDB 5DC4B 3RX8A 3LQMA 3MRNA 4TUKL 4HJ0C 4BUHA 4Y4HC 1JNNL 1N64L 1RZKC 4H0HB 4ZNEE 4JJ5B 5TGBB 1XAUA 1IAOA 3GJFH 4NSKA 2EDDA 3FO0H 1F4HA 5A43C 2JKXA 1T1YA 1FAKT 1X3DA 3FHAA 3VXSB 4HK0A 1KTDB 4JPKL 3LRSB 1UB6A 3QPQD 2UWEE 3G04A 1PX3A 1AHWB 1MAMH 1JPGA 2ERJB 5E08L 3KJ6H 4NQDA 4M1CC 4JVPA 4NQCE 3LRHA 1MVUA 1MVFA 1KN2H 2W92A 5GGUA 4R4FL 5CD3B 5KANI 4DFHA 2MTPA 1KFAL 2CUHA 1JTOA 2FX8H 4JFFD 2XWBA 2KH2B 4IOIA 3QHFL 1YECL 1WBXA 4ZAKA 2HH0H 2NTSP 4X9HA 5F9JB 3C60A 4MNQE 4ONFL 4P59L 3QUML 2HAZA 2VLJA 1B0RA 4G80A 2VL4A 4OCSL 1MFNA 1MY5A 4YNYB 3AS1A 1S7XA 3CJJA 5K9JL 1IEBB 2A6JB 5GRUL 4P2YA 2E9JA 3ARUA 5I8EB 2CKBL 3OG4B 1EXUA 2F9BT 5EBLB 3LCYA 1CICC 2LVCA 3QUXA 2AK4A 2DQUH 1LDSA 4X9IA 3MRJB 3O3DB 5TE6H 4PTTB 4WCYL 1J8HA 1L0YA 3KYMB 3SDDA 2D3VA 1R3LB 4YHZH 4TSAL 4UTBL 4KMTH 4M6OL 4P3CH 1AGDB 4JR9L 3VXRE 1CN4A 1EGJL 1HSAB 5T3XD 3PQYD 1CR9L 4U05A 3OB8A 4WI6A 1MEXH 2DI9A 3GIZH 5DFVC 3RWDA 4ODBD 4G43B 2H41A 3PWPD 5J6GB 3HNSL 4IRZL 4N0FA 3D2UB 4DW2L 2LAAA 5B4MD 3VFVA 4GMSL 1X5GA 1G0YR 1BF2A 3KR3H 1IM9A 3EYFB 4H25A 5C86A 4P23D 1IFHL 4XNZC 4QXTA 5F3HA 3KHQA 3E6HA 1ROWA 4LSVH 4N90E 2RGSA 1I8IA 3OJMB 2DKSA 2B1HL 3FO2B 3D3VE 5JHDB 3C5SA 4QO1A 5L88L 3IRZA 4R9HA 5IROA 4PTUA 2VIRA 5E8OB 4I77L 1X9QA 5ADPH 3QJHB 4OZ4B 1U92A 4OCXH 3O9WB 1E4XI 1NBQA 3O4LE 1B90A 1Q9OB 2BMKA 1AXTL 3E1F1 3MV7A 4XXCA 3IDMA 1NAMB 4P2OB 4UINL 4APQB 3TBYB 4GAYB 3VXTB 4WWKB 3NFPA 5F1IA 3RJDA 5CS7A 3AS3A 2PYEA 3NCMA 4X9FA 5HHQA 3IU4L 4CAGA 1QEWB 1VPOL 2EC9U 1K4CB 2CIKA 2O5ZL 4NM4H 1S9YB 4LVOC 4PJBB 2VDQL 1I7ZA 2OS7A 1Y0LB 1E28B 3TNMB 4PJXB 4LSPL 2CRYA 5A16B 4F9LC 2GSGB 4O2CA 3ET9F 3ZSTA 4MJIB 3TO2A 2LTQB 4XMLL 4NYLB 4GXUM 5EUKA 3BGFB 3C6SB 2YPKA 1C12B 2Q7NA 4GT7A 1EVUA 4BJLA 2FHFA 3MCLL 7FABL 5DHXB 5IOPA 1A47A 1UKTA 2Y6SC 3PP3H 5DUBB 4AM0A 5I8CA 1A7NH 3T77B 2ATPB 4G9FE 1RU9H 1U95A 5FM4A 4P9MH 3FB8A 2X89A 1EBPA 3FFCB 4DKFH 1I7RB 2NY0C 1QACA 4YGVA 1GGCH 4K2UL 3Q6GL 5HPMB 4HWEH 1MRDL 3MMEB 3QAZB 5J7CC 4HBCL 1DBKH 2BDNL 4K94C 4V1DA 2W65B 3MLXL 3NIGF 3QG7L 2APVA 3EYUL 4YHOH 5FO7B 1NGYB 4M93B 3QCTL 3MOAH 5BS0A 2KPNA 1FPTH 2VLMD 4RAVB 1G7IA 4JDTL 1DL7L 1JL8A 1KPRB 4NC1C 2E7BA 4HUWB 2OJZH 4ODUB 1DVFB 5T1MB 3BD3A 2EXYD 3DUSA 2Q87A 1JHLL 2HT3D 4JO3H 4GRWF 1QA9A 3DRTA 4WV1B 3K2UH 5FYKU 3IDIB 5J13C 5MEQB 1AC6A 1A2YB 2H26B 1YYMH 4XPFH 3BH9A 2BNRD 2P5ED 3DX9A 2JCCB 3IFPA 1RZ7H 4O51B 4XBPA 4YXKL 1OARH 2UZIH 1QFPA 5HGAA 5EIIA 4OUOA 4OF5A 4PUBH 3EYOA 3KPQB 3UJIL 3FQUA 4G6KL 4F7PA 4Y2DC 4IIQC 4XVTL 4YR6A 1AR2A 4OFPA 4P5TB 2QQKL 1OP3H 3DBXA 4MQXC 3ZTNH 1UA6H 1S9WB 4F7CA 1IL1B 3GGWB 2QADB 5DJ6A 4PGEB 1U3JA 4Y16D 3QEQB 4ZUUA 5D1XA 2E7CA 1P84K 3DUUA 4OGXL 2AEWA 2Z35A 4D9LL 3WSQL 4IRJB 1IC7L 3BO8A 1ZVYA 2X09A 1OTSC 3RPIB 3P4MA 1U8HA 2DAVA 4DCQA 2VKWA 1ZT4B 3VRJB 4KRMB 3WIFB 3PGDB 5SWSE 2AK1L 1YN6A 4JY6B