2IQAB

Pfa2 fab fragment, monoclinic apo form
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
220
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSLSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKNYNPSLKSQLTISKDTSRNQVFLKITSVDTADTATYYCVRRAHNVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG2a Fab fragment PFA2 Kappa light chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
total genus 37
structure length 220
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iqaB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iqaB02
4X6FB 5KZCD 3FQNA 4K3GA 3TIEA 2W65B 2CDEB 3BD4A 1NC2D 2HN7B 5DGRA 1KFAL 3KG5A 3BGAA 3FQTA 3SCMB 5F96L 5GZNC 3MBEC 1ZGLB 2X1OA 3K4ZA 3ZDXF 1SQ2N 2XKUA 4HKJB 4ZG1A 2AQ1A 1RPQA 4Y2DB 3V7AG 1L4IA 3IJHB 2FGWL 4KAQL 1JCKA 3VWKA 4X9IA 3CZFA 3X13B 3PQYE 4UQ2B 3KS0H 5FM8A 4PJCE 1KXVC 1Q94A 3QUKA 4I9WD 5DK3A 2H8PA 2AXGA 3NTCL 4XVJH 2Y4SA 5E2JA 3L5WB 2Q6WB 4QXWA 1U8KA 4MGXA 1JBJA 4TUOA 3ARRA 3SGJC 1EHLL 1V05A 5C0CA 2ZNXA 5C2BL 1AHWC 4RFOL 5ALCH 3RX5A 3ESVF 1X6NA 4PV8A 1LEGB 5C0BE 2GCYB 1NGXB 3P30H 4HS3A 3O3EA 1OAYH 2H26A 1EEYB 1QD0A 3OSKA 2ZCKH 5JMOC 4QTIH 4QT5B 3UO1L 2HKFL 5CSZA 1F4AA 1P6FA 4LP5A 4UU9A 2Z92B 1R0AL 4DTGH 4NO0B 3LD8B 4KJQC 3OMZA 3TBVB 1SVCP 5C0AB 3VE0B 3UTSD 4JREC 5HY9A 3ARBB 4ZAKB 1BX2A 4PRBB 3SE4A 2Z31D 1LD9A 3BISA 3B9AA 3F7YA 4Y19E 4NQCB 2IANB 3NFPB 3SDAB 3EHBC 2AK4D 3BEVA 5B3JE 4LHJB 3TN0D 2H32H 1VERA 3QWRD 2HJFB 2Q86B 3LSOA 3MRKB 3I02B 1UM4H 2Q1EA 1MEXH 2F54E 1YPZA 2FECL 5E2WH 3WD5L 3ARDC 1GVIA 3G6AB 4FQHB 2N4IA 1MFBH 1X44A 3V6OE 5HYJB 1ZLUH 2VXUH 3L6FB 1NFDF 5EZIL 1UYWH 1RUQH 4KU1A 3QSKB 5EOQH 3MLZH 2W60A 1CGYA 5CINL 5E6IB 2VITA 1LK3L 4G7VL 4TULL 5KAQF 5F93C 3IXAA 3WHE1 4JFED 3M45A 5J8OA 3KYNB 5LGHL 2VRAA 5SWZD 4G6JL 2IQAB 3C6SA 3KPOA 5TH2A 4NQVB 5DJYB 3RUGF 1MRCL 4I0PD 1PEZA 3BH9A 4G8EA 4LVOB 3P4OA 4MS8C 4OGZA 5T3XE 5KSAD 1RUAH 2D7TL 4AIZB 5CILH 4CADA 2WWMC 3SGDI 3CSGA 1CG9B 1F3DH 4FTVA 1K6QH 3JV5A 4KUCF 4Z6AT 2A77H 1F4YL 1CGUA 3KDMB 2PCPB 5FGRA 3G5YA 1KEGH 4OFYA 4EUPA 4HWZA 2C4XA 1IMHC 4D0BB 3TVMC 1NEZA 2AXFA 4PYHA 4K8RC 2VQTA 1X4XA 3HRZA 4RRPA 4M1GH 4YDIH 5I1JH 5K59E 1ORQB 2HLAB 2WANA 2VAAB 3I84A 5ESQB 3TH3T 3HAEH 4WJ5B 3NIDF 4HIJA 3O4LD 1ZLUK 4QF1A 1NGWA 3DXAA 5GS1C 3TT3L 2V5TA 1NBVH 1MJ7H 4XPGH 2A1WL 1YN7A 5T1LB 3T3PF 3ET9F 2E27H 3K46A 1J1OH 4IOIA 2EZ0D 3X11A 3EJJX 1DE4B 4PBXA 1UB5B 1PFCA 1XR8A 3JBG7 2EXWC 4NZRL 3RFZC 5TGBB 3MNVB 1MIML 4MA3A 3NZHL 5DS8A 1KENL 3QIBC 1QOKA 3H9ZA 4ELMB 5BRZD 1SEQL 1KTRL 1U3ZA 1HXMA 1XH3A 2GI7A 3C60B 1RZJL 1AY1H 5FB8A 5GS0L 4ZQKB 1FCGA 4IRJB 5F7KC 3MRMB 3EW3B 3PHQB 3VA6A 4U1JA 5D71H 4XNYL 1CDCA 5T3ZE 4ORZC 3JV6A 5EC2A 2KBGA 3CVIH 3GMRA 5T1MB 2YXMA 5E5MB 1J1XL 4HWUA 2JIXD 4PJIA 1JPGB 3RWGA 3O41B 2XY1A 3D9AL 3KJ4B 4WEBL 1ED3A 5C0AE 3T8XB 3G5VB 4YR6B 4XTRC 2X1QA 5FYKH 2OTUB 4IOFD 4PV9B 4HV8B 4NQCE 2IANE 3GSRA 4JFOB 1Q9LA 2DQCL 2OM5A 2G5BB 4QXUL 2I9TA 1BZ7A 4RFEA 2CRZA 5DD5L 1T1YA 4U1MA 5A3ID 5CJ8A 3U6RA 2OL3B 5JHDB 3TJEL 1GXEA 4CVWA 3O6FA 2G75B 4N5EC 3S37H 3IJSB 3RZCD 5HYJE 3WJJC 4BZ1L 4RGNB 1MLCA 2VLLB 3T09A 5LWYL 5EUKB 4U2YA 3OKNA 2IC2A 1NCCH 3VDAA 1YN6B 1XGTB 3STLA 3IT8D 4DGYL 4RGOH 5CWSA 3RGVD 2Y5TB 2CMRH 3HG1B 3CK0L 4X5XB 1PKOA 4E41B 4Z7NF 3ZE1F 5JPMA 4XP9L 2IQ9H 1ROWA 4K7PL 3VXPB 4BUHA 5C6TL 2B39A 4G3YH 5DRNB 4LLYA 1VACB 3QJHA 3QIWC 4KTDH 1R5WA 2H1PH 2F5BH 5J57B 3JTTB 1PX3A 1NC4A 4NM8H 1W0WA 4PJBB 4U0RB 4AEHH 4GO6B 1DBJL 3MCG1 3WO4C 1T89C 2NXZC 3C2AL 5D93B 5TE4L 3FT3B 2DS4A 1C5CH 4K3DH 1XGPB 3JWOL 2E7MA 4GRWF 3S4SB 3EGSB 5HHOB 2YSSA 4CVXB 1ZLVH 4G6MH 4KVCH 1QFWL 3BSZL 1U93A 4BQ9A 5E1AB 3MLXL 1H0DA 2VDQL 4KMTH 1HE7A 1RURL 4G9FD 2DRUA 3T3ME 4JFFA 3U7YL 1HZHL 3EYVA 2R69H 2P8PB 3WIHL 3FB5A 5LAXA 1ZLSH 4CU7A 2IG2L 2NY3D 3B9KB 3GRWA 1Q1JL 3Q1SH 4C54A 3GKWH 1Y6MR 3VH8A 3EOTL 3UAJD 2YC1B 3BUTA 3PWJB 4ETQB 2NX5A 2XFXA 3HNTH 3WFHA 4IMLA 3GUTA 5K9KB 2AJXL 4R90H 5IROA 2VDOL 2H3NA 3HZKA 4L5FH 1VGKA 4WUUB 3O3BB 1MCOH 4ELME 3SQOH 2I26N 5EBMB 3MUHL 5I1HH 2EIEA 4X98B 3BPOC 1BFTA 2JLLA 4ZUUB 2R23B 2ID5A 1AJ7L 3GMQA 1U8PB 4MQTB 3RNQB 3PJSB 3W2DL 4EQ3A 4BQ8A 3LKRA 1KJ2B 4ODXA 4JZJC 2YMXH 2NW3B 1B90A 2QJDA 3QHFL 2XXMB 3MRJB 2GSIA 3TM6A 5F44A 1E4KA 3BZ4B 4OKVB 2GTZA 3QDGB 4U6YB 4X0KB 1KCVH 3L7EA 1DN0B 3REVA 3K74B 1KJVA 1OVZA 4LNRA 1X7QB 1W0YT 1ZLVK 3RTQC 1W8NA 3TZVD 3WSQH 2OI9C 4XVTL 3FL7A 1O0VA 4LLUA 5GZND 3MBED 1QSVA 3SO3C 2P8MA 4OF7A 3WUWG 5J06A 1D5IL 4ZXBB 1JK8B 3SJVB 1Q9KA 5A2FA 4UOW1 4XMPL 3S96B 4B7LA 1ZOXA 4I2XA 4S1QH 4LQ1A 4EXPX 4UIMA 5IB1B 4PJXA 3O3UN 1XF5A 1DUYB 2X4QA 4NN5B 2YD9A 1RJCA 3BGFC 4WWKA 4LRIC 4F9PC 3E6HA 3D25B 1LNUA 5D7IA 5JHDE 5IIEB 1KF9B 4OCXH 1MHPL 5ADOL 3TT1H 4EDWH 4RQQA 4ENEC 3G6JF 3MRNB 2ZCLH 1MCCA 5D2NA 4XI5D 4BKLB 1L7TL 2VDNL 2DKUA 4QXTB 3LS5H 4G5ZL 3KLSA 1YY8A 2R4SL 4N0YL 2FIRT 4U1KA 5I8OH 1DUZA 3UBXG 4TYUA 4QHUA 3HG1E 4KJQD 4Y4FB 1CDIA 5CAYB 1QLFA 1FNHA 2EEDA 4PGCB 1IGMH 4E41E 2DKMA 3HC0B 5F7DB 3DX6A 4EN3C 1GHFH 3IJYB 1T21A 3EHBD 3BWAB 5ITBH 1AKJB 3MRRB 1GOFA 2F9BT 4JY6A 5DJ8B 4M5ZL 1JTPA 1IKFH 4K9EC 4PJBE 3ARDD 5K9QG 1JZ7A 5DJDA 5JOEA 1NAML 3ARYA 3VFOA 2EE9A 2G2RA 2AABL 5EORL 5CEXB 5GRZA 2QHRL 1AGBB 4Z76B 5HHOE 4LDEB 4G80A 1QHPA 3U46A 3BIKA 2HTLC 2KPNA 3BDXA 3KPLA 1B4RA 1FL5B 4ZFGL 3GI9H 4KKAC 4ODSH 5E94B 5D7JA 5FECA 5TFSL 5B8CC 3QULA 4EI5B 3U30C 4NNYB 3TA3B 3IDGA 1P4BH 3WKNA 2DKSA 4WO4D 4LEOB 4EQ2A 5E2TL 4XPHH 2BJML 1U8IB 1I85C 2YN3A 5MEQB 1BWWA 3QUZA 5JIIA 3RWCA 5L0QB 1AGFA 5CD3A 1CLZL 3BW9B 4YK4C 1TVDA 1ZWIB 4MS8D 2C3VA 3X12B 4Q7DA 1KTLA 4ONFH 1T5XA 2CKBA 2GUOB 2Y72A 1S8DA 2WWMD 5AZ2H 1DBMH 1RJLB 3KLAA 3LPGA 4LSVH 4PY7A 4RMVA 3SDYH 2BSED 5DJ0A 5GGQH 3CAFA 1MREH 4KJYA 4ONOA 1A3RH 1CFTA 5EO1B 2VLMD 4HAFA 3TVMD 4EZMA 1OAZL 1T2JA 4K8RD 3MZGB 1F5WA 5B39G 5GGRA 2VLKB 3MJ8A 1LDPH 2YPKB 2NY7H 1ZA6A 5DD6A 1D6VH 4DN3L 3QDGE 1TNNA 7FABL 1NDGA 5F1NB 1BIHA 3QUYC 1JYVA 2A2QT 4JAMB 2IPKB 2NXYB 2YWYA 3LCYA 4JJ5B 5DWUH 2A9NL 1CS6A 3BEWB 5KW9L 2UV3A 5E8PA 4KKBC 1GZQB 1JGLL 3SJVE 3DV6B 4X6DF 5D1QA 4WUKL 1NGPH 1ZAGA 5ERWA 3L3HB 4P9HL 5EH1A 4P3DB 1QLRB 5ICZB 4N68A 1RD6A 3NIFE 4LOUC 5IT2H 2MQ3A 1S7WA 5C86A 3PL6A 1YECH 1TCRB 2EXWD 1X3DA 4FFZH 4CW1A 1ES0B 1J7VR 3QIBD 3LN4B 3K1KC 4CMHB 4V1DB 3IAQA 4JHWH 3ZKQD 1DFBH 4R9HA 3L3JA 5DMIL 4HQQL 2ARJQ 3BYYA 4X7SH 2FB4H 2H32B 3RUGA 2HFFA 2NY1C 2HKHL 2MSPA 4F7TA 3VI3F 1XCTA 1PW3A 1F4WH 1T0PB 3ILPB 5E03A 1DBBH 2APXA 2WBJC 3HE6A 3NCYS 5JOFB 4MDIA 3DUUA 5DTFB 4CJ0A 3ULUD 4NFDA 4K2UH 1F90L 5L6YL 1Y6NR 3ALPA 4M7LL 1QRKA 3DOSA 4Z7WA 1RZ8B 5IK3A 4AQ1B 5T1KA 5K9JH 1RZFH 1S7VA 2JJTC 3C6LB 3GSOA 4R2GB 5AEAA 1OHQA 2EDHA 4X8JB 2ATPA 1U8HA 1HSBA 3UYOD 3MRPA 1JN6B 2GSGA 3FO9A 3MNWA 4KV5E 1N4XH 2CLVA 4J23A 4BELD 4Y5XB 4L3ED 2AEQH 4U6HA 5JXAH 4N5ED 4NM4L 4L29B 4PIRF 5L2KD 1P7QA 1KCSH 5I9QC 4JM2D 1WZKA 1RZKL 4LU5H 4Y1AB 4PRHD 1KG0A 3NBNA 2YZ1A 1BWMA 4NYLB 1M1SA 4PJAF 2W92A 3FAWA 4PUBH 1ETZB 5CZVH 5HHPA 4AJ0A 1RU9H 4Z7VA 3V4UH 3QIUC 3U0TB 2Q7NA 4WW2B 1BJ8A 3GSWA 1CLOL 4NCDA 4HXBL 3UZQA 3NZ8B 4X7CC 5CLWA 3AS1A 3FMGL 3HKFA 1A3LH 1TTGA 2C3XA 2E8ZA 2ICWB 3NVQA 3UZEA 1F3JB 3HAEB 4JPIB 4O2FA 5I18H 2XQBH 3QIWD 1GAFL 4P2CG 1FE8L 1I1AB 4CMMB 2W9DH 3PGFL 4UT9L 1CT8A 3V8CA 4X6BB 5KS9B 5I0ZA 4YEEA 2NXZD 1H3VA 1OAKH 1MHCA 4F3FB 4MLIA 2AV1A 3VGAB 3GJEB 1Z5LA 5GPRA 3DROB 3QO1B 3TEUA 3TIDB 4HS6A 1WVZA 4F7PA 3KWWB 5B38A 1EEQA 4HT1H 4M93B 4HIXL 5E4IA 3OJMB 5IHUL 3SBWA 2VLKE 2VDRL 1HK6A 1IGTB 1R3KB 3PV6B 2E7LA 4DUWA 4RAVB 1SMOA 1YMMD 3K8MA 2UYLB 4R4NC 2ZG1A 1I9IL 4OFIA 3DGCR 2X6MA 3I75A 3O6FC 2OP4L 5E9DB 2UZXB 4U1GB 4L4TD 2I9LA 4UDUA 3SEPA 1J12A 2BSSB 3WJLA 1AIFA 1QBML 3S88L 2RQ8A 2OCFD 3TO2A 2C3HA 1YNTA 5F7WC 5H94A 5JHLL 1YEDB 3RRQA 3H7BA 1MCEA 5ISZD 4PJ8C 3LH2H 3WL9A 4GS7B 4D8PA 2Z35A 3D48R 3MODH 4MB5A 3N1QC 4WHTB 4JKMA 1A7OH 4NBXB 3MCKB 2AXHA 3ALXA 3OGCB 3O2DA 3DX7B 5IJKA 3SOBH 3D69B 5I1DA 4X6EB 2C7UB 3H9HA 4LRNH 4KRPB 3RTQD 2CKBL 1H15A 2P47B 4YIQA 2P49B 5C3TA 2QR0B 3IDMA 3CFBA 2OXHA 4A6YL 4M7KH 3EOYG 3C87A 5MHSE 2HVKB 4JN2A 3SDDD 1FORL 2ILLA 3NA9L 4P3WA 3L3OB 3T65B 4UV4H 3VFNB 4G9DB 4HJGB 2VWEC 4YHPB 2BVQA 3OBAA 4X7FC 1UH2A 4Z7OE 4PR5A 2EKJA 2BVYA 3RY4A 5JW3H 1VPOH 1Z6JT 3P2TA 3UP1A 1JZ4A 3WLBB 3TBTB 4ALAH 5C8JA 3RI5F 1LDSA 1EGJL 2D31A 3CXHK 3VGFA 2ICES 5HDBF 4P2RB 5IBTL 2BVTA 4ENED 1KB5L 4Z0XB 2ICWI 4PGEB 3LEXA 1IAOA 5EUOF 2XOTA 4MZ3A 5JORB 3I50H 4Y1AE 2R8SH 2CDFA 3EYSH 1SYVB 1ZANL 4POYA 4B50A 1HCVA 2VLJB 2ZPKL 5TDOA 3LKPA 5KG9B 2FBOJ 4JO3L 2XZZA 2H2SC 5C9JB 1WEJH 4GRLA 4ORGA 1UB6B 1JGEB 1WTLA 4AENB 3AROA 4R4BB 5GZOD 4F37F 4M3JA 1A6TB 1YZZA 1I8KB 4MA8H 2ZCHL 4EN3D 2AGJL 3ULSA 1E4KC 3QXUA 5I19L 5CS7A 1JNJA 1TJIH 1L0XA 4MAYA 3QZWA 1N3NB 4GW1B 3VXOB 3O3AB 1BF8A 2X4RB 3TPKA 2J2ZA 1FL3B 1QFWM 5ENWA 2FATH 3LVEA 5KS9E 1K9TA 1TVBB 3C09B 3RWIB 1EX0A 3HR5B 4OZ4B 3D0LB 1BD2D 5HHQA 2DD8H 1YEEL 4WY7L 2HTLD 3VWKD 1F6LL 4MA1C 3HTLX 1QG3A 3QDJB 2DQHH 4D0CB 4KKAD 1QO3B 3AY4C 1EJOL 2EEAA 1HHHA 3ARXA 4ZTPH 5BO1L 4OF5A 3OWEA 1EFQA 5I1GL 4LHUD 4XAKD 1TQCB 2FD6L 2CGRH 3EDFA 5C0CD 3TYGL 1T0MA 5E9DE 2JCCF 1DVFA 3VFVA 3VRIA 3D85B 3G6JA 4OFPA 5M7QA 5JNYA 2P7TB 1OGAA 4Y5YC 3S6CA 3SKNB 5T33H 1KIRB 5TDNB 2OX5A 3O3DB 4K23L 5JOPD 2HFGL 1IC4L 5EG6C 3MGAA 1LO4L 3FHAA 1G9NC 3OG6B 4JVWA 4Q9BA 1DBKL 4XZUA 3FT2A 1FQ9C 3O6KH 4L8SC 3GMOA 2YKLH 2ZUQC 4TNVK 5FYKE 5IW3A 1WZ1H 5C0JB 5DQJB 1PAMA 2LVCA 3EOAA 1K4CA 4S1RH 3H9SD 3G04A 3HZVB 4PREB 3S9DB 1UM6H 4J4PA 5FHAH 4P5TA 1LO3H 5EZOL 2VDPH 2LE9A 4R8WH 4MA7H 4I77L 2BY3A 4GG8A 5CJQH 4KKBD 1MAJA 3VRJA 1UXSB 2UZIH 2X4SB 4OM0H 1FC2D 2P5WA 3S3JA 2VZOA 4D9RE 3DX9B 1KPUA 2HP4A 4HFWB 4LOUD 1S5HB 5D7LB 1PVHA 3CDGB 1LO2L 1T2XA 5BV7L 5C09B 1IAMA 2Q8BH 3T0XA 4TQEH 4KZDL 2JJSA 3CLFL 5HVWA 4KTEH 2VXTH 1JTOA 5H2BB 4X4YA 4L9LA 3MRLA 4P23A 4N1HB 4L8DB 4N90E 4P2RE 3VXNB 1M7IA 4NQTA 4LPYA 5EWIL 1U2HA 1BFOA 4KKNA 3ZTNL 3TYFA 4FTVD 4FQJH 2VLJE 5DDHA 1NGQH 1WZLA 1PQZB 5C0EB 2WBJD 3ZE0F 5GISL 3ARWA 1GIGL 3QWOA 4XRCB 4XBGA 1QQDA 1A14H 1LO5A 2FX9H 2IADB 3QB7C 2P8LB 1IBGH 1WBYB 3G08B 1MCSA 2KDGA 3MXWH 4Y16A 4YC2B 3MUGA 1OP9A 5I30H 3GHBH 3T1FA 4QOKB 2ZG3A 1FIGH 3ZYOA 2AKRA 4S1SL 1TJHH 3NCJL 5HGDA 5JW4Q 5E8NB 3QXTA 4Y0GA 2FJFB 3JZ7A 4JDZB 4HUVA 1A1MA 4PJ7B 3BPLB 1EBAA 2XA8L 4UIKH 4G6KL 4J1UB 1NBZA 4LCIH 4OD3H 3DV4B 3FQWB 4WTZG 4X6DA 4UDTA 4RNRA 1UQSA 2X9YA 4PG9B 3WIFB 3HMXH 4O51B 3C5ZC 3HUJF 4ZUWB 3GM8A 2B4CH 3QDJE 4MWFB 5H37G 3MUJA 5FUCC 3MRBA 1J5OL 3O2WL 3FOLB 3EAKA 4HD9A 5C9KA 5EULV 1F8TL 3IDNA 3QUXB 2R1XB 1A7PH 3QIUD 2AJZB 4FZEL 4JFDA 3EFDH 4XP4L 3VGGA 3GI8H 2IPUG 3SDCA 5J6HA 3MOQA 5GJSH 3HCVB 5IJVA 1P2CA 2GIYA 2WZPD 1S7UA 3N1MC 1FZJB 5CHNA 5IVOA 3MGOB 1RUML 4P2OB 4WNQB 4ZOCA 1KJ3L 3MJGX 3SDXB 4IIQB 4I3RL 3R8BB 1D7FA 4JG0L 4OSUL 2D7PA 1EMTH 4LHQB 2WIIA 3MJ9L 2D7OA 1Z3GH 5KVDH 5AD0B 1YEGL 4F9LC 4DVBB 4UZGA 3X3FL 3ULVH 3IF1A 1BOYA 3C9NA 4L3CB 5BQ7B 4OLZH 2VKXA 3MV7B 2EYSB 5IQ7L 4R4ND 3TESA 5GIRB 3ROLA 2BSRA 3CSYB 3O6FD 1O7SA 1K85A 3T0VA 3ZSTA 4KPHH 1P7KB 1N2RB 4NHUA 1MCJA 5D5MB 1JGVL 3MV9D 3CFKA 3GMLB 3H3BC 3JWDL 5E2UH 1VEPA 4MJIB 4APQA 1TMCB 2EEBA 4HFUH 1U3JA 4HBCH 5D7LE 5GGTH 5E8EA 3H0TB 5C09E 4ZD3L 3U36A 5IMOB 1MSPA 1BFVL 3M1BB 2CD0A 5CZKA 5GSVA 5IQ9A 3WNNA 3HC3L 2NY5C 4KROC 4XH2A 2DQGL 3BGMA 2BNUA 4D0DA 1W2KT 1Q9WA 1H3WM 4WTXA 2EIZB 3FZUD 1ZS8A 2R29H 3HLAB 5I1CL 3TNNA 5DK0B 5DD3L 1JNLL 2NTFB 4I18C 3MA9L 1NL0L 1UZ6F 4ZS7H 2FJGB 3DSFL 4TRPH 1NC4D 2Q76B 5KN5A 5MENA 1ZHBB 2XTJC 3A6BL 5T5FH 1KIUA 3QUMA 4OTXH 2VLRB 1T5WB 4I5BA 4XXDA 1DJSA 5BJTB 1EPFA 1KPRA 3MO1A 2PXYB 3O4OC 4WW1A 1QFHA 3THMH 4AT6A 3PE9A 2DQTL 4NQXA 2J4WH 3RA7H 4HCRA 2EH7H 4Q97A 3QP3A 5EO0A 1CXFA 1KLGA 4QOKE 4HULB 1CFNA 2X5PA 4Y2OA 1IC7L 3W9EB 4NO2A 5IFAH 3K4AA 1HHIB 1QVOA 1EEUA 2RAMA 4PJ7E 2ICEA 5GJTL 1BQHB 1YYLH 4JFQA 2MQ0A 4R4FH 3SGKA 5ESVA 5F9JB 3WFZA 2YA2A 5B4MD 1B0RA 4XAWH 3WJLC 5MI0C 1IT9H 5I66B 3H42L 1UH4A 2NY4C 3G6DH 4MQSB 5F89B 3H9YA 3DJ9A 3KLHC 2R4RL 4MAUH 1G6RH 1T80A 2EYRA 1V7NH 3P9LB 5JPNB 1YQVL 3MXVH 2HFEB 2H2SD 5L9DL 2FWOA 1MWAH 4GBXC 4YHMH 2QQNL 4H20H 2ZOKB 3QXDA 2X4OB 3D2UB 3W82A 1T7ZA 3U48A 4X5WA 1KXQE 4R97B 2GW5A 2WBKA 3I85A 2VIRB 1BVKA 3ES6B 4FP8H 3BKMH 2D7QA 4HSQA 1UENA 4KJPC 3OPZH 3BP6A 5DFVC 4HJJH 3SDXE 4NRZB 4AY0A 3WHXB 1A6VH 1FAIL 1FNAA 3LZFL 2P46B 3OHXB 3VXRD 3MACL 2NNAA 4RISH 4LPUA 2F53A 5ADPL 1ADQA 3UTPE 1V3MA 2YZ8A 2ORBL 1S3KH 3MA7A 3S7GA 4LSQL 1MCLA 4GQ9L 5HYQB 2BY2A 5IHLB 1OTUC 4Q9QH 4UV7H 4XNMA 4GKZB 3PWVB 4HIIB 4O2EA 1I9EA 4OLYL 4Q6IC 3LV3A 4AZ8A 2IBGA 5FK9B 5D6CB 1A64A 5DVMA 2R56H 3W39B 3MV8B 3QCVH 4FFVC 3BXNA 3O9WA 3MV7E 1PYWB 1SBBA 4OLVH 1MCRA 3BMWA 1YA5A 5BOPA 1D6EB 1U91A 4ZPVA 2A6IA 1J0IA 2VDKL 4I3SH 4NQDA 3C5SA 3BH8A 4Y4KB 3NGBB 4ZO8A 1BZ9A 2LVEA 3P77A 3FOMA 4P3CH 5GRUH 4GOSA 1ORSA 1N0XL 1J88A 3DURB 4PY8I 3VWJB 3FFDA 5HDQH 3Q48A 5D5ME 4J3UA 5EUOA 4QYOB 1IKNA 1KGCD 3QEHB 4PP2B 1I75A 2VYRE 1WC7A 2VXVH 4J3VA 2GK2A 1A4JB 1CE1L 5HHVH 5KVEL 3MBXL 4ESKA 2B1HL 1Z9SA 3EO1A 1WWBX 1MI5B 3WNOA 1NMBH 1HHKA 3QEUB 1D5XB 3P73A 4YGVA 4C56D 1SEBA 2B0SH 5F7YC 1A7NL 2DQIL 2AK1H 3LEYH 1HINL 1C08B 1BF2A 1QSFB 4MAYC 2XTLA 5F3BB 1CZ8H 5IG7B 5C0FA 4MMZC 3LDBB 3DGGA 3WKMH 1KACB 1CK0L 1WZMA 2FIKA 4M4RA 3VCLB 4DFHA 4QHLA 4JZNA 1JRHL 2VLRE 5D1XC 2JB5H 3AFLA 4AIOA 3ECBA 2VC2H 4QCIB 4XP5H 4U33A 3WFEL 2V2XA 3BP4B 2X05A 3IU3B 3KPPB 1FN4A 5J13C 1MHEB 4PGZA 3WS6C 2VB5A 1MNUH 1IAKA 3MRHB 3NAAH 2OTWB 4U6XA 4XWGL 2V7HB 3S5LG 4RAHA 4X83A 3KYMA 3U4EA 2PTTB 4QRRB 2YPLB 3IFNH 3IKCA 3QXVA 4Y4HA 4OD2A 5IGXH 3BIAX 1NC2B 4OZGF 4NJ9L 3OXRB 5FAAA 4U3CA 4AIXA 3B3IB 3EO0A 2JCCA 1VFAB 1ZT4A 2BRQA 3JTSB 4XVJL 2JTDA 1TZIA 1OAQH 4MB3A 4CDGC 4NC1E 4UAOB 3UPRA 2NW2B 1RJYB 4HIEB 3RIAF 3DBXA 5GRXG 5IVXF 4NWTH 1HKLH 1FLTX 4R3SA 3Q6GH 5ALCL 3VXMA 1A9BA 2HJLB 5FUOH 2PNDA 2IAMB 4YNYA 2ZKHH 4QTIL 3MYJB 4TPRH 5JIPA 1AE6H 4WV1C 3NACL 5CGMA 4MCYB 1XGUB 3ORJA 3RPKA 3MLWL 4DTGL 3EYQC 3IDJA 3OB8A 3WFCH 4U49A 3VJ6A 1N5YL 1NCTA 4GG6F 4XNQB 1ZA3B 3H3PL 3J8F7 2I25N 2VSCA 1JHTA 1VADB 4OCSL 5EZJA 5BXFA 4HPOH 5FDWA 2BP3A 4LLWA 3QUML 4K7PY 3VFWB 4XC1L 3HFMH 2Y6SC 4KRMB 4N8CH 2Q7YB 2P5ED 3RZWA 5J3HC 3L95A 4M48H 5J9PB 3IFPB 4MCZA 5IBUB 4P57A 5CIPH 1NANH 3C5ZD 1XEDA 2VJXA 4HCRL 4W4OC 3CFJA 2JJSC 1AD0B 3WV0A 3UZVB 1UYWL 3PWLB 4Q6YA 3FQXB 1YNKL 2WLYA 2D9CA 1BJ1J 2O5XH 4P23C 4MDJA 4NKMB 4DQOL 2DI8A 4WGWB 1CQYA 5F96H 3HZMA 1PG7L 4WVRA 3CUPA 3GNML 2W9EL 4UBDD 1MY7A 1EERB 4X4ME 4JGJA 5I2IA 3LKOB 1FO0A 2F74B 2FGWH 3ULUH 3HE6D 3DVFA 4JFPB 1FBIH 3U0PA 1N5AA 1EH9A 1H3PL 4PGDB 4Y5VB 1OF2A 3EKCA 1F97A 1MI5E 5FA4A 1EHXA 2IGFL 3NTCH 1K6QL 2QHLA 1PG7X 3RBSA 3TV3L 4F15B 1ZHNA 4HIHB 1EHLH 1AFVL 1I8IB 3DUHA 3K8KA 5C2BH 2DN7A 3P40A 4RFOH 2O61B 3OAUL 1S9KC 1C5DA 2APTA 1FIEA 2DQJL 4G8IA 5BVJA 4LKCA 3SPVB 4QNPE 4AG4L 2QTEA 1ND0A 1UXWA 3DMMA 3UO1H 2A6KB 1U92B 1P7QD 2HKFH 4L4VD 3ZLQC 5I16B 3GBNL 3FRUB 2Q8AL 1QBBA 2JK5B 1R0AH 1CD8A 2SEBB 3T0EB 1MF2H 1KTDA 1MJ7L 4NDMB 1ZKAA 4LHUG 4XPGL 2OBGA 1H3TA 3HUJA 2E27L 5FKAA 4P4KA 4Z0BL 3ZKNC 1MCNA 3PQYA 1LHZA 4PJCA 4OV5A 1CFSA 3K7UA 1BBDL 3HPJA 4QRRE 2YD4A 3E6FA 2YPLE 4UINL 4LCUB 4KROD 5EIIB 4BFEA 5CGTA 3PWPB 4IBLT 4HK0B 3KYOA 2W1NA 4OZHF 1GGBH 5DUBA 2DB8A 3K8LA 3DUSA 1A6UH 2VE6B 1CICA 4Y7MA 3INUH 3K4DA 2APWA 2QEJA 3DO3A 8FABA 5ITFA 3DVIA 5EZIH 5EU5B 2XTJD 1S7QB 5EN2B 4N5UA 2VISA 3DIFB 3RY6A 2XWBB 5CINH 3ROOA 3M17B 3QNXB 5IFJA 1LK3H 4G7VH 4TULH 2IFFL 2RFXA 5DK2B 3VMOA 1JYWA 1PZ5B 4GAYA 1V3JA 4HUWB 2DLTA 3GBMH 2C9AA 1XF2A 1Z9MA 5ESAA 2AJVH 4IRSC 1Z2KA 3BVNB 3EO9L 4L8BB 1X5XA 4JM4L 1XF3B 2DQEL 3E2HB 4GKOA 1YUHB 4KH2A 3EYUL 1HCFX 1VFBA 5BZDB 4OT1H 3DNKA 2VSDA 3KVQA 4JRYD 2D4FA 2E6QA 2DMCA 4YQXH 4CRPA 1A2YB 1XZ0A 3KJ6H 3FO2B 4APQC 3OX8B 1MQ8A 2EXYC 3L5XL 1A3QA 2JJUA 2R2HB 1CFQA 5I1LA 1FL6A 4PFEA 1HHJB 3MUY1 4OIBA 1AXTH 1FZKB 1JWMB 4HLZG 3ARFC 3MLPA 5J11B 5I17A 2EIBA 4NUJA 4LVNB 1Q9OA 3TT3H 4L1DA 2D3VA 2CMRL 3H3KA 2A1WH 4RMWA 1OP5H 4DUXA 3MJ6A 3RIFK 4KJPD 5DFVD 3JWOC 1F58L 2YUZA 1LK2A 1DSFH 3P11H 4IHOB 2IQ9L 5D2LF 4E5XB 4PJFF 3KR3L 4YHIA 3CDCA 5CGYC 4NZRH 1NUFA 4KTDL 3NZHH 1KENH 2K7PA 3T77B 2YEZA 5IEHB 2BZDA 4ZFOA 4NO5A 3RGVB 2CRIA 4MNQA 5M94B 4XCCH 5C7XL 1RZJH 4NKDB 4POZC 1OTUD 3IFOB 3TPUA 5D1ZA 1FNEA 5SWZE 4EKXA 2EDQA 3ZDZE 2NY6C 3D18A 1OSPH 2W65A 1N64H 4KVCL 4FFVD 5T1DL 4XNYH 5E00A 5BVPH 1GGUA 4KMTL 4MD0A 4S2SA 1NGZB 1HHGB 2W0KA 4JRXB 4K3HA 1J1XH 4U6TA 1BBJB 5I1IL 4Y2DA 5GGSA 3D9AH 3T0EE 1XGQA 1MHHA 2F8OA 5CZXD 2LV4A 1I7TA 3Q1SL 4HH9B 1A1NB 4GRLD 5CEZH 3VFSB 2C1PB 5T5NG 1TZHB 3RWDB 2AJYH 4QXUH 3QI9C 1OP5K 1S7SB 4H5SA 1VFUA 4YHYB 2ZZUT 5DD5H 3PWPE 4RGMC 2P43B 1G7IA 4HWNA 3CSPA 3PNWB 3CFEB 1MCOL 4JQXA 3WUWA 2X1PA 1U8NB 4OLWH 3T0AA 5I1HL 2AJSL 4MAYD 1LEGA 5DI8B 5EO9B 1VA9A 4G8FB 1UWEL 3C08L 4BZ1H 1R3JA 4UT6L 4QT5A 4PJ9B 2WINB 2OJEB 1ODAA 3V9FA 3QH3B 3KXFB 3MR9A 4QRQA 3MV11 4PJEF 3ZO0A 4NO0A 4DGYH 4NQSB 5FGBA 4HZLA 3VE0A 4PJHB 3WSQL 4PRBA 1G6RB 2F19L 3SO5A 1MCFA 3LPWA 5EA0H 5DRZB 4XB8A 5IVZA 4MX7A 4OGXL 1MWAB 1OGTA 1UCTA 4K7PH 3O9WC 4K3EL 4S1QL 5DJ6A 5C6TH 1V3KA 1G7JA 3B2VL 3BKYL 1H5BC 1IM9A 1U3HB 3PWUB 1EAJA 1N6UA 4OIIL 4WEMB 1CLCA 2IALA 5EPMB 2MPAL 3PF2A 3WFBH 3QFDA 1DLHA 1J0ZA 3TZVB 4EEEA 4YO0A 1DBJH 3C2AH 1OGAD 3LKQB 2NR6C 4BSJA 4FMKA 4OCMC 3L6FA 3QHZH 5FOBA 1VESA 2EC9U 3CX5K 5DRXB 4OCXL 5DEZA 3MRQB 3DVGB 3NN8A 5MERB 4EDWL 32C2B 1QFWH 5HHNA 4JQIL 4OBRA 5SWSD 3BSZH 3MLTB 2QQLL 1G7LA 1NDMA 1RURH 5JDSA 2L0DA 4H0HB 2ZUUA 1HZHH 3KYNA 4JZOB 4FQPA 5JZ7C 3ZE2F 4YZFE 5I1KL 1T7XA 2IQAA 1A4KA 3ULVE 4AEFA 1IEHA 4CUCA 3EYQD 2IG2H 4HWBA 5DVLA 1MRDL 1IGML 3EOTH 3IDIB 3BWUC 4NKOA 1FNSL 2ESVA 1GHFL 2H2PC 4X6CF 1NGYA 4U2ZA 5TE7L 1U6AH 3BO8A 1AR1C 3I2CL 2VDOH 3DI3B 5IMMB 2J6EL 5TF0A 4E42B 2Y6SD 2P5WD 1EFXB 5J3HD 1IKFL 1F45A 4DWHA 2JJWA 2N7BA 5FHBL 5J6GA 5DJCA 4R0LA 4O02H 2FYYB 3BPCB 3W2DH 2MKWA 1OT2A 5CMAB 1KEML 2VQ1A 4DZ8B 1ACZA 3VH8G 2VAAA 3MREB 3PDOB 3U4BL 3NFSL 1IFHL 4WJ5A 3EOBB 1S7TB 5AWNH 2X4NA 1QFUL 2A83A 4P23D 1MOEA 1NSNH 4OZGA 5D7SH 3RWFB 5IB4A 5LXGH 5T1LA 4JRXE 1J1PH 4FQQB 5JA9A 3GSQB 3WDIA 2V2TA 3O8XB 1DE4A 1REIA 4YFDB 5EIQA 4XMPH 1UWGH 4PGBA 5KANG 2EO1A 4PRID 5IVXA 1C8PA 4YX2L 4EUPH 1QRND 5B39A 5TGBA 4U7MA 5CJOH 2Z9TA 1CU4L 3ARZA 2BDNL 4D94A 4ONFL 3OKDB 4G9FE 3KPTA 1WIOA 4WO4B 1DBML 1FH5H 1ONQB 4ZQKA 4Y16D 1UJ3B 4M6ML 3TCXA 1XGRB 1S7RA 5GGQL 3MRMA 4PTUB 1WQVT 4XBPB 5FUZL 4GG6A 2DQFB 2ITDB 3WLWC 1FFPB 2J8UB 2ED8A 1QTYT 2VDNH 3LRHA 1LDPL 4G5ZH 3KXFE 2WP3T 1D6VL 4B5EA 1FP5A 2R4SH 3UJTH 4N0YH 4LKXB 3MRGB 4MXWH 4PJHE 1JWUA 2GKIA 4YR6A 3DRTB 2WBWB 2OTUA 5CUSL 2AV7B 2GJ6B 3MZTA 4M6NL 3ZKND 2DIJA 2DM2A 2G5BA 1UM5H 3CMOL 5AUMA 3NFNB 2ADIB 5DEGB 4ODTL 4FFZL 5C08A 4M5ZH 1EHNA 2OL3A 5JHDA 3LKNA 4JFXB 5B21A 5C07A 5DFWH 1NAMH 1BQLH 5ICXA 1EO8L 1YJDL 2AABH 2CJUL 3QFJD 4V2BA 1UWXH 3HI6H 2XQYK 1IZKA 1PY4A 3B4NA 1UKQA 3ZYJA 2Z93B 1I7ZB 1T0NB 3OKEA 4ZFGH 5IM7B 1JGDA 1T3FB 3F5WB 2EH8H 2GYSA 5TFSH 1IGCH 4GLRH 1F4WL 4HX1A 5CIPB 1DBBL 4PRAB 4E41A 4K3JL 2BJMH 1ZV5A 3X3GL 3VXPA 4HAGA 4ZFZB 1KNOA 4RSVA 1CLZH 1F4XL 4J2XA 4TUKH 1FJ1A 2FJHB 4OI7A 4ISVA 1ZHLA 5A16B 4NNXA 3V0VA 4CDHA 4OCNC 4YWGL 1T22A 2WNGA 1JWSB 1FLRL 3QG6B 5DYOA 3LS4L 5CFHA 2EIDA 3S4SA 3EGSA 5ILTL 4RFNB 4WFED 3WN5C 1ZT1A 4CVXA 2D0HA 3V0AC 4APQD 4P4KC 3GJFA 4LPWA 1QR1B 2EXYD 1RHHA 3ARGA 4E0RB 4O4YH 1OAZH 5DXWA 4HDIB 2ZUXA 4BSVA 5DHYB 2FBJL 2X4PB 4NSKB 3UTSA 3SE3A 5KJRH 4DN3H 3GSVA 4ZSOA 1FFOA 4F8QA 2R0WH 7FABH 1D9KC 1UWXK 2Z31A 2RR3A 4PUBL 3OKLB 5CZVL 4F57H 1EBPA 4OZHA 4BQ6A 1XIWC 3V4UL 3TN0A 2Y5EA 3QWRA 1HYSC 5E6ZA 1JGLH 4L3EB 5CEYB 3TF7C 1OSZB 4WUKH 3F12A 4JM2B 4CVZB 3RWHA 4JB9L 1NKRA 1LE9B 4B53A 3L5IA 3Q6FA 5K9KA 5CGYD 1G7MB 5I8KL 3KYAA 2XQBL 4WUUA 3L3IA 4LLQA 4MD4A 4UQ3A 5DHXB 3GK8L 2W9DL 1C12A 2BCKA 1CN4A 2R23A 4DEPC 3NIGF 4HKBA 4KMQA 4QRSA 1H8NA 5HGAA 4POZD 2EYTB 3RDTC 1KJ2A 3O11B 5DMIH 1G0DA 4HQQH 2NY6D 4KK9C 1MAKA 3BZ4A 3GRWH 1QSZA 1DLFL 5FFLA 2A74B 4OKVA 4HWBL 4JFEA 2J8UE 2HKHH 4HT1L 1X7QA 3DLQR 1FFNB 3VXTB 5J12C 4LGRB 1IQDA 4WEUD 4KK6C 3WEXB 1OOAA 4Q0XH 5DA0B 3I6GB 3S97C 3V6OC 4I0PA 5K93A 4MNGB 2A38A 4TNWK 4CNIB 5KSAA 1F90H 2DYPD 1IGYB 1R5VB 4M7LH 4KC3B 2GJ6E 3OF6A 5JMRA 3MQIA 3KPNB 1BAFL 1E27B 5D9SB 5DJZA 4D9QE 3QI9D 1PKQB 5FF6B 1NCBH 1N8ZB 4HKZA 1NANI 4P4RB 3D25A 3PIQB 5IIEA 5I76B 3IVKB 3LH2L 4HXAL 2VL5A 4QXGH 5IEKB 5LQBL 3TBYA 4JQVC 3BP5A 1AO7B 3O4LA 5LJYH 1RZKH 2VMFA 2DJSA 1IGIL 4LCWB 5D2LA 1IAIL 5CJXA 2B20A 3MROA 1QEWA 5DJAB 5TPWL 1ZVSB 1FSKB 3MCLH 3UCRA 5EOTA 2YD1A 4BYHA 1R3LB 3DVNB 3EBAA 3IAPA 1NBYB 4I4WB 4PGCA 3U9UB 3BN3B 4HGWB 4OFVA 1T4KA 1HN1A 4M7KL 4NPYB 5DT1L 1B6DA 1CLOH 1CDBA 3LKSA 4HXBH 3T4AB 4RZCB 3FMGH 1M05A 1SY6A 4WCYL 3O9WD 5BRZA 3MRRA 2Q3ZA 5FKPB 5LGJA 1N6QL 1BIIB 5DJ8A 3SCMC 1JZ6A 5FO8B 5HYSG 1GAFH 1ZHKB 3PGFH 4UT9H 4YDVB 4LDOB 1Q72H 2VN4A 4Y2DC 5CEXA 3MRFA 1AGBA 3JUYA 1LEIA 2ITCB 3AREA 2NR6D 4Z76A 3B9EA 3RAJH 4XMKL 4BH8B 3ULUE 2FL5B 3SDDB 1C7SA 4KI1A 4TVPD 4HIXH 2JIXA 1FYTD 2F58H 3IGAB 2VDRH 2FHCA 1UEMA 5ACMA 4HW6A 2QQKL 3HNSH 4DN4L 4LEOA 5DMKA 2PW2B 2CLZA 4JQXC 2W0FB 1GL4B 5E4EB 5F88B 3VXUD 4BFBD 4N0FB 4ODWA 4OKDA 1I9IH 4YPJA 4FRWA 2IPTL 4QRUB 3BW9A 4L3EE 2AS5M 2HH0L 1HNGA 1AGCA 3S88H 5ICYB 4DGVL 2H2PD 2FECI 5B38G 1AR1D 1TJIL 4PJDB 2PYFB 3LD8C 2E8YA 3GFUA 1JMZA 4PJEA 4FXGA 3ARBC 3ZT6A 4ZAKC 4LFHG 3X14B 4ZDHA 5C0NC 3FFCB 2FATL 4ZOAA 3SDAC 1T1ZB 4J3TA 2V5SA 4HUMB 4GUPB 3DWTA 2QQQA 1C16A 1A6ZA 3LQZA 5I8EA 4Z7UF 4EN3B 5I75B 3ZDYF 4FFYL 3UTTD 1GGCH 3FQNB 4XNUH 4Z78A 3TIEB 2O93L 1FHGA 2IPKA 4JJ5A 4XMLH 1MUJA 2CKBH 3AXLA 5I74B 4QGYA 5KSBF 5L8LB 3IETB 4MNGE 3DV6A 4A6YH 2BSTA 3W5NA 1B4JH 3L3HA 1HI6B 1V7ML 1QLRA 2CGRL 4P3DA 2DLIA 4M03A 3VXMD 1FORH 3BKCL 3NA9H 2QADB 5I73B 5E6IC 2X9WA 3DRQB 3VWKB 4HEME 4H8WL 3CZFB 3P0YL 3LN4A 4V1DA 1Q94B 3BJLA 2CRYA 3QUKB 2Y7QA 2H8PB 1PKQE 2AXGB 5CBAA 4DCQA 2OZ4A 2MCPH 1B9ZA 3VRLF 1U8KB 5C0GA 1FFQA 3MGTA 3MRIA 5DSCA 3HPLA 4Z5RA 1U42A 1EGJH 1QHOA 3Q2CA 2EC8A 2EDOA 4LVOC 3BYTA 1KB5H 2YKLL 1AO7E 3WLWD 4HS3B 3O3EB 2H26B 4YK4B 3UXFA 4LCWE 4X6CA 1VSCA 4R96A 1E4JA 3ZTJG 4U1LB 4JO3H 5CSZB 1SJVA 2APVA 4EI6A 3W9DB 4UU9B 5FHAL 1I8MA 1DL7H 4ZMAT 4ZODA 1MJUH 3SE9H 4N8VG 4R8WL 3NMEA 5HY9B 4QHMA 1XGYL 1JUFA 1LD9B 4S0SD 4EDXA 2ZCHH 4OM0L 1VGEL 1P69B 4N0CD 2AGJH 5C6PB 3BEVB 1IEBA 3W5MA 5I19H 2AEPH 2BNRA 3LSOB 4X5LA 2XZAH 1YPZB 5DMGC 2IH1B 5D6DA 3QDMB 1TITA 4L29A 5JUEH 3G5XA 2CXKA 3BI9X 4YBLB 4HWEH 1TIUA 1YEEH 3CU7A 4WY7H 4PRPB 2AERT 3OKYA 2W60B 1EJOH 2VITB 4DK3A 3C60C 1LEKA 3C5JA 3QZWG 4KGLA 3U0TA 3IXAB 3CPLA 5BO1H 5I1GH 3SKUD 1NLBL 4IRJC 4B0MM 2DLEA 2FX9L 1A14L 3C6SB 3KPOB 2ICWA 5TH2B 4WTZA 1DQJA 4JPIA 3BH9B 4JVPA 3BZFA 4G8EB 5FGSA 5ACZA 1GZPA 3HI1B 3P4OB 6FABL 3D6GA 5J56B 3DMMD 1QSEB 5DA4A 4HC1A 3SGJA 4CADB 4PJDE 5AG9A 5KS9A 4JHAL 4M3KB 3PP3K 2HFGH 1L7IL 1AHWA 3KJ4C 5IB2A 1LO4H 1ULVA 1QBAA 4OZFG 1O5DT 3FFCE 3GIVA 1DBKH 3WDJA 4Q9CA 4MXVF 1MRFL 1WBZA 3G5YB 1V3LA 15C8L 4JCLA 4HWZB 4P4KD 4EUPB 5CEZE 3PQYD 4N0UA 1NEZB 2AXFB 2NY5H 4H1LG 3HRZB 3AGVA 3NPSC 3PV6A 3CH1B 3S34L 4YXLH 4RAVA 2B4CL 4Z7QE 1YYML 4G6AC 2EDJA 4HIJB 4QF1B 4RAUA 1NGWB 1D9KD 3DXAB 2D03L 3N85L 1D5ZA 5E9DA 5EZOH 1WAAF 1YN7B 4I77H 1CICD 4RGNC 3FB6A 2ADGA 4CVUA 1HYSD 2BSSA 4I1NB 1MCDA 3GI8L 4MXQD 4IOIB 4LSDA 5GJSL 4BZYA 4P2QA 3X11B 4AYFA 3ARDA 3SY0A 1XR8B 4OJFL 3O6ML 4MA3B 1J0JA 5BV7H 4OM1L 1YEDA 5IMLA 4IJ3C 3BD5A 1S78D 5FEBA 1HXMB 1DANU 3T2OA 4O5LH 4NQUA 3U83A 3ZHLA 1EMTL 5FB8B 1QFWI 3RDTD 4LSUL 4XB7A 1Y0LA 5CD5C 2QV2A 4KK9D 2M1KA 4NN6B 5EWIH 4H26A 2F54D 4U0RC 4MNHA 5EFIB 4HHAA 3JV6B 3QQ9C 5D93C 4ZPTA 3GMRB 5DJ2A 1NAMB 1RK0A 2V2WA 4LMQI 5JOPE 5GISH 1GIGH 4GAGL 4PJIB 3TH4T 5JQ6L 3RWGB 3VG0L 1LO0L 4ZYKA 5E24E 2HVKA 3T65A 3ARGC 4H25A 1KC5L 4KPHL 2BC4A 4G9DA 4G6FD 1HEZB 3BT2H 1A6WH 1CVSC 5FA3A 3B5TA 2WUBL 1NPUA 3GSRB 3BRFA 1XCQA 4LLAA 1Q9LB 1KTKE 2FH8A 4GSDH 3O2DH 2I9TB 5E2UL 1BZ7B 4RFEB 4G7YL 3B9DA 4S1SH 3NCJH 4U1MB 1QA9A 1YPZE 2X7LA 3B9KC 3U6RB 2HT2C 3QDME 2OQJA 2XA8H 4PGEA 4G6KH 5T3XD 1OQOA 1T83C 2Z8VC 3N0PB 1A02N 5DZOA 1MLCB 3MFGB 4JN1H 4YLQT 5GS1A 4ZNCD 4PRPE 4GRWH 5KG9A 3N1GC 4C4KT 4J8RA 3OKNB 3SKMB 1J5OH 1FZMA 3STLB 3Q3GA 4GKNA 4DAGL 3O2WH 1WCBA 1JGEA 4TRPL 5CWSB 5BOZG 4AH2A 4AENA 4MNQD 1F8TH 4OTXL 4JEGB 2FO4A 3EFFB 3EJZC 1P4LA 1I8KA 3GEWB 1JPTL 4YDLB 5JPMB 3KHQA 4OQTA 1KLUB 1I1CA 1LVEA 2J4WL 3QJHB 4GW1A 3RA7L 2EH7L 2VDLL 1KJ3H 3O3AA 4WI5A 1R5WB 3VXOA 1OD7A 4Y89A 1FL3A 1QSEE 4I3RH 4ZXBC 3VGHA 1NC4B 4OSUH 5T5NF 1JNHA 4YUEL 1I3UA 1JPFB 4Y2DD 2QSVA 3MJ9H 1HQ4B 7CGTA 3LHPL 2HMIC 2MKLC 4XCFH 1YYLL 4R4FL 1KJMA 5GRWA 2YSSB 1YEGH 5H35B 1XFPA 3G6DL 1U93B 4NN5C 5CJBA 3X3FH 1H0DB 4JFFB 1DQQB 5IWLC 3MXVL 3NCYP 3DXAE 3K1DA 3KYKL 5IQ7H 3LY6A 3P4MB 5LAXB 1OY3B 1J11A 4H20L 4X7TB 4WHYH 2WW8A 5F6IB 2W0LA 1T04B 5T3ZD 2P7TA 4MYWB 3SKNA 4FZ8L 1UG9A 2VABA 2Y06H 5CJXC 2NX5B 4FP8L 1YEJL 3GUTB 3JWDH 4IMLB 3AS2A 3OPZL 1P9MA 4HJJL 4NO0D 3I9GL 2H3NB 4Y4FC 3HZKB 3VFUB 2HJKA 4G43A 5C0AD 4ZD3H 1A6VL 1VGKB 1BFVH 1T66C 1S9WA 5C0ND 3HC3H 4MJ5A 2VR5A 4RISL 3HI5H 2IAND 4NQCD 3SDAD 2DQGH 4KK8C 1CVRA 5C0JA 5I15H 5DQJA 3LKRB 4IRZH 5I1CH 4GLRI 5DD3H 3VFGL 3WO3B 1IM9D 3HZVA 1NL0H 2GSIB 4F80A 1WFNA 4U0QB 5BW7C 5CP7A 2X10A 4UV7L 1G7HA 2X1WL 3DSFH 3L7EB 3REVB 1TTUA 3WXVH 3HB3C 2ZSWA 4HC1L 2ARJB 4LLUB 1JMXA 4PJIE 2P8MB 3V5DA 2VTFA 1IZJA 1PZUB 1IC5H 1Q9KB 1SJXA 2CUIA 2Z8WC 1LP9F 4HFWA 1JHLH 3L7FA 1EAPA 4EI5C 2DQTH 5D7LA 5E6ID 5FXCH 4UIMB 2Z8SA 4PJXB 1IQWL 1T89A 1XF5B 1E4XL 1IC1A 3H2WA 5DF0A 2X4QB 4K7FA 4W68A 4PJGF 2VXVL 1IC7H 1TFHA 3KHOA 4WWKB 2LU3A 3VMNA 5L0QC 2L7JA 1IAIM 2OMNA 3E6HB 1FDLL 1LNUB 5D7IB 3PG2A 2UUDH 4RQQB 3VMPA 5D2NB 5FCSH 2PW1A 4NKIL 2UWEF 1MLBA 4ZO7A 1YY8B 2CSPA 2XNAA 4L4TA 5L9DH 4F7CA 4YHNA 4U1KB 3S5LA 3VD7A 1DUZB 2IADA 4QHUB 2IH3B 4Z9KB 3G08A 1QLFB 5F21B 35C8H 1NJ9B 2VC2L 3DX6B 4Z7UA 5ISZA 4G8GB 1M6OA 3HE7A 4MJ4A 4L8CA 2NXYC 5C70A 4U7KA 5IMKA 5E8NA 4JY6B 1MNUL 5DMGD 5T1LD 3LZFH 3MX0A 1OL0A 4JZJA 3VFOB 3DV4A 2G2RB 5IHZA 5SX5H 43C9A 3LOWA 4UB0H 5GS2H 4N0RA 1GPOH 1X5GA 2D4DA 1K2DB 1OTTC 4G80B 3U46B 3BESR 1U8OB 4GQ9H 3KPLB 1Z0MA 2Y9RT 4CMHC 4XX1E 3FOLA 1MJJA 3GHEL 5D7JB 5FECB 2DLFL 4OLYH 2VWEE 5DFTA 3QULB 2UUDK 3P9MA 4JFFE 1HKLL 3IDGB 4HUUA 4C83B 2P1YA 3CFDB 2AJZA 4GMSL 5LGKA 4IRJD 3VFMA 2ZKHL 1NCWL 4K8RL 3QUZB 2VDKH 5FM5O 2DQUL 3RWCB 3PXJA 3RJDA 1AGFB 4TPRL 4TTDD 2DI7A 2JELL 1YEKL 5CD3B 1P1ZB 1N0XH 3LMJL 4P2OA 3PGCA 4MQ7A 2LU4A 4F9PA 2NX5E 3FO1A 4JFYA 2C3VB 2X41A 4KI5E 4FS0A 1KTLB 4XPTL 1A1OB 1T5XB 1XMWA 2CKBB 3LB6D 4OLXL 3V5KA 4DZBA 4JO4L 4A6YB 4AL8L 3SKJL 1CE1H 3KLAB 5FOJA 3SKOA 5IVNA 1SVZA 5KVEH 3MBXH 2B1HH 2W0PA 2I07B 4XXCA 2MQCA 5DJ0B 4KXZH 4PBVC 4HPOL 3RHWK 4P2YA 3K0WA 4KJYB 1I7UA 1CFTB 3HFML 3C6LC 2ZUVA 4N8CL 1A7NH 4R2GC 4L3CA 4M48L 1HINH 5GGRB 3MJ8B 1DQLL 1YEFL 1ZA6B 4RCAA 5DD6B 5SX5K 4MB4A 1S9VA 3HNVL 4G6AD 3S35L 4Y5XC 5JHDD 1CK0H 2Q3AA 1X5JA 3NCCB 4MHHG 4WI9A 1JRHH 1CCZA 4JFHE 4BA8A 1E6OH 1F4HA 1KB5B 5E8PB 4RGND 3WXWL 5ID0A 2O5XL 3NCBB 5D1QB 2HYMA 5ERWB 3GMLA 3WFEH 4QHKJ 4KDTA 2AJ3A 4I2XE 5L2JB 1NFDB 4MJIA 1AD9B 1HILA 3PL6B 4PJXE 1QUNA 1I9JL 4Z95H 3GSXA 3U7AA 4NCC1 4WFFD 1T1WA 1NKOA 2BVOA 3S35X 4WW2C 3B6SB 3ULUL 1BD2A 1HQRB 4XWGH 1PBYA 4E41D 1FBIL 4KGJA 5FYJD 1I7RA 1X5YA 4NJ9H 5D7IE 1ZLWH 3L3JB 5B8CA 3FQUB 3N50A 1MPAL 3RUGB 2HFFB 2XZQL 5D2NE 4LHUA 1IE5A 1I1AC 2R1WB 2YR3A 3QEQB 1EEZA 1G7PA 2Q76A 3G5ZB 3F62A 3LPFA 3BRDA 2R9HD 1I85A 3VDCA 1EZVY 1XCTB 1EZVX 3QQ9D 4GXVH 4PLOB 12E8H 4LCCB 3HE6B 1FGNH 3VGAC 4XCNA 4PGJA 5HHOD 3HZYA 1U41A 1AC0A 4M93C 3RVXC 1MFDL 1I8LA 4NQEA 3ARGD 3OKMA 3NACH 1P84K 1HH6A 1VKXA 3I3EA 1DZBA 2F5AL 3MLWH 2LAGB 1D5BB 5IK3B 5T1KB 1MF2L 1S7VB 1A5FL 4G8GE 1N5YH 1WWCA 3GSOB 3AS3A 4X80H 2XKSA 2ATPB 3H3PH 2H9GA 1U8HB 1HSBB 1HHIA 1KOAA 3MRPB 3MNWB 3B9KD 2X9XA 4OCSH 2CLVB 2HT2D 4U1GC 1U8QA 2ZSVA 3BRGC 4FNLH 2D7MA 3QUMH 4U6HB 3T4YB 1WAAA 3H9SA 3OJ2C 2W91A 4XC1H 4KKLC 1DBAL 1P7QB 3GMMA 3KLDA 5DURB 5F89A 3ZDXE 4DOHB 4BSWA 4LEXH 1GGBL 3QUYA 2B5IB 1KG0B 3TO4B 5F6HI 4ZUSA 1A6UL 4UNUA 4WUUD 5FDYA 5C0IA 1ZLWK 3P9WB 4HCRH 4X7DC 1NMCB 3INUL 2FX8L 4OGAC 4GS7C 4JO1L 1CDJA 3MLUH 2GJZA 4PRNB 3N06B 1YNKH 2B8OT 2IEPA 3QO0A 3EJZD 4DQOH 4KROB 3ES6A 1UACH 2E9JA 1PG7H 3QDGD 3R0MA 1WFTA 3QISA 4ERSL 2JB6A 4KRPC 1NUDA 3GNMH 2W9EH 1TTFA 1T6VN 5MEOA 3GBML 4PJ5A 1UVQA 1WK0A 1ZVYA 1D5MA 2R15A 4ZXBD 5D96B 3SJVD 1HKFA 2AJVL 1DEEA 1H3PH 4LVHB 3VFPB 4ZOEA 1MHCB 3L9RA 2J1KA 2AV1B 3N1PC 2CLRA 2HMID 2IGFH 1Z5LB 3Q5TA 5HYQA 4BH7A 3OF6D 3RPIA 4OT1L 3PWVA 3TV3H 2WBJA 3P4LA 4YQXL 2BVPA 4F7EA 5BV7B 1WV7T 1AFVH 3M8OL 3KJ6L 3MV8A 1PYWA 3OAUH 2PR4H 4Z7WF 2ZNWA 2DQJH 1I4FA 2FSEA 4AG4H 5IOPB 3L3DA 3I75B 2ZOLA 1AXTL 2JJTA 3FAXA 3CC5A 2BFVL 3GBNH 2I9LB 1ADQH 4UDUB 2Q8AH 1AIFB 3QEHA 1NFDE 1QNZL 3VGBA 2CH8A 1EO7A 3OR6A 1X9QA 4XNXH 2XI9A 5KVFH 1YNTB 4Z0BH 5DHVA 4YDJA 1JGUH 4Y4FD 1DSFL 2P24A 3O6LH 3P11L 1FZOA 5H94B 1T66D 3H7BB 1BBDH 3RKPA 3WL9B 4UINH 2CUMA 4D8PB 1W0VA 4P9ML 1VFOA 4GXUM 4S1DC 4OAWA 4KK8D 4WFHE 5CSGA 1QSFA 1MCBA 5ETUB 2GT9B 5GGUA 2OXGA 2DJUA 4Z7VF 4P5KA 1KN4H 3RUGE 5IG7A 4XCCL 4M1CC 2M2DA 3MSPA 5I1DB 3QEQE 4JKLA 3QIUA 2CR6A 3E0GA 3H9HB 3C09C 3GMNA 1J18A 4RIRA 3ZKSD 2HFTA 2OR8A 3FT4A 3HB3D 1OSPL 1H15B 4YIQB 4LVEA 4F2MA 1T6WA 1N64L 3L5HA 1QACA 3ARED 2XACC 4QCIA 5BVPL 4NRXA 1DP0A 3VXQA 1UH3A 2IFFH 4JN2B 4GRWB 1ZMYA 4NGHL 5GRYA 1A6AA 1MHEA 3CDYA 4EI5D 2YRLA 2XRAL 2XWTA 1RUPH 1TETL 4K55A 1QZ1A 1L9MA 2JF1A 1FVEB 4QRRA 1TQCC 5FIEA 4XVUC 3EZ8A 2VN7A 5CEZL 3NIDE 1KSRA 1I1FA 4TOYH 3FN9A 1YY9C 3EO9H 3OXRA 2EKSA 4JM4H 2AJYL 3PABB 2D31B 1OB1A 2DQEH 3B3IA 3B8YA 1RQ5A 3EYUH 3T3PE 3T0BA 1T20A 1X6LA 4DOHE 5D7KE 3LEXB 2NW2A 1IAOB 1UKSA 5F3HA 1FNGB 1MJ8L 1RIVL 4OLWL 2CDFB 3KAAA 1P9MC 2FHFA 3L5XH 5TDOB 3LKPB 1QPPA 2IF7A 4ONHB 4YHKL 3RI5K 2IAMA 4GRLB 1MFEL 5DEFA 5IB3B 5DR5L 4LARL 1EK3A 3MV9A 2GK0B 3QNYA 3NA4A 4YJZL 3TCLA 3VA2C 4MCYA 2HT4C 3OGOE 1HOCA 3MRCB 2X4TB 2KZ1B 1B0GA 1CL7H 3LAFA 2XT1B 2Z91A 3ULSB 5HXMA 5EA0L 2B2XH 4PJ8A 4HG4J 4MAYB 1R5IA 1F58H 4JFZL 1VADA 4M9OA 3RL1A 2NXYD 3LIZH 1TQBB 2I60L 4WI7A 3KR3H 5ENWB 2HRPL 4F37K 1NLDL 4UTBH 4QEGA 1HDMA 3WFBL 1LP9A 3T1WA 1OTTD 2A6JB 2X1XR 4PD4K 4DKDC 5C7XH 1F11A 4V1DD 4DVRL 3QHZL 3ZKXB 3R06B 2APFA 1RMFL 3MRDA 1HHHB 2VERN 2ZWLT 4PJGA 5T1DH 1FG2B 5E08L 1CDYA 1RIUL 3VI4F 5IBLC 3LQAH 2EDLA 5FV1L 5INCA 3N1FC 1T0MB 1NCDL 4DGIL 1DVFB 4RWYH 4R26L 3VFVB 1A7QL 3VRIB 3G6JB 5DUPH 3B5HA 5I1IH 5JNYB 2X44D 2F74A 2Y36L 2ENYA 1G7QA 1K3IA 1U8JA 4JFPA 2UWEA 3HR6A 5M95B 2PYEA 3WNLA 3AB0C 2H6PA 5DD0L 4S10A 3UTZB 4XHQA 2G60H 1U6AL 4LF3B 2FR4B 4K94C 1JP5A 1AH1A 4YC2C 3RWJB 3GMOB 1CD1A 4WENB 1ZK9A 3OAZH 3C6LD 5E8DL 4Z7NE 4R2GD 3BN9C 3ZE1E 3GSNA 1INEH 2XV6B 3UEZA 4NNPL 2AJSH 2DTSA 3HE7C 2BNRD 4JR9L 3E3QE 3G04B 4LCYA 1UWEH 4O02L 3C08H 1DQTA 1NFIA 3BPLC 2VZ3A 4UT6H 4X4XB 3VU2A 1CGSH 1FO0H 4P5TB 1UADC 4YBQC 5EU3A 1P5UA 5AWNL 4WI4A 4GG8B 5ALBH 2JK5A 3VRJB 4DKEH 4Y1AD 2GHWB 3KPQA 4NDMA 1NSNL 2P4AB 5D7SL 4GRWE 2P5WB 1J86A 5LXGL 2F19H 5E2VH 1J1PL 1KPUB 4JPWH 1KIPA 3VXRA 4LQFL 4OGXH 3QUXC 2R0LL 1UWGL 2ZUYA 4LNVA 4K3EH 1KYOJ 1GJIA 4KJWC 4EOWL 4U1NA 3B2VH 3BKYH 4LCUA 2YWZA 4X4YB 4L9LB 5CJOL 4OIIH 3NH7L 3MRLB 1CR9H 3NPZB 2MPAH 3REWA 2V9RA 4WIQA 3AY4A 1M7DB 4P2OC 1FNFA 5EDXA 4IS6A 2VE6A 1M7IB 4IIQC 1FH5L 3QRGL 1BFOB 1I1AD 5TQ0L 4FQ2L 5DDHB 2C5DC 5EN2A 3V4VL 3OAZK 3MFFA 3BFOA 4JQIH 4JDVA 3DIFA 2XWBA 3QWOB 5TE6H 5HGBA 4XXCC 1AXSA 2QQLH 4XBGB 3ZL4L 4Y5YA 1BVLA 4NN7B 1ZGLP 1LO5B 3FQRA 4AMKL 1U58A 3RVXD 5JLZA 5JR1H 5BS0B 5DZNA 5EOCJ 3UJTL 5K9OA 5I1KH 1GOHA 4MXWL 4Y16B 3MUGB 1CLYL 3ZHDA 5EBLA 1FPTL 1UA6H 4XPAL 2PN5A 3T1FB 1TXKA 1MRDH 2AKRB 4L8SA 4N9GA 1FNSH 4C56A 4KQ4L 5E9DD 3OJDA 5HGDB 1UM5L 5TE7H 1YUHA 4HUVB 3I2CH 5D72H 2J6EH 5EC1A 5I71B 4KKLD 5AYUH 4P2QD 3BDBA 4KDTC 4X6DB 4UDTB 4RNRB 1UQSB 5EU4B 2A9ML 5FHBH 5E7FA 1H9VA 1BQLL 3O2VL 5CJ5A 3MRBB 2AJUH 1KEMH 5CBEA 1KB9J 4LP4A 4OGAD 3QNZA 3HI6L 2NY0B 1FZKA 4N1EA 3U4BH 3NFSH 1IFHH 5FYKD 3IDNB 2D0GA 4ZUTA 1QFUH 1BZQK 3AU1B 4XCYB 4JFDB 3V52H 3R8QA 2EH8L 3SDCB 1IGCL 2YXFA 5J6HB 4O00A 1QBLL 5IJVB 4D3CL 1P2CB 5B22A 1YC8A 4KUZL 1S7UB 4PBWD 5AAMA 3G6JE 4KRPD 4AK1A 1OGAE 4PYGA 3KPRA 4QRPA 4YX2H 2AQ2A 3IDYB 4LLDA 4OB5L 4QRTA 4TUKL 3DYPA 5JO5B 3PP4L 2PXYC 1C7TA 3A6OA 3T77A 5SWQA 1CU4H 2BDNH 2WIIB 4KTYA 4D9RD 1I8LC 5F9OH 4QO1A 1NUGA 3GGWA 3IFOA 1J8HA 4M6MH 3HC4L 4UMGA 3IF1B 4R6UA 4Z18A 3C9NB 4CN1A 5FUZH 4I0KA 1SJEB 3D39A 3IDUA 4O4YL 5I1AA 2MFNA 3DX8A 2IBZY 4M62L 2IBZX 4N90D 4P5MA 3OZ9L 4XGZA 1VENA 5IB5B 3ROLB 2BSRB 2NPLX 4X9BA 4ETYA 5KJRL 4K71B 3RY5A 4NC1C 1HH9A 2R0WL 3LN5B 1CFBA 5E5RB 3TH2T 5IV2B 1F3RB 4NHUB 4F57L 5CP3H 2P5WE 4FMFA 3QYCA 3CFKB 1XT5A 2QKIB 5CUSH 5ACLA 4OUUA 1WWWX 4M6NH 4LIQL 5E8EB 1S7SA 2P5EA 4PJAB 1VB9A 3CMOH 5FGCB 5GSVB 5IQ9B 2NY2B 1SJHA 4R97C 5DRWB 3FONA 3QR2A 4BJLA 3C5ZA 3PNWA 4ODTH 4XH2B 3V5HA 4YXHH 3BGMB 1N59A 4S1DD 3K2UH 2BNUB 4P0DA 1U8NA 3SGDH 4D0DB 3TNNB 5EO9A 3G9VA 3P3YA 4G8FA 2VO5A 3P0VL 1EO8H 1YJDH 4M1CD 1AP2A 2CJUH 3MNZB 1LILA 4PJ9A 2WINA 5KN5B 3L3KB 1INQB 3GRWL 5MENB 2BMKA 3QUMB 4I5BB 4XXDB 4M43L 2X4UA 1KBGL 1KPRB 4PJHA 3QDHA 4UTAL 4WW1B 5BS0E 4Q0XL 3CDFA 4K3JH 1MWAA 3UYRL 3PUCA 2CDGA 3X3GH 3DTXA 3GSNL 5DC9B 1FVCA 1KLGB 4UT7L 2V7NA 1F4XH 4KHXL 3PWUA 1A8JH 4XTRD 4XVUD 3FB7A 4WU5B 4Y4KC 4F9LA 4NO2B 1AR2A 3NGBC 4NC2B 1SHMA 2DICA 1JYNA 1QVOB 1N7MH 2ICEB 3D85D 3VWJC 4Q2ZB 3V95A 3FTGA 4JFQB 4YWGH 3P0GB 5ESVB 1FLRH 1NCBL 2RCSL 3LS4H 4X6DE 3S3PA 5ILTH 3LRGA 4OIAA 5MERA 2EYRB 4OCLC 4QXGL 1RSFA 3ARQA 1JRHI 3OR7A 2E7HA 1MFAH 4L4VA 3MLTA 3QG7L 3JV0A 1WGOA 1T03L 2FBJH 2ATKB 4GKSA 3QXDB 3QCUL 5HYSA 2ADFH 1WF5A 3MCLL 3P4NA 4JFDE 5HVFB 3C2SA 2HT4D 4A2LA 4OZIF 2CPCA 2I5YL 4XPFL 1BVKB 3LDBC 3S4SG 3JXAA 3BP6B 1Q38A 4OBSA 3W81A 5J89A 3AM8A 3VI3E 1DR9A 4JB9H 3OXSB 3U9PL 4BFIB 5I8KH 3PHOA 5HHMD 2NNAB 3I6LE 4I18A 4E42A 3CX2A 2F53B 3ZT5A 4U1IA 2HRLA 2YA1A 3GK8H 3MA7B 3TGXA 5DQ9A 1WBXB 5CCKL 5D7LD 4GH7B 1Q72L 3VG9B 4XNMB 4DZ8A 4O2EB 2VXQL 3RAJL 3LV3B 5CLTA 1G9NL 2V9QA 1DLFH 3IKKA 2C1OB 3TLRA 4HWBH 3BXNB 3I6KB 2N56A 2F58L 2VZ1A 1U91B 5IBLD 4ZPVB 2A6IB 3RWFA 5F7HA 4XP6L 4NQDB 3C5SB 1JV5A 3GSQA 3HNSL 3FOMB 3P77B 4M7ZB 4NT6B 4UAOC 1ORSB 5BZWA 3FFDB 2YD8A 4URTB 5JTWA 1KIQA 5EUOB 3T04D 1GSMA 4WFEE 2DWDA 4JKKA 1WC7B 2A73A 2IAMC 5F1IA 2EDFA 3U82B 4P59L 4YGAB 3PWNA 2ZP0T 5HDLA 4PJAE 4JRYA 1BAFH 4TUJB 5FGCE 3EO1B 2CUHA 2CO7B 3QA3A 5HPMA 3RNKB 5IW6B 1HHKB 4GW5A 3QHTC 1UJ3A 3P73B 1DQDL 4XPBH 4YGVB 5GQBA 1SEBB 1XGRA 2DBLH 2XWJB 4RMTA 2E5EA 4QOKD 4NRYA 3BN9D 1F6AA 4GBXA 2FLRT 4HXAH 5DD1L 2DQFA 5LQBH 3HE7D 3V6FA 1M4KA 4GMTH 5C0FB 2J8UA 4W70A 3DGGB 4ZFFA 2G9HA 4UUJB 1IGIH 2FIKB 1IAIH 5MENE 4JZNB 5F7LB 1H3XA 4XCEA 4YBQD 5TPWH 1FFRA 1GGCL 4LKXA 4XNUL 5GXBB 3ECBB 4XMLL 3AVEA 3SN6N 3DRTA 5I6XB 4OGYL 3GMPA 2V2XB 5JW5A 2AV7A 1U36A 5DT1H 1FN4B 1B4JL 2EDWA 4Y8DC 5DQDL 3S36X 3QUXD 1IAKB 4NHCH 4U6XB 4WCYH 3NFNA 4KJWD 1SMAA 3KYMB 3U4EB 1N6QH 4HGMA 3IKCB 3JV4A 4Y4HB 4D9LH 4P46B 4OD2B 5EBGA 4JFXA 2Z0BA 4JY5L 4Q6IA 3EO0B 2JCCB 1ZT4B 4P2OD 2MCPL 4X99B 1U95A 1TZIB 4WDIB 4N8VA 3RGHA 3UPRB 3FKUS 1GOGA 4XMKH 3UPAA 4R3SB 5F9DC 4Y5VC 5TDPA 1AQDA 1IL1A 3UTPD 3B8SA 1TDQA 4YNYB 2EICA 1X5KA 2IMNA 3V2AR 4Q9RH 1P84J 2QQKH 3S98A 4DN4H 4F15C 2Z4QB 3OKOA 3BX7C 5L8JB 3AMLA 3RIAK 4X7EC 3VD9A 3BUYA 1DL7L 3IDJB 2OL3H 4M61A 4QY8B 1MJUL 4CN6A 4ZFZA 3SE9L 1P5VA 2IPTH 4WFGE 5IW1A 1HIML 4XT1C 2HH0H 1NAKH 3F65A 1JHTB 3MLYH 4FQIL 4NJAH 4OF8A 5EZJB 4DGVH 2BOBA 5BXFB 1JWSA 5FDWB 4HPYH 4LLWB 4A2MA 2AEPL 2G5RA 3T0EC 2F53E 1QYGH 3V7MA 1UEYA 2XZAL 3QCTL 1FGVL 5F1OB 3KS0J 3TBSB 3L95B 4MJID 4MCZB 1K8DA 2WWKO 1QR1A 4P57B 2MHAA 3FCTA 5JUEL 5D1XA 5TQ2L 1CXEA 3CFJB 5FYJH 3C8KA 4HK3J 4IOSD 4HWEL 4GFTB 2KKQA 1S9YB 4FFYH 4MJ6A 4OCYL 4QTHB 3OKLA 4CL7A 3TBWA 2GFBA 4NQDE 3WS6A 3GB7B 1UZ8B 3HZMB 1AI1H 5HDBE 3CUPB 4OZFA 4BUGA 2UVEA 3PGDA 4NZUL 5EUOE 1V7MH 4CVZA 5I2IB 2VLRD 1FO0B 4H1LA 1J0HA 3BKCH 3GJFH 3KPMA 2NLJA 5LBSH 2XZCH 4H8WH 3P0YH 3U0PB 3W0WA 2PXYD 1N5AB 2YUXA 4JG1L 1OF2B 2MMXA 3JSSA 4NO3A 5FA4B 4Z8FL 4NQED 5JXEC 1S5IL 2R39A 1NQBA 1QFPA 4Y88A 4JDTH 5SWSA 3BD3A 3O11A 2OSLA 4J3WA 4KFZC 2A74A 3V7AE 4M6OL 5C0DB 3E2HC 2NY5L 2N1KA 4FXKA 4KZEL 4G8IB 4LKCB 4WV1A 3BP7B 3V6ZA 2HAZA 1CDUA 4JPVH 5INDA 4YXLL 3IB4A 3IRPX 1ND0B 1UXWB 3DMMB 3AAZA 4G42A 3QUYD 5HGHB 2OK0H 3R0NA 1XR9A 1KTDB 2DWEA 1TVHA 3D3VA 2BRRL 1PG7W 1XGYH 5FKAB 2DJ4A 3KPNA 4OV5B 1KJ2H 1CFSB 1NCAH 1VGEH 2R0KH 3D2UD 5J11C 1CGXA 4NP4H 4LVNC 3HPJB 1XF1A 5E8OA 1NCNA 4NBZB 5A3IC 3ULVC 5GS3A 2R2EB 2L7UA 3PIQA 5KSUA 5I76A 3KYOB 5DC0A 3GJFK 4W4OA 1TJGL 2JCCE 4XHJC 4LSPL 5DUBB 5MP6H 4O5LL 3DUSB 1F3DJ 3ZMRA 2BK8A 1JF1B 1CICB 4PJ5D 1MAML 4LCWA 8FABB 5ITFB 1R3HA 5DJAA 1FVDA 2VDML 4O9HL 2NY1D 1WISA 3RGVC 2X2YA 2FX7L 1PLGL 3ROOB 1EA9C 4I4WA 4Z77B 1NMAL 5IFJB 2EDNA 2RFXB 4PRIA 2VZUA 1QRNA 2ICWJ 1NLBH 3WE6A 4GAYB 3T4AA 4RZCA 2VR4A 3GSUA 3MV8D 3WNMA 5FKPA 1XF2B 4Q74A 5HGGS 5ESAB 3BT2L 5H8DA 1A6WL 5FO8A 4Y4KD 4MD5B 6FABH 3QQ4B 1FG9C 1CE6B 1OLLA 2BERA 2PO6B 4GSDL 3EYOA 3O2DL 2GITB 5J12B 4JHAH 2QSCL 1L7IH 4LASH 4DW2L 2ITCA 2CQVA 1PSKL 4ZO9A 1XZ0B 2E3VA 5DZLA 1MRFH 15C8H 1J05A 2VUYA 1BGXH 1CFQB 1FL6B 3V6BR 2YHGA 1RJZA 1MI5D 3HAEG 4HMCA 5HD8C 4YHYC 4JN1L 3S34H 3VFRA 1SY6H 1GCFA 1YYMH 5I17B 5C2UB 4PJCF 4N0FA 2D7NA 1QSFD 2D03H 3N85H 5F70A 1FCCA 1J8KA 1RY7B 3O45A 2XIDA 4PJ9C 1MVUA 1YNLL 5I8CA 5BMFL 1LK2B 3MMEA 4HS8H 3N9GH 4PJDA 4UILL 2GJJA 3D0VB 4YHIB 4EBQH 4WU7B 3VXSA 3WFDH 5GGVH 3ZE0E 3CCHA 4OJFH 3O6MH 2KQNA 4O2CB 3ALWA 4OM1H 2B7DT 3QFJA 2YEZB 4JPKL 4LSTL 5F71A 1IM3A 4NO5B 4LPCA 4MNQB 4FQXA 5CSBA 1T7WA 5D1ZB 1FNEB 1LMKA 1GC1H 4LSUH 3D18B 4XCFL 1U3HC 1I3RA 4QRRD 2YPLD 4OCRL 3O0RL 3C8DA 5E00B 3TZVC 5B3JF 1U8MA 4MD0B 1CDHA 4S2SB 5EBWA 3TJHC 3IETA 3BDYL 5ELIA 1G1YA 4GAGH 1HI6A 5JQ6H 1KCUH 3VG0H 1LO0H 3CFCL 1A7RL 1SYSA 4IRSA 4ONGL 5GGSB 1WWAX 1XGQB 1MHHB 1I7TB 1RI8A 3HUJE 1U8LA 3DRQA 1KC5H 5C71A 2IAMD 3K3QA 1G0XA 5EU6B 2WUBH 1H8OA 2Y06L 1RUKH 1PJ9A 3ABZA 4FA8A 3KPSA 4H5SB 1KXTB 4G7YH 2W07A 2YK1H 2NYYC 1G7IB 2BOCA 1AGDA 4OZIA 3WUWB 1E28B 2HG5A 4PJ8D 2XN9A 4R7DB 1K4DA 3HI5L 3ARFA 4XI5C 5DVOA 3AM8C 1RVFH 1R3JB 5I15L 1KPVB 4IRZL 4WHDA 1K8IA 4FQ1H 2GTWB 4WRLA 3IS1X 4U1LA 4GAJL 4ELKA 3MR9B 1QKZL 4QRQB 1MFCL 3W9DA 4DAGH 4LAJH 3WXVL 3FN0H 4HZLB 1GGTA 1H8SA 2OZ4H 4HUXB 3E1F1 5IVZB 1O7VA 4MX7B 1IC5L 5KTEH 1JPTH 1OGTB 4F33A 4M00A 5DJ6B 1JHLL 5LCVH 1FV1A 2AP2A 2OR9L 1G7JB 1KELL 3WIHA 1IM9B 1AC6A 1I3VA 2VDLH 2IH1A 2IALB 3EZJB 5K59F 3QDMA 2WQ8A 1IGJB 3MOBL 3O8XC 3QFDB 1DCLA 1DLHB 5TJWK 2YD2A 3VFTA 3R1GL 4YUEH 4YO0B 4W6XB 3UBXB 1G9MH 5DLML 3LHPH 5FOBB 5IKCB 4PRPA 2PYED 4NOBA 4P99A 2RB8A 3NN8B 2J5LB 5HHNB 2OJZH 2UVFA 4LSSL 2XXCB 1G7LB 1NDMB 4WO4C 1LWRA 1ZT7B 4O58L 4AM0B 4H88H 4CU8A 5JDSB 1UJ3C 2DYPA 3KYKH 2HWZH 1A4KB 3MV01 4MJ2A 1LE5B 3QI9A 3GO1L 1UZ6E 35C8L 3HI1A 3WS3B 4FZ8H 4NKOB 2ARWA 4DKAA 2ESVB 1QSEA 1HSAA 1NGYB 3B5GA 3BO8B 1YEJH 2WUCH 3I9GH 3T0ED 1WTGT 5KSVB 4HK3N 2O5ZH 4JE4B 2PTUA 2E6PA 5AAWA 4MNQE 5J6GB 5DJCB 3EYFA 4OD1L 1X5ZA 3BQUB 4R0LB 4KVNL 4UB0L 1RZIB 3CH1A 1GPOL 2VQ1B 4HF5L 3VFGH 3PWPD 1IEAA 2X4NB 4NZDA 3TC9A 2A83B 2VKWA 5H37H 4OZGB 4HC1H 5IB4B 2DL2A 2BVUA 1PD6A 5A40E 2V2TB 1H5BA 1R24A 2XPGA 5ID1A 4JJHA 4ODUA 4PGBB 4PLNC 3FRPG 4HKXA 5IVXB 1T1XA 4YPGA 5B39B 5EU6E 1EUUA 1ZSDB 1IQWH 2V9TA 3EDDA 1E4XH 1DQMH 3F7VA 2IFGA 5JXED 2FLBT 5EU7E 4LSRH 2ADJB 1FDLH 1FYTA 1KT2A 1S7RB 2DF3A 2Q87A 3IYLW 4GG6B 5AYQA 1RAMA 3T2NL 5EFIA 3VXUA 5GRJL 5F9AC 4NKIH 3UDWC 3RBGA 1NAMA 1YDPA 1EXUA 4RFNC 3UBXI 5GSRA 5DC4B 5HDOA 1MH5A 4GW4A 3ULUC 2XG5A 3L3GA 1JWUB 4BZ2L 3MJ7B 4ZO6A 4M7LT 5E1HB 1HEZA 2DOCA 1E6OL 4OI9A 2RIKA 3A6CL 2A6DA 2BNQB 3NPSB 2FH6A 3T2QA 4JKWA 5L88L 5AUMB 4W4NA 3ULVD 1JTTA 4Z95L 1TPXB 5C08B 4RX4A 5MEPA 5E6YA 5K9QI 2IPUK 3T3MF 4ZNEA 3LKNB 4ZUVB 3I3DA 4R7NA 4XHJD 5C07B 4YAQA 5ICXB 4JM2C 5HJ3A 3UTTA 5KZCB 2ED7A 3KPRD 5LG1A 4QRPD 2WSKA 2DTML 2J8HA 5F9WB 4KY1H 3SKMA 2K3TA 4YHZL 3OKEB 1JGDB 3GHEH 4U1HB 2DLFH 2XKNA 3UTQA 4JY4A 4GXVL 3KNBA 12E8L 4HX1B 4JHBA 3BZEA 4IJ3B 3EFFA 1J8HD 1FGNL 4GMSH 4JLRA 5HVGB 4ELMF 1JF6A 2DLHA 1Z9OA 4K8RH 1NCWH 4XC3L 2DQUH 1KLUA 3D39D 2JELH 1KNOB 1YEKH 3LMJH 2MOVA 1FJ1B 2V17L 2ESVE 4ISVB 1ZHLB 3K2MC 4JRXD 4XPTH 4NNXB 4OLXH 3V0VB 4CN4A 4X80L 1JPFA 1T22B 4JO4H 2R1YA 4AL8H 3SKJH 5DYOB 1HQ4A 1RK1A 4KQ3L 5FO7A 4H0GA 3HS0A 3UJIL 1ZT1B 2W9LA 3GDBA 5H35A 2R2BA 4XNZB 1II4E 4FNLL 5J1SC 3GJFB 1IAII 2I24N 4K7PX 3TNMB 1RHHB 3ARGB 3BHBA 5F72S 3J7HA 4LEXL 5HD8D 4BSVB 1DQLH 1X5HA 4AEIL 1DQQA 4OQTH 1YEFH 3UTSB 3GSVB 4ZSOB 1FFOB 3HNVH 3S35H 3P4MA 2Z31B 4OZGE 4X7TA 4HH8A 4OZHB 3MLUL 2AK4B 1A0QH 1T04A 3TN0B 3OKKA 3WXWH 5ANMB 4PJ9D 2FHBA 1UACL 1FSKC 2NZIA 3F12B 3KXFD 1A9EB 3A67L 5IVXE 3RWHB 3RL2B 2LTQB 3Q6FB 43CAA 1RZGA 3VFUA 2A0LC 4WI2A 1I9JH 3QQ3A 1ACYL 2YPVL 3L3IB 4GRMA 4LLQB 4MD4B 4UQ3B 1IRAY 3IAGC 1F2XK 1C12B 2BCKB 4RBPH 2VNCA 3U2SB 4HKBB 4X9FA 4PY8J 4QRSB 5HGAB 3CXDL 2HT3C 1NUNB 1T7VA 2UY6A 2GAZA 4GQPH 1ZTXH 4ODBD 1BEYH 1U3HD 3STZA 1K5NA 4GG6E 1MPAH 1Y18A 4JFEB 5E70A 2XZQH 3V0WH 4YXKH 2LABA 5SWZB 1IQDB 2ARJA 3D5OF 3TJHD 2PR4L 3UC0L 1EUTA 4I0PB 3WIIL 1BOGA 1TENA 4PJBF 5E56A 2BHZA 3SDDC