1FSKC

Complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
QVQLQQPGTELVRPGASVILSCKASGYTFTSYWINWVKQRPGQGLEWVGNIFPSDSYTNYNQKFKDKATLTVDKSSSTAYMQVNSPTSEDSAVYYCTRGARDTWFAYWGQGTLVTVSVAKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR POLLEN ALLERGEN BET V 1-A
publication title Dominant epitopes and allergic cross-reactivity: complex formation between a Fab fragment of a monoclonal murine IgG antibody and the major allergen from birch pollen Bet v 1.
pubmed rcsb
source organism Betula pendula
molecule tags Immune system
total genus 40
structure length 220
sequence length 220
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2000-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fskC02
4MAYC 2I60L 1NC2A 4GFTB 1FZOB 2O5XH 3FO1B 4K3GA 5IFHL 3T1FB 3HZVB 1RZFL 4K9EH 5BOZG 3MJ6A 5F3HA 1K85A 1I4FA 2JB6A 1G9MH 5IHUL 4ONOA 1TTUA 5I1LA 4I0PD 1OTUD 4PJ8D 2B0SH 2AAVA 3T09A 5KSBA 1FJ1A 1AFVH 1ZLWH 3MJ9H 4HIEB 4AQ1B 3EO9L 1RZJC 4K71C 3IETA 1WIPA 4EUPB 1U91B 1UZ6F 3MUZ1 3FRUB 4PJ9B 4CW1B 4Y16C 4LAQL 5F97E 5IQ7L 1HYSC 4UBDD 2I9TB 5DR5H 3SOBL 4LSVH 3NPSB 3PJSA 1AH1A 4JFZH 5HI5D 1YPZF 3RWJA 3ARDA 4LCCC 1BBJB 1MNUL 4E42B 1KN4H 1RUML 3V4PL 4N1CA 2BC4A 3DX9A 2ZUQC 3IU3A 3ARZA 3DROB 3E6HB 5IESH 4OLXH 5L2KA 3VRLE 1F4WL 5F70A 3MZGB 4DFIA 3WUWG 3HCVA 4M7JL 4Y2DB 1ZTXL 1UWEH 2XRAL 5IB2B 1JCKA 4NQTA 1TJIH 1FZMB 5IEHA 3MV8A 2DKSA 1U8JB 3LY6A 7CGTA 4DGVL 2AQ2A 1A47A 4ZNCD 3STLB 4PYHA 2OR8A 4F7MA 1T83A 5BZWA 4F7CB 2PKDA 4K7PL 2H32A 2FWOA 1LP9E 3KNBB 5IG7A 2FLRT 2DLEA 5TDPA 3QEQD 5T3ZL 4JKWA 2Q6WB 1OAQL 2UYLA 4QTIH 2WK2A 2CDEA 3PL6C 4LPVA 2DJUA 2GSIA 4I4WA 1IVLA 1UM4H 5ANME 5I1DA 4OB5L 2BXYA 3WEXB 1L0XA 2R2BB 1HHHB 4X99B 3PDGA 2JB5L 1CK0L 5IIEA 3CFJA 2DI8A 4PR5A 4U2YA 3DHMA 1TZGH 2YUXA 3CVHB 3L95A 2R1WB 3HNTL 5ESVA 1A6WL 2ZCKH 1Q0XL 3ZKQD 4Q6IC 1KJ2H 2BVUA 4GKOA 3UP1A 2C3HA 3JWNC 3PGCA 2XT1B 3PABA 3QUZD 2GY7B 1XIWA 3X12A 4OZFG 1A6AB 5EBWA 5DS8B 4PJDA 2RCSL 5HHVL 3VA2C 5FGRA 3W39A 5DRNA 4Y4KA 1CD8A 5JUEL 3OKKB 1RZ7H 3WO3B 3AXLA 2VZTA 3QR2A 4LLUB 5JPNA 5MEND 3LIZL 3JWDH 5IW3A 5DSCA 4WTZG 2FEDD 4LEOA 4MQTB 3RQ3A 5JQ6H 3UTSE 1IC5L 1T6VN 4Z95H 1CDBA 1UGNA 3BIKA 1PGRB 3BT2H 5D5MA 5EC2A 2VDLH 5CEYA 4YDKL 3S5LB 4AQOA 4KZDL 1ZHBA 2CK0H 1MCCA 1VEMA 3QNYB 3RWCA 4PGJA 4XC1H 4DFHA 2A83A 4PJBF 4BYHA 1VPOL 3O9WC 4NC2B 1HQ4A 3ILPB 5I0ZA 3FFCE 1FLRL 3QXDA 4MCYA 1MLBB 4NC1E 4XGZB 1IEBB 1R0AL 3JUYA 3T77A 4K8RC 2JTDA 5C0ND 4LGPB 3FB5A 3O2WL 1VGEH 2E3VA 1U3HC 1NCCL 2NY5C 1FN4B 3LQMA 3TO4C 1JWSB 5I15L 2H1PL 3BXNB 1I1FB 4RAUB 3UZVB 2JK5B 5DRZA 4LLMB 4NZUL 5AG8A 1LEKB 2IBZX 3KYMB 3QXVA 1ORSA 2P5EB 1EHLH 5BQ7A 1CE6A 1D6VH 3QI9A 1R3KA 4U1LA 3PQYE 4XPHL 2GK0A 1F90H 1NGWB 1TQCB 2H8PB 5E8OA 2YHGA 3AUVA 3KPLA 4EN3B 1N64L 1SJEA 3QEUB 5K59E 3K80A 2AJZA 1N5YH 3O11B 4OZFH 4GRMA 2DQJH 1T2QH 2XFXA 5I74C 3SJVD 3GSRB 3TIDB 3QXAB 5EO1A 3ZTNH 3BKCH 2G2RA 2NY2B 4AIZB 4FA8A 3TGXA 3QO1A 5DQJB 1OP3K 4P2QD 2X1PA 1FAIL 3MRHB 4HH8A 4ISVB 4UB0H 4PV9A 4WY7L 5C0GB 4IDJL 2RGSA 1VADA 4CU7A 5GGRY 4B7IA 4ONHB 2XTJD 3SN6N 2MCPH 4OLZH 1BZQK 5C2UB 3QDGD 4BH7A 4KKAD 4PJGB 1A7PH 1BGXH 3O6FA 4FP8H 3IFOA 1UFUA 1QRND 1CGTA 3EFDH 3MBEB 4KRPB 3U36A 1NC2D 3RWIA 1V7NL 2ARJA 3MO1B 3D3VB 5KAQG 1RZIB 3TC9A 4MNGB 4QRUA 4LCUB 1RIHL 3A6CL 4H8WH 1CIUA 4GW5B 4KAQL 3R0MA 1CE1H 1YNKH 5B3JF 2FJGB 3OTTA 4YGVB 3GIVA 1OW0C 3JV6B 4GMSL 1ED3B 1G6RB 3SO3B 2ARWA 4JM2A 3CPLB 5KSAB 5CLTA 4LHJB 4X6CA 5HJ3B 1RI8A 4NP4L 5F9WC 4LSSH 4APQB 1BF8A 2P45B 4F58L 4RMRA 3WL9B 5I66A 3BW9A 3ARDD 1WV7T 4XAWH 4A6YB 3RI5F 1AD9A 4WHDA 5KOVC 2VLKB 1JGEA 2AJ3A 1PVHA 3KJ4C 4R0LC 5KANG 2HWZH 2R23A 1J1XL 3VXME 4QNPE 5HDBF 5L2KD 4DOHE 4QO1A 3A6BH 1DN0A 3JTTA 5DC0A 2CH8A 1P4IH 5I76A 3LSOA 4JFXA 5D8JH 3QZWA 3TN0A 1ITBB 5CSGA 1HSBB 3MV8D 3RTQB 1QSEA 2YXMA 1YEJH 5B8CB 3PIQA 4MJIB 2FH6A 3RHWF 1S3KL 3H9ZA 4NQEB 3VXSB 1KLFA 2NY4C 3EOBB 1MCSA 4MD5A 2IADA 3H3BC 3GNMH 3FQXB 4MSWB 1N0XH 1CVRA 1KIRA 2NXYC 3FB6A 1X44A 1KBGH 2VDQH 1JZ4A 4WHYH 4I77L 1ONQA 2F15A 1LD9A 4M5ZH 5GZOC 4HFUH 3FT3B 1IGJA 3EDDA 2GTWB 5LGJB 4HUUA 3RNKB 2ZSWA 2YA0A 1YEDB 3V6ZA 4Z7WE 3FQRB 3OJMB 4JDZA 1YPZB 2VDPL 3UJIH 4M8QB 4PY8J 1QRKA 4KI5F 5CP3A 4F15C 2WUBL 1QSVA 1I8MA 1J7VR 4PLNC 3O2DH 3SE4C 1XIWD 1TZHB 4YFDB 5FA4A 1PDKA 5D71H 5EZJA 3NCMA 4ZUSA 4POZC 3VRIB 1S9WB 4CUCA 1FVEA 2X5PA 4ELMB 4LARL 4N0YH 4Y4KD 3CK0H 2IQAB 5H35B 3QPQC 4M1CD 5FA3A 3V8CA 4DVRL 4WUUE 3ZO0A 3O4OC 5IK3A 3RY6C 1OAZL 2IMMA 5CBAA 1HKLL 1NUFA 3FOLB 3TBVA 4G43B 2DKMA 1K3ZA 1XGRA 2XPGA 4R2GC 4QOKA 3VG9B 4M8VA 3Q5YA 5BV7L 2VDOH 2IBGA 4YC2C 1NANH 5AYUL 4M1GL 3LKRA 2HKFL 3VRJA 4PJ7E 1DQDL 1ZA6B 4JZNB 4GUPB 1F2QA 4OCRL 3GMLB 4FQ2H 1JNHB 3BH9B 1FNEA 2DLFL 4ZAKB 3AS2A 5EORL 5CS7A 4NCC1 3HI6L 1KJMA 5HHME 4O51B 2WUCH 4RFEA 4GKSB 3NABH 2X9YA 3TH3T 1U8MA 4P4KC 2ZNWA 3VGAB 1NEUA 4H5SA 3QUMA 5GRUL 4HBQA 3MROA 1DBJH 5DJDA 3ZKNC 3NFNB 2VIRA 4N1EA 1U8LA 1QYGL 2XQYG 3U30C 3L5IA 4XXDA 3QI9D 1MCBA 4Z7UB 2XV6B 3QIUC 1FO0A 3QUXC 5A1AA 4YHML 2IF7A 3W5MA 1VERA 1KIPB 3C5SB 2FH8A 3MV7B 3OJ2C 5AG9A 5I8CB 2F8OA 3KLDA 5B21A 2VDKH 1A6VH 2FO4B 3IJYA 4H88L 4OFKA 5EO0B 3U0WL 4PIRF 5AYQA 2P7TA 5IVXE 4ZUTA 5ACZB 5SX4H 3KPPA 1CD9B 4OGAC 2XNAA 3Q0HA 1FV1B 4C55A 1JGUH 4J3VA 4PUBL 3LN9A 1F3JB 1Y6NR 4U1IB 4EUPG 1ZLVH 3S3SA 5F7MC 2C1PB 2GJ6B 2JKXA 4UT7L 4PJEA 5I8EA 3RI5K 3RKDD 3V5KB 2EDOA 4PGEA 4ZNEA 4WHTA 3O6FD 1XF4A 4LCCA 3K0WA 4PJHE 5BRZA 4WU5A 1C08B 4Q9QL 43C9A 3MLVL 4JKMA 5JR1L 4GW1A 2G75A 3TA3C 5BVJB 2X40A 4PG2A 4O5LL 3RHWK 4JPKH 1C5DA 3MR9B 3L5WA 5ADOH 1GGCH 3G5YB 3MQIA 2BRQA 3QEHA 4NGHH 5BZDB 4CKVX 1OGAA 3VW3L 3SGKC 2PO6A 3VH8G 1HH9A 3BRGC 5F96L 3L3DB 4MGXA 5FHAL 4JM2D 4MQXC 4OCSH 4UINL 4MHHI 1U92A 2Q76B 5LKNA 5E8EB 4XBPB 5KVEH 1JI1A 3EYQD 4I1NB 3WIHH 5KSBF 4OSUH 5B39A 1DSFL 5ESQA 1EFQA 4PJCA 5C2BL 5E1AB 1RZKL 3QNZB 2J6EH 2P42B 3S3JA 4O9HH 5DI8B 1IBGL 3PG2A 4U1NA 4X4MA 1EAJA 2R1YB 1CXIA 4YDIH 4F7EA 4G5ZH 2PCPB 4XHJC 2G9HB 1J1PH 4Y5XB 3UTPE 3UJTL 2W0KA 3KJ6H 1WAAE 4CMMA 3GSVB 3JTSA 3ARFB 3QXTA 5JO5A 1NDMA 4N68A 3TN0D 4JN1H 4ZXBB 1QSED 4NO2A 1ZVSA 4OZGF 4G3YL 3BQUA 3HNVL 4MA1C 5ESAA 4EUPH 4HPOL 4KK5D 5EPMA 2XQBH 2DQGH 3HPLA 2COQA 3BZ4B 3MUGA 5GGTL 4IIQB 3IJHA 1UB6B 1INEL 1JHLL 4G6MH 4RGOL 3C2SA 1YQVL 3L9RB 4Y1AB 2ZCLL 2ZOKB 5CZVL 1IAIL 2X70B 1L7TL 2NY1C 1LK3H 4KMTL 2NZ9C 1J1OH 4XCCL 2ITDA 4QHUA 4LAJH 4PJXA 4FXKA 4YXLH 4I0PB 2QKIA 4PJ8B 3UC0H 5HVHC 3S5LG 3S8WA 4ODVL 2OMNA 1SYVB 1EVUA 3GMPA 1ZXQA 5IHLB 2VL5B 3AAZA 1AGFA 3RBSA 1PKQB 4JKPH 4HWZB 1EERB 3O3AB 5ICXB 2LU4A 1T03L 1SVZA 4P2CG 1IAII 5TE4L 3M8OH 4U6YA 3DGGA 4YJZL 1OAKH 4HMEA 4R97B 1B0GB 1KLUB 1A3LL 4NM8L 1IEHA 2PYEE 4FG6D 3KPOA 3RA7H 3SGEI 2MQCA 3N85L 1T0NB 3STZA 1UXSA 1X5XA 3QUYA 5JXAH 2FX8L 1A7NH 2EE6A 2Y23A 3CVHH 4PJDF 2EXYC 4PJIA 3L7FB 3BMWA 2IANE 4QOKD 3VFUB 3PF2A 4S2SB 4XPAH 4UUJB 5DD1H 5IOPB 4WWKC 1I1YB 4R8WH 3RL1B 2JF1A 2QSCH 4KKCD 3T4YA 4XWOC 2G5BB 2HKHH 2WANA 4PV8A 5D5MF 3GSNB 4J1UB 1KPRA 4N8PA 1MFDL 3OJVC 3QEQB 4N0UB 5JDSB 4PLJC 1S7TA 4TULL 5CGYC 4J3UA 5GS0H 1WIOA 1N6QH 3MX0A 1Y6KR 1GJIA 2Y7QB 4I3SH 1IQWH 4WV1A 4JDVA 5DFVC 1XCTB 4W6XB 5E9DE 2VISA 2CO7B 5AZEL 4ZO8A 3WNKA 1KJVB 5GJSH 3S34L 4UV4H 1AGEA 3BVNB 5CJQL 4LCYA 3BIAX 4BSWA 3PWUB 2CIIA 3QUZB 1BLNB 4PRBA 1ES0B 5B4MD 4Z7QE 3ARTA 4OCLC 5EZIH 3WNMA 5BV7B 4OF6A 5L88L 1KCVL 4TSCH 1UVQB 4GSDL 5C9JB 3HFMH 3HI1A 1H15B 1CLOH 5E5MA 3RX7A 43CAA 4IDLA 4MJ4A 3UPCA 5MENB 4KJYB 4JZJC 4J6RL 3FMGL 1OW0A 4LVEA 3QDJE 2AABH 3TCLA 4HZLA 1YUHA 1WZMA 5SX5H 5GGVY 4P5MA 2B1AH 3HZMB 4D3CL 3V4VH 5CILH 1FPTH 3ULVF 1AIFB 2MJWA 1Q72H 2BCKA 4JN2A 3VCLA 5ID1B 2J4WL 3M17A 2VXQL 4JHZA 2A77H 4WGVB 5DVNA 1Y0LA 3F6IA 3NAAH 5BRZD 4XCFL 2K7QA 4R0LA 4G6JL 3FO0H 1KIUA 1LK2B 4X5XA 5HYJA 3QH3B 3C87A 4GLRI 4UILL 2QR0A 3L1OH 4EXKA 4LQ1A 2A6DB 4UTBL 4YXKH 5T33H 5HYQA 4KVNL 3IFPA 5E4EC 4Y4FD 4OZ4B 1OGAD 5IGXL 2PO6D 2F74A 2D31B 4NZTH 2HA1A 3H3PH 2DDQL 3BSZL 1UEYA 1MY5A 2GTZA 3HR6A 3MUHL 2EYRB 4L8SB 4NN6B 4Y2OA 3SGDH 5HVGB 4YH6A 2H9GB 4KRLB 4DZ8A 1A14H 1XGQA 1Q9WA 2L7JA 2YZ8A 5JTWA 1BD2E 2R1XA 5E2TH 4JM2F 1OGTA 1NCWH 3SJVB 5FGCE 4XB7A 4HUNB 1A9BB 4L4TE 1P6AB 3B9VA 1I1RA 5D9SA 1JGVH 3VFVA 5TF0A 4P2QB 1TVHB 1ZEAL 2I26N 3RDTA 2UWEB 4ODWA 1I7RB 1A4JA 1A6PA 3SE4A 1XFPA 2XTJB 3BQUD 3X11B 4LF3B 3EYSL 3QDGB 2FECL 1HWGB 1S7QB 1UYWL 4G6AC 4HAFA 2VNCA 4X4XB 1MRFL 2HH0H 4L8BA 1QRNB 4GAJL 2MHAA 3C8HA 2CLZA 1NC2B 5IHBA 1MRCL 5LBSH 12E8L 2IBBA 4V1DE 1TENA 2YR3A 5F3HB 1I4FB 4NWTH 4YAQA 2V17H 2R29H 2JB6B 2YN5A 4HS8L 5D7IE 4HG4J 5I1LB 4L3EA 5HHOA 4HPYL 4EOWL 1G7IA 5KSBB 2FECI 2YMXL 1FJ1B 3UEZA 1S5IH 2XY2A 1Q9LA 2E6JA 3MRLA 5EOCJ 1IAKA 3IETB 4GXVH 1A64A 1I3VA 4ODTH 3MNVA 5IHZA 1NLDH 4PJ5A 4ESKA 3EO9H 2KQMA 4IMKA 5EZOL 1U8IA 3HNSH 3PJSB 3ZKSD 1RMFL 1I7TA 1N4XH 3VGFA 2X41A 3RWJB 3ARDB 5FIEA 4JFOA 4KKLC 1JMZA 1A6UH 4QHKI 2LE9A 2PF6A 3VWJC 4AMKL 2NTFA 1X5HA 4Y5YC 1L9MA 3OB8A 3DX9B 3HMXH 1OP3H 3TZVC 3IU3B 3QUYD 1CL7I 5L2KB 1CFBA 2X9WA 5KJRH 1UM5H 3HCVB 3QA3A 3FL7A 1DL7H 3QUXA 4X98A 1MJ8L 2C3GA 1WTGT 3MV8B 1FVDA 2LVCA 4FFVD 1XF2A 1YYLL 1F4WH 1P5UA 1CDJA 1H3PH 1KPUA 2XRAH 5BZWB 5F9DC 2H32B 2FWOB 5IG7B 3N1PC 5C0IA 4KXZI 4OD1L 5D1XC 4NKQB 3GKWL 4HIXL 2GK2A 3KPQA 4NSKA 2YZ1A 4ONFL 4YO0A 2UYLB 4L3CA 2CDEB 4K7PH 2GSIB 4I4WB 1NKRA 5I1DB 4PJFE 2APXA 1BFOA 1D5BA 5T3ZH 2NPLX 2OJZL 1A7QL 3UMTA 5IIEB 3CFJB 4PR5B 4NQXA 1I8LA 3L95B 5ESVB 5CWSA 5F7HA 3D18A 3D39A 1I9JH 4FXLA 2HP4A 2DBLH 2J8HA 2MKLC 3PGCB 4OAWA 3PABB 1K4DB 4HEME 1XIWB 5IJVA 3LRGA 1WCBB 3X12B 4F8TA 4R26H 5EBWB 2F53A 2AS5M 1A6ZA 5J1TC 5AWNL 3W39B 3KLAA 5DRNB 4Y4KB 2W91A 3QQ9C 3QUML 1SVCP 4ENEC 3AXLB 3MRPA 5ANMA 5JPNB 4JFDE 5F7NC 5IJKA 5DSCB 4LEOB 2RCSH 4HIHA 1BX2A 5FYJU 3ROOA 5CEXA 4XNMA 5KTEH 4U0QB 3BIKB 5D5MB 5EC2B 1FO0L 2AXFA 2HAZA 5JUEH 5CEYB 4BZ1L 3OZ9L 3LIZH 5DO2C 1ZHBB 5JXEC 3IF1A 3RWCB 3CFCL 2A83B 3PWJA 4AM0A 1D9KA 4XWGL 4XCNA 1YEFH 1HQRA 2W1NA 3MRCA 4ODBD 4WRLA 4BZYA 1FC2D 1IFHL 3QXDB 3N50A 5I75B 4MCYB 2D3VA 2NW2A 2X9XA 5GS1A 4RMSA 1WEJL 3T77B 1KEML 4KTDH 3FB5B 1WFTA 3U0PA 1G9EA 5F6HJ 1PSKH 2YC1A 1ZANL 3K8MA 4RX4A 3L3KA 1D5XA 4FQHA 1PD6A 4PY7A 5DRZB 4XMLL 3RFZC 1MIML 1U3YA 3K7UA 1NCCH 4RA3A 4YHZL 2NY4D 3RGVC 1FSKC 3BD4A 1ORSB 1NGQL 4KK8D 1K9TA 2H1PH 1MEXL 5BQ7B 1CE6B 2IH1A 3WXWL 3QI9B 4R90H 5GGRA 3QFJE 3ZT7A 2DN7A 2JJTC 1R3KB 4U1LB 3L5XH 2GK0B 4M43L 3R8QA 5E8OB 1SJEB 2AJZB 2XG4A 4UOW0 3BYYA 4GRMB 3REWA 2XFXB 5ID0A 3P0GB 4O58H 4XNQA 1JZ2A 3V52L 5FUZL 4ZOAA 1N64H 5EO1B 1HINL 2G2RB 1YN7A 1RU9L 3TPKA 4LVHB 3QO1B 2ED7A 2APFA 5DZLA 4PV9B 5IBUB 3HB3D 3MRKA 5T3XD 3RDTD 1VADB 2VABA 2IFGA 5TFSL 4MB5A 4PJAA 5LVEA 3LEYL 3H3KA 1C7TA 1HDMA 4WY7H 4BH7B 2W60A 3NMEA 1Z9LA 4POZD 3NBNA 4DKEL 5GJTH 3V0WL 4J23A 3PQYA 4FQ1L 5E2WL 3O6FB 1EJOH 1MJJA 2VRAA 4PBXA 4XVTL 3IFOB 2CSPA 3U36B 3RWIB 5ACMA 2ARJB 3TT1H 5JHLL 3LKNA 3WIFA 5C86A 2WWKT 5T1DH 1J86A 3FQWA 4U6XA 4QRUB 4L3ED 5HHOD 4PS4H 4ELKA 3K74B 4C83A 4M1DL 3LDBB 4N0FA 3NCEB 3GIVB 5F72S 5ENWA 4K3JL 1LVEA 1TJGL 2N56A 3KYKL 4KAQH 5FKPA 4JM2B 4X6DF 1N0LA 2VYRE 3WFEL 1X6NA 4IOIA 4X6CB 4PJ5D 3X14A 2P8LA 4NQUA 4ODSH 2UZIL 2NX5D 1F13A 5I66B 3BW9B 5L9DH 2K9UA 2DLGA 1AD9B 4HUXA 4JRXE 4JANA 1M1SA 3RAJL 1JGEB 1PYWA 2AJ3B 1FIEA 3EDEA 2ZOLA 1A2YB 4YXHH 3I85A 1MIEH 1DUZA 2M26A 2R23B 3S3PA 5T1KA 5F93C 5J13C 3WS6A 3QCUL 1DN0B 4S1QH 3JTTB 1VEPA 2GHWB 3QUXD 3MXWL 3LH2L 3Q6GL 4JFXB 5I76B 3TN0B 3QZWB 3FRPA 3EHBC 1QSEB 1SBSH 5EUOE 3PIQB 4PRNA 5E7BA 2OP4H 1R3HA 2J88L 4ODUA 4MD5B 2IADB 3FAXA 3QO0A 3ET9F 1KIRB 1H3VA 3FB6B 4JZJA 3EUUA 1UG9A 1ONQB 2BX5A 4L1DA 3SCMA 3IRPX 1LD9B 2RBLA 4NRYA 3TIEA 5TF1H 2FHBA 4QEGA 3WSQL 1F58H 3GBLA 1IGJB 4MX7A 3IRZA 1FHGA 3VXMA 4HUUB 3HE6A 4U4BA 2ZSWB 2FGZA 1TVBA 3V6ZB 3EYUL 4URTB 4PRHE 5C3TA 4KZEL 3D39D 4JDZB 4FXGA 1GGBL 2BHYA 2WMPA 2J12B 3MMEA 2ADJA 3B2VL 1DN2A 5INDA 1I8MB 3KPMA 1CYGA 4TTDC 3OKDA 3BJ91 3CLEL 2HFGL 4D0CA 3BEVA 2F53D 5FA4B 3GSNH 1OD9A 1JIBA 5EZJB 3E2HB 2VMFA 4ZUSB 3KPTA 3VFGL 1HXYA 1NL0H 3MLTB 4PPTA 3CDYA 3IS0X 5FA3B 1JYNA 3KPSE 2FGWL 1J0HA 5KVGH 3R8BB 5I1HH 2NXZC 5IK3B 5CBAB 3OKEA 4KGJA 3TBVB 4NN5C 1EVTC 1GC1C 1XGRB 3D85A 2OMBA 2XPGB 5L2JA 3ARVA 4JPIA 4QOKB 2NY6D 2BOCA 2ZKHL 4HK0A 4UDUA 4ZOCA 4JVWA 1S78C 1HKLH 3BEWA 1D9KD 3HR5A 4NNPL 3MBXL 2OI9B 1P5VA 1OQXA 4KJPD 5GS3A 2A9NL 1NGZA 1TETL 3VDCA 5A2JH 4Z0BH 5BV7H 4ZODA 2V2TA 5HYSA 3HE7C 1FNEB 4M1GH 4XP9L 2VQ1A 2ZG3A 5IROC 5KBNC 2J8OA 4MHHG 1KJMB 3ZE2F 1NQBA 2ADFH 3T0EC 4RFEB 1AE6L 3CX5K 1U8MB 4RX4D 3B9KC 4BZ2H 5HGDA 4WENB 4RIRA 2A73A 3OSKA 4H5SB 3QUMB 2H6PA 1BZ7A 1OAYL 1TXKA 1L4IA 3MROB 4PYGA 5DJDB 2VIRB 4JFFE 3KWWA 1U8LB 4N0CC 2NR6C 4XXDB 1J5OH 1FO0B 4PJ7A 4E41E 5GPRA 3TYGL 4WNQA 2DJSA 1B4JL 4HHAA 3PP4L 3MRQA 1FORL 1MFEL 3CIQA 1C1EL 5F1OB 3CFDA 4OKVA 2B5IB 4WFEE 3FN3A 5ICYA 2WM0A 2LU3A 3IJYB 2APWA 1KTLA 5KS9F 2P7TB 4OZIE 4G6KL 4ZUTB 4K71B 3KPPB 2XNAB 2WZPD 4KUCD 1X5IA 4R4FL 4H88H 4F57L 1F3DH 3U83A 1B2WH 1RUQL 4G7YH 1UM6L 4OBRA 4PJEB 5I8EB 3OX8A 3NGBC 4PGEB 3DNKA 3ARWA 4WHTB 3PQYD 2ICES 2EDTA 1XF4B 4MDIA 4UT7H 4YHPA 2LAAA 3AU1A 5BRZB 4WU5B 3TV3L 3MUY1 43C9B 2A74A 4XNUL 4LCWE 1SYSA 3TZVA 5TE7H 2G75B 1AXIB 4G9FE 5T3XL 1MCPH 4Q9QH 4RMWA 1C5DB 1HSAA 1QLFA 5T5FH 5JW3L 3MLVH 3L5WB 2KL6A 1ADQA 3F8UB 2XN9E 3QEHB 4HSQA 4Y4FB 4QKXB 1OGAB 5JW5A 2PO6B 2X4SA 1HH9B 2W0FA 1T4KA 3DIFA 4XWOD 5E5RB 4JFPA 5A2FA 1KB5A 1YNLL 1U92B 3BGAA 4MQ7A 3FQUA 3VW3H 4EI5C 1AP2A 4PLJD 5F96H 2ZJSH 2YD4A 5B39B 4PJHA 1BIHA 5ESQB 5SWZE 1UB5A 3TT3L 4PJCB 1JGLH 3EIFA 3B5GA 4U1NB 5JHDE 3N0PB 5DFVD 3VJ6A 2V6HA 3RVTC 1DSFH 3W82A 2FYYA 1WC7A 4F7EB 1BAFH 4KJQC 1RZKH 5T1KD 2AGJL 3PNWA 4RCAA 3V8OA 1JPST 4PGZA 1GGIL 1IBGH 4WO4C 5DD3L 1A7OH 4CMMB 3PHQA 1NCAL 5I19L 4W4OC 3JTSB 1SY6A 5JO5B 1NDMB 4IM8A 4NO2B 1ZVSB 3BQUB 5ESAB 1KB9J 4GG6E 3UJTH 4TVSa 5EPMB 3OKLB 3HPLB 2A0LC 1OLLA 3MUGB 4M6ML 3T2NH 1JF1A 3IJHB 3NCJL 4ZUWA 1AJ7H 4NN7C 5F1IA 4GG8A 1MI5E 3HNVH 3U4EA 4HPOH 3VFSA 1AR1C 5GSVA 5KVDL 4M6OH 2Y36L 3D1MC 3O6LH 3SCMD 1Z3GL 3U0TB 5D93B 1OAUL 4RGOH 3MLRL 3ZL4L 2ITDB 3BP7A 4QHUB 4PJXB 2ZCLH 3VXMD 4FXKB 5CZVH 2Y06L 1IAIH 3HE6D 3U6RA 5JXEA 1I3GH 4ODXA 5F7UA 1WAAA 4OIIL 4M4PA 4KMTH 1RULH 1GGUA 1L6XA 3GMPB 3AAZB 1AGFB 4XP4H 3RNQA 3EW3B 5BCAA 2VXTH 3OAZK 5JIPA 3C5ZC 2B4CC 2QQLH 3SGEH 4TVPE 3TCXA 3DX7A 3E0GA 3VRLF 3DGGB 4XCYA 1QBML 3C2AL 1X5ZA 2O5ZH 3BE1H 4I5BA 3RU8L 3GMMA 1FE8L 1IGIL 3VFOA 3AS0A 4CAGA 3KPOB 3PE9A 3SO5A 4YHIA 5HHQA 3CU7A 4OLUL 2B2XL 5EBGA 2YWZA 5L0QB 4NM8H 3STZB 5HHPA 1UXSB 3B2UC 3U48A 3EOTL 4D8PA 1LP9F 1KENL 3QUYB 4Z7VE 2J8UF 2ARJQ 5CP7A 3D85D 4K3EL 4PJIB 2B20A 2Q20A 3Q48A 4TOYL 4OLVH 4K94H 3NN8A 3MRBA 4LRNH 1TTFA 2MQ0A 4P2OA 3T4YB 5D6DA 1IKNC 2MPAL 2FL5A 4NM4L 1BHGA 1QQDA 4JG0L 4FQXA 4NFCA 4PV8B 4PGCA 4HLJA 3VU2A 1LWRA 1KPRB 5EU3A 4H0IA 4H1LG 4B5EA 1S7TB 1YDPA 1PW3A 2HVKA 2PYEA 1NAKL 3QFDA 1SHMA 2HT4C 3UBXA 4NQCE 2P47B 1MFDH 1AR2A 1MREH 5IBUG 3TP4A 2APTA 4WV1B 4TULH 4JDVB 4YWGH 4KQ4H 3FKUS 4OQTL 4WW2C 1C5BL 4JRYA 2VISB 2IANA 4ALAL 4EXPX 3PUCA 3RWHA 2AJUL 3RIFF 1AGEB 3WO4C 4P3DA 4LCYB 4BSWB 4JFEA 1HIML 1KTDA 2CIIB 4HBCH 4PRBB 3DBXA 5FDWA 4KI1A 3PGFH 1U8HA 3DI3B 3IAPA 3HI1B 5HHMD 25C8L 2QEJA 4Y7MA 5E5MB 4JGUA 5CSBA 3WDJA 4JREB 3U1SL 3X3FH 4LLYA 1ZVYA 3W9EA 3M1BA 1KLGA 2IFFH 3TCLB 4HZLB 1YUHB 4P5MB 5E9DA 1R5VA 2GSGA 4B7LA 1G7JA 2EDKA 3FMGH 2BCKB 4MJ2A 4JN2B 1L7IH 3VCLB 4BFBD 4XP5L 1E4XL 3M17B 4GLRH 2K1MA 5DT1L 5MEPA 3CNKA 1OSPH 1ZLUK 3T3PE 1DBKH 1A3RL 1P69B 3KJ4B 4R0LB 1U6AH 3GJEA 3TVMC 5C0AE 4X5XB 2VXQH 3ULVH 3VMOA 3G5ZA 2QR0B 2W65A 2EDYA 3EYOA 1C12A 4F37F 4GAGL 5C0EA 4JAMA 1OAXL 4G42A 5HYQB 3NIGF 3OG4B 3LEVL 3ZHLA 3FHQA 3I02A 2UZXB 3IFPB 5K59F 2C7UA 4MDJA 2OYPA 1E4XI 3QZWG 1EA9C 2F74B 3QWOA 4R9HA 2NY4B 4KVNH 3WLBA 4LQFL 3PDDA 4DN4H 1CFVH 5CZKA 1MCWM 4NQDE 4QWWD 5L6YL 1N5AA 2VR5A 5IGXH 1M7DA 2GTZB 4QRRE 1SM3L 5AEAA 4UV7H 4WEUD 3TM6A 2NY3D 2DDQH 4Y19E 4X8JA 5DUMH 4DZ8B 2DQCH 1XGQB 2D7TH 1Q9WB 2R1XB 4WI8A 3I6GA 1OGTB 3DVIA 2DQHL 3MYJA 5BO1L 3CX5J 5D9SB 1KCLA 2YD9A 1QFUL 3VFVB 4PREA 3NFPA 2EO9A 3INUL 4KKNA 3RDTB 4ODWB 1A4JB 1HK6A 3OAUL 4OZFA 4YNYB 1ZEAH 2A1WL 2VAAA 3I6LE 4OM1L 2VZOA 3DECA 5C6TH 4L8BB 1JYXA 4NZDA 2MHAB 4L1HA 2CLZB 4NNXA 2P1YA 4PGDA 5FM5O 3TH4T 3EYSH 1T2XA 1BD2A 4UIMA 1JF5A 4W68A 2D7QA 3P3YA 4YAQB 1KCSH 4L4TA 4OM0L 3MPCA 3RPKA 3HKFA 1MRCH 4L3EB 5HHOB 4G7VL 4POUB 5JXED 3IAGC 1G7IB 2OLDA 3WNPA 1S7WA 4YC2B 1XGTA 2VKXA 1Q9LB 3C6LC 3MRLB 4HS8H 3AY4A 1FBIL 3A0OA 1IAKB 1A7RL 3QDAA 3FB7A 3HPJA 5A16A 3MNVB 4KHTL 5IHZB 1A7BA 3O8XA 4PJ5B 4Z8FH 5IROA 5CJXC 1U8OA 5C0DA 2BY3A 3MRMA 1U8IB 1X5GA 2NX5B 1I7TB 1CL7H 1MHPL 2DWEA 4JFOB 1TZIA 3RIFK 1CGSL 5FF6A 1KPVA 1IKFL 2NTFB 4F9PC 1RMFH 1U0QA 5DEFA 2AXJA 1FGNL 3KYNA 3IDUA 5DFWH 3QA3B 4KXZH 1JVKA 4QF1A 3QUXB 4X98B 4YK4C 2EH7L 1FVDB 4P2OD 5D7SH 3D5OF 1GAFL 3SE3C 2XWTA 1XF2B 1J0YA 5TDNA 1OM3H 4FQXD 4YHYB 1P84J 4KTEL 3CDFA 1MJ8H 1RVFL 4Z7WF 3GRWL 1HXMA 5F7FA 1TTGA 2Q86A 3KPQB 4NSKB 2PYED 3FONA 4YO0B 4P9ML 5D2NE 4L3CB 4ORGA 3BZDA 5ALBH 2X1OA 1BFOB 1MH5A 4B50A 1ZT4A 4LSPL 2RJMA 4NQXB 1V3KA 2ITCA 4JRYD 2IAND 1G7QA 4TPRL 5CWSB 3D18B 5KVMC 3D39B 4DGYL 5JOEA 2WBJC 2OJZH 1A7QH 2IPTL 1LO3L 3O4LE 1MJ7L 1NEZA 2AV7A 3LHPL 4F37K 4OAWB 4JFED 2EYSA 5J06A 2F5BL 3LS5H 5IJVB 2E7LC 3P4LA 1YJDC 4KI5E 1YA5A 2F53B 4JQVA 3OGOE 5JOPE 1LDPL 1A6ZB 3KLAB 4Y88A 1NKOA 1MCIA 2IMNA 1T2JA 2Y07H 4OCYH 2CGRH 3LKPA 3MRPB 5ANMB 4PJ7F 2Y1VA 2YN3A 1EJ6A 1IQDA 2DLHA 1RUPL 1BX2B 4HIHB 4TNVF 3ROOB 5CEXB 3SGJA 4XNMB 4DK6A 3DWTA 4P3CH 5E9DD 2AXFB 4WJ5A 2DQIL 2MFNA 4XXCC 3T4AA 4EI5A 1B90A 3IF1B 2NY6B 4ZFOA 3PWJB 4AM0B 1D9KB 2KH2B 3MLSL 3WFHA 4XCNB 1HQRB 1XGUA 3OZ9H 3MRCB 1V7MH 1CR9L 5MP6H 1N2RA 3E1F1 2HVJA 4QY8A 1U2HA 1XCQA 3CFCH 3KS0H 3WJJC 2NW2B 5GS1B 5D96C 1WF5A 5CINL 4Z76A 1OT2A 3VXPA 3U7AA 5I8KH 2Q1EA 3CFKA 3U0PB 4JFDA 4U31A 5A2LH 3ME0A 2DQDH 4X8XA 3P9LA 3B9EA 4PRPE 1YEEH 5D70L 3L3KB 1D5XB 4FQHB 4MA1B 4PY7B 5DUPL 3SKJL 1KEMH 1J12A 4OV6F 3WHXA 3MA7A 1VENA 4LVNB 4P5TD 3UO1L 5F9AC 1ZANH 2WIIA 3VA6A 2IH1B 5E8NA 4OD3L 1PG7W 5IVXF 5E99L 4N5UA 1DQTA 1PAMA 5DJCA 4H25A 3V6FA 4KROC 5F7EH 1MEXH 4YHKL 5DD0H 3WXWH 1KEGH 3REWB 1ADQL 5ID0B 1A02N 2JCCA 4JVUA 4XNQB 4M43H 1VFAA 5DTFA 4JM4H 1T0MA 1YN7B 2BHZA 2HTKD 5F6IC 1U42A 3B5HA 1KB5L 3UXFA 4PP2A 3MRKB 3V6OC 1F45A 2VABB 1AKJA 3DVGA 5FUZH 3VGEA 3GK8L 1JZ6A 1X5YA 4PJAB 5DJXA 5FYJL 2K3TA 3Q5OA 3IDYC 1HDMB 1W2KT 2W60B 3QFJA 1I8IA 4XMPH 1BP3B 3PQYB 5TFSH 2JJSC 1MJJB 5H2BA 3QHZH 3FOMA 1WICA 1EMTH 2NXZD 4ETQA 5FYKE 1BD2D 3LKNB 3WIFB 1QEWA 4GRWB 4XVTH 4L4TD 4U6XB 3FQWB 1SY6L 1BJMA 3U4BL 5JHLH 2XWBA 4ELKB 4P23C 4XVJH 4C83B 2Y6SC 4N0FB 1EEZA 5ENWB 2DI9A 1YEGH 5E24E 3P30L 5FKPB 3DXAE 4IOIB 1Z5LA 1T1ZA 1M71A 3O8XD 1ZHNA 1BQHG 1DQMH 2VDNL 4HK3N 1CXLA 2P8LB 4FQJL 2WLZA 3X14B 5KSVA 4K3JH 4AL8L 2X89A 1WAAF 2KQNA 3TNNA 4YPGA 4HZAA 3EJZC 3MZTA 4HUXB 4WTWA 5K93A 3V5HA 1PYWB 2YSSA 1OTSC 4NCDA 2UZIH 1QA9A 2ZOLB 3BKJH 4FZEH 1IT9L 1DUZB 3IFLH 2O5XL 5T1KB 5IKCA 2NR6D 4K9EL 3IDGA 4CMHB 1RZ8A 1G9ML 1H5BC 4OI7A 2DL9A 2B0SL 5I16A 4PRNB 2ID5A 3LPGA 4I13B 1K6QL 5I1AA 1R3HB 4OZGE 3MJ9L 4ODUB 3Q6GH 4TNVK 1G0YR 5JIHA 1F6LL 5ERWA 2NY5H 5CKAA 1QFPA 4JRXA 3SCMB 5JPMA 2J88H 4NRYB 3NZHH 3TIEB 4FNLL 3WD5H 1G1CA 1CT8A 4LSVL 4MXQD 4MX7B 3VXMB 4JFZL 1FVCA 3HE6B 4ZD3H 2OR7A 4DOHB 1TVBB 5J11C 4RFNB 3PWPE 3T2PA 1KN4L 5B38B 1UEMA 4FXGB 3KHQA 2NNAA 1UJ3C 1H0DA 1DUYA 3MMEB 2R0LH 3BDBA 2ADJB 5E4IA 4S10A 5INDB 3KPMB 4OLXL 1TNMA 5D2LE 3OKDB 3R0NA 1UH2A 3ZDYE 4D0CB 1UWGL 2YRZA 3BEVB 1YMME 2VXSH 3B2VH 3WN5A 5BW7A 1G9NL 1HXYB 1KCKA 1P6FA 5C09E 2Z9TA 2HFEA 3RVXC 5E4EB 4PRDA 4RZCA 1P7HL 1FYTE 3VH8A 3C6SA 3VFGH 3OKEB 3IDIA 4M7ZC 4X0KA 3D85B 5GZNC 3BPOC 4QTIL 4GBXA 5L2JB 1A5FH 1NFIA 1RFDH 4JPIB 4EI5D 1UM4L 2BOCB 4HK0B 4UDUB 5C92A 1AI1L 3UBXI 3BEWB 3QQNA 3HR5B 3QPXH 4OLYL 2ESVA 5IVZA 4JGMA 4S0TD 4TRPH 1KJ3H 1TZGL 1NGZB 5C0BE 3G6JA 2GKIA 2H45A 3LRSA 2FBOJ 2VITA 2V2TB 5HYSB 1TQBC 1J0JA 1KJ2L 2AJSH 3IXTA 2VQ1B 2A9NH 4WIQA 1URLA 4JFDD 1V8HA 1O0VA 2W9LA 3VDAA 2CRIA 4Z7QF 5DJ6A 1MPAH 1S7UA 4XP9H 5HGDB 2QADD 4RIRB 5ILTH 2H6PB 3NFSL 4YFEA 4WI5A 1BZ7B 1VGKA 2V5SA 3L3OA 3K81A 3KWWB 1P2CA 4KPHL 5HD8D 4Z95L 3OAZH 1JYVA 2W9EL 2D9CA 5DEGA 1T66D 2OTUA 4PJ7B 2BVQA 4WNQB 3GSXA 4HHAB 5F8RC 2LTQB 3MRQB 2CK0L 2VZ1A 2ZG2A 3QCTH 3V5DA 2CJUH 4IOSD 2JJWA 3CFDB 4OKVB 4JCLA 2DJ4A 3QDHA 4CU8A 3TYGH 4KJWD 5HHMB 3UTTE 5ICYB 3PP4H 3H0TA 5E56A 1KTLB 4P5KA 4UOJA 1C1EH 1CQKA 5TPWH 3H8NA 1T7XA 3O45A 4K23H 3RZWA 1AKJD 4R7NA 4HK3J 1VGEL 4JFFA 4XP6L 2R0ZL 5I2IA 5E2UL 3BZEA 5LJYH 3OX8B 4J8RA 3QFJD 2VOTA 3LS4H 4E41A 1TJHH 1E27A 4UDTA 5I73B 5IB4A 4MDIB 3SDCC 1CXKA 4RGNE 4YHPB 5LWYH 4U0RC 3AU1B 4KKBC 3F7RA 1EZVX 1EHLL 3RVWD 1D6VL 2DMCA 2IEPA 4F9PA 2A74B 1SYSB 1FFPA 5JW4M 1CLYL 1U95A 1CD0A 2XKNA 1F90L 1QVOA 4OZIA 3TV3H 5D2NC 3MACL 1FFNA 1PZ5A 1HSAB 1QLFB 3T8XA 1P9MC 1RHHA 1T2QL 1H3TA 5E6IC 5J89A 2GCYA 4ZUVA 4XX1G 5T3XH 5JW5B 4KQ3L 3S6CA 2W0FB 1T4KB 3DIFB 4NO3A 3ZTNL 1CDIA 3BKCL 4JFPB 1JYWA 3HC4L 1KB5B 4O2EA 3ECBA 4MQ7B 3FQUB 3IDNA 3SDAA 1AP2B 5GIRA 2Y5TA 2X89D 1E6OH 4PJHB 2BY0A 2MCPL 4OLZL 5HYIA 2NY3B 1UB5B 5IEKA 2OCFD 3SDXE 4LCWA 3NPZB 3C09C 2EC9U 4FP8L 2QJDA 3VJ6B 2FYYB 3QIWC 1WC7B 3EFDL 4YE4L 3TT3H 1GOHA 5J0BA 5A3ID 3PNWB 2FB4H 4LU5L 3ULUE 3I6KA 4QXTA 5DZOA 2XN9A 2GUOA 4FFWC 5L7XH 4NKOA 5BXFA 3PHQB 3GI8H 3KXFE 4I18A 3S98A 4GMTH 4H8WL 2HT3C 1CE1L 1YNKL 1WCQA 2HFFA 5D7IF 3JWDC 3GI9H 4AZ8A 3HRZB 1NCAH 4R4BA 1MCHA 4GXUM 4ZUWB 1GL4B 2BNRA 5F1IB 4GG8B 5SWZA 1ZLUH 3U4EB 1D5MA 3VFSB 5GSVB 1T3FA 2FJHA 1MUJA 4JRXD 1BJ8A 2AP2A 3DYPA 1GYAA 1B6DA 3L7EA 2X09A 3BP7B 2J5LB 3ARYA 5H37G 5GXBB 2E5EA 3U6RB 3VXTA 4XAWL 4OI8A 4ODXB 2Y4SA 3FN9A 4Y4HA 2WNGA 4XZUA 4YHLH 4HAGA 2DM7A 4NZRL 4HD9A 3DSNA 2Y06H 3RNQB 4QCIA 2QHRH 4MCZA 3ARBC 2O61A 4OIIH 3WJJA 4JY4A 3A6BL 1BQUA 4UAOB 1GHFL 3DX7B 4XCYB 4I5BB 1YEJL 3GMMB 5EIVA 3UDWA 1U2CA 1X3DA 2CLRA 5LCVH 3VFOB 4NFDA 3MRJA 3BPLC 5M7QA 1JI2A 4YHIB 1QBMH 5HHQB 3GNML 1JMXA 1FE8H 5F7YC 5HHPB 4CVZA 2UV3A 4D8PB 1FSKB 1IGIH 1KBGL 1X4YA 2VDQL 5CP7B 4GBXD 4M5ZL 4HFUL 2HJKA 1NUNB 1U58A 3KLSA 3NN8B 2A38A 3MRBB 3CDGA 3EOTH 2ESVD 3ZKXB 1KENH 2D03L 1BFVL 4PJFF 4P2OB 1NCBL 4P57A 4XPGH 4K3EH 2FL5B 1QQDB 5CJ5A 5DMGC 4P59H 4FQXB 2VZVA 4PGCB 3UJIL 5EU3B 4OZHE 1MCOL 1YDPB 2HVKB 2PYEB 5FO8A 1NLBH 3QFDB 3UBXB 3KYAA 3CFBA 3OHXA 4ZFOL 4Z7VA 2EKSA 2SEBA 4NRZA 1NAKH 5H37H 3L3JA 4JRYB 3DOSA 2IANB 3RWHB 4BH8A 2JJSA 3C60C 4RWYH 2QV2A 1RK1B 2HLFD 2DIJA 4BK5A 4J3XA 4P3DB 3HAEG 4JFEB 1KTDB 3DBXB 5J4MA 2RR3A 4LHUG 5FDWB 4MA8H 2VDOL 1AC0A 1U8HB 1EUTA 4YDJA 5EH1A 1U8NA 1HIMH 3QQ3A 4U3XA 4P9HC 1CU4H 2OL3A 4NQCA 5CEZE 2R56H 4AEHH 3W9EB 3M1BB 6FABH 1KLGB 2UY7A 1V5JA 5FO9A 5E9DB 3K2UH 2XXMB 1R5VB 1IM9A 2GSGB 3B6SA 3G04B 3U9UA 4JFFD 1G7JB 5FAAA 3NABL 3LB6D 1DQQA 2QL1A 4JE4B 1X5KA 4QRTA 2XZQH 2E9JA 5MEPB 2BNQE 3EO0B 3L5JA 3DV6A 5EIIA 3GJEB 4XP5H 1E4XH 4WFED 5DT1H 3JSSA 2CUHA 4NJ9H 3G5ZB 2YD8A 5J13B 3EYOB 2W65B 4XRCA 1C12B 4LSTH 1C5CH 5C0EB 4JAMB 4G42B 3BKML 3I02B 2C7UB 4G80A 2WQRA 1EK3A 4MDJB 5LGHH 1ZHLA 4OLEA 4RMVA 2MOVA 3BUYA 5IF0A 5KVFL 3FRPG 1WZKA 3QWOB 2YOCA 4P5TB 3WLBB 3VXRE 1RUAH 3LEVH 4YPJA 5EDXA 3VD7A 1F2XK 5DXWA 1N5AB 1T5XA 4QHLA 5EIQA 3SDAD 1M7DB 1J9CT 4JKKA 1FNAA 1FRGH 4PJBA 3HAEH 2R4RH 3N1QC 4X8JB 1NGPL 5L6YH 1S9VA 5C0AA 4LCWD 4ACPA 4BA8A 4NDMA 2E27H 3I6GB 3MYJB 4MD0A 3D3VE 1B3JA 1KFAL 4AT6A 4PREB 4MNGE 2I27N 2XN9D 3S37H 3NFPB 2VDRH 1T1WA 1X5FA 3I2CL 4U49A 5BO1H 1KG0A 1OF2A 3CH1A 5AAWA 4GS7C 1QFUH 2L0DA 4OZFB 4NQDA 5ADOL 4WW2F 1G6VK 2B1HH 4NGHL 4BKLA 2VAAB 3INUH 3P4NA 2BNRD 3GKZA 5IFJA 2DD8H 5ADPL 4NKIH 5JDJA 4NNXB 4OCSL 2NXZB 4FQCL 1BD2B 4UIMB 3P11H 3ABZA 2YBRA 4OM1H 5FGCB 3N1MC 2AJVL 2EICA 4WW1A 3WIHL 4L4TB 4Y5VC 2ED9A 2FEEL 5J8OA 5B3NA 1PG7X 4XVUC 3AVEA 2J6EL 2DAVA 2VLKE 4O9HL 4Y4HD 1ZGLM 3GMNA 1S7WB 3LQAC 1XGTB 2FATL 4OM0H 2YXFA 4YDIL 5DVMA 3D0LB 4G5ZL 5JIIA 4HXAH 1J1PL 1JZ7A 2IWGA 3HPJB 5A16B 1JV5A 4PTUA 1AO7E 4QYOA 1II4E 3OL2A 1K3IA 4FMKA 3O8XB 5HYSG 2X05A 1FBIH 2NCMA 5EWIL 5TE6H 3VWKC 1U8OB 4HKXA 5C0DB 3ZT6A 1A7RH 3MRMB 4MJIE 5C0RL 1I1AC 2FEEI 2NY7H 4P46C 4NQEE 2DWEB 4KHTH 1TZIB 5EUOF 5FF6B 1KPVB 3AROA 2LFGA 2V9TA 4G6ML 4CVUA 5GGQL 2EH8H 4QXGL 5DEFB 4DKAA 5DFTA 2BSRA 4JO1H 3KYNB 1GH7A 3S7GA 1CGSH 3ZE0E 4YDLB 1K8DA 1LK3L 4YR6A 3MRIA 5EULV 5ACLA 3SKMA 1Q8MA 5JZ7C 2EDLA 4QF1B 4HUVA 2BOBA 4I3RH 3ORJA 5SV3A 1FGNH 1DANT 5IUSA 4YXLL 4KROD 2VXVH 3UC0L 3ZKMD 2XWTB 4TVPD 5TDNB 2BZDA 2BRRL 2EH7H 1HXMB 4JKPL 2D0HA 2Q86B 1I85C 2YK1H 3FONB 4CADA 1JPTH 2OTPA 4K3DH 5GRXG 4ORGB 4KTEH 1NMCC 5FECA 2BFVH 2EDDA 1VHPA 1OAKL 1FNLA 1MH5B 3P2TA 3ISWA 3RWDA 4FTVE 4ELME 1ZT4B 3UTOA 3MNWA 2ADGA 2O5YH 1IC4L 1JNJA 4P9MH 2EZ0C 5E70A 2ITCB 3T0VA 1G7QB 4X6BB 3DV4A 3SDCA 3MV11 5BOPA 1BVKA 1EEUA 1QLRA 1ZKAA 5JXAL 1NEZB 2AV7B 4FN0A 2EYSB 3N9GH 5CMAA 4NPYA 3V7AE 4WTXA 5CUSH 4LPYA 2VWEC 2IPTH 4XPAL 5DD1L 3MV01 3OGCA 2QSCL 3DX8A 4MJ6A 3R1GH 4J4PC 2HKHL 4NQCD 2Y6SD 3IXAA 3LKPB 5K9JH 1U8PA 3FCTA 2QQNL 3OAYK 1IQDB 5K9QI 1QO3A 4N90D 4JY6A 3UZEA 1IM9D 4D9LH 4WJ5B 3ZMRA 4S1DD 4PY8I 3T4AB 4EI5B 3ULUC 4R3SA 4ZFOB 1RUPH 1IQWL 4I3SL 4IS6A 4WHCA 4XMKH 3HS0A 3BN9C 3IDXH 2C3VA 2X4QA 2Z8WC 3WFHB 4Z77A 3TYFA 1PBYA 1XGUB 2V9QA 5D1ZC 2DQIH 3EJZD 3G5XA 4DKDC 3W0WD 1N2RB 5DD6B 2HVJB 1KULA 4QY8B 1XCQB 4MA7H 4O4YH 1LMKA 1OTSD 4UV4L 3MLSH 1PKOA 3Q5TA 1RPQA 3RUGF 1DZBA 4Z76B 4IOFC 1Q9KA 3VXPB 5IT2L 4F9LC 3CFKB 4ZOBA 4JFDB 3C08L 4K7PY 1WT5A 2GW5A 4TSCL 3ZE2E 4G8IA 3P9LB 1J11A 3HFML 1G1YA 2QADB 1P7QA 3NPSC 1CLOL 3DMMA 3WHXB 4PB0H 3MA7B 35C8H 5T1LA 3MRRA 4NKDA 2WIIB 3CSYB 5E8NB 4PRAA 5D70H 5DVLA 3ILQD 2BHUA 1PJ9A 3SKJH 4OZIF 4ZFGH 3R4DA 2B1AL 4L29A 5E08H 5DK3A 5DJCB 4H25B 5CILL 5IM7A 3V6FB 2V5MA 1FPTL 4OF3A 5KSUA 2WWMC 5C0AD 1AGDA 5E99H 1ZLSH 2ZUTA 2JCCB 1F97A 1OTTC 3SKNA 2A77L 5GQBA 1VFAB 5DTFB 4GKZA 1T0MB 3NAAL 4P49A 3MFFA 2IGFH 4F7PA 2IH3A 4PRPA 2ENSA 4PP2B 1ADQH 3FO0L 2UVEA 4LP5A 1AKJB 3DVGB 3BPCA 2QLVB 4FMFA 3SDDA 3L1OL 3P77A 5DJXB 3G08A 5T33L 2GT9A 1KB5H 4JCMA 4NQDD 1KACB 3QFJB 5C6PB 4OCMC 3GK8H 4OUUA 2ZWLT 3PWNA 4NZTL 5H2BB 3DO7A 3B83A 4LEXH 1PX3A 3FOMB 8FABA 3H3PL 3F58L 1FAKT 4ETQB 3FT4A 3C8KA 4JB9H 1QEWB 4MWFA 2EE3A 5K9KA 3FZUD 3TFKD 4OT1H 2XWBB 1A14L 5BVPH 4NO0A 3D2UA 1NCWL 1EEZB 4YHOH 3BP5A 5GS0C 1FNGA 2YPLE 4JDTH 1JGVL 2ATPA 1Z5LB 3WJLA 3RVUD 4S0SD 1T1ZB 1M71B 3I6LD 1ZHNB 3FQNA 5KSVB 5EUKA 1G7HA 3TNNB 4YPGB 2A9MH 3ZHDA 2OK0L 1OARH 5D7KD 1OB1A 3CCHA 1X4XA 3JV5A 3QJHA 3UBXG 3P0YH 3T0WA 4GG6F 4TUJA 2C1OA 1A6TA 4FQJH 1KYOJ 2YSSB 2IPKA 1QA9B 2HH0L 4Y1AE 4JHBA 5LBSL 4YIQA 3C60A 1JHTA 4HKJA 5IKCB 4OFVA 1K5NA 3IDGB 3GO1L 1ZA3A 2XYCA 4MVBD 2R29L 1M4KA 1RZ8B 1AD0A 5MI0B 5I16B 1NFKA 3W2DL 3LOWA 2HTLC 4HF5L 1FYHB 1S5IL 1IC7H 5LGKA 5HDOA 4GXVL 4D9QE 1Q94A 1UKQA 2H2SC 4ODTL 4UOW1 5ERWB 1K6QH 1ZOXA 4EI6A 4JRXB 5JPMB 1NLDL 1U3ZA 3TJEH 2IPUK 1CT8B 1ZGLA 5HI4C 1HHGA 4XX1E 3HNSL 4YBQD 1N4XL 1TQCC 2P5WA 1FVCB 1WBZA 4EN3C 3DURA 1A6UL 4FNLH 5DLMH 2WINA 1I3RA 1S9KC 2VZSA 4NIKB 2NNAB 3NA4A 3SDCD 4LLQA 1H0DB 3L6FA 1DUYB 1FFQA 3HMXL 3NCYP 3NTCH 4IJ3B 4OZGA 5KJRL 1UM5L 4Z7VF 4LKXA 1DL7L 1G0DA 3WN5B 4P3WA 1BJ1J 1F3RB 1WWBX 2HFEB 1EGJH 4X6FB 4KRNA 1H3PL 4R4ND 1UWGH 1S5HA 1CQYA 4PRDB 4RZCB 4I2XA 3SBWC 5T5NF 4LLVA 3NACL 3VH8B 3C6SB 4N0UE 5D7LE 1G9NH 3F5WB 1QLEH 3IDIB 3IS1X 4X0KB 1QKZL 4GBXB 1K8IA 4JQXC 1NFIB 5C0JA 2J8UE 1Q1JH 1FFOA 4BQ9A 3O3DA 5GGVH 2ESVB 5IVZB 1WFUA 4M7LT 3AREC 1FGVH 1UC6A 4KI5D 3G6JB 3RX5A 3LRSB 2OL3L 1AI1H 2VITB 1I9JL 5JOPD 1YMMA 4HJJH 4OLYH 5DK2A 3IXTB 4Z7NE 1E4KA 2DBLL 3SO3C 1CLZL 3UAJC 1NC4D 4G8FA 4R26L 3T65A 1FYTA 5JOFA 2IBZY 2DBJA 5DJ6B 4APQC 3CDCA 1UQSA 1OPGH 1P7QD 3OKMA 3RZCA 3DMMD 1J0IA 1VGKB 5MENE 5T1LD 3L3OB 1KCRL 1T89A 3OR7A 5KZCD 1P2CB 1YYMH 1YEIL 1FNSH 5KTEL 3NFSH 1AGCA 5DEGB 2OTUB 4LL9A 1JFQH 5FGBA 2BVQB 4LKCA 3GSXB 3MRNA 1F4YH 4ZPVA 4KPHH 1FNFA 2A2QT 2W9EH 1U9KA 4Y5VA 5CJOH 3ZYIA 1YEFL 3RTQC 3H0TB 2E6PA 3GM0A 5F7DA 4F8QA 4P5KB 4ZO9A 4PRPD 5E94A 4MNHA 1HZHH 2DTSA 3O45B 2JJUA 3T3PF 1MF2H 2WAHA 3U7YH 4KTDL 4R7NB 1I7UA 3SDDD 2R39A 3TBWA 1KUMA 4JFFB 5I2IB 3BZEB 1D7FA 5A2IH 1PSKL 4AEEA 2F19H 5D7JA 4J8RB 1JPSH 5I8OH 1E27B 4P46A 4UDTB 4CVXA 5HI3C 4X80H 5IB4B 2PTTA 4XP6H 2R0ZH 3PP3K 4L5FH 5E2UH 5E95B 2EIBA 5FUCC 4KY1H 2LAGB 3F7PC 1Q0YH 4R90L 3Q2CA 3DVNA 1FFPB 3RVVD 1U95B 4XTRD 2XKNB 1M7XA 3L5XL 4KH2A 3MOQA 1QVOB 1MHHA 4NHUA 1FG9C 4OZIB 4MXVE 1FFNB 1PZ5B 4NO0D 3T8XB 2PXYA 1CLYH 1RHHB 3D2UD 4MZ3A 3SJVE 1H9VA 2GCYB 4O58L 2AEPH 4ZUVB 3NIGE 5IBLD 2YD2A 3BI9X 3CAFA 4LSRH 4NO3B 3MACH 4XNZC 5DMGD 4O2EB 1DJSA 1E0OB 2EDJA 3ECBB 4X4ZA 4H1LA 3IDNB 2CUIA 3SDAB 4KQ3H 3MFGB 5GIRB 2Y5TB 3D6GA 3ZSTA 3UYRL 5ITFA 3HC4H 3KPRA 5IEKB 5FYKD 4J7RA 3VG9C 4GW4A 1CVSC 3G9AB 4LCWB 5GJTL 4PP1C 3IGAA 1EJOL 1QRNE 1GC1H 1WWCA 2P24A 5DHVH 1HWHB 1JN6A 2DIBA 3VE0A 1CXEA 3TT1L 3MLXH 3C60D 3I6KB 4QXTB 2XN9B 2GUOB 4NKOB 4AG4L 5BXFB 2VJXA 5T1DL 3DX6A 5C7XH 5HGAA 1X5JA 2MSPA 4I18B 2F58L 4YE4H 4HWBA 1NEZG 3J8F7 4LU5H 4PS4L 2HFFB 2ZUYA 4R4BB 3NOIA 3VGAC 2BNRB 2GYSA 4O2FA 5FKAA 3JV4A 1TDQA 1D5MB 3SDXA 1T3FB 2FJHB 1MUJB 1CTOA 2VE6A 4N8VA 2DTMH 1DBML 3L7EB 2E9IA 4ODSL 4JRWA 2P5WD 3HZVA 3VXTB 5L9DL 2H26A 4Y4HB 4OCXL 4QT5B 4XZUB 2R9HD 3PV7A 3KXFA 4S1RH 2BSSA 5D1ZA 4YXHL 1MIEL 3TESA 4QCIB 4MCZB 2O61B 4X9IA 4JY4B 5EOCL 5IQ9A 4S1QL 4NZRH 1FG2A 3MV8E 4F9LA 1VDGA 1SBSL 4CW1A 5EU6A 1F5WA 4Q0XH 4QGYA 1BBDH 2CLRB 1WZ1H 1GHFH 1R3IL 1LDSA 2OP4L 3MRJB 3WLWC 1RUKL 3WBDA 2X7LA 2DYPA 4CVZB 1B4RA 4TSAL 2LV4A 1ZE3C 3O0RH 3CVIH 5I1CH 2Y5EA 3U9PH 5TF1L 3CSGA 2CD0A 4QLRA 1D3CA 2HJKB 4XPFH 1F58L 2YPVH 4IRJA 2ICCA 1U58B 4JO2H 5MHSE 4OIAA 4TSBL 3F7VA 2EIEA 1A1NA 3CDGB 4KROB 2LQRA 3QUKA 3P9MA 1MAML 3I9GL 4P57B 2CPCA 4PRIE 4X83A 3GM8A 1J0ZA 1FZMA 3BDYL 1YMMD 2YS4A 3S96A 2D03H 1BFVH 1QFWI 1NCBH 4D2NA 3T2QA 3TBTA 2CRZA 5F6IB 5FO8B 1PX4A 3MRGA 3CFBB 3GSNL 1JTPA 3OHXB 1MCOH 2FX9H 4I9WD 2E7CA 4AEIL 4Z7VB 2EKSB 1NL0L 3CXHJ 3RX8A 2SEBB 2QQKL 3CXDH 4LRIC 1WITA 1UZ8A 4NRZB 3RZCD 4BSVA 3L3JB 5LG1A 4JY5H 2W59A 5KVGL 5I1HL 3DYMA 1IMHC 4WFGE 4Y5XC 3GSUA 4ZS7H 3SKUD 4M5YH 4M93B 4ORZC 6CGTA 4OZHA 1NFDE 4YDJB 5F7KC 3ARFC 5IMOA 1CXFA 4ZXBC 3C5JA 3LQZA 3QQ3B 5HVFB 5J56B 2OL3B 4NQCB 4Z0BL 5HY9A 4IIQC 1EFXA 3FQTA 4HXBL 5HYEA 4OQ1A 5FO9B 1IM9B 2NLJA 3B6SB 3U9UB 2ADFL 4Z18A 4HFWA 5M94B 3MJ8A 5CD5D 3LD8B 1DQQB 5D7JD 2DL2A 4BZ2L 3EFFA 4QRTB 4GO6B 3QAZB 4P46D 3GZKA 3TJHD 4I0PC 1OTUC 1RJLA 4PJ8C 3LKSA 1IC1A 3W0WB 1J10A 1GSMA 1HN1A 4BQBA 4BQCA 3DV6B 4WGWB 1XR8A 4HUKB 5DDHA 5EIIB 1J5OL 3BGFB 5GRZA 5L8JB 1MFAH 4XRCB 3FHAA 4XGZA 2VLLA 2XY1A 2EDBA 5HYFA 4MAYA 2PXYD 4G80B 5FGSA 4R97C 3DUUA 1ZHLB 3S36X 5CIPA 5IF0B 3BUYB 3PXHA 5CFHA 3BKMH 3CD4A 2BK8A 3U7WH 1O7VA 4HT1H 3QG7L 4NHCH 1L0YA 5DJZB 3ULVD 2Z8RA 1T5XB 4QHLB 5KVFH 2BNQA 4U1SA 3ZYOA 4EBQL 1W0VA 4HG4K 3V9FA 2VC2L 4PJBB 1ZAGA 4RGND 3WKML 2Z0BA 5IW1A 3KPRD 5C0CA 1B2WL 4G7YL 2DQEL 3S88L 1KXTB 2X10A 3OQ3B 5C0AB 1RJZA 4G6FD 4NDMB 3QNXA 1KGCE 5F6HI 4Y16A 4ZSOA 3KPNA 5H8DA 4MD0B 3OAYH 1RIUH 1NGPH 4LASH 1U8KA 4AT6B 32C2A 1MAJA 3IFNH 4OGYH 5LQBH 1T1WB 5TE7L 1KG0B 4Q97A 4UNVA 5IMLA 1OF2B 3CH1B 1MCPL 2FDBP 3VXRA 1KFAH 2ATKA 3GGWA 3MRHA 5T5FL 4NQDB 1XMWA 4BKLB 3I2CH 3P4NB 2EXWD 2PYFA 5IFJB 5I1IH 1V3MA 2J7LA 3SBWA 5E8DH 1DFBL 1NAMA 4X6CE 1FH5H 1PY4A 2R69L 2E9WA 2YBRB 4WW1B 4ZQKA 5ADPH 2BDNH 1P53A 2ZJSL 4PB9H 3QUZC 3ULUD 2I07A 1JGLL 4FQCH 4RDQG 5BV7C 1N59A 4GH7B 3GMNB 2XZCL 2AJVH 3KXFD 4KK9D 1F4XH 5D1ZD 1CGVA 3AREA 3PL6A 1BAFL 2BMKB 2NZIA 4OV5A 2QTEA 1JV5B 4PTUB 4QYOB 1IGFL 1EAPA 2FEDC 4HMCA 1A7OL 2FATH 4U7MA 2OZ4A 3VGGA 4EDXA 4DW2L 5K9QG 2UUDK 4HKXB 1QSEE 2C4FU 3K46A 1WSST 3OWEA 4LIQE 2BP3A 5EU6D 4NOFA 4Q6IA 3T2NL 2DLTA 5EWIH 4ETYA 1AJ7L 1BZ9A 2N7BA 3BAEL 4CVWA 5C0RH 1EBPA 2DYPD 1QACA 2BSRB 5GRYA 2G60L 1N8ZA 4IBLT 1L6ZA 4M6OL 3O6LL 5CCKH 1GOFA 3D69A 3TPUB 3JVGC 1K8DB 3ZZ1A 4YR6B 3MRIB 5GGQH 5DF0A 4IRJD 4QXGH 2BOBB 4LPCA 3MCLH 5C0NC 5TQ2L 4I8DA 1AO7A 1I3GL 1RULL 4X6DA 4KVCH 3RTQA 1OTTD 3B4NA 1OT1A 4XP4L 1UCTA 5JMRA 5GRJL 2Y25A 4XCEA 2VXTL 5CGTA 1HOCA 2IPUG 4TYUA 2QQLL 3CFEA 4CADB 5FECB 3O9WA 2VTFA 5FM5M 2BRRH 5D2LF 1P4BH 2O5ZL 1LGVA 2F54A 3BE1L 4LFHG 4L8SC 4NN6C 3RWDB 2HG5A 3ZDYF 2ADGB 2RHEA 4YFLF 1I9IH 1JWUA 4NUGH 1OP5K 1ZGLP 5KG9A 2K7PA 1YQ2A 3DV4B 5IBTH 3SDCB 1U3HA 1BVKB 1IC4H 3TO4A 1QLRB 2EDRA 5CMAB 5TQ0L 4X9HA 3RJQB 4OLVL 1YECH 4K94L 4P48A 4YX2H 3B5TA 4LRNL 3OGCB 4Q9BA 2XTJC 3DX8B 1LE5A 1R5IA 4MJ6B 4KKAC 3IXAB 4BELD 2IQ9L 1U8PB 1EFXD 3FCTB 4FTVA 3F7QA 2X4TA 5GGSA 3QWRA 4YFLI 4Z7OE 4HCRH 1QO3B 4JY6B 1BQHA 2QQNH 4R3SB 1H8NA 1HHJA 5DK0A 5C08E 1MREL 3ZE1E 2BXZA 4IS6B 4N1HB 3HS0B 2Q8AH 2C3VB 4BFEA 2X4QB 3QEGL 4Z77B 4YWGL 4KQ4L 1RZKC 3TYFB 4RA0C 3G5XB 4UIKH 5C6WH 5EO9A 3C09B 1OWRM 4JO4L 2D7MA 1PG7H 1T80A 1MCEA 1Q9KB 1NUDA 2HN7A 4HBCL 1KF9B 3NIFE 4KHXH 4QRSA 5CEZD 1NC4B 3PGFL 4G8IB 1UA6L 4MAYD 2C5DC 1P7QB 5IT2H 2XZZA 4DUVA 4M62H 3DMMB 3C08H 5T1LB 2OR9H 3MRRB 4IMLA 3X3FL 4NKDB 5KZCB 1SEBA 3L3GA 4LGRB 4PRAB 2IFFL 5DJ0A 3C9NA 2BNQD 4L29B 3JWOL 2FX7L 1LO0H 1INDL 5IM7B 3OR6A 4PJEE 5C0CD 5KSUB 2ORBL 1L7IL 1T0PB 1AGDB 2X44D 3GHBL 2C4FT 3SKNB 5C8JA 4Y16D 1OSPL 2DMKA 4GKZB 4KTYA 1HYSD 2EDEA 4W6YB 1DBKL 4W4NA 4F7PB 4RBPK 5I6XC 1U6AL 2IH3B 4PRPB 2CIKA 5F1NA 3IU4L 3ULVL 3SQOH 2DQFA 4GQPH 3BPCB 3MOBL 3SDDB 1NBQA 1CZ8L 3VXRD 3P77B 3MA9H 4YDVA 2GT9B 1W0YT 1XR9A 3VI4E 5I0DA 1YNTA 2KKQA 1OGAE 4C4KO 3BHBA 3WV0A 4OUUB 5TJWK 4E0RA 3PWNB 3ESUF 3DO7B 5FEBA 1J8HA 3I3BA 8FABB 4DN4L 1UACH 1CFVL 5GRVK 5F3BA 3FT4B 1KC5H 3C8KB 3WHE0 4MWFB 5IB1A 4LNRA 5K9KB 4JLRA 3BP4A 4UV7L 3HG1A 2OTWA 3F58H 4HWBL 5DUML 2JIXA 4EZMA 4Y8AA 4X5LA 2DQCL 2D7TL 4HGMA 4NO0B 5KS9A 5I30H 3D2UB 1I8KA 4LPTA 3SDXF 4PG9A 5BS0E 3BP5B 3ARED 3PL6D 4Y4KC 4JFYA 1IAOA 1YJDH 4YQXH 1QSFE 2ATPB 3LV3A 2AXGA 3FQNB 1KNOA 1DQJA 3ULUF 2NY0C 4OD2A 1C16A 5EUKB 1G7HB 4FOMA 3GFUA 3K8KA 3CCHB 3QJHB 2J1KA 4TUJB 2C1OB 1A6TB 2VLRE 2IPKB 5C6TL 3B43A 3WNOA 1DCLA 2OK0H 4M7KL 1E4WH 3V0VA 1VFUA 3C60B 4YIQB 1JHTB 3QDME 4HKJB 2IG2H 1CI5A 1WTLA 5E8PA 1K5NB 5F44A 1ZA3B 4MAUH 3ARXA 1KCSL 4PJXE 4QGTA 4TUOA 4XVSL 3A67H 1AD0B 1EIBA 1R3LA 2YPLA 4MMZC 3EOAA 2AI0H 3T0EE 5T5NG 1AO7D 2AJYL 3RY6A 5I18H 3GO1H 4RGMB 5AD0A 4U3CA 3PP3H 2FBJL 1UCBL 1YN6A 4KDVA 3UROR 1Q94B 2I5YH 4LOUC 3PWLA 3W2DH 4MQSB 3X3GL 4D9RE 4EI6B 4HF5H 1M6OA 3O9WD 4Z8FL 4NOBA 1Z2KA 1MQ8A 4OLWH 1ZGLB 1DLFH 4D0DA 1HHGB 2F54D 2X42A 3H9YA 3O3UN 4QXUH 1CL7L 2P5WB 1WBZB 5GRWA 1JGDA 3HLAA 1EXUA 5KW9L 2J3SA 1JBJA 3DURB 1KIQA 2WINB 1I3RB 4K8RD 4WI2A 4NC0B 4Q9RL 5ALCH 1U3HD 2V2WA 4LLQB 4PGBA 3TO4D 2XACC 4P4KA 3BYTA 4JPVL 4XNXH 4LVHC 4TVPH 4OZGB 1GVIA 1RURH 4LKXB 4JHAL 2BC4B 3QB7C 1IE5A 1RHFA 1OY3B 5D7SL 5KOMC 4M3JA 1VA9A 3H7BA 3PV6A 4NQVA 1OM3L 3RKDC 3QIUA 1S5HB 4I2XB 4X5WA 3VI3F 4LLVB 4XPBL 5IEHB 4FTVD 1LE9A 3QWRD 5DQDL 5C07E 1AQDA 1JZ5A 4M00A 3VMPA 4OZHF 4F7MB 4KDTC 4DKFH 1K8IB 5FV1L 2CO6B 5ALBL 3DRTA 5C0JB 4M02A 3NACH 5TDPB 5J1AA 4DGIL 4TUKL 3WYRA 1FZKA 1QKZH 1SMOA 2BNUA 4QXWA 5EN2A 3KG5A 1YMMB 3LDBC 1VACA 5DK2B 2ZPKL 2HJLA 3LS5L 3MODL 3BD5A 2OL3H 4G8FB 3WNLA 3T65B 5JOFB 3EYQC 3Q1SH 5D7LA 3MGOA 3N1FC 4NFBA 1CLZH 3OKMB 3RZCB 5J12C 2Y07L 4OCYL 2CGRL 1HCFX 4J2XA 1LP9A 1CWVA 2D7NA 2J8UA 1EHXA 3TA3A 3OR7B 4PJDB 4WI6A 2BY1A 2EKJA 4QTHA 1FL3A 1XCTA 4UU9A 1LO2H 1AGCB 1SMAA 4P3CL 4FZ8H 3WUZA 4LKCB 3MRNB 1KCRH 2ICWJ 2HRPL 1R24A 4ZPVB 3SGKA 1MY7A 1YEIH 3GB7A 2GQHA 5CEZL 4HJ0C 4Y5VB 4B53A 3TN0C 1V7ML 1J87A 5MP6L 2XKSA 5DURD 5F7DB 4WFFD 4NT6A 3T0AA 4HC1A 5E94B 4MNHB 1WWWX 3JXAA 1HQ4B 3RIAF 5I8KL 2KZ1B 1I7UB 1YMHA 3TBWB 3L5HA 4DEPB 1FIGH 3P4MA 5D7JB 1RZJL 2DQDL 5HYJD 8CGTA 1YEEL 1INQA 2O26U 3EYVA 4RRPA 4P46B 4MYWB 4CVXB 2PTTB 4OF7A 1J8HD 3CUPA 3UYOD 3UTSA 4HDIA 2NMSA 1O5DT 3CMOH 1KB9K 3JVGA 3CFIC 1HILA 1MHHB 1E28A 4NHUB 4OF0A 3HG1D 1RIVH 2AK4E 5F7EL 1DR9A 5L8KB 5DD0L 2JIXD 1KEGL 2NXYD 4LVOB 2PXYB 3FFCA 4NYLA 4JM4L 5GZOD 3KPLB 4FG6C 5EBMA 4R7DA 2FSEA 3FN0H 4H1LB 3DRQA 4CNIA 3HC3H 3HZKA 1TCRA 4RGNB 1Z6JT 5ITFB 5JORA 3KPRB 3AB0B 5JIKA 4GW4B 4G6FB 3FAWA 4XMPL 3ZDZE 1BVLA 3IGAB 2G5RA 2ILLA 5ECJE 3UYRH 2P24B 2LU7A 3GMRA 3QHZL 4XH2A 4HKBA 1JN6B 3VE0B 1XT5A 1EMTL 4WEBH 1MWAA 2W92A 3P73A 3IAQA 4A2LA 1KTRL 2DM2A 1GIGH 3DX6B 1IGTA 2OZ4L 3S97C 3HAEA 5HGAB 3QPQD 3EJJX 2YPLD 5BJTA 4ZTPH 4LHUA 4XVJL 1T5WA 4AG4H 2AQ3A 1MCRA 4EVNA 1D5ZA 2F58H 5FKAB 4O2FB 2AK1H 4R2GD 3JV4B 1CF8H 1YEGL 4XC3H 5I17A 3OV6A 3SDXB 1WJ3A 3LEXA 1JRHL 3KDMA 3OKNA 2CDFA 4PJ5E 4WWKA 2DF3A 1DQML 2VE6B 3HC0A 4N8VB 3QJFA 4WI3A 2NX5E 2VLMD 4GAFB 5B4MC 4X4YA 5ICZA 3G6DL 2H26B 4NBZB 1G7PA 2PN5A 1DBMH 2MNUA 3KXFB 3SE8L 2LVEA 2EEBA 2B5IC 5DUBA 2BSSB 3BKJL 5D1ZB 4FZEL 3MTRA 2OXGA 3IFLL 3VXNA 4P4KD 1VFBA 4OCXH 1JRHI 1ZWIA 3DGCR 3Q6FA 5IQ9B 5FUOH 3ZE0F 4U2ZA 1PLGH 1FG2B 3ZKND 4MMXC 4D9QD 1DEDA 3E6FA 1S7SA 2X4UA 5EU6B 3K4DA 3UX9B 3I50H 1OL0A 5EOCH 3QIUD 3LN5A 5CBEA 5A2KH 3LSOB 1WLHA 4K8RL 2GAZA 2X7LB 2DYPB 1CTNA 3LRHA 5GGTA 3N1GC 2NY5L 3CMGA 4M48H 5DQ9A 1R3IH 1S7XA 1CGXA 3V4UH 3W9DA 4FFYH 3NZHL 2DOCA 1RUKH 3WD5L 2CRYA 4IRJB 4P2YA 1QFWH 3O6MH 4TSAH 3F7VB 1ODAA 1A1NB 5SX5K 4PG2C 3QUKB 2VLJE 4ZD3L 3P9MB 4NWUH 1OLZA 4ELMF 4OGAD 4MNQE 4YEFA 1ITCA 4BUHA 3P4OA 1EPFA 3D39E 4L4VE 1MRDH 4Y4FC 2BSTA 4TSBH 3RIAK 3S96B 2PO6C 1GXEA 3I84A 2R0LL 3BKYH 1ND0A 1MAMH 2FLBT 3HA0A 3I9GH 3TBTB 4R96A 3BDYH 2F53E 3MRGB 2AJXH 2ICEA 1XH3A 2I9LA 5D7LD 2VXSL 1QNZL 1J8KA 1UZ8B 4WI9A 4BSVB 3O6KH 3RWGA 3GBMH 3WKNA 4N0RA 3O3BA 4DQOL 3TA3D 2ADIA 1I3UA 1FVEB 2MCG1 4AEIH 1G0XA 2Z31C 2QQKH 4PRIA 5HDLA 1P4LA 3GSUB 3K3QA 2UUDH 1XF1A 1A5FL 3HUJE 1RFDL 1XGPA 4OZHB 3FFDA 3QPXL 5FDYA 4MXWH 3U82B 4FQLH 4MQXD 4CN1A 2WIMA 4Y8DC 5IMOB 1K4DA 2HLAA 4TRPL 3C5JB 4Z7WA 1KJ3L 3BQUC 1WCBA 1F6AA 1G7LA 3LQZB 1JP5A 3AFLA 3SE9L 3EOYG 5HY9B 1EFXB 3FQTB 2AJSL 2GI7A 3LKRB 4B0MM 3VRJB 4Z7UF 5FB8A 1BFTA 2FIKA 1WBYA 4M6NH 2NLJB 3GSOA 3QBTB 1T04A 4HFWB 4TNWF 3G9VA 3MJ8B 5D93C 1MPAL 3EFFB 4HXBH 5I1KL 2GJJA 4XHJD 5ILTL 1RJLB 1EO7A 3TH2T 3LKSB 4UQ3A 4WUUA 3UTSD 4LK4A 4J3WA 1XR8B 5DDHB 3MLZL 1NFDA 3X13A 3RBGA 1X7QA 1EO5A 4PD4K 3QISA 4BSJA 4KC3B 3MLWH 1IAMA 4X6EA 3K4AA 3RUGE 2VLLB 3QCTL 4OKDA 1B88A 1MCNA 4JFQA 3H9SE 4GJTB 2CJUL 5DJ8A 4MAYB 4F3FA 1OP5H 3DUUB 3FFCD 4QHNA 5CIPB 1DBBL 2NY1D 4OCWH 3MGTA 2UY6A 5HSFA 4G8GE 2NZ9D 5TPWL 1MQKH 1WVZA 4HX1A 4K23L 5L0QC 2BNQB 4PJAE 4U1SB 1W0VB 2Q8BL 3QUYC 2ZNXA 3HMWH 5IW1B 4N9OB 5C0CB 4IRSC 1R3JA 1MFBH 3BRDA 3QG7H 4YZFF 4XP1L 1RJZB 2VH5H 3LS4L 4YGAB 3QNXB 1TJHL 1F00I 4U6TA 4EBQH 2VC2H 4FFVC 4DZBA 4Y16B 2FCBA 3WKMH 4ZSOB 3KPNB 5EBLA 4FHBD 2DQEH 5LWYL 2DWDA 3S88H 1U8KB 3NH7H 1YZZA 2CQVA 32C2B 2R0KH 5DYOA 2ERJC 4GRWE 4PTTA 4LCCB 4WCYH 3QWQB 5IMLB 3VGHA 2EDXA 3VXRB 3VWJA 2ATKB 4LHUD 1N7MH 3GGWB 1QPPA 3CJJA 4Y5YA 1A21A 5DC9B 2ZUQB 1CGYA 4GW1B 4WV1C 2YD5A 2PYFB 3EDKA 3HI5L 2EXYD 1TNNA 5IVXA 1FQ9C 1OSZA 1KELH 5FYKH 1NAMB 2R0WL 4JFHE 4WWKD 4FABH 1PQZA 4Z78A 5IB5A 4ZQKB 4WHYG 1E6OL 1YEHH 4KDTA 5TDOA 1DFBH 4A2MA 2I07B 2R69H 1N59B 5D1XA 1TPXC 1P84K 3O3EA 4RFOL 5CGYD 4DAGH 3PHSA 4JEGB 3AREB 3PL6B 3DSFH 4F33A 2FB4L 4OV5B 4JREC 2F5AL 2XZCH 1EAPB 5I1EH 5L7XL 4EDXB 2DB8A 3GI8L 3RL2A 4GMTL 3ALWA 1D5IL 4P9HH 5D6CA 1NCTA 1IGFH 2Q7NA 4Q6IB 3GI9L 4DW2H 1BZ9B 3QQ4A 3GBNH 3VXUE 1R5WA 3AM8C 2AEQL 2IAMC 4XBEH 4RBPH 1N8ZB 3D69B 3A6OA 3BAEH 1A2YA 2AV1A 1AY1L 2G60H 1AO7B 4YHLL 4BUGA 4LHQB 4X6DB 2OSLA 2QKIB 4NJAL 5TQ2H 3GMQA 4XCEB 1UJTA 2QHRL 1HOCB 1GZPA 3CFEB 4TNWK 4HKZA 4KK8C 3S36H 4YHNA 1SEQL 3O9WB 4LSUH 4YBLC 5GRJH 2F54B 1V3JA 2HG5B 4V2BA 2XIDA 1JWUB 5LCVL 3VGDA 4U6YB 5MHSD 5KG9B 4BQ8A 2OBGA 1U3HB 5DHXB 4PRID 3TO4B 4X7SH 1W72A 3OF6A 4M4RA 2NW3A 5CSZA 1EEQA 5GS2H 4JG1H 3V6OE 4HIIA 5IW6A 5H94A 2X4PA 3HB3C 3RDTC 3RGVA 1ZMYA 2E9BA 2Z93A 3ARGC 4LSDA 4XPGL 1LE5B 1R5IB 5TQ0H 5J6GA 2JJTA 4P59L 4K2UL 2YKLH 4FTVB 2X4TB 3MLTA 5GGSB 3S37X 4XNZB 1RY7B 5D72H 1NLBL 3T3ME 4Z7NF 4MD4A 5I74B 4LSQH 2IQ9H 1BQHB 1JF6A 3VXQA 2NY0D 1HHJB 4WFGD 5DK0B 2OM5A 4Y89A 1IILE 2P46B 1FNHA 4E9LA 1EGJA 3MRFA 5EU5A 3WFCL 1CG9A 2P43B 2VO5A 5EU7E 2QSQA 4WUUD 2EEAA 3LMJH 4LMQE 5EO9B 2JELL 1BFSA 4RWYL 1XAUA 1HNFA 2W9DH 3QEGH 4HC1L 3RPIA 5ETUA 1J05A 3WS3A 2HN7B 4JO4H 4QRSB 4AJ0A 4G6AD 2MKWA 4MA8L 3LQAH 3MJGX 4P99A 3BWAA 4U7SA 2XZAL 3LCYA 4IMKC 3MNZA 5FHBH 4LLWA 5FYLE 1TCMA 1CU4L 4U1GC 4IMLB 5C08A 2R56L 1SEBB 3RY4A 1MJUH 1UA6H 3L3GB 2DKUA 4AEHL 6FABL 1I1CA 5DJ0B 4PLOB 4LOUD 3C9NB 43CAB 3K2UL 4WUKL 3VMNA 1VESA 2H2PC 5DD5L 1F11A 3OR6B 4UT9H 1BEYH 5EA0H 4N8VG 1UENA 3OXRA 2XZQL 2P4AB 3JWOH 2FX7H 3ELAT 1INDH 5GHWL 5C8JB 5F9WB 5DURB 2ORBH 5E00A 3GHBH 1DP0A 5FOBA 4ZDHA 4YHYC 2CIKB 1IGYA 3ULSA 3GJFA 1HEZA 1BECA 5F1NB 2DQFB 5HDQL 4NJ9L 4KKLD 1Y0LB 4M61A 1MVFA 3B9AA 4LSTL 1C5CL 5D4QA 1CLCA 3VWJD 2D4DA 4YDVB 2EDQA 1OWWA 1XR9B 1TITA 5HYJB 2XTLA 2YA1A 3IU4H 4MXVF 1YNTB 4H1LH 3TZVD 5LGHL 5DEZA 4XPTH 3BHBB 2P8PA 3MOBH 3OJDA 3HTLX 4E0RB 1CZ8H 4D0BA 2D7PA 1J8HB 1I8LC 2JE8A 1UKSA 3QDJA 1RUAL 3LAFA 1KN2L 3SKOA 5IMKA 5F3BB 4ODHL 4UMGA 1SJVA 1MWAL 1XGYH 1KGCD 2XWJA 1FRGL 1T7WA 5FYJE 5IB1B 4LNRB 1AQKL 1CS6A 2UWEF 3BP4B 4IEFB 2R4RL 4JLRB 3HG1B 2OTWB 5GSRA 5TGBA 2JIXB 2DICA 5D1XD 3QULA 5LXGH 1X4ZA 2E27L 2NXYB 5KS9B 1I8KB 4PG9B 3BP6A 2BVTA 4QHMA 2R8SH 4HWBH 4JFYB 3GSQA 1IAOB 4S1SH 4HEPG 4Y4FA 1G7MA 3S37L 3LV3B 2YA2A 5IJKC 3IB4A 2AXGB 2VDRL 1KNOB 1DQJB 2XA8H 3MOAH 4OD2B 1C16B 1T1YA 3CLFL 2VXUH 4J12A <