2IQAB

Pfa2 fab fragment, monoclinic apo form
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
220
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSLSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKNYNPSLKSQLTISKDTSRNQVFLKITSVDTADTATYYCVRRAHNVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG2a Fab fragment PFA2 Kappa light chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
total genus 37
structure length 220
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iqaB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iqaB02
5GGTH 3RAJL 5HHNB 2YD1A 3LS4L 1IKFL 1JF6A 4TRPL 3INUH 2ZCLL 1T1ZB 3PL6B 5KSAC 1Y18B 4WJ5A 1PY9A 1SEQH 3C6LC 3HE6D 2GTZB 5GSVB 1MCNA 4ENED 2VLMD 2EECA 4ZPTB 2HLAB 3R8BB 3S36H 1M7IB 2QQLL 4WUKL 1PEWA 3KYMB 5DUBB 5ESQA 4KUZH 3S97C 3GJEB 1AI1H 1CXFA 5DJDA 4CVZA 1A9BB 2DLFL 4L8DB 1KB5B 4LDLB 2W9LA 3D9AL 3PHSA 4Y2DD 5F21B 5I6XC 5DQJA 1QBLL 4NJ9H 2QSCH 4MDIA 1P1ZB 1WBXA 5GHWL 5GRUL 3KNBB 3MV7D 5TGBB 3RL2B 3DBXA 4BQBA 4L29A 2DN7A 1ZANH 2ZJSH 4YHYC 2IGFL 3EYSH 5FCUL 4MAYB 1TTGA 1T1WA 4KTDH 1KTDA 1YECL 4NRYA 4ZFZB 3G6JF 3VFMA 3BVNA 4Q6IA 5I1AA 2EO1A 3VGFA 4QYOA 4OZIF 3NN8A 3E2HC 1WFTA 5DT1L 2DDQL 3VXTB 3FTGA 5IMMA 5TFSH 1ADQL 4DKEH 2BNRB 5D2NA 5F89A 2DWEB 3QUMA 2VIRB 3PP4H 4TOYL 3HHRB 4F33A 5CINL 5HHXL 4ZTPL 2XN9B 3LV3A 3OR7A 2ARJA 4AIXA 1FG2B 4JZJA 1NANI 3W81A 3IDIA 2CIKA 4XP4H 1IVLA 5GRVL 1L4IA 2X05A 4KI5F 5DEZA 4PJBA 4AT6A 2NXYD 4NHUB 3QIWC 5D2LA 4XMKL 4FP8H 3W9DB 2OK0H 4HWEH 3CD4A 3OSKA 4A6YA 3QEQD 2YUZA 3O4LB 4JFDB 3F65A 4XC3L 2EH7L 1F42A 4NNXA 5IGXL 2C1OA 1CN4A 4EXPX 4E5XA 5C0EA 1A7RH 3MJ7A 1BM3L 4I3RL 2B5IC 4DKAA 5EDXA 3L7EB 1ZA6B 3AM8C 2D7OA 3RIFK 4BH7A 2VB5A 5CEXB 3RWIA 1TIUA 5IVXE 3DWTA 5HHVH 1F6AA 4ZNCD 5TQ0H 3RZCA 5E99L 4MX7B 3V4UH 5EO9B 4QTIL 4YPJA 2BHYA 3WEXB 5FGBA 8CGTA 1YUHB 3LQAC 1UKQA 4PGDA 3WKML 4Z78A 4LLUB 3MNVB 3IT8D 5B39A 1H5BA 1FZJA 1A4JB 1JPGB 2BRRL 5DUML 4LNRB 4N0YL 4NZDA 1UM5L 3GMRA 3O9WA 2YK1H 1BIIB 3LQZB 4POUB 1C7TA 4ZXBD 4HWBA 4AEHL 2EIZA 1I85A 1I3RA 1ZV5A 4LFHG 1MAMH 4O02H 4Y5VB 4D9LH 1HYSD 4YHLL 2A2QT 1W72L 2H2SC 2FJFB 4TPRH 5L7XH 2NTFB 4ZQKA 5FYLL 5DRZA 2YRZA 4GLRI 4DZBB 3CSPA 4M61A 5I1LB 4NUGL 4GRWH 1I1YA 1CL7I 3IGAB 1Q1JH 5IHZA 4KROB 4XCYB 4RGNB 3KLDA 4P46B 2L7UA 1BX2A 3L5WB 4N1CA 3SO5A 4I0PC 4LU5L 2BNQB 4N0UA 3MPCA 5GS0L 3OL2A 4H25A 4OGAD 3RNQA 3CFDB 1ZLUK 4I9WE 4GRMA 4XVUC 3NA9H 4ZUUB 1XF5B 3LAFA 5CP7A 4RIRB 5HHME 4WDIB 4X6CF 1ZVSA 1G7PB 5F7YC 2IALB 4CADB 1E6JH 4LPTA 3RJQB 3GK8H 5F7HA 5IMLA 3REWB 5HDBF 1F8TH 4HS6B 1EFXB 3LEXA 1NCNA 3B9KC 1P7KA 3W5NA 1CXKA 3SGDI 1QSEB 2AJ3B 2EYSB 3QO0A 1KXQE 3ARGB 4XNMA 1I9IH 1G9MH 4NN7C 5IT2L 5IV2B 5IQ7H 1II4E 3G04B 3GSOB 3OAZK 4PJXE 4EDXA 4NWTH 2YA0A 3KYAA 3RZCD 4IRSB 3GGWB 1DQLL 3QIUC 4GSDH 3QXVA 2EEDA 1PKQE 3DSFH 3VXSE 5EU4A 1EDQA 2ICWB 3PWNB 4Q0XL 3BZEB 2X1WL 3WO4B 2GSGA 4K23L 4QHUB 1I8IB 3C09B 1CGXA 2GAZB 3WS6A 1FVCB 1FZKB 2F58H 3VRJA 1J87A 1SEQL 4XC1L 1PQZA 1P53A 3NFPA 4HLZH 1DFBL 4D8PB 3I75B 3Q2CA 1I3GL 3QDMA 8FABB 1BD2E 4KUZL 3BIAX 1TDQA 3U6RB 3LMJL 4NC0B 1JNJA 1LMKA 5INCA 3BPCA 4UQ2A 4F3FA 5D1ZD 1MFAL 2FEDD 1FZOA 3JSSA 4HUMB 4OSUH 2CK2A 4L8CA 1KCVL 4LRIA 1P6FA 5DO2C 5T3ZL 1KPRA 5DJYA 2X89A 3B9AA 3PDDA 4Z8FL 5DMJB 3JVGC 4KTDL 3LKOB 4JKPH 4YHKH 3EFFA 4M7KH 4MSWB 4RAUB 4HXBL 4NDMB 5J9PB 1DQDH 1I75A 3VFNB 4JRXE 1F4YL 2Q3AA 5JDJA 1ZHBA 3MV8B 3BW9B 2DL2A 4XMLH 4F9PC 2OQJB 4RQQB 5KVFH 3ARYA 5TFSL 3BO8B 4KJPD 1EHAA 4J4PA 2J4WL 4YPGB 4KKAD 1T2XA 1LO2H 3S96B 1GIGH 1QLRA 2XKNA 5E6IC 5C0JA 5HVWA 4MWFA 4Q2ZB 1V3KA 4YUEL 5ANMA 3MC0A 1DBKL 2WBJD 3MQIA 4XP4L 5C09B 4FMKA 5LAXA 1AJ7L 4Z7VA 1G84A 2FSEA 2JLLA 3G6DH 1C16B 4P3WA 2B4CH 5EC2A 3BQUB 2OK0L 1IGTA 2Z9TA 3EIFA 5EZIH 2YUVA 2G5BA 1RFDH 4X4ME 5HGAA 4CW1B 3UBXG 1LK2A 4AJ0A 2W60B 1WTGT 1CG9B 5I8CB 2VWEE 4OFIA 1JPSH 1VGKA 5B38B 3WO3B 1JUFB 4M9PA 3LIZH 4XGZA 4NUJA 3QDMD 1HYRC 4ORGA 4BYHA 3H3PH 4AIZA 1RZFL 2A77L 2NNAA 4UT7H 2I60L 1GOGA 1WZMA 2J8UA 3O6LL 1EO8H 3ULUC 4XMPL 3V4UL 5FA3A 2X89D 4Z77B 2HVKA 3J7HA 5KSUA 1WBYA 3QH3B 4OCLC 3TM6A 3UPAA 4QHMB 3MRCA 1MOEA 2NMSA 4PLJD 43CAA 5DK2B 3HUJA 1CD9B 3QUKB 3EKCA 4MQXC 4HWUA 4HGWA 4XNZB 2FYYA 2R23B 4O02L 4LEXL 3SHSA 4D9LL 1GJIA 5EZJB 5L7XL 3VXUB 2NY7L 1FO0L 2A73B 5MHSD 4PJIB 1NC2A 2O26U 5GS1A 3UTQB 4JJ5B 1MWAA 4J4PD 3BN3B 3FFCE 5JW4R 2P8PB 4J6RL 4UNUA 2C9AA 4K07A 1X5FA 3T77A 2JCCA 5I8OL 2XFXA 2E7MA 4GG8A 3IFOB 4XWGL 4M3KB 5C0BD 4OIIL 1CF8L 1AO7E 3IJSB 3TNMA 1CLYL 1R5WA 4XWOD 4XCEA 5FECB 1A6UH 5DJ6A 1WFNA 1E6JL 4NO0A 2XOTA 4IIQC 3GK8L 1JWSB 1U3JA 1RJZA 1DBAL 2D9QB 2M2DA 3MCG1 2DKMA 2QBWA 3FQUB 2FATH 3RWDA 5BW7A 3F8UB 4HJJH 5E5RB 3FB7A 3EHBD 3LPFA 4IDJH 4BELD 5GZNC 2Z0BA 5ETUB 3N06B 1REIA 2IQ9H 3BH9A 4YDVB 5EBLB 3ARRA 1WT5C 5D8JH 4PJCE 3MACH 4NWTL 3VFOB 4N8VA 4Y2DB 4J1UB 3BD4A 4FFYH 2ADIA 1CE6B 3DSFL 4RMSA 4U1MB 3V5HB 3CH1A 4M02A 4G6AD 4RRPA 3KJ6H 2WWMC 1KIRB 2A0LC 1JHTB 1NMAH 3LKNA 3QWRA 4AMKH 2P5EE 1K6QL 1FFRA 4PB0H 1IAIH 1IEBB 3LQMA 4FQPA 3FL7A 2F58L 5IMOA 3MUHL 1ULVA 3EYOA 2RJMA 1YDPB 1AGDB 4V1DE 4XPHH 3SE4A 3GI8L 2EDHA 3GMPB 3PWVB 3QBTB 5GJTL 2Z93A 3SBWA 5HDQL 1CXHA 2ZG1A 3R1GL 5F1NB 5DD0H 1CK0H 3MLVH 3T0VA 5IW6B 1MCJA 3AY4A 3WL9B 1TQBC 3NPSB 4MD0B 1DEEA 2ZUUA 4F7PA 4Z95H 1JMXA 4PJHE 4ZNEA 1A6VL 4P2RD 1JGLH 2FNBA 1LGVA 3OAYH 3R0NA 3QWQB 4MNQE 2X2YA 3TO2B 4GRLD 4LCUB 4YFEA 1MCKA 1RVFH 2OI9B 3ISWA 1ZGLA 4PGBB 1S7QA 3M07A 5ITBH 4M4RA 4GMSH 1OSZB 4XMLL 4X6EB 3SOBH 5D7JA 1D5BA 3L5XL 3UJTH 1IAMA 1N0LA 3EYFA 3TIEB 2VDPL 5JZ7C 4DVRH 2QQNH 3IAPA 3NH7L 1XF1A 4KQ3H 1EGJA 1GIGL 1CFVH 1F58H 2BSTB 4OIAA 4F7CB 2AI0L 3MV9E 3T04D 3STLA 4JQXC 3C8KA 3GSNL 4I5BB 4IRZH 4JY5H 4XPBH 4C57C 3OXSB 3MOQA 3GBLA 4C83A 3G6DL 4YFLI 3SE9L 1X5AA 5AUMA 1PSKH 2BFVH 3HG1B 4LCWB 3O4OC 2DQDH 4HZLB 2YOCA 1BFVH 4OZIE 3SCMD 4KV5E 1HHKB 3JTSB 5C0CB 1N3NB 3K4AA 4KKBC 3NCMA 3EDKA 4L9LA 4ZXBB 5HVGB 1VKXB 1MI5A 4NKIH 4WFGE 2HFGH 2CLRA 1KJVB 1L0QA 2AJZB 3Q3GB 1QRND 2AXGB 4EI5C 4O2FA 3MBEC 1T0MA 5GPRA 2CKNA 6FABL 1NC4B 1NPUA 2RIKA 4IEFB 4G6ML 5I1KH 5JMOC 4LPCA 4JCLA 5I76A 4PRDB 5IVZA 1DE4B 3VH8A 3LKPA 3HC3H 3RTQA 2Z4QA 4YIQB 4JFPB 3O3UN 1EXUA 4P2OC 1IKNC 2SEBB 1FYTD 1XFPA 3BUTA 1B4JL 2R0KL 1TETL 2OZ4A 1BIHA 1JNNL 4PJIF 5F3HB 3V6ZB 1OL0A 5E8OA 2R1WA 1YY8A 2IBZY 3G5VA 4WTZG 1EMTH 2ESVD 1BJ1J 4B5EA 1O7SA 2O5XH 3O3BB 1EAPB 1C1EL 1GHFH 4NKDA 3ZT7A 4U6XA 4HGMA 4GQ9H 3AFLA 3CDCA 4HIIA 1RZ8B 5BMFH 4Y4FD 3BWAA 5EN2A 3NABH 2VDNH 4PY8I 2QSQA 1IGYB 4JFQA 4X6DB 3PWPE 4WIQA 1EUTA 3NCFB 4WW1A 4G9FE 3MODH 1UKTA 3VFPA 3V4VH 2FBOJ 3HNTL 4Y16C 1GL4B 3BWUC 1LVEA 5FV2A 3DV4B 5D5ME 3CCHB 3L3GA 1NCBL 1WIOA 2GY7B 5KVEL 4C55A 1KTLA 2DWDB 4TYUA 3TO4C 1QQDB 3VD4A 1XGYL 3ZKMC 2FX9H 3SJVE 3SO3C 2D2OA 1XGUA 2DYPA 3BKYL 4YNYA 3ORJA 1MI5D 3BGMA 2B0SL 2B4CC 3CLEL 3PUCA 2R2BB 3UPRB 5F3BB 3BUYB 1JV5A 3VDBA 3MACL 3UBXI 1U8PA 5MENE 5B8CA 3FQWB 3OKKB 3TN0B 3WFDL 3EOTL 3S4SB 3AS0A 1OAZL 4P4RB 4AMKL 4KU1A 5C08A 3DTXB 4PB0L 1J0IA 4IHOB 2FR4B 4YR6B 1KV3A 2PW1A 3P9MB 3P4NB 1OGAE 5FYKU 3FB6B 4FFVD 2EEBA 4ZS6C 5C0GB 1JWMA 1I7TB 4G6FD 2VR9A 3MNWB 3T4AB 4X4YA 2EH8H 2IEPA 2WUCH 3GMQB 1ZT4B 3CX2A 3EYQD 1Z9MA 2X4NB 5DD0L 1GOHA 3ARFB 3FKUS 5ITFA 3O0RL 1MRFH 4JY6A 1KNOA 3BP7A 3FQNB 2E9WA 3PQYE 3MRGB 3FT4A 1CFNB 4IRJA 3ZDZF 2JJTA 4CVXB 4U7KA 1J1XH 2Q8AH 4GMTL 1OAQH 4JG0L 1XMWA 2KBGA 1UT9A 2QLVB 3B43A 1RUAL 2NY1D 3IVKA 4WW2A 2YUXA 1RVFL 3BKML 4LDOB 3HI6L 5EFIA 3HCVA 4NO2A 4ODXA 4XP9H 1MVUB 3SOBL 2IANB 3G5XB 3ROLB 2ZKHH 5KANI 2DYPD 3S98A 1H3GA 3KDMA 5L2JB 4ODUB 3TVMD 3FT3B 3OGOE 1HHJA 4KAQL 4UQ3A 3O8XC 2NLJB 1KB5L 2NY3B 2Q20A 5DTFA 3T3PF 1XZ0A 2YWYA 1WTLA 4KKLC 3K74B 4P0DA 2X4SA 3AMLA 3RP1A 3BZ4A 2BFVL 1NMCC 1CU4L 4OFYA 2X4UB 5C8JA 5FA4B 5C08D 2DQTH 5E1AB 2NW3B 4J8RA 1U92A 4PTUB 3RVTC 3PF2A 3WLWD 4DJMA 3EJZD 1P4BH 1U0QA 4QRTA 1NDGB 1UJ3B 3V9FA 1INDH 2LVEA 3RWFA 5MEQA 4WEUD 1CGSL 3FO0H 3WHXA 1BQHG 1R3IH 5I16A 5JXEA 4P2QB 1TQCB 1E4XH 1OAKH 2F74A 1LNUB 1XGQA 3M1BB 3HNVH 4RX4A 4UTBH 3HC3L 1OQOA 4ZTOH 1RZKC 2ZZUT 2BVPA 2Q7NA 4IJ3B 1J12A 4JHWH 3CU7A 3Q5YA 1I4FA 4HKZA 2HJFB 5ESVB 4LVHC 3ARWA 1JL8A 5E1HB 1W0VA 4MA7L 1FAKT 3MCLH 2R0WH 3LKQA 1Z5LB 3RKPA 3CFEA 5FKAA 3DHJA 4X6DF 1AXIB 1KT2B 1TZGH 4M7ZC 1A6WL 3MRNB 1KELL 3MJ8B 4GW5A 4JREC 2O5XL 4OLYH 2NX5E 2GT9A 4F37K 1QLEH 4JFZL 5D1XA 1T7ZA 1U8JB 3SPVB 1UG9A 2ZG3A 3OJDA 4PV8B 4B50A 5AYUL 1WAAE 2BJMH 1HINH 1ZHNB 2P46B 1WFUA 1HK6A 3UC0H 4PB9L 4Z0BL 1UH2A 4L1HA 5CJOH 3HA0A 2P5WB 4E0RA 4G5ZH 1K4CB 1CQKA 3QUZC 1PX3A 4QXGH 5GRJH 3UZVB 1KEMH 1LO3H 2JK5B 2V9TA 5TE7H 4HJGA 1G7JA 3P77A 4FMFA 5SV4A 2VLRA 3SDAA 1RI8A 4PR5B 3O11B 4YXHH 3RY5A 1X9QA 5I0ZA 2FX9L 2MQCA 2BNQE 1NCDH 3KPMB 1XGPB 3H9SB 4X9FA 1QFUL 1RJLB 2AS5M 4YAQB 1Q72H 3GB7B 2WZPD 5ID0A 3JV4A 3WBDA 3NBNA 5B4MD 1MCFA 3FOMB 1ZSDA 4L5FH 4ZUSB 1DR9A 2D7NA 3UTSB 3WIIH 2BXYA 1G6RA 1U6AH 4FZ8H 4XNYL 5EA0H 3T09A 2H26B 1W8OA 4U1GB 3DSNA 1S5IH 3HB3D 3ZL4H 2AJXL 1RUQH 3N0PB 4GBXB 2JELL 3A67L 1QSEE 3K7UA 3RWCA 3W11C 4HUVB 4KTEL 3FRPG 2XXMB 4GRLB 4NQCA 5A1AA 1UXWB 4K3DL 4QRSA 1G0DA 5J6HB 3MRJA 2FO4A 3AREC 5DMKB 4XB8A 5LKNA 5DUPH 3MO1A 2LAGB 5IB2B 2EH8L 4F9LC 1ORQB 1EHNA 1HQRA 2RAMA 3FAXA 1RQ5A 3R06A 3IKCA 4NQXA 1CR9H 1MRFL 1LO5B 5IOPB 5EUOA 5ICZA 1T66C 1CD1B 2D31B 4MCYB 3BGFC 3GSQA 1J1XL 2Q8AL 1OAQL 2D0HA 3TBSB 3V8CA 1L7IL 5MERA 1QVOA 3HRZA 5E8EA 1OP3H 3TBVB 1P7QB 4FQLL 1AY1H 2DI8A 4MQ7A 4RAVB 2A6KB 4TVPE 4NQDA 5I75C 3WNKA 1IJ9A 3STZB 2PYFA 2VLRD 3SDAD 5C0DB 4IOFD 5DI8A 3IF1A 2VQUA 2BSRB 2Y06H 1KIPB 3GMOB 3O6ML 4TNVK 4ODVH 1QRNB 1VADA 3SQBA 2H6PA 2R1XA 3R8QA 4WWKC 3C2SA 1FZMB 1IAKB 2D0FA 2EDTA 5JW4N 4KHTH 4KMLB 5I1JH 2VZSA 4TVPL 3MREA 1VFAA 5SWSD 5EWIH 2BVQA 5A2LH 5HJ3B 2MJWA 1UC6A 3PWJA 1KPUB 3J8F7 1ZGLP 4NT6B 3HAEH 1T0PB 5BZWB 1FYTB 1F11A 5AWNL 3CFJA 3V4PH 4N9GB 5FOBA 2DQTL 3PDOA 4Z7UB 2X1QA 5DHVB 4U2ZA 3DX9A 1ZKAA 4M7LT 3OBAA 2F54E 2ITCA 4I13B 2ED9A 2ESVB 4ZUTB 1H15A 4KJQC 4YHNB 1CFBA 1INDL 1E4JA 5I1GH 2VDRH 1J5OL 1FGVL 3HKFA 2OJEB 1BVLA 3U0PB 4I18B 2XA3A 2XQBL 1S9VB 4PLKD 1YNTB 4EOWL 3FO1A 4QHNA 3SE3C 1MHCA 1BWMA 3TPUA 3IFPB 3U0TA 3S7GA 4LCCC 2QV2A 2GYSA 3HNVL 4UTBL 1QR1A 4P5KB 3IU4H 4XCFH 1K5NA 5IJVA 1OCWH 1VFBB 3ARUA 4MJIB 4ZOAA 4JHWL 1I1AB 2PYEA 3AAZB 3RI5F 1EHXA 1AQDA 2WM0A 1UZ6E 5HY9B 2BDNH 4Q9QL 4NQEB 4U1LA 4O2CB 2A74A 4UV7H 4XNQA 3EUUA 5DS8B 2R0WL 4NQDD 1MEXH 3U36A 4OUOA 3ZYZA 2APXA 3KPSD 3GHBH 4FQJH 5BRZA 5DDHB 4KY1H 1JWUB 1C12B 1DQJA 2GSIA 4KI1A 5I1CH 3BPOC 2V2WB 3MLRH 3TJHD 1NFDB 2X4RA 2BJML 2Y5TA 4H26A 4L1DA 2VDOL 3WO4C 3BRDA 1KN2H 4YWGL 5L2KA 1MHPL 3CDGA 4Q9CA 2V9QA 4BFIA 1D9KC 2HJLB 2R9HC 4Z7QF 3VXUE 4PJIE 3SDYH 3IB4A 4XZUA 3D5OF 3RWEA 1I3VA 5C0IA 1S7WB 1HILB 4OZFA 3V0VA 3MRBB 4NRXB 4A6YH 3UTZB 4QRPD 1UWEL 4YHZL 3OF6A 3TH2T 3CPLB 3BRGC 1S78D 2D7TH 4LBEA 1GH7A 2J6EL 4LSTL 3PG2A 2Q8BL 1Q72L 3FT2B 4MVBD 5CIPB 2ZWLT 4YDJB 2VL5B 1E6OH 4X8JB 4P5TC 3GIVA 4L5FL 3WJJA 1CFTB 4OUUB 1ZS8A 5C07D 2H2PC 2B2XH 5KW9H 1T1XA 3RKDD 3WD5H 2DI7A 1JGVL 1S5IL 1IBGL 5FK9B 1JNHB 5CUSL 2G75A 4L3CB 3QUXC 4JFHD 5IBLD 43C9A 4NOFA 4ZFGH 1WZKA 3UTTA 1D5ZA 1ZAGA 4OV6F 5K93A 3LH2H 3DRQB 1NGQH 1HEZB 2J5LB 1DSFH 2IF7A 7FABH 2HH0H 1R24B 4YGVA 5B3JF 4OBSA 1I1FB 1BAFL 1MRDH 3MRFA 5DUPL 2YPLB 5DRNA 5IBTH 5D7KD 4G8FA 2AK1H 3U9UB 1D5IH 2CO6B 5E8NB 3CH8A 2OL3B 5J1SC 3LPGA 1R3KB 1IMHC 3VWKA 3QR2A 4LKCA 4OT1H 3MRQA 4EI6B 3K8MA 2H9GB 4KRMB 3GSVA 4GAGH 3LDBB 1J8HE 1YEEH 4QOKB 3VJ6B 3I3DA 3RVUD 2DD8H 1A6TA 5TF1L 3L9RB 4R0LA 2XRAL 3KXFA 1JRHH 4NQVA 4UU9A 4YHPB 4I1NB 1PAMA 1KFAL 3DROB 2H3NB 3GSWA 1OQXA 5CZXD 2Y06L 1DVFA 5E5UB 1ZGLM 3W82A 3OAUH 1IGCH 3MMEB 3S4SG 5BS0B 3DVIA 1I1RA 1JYXA 2K9UA 3QRFM 3DUUB 2X7LA 5IQ9A 4WCYL 4WO4A 3ZDZE 4NQUA 3H9HA 4ZDHB 1FQ9C 3VFUB 5BXFB 2YD9A 3CSGA 4W4NA 1NL0L 4Z7UF 5IHLB 5IFHH 1Z0NA 5EWIL 3QUYC 1MNUL 3D25B 3QDJA 3X3FL 1AD0B 3WFEL 1MHEA 5FYKE 1QSFD 3QQ3B 4XVTH 2WINB 3E0GA 4IS6B 1T20B 3UTTD 2APVA 4PG9B 4E42B 2X1XR 2VLJE 3D85B 5TDNA 3GRWL 5HGDA 4NZTH 3DOSA 2DQJL 3A6CL 4KZEH 1EO7A 2FL5B 4LCWE 3HG1E 1F3DH 2VDRL 2PR4H 3T3PE 3GMLB 5CD3B 1EV2E 2Q86A 5FYJD 4K7PY 5FYKL 1KCKA 4C56B 3OJ2C 4MNHA 5C0CE 2R8SH 1LO4L 3I6GA 4H5SB 1P9MA 5CGMA 2AXHA 3IU4L 5CD5D 4FQIH 2VYRE 3HE6C 4Y4KB 3WIHH 4ENEC 2YA2A 3GO1L 3ZTNL 5JHDA 1ND0A 5J1AB 1RIVL 1NFDF 1G7HA 4ZPVB 3JTTA 4FTVA 4JM4L 3NCJL 1ZT7A 3WFHB 3E8UL 1VERA 2A6IA 3ARDA 3GHBL 2HT2C 4LPVA 1F00I 4WNQB 3EO1B 2HTLD 1DVFD 3NGBC 2LE9A 1BF8A 3CXHK 1GGCL 2BK8A 1OT2A 2X9WA 4OIBA 4JM2D 4R97B 2AV7A 4LHUD 1YMHB 5KS9B 4K2UH 5EU6B 1K8DB 3CUPB 3NCEB 4PRIA 5CJBA 4K7PH 3O3DB 5I30L 1T0NA 4LPWA 3GNML 5ALBH 3DI3B 4X7FC 1H3PH 5GGRY 1NCWL 3ZT6A 2LTQB 1S9KC 1A9EB 1KXTB 3C60A 3H9YA 3QDJD 3VW3L 4X6DE 3UTPE 4KFZC 3E3QC 1QNZL 3BT2H 1KF9B 2HJKA 2E5EA 4M43H 4PJDE 2BVOB 1I7UA 2X70A 4RWYH 3WE6A 1NCAH 1MIML 1HZHL 5K33A 4KPHH 4Z7NF 4WI8A 3MRKB 2LAAA 4S1DD 4P23C 2NXYC 1E6OL 3ARZA 3F5WB 1KTRL 4PRHD 2A38A 3NIFE 4QTHA 4HXAL 5KSBB 1FN4A 3WD5L 2CDFA 3BIKA 4JO3L 2AK4A 3RUGE 1LEKB 2ILLA 1Q0XH 1CFSA 1YA5A 2QJDA 4S1QH 3ULUE 5CSGA 3L3IB 1R0AH 1NGQL 3SY0A 1BOYA 4OD1L 4NO5B 5C0ND 1DSFL 4KUCD 2QADB 2XNAB 3QO1B 4X98A 1MRDL 2VITA 5LVEA 4OLWH 2EDEA 3WHE0 2HFFB 2BOBA 2VUYA 1FV1B 3PHOA 2ZP0T 4U3XA 2R0LH 4TUJA 4M5YH 3RHWK 1JZ6A 5E4IA 4HX1B 3WMSA 1KEGH 3RIAF 1CGTA 4JRYE 5J8OA 4O2EB 3MRPA 4DOHB 4PRID 3U7YH 1IC5L 1JPST 1MAKA 3EJYD 4N90E 4Q6IC 1HSAA 2O5YL 2RR3A 1OM3H 1HYSC 2R4RH 1JRHL 3B6SB 3B8SA 1KCSL 5I18L 3LN9A 4L8SA 2ZOLA 4I0CC 1SBSH 4PLOB 5D2NC 1M05A 4P57B 4LLQA 2IAMB 4CKVX 4GFTB 2IPKA 4KDTC 1N4XL 4S0TD 3QNYB 1DN0B 4AM0B 4MS8C 5D9SB 4XH2B 1S7VA 3OJVC 4Y5YB 4OGAC 4GAYB 4OLXH 3D39A 5IB4A 4D9RE 5HYSA 4RFEB 1IGIH 4OLUH 3HE7B 1M6OB 4M5ZH 5JW4Q 4BZ2L 3DHMA 2IANE 4DEPC 1ES0A 4BM7A 3NCCB 4OM1H 4S10A 5K59E 1H9VA 1QFWL 2XKUA 3RGVD 1LD9A 3QHZH 1YPZE 2C7UA 3CK0L 3S34H 2YS4A 2DLHA 3QFJD 1T83A 4F2MB 1AGEB 1FGNH 1CDHA 4GG6B 2DICA 5CEZD 3KPSB 3AB0C 1AXSA 4KZEL 2CMRH 3RZCC 3ILQD 4XP1L 4FNLH 5AD0A 1KLGB 3RY6A 4HIJB 3HS0A 2EE9A 4GAJH 4JG1H 1QBAA 1DQTA 1Q9OA 4M6MH 4HH8A 1H5BC 2D03L 5C0AA 1KLUA 5H2BB 3FB8A 1RHHB 2Y7QB 4RWHA 5I1EL 3QI9D 5EOTB 4P4KA 1I85C 1W0YT 2VISB 5E9DB 2PW2B 2P48B 2JB6B 35C8H 1A6ZA 5D1ZC 3E6HA 3CGTA 1F6FB 5KS9F 1HIML 1NAKL 1UB6A 2FEDC 3FOLB 4M3JA 5EZLA 1WFOA 3T0EB 1OTUD 4HT1L 5FO9B 3BDYL 4LLMB 3DPBA 2EYRB 1MPAL 1IFHH 2R39A 3IDNA 2DQGL 1F90L 4LCYB 1BLNB 5I9QC 1F6LL 4R2GD 3D39D 1A6AB 5DFTA 3T65B 3V0WH 1EGJH 1MJ7L 1H3PL 3UJIH 3BI9X 1YC8A 2EO9A 2HRPL 4KJYA 1UM6L 1JTOA 1XF2A 3MV11 3TT1L 2P45B 4HK3N 5LWYH 4NC1C 2XT1B 4L3EA 3IFNH 3S35H 3QQ9D 4AL8H 4P3CL 4KJPC 2XWTB 3VWJD 3BT2L 1G9NH 4KKAC 4M43L 3EYVB 1J11A 4X6FA 2OJZL 1QO3B 2P5WE 4RSVA 1JHLL 4RWYL 4E41B 1CICD 4U6YA 1Q94B 3QCVH 5KSBF 3AU1A 1VEOA 1W0WA 2WBJC 2D3VA 5EUKA 1MREL 4PJ8B 3L3OA 4YHOH 5FKPA 2XACC 3FN0L 1LEGB 1EEYB 3U1SH 4NRZA 4OZHB 4G7VH 5HTSA 2O61A 1XCQA 3QIBB 3OKMA 3ULVD 4I3SH 4R90H 3T0WA 5FHAH 1MSPA 4JO2H 3H9SE 3AS2A 4V2BA 3H7LA 4LAQH 4CMMA 3MGTB 5DGQA 4B53A 3KPRA 3MZTA 5E08H 1R0AL 1DJSA 1CE1L 3IS0X 3W0WA 2EZ0D 4KZDH 4DKDC 3LZFH 2EDQA 3GSXA 4EN3D 1RK0A 3VI4E 4R7NB 1XGTA 4XXCC 3BYTA 4MD5B 4OLWL 2DM7A 3B3IA 4LRIC 2FRGP 2MPAH 3TA3A 3EBAA 2EXWD 5CIPH 1M7DB 1K8IB 4Z76B 2B1HL 4G8EA 4FS0A 2Z35A 4NC2B 4PJAB 5KSVA 4Y19B 4PJ7A 1KEGL 2G5RA 2WSKA 2PUQT 2DIBA 4G7YH 4NHCL 5DJXA 2ADGA 3IXAB 4PLJC 2ZPKL 1U8OB 5BZDB 4G8GB 4XPTH 4OKVB 4NYLB 1X5LA 3TNNA 5JOEA 4K71B 1UJ3C 1H3XA 2Z91B 1OM3L 1J10A 1OPGH 1B4RA 2B1AL 5B3JE 1QSFB 4L3ED 1ZOXA 5K9KB 4J4PC 2CKBB 4R4BA 5DD1L 1DDHB 4F15B 1X5YA 4G80B 1UA6H 2VTFA 1N5AA 1QACA 4HDIB 4M6OL 3MLPA 3VFSA 1U8MA 4XCNA 3RWJA 1A2YA 5H37H 4PJ5A 4TNWK 4ZAKD 4EKXA 4S1RL 2OL3H 5JOFA 1KLFA 1NMBH 2FX7H 5J06A 2X09A 4KRPD 4WEBH 1NBYB 4QHKJ 2E7LC 5JQHC 4XWOC 4GG6F 4JO4H 3VCLA 4LLWB 4WJ5B 4JFXA 3RQ3A 1KCUH 2V2XA 4HMDA 5D6CA 5T1DH 4CMHC 3H0TB 3T1FB 3QJFB 3EHBC 4F57H 3KPRD 1PG7H 3QIWA 4PJ9B 4YBLB 5DJ8B 4NPYA 5ICYB 4Y5XB 1RSFA 3C5SA 1DANT 4HC1L 1T2QH 2GHWB 4G6JH 3TA3D 1I1CA 4G6AC 1N64H 3U7WL 2IBGA 2NY0D 4JM2B 3VXMA 1R3LA 3AM8A 4LK4A 1X7QA 4DN4H 3F6LA 3FHAA 4XAKE 3DXAA 3VFVB 3DUSB 1YEJL 2BC4A 5E6YA 4WU5A 3ARBB 3BHBA 5J11B 2FEEL 2ITDB 4QYOB 3KHQA 3F12A 1S5HA 5E00A 2ZOKB 1URLA 3FTGB 5IMMB 2DQUH 1GXEA 1SYSA 1DQQB 3SKOB 1WC7A 1MH5B 1JPTL 2KL6A 5CJ8A 5F89B 5MI0B 1T7WA 4RA0C 3QUMB 3JUZA 2CLZA 4NM8H 3O2VH 1ORSA 3K8LA 4OD3H 4GXUM 5CSBA 5TDOA 3FO9A 4NQEE 1MFEH 1RMFL 5EIIB 4HKXA 4JKLA 4XVSH 4AT6B 4PJ5D 2ZSWA 1HH9B 5D7LA 5T5FL 3MRRA 4ONOA 2OYPA 4UTAL 3IDMA 5DJCB 1FBIL 5IBUB 4NNXB 2YPKB 4Z18A 5IM7B 3S3JA 5LWYL 5J6GA 5FB8A 2NR6C 2LV4A 4AL8L 3MJ7B 1PJ9A 2UVEA 3K81A 4O5LH 1G9NL 4HPYL 4OZHF 3TZVA 1ADQA 3VMOA 5DHYB 5HHOA 4MXWH 4NSKB 1N6QH 3T2OA 3RWIB 3QCVL 2XZAL 1YYLL 2FJGA 3TBWB 4FZEL 2DLEA 3WUWA 3I6LD 5DMIL 3DX7B 4XPGL 4PYGA 2EXYD 4ZFOB 4MXVF 4G7VL 1FFPA 5CHNA 1YJDC 3B9KA 3K3QA 4QCIB 5FHAL 3VXMD 1FZJB 4JO2L 1HN1A 3SCMC 1HSBB 1F45A 2VC2L 2I25N 2P8MA 3HC0A 3O9WB 4AZ8A 3RPIB 2ZSVB 2COQA 2I9TA 3QDGE 1LE9A 2B8OT 4K3JH 3U0WL 3O3EA 3KLSA 1YMMA 4MQSB 4KXZH 5E08L 1MHHB 3SE4C 3X14A 5IKCA 5JIIA 1XR8B 4ZQKB 3KPQA 5HYFA 4NWUH 2MCPL 3SBWC 1ZHLB 2MSPA 3D3VD 4PJAF 3T2QA 4UNTA 4G42A 3AY4C 3QB7C 32C2B 1NGYB 2VNCA 1HNGA 1SY6H 3E6FA 2V7HB 4N0UB 3ARSA 1KBGH 4R3SB 3VGAC 1R5IB 3F7PC 5EB9A 3V6BR 5CEYA 2APBA 5JMRA 3NACH 1TJGL 1IGFL 4XPTL 1U8NB 2VE6A 3B2VH 2YPLE 1RZKL 5EBWB 2FD6H 4PD4K 4R8WL 2FO1A 3I6KB 4MNGB 3OKNB 1YYMH 5IVXA 1U91A 2E9IA 5MEPA 1VDGA 3KPLA 3LEXB 2PXYA 5EU3A 4NGHH 2DQEH 2GY5A 1T03L 3FO2A 5L6YL 4Y4FC 3QFJB 1WF5A 1MQKL 4WV1A 2IWGA 2MQ0A 3S36X 3TZVD 1FFOB 3BOVA 2WV3A 4EIGB 4JJHA 1UA6L 4JQIH 4QOKE 4OF7A 4EDXB 2MQ3A 5I74C 4F7TA 1ZMYA 2YPVH 3AMKA 5ENWA 2OL3L 5AZ2L 5EU4B 5FV1L 1NGZB 4LP4A 1NMBL 4GXVL 3GHEH 1B0GA 4WVRA 4WEBL 4UINH 2Z8RA 4L4TA 3ES6B 4OZGA 3GSRB 4BA8A 1V3MA 1YEDA 5E6IA 1G6RH 2CXGA 1T1YA 4M6AA 1MLBB 2PO6A 2W0PA 3NFPB 2MNUA 1P84J 2DRUA 4L9LC 2XQYG 2F53E 2VDML 1YMMD 4X0KB 3IDXL 5LGKA 4F57L 1NLDH 1UM4L 1S8DA 3F58L 3Q6GL 5TJWK 5AZEH 2X9XA 4UQ2B 4JM2F 4M6NL 2NY5L 4L8CB 4AQOA 2I07A 2AJUH 1T2QL 5EU7E 1KENH 2W0FA 3I50H 2I9LB 3IETB 4W6WB 5DK0A 1OB1B 3IAQA 5TDPB 1DLHB 4UZGA 1NH6A 4R2GB 4FXGA 5C2UB 2CUIA 3UPCA 5CMAB 5TQ2L 5GGTA 5T1KA 4PTTA 3JWOL 5EOCJ 3MBXL 1P4LB 2RB8A 1ZHBB 3H8NA 3VXRA 2EDLA 5DLML 3O3AA 5D71L 1MIEL 3M8OL 4C56E 1LHZA 5EU5B 2PXYD 2VXVH 3EYQC 2Y72A 3VWJB 1BP3B 3ARQA 4JFEE 2ZUWA 3VE0B 3ZDXE 5FYLD 1P5VA 4PRAB 4NM8L 4ELMB 1FC1A 25C8L 2JB5H 5HYJA 4RA3A 5E8PB 5LAXB 3D0VB 4WY7L 4MD4A 3CLFH 1I8KA 2HVJA 4Z7VB 3RIFF 3T2NH 2FSEB 4XCCH 4ZO9A 4WUUB 4QXTA 1IAII 2NY1C 1IGTB 1FSKC 1IQDA 1H3VA 1RZIB 5GS0D 1A1NA 1A5FH 3ZKND 1BZ7A 1GGIH 2YD6A 4RFNB 5BV7B 4RMWA 1LK2B 3T4YA 2X4PB 1NUNB 4F8QA 1O0VA 1CDBA 2PO6D 1VGKB 2Q6WB 4PJFB 5KS9E 1AC0A 5EU6E 3STBA 5ISZB 3FONA 1R5VA 4XGZB 3QPXL 4Y1AE 4ORGB 1NUGA 4I77H 3TVMC 2X44D 4AIZB 3MUGA 1IT9H 2HKFL 4EN3B 4YGAB 5T1MB 4MA3A 1BHGA 4I9WD 4GKNA 4XP6L 5F9JB 5L88H 3PABA 5HHMD 4AENB 1FP5A 2CUMA 1YEFH 1AKJB 1CTOA 5KSUB 2FBJL 4XTRD 2Y6SD 3MYJB 3BXNA 3H3KA 1QKZL 4LRNL 3LEYH 4FQ1H 1NQBA 1QHPA 2CDEB 5F72S 3TV3H 43CAB 4XNXH 1FPTH 3HI5L 1GAFH 3ALPA 3EJZC 5GIRB 3WIFB 3O6FD 4K9EH 2PTTA 4JLRB 5JW5A 3TFKD 4MJ5B 2ZCKH 5JXAL 1LE5B 5F7EH 1NC2B 2YSSA 4DN3H 3NZHH 4LSQL 5GS1B 5I66B 1UB5A 1DBBH 3KR3L 3VXSD 4ZSOE 2ICEA 1X5ZA 4OCSH 2JCCB 3QG7L 3HN3A 4IRJC 2JJTC 2P49B 3K2UL 1QHOA 3VG9C 5T3ZD 3M45A 3OGCA 4OI9A 1JF1A 5A16A 4MGXA 3QYCA 1YEKH 1RZJH 3TNMB 3EW3B 3NACL 4ONHB 3X11A 4BQCA 5BQ7A 4WW2C 2X6MA 1XCTA 5LBSH 3B2VL 2FD6L 3D2UB 5DJ6B 3IXTB 3SDDB 5DVNA 3GJFB 1RJZB 5IF0B 5DD6A 4LGPB 3TYGL 1FLRH 3H42H 4NGHL 2DQEL 3RWDB 2DTML 3C5ZB 3ARVA 3VFTB 2FGZA 4DK6A 4APQD 1FO0A 4U1HA 4MCZA 3BH9B 4JQIL 2CGRL 4AH2B 4PV9A 2Y36H 1A4KA 4N8VB 2JTDA 3D69B 3LN5B 2YPVL 3CH1B 5T33H 3WN5A 5MEOB 4U1NB 2WMPA 4YBQD 4UINL 2NY0B 5HPMA 1KCRL 1SJHA 2FJHA 4QRUA 3HLAA 2W65A 1BVKA 3MR9A 3S3PA 4BKLB 4KWUA 4EUPG 3D0LA 4PJGE 5ABDE 4KVCH 4PRPE 5DQ9B 4PY7B 4I4WA 3H7BA 4WFHE 3LHPH 3TCLB 1NLDL 1OGTA 5J56B 5B4MC 3KVQA 1KOAA 1IC4L 5JXEC 5CILH 1RPQA 5E2UH 1AGBA 2XG5A 4JVUA 4OQTL 4XBGB 4ESKA 4F7PB 1F4WL 3HB3C 3L3JB 3RBSA 3EYUH 1I9EA 4ONFL 5FYJH 2J88H 4GG6E 4EI5A 1D6VL 5D96B 3MBEA 4PY8J 2AW2A 2VXTH 1QEWB 3SDXA 4FRWA 1X6NA 1N7ML 2VQ1A 5FIEA 4G3YL 1RD6A 1IQWH 3IU3A 3LN4B 2BCKA 4HS3B 5IW1B 4ELMF 3VGBA 2IQAA 5D7JB 1D5BB 4H8WL 5IB5A 4JGMA 2VAAB 2O5ZL 2VXVL 4Z7VF 1OLZA 3EYFB 4NZRH 4XNUL 2FX8L 1U8HB 3OKEB 1QTYT 4X7DC 3S5LA 1WZ1H 2CXKA 3FMGL 3OB0H 3TT3L 1A1OA 1TJHL 1BOGA 1FHGA 5E9DE 4XB7A 2ENYA 1DUYB 1YNLH 3STLB 1FL5A 4X5LA 1C08A 2QHRL 3CLFL 2DM3A 5JPNA 3T2NL 4XCCL 4QGYA 4PJFF 1IC1A 3ZTJG 1HDMA 1RZ7H 4PJEE 3ZHKA 1AC6A 1VCAA 2H45A 2YKLH 1DBMH 3VFWA 1S7UB 3SDAC 1KGCE 2CPCA 4IOFC 3LSOB 5L0QC 3ILPA 3X3GH 4YLQT 1S9YA 1Y0LA 1N59B 3KYNB 3BKJH 2CLRB 4LSPL 3FRUA 4LLYA 3IJYA 3JWDH 2JE8A 4OD2B 5GRXG 5IEKA 5TPWL 1A0QL 2WAHA 1RJCA 2E9BA 3ZDYF 4LVEA 4DK3A 3UMTA 2ICWI 1AO7D 1LK3H 5IVZB 5L88L 3RTQB 4AEEA 4YZFF 1HQ4B 3WV0A 5HDLA 3QNXB 4BQ8A 4UV4H 2R69H 2IG2H 1E4KC 3QP3A 1AQKL 4P2YA 1ZHKA 1PGRB 4PGCA 2W07A 4HV8B 4DZ8B 1S9XB 5HD8D 2JCCF 4JN2A 4JFYB 3QCUL 4K9EL 4OZHE 4KVNH 1ZLSL 3X12A 1K2DA 3IDGB 5CZVH 2AABH 3F62A 3HZMA 4BUHA 4DN3L 4PLKC 5EN2B 1NEZA 4BK4A 5GQBA 3AS1A 3PGCB 3TIDB 5A3ID 4MLIA 4F8TA 5IJKA 3G6JA 5JDSA 3KJ4B 4I3GA 2P5ED 5BVPL 4OZIA 3VFPB 4M48L 4FABH 2HTKD 4TVSa 5F9AC 4NBYB 1WQVT 2YEZB 1W8NA 4U6VH 4FQXA 4N9OB 2IC2A 2L7JA 1YN7B 4V1DD 1JMZA 1N8ZA 3C5JB 3K1DA 3D18A 2Z31A 3DNKA 2XPGA 1G7LB 1TCRA 2GJ6B 1LDSA 4M4PA 1XGUB 1E28A 1AHWB 1I9JH 3TJHC 4QRQA 5B39G 4J3SA 5EORH 2R56H 2APTA 1CIUA 4G8GE 1E4XI 4HUKB 4D0CB 3BX7C 1KJ2L 1T04A 3KHOA 4YEEA 2D7PA 1HXYA 4RGOH 5F6IB 3HPLB 4MNQD 1KPVB 2Y36L 2P24A 4HCRL 5IR1B 1VACA 3E3QE 3KWWA 5EBMA 5B8CB 3WYRA 4OAWB 1OP5H 3L6FA 1FNGB 5E4EC 2Y1VA 3ABZA 2NY2D 1V7ML 4Y4HA 1QBMH 3CX5K 4LSRH 3IDYC 4ZUVA 4CDHA 1S78C 1WGOA 1ZWIA 4I48B 1ED3B 5DURB 2F5BL 1WBZB 3LHPL 2CR3A 1Z3GL 2VH5H 5FUOL 4MVBC 3LS5H 3BJLA 3MV9D 1ZA3B 3CVHL 2YD2A 2CKBL 1W72B 3MLWL 4EDWH 3V2AR 4PP2A 5CEZH 1JK8A 4ZG1A 1U41A 4YDKH 3KPPA 3RKDC 1RUMH 2Q76A 4TUKL 1L6ZA 4DGVH 1NBVL 1T7XA 3QRGL 4LSDA 2J88L 3QULA 5IBLC 3ARXA 3NFNA 4X9BA 1BFOB 1B0RA 4FQXD 1TZHA 4XHQA 5F71A 4WFGD 5I1DA 3RWGB 3QZWB 1IQWL 4ODXB 3MNZB 3V52H 4JR9L 1DUZA 3N9GL 4HW6A 2R4SL 2FLBT 5MENA 4NZRL 1T22A 3CXHJ 4JO1H 5FM5O 1UWGL 3WXVL 1RZJC 3S88L 4X6CA 3N85H 2P7TB 3F7VB 4Z9KB 5HHMB 3BZ4B 1PX4A 2OXHA 5D2NE 1BEYL 3RVUC 1RUPH 5I8EA 3TC9A 2F5AH 4LKXB 2WIMA 1IL1A 3EDFA 4PS4H 4FQCH 4Y4HD 5HHNA 3SGJC 1IC7H 2W0LA 1T1ZA 3PL6A 3CJJA 3OAYK 3X3GL 5CZXC 3P0YH 4PJBE 4QRTB 1TVBB 1OAYH 5D2LE 3O6FB 4U0RC 1LQSR 3BKJL 1HNFA 5DZLA 4ZPTA 5MEQB 4PJXB 2NZ9D 1DL7H 3DRTB 3KYMA 1DQML 5DUBA 3QUML 5I16B 3TWCH 3WJJC 3ROOB 3CZFA 4M93B 1A9BA 1LK3L 2DIAA 2YZ1A 1WEJH 5MP6H 1MAJA 5TE6H 5C2BL 1MCRA 3RDTD 3U4BL 4DQOL 2ADFL 3KNBA 4HMCA 5TGBA 2IG2L 4U1SB 4OZ4B 2E9JA 3SJVD 5D1QB 1V3LA 4OB5H 1BD2B 4U0QB 4L4VA 4GW5B 5KJRH 3GMMA 2AABL 5GRYA 5D1XB 3VXTA 4BZ1L 4PREB 4RZCA 2IBZX 2VN7A 1FRGL 4K8RL 4O51B 5MEND 1T21B 1HKFA 2BNRA 3LKSB 5ACLA 2DWEA 2VIRA 5FEBA 1CT8A 2XN9A 4OCYH 5CD5C 4NFBA 1FG2A 5E2WL 1JHKH 2GFBB 4ZFOL 5JHLH 4NZUH 4GOSA 5LCVL 4P9HH 4JRXB 4NHUA 3IDUA 4R0LC 3P77B 3W9DA 2XY1A 4CJ0A 4XAWH 1J1OH 1FC2D 4EJ1C 2RGSA 1EA9C 3O4LA 4KHXL 4JFDA 4R26H 4HWBL 2KQNA 3PL6D 4N0UE 3U9PL 1DVFC 4EVNB 3PQYD 5F96H 5EC1B 3JBG7 3PXHA 4UIKH 1ZA6A 3CSYA 4WO4C 2QSTA 3P4OA 5CEXA 4DTGH 5L8LB 2C4FU 4P9MH 2BZDA 3MUZ1 1FH5H 3EFDH 4MX7A 1A7NH 4HSQA 1CWVA 4K55A 4IOSD 2P42B 3WEXA 1YUHA 4LLDB 2CRYA 4NKMB 5EBGA 5DYOB 4LLUA 1TITA 3OJMB 3CFCH 4MAYD 1JPGA 1A4JA 1QD0A 4KRLB 3QHFH 4LNRA 3GJFH 4HQQH 1BIIA 1S7RB 3LQZA 3EDJA 5SV3A 2DM2A 1V7NH 4Y5VA 4O58H 1E4WH 4H0GA 5DRWB 4S1DC 2FJFA 5ILTH 1UKSA 4KMTH 2NTFA 5DJ2B 1IGJB 4LIQH 1H3UA 4DZBA 5I1LA 4NQXB 5JTWA 2BNRD 5JUEH 3IGAA 5F1KC 1BVZA 2VDLH 2Z92B 1RUML 3MJ9L 1P9MC 3MA9L 2XN9D 4XCYA 3QDME 5I71B 4GKSB 4JRWA 3NPZB 1QVOB 5E8EB 3L5WA 3EZJB 3SEPA 2HFEB 1JTPA 3LD8B 3CFDA 3EGSB 2CLVA 2VDKH 5SX5H 4AEIL 4ZUUA 3MOAL 5C0NC 1XF5A 2PYFB 1RAMA 4RIRA 4WDIA 4N8VG 4BFGA 4UT6H 4LCCA 1X6LA 3O4LD 1HHIA 1S7TB 2IALA 4CADA 1XIWB 5K9OA 1GC1C 1P7HL 4RRPG 1KXVC 3FFCB 5D7IA 5J13B 4LSVH 5FM4A 2H6PB 4N5ED 1CZ8H 1Q9LB 2R0ZL 3U7AA 2AJ3A 2EYSA 3ARGA 3EO0A 3MREB 4ODHL 5IV2A 3G04A 3QISA 1C5BH 3TH3T 5GISH 1AO7B 3EJYC 4IRSA 4TQEH 3GGWA 4DW2L 1JF5A 3U46B 5C0FB 1RUPL 1U8QB 5KOMC 3PWJB 2VRAA 3P4MB 2ICWA 3PWNA 3BZEA 3CFJB 4PJXF 1VFOA 5FOBB 2NX5D 2ICES 4FQCL 3PDOB 2E8YA 4QHUA 5ANME 1I8IA 2H1PH 2GAZA 3KPOA 5GSRA 1OTTD 1NCCH 1FVCA 1FZKA 4Z7VE 1H15B 3UO1H 4NN5C 3TBTB 4FXLA 4D8PA 5BVJB 3I75A 3PWUB 3EAKA 4PJCB 8FABA 1MCPH 4HEME 3U6RA 2YN3A 2JIXA 1OOAA 3FO1B 4QHNB 1MHCB 3BD5A 5C6TH 4JPWH 5DWUH 5DEGA 3QEUB 4F37F 3U0TB 3OXRB 1JGUH 1J8KA 2HWZH 1WEJL 5MP6L 2BHZA 4KROD 5ISZE 2P5EB 2PYEB 1JRHI 3QWOB 3HFMH 1ZE3C 4RGND 3RGVC 4P46D 4U1LB 2A74B 2BNQD 4CL7A 2DJ4A 2J8UE 1QBBA 3LKOA 4MSWA 4RNRB 4CN6A 4JN1H 5BV7L 4NDMA 1N2RB 3KLAA 5J9PA 3VFNA 3RAJH 3LS4H 1ACZA 4TRPH 3MV8A 2CDGA 3ILQC 1DQJB 3BW9A 2ZCLH 3MXVH 2ZNXA 4XBPB 2OQJA 4RQQA 4FFZH 1MJ8L 1A7OL 3MROB 3BO8A 4KK9C 2X4RB 4CRPA 1EFXD 4H26B 4Q9RL 4YPGA 3OKDA 1PKOA 1QSED 3RU8L 3H9ZA 4YZFE 3S96A 3MFFB 4MNQB 2VO5A 4Q2ZA 1UYWL 1JHKL 3QI9C 3D9AH 4IRSD 5C09A 4ZMAT 4HBCL 1DLFL 3UBXB 2NPLX 3ARPA 4MJ2A 1C16A 5GHWH 1SVZA 3BQUA 3GSNB 5IB3B 2Y07L 3BGAA 4OZFB 2JCCE 1J0YA 1D5XB 1DZBA 5FCUH 4C58B 1HI6B 4R26L 3VH8G 1YECH 4CW1A 1RJYB 2HLFD 1KG0B 3TP4A 3JV5A 5T3XE 2JJUA 5B38A 4UIKL 5DT1H 1EHLL 3GM0A 4DVBB 2ERJC 1J0KA 5CJQL 1ZS8B 2EKSA 2XWJB 3THML 3SE8L 2FH6A 4UI2A 1U93A 1FH5L 3EFDL 4TVPD 5IMKB 4BFEA 4TOYH 5HHXH 4ZTPH 1U8KB 3QEHA 4Z77A 5I73C 4PRBB 2I26N 1AP2A 5T3XL 3KYKL 3QQ9C 4UILL 4QHMA 1D5ZB 1AFVH 1RZGB 4XMKH 5DK2A 1T83C 3QUKA 3QHFL 1CICC 4HQQL 2HMID 4KJWD 1C5CL 5E2VH 1FDLL 5JW3L 2R23A 1T4KB 3MRFB 1V7NL 4K7FB 1JP5A 3MV8D 4XC3H 3F7YB 4G8FB 2EH7H 2J6EA 3CZJA 5EZJA 5ILTL 5IGXH 3RY6C 5HVHC 3U83A 2A73A 9CGTA 3ULVC 3VWKB 4DGIL 4I3RH 4LKCB 4WU7B 2P8PA 4LDEB 3MRQB 2VDLL 4YFDB 2KKQA 4TNVF 1V5JA 1F02I 2QKIA 3DETC 5H37G 4P59L 1YJDL 3VFRB 3IFOA 5E99H 1K4DA 2F54D 4QTIH 1A6TB 3KXFB 1UENA 3BQUD 3IJSA 2BMKB 2EZ0C 1F4XH 3WKMH 2FIKB 1F4AA 4ZNEE 1HXMA 5FECA 1F13A 3GSWB 2OTWB 2XYCA 4GW1B 2CRMA 5DUMH 2BRRH 1JWSA 4N0YH 2DB8A 1KC5H 1UM5H 3PWPB 4MB5A 3QPQD 4JDVB 2EXWC 5HHPA 3FQUA 2W9EL 4G9FB 4P9HC 2D4FA 1CZ8L 2GUOB 2X7LB 4YHLH 3X17A 1W72H 3OKOA 5IQ9B 4HH9B 5ETUA 3RVVC 4LVOB 4YDVA 2ADJB 4NUGH 4LVNB 2VKXA 5GISL 5D5MB 5KZCD 3VFOA 1Y6NR 2OP4H 4Y2DA 4J1UA 5F1SA 4NKQB 1AE6L 1S7SB 4IMKA 3RDTB 3QQ4B 4HWNA 4UT9L 3MV7A 4RBPH 1MHEB 3W9EA 3ALXA 1SQ2N 4PJCF 1JHTA 3OHXA 4NNYB 3PGDA 4LU5H 5GS0H 1UACL 4HHAA 5F6HI 1IEBA 5GGSB 5FM5M 3DUHA 1NCCL 1OP3K 2X4TB 1AGDA 5DHXB 3GMPA 3PWVA 4ZAKC 2H8PA 2Q86B 3VXUD 3MRDA 2H32B 4KRPC 4MNHB 5DWUL 5F1NA 5F7KC 3DECA 5IW6A 4NCDA 1JGUL 1U95A 1D5MB 1BGXL 2G9HA 3PWLB 4MD0A 5IT2H 1NCTA 5DJZB 1DQLH 4TTDD 3GMNB 5JHDB 1ND0B 3HAEA 1NGXB 1OGAB 3TO2A 3L95B 4FTVB 4LCUA 3QEQA 3ARDB 3O2WL 4NNPL 1VA9A 4K23H 4PGBA 1D7FA 5IVNA 5ICXB 1OSZA 3MXVL 4DKFL 4X6EA 4FFZL 3TA3C 3PQYB 4XC1H 3JV6B 4J23A 1HH6A 3NAAL 1DFBH 3TIEA 3ULSB 4ORZC 3D1MC 1I3GH 3UDWA 5A40E 4JCMA 5JIPA 3DX8A 3LMJH 1MFBL 2BSTA 3UCRA 1MFAH 4DUWA 4PD4J 1S9WB 5IIEB 1KCVH 2AQ2A 3C60B 4I5BA 5T3ZH 3DURB 3N50A 3OXSA 2F8VA 1RIHL 2OZ4L 1SYVA 3HR5B 4Z8FH 1IAOA 5F1OB 2D4DA 4HZLA 1E27A 1EBAA 5FYJU 1I7UB 3TBYB 1Q9WA 2XTJB 5FDWB 3JTSA 4HXBH 3VD7A 1N3NA 5CKAA 1GGBL 4MYWB 4ZXBA 3PP3H 1VKXA 1F4YH 3GSUB 5EO0B 4X9HA 1UCTA 3Q3GA 1UJTA 2AJZA 2AXGA 4KV5F 2NY6B 2IADA 3RY4A 2D7MA 1BFSA 2GJ6E 3O45B 1N5YH 2J4WH 2FEEI 1J05B 2Y9RT 3IYLW 2ATKB 3MLZL 2CDFB 4KDTA 4JE4B 4PRDA 2AK4B 4LARL 1A14L 4W4OA 4YUEH 1LEIB 4YIQA 1MY5A 4WGWB 3OX8B 4JFPA 1DBKH 3MRIB 2HT3D 2SEBA 1AJ7H 2IFGA 1JGEB 1AFVL 2J3SA 5E8DL 4HUXB 1JGDB 5F3HA 3V6ZA 2JJVA 3RZWA 1RUKL 3HRPA 3SDCB 3V5DA 4KK5D 1QFOA 4H0HB 5HYIA 4X98B 4D2NA 5E2VL 2BOBB 1EAPA 1GZQB 1MVFA 1SJEB 5C08E 1YEGL 4JKMA 3PHOB 4UDUB 2EXYC 4TUJB 1EH9A 4A2LA 2KDGA 1RZ8A 1AGFB 1CQYA 1F3JB 2RFXB 1L7TL 1WK0A 3FQTA 1IGYA 3C87A 1UVQB 5CP3H 5FYKD 3NZ8B 1F5WA 1RZFH 2A77H 4Y89A 1HHGB 2I60H 3O6LH 1HSAB 4XMPH 4D94A 3DV4A 2L4OA 1F4XL 2NX5B 4LCWD 3HG1D 1IEAA 2LU4A 3IRZA 4L8SB 2DWDA 1HCFX 1AXTH 3K4DA 1AR2A 3SKNB 1QQDA 1IAIM 1IM9B 1KIQB 4UAOC 5C0CD 1KC5L 5D5MF 1U3ZA 4X7CC 5J12C 2A83B 4LEXH 2YR3A 1YEIL 1H8SA 3BPLC 5HYSB 2NY7H 2R2BA 1FO0H 3UPRA 5F3BA 3BUYA 1NC4D 3N1MC 5D1ZA 5JO5A 3BRFA 3S37H 2OP4L 5F7WC 4J6RH 2ZCHL 5IESL 4D0DB 4XBEH 4CN4A 3TN0A 2EDXA 5I8OH 1HWGB 3JUYA 2C7UB 4P4RA 1NAMB 2IH3B 4XWGH 3DTXA 4LAJH 4OIIH 2CO7B 1CF8H 1P5UA 3TZVC 1KTKE 4GS7C 1UCBL 2EC9U 2FR4A 4YR6A 3DV6B 3AROA 1CLYH 2PNDA 3HPJB 4OLZL 1AXSB 1W2KT 3P9MA 2E6JA 5C0GA 3BPNC 1I7TA 4DAGH 3T8XB 4Z7WA 3MNWA 1DBAH 2VSCA 2WIIA 3GMQA 3MUY1 1ZT4A 2NYYD 3WLBB 1G7MB 1Q9OB 2X4NA 1CYGA 3FAWA 3EZ8A 5C0AB 3UTPD 1R6VA 1SEBB 1D6EB 1SMAA 3PIQB 4X5XB 5E2TL 4MQTB 4CVXA 4K7PX 4OV5B 2WBJA 4P4KB 1TVHB 2AEPL 4NP4H 1MCEA 4HWZA 5AEAA 2W91A 3WNLA 1A6ZB 2AGJH 4OGZA 4BSVB 5EZLB 1K6QH 1MCOH 5HDOA 3LOWA 3UZQA 4WFEE 1VGEL 1L0YA 2IANA 1FVDB 3B2UD 3G5ZB 4GKOA 4QHLB 3HMXL 4RFOL 5ADOL 3GI8H 3FT3A 2E7BA 5GJTH 4V2CB 5HDQH 2NLJA 5A2IH 4CVWA 3QAZC 1PEZA 3R1GH 4PUBL 5E95B 4XXCA 5EOCL 1FIGL 1G0XA 4KJYB 5CS7A 3WIHA 3TN0D 4CJ1A 3SKJL 3KS0H 1A6VH 1OW0C 2PXYC 3DMMB 4JPKL 4MA1C 3VXQB 5FA4A 5E1AA 2NW3A 4X6FB 5KG9A 4WV1C 4YQXL 4HIXL 2DQFB 1BQHB 4PTUA 4QLRA 2AXFA 1J1PL 3RBGA 4D3CH 2W38A 4JRYD 1MFCL 1UJ3A 4AIOA 5EUKB 2EIEA 4M9OA 4N0CD 5KTEL 3MLXL 2VLRE 4CNIA 4NRZB 4YK4C 2O61B 2C3XA 3L5XH 3EOAA 3B9DA 4MJ4A 4N90D 4XVJH 4EEEA 1N5YL 4P2QA 2VDPH 3ZKNC 4EQ2A 3ARFD 3NH7H 2NW2B 1LNUA 4P5MB 3RHWF 3RX8A 2AI0H 2PO6C 2QSVA 3HI1B 1NSNL 1MJUL 2NY4B 5DA0B 4KQ4L 2F54B 5C0BA 1FNEB 3GSNH 2NXZB 2HJFA 5ESVA 2VLKB 3BE1L 4D9QD 3W0WB 2DTSA 1CGVA 3SE9H 2HAZA 1FL3B 1Z5LA 3K80A 2E7LA 1QLFB 2WLZA 1RK0B 1CGYA 2FB4L 2DF3A 2DMKA 3VRIB 5KSAB 2X4QB 4D9RD 3MRNA 4UIMA 3MJ8A 5LJYH 3C6LB 4KKCD 5B22A 2IAND 1DCLA 1U8JA 1OF2B 4OZFG 4JDTL 4NQCE 3SPVA 4DWHA 4XTRC 4G8EB 2Z35B 2Y6SC 1TPXC 5GZND 2VZUA 1ZHNA 1NBZB 1YN6B 6FABH 2NY3D 4G6MH 2PCPA 5KZCB 3PE9A 1WV7T 1MY7A 1WAAF 5H8DA 5I6XB 5IHUH 1MJJA 3TFKC 4RGMC 5GGRA 3CFBA 5EUOE 2JK5A 4YHYB 4YJZL 2XY2A 1B4JH 2R0KH 1TETH 1AXTL 3O11A 3OKYA 1JNNH 1U58A 4Y8AA 1Q8MA 3O6KL 4XPFL 1XGPA 4B0MM 3E2HB 4NQDE 5FGSA 3GB7A 1PZUB 1C1EH 5JOFB 4OGYL 2VLLB 3FOMA 1EPFA 4ONGL 4YXLL 3UTSA 4H1LB 4P2QD 2DLIA 3B5GA 3DO7B 3S37L 4KXZI 4XBEL 3VMPA 1CLCA 1VPOL 1WSST 1ZT1B 4GBXA 1NLBL 4P2RA 5D6CB 3HNTH 5KANG 4ELKB 3QIWB 4ZFFB 2GK0B 4APQC 4GRLA 2G60L 1NCBH 1UXWA 5KVEH 5J6HA 1AR1C 2DM4A 3VGEA 2YMXL 3C5SB 3MA7B 4DAGL 3O2DH 2IH1B 3CU1A 2EC9T 5DMKA 1NKOA 2OMBA 1HHHB 1XGYH 3P73A 1UXSB 5IB2A 5C1MB 2DQCL 3G08B 4OI7A 5K9JH 1ORQA 3KGRA 3BKYH 4YBQC 3FJTA 5JZ7D 2B5IB 2B0SH 3WS3B 1U8IA 3QA3B 2ED8A 3CLEH 5ALCL 1CD1A 2D31A 2BC4B 3B83A 4WU5B 2PTVA 3TBSA 2P5WD 3C6SA 1S5HB 4NP4L 4YH6A 3TBVA 5EO1B 1P7QA 3WFDH 1SYSB 3EOTH 2EKJA 4RAVA 2A6KA 2AGJL 1I7ZB 2QR0B 1OAZH 2CJUL 3S35X 3SCMA 1MCOL 5C0DA 3SKMA 1ZLVH 2CLZB 2PYEE 4YXKL 1PFCA 1X5XA 1OARH 3U30C 2BSRA 4JFHE 1A8JH 2EDWA 5TDOB 3BISA 3GBNL 1KIPA 5D93C 3H9SD 3GMOA 3MSPA 4HC1A 4MZ2A 1NEUA 1QRNA 2W9DL 2VWEC 5BRZE 1J8HB 1D3CA 2AJYL 1IAKA 4P3DB 2PETA 5FOJA 2I24N 3BKCH 5CBAB 3UTSD 4LGRB 3CC5A 3BEVB 3O0RH 2OX5A 3L5IA 4OM0L 5HJ3A 4OCNC 3UEZA 4GMTH 3BD3A 4GBXD 4I0PB 2ICCA 4PG2A 5L2KE 1T5WB 4JG0H 4NT6A 3A6OA 4U3HA 5BZWA 1FYTA 2FECI 3O41B 2AEQL 4Z7UA 1RUAH 3NMEA 5DHVA 4F7EB 1A3LL 2VSDA 4D3CL 2KQMA 3BKMH 1TCMA 2ESVA 3A6BL 3G9AB 4U2YA 4ZUTA 3HI6H 4JDZA 5F7DB 5J57B 4POZD 5CHNB 3WN5C 1FVEA 2OJEA 4I18A 1S9VA 3B9KB 4XVJL 2V7NA 4Y4FA 1YNTA 3MXWL 2N1KA 2JJSC 1WVZA 3GFUA 5J7CC 3IFPA 4RDQG 1I7RB 3CX5J 4HJ0D 4KAQH 4NN7B 1ZLWH 1KB5H 2K1MA 4P5KA 2VQTA 1VFBA 4JB9L 4MJIA 3EOBA 1I1AA 3AAZA 3QIUB 3EJJX 5HY9A 2A6DB 2VLJB 1P7QD 1CGWA 4NN6C 4R4FL 5DS8A 3OZ9L 3KYOB 4UOW0 3IJHB 4BFBD 1CU4H 4W6XB 1RIUL 1XEDA 1UZ6F 1A3RH 1G9MC 2EDFA 2R15A 3UYRL 1JWUA 2IPUK 3HR6A 1C12A 2I5YL 4LMQI 1BREA 1XH3B 4LQFH 3UTTE 1I8MA 2V2WA 1GRWA 5LGJB 1NFDA 3IDJB 2JF1A 1CGSH 3F7QA 2R2CA 5DVKA 4EXKA 3DX6B 5A2KH 2FLRT 4TNWF 3V95A 2W1NA 3H3BC 2EDBA 4OBRA 5FYJE 1B6DA 5IHUL 3PHQB 2OTPA 1VSCA 1A6PA 3KPLB 1AGCB 1F2QA 1HILA 1INQB 3MRBA 4HPOH 5DZNA 5A3IC 3UTZA 1PG7X 4MA7H 1NGPL 3CPLA 4HEPG 5I1IH 1OLLA 3K2MC 1A6WH 3KXFE 2VZ3A 2HTKC 1KELH 4XRCA 4M1DL 3FT2A 4WHDA 5ENWB 3VI3E 4C4KT 5CIPA 3VG0H 4YDJA 4M8QB 2VL5A 4JFZH 4KGLA 4X8JA 5IFAL 1CFTA 4OUUA 4JPIB 4OZGB 1WLHA 5AYUH 5CWSB 4ZYKA 4XPAL 5E6IB 1T89A 1T1YB 4PB9H 4Z0BH 4R96B 5FK9A 4PJDB 1JNHA 4NFDA 4MJID 1I1AD 4L3CA 1MCCA 1UZ8A 1S8DB 4CU8A 3BEWB 1JNLL 4YDLC 4NQED 5EOQL 2HFTA 3DRQA 5F1IB 1HEZA 3QDJE 1R24A 2I07B 5ESAA 1I1FA 2I27N 2WNGA 4DGYH 3O2DL 3MGAA 5IWLC 2W0FB 2YPLA 1A7BA 5H35B 3U9UA 5K9JL 2NY2C 5E8NA 1QFUH 2OL3A 3TVMA 1R3KA 4FXGB 3PV6B 3RUGB 2VKWA 5M7QA 5T1KB 4NO3B 3FQRB 4R9HA 1PLGL 1MFNA 2H9GA 3CSBA 4G8IB 2GQHA 3C2AL 2KH2B 4XNYH 1XAUA 2Z8VC 1AH1A 3VJ6A 3MGOA 1XF3B 2AJXH 2DQHL 3MJ6A 3L9RA 4Y88A 5HYSG 4OJFL 2JELH 3A67H 1ERNA 3FB5B 1LDPL 4KTEH 4YHPA 4MJ6A 3DROA 2H3NA 1OARL 5IJKC 1JPFB 1XGRB 2R2HB 4JRYB 3MMEA 4JHAH 4K3DH 4JHZA 5GRZA 5JHDE 5BS0A 4I0KA 3ZT5A 4MD4B 4FTVE 1I8KB 4QRRB 1ACYH 3DUUA 4FQXC 5IB1A 1VEPA 4ZDHA 1A1NB 3BZFB 5FFLA 3VFUA 3BKCL 5BXFA 1X44A 1BZ7B 3UJJH 2IMMA 2Z31C 5ECJE 3TF7C 2BP3A 3D25A 4HFWB 1AD0A 2APFA 4C59B 2VXUL 4KI5C 4ZUWB 2ARJQ 1L7IH 2RBLA 3QQ3A 3LEVL 2WINA 3U82B 5GZOC 4IS6A 3MUGB 1T20A 2YZ8A 1FAIL 4FQLH 4UUJB 3PJSB 3BYYA 1BQLL 3FQXB 4NKOB 1J18A 4IIQB 1WWAX 1UQSB 2FL5A 2ZUQC 4MDJA 2YPLD 3MZGB 5C7XH 1MF2L 3GMLA 1RK1B 3D87B 4FQ2H 5CD3A 2EYTB 1PYWB 3O6MH 2XTJE 3EOYG 3BXNB 4C56A 5DJAB 4Y4HC 5GJSL 4H5SA 5DZOA 1YPZB 2V2TB 4TVPH 3ET9F 5JIKA 4Q7DA 2P4AB 1T7VA 4Y4KA 3VD5A 3QUZD 3P9LB 2J8HA 1KJMB 4QOKD 2NZ9C 2YSSB 4L8BA 3U2SB 1S3KL 1FCCA 3WFHA 2UZIL 1UB5B 1TNMA 5AWNH 5ACZB 2AK4E 1A3RL 5DD3L 4WNQA 3U4EA 1GCFA 3EO1A 4OLVH 1GOFA 2P44B 4LQFL 4WRLA 1P84K 3QFDA 4NQSB 1EVUA 4HIHB 5BS0D 3HNSL 1JF1B 5F9WC 4JVPA 1YMHA 5KS9A 1FGVH 1J5OH 5HGBA 1K8DA 3CUPA 1A21A 2VDQL 2XQBH 4EOWH 4N0FB 3O3DA 1NFIA 1QSVA 4X7TA 2W59A 1U9KA 1TQBB 3GBML 5FUCE 5DD6B 1IEHA 1JIBA 1A9EA 3I3EA 4CN1A 1L9NA 4BH8B 4JY4B 4BZYA 4Q9QH 3LB6D 3NIDE 4HPOL 1CGUA 4MCZB 2AEWA 4GRWB 2BVOA 4OZGF 3UXFA 5I1IL 4JZOB 4W68A 3D85D 1G6VK 5L9DL 1NCUA 4BSJA 4PJDF 1SY6A 1G7QA 3VG0L 3BJ91 4WI3A 2VUOA 3F5WA 1J86A 3Q1SH 3M17B 4C56D 1TENA 3HLAB 2VDOH 2W65B 4YWGH 1T66D 5KSBA 3ECBB 3KPNB 1MHPH 5DRXA 4JFED 3PL6C 2ICWJ 3D39E 3H7BB 3L7FA 3LVEA 2EE6A 4Y4KD 3NIFF 4JGUA 5M94B 4QY8B 5I19L 5CFHA 3O4OB 4NO5A 1G9EA 3RUGF 4UB0L 4MB4A 3QO1A 4DGYL 1X5IA 4HF5L 3ULUF 1UWEH 5FDYA 4YHZH 2HFFA 5CBEB 4H88L 1FV1A 1B2WH 1NUFA 3DVFA 1AD9B 2J6EH 4LSTH 3ZLQC 1BJ8A 4CU6A 4EI5B 2Q8BH 4BSWA 4HX1A 3I02B 3K46A 3MBEB 2MWCA 4MAYC 1Z9OA 5EU6D 1F97A 2Q7YB 4O2EA 3FZUD 3TESA 5C9JB 5CSZB 2WBWB 1JZ2A 5SWSA 2IQAB 4MHHI 1JGVH 3ULVE 3I2CL 4PFEA 1IBGH 1NAML 4P2OB 1NDMB 5CUSH 5C0AE 3B6SA 4W81A 3DVNB 1E4KA 2YD4A 4H1LG 5IG7A 2ZUXA 1JE6A 4X8XA 2IAMA 4YHML 4JHAL 3QNYA 2HKHH 1DN0A 4AM0A 1MQ8A 4XH2A 1BAFH 1ACYL 4Y5YA 3BH8B 2DJSA 4GAYA 3V7AG 4RFEA 2E27L 2QQKL 4ERSL 3HE7A 5DJ0B 2GTWA 4CGTA 5JPMB 3UJJL 1R3HB 1KSRA 3QXAA 3ILPB 3MLYL 3P4LA 4K94L 1S9YB 1ZTXL 4Y16B 3LQAH 1EZVX 3FRUB 4N5EC 3RVWD 4LLYB 5TF1H 2XRAH 1T3FB 1AGEA 5K59F 3NIGE 1ITBB 2CRIA 4ZS7L 4GG6A 2K7PA 3KPSA 2QADD 1YPZF 3BESR 5KOVC 1KFAH 3TO4B 12E8L 2ATPB 4L3EE 4LLVB 2HA1A 3SO3B 4HIJA 4OCRL 4ODTL 5C7XL 4FQ2L 4RAHA 3JZ7A 5DSCB 2IFFL 2X4OA 1MCLA 4TN9A 3BMVA 3CMOL 1T5XB 2Y5EA 4WCYH 5DR5L 5H2BA 1OTTC 1RHHA 2Y7QA 3CVIL 4JANB 5E7BA 1NL0H 4JN2B 1QA9B 1TMCB 3SQOL 4YO0B 5EOTA 4N5UA 4PGEA 1MNUH 4Y5VC 3X3FH 2PW2A 4Z7OF 5BJTB 2JB6A 3WFEH 1NEZB 4LSSL 5INDB 4P48A 2E6QA 3CNKA 4OCXL 3FOLA 5D72L 3EO9H 3T0EA 4QRPA 2IAMD 4R6UA 3N1FC 3L1OL 4OLVL 4KROC 5FO9A 1G7IB 3KPRE 4LLMA 4JFOA 3GRWH 2VLKE 4P49A 2AVGA 4RGNC 3W0WE 2DQJH 3A6CH 4P46C 4X4ZA 5C3TA 4KRNA 4LCYA 1S7XB 1BLNA 4PRPD 2ARWA 1KJ3H 4WFHD 1O7VA 1A6AA 1N8ZB 4X4XB 4HKBA 4KMQA 1YEHH 3HE7D 5FYKH 3T65A 3UAJD 3V6OA 5C07A 4XHJD 4GRWF 3GIZL 2XPGB 1LO4H 1OSPL 4IMLA 3WUWG 2ZUSA 4ALAL 4QRQB 4X5WB 2XWTA 1U3HD 3GO1H 1K3IA 3ZTNH 3EYVA 1RIVH 1QO3A 1FNSL 4FXKB 1PD6A 4X99A 3ARGC 4JM4H 3NCJH 4JZNA 4E41A 2P24B 1CLOL 1Q94A 2IPTL 3E8UH 1L6XA 5E56A 2E8ZA 5C0RL 5HYQB 4PJ8A 2VABB 4IRSC 4Y7MA 1C7SA 1LEGA 1EEYA 1GVIA 4LNVA 3WNOA 2GCYB 3LRSB 3QIBA 1GGCH 4WI7A 3ZO0A 3Q1SL 3W2DL 2AKRB 1SJVA 5SWZB 3O8XB 2UUDH 3C09C 4ZUVB 3BIBX 5LQBL 4PJ5E 5I30H 3GNMH 1NCWH 1RULH 5EULV 3MGTA 4ZD3L 5DD5L 5E9DD 1NMCB 2EDDA 3VW3H 1C5DB 2WW8A 1QNZH 3SGJA 1XR9B 4R7NA 1FL6A 4MD5A 3T0ED 4HCRA 1VFMA 1B2WL 1LP9A 5E6ZA 5CJXA 1MIMH 1HZHH 4JAMB 3TYFB 4BUGA 3VI4F 3BP6A 1B0RB 3V7AE 1TZHB 4PJAA 3QDGB 4YBHA 4Y19A 4FQQB 3CMGA 2M8XA 1A1MA 3X13A 1U8OA 5BZDA 4POYA 4G8GA 4OKVA 4R7DB 2N56A 2HMIC 4NYLA 4WHTB 3WNNA 1OTSD 4HXAH 2MTPA 2Z91A 3MRHA 4JO3H 1DUZB 3VXME 4JFFB 2V5MA 4DFHA 4YC2B 1QSFA 2BXZA 3DXAE 4LVHB 2IJ0C 3DYMA 1DDHA 4DCQA 1N0XH 4OFVA 4G80A 3K1KC 4GJTB 4OD1H 3T0XA 4M7ZB 1IRAY 4E41D 2N7BA 4MA8L 3QCTL 2HKHL 1A7PL 2W0KA 4JREB 4X9GA 4IOIB 3RL1B 3OB8A 3OWEA 5J89A 1SJXA 2P8LB 4PJ8D 3RA7H 3UX9B 2DQIL 3CIQA 3AXLB 4EBQL 5HGHB 5CLWA 4D0BB 1IL1B 4RMTA 1SMOA 3BQUC 3QIBD 1IGML 3ETBF 1EUUA 3DYOA 1TJIL 3ULUH 4LLWA 1CTNA 1IC5H 3QPQC 3LQAL 2F8XC 3QUZB 5D7LE 3WFCH 3H0TA 4PRNB 4X9IA 3T1FA 3QJFA 3WDJA 2O5YH 2EDJA 1KYOK 4PJ9A 1UEMA 2P43B 1RURL 3HMWH 5DJ8A 5ADPL 3Q5TA 5KVGH 5ICYA 4Y5XA 3CZFB 1KCSH 2HT2D 5I18H 4DUVA 4J2XA 2DBLL 4X80L 5T1LB 1N4XH 3BFOA 5HHOE 3OB0K 4JM2A 2A9NL 4LHUA 4Y19D 2UY6A 1A3QA 3G6AB 2F53B 5I1HL 3VFVA 2UWEA 3DUSA 4G8GD 4L4VB 3ARBA 4OCWL 4BZ2H 3IS1X 4WHYH 2ITDA 4XNZC 3GMMB 2GJZB 5AG8A 2ZOKA 2WUBL 4RZCB 3BSZH 1QFWH 4OTXL 1DQQA 4HMEA 3SKOA 5KVMC 1BZ9B 4S1SL 1MH5A 3CK0H 1MCSA 2PF6A 3EO9L 4F58L 1JI2A 1F4HA 1CT8B 3V5KB 1YMME 1QYGL 3MRLB 4GXUN 4UMGA 2ZG2A 3AREB 5A2JH 5EIIA 3R0MA 4XP1H 4S2SA 4P23D 4TTDC 3BAEL 1HH9A 1KJ3L 3MTRA 3AGVA 5E70A 3IAGC 3FN9A 4PRHA 1YEHL 1ETZB 2V17L 3C08H 2UYLB 5DJCA 5ELIA 3QEGL 4TUOA 2D03H 2OS7A 3BGFB 1P4IL 4JFEB 2YPKA 4NJAL 3N1GC 5IM7A 5F9DC 5I1EH 1QOKA 3ZMRA 3K0WA 4YDIH 2EDYA 4MXQD 5JOPE 3REVB 3IFLL 1F2XK 4PJ9D 5GGVL 3CSYB 4QHKI 5DQDH 5DHYA 5I75B 4NSKA 3P4OB 3VXNA 3GI9L 5DFWH 4AY0A 5JR1H 4JPVH 5LGHH 2WK2A 1HIMH 1NAKH 5JQ6L 3TBWA 4Y2DC 3VGDA 4HT1H 4Q97A 3DX7A 5HI5D 3BDYH 4IMKC 5FYLE 4ZFOA 1MPAH 4WWKB 2DQGH 3OR6B 4JVWA 4QCIA 1F90H 2KPNA 1HSBA 1NGWB 4B7IA 4Y1AB 4GH7B 3RPIA 3MLUL 2ZSVA 5EPMB 1MJ7H 3ARBD 1RULL 5HHQB 4L4TE 2NZIA 4OZGE 2HRPH 1MHHA 1UM6H 5F9OH 1XR8A 3TT1H 5FO8B 1INEH 4K3HA 1ZHLA 2BRQA 4WI6A 4PLNC 1PZ5B 4HKJB 4P3CH 2A6JA 2OJZH 1EEZB 4TSAL 4M7LL 32C2A 1JHLH 4X7SH 3P30L 5FHBL 1NGYA 5CCKL 3NPSC 1L0XA 4ZODA 4MS8D 3QJHA 3WKNA 2V7HA 2HT3C 5FUZL 1MREH 5E03A 3FN0H 4R3SA 2CLVB 1R5IA 2AV1A 1ZVYA 2Y25A 3MRMA 1YZZA 3FFDA 2A9ML 4QO1A 3S3SA 3WJLA 1U8NA 3DO3A 1OP5K 4KK5C 4LCCB 5EBWA 1HHIB 1X5JA 2OI9C 1ONQB 5K9OB 3I6KA 4MNGA 4QF1B 3OKNA 5D7IB 4MAUL 5DMGD 4ZSOB 3OPZL 3RGVA 2QEJA 2R1YB 3NFSL 1KIUA 4X7EC 3QFJA 5I8KL 2K7QA 4G9DA 4NFCA 1WCQA 5A43C 3VXRE 3UDWC 3MOBH 1N0XL 3EO0B 1FFOA 3F7RA 4K8RD 1CE1H 5IEHA 1J0ZA 5K9QI 4WWID 4U6HB 3OKLA 1F3DJ 3P3YA 3MJ9A 2XZCL 3RA7L 4YHIB 2VMFA 4GUPA 3BPOB 3P2TA 1NGZA 3ZKSD 1GPOL 1V8HA 4LEOB 5EZOL 5J3HD 5GGTL 5HYJE 3ES6A 2B1HH 3GSRA 3KPOB 3ULUL 5GSRB 5T3ZE 3INUL 4NHCH 1D9KB 5C9KA 2ZPKH 1MLBA 3O9WD 4QRRE 2HG5A 5IFJB 3QI9A 5GGQH 3I9GH 4ZXBC 3WFCL 3S36L 4X0KA 1EX0A 5F7MC 4M1CD 2JIXB 1AI1L 3HMWL 2B1AH 5KVGL 5DEGB 3N1PC 5DD1H 5ERWB 4HLZG 4J7RA 4NJ9L 2QSCL 3QXUA 1JTTA 4M6OH 2I9LA 4W4OC 1JZ8A 3IETA 4N1EA 2ZJSL 1ZANL 1OB1A 4PJGB 5TDPA 3EYSL 1DLHA 3S5LG 1AIFB 4P5TB 4PRPB 4S1RH 2CQVA 3RNKB 5CMAA 3OG4B 3KLAB 1IILE 1P4LA 2CDGB 2BVEA 3MLTB 4U05A 2BOCB 1LO0H 3BSZL 3FHQA 4LPYA 5EU5A 4ODWB 5SWQB 3QUXB 4DKEL 3AS3A 2NYYC 3VWJA 1U3HB 4ZOBA 3OKDB 4UOJA 3VE0A 3PP4L 4PRAA 3L3KA 1DANU 2E7CA 4ELMA 4Q58C 1CICA 1A22B 4U1IB 2Q87A 3MCKB 3QG6A 5E8PA 5F7UA 3LKRB 1MLCB 3DIFA 3ZDXF 2HP4A 3D0VA 4K3GA 4HC1H 4FQHB 4WUUA 4FP8L 3L3HB 4HWEL 3U7WH 1RZIA 2EDNA 3C08L 2X1OA 4Z7OE 1M71B 2X4PA 4CBPA 1YEJH 4HGKC 3ZYIA 1A7RL 3B2UC 2Q6WA 4M62H 4PJFA 4YDIL 3P9WB 5ISZA 4U33A 5I2IB 1U8LB 3DLQR 5A2FA 5DQDL 2YN5A 4RCAA 5F6HJ 3D6GA 1JPTH 4EN3A 5JR1L 4JPVL 2EKSB 5DHVH 5HHVL 5LGHL 5E7FA 5TQ0L 3ZE2F 1U93B 3HZKB 5F88B 5T1MA 4PJEB 4IDLA 1MRCH 5F9JA 3QEHB 4AENA 3TN0C 1AP2B 1AKJA 1NEZG 1F3RB 1RMFH 3ZE1E 4GRWE 3MYJA 2WQRA 2CDEA 5E94A 4LF3A 5T5FH 4UTAH 2YK1L 3PNWA 5GIRA 3QUYB 3WIFA 1FBIH 3G5YB 4QXUH 3VXPB 2FZ3B 1MAML 4N0CC 4JLRA 4MMZC 4MJ5A 1OP9A 1WCBB 4TPRL 5F9OL 2YA1A 1JN6A 4HK0A 1LE5A 1INEL 5SX4H 2QQQA 1KULA 4GO6B 5I66A 1X5HA 4ZO7A 1Q1JL 4HPYH 3ARFC 1GYAA 2FCBA 2YHGA 5F7NC 1CFQA 4CVUA 2QKIB 3BP4B 3MJGX 4X7SL 2XZAH 3H2WA 1YYLH 3NCYP 2UVFA 2YD7A 1K4DB 5D7IF 4FZEH 1JYNA 4ZAKA 4HUUB 5DMIH 2YD5A 3QDHA 1IM3B 4XPGH 4WUUD 2V5YA 3NA9L 3Q6FB 4ONHA 5JLZB 1HXMB 3D2UA 4AK1A 3IXTA 5FF6B 3SDDA 1MFDH 4X6BB 3GJFA 1QZ1A 2VC2H 5IF0A 1JYVA 4LOUD 5F8RC 1F8TL 3HE6B 4KKCC 5HHPB 1T6VN 1WWCA 3U0WH 5KN5B 3C5ZA 2E3VA 5ISZD 3VFTA 3OKOB 3SDXE 4KK6D 3GJFK 2BVUA 2HN7B 4BQ9A 1TFHA 1CDGA 3MOBL