2IQAB

Pfa2 fab fragment, monoclinic apo form
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
220
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSLSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKNYNPSLKSQLTISKDTSRNQVFLKITSVDTADTATYYCVRRAHNVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
molecule keywords IgG2a Fab fragment PFA2 Kappa light chain
total genus 37
structure length 220
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iqaB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iqaB02
4Q9RH 2GJJA 4NQED 4O00A 4ZO9A 4N90D 2AJYH 4EUPH 3C8KA 2J4WH 4U1JA 2G5BB 2DD8L 5DMGD 4Z7VB 1SMAA 5E2UL 3C6LA 1S7VB 4KHTL 4MCZB 4U6XA 2R0ZH 4L5FH 4KJWC 4P2YA 4P59H 1OAKL 2CD0A 3SDCA 4ALAL 5E6IB 3OR6A 2FEEI 4L4VA 4OBRA 3UTTE 1MI5B 1ND0A 4Z7WA 4HT1L 1KG0A 5L2JA 5FM4A 4U31A 5IMMA 2VH5H 3BOVA 4KROC 4D9LH 4I2XE 3OR7A 1AD0B 3WJJA 1IM9B 2LVCA 4UV4H 3SDAD 5JHLL 3KG5A 3QIWD 3H7BB 4CU7A 4Y5VC 2X05A 1A0QL 3DI3B 1JZ4A 4LLWB 5IB1A 2QADC 3VXUA 3FB8A 1CXFA 3W11C 1L6XA 3F12B 2PTTB 1EUTA 1ES0B 3RI5K 1KXVC 4LBEB 1JGDB 4IMLB 4K3JH 5E6IA 3VJ6B 3W0WD 4RCAA 5F7LB 3O0RL 1QNZL 4JPKL 5GRJL 3OQ3B 5JDSB 2F5BH 1A64A 5IMMB 4GBXD 3QIUC 4X5XB 1ZTXH 1UWEH 4EKXA 4ZUSA 4PLJD 4Z0XA 4YJZL 2OK0H 3A67L 3G6DH 2FGZA 4OGAC 4JFPB 2A6JA 3QNXA 4W81A 1BOYA 5DJ2B 4Y8AA 2AJ3A 3ZTNH 3FB6A 4UMGA 1ZHLA 2ZSWB 3WN5C 1BM3H 1X44A 1VEOA 3WS3B 1BQHB 35C8L 5JHDA 1RPQA 3MRFB 3NFNB 2DWEB 1J0JA 4EBQL 1TZIB 3OX8B 3KPSA 2BNQD 2YHGA 3KPOA 3THML 1NFDE 3FOLA 4Z8FL 1EO7A 3SDXB 1A1MA 1X3DA 4Z7QE 1IC7L 3BIKB 3V6ZA 1R3HB 1CTOA 1CFVL 1U8PA 4QHMB 3I6GA 2Z93A 4F3FB 4UV7L 4H5SB 3MGOB 3W82A 1LO5B 2C3XA 3S34H 3FO9A 1WITA 4JJHA 2DKMA 2L7UA 4PGBB 3S37L 4OF0A 1NCAL 4EI5C 1FC2D 4PRDA 2Z31A 2FDBP 1QLEL 3ARUA 4HBQA 15C8H 2APXA 1MCOH 4HK3N 4P4KD 4WHTB 2H32H 3RQ3A 1DSFH 3MRLB 5CJBA 4YHKH 1YC7A 2FSEA 5LQBH 4BZ2L 1BJ1H 3HNTH 2JJVA 2H9GB 4TVPD 4QHUA 3W9EB 4PG9A 3RHWF 3WNOA 4Q9CA 4KZDH 4J8RA 3V6ZB 2VLKB 1H0DB 2VLMD 2VZ1A 3FHQA 3OWEA 5TE4L 3ULVL 3L9RA 4PJ5A 1LNUB 3AVEA 3E6HA 3KLSA 5CZVH 2V9TA 3ILQD 2PW2A 3REVB 1NAMH 4LF3A 4U0QB 2VOTA 3EYVB 3FZUD 3MRQB 1F4YH 1FBIH 2A38A 3VXOB 3W39B 1J8KA 4LSQH 3CXDL 1CLOH 5JMOC 1M7XA 4RZCB 1NJ9A 3TPUA 1RZJH 3KPQA 4Q9RL 4MA1C 2B7DT 3RTQB 5HY9B 3OZ9H 4F7TA 2AJYL 1DBKH 3G6JF 1I7ZB 1JTOA 4L1HA 5E6YA 1EEQA 1D7FA 4YPGB 4O5LH 3BYTA 1R0AL 1TVDA 4JQVC 5HHNA 3GNML 1FNSL 1QEWA 4NO5A 1UCBH 3E6HB 4CN6A 2EEBA 2YD3A 1JHKL 3VDCA 3JWNC 1FLRH 1U6AL 4TSBH 4PJGF 1S9VA 5TGBB 1DLHA 3QIBD 3TZVB 1CIUA 5GRZA 3IJYB 2OTPA 1U36A 3JWDC 2X4UA 4EDWH 2X41A 2F54D 4HS3B 5JHLH 3L3IA 3S96B 1RQ5A 1XF3B 2X1PA 3H7BA 1H8OA 3MV9A 5KS9F 2HT3D 3U7WH 4LKXA 4MJ2A 5E95B 5EORH 3Q6FA 5FA4B 2NXZB 5EOQL 4NHUB 4EUPA 4GW5B 5TQ0L 2BRRL 1DANT 1IKNC 5E99L 3GJEB 5D9SB 2W0FA 4WV1B 3MRCB 4QY8A 2DLHA 2OMBA 4GXUN 4HV8A 2VR4A 3E2HC 1XF1A 1RIUH 4AMKL 5I8KH 4Y5YC 3BHBA 3RY4A 3TCXA 5J12C 1TVHB 3QDJD 2FECI 1D5BA 4HQQL 3N85H 2ZKHL 5ABDE 1R3IH 1N6VA 4ETYA 4FQXC 3EYFB 4NN5C 4NZJA 1KTKE 1YDPB 3MNVA 1XR9A 3IFPA 3AREA 4F7CB 4U33A 3GRWA 1ZKAA 2EEAA 3GSUA 4FXKB 2HAZA 4MDJA 4TRPH 1JPFA 2BY2A 5ICXB 2P45B 3U0PB 4PGZA 1PY9A 3SKMB 3QNXB 3F7VB 1IGIL 1T1YA 4PBXA 2DQFA 2JB5L 4JVPA 4WU5A 5D6DC 3NCFB 1JYWA 4ORGB 3PWJA 4AEHH 4OSUL 4B53A 3QI9B 4X4XB 1X7QA 1S9WB 5DT1L 3SDAC 1YQVH 5D7JB 1Z9SA 1CE6A 4LGSB 4U6HA 2I9LA 5M94B 4JO2L 4KMTH 5KN5A 4H88H 3MLVL 2OTWA 3UBXB 1HKLL 3O2WH 43CAB 1U92B 1CF8L 2ARJA 3GBML 3QXAA 3HNSL 4LHUB 1T7YA 3MV01 5I18L 1RUML 3S7GA 1CXLA 3QBTB 4HT1H 3H3PL 3PJSB 4X98B 4D0BA 1IAMA 3C6SA 3ALPA 2ZG2A 3IDUA 2A0LC 2CK0H 2JJSA 1EAPA 2BSRA 4UBDC 1SJEB 4XNXH 5IB2A 3AS0A 3NPSC 4KXZH 2XG4A 2R2HB 4KVCL 3KPMA 5DMGC 5EC1B 2BZDA 2HVKA 3VWKB 1KELL 1K6QH 4OB5H 4WFHE 4DEPC 4YX2H 4GRWF 4Y4KC 4A6YA 2P8MB 4KC3B 5DGQA 3MXVH 3ZTJG 1QBML 4R97B 1IZJA 1S9WA 4NKMA 5SX4I 4Q2ZA 1LWRA 3RHWK 5D2LF 2FD6L 1CIDA 2VLJB 1BZ9A 2C4XA 5GRUL 3BN9D 2Y36H 4NBZB 4NM4L 1U8IA 4JHZA 3SKJL 4QCIB 1I9IL 1F11A 1TQBB 1X9QA 5FHAL 4U3CA 3QQ3B 2GFBA 1CTNA 3I02A 4NGHL 4HZLA 2PN5A 3MO1A 2BNQB 3KWWB 1FVDB 4YDIL 2C3HA 3O3DA 1PVHA 1UB6A 3EYFA 3OHXB 4WGVB 4S1RH 4F7PA 2G9HB 3Q5TA 3H9YA 5A2KH 1YPZB 3NACL 4LIQL 4YQXL 4P5TD 4F7EB 2DJ4A 4ZYKB 3DX7A 5F1OB 5DO2C 4KZEL 5SV3A 5DVNA 4JHWH 1J0YA 1JK8B 1V3LA 2NMSA 1QVOB 1J18A 3FQWA 3MRBB 4M6NL 4E42B 3AFLA 3TT3L 3T65B 3MV8E 3MR9A 5DFVC 1JJUA 3EFDH 3UYPA 4OLZL 3CFEB 4ZO7A 3WJLC 3MLPA 4GW4B 5HHNB 5IEHA 5DTFB 5H8DA 3DSFL 4KDTC 4P2OC 3QR2A 4C59B 4X6DF 1FNGB 4HKBA 2BFVL 4PJBE 5C0IA 2VXUH 3SCMD 5T1MA 1F90L 3DGCR 4FZ8H 1UB6B 2W60A 1I3RA 5IBUB 1TTUA 1AHWB 1RUQL 5E8NB 2BHUA 4NWTL 3BKML 3FL7A 5HTSA 2O5XL 1ZXQA 1OPGH 4EZMA 5AG9A 2CDEA 1NMBH 4XMPH 4C83A 3Q2CA 3GM8A 3D0LA 3VH8G 4C55A 4YHYB 3JVGC 4MA3B 1ZHKA 3Q6GH 4LLVA 5GGRA 4HULB 1AQDB 3SDDB 3VMNA 5IOPA 4L29A 4F33A 4OZGB 3QRGH 5C0AB 2EDDA 2XTJB 4KVNH 4XCYA 3SGJC 3N9GL 1J88A 5J11B 4NKMB 1XEDA 2Z92B 3LCYA 1V7NH 2YR3A 2YA0A 5DUPL 3W5NA 1BM3L 3T65A 4HC1H 3MSPA 1KLGA 3LKQB 4LASL 5IW6B 4RGOL 2VIRA 4ZAKA 4M5ZL 5ICYA 4KK8D 1CG9A 3QUYC 2V2XA 4EBQH 2BY3A 1CXIA 3O9WA 4XNQA 4UZGA 2ADJB 4JPVH 1C5DB 4JY4B 2GYSA 2BOBB 3RDTA 2GT9A 4IEFB 1TCRB 2KBGA 1B88A 3RWIB 5L2KB 1CFVH 1IARB 1VDGA 3B5GA 1WC7B 3GMOA 1M7DA 5IFJA 1WQVT 1LE9B 5C0DA 3BKCH 3RP1A 4V1DB 4X7TB 3O4LA 2A6KB 4J1UB 1D5MA 1A6TB 2ICWA 3H2WA 1DBBL 5JXEA 1JNHA 3MACH 1G7PA 3MLVH 3WDJA 2VDPH 3GNMH 3GSRB 1NGXA 3PL6D 5CJ5A 5I1AA 2DIAA 4FTVD 3PGCB 1P4IH 3LKPA 2DTSA 2OSLB 1NGWB 4KRPD 1XGUB 3EJYC 1N6QL 4ONOA 4LK4A 1VHPA 3PJSA 2HMIC 5I8CA 3NTCL 3RUGB 1BBDL 2DL9A 4XTRD 4JN2B 3OV6A 4GXVL 4PY7A 1HE7A 2WIIB 2X4NA 3OL2A 3VJ6A 1HHIB 4QGYA 1U9KA 1CD0A 1G1CA 4Z7NE 4HWZA 1J1PL 3HMXL 1PG7W 1KCVL 3BZFA 4WFEE 1DN2A 5HYSG 1CN4A 5I2IB 5GGSB 5C8JB 4MA7H 4U7MA 1IJ9A 1U8LB 4J3VA 2GKIA 2R2BA 5D7LD 1ONQB 4MJ4A 5T3ZL 2E8ZA 3K2MC 4GAYA 2HJFA 2W0LA 4Q0XL 3KYAA 4U1IB 3FB5A 1VFBA 1ZV5A 3L5WB 4JDZB 4LSDA 5KS9E 1CLOL 1YN7B 2RFXA 3SKJH 2JJSC 3KYOA 3ROLB 4YWGL 3T04D 4JANA 3ULSB 4PJHE 7FABH 3VG9C 3CFKB 3SKNA 3U4BL 1J8HA 2RQ8A 3D25B 1NSNL 2NX5E 3STBA 1K4DB 3FB6B 5C2BL 3RJDA 2OM5A 5BS0E 2XQBL 3VWJA 4LU5L 4MB3A 1DQDH 3ARVA 4WI2A 4OQ1A 1SY6A 5DSCA 1KEGL 3LOWA 3VFUA 4XXCA 3K4ZA 2C26A 3ARPA 2DIJA 5C9KA 1AD9B 5C0CA 2NZIA 1LDPL 1ND0B 1LHZA 2IBZX 1WCBA 5L2KA 2RFXB 1UEMA 3RA7L 1BAFL 4RA3A 3VG0H 2ZJSL 3OR7B 3WSQH 4Z7UF 4F7MB 2CLRA 5B8CC 4PJDE 1V7MH 2AXFA 2J5LC 4AJ0A 1I1AC 4L4TA 4U1KB 2J7LA 3TYFB 2DLTA 3OXRA 3C5JA 1WCQA 2DLEA 3VD4A 4KMTL 3PABA 3TFKC 3L5IA 4BM7A 4N5EC 3NCEB 4OLUH 2D9QB 3DVFA 2R23A 4U0RB 5J89A 3ZHLA 5LCVH 2WWMC 2VLME 1HOCA 3ZKNC 3MOAL 1C12B 1IL1A 5GGUA 2HVJB 4GQ9H 5E1HB 3VFRB 1QUNA 2AGJH 4JFHD 1RZ8A 3P73B 1G7HA 4I18C 1UKSA 2IGFL 3JUYA 5EIVA 3QH3A 4IRSA 4YFEA 1D5ZB 2GJ6D 4D0CA 4M8VA 2W9EH 3OKEB 5FYJD 3U2SB 1RURL 2DAVA 3RWHA 3N9GH 3LV3B 2EZ0D 1NUNB 1D3CA 1A14L 3M07A 5IB5A 3BXNB 2MFNA 1QSFE 4XBGA 5FK9B 1INDL 5FA3A 2X6MA 2ITDB 4RGOH 1F6AA 1F02I 4RZCA 2HT4C 1LMKA 2WP3T 4GXUM 1NAMB 1FP5A 3ZT7A 5CGMA 4N0YH 1ZHBA 3WNPA 2D31B 2IMMA 5E7BA 5F7WC 1KFAL 4MNQB 1JPTL 3QEQD 1NCWL 1J0ZA 4MXVE 1MRCL 1T22B 3PP4H 3GUTA 1YY8B 2ZWLT 4ZUTB 1I3GH 5C0JA 1KB9J 3TO4B 2ICCA 3IAQA 3LIZL 4IRSB 4KKAD 4NO2A 3BGFB 1F13A 5GS0C 5F7FA 1P4IL 4JZOA 4PJFF 4L3EB 5C0RL 3BT2L 1ED3A 1FNGA 3RIFK 1FVEA 2AXFB 3T09A 3T2NL 4C56B 4KVCH 3UO1L 3DRQA 1G6RA 1KNOA 4NQXB 5I71B 4JRXE 2VZVA 3ZT6A 1RJYA 2X4RB 5DEGA 1T5XB 3IKKA 3CXHK 3HC4H 3LRSA 5ETUA 3VI4E 5HXMA 1P4LB 3TH3T 5JR1L 3QCVL 4L9LC 1M6OB 4LCCB 5KSBB 5DUML 3PV6B 3F7YA 2WW8A 4X6CA 4UT6H 1EGJH 4WWKC 3PP3K 5FHAH 5IQ9B 4HK0B 3WS6A 4JDVB 5HPMB 1E6JH 1PGRB 4DFIA 2IBGA 5I30L 2Q6WA 1YN7A 1OW0A 4HUUB 4RMQA 3V6OA 1RK0B 5ESQB 2XZZA 4WVRA 1CD1A 3KPNA 1PZ5A 4NFCA 3BQUA 4KWUA 3BKJH 1D5IH 4HKXA 2WSKA 4M1GH 3U0TB 1JUFA 1MI5A 3TNMA 2PCPB 3BZDA 2OJEA 4RMRA 3LZFH 4X9HA 4XCNB 2XZCL 4YBHA 3VXSB 1TZGL 3LRSB 5ETUB 1FGVL 3FN0H 5EO0A 1RK1B 1JYNA 1CGUA 4G6JL 5KN5B 4W6XB 1K2DB 1KEGH 4NQXA 1NCNA 3MLZH 3K74B 2XWTB 1EFQA 1ZANL 3VFNB 3L5XH 2CMRL 1R5VB 4AL8H 3DSFH 1ODAA 1X4XA 4LLQA 4Y5VB 2D2OA 5I74C 3W11D 1VESA 2GY5A 3RGVD 2DL2A 3D69B 2DD8H 1TITA 5BS0A 4NQCE 3WD5H 4LPVA 3UAJC 4LEXL 3UTPD 3VWKA 5EO9B 2VKXA 1NMBL 4XMPL 1A02N 4KJYA 4DZ8A 4QO1A 4N1CA 4HAFA 2UZXB 4CKVX 1HDMB 3RVXC 1OVZA 2E7CA 4YXLH 3QWOA 4PJFA 1BBDH 4HK3J 4U49A 4LGPB 1EVTC 2MPAL 3S5LB 4PJCE 4FQXA 4QRPE 1MCLA 4YBQC 5CCKH 4ZFZA 4M6OL 2JB6A 2DI8A 2GAZA 3S4SG 4S11A 2C3VB 2YPLE 4JZJC 5CHNA 4R2GD 4XT1C 5HVFB 5LQBL 5C0ND 5C9JB 4G80A 1FYTD 1A6WH 1I1FA 1MY5A 1MFDL 3GJFA 4RAVB 1YPZA 2OZ4H 2P5EB 3L3OB 2XZAL 5FYKU 2B4CH 3UDWA 5E7FA 1BZ7A 1IC4H 5LWYH 3K0WA 4E41D 3KWWA 1CT8B 5EU5A 1U58B 4JPKH 4KKLC 1QSEE 1NBZA 4W4OA 2J8OA 4TYUA 3GSUB 2G60L 1T21B 1OD9A 5A2FA 5C2BH 2N7AA 3WXVH 5KVDL 3BH9A 1MRCH 4JE4B 3SE4A 4L5FL 4QRUB 4WDIB 3LDBC 3UJIH 3R1GL 3HB3D 1JGEB 4KI1A 3K2UH 3I75A 4MAYB 2DQTH 3C5ZD 5CILL 3MBXH 4F15C 2D0GA 5HHPA 3BIAX 4RQQB 4C57C 2W60B 2H2SD 4OCNC 3RGVA 3ARWA 1J11A 2E5EA 3JV0A 1NBVL 3WUWG 1CVRA 1EAPB 2BSRB 2NY0B 4M1DH 4QRPD 2XRAL 1HWHB 3D2UD 1KTDA 3VGEA 3VWKD 3EYVA 2NNAB 5SWZB 3GZKA 3VXRB 2MJWA 1NCBH 4OFIA 4OT1L 1FYTE 4I5BB 5IM7B 2Z4QB 5DRNB 3WEXB 5AAWA 1XR8B 3ZHKA 5IWLA 3OSKA 2DRUA 4QHLA 4Z7QF 1T04A 1B4RA 5DUMH 1SYVB 5GS0D 3AXLB 3B9KA 3DIFB 5IMOA 1RJCA 1WFOA 4JRXB 3AY4A 4JZJA 1MELA 4I3SH 3PWJB 5KSBF 1CL7I 3VRLE 1EO8H 3JWDL 1CR9H 4G8IB 4I3RL 3QEHA 1XGPB 3QQ9D 1FYTA 2D03L 1T7VA 1BZ9B 3EZJB 2EDNA 3BKJL 5C07A 3ARGC 2LQRA 1TLKA 4XPFL 1WSST 2J12B 3RNQB 1HXYA 4CW1A 1WAAA 2GFBB 2ICWJ 5EPMB 1FAKT 3H9SE 3QXAB 3IDJA 1FNAA 4BQCA 4P5KA 1F6AB 4NPYA 5F7DA 43C9A 2WINB 3PHOA 5ITBH 2OL3H 4HUXB 2GJ6B 1G9NH 3FQTB 5IHUL 4XPGH 4K3GA 4Z9KB 2OJEB 4P99A 1IQDA 4YHIB 2L4OA 1NC4A 2CR6A 4W70A 2VDNH 1TNMA 4EN3B 4Y16D 3PDGA 3TN0A 1CFNA 3FO1A 4PRIE 2BVEA 3VFPA 2R0LH 5HGBA 1ZT1A 2VB5A 3FQNA 1XR9B 3IFPB 3BHBB 2YA2A 4MB4A 1YY9D 5EO9A 5HPOA 1EIBA 1JI1A 3RJQB 3MGOA 1U3HD 2VQUA 1DANU 3D2UA 4L8CA 4CW1B 5LXGL 3QNZB 3QUXB 1K4CA 1KB5A 1KTRL 4DVBA 1HCVA 1FNEA 3BRGC 4ODSH 4ORGA 2CUMA 3SDCC 4WO4C 5KSVA 4YHZH 5AYQA 4U2ZA 2JB6B 4M6OH 5I75C 4QHKI 4U3HA 1DP0A 4H1LA 4ONGL 4Z0BL 1MLBB 1RZIB 4ZPTA 2P8LB 3DYPA 2I9LB 1IGFH 3FFCD 4XC3H 3O2DH 3AXLA 3B9KB 5KW9L 3VRIA 1RFDL 4P4RA 4FFYL 1QTYT 4NQDE 4ODVL 5IW3A 3EDEA 4FABL 4JFOB 1XGPA 4XPBL 4OKVB 3UROR 3KLHD 4CDHA 4MNQD 4PRNB 1G9ML 3VGHA 1JPTH 4RDQF 2H6PA 1FFPA 1RIUL 3DX8B 1D6EA 1DBKL 4MQTB 1W0YT 5DQJA 5B3JE 1BREA 5E8NA 3VRLF 5INDA 1OARL 1Q1JL 3TEUA 4XCCH 4NM8L 1NDGA 2X70A 1I1CA 1NC4D 3LKRB 4LIQH 2FLBT 5KS9B 4XGZB 3BQUC 1YEDA 1NH6A 1OOAA 1BFTA 2FATH 4TRPL 4M4PA 4PJIB 5L0QC 3V0VA 3B4NA 3SY0B 4O4YH 5IJKC 4R26H 4DKEL 3ISWA 4XP5L 2FIKB 2VSCA 4OD1L 4X99A 1KF9B 1AR1C 4NKDB 1BFOA 4TNVF 4MYWB 3WFBL 2J8HA 1UACL 3MNWA 2Z31B 4WUUD 1UKTA 1S3KL 1WT5A 5BZWB 5EO1B 2CGRH 3SDCD 4UINL 3FO9B 4H88L 2HMID 1XMWA 2CSPA 3BXNA 3QFJD 4LP5A 4KQ4L 3QDGE 4PJDF 4I2XB 2ZUSA 2ZOKA 3G04A 4XXDB 5F8RC 1IGMH 4DGIL 3CU1A 1NAKH 4XNXL 3RKDD 4LQ1A 1T4KB 2ORBL 3EYQD 2D31A 2JJTA 4JM2A 4N8VG 3AU1B 2AJZB 4UNTA 1YN6A 3KLAB 5JIHA 3FN0L 1OF2A 3G5XA 4GAJH 3ROLA 4WJ5A 5JW4R 4TUOA 4B7LA 2LU7A 3WHXA 3T0XA 1FL3B 2ZPKH 4RNRB 1TJHL 1VADB 4WRLA 1IGIH 5F9WB 2X9WA 2BMKB 4Z18A 2AJSL 1T89C 2FO4A 2SEBB 1KIRA 1J0IA 4XP4H 3VXSD 1A4JB 4UT7L 1T4KA 2VXSL 4PREA 2IMNA 4AG4H 2WQRA 5IROA 3NN8A 2AV1B 5FO7B 4R4BA 3C08H 5FYKE 4OCRH 2ZSWA 3MV7A 5ISZE 1N4XH 4P2QA 3K1DA 2R0ZL 2ZZUT 4HWEL 1MAJA 4HUKB 3WN5A 3WHXB 4QRSB 3KPSB 3QHFH 5EG6C 5J11C 5I6XC 3N1MC 2JIXD 4EQ2A 3G5XB 3FQNB 5I0DA 2XRAH 4YUEH 4YDKL 1CK0H 1S7TA 3QCTH 2FIRT 1MLCA 4YHPA 4O2CA 2HLAA 4M9OA 5IFJB 4HUUA 3T1WA 5DHVA 5DJYA 1E0OB 4ZODA 5D1QD 3BFOA 1RZ8B 1CDCA 3STLA 5HDBE 5IG7A 1S7XB 3KJ4C 2F58L 2FX7H 1KXQE 4HIJB 3BKMH 2MQCA 4NM4H 3BD4A 1MFAH 4H26B 4NO0D 3CDCA 4ZG1A 2H32B 5C70A 1T0MB 4H1LB 5DJZA 3BRDA 1QLFA 4JFXA 2D03H 2WIIA 5JW5A 5DR5H 5SX5K 4ZD3L 3TJEH 1FIEA 5MERB 3NGBB 4Y7MA 5EZJB 3VWJC 3OB8A 3KPSD 3RNKA 5KZCB 4GRMA 4LNRB 1NUFA 1FSKC 4PJ8C 1B6UA 3C8KB 3NOIA 5I1JH 3ARTA 4XNZC 1MCRA 1L9MA 1OAXH 1QQDB 2K7QA 3CNKA 3NCMA 4LSTL 5CMAA 3MLXH 3BVNA 5AZEH 1Z3GH 3QPXL 1OP5H 1S7VA 1KIQA 2HLAB 1BGXL 1YEDB 1EEZB 5JA8B 2E6QA 3I50L 3TT3H 5I2IA 4I77H 2AEPL 4XCYB 3BGAA 1GGIH 2VUYA 3INUL 1TNNA 3DLQR 1NDGB 3RBSA 3FO1B 1RULL 3MRIB 2DMBA 1P4BL 4R4NC 2BVOB 2VDLL 3P9LA 4ZXBC 3PV7A 1LEKA 1VFBB 5IHZB 5EUKB 1KLUB 4HKJB 3CX2A 3T0EC 4JLRA 1KJ3L 2R0KL 5SWZE 5F89B 1KCSH 1IAOB 4FMFA 2XWJB 5GGVY 3QI9D 4BH8B 3T2OA 1A6AB 2JIXA 3BPCB 1TCRA 1JFQH 5BMFL 3P3YA 1B3JA 1JV5A 4NZRL 1IM3A 1F4WL 2X10A 4ZFGL 1BD2B 3O3EA 4FG6C 4NQEE 5FEBA 3LEVL 1OAYH 4D0DA 5DZNA 4PV8A 3UAJD 3M8OH 4HBCH 3D5OF 3MNZB 5HVHB 3TGXA 1RUAH 2QEJA 5GJSL 4YHKL 5D7LE 1BQUA 5KANI 2ZOKB 3G04B 4O02L 4U1NB 5FCUL 4H8WH 4HMCA 2PNDA 3MJ7A 3VXMD 1OF2B 3H9SB 2HT2C 1XZ0A 3LS4H 2A6DB 3STZA 4LMQE 2NTSP 3DGGA 4QXTB 2NY4C 1GGBH 5GRWA 1B0RB 2FCBA 4LAQH 4EOWH 2DMKA 4F9PC 4Y4KA 1JYXA 5JUEL 4Y19E 3IDGA 4RQQA 3GI8H 2IALA 4GW1B 3WO4C 4P2QE 1LP9B 3QP3A 4HZLB 4KXZI 1HHHA 3DARA 3O9WB 4W6YB 1MH5B 4LSQL 3AAZA 5GRXG 4I9WE 1ZA6A 4LRNH 3LD8B 3BISA 3A0OA 4GKZB 4RFOH 3UTSD 1QPXA 4R2GB 3BP4B 2EO1A 1DEDA 4PRHE 2VLLA 3Q5YA 3MRJA 1HK6A 1AFVL 2VDPL 4F7EA 4AIZB 3E0GA 1UCTA 3QUMH 4H8WC 1AGDB 5IV2B 3U9PH 1A2YB 1UGNA 2FGWL 3C5ZC 5FGBC 4HHAB 1K4DA 1BJMA 4GRLC 1W0VA 1EPFA 2CIKB 3DTXA 2HT3C 3GK8L 1WK0A 2H2PD 4M7ZC 5DTFA 1IAIH 1CXHA 2HRLA 5I0ZA 3CFEA 1FPTL 1H3XA 3P2TA 3V7AE 2VDOH 4HGMA 1FYTB 4BH8A 2CGRL 4GBXC 3FMGL 3QIBC 3N1PC 4IS6A 5T3ZH 1V3MA 2NQCA 2P5EA 2Z91B 2EH8L 4AIXA 3RX8A 2CRIA 4RFNC 1S7RA 5BQ7B 3V5KA 3BI9X 5IKCA 2NTFB 1E6JL 5GIRB 3IFLL 5HY9A 5C3TA 3RTQA 5J06A 1FVCB 1OTUD 3U4BH 3FB5B 3L5WA 5BVPL 3GSVB 1J1XH 3X14B 3IS1X 3HNTL 3DVGA 5DD3L 2YUVA 4NO3A 1NUDA 1T3FB 1ZGLB 1W0VB 5L7XL 4LSRH 3OKYA 1I3UA 4Y4KB 2FATL 1T03H 4FQ1L 5HHPB 1AKJA 1Z5LB 4IIQB 4XNYH 3KJ6L 4HGWB 1ORSB 1INQA 1GCFA 2HP4A 4O58L 2JJWA 1LE9A 2FBJL 1IGTB 4H20L 3CJJA 5IVNA 2AEPH 2AK4D 3THMH 3VG0L 3L95A 5JOEA 4YHML 1HEZA 1KT2A 4TSAH 3BP4A 5JLZB 2BSTA 2EZ0C 3QRFM 1U92A 3ZKSD 4DVBB 2CKBB 4NN7B 2ZCLH 4JRYB 4GS7B 1B0GA 1ACZA 2ZG1A 1FC1A 1IBGL 5DJDA 2XG5A 3MJGX 5AYUH 4POYA 4LEXH 4OTXH 2NXZD 3BH8A 4K8RC 2FLRT 3TVMC 5ADPL 2UWEF 4YHPB 3JV4A 1NAKL 3B9VA 2R9HD 4PLOB 1F4WH 4ZFGH 2P8MA 2UY7A 5TE7H 1QACA 4Q6IA 3L5JA 2DLIA 1XF5A 3JXAA 5F7UA 3HR5B 4QRSA 1X5IA 4GAJL 1I1AD 1A14H 1MFEH 3QFJB 3JTSA 3ZDZE 2R0WH 1ADQH 1EXUA 3E8UH 4D2NA 3I2CL 5E24E 1GAFL 3D85A 5GS2D 5HYEA 3T4AA 3UDWC 1EGJL 2F74A 1YNTA 4WWKD 3MUZ1 3CC5B 3BP6A 1ITBB 5E8PA 3CXHJ 2JTDA 4N0YL 3VXUE 3DECA 3MV7E 1U41A 5ISZA 3LPGA 3RWCB 2RAMA 3PUCA 5ICZA 4FFZL 1FHGA 3QAZB 4NO0B 1M71A 4X8JA 2J88L 4OCRL 2FSEB 3QUZC 4RFOL 3HMXA 3JWOL 5JW4Q 1HQRA 4MD5B 5D70H 1H5BC 5GJTH 4WUUE 4OFYA 3HG1E 4DVRH 4NN6B 5A2JH 5ADOH 4G6JH 3RPIA 3F8UB 3GMPB 1UJ3C 2LU4A 4N0FB 3EDJA 4QOKE 5JOFB 1P1ZA 4NT6B 4OZHF 1P9MA 3EYSL 3I50H 3GMLA 3MV9B 3G9AB 1G7MA 1LO3L 2YBRB 1B4JH 4LSSH 1CFTA 2CDGA 3LHPL 4O51B 3WNKA 3O4LE 4I2XA 3B43A 1MF2L 2MKLC 3PXHA 2V7HB 4OLZH 3QIWC 2RBLA 4HAGA 2YZ8A 1U58A 3IF1B 4K7PY 4JM2B 5KVFH 3VXTB 4OT1H 3QISA 2ZUUA 5TQ0H 4R96A 4TTDD 1XGTA 1GOGA 1G7HB 1LD9A 4GAFB 4PD4K 3MMEA 2FJGA 4Q6IC 4X6BB 2DQIH 3GO1L 1N3NA 4UDTB 5IMLA 3OB0K 5D5MB 5ALCH 1F4AA 1JGEA 4TNWF 5JOFA 4LCCA 5KSBA 3QI9C 1C12A 1K85A 2IQAB 4FXGA 2J8UF 4AMKH 3S96A 2GW5A 1GC1L 5HHVH 5E9DA 1ADQA 4QXWA 5IROC 4JQVA 3P73A 4WW1A 1QR4A 4X6FB 1R3IL 3OKOA 1TIUA 1BD2D 5TDNA 2H6PB 1DQLH 3TM6A 1VADA 4Y19A 4OZ4A 3RWJB 3EDDA 3BP5B 5F6IB 4PJXF 1IC5H 3INUH 1G9NL 4XMLL 3SQOH 5LWYL 3BO8B 5E08H 4AL8L 1RULH 1AO7D 5GHWL 4JHAH 1A8JH 5BOZG 4F58H 3QXDB 1Q9OB 1BHGA 5EIIB 3K80A 5HGAA 1KEML 3CVHA 2UZIL 3CUPB 5DZOA 5LGHH 3VWJD 4OFYD 3SDYL 2VLJD 3RL2B 4KKCD 4MZ2A 4JGMA 1R5VA 1HZHL 4P4RB 3FQRA 1KBGH 3LD8C 4UOW0 5IVXA 1I8MA 5B4MC 3U82B 4FXKA 1NDMA 1CXEA 3I6LD 4BK4A 1FFNA 3NACH 5KVMC 3SPVA 5FV2A 4CVZA 1IBGH 4NNYA 3D69A 1QLRA 2PW2B 1INEL 2BVQB 3KDMB 4XNUL 3P30H 3MPCA 3O6FD 5I18H 2C1PB 1NC2A 5EBGA 5JORA 4IOIB 4KZEH 1SJXA 2XI9A 2LAAA 1O7VA 4OFKA 5H37H 3PE9A 1RUAL 4J6RH 2PXYC 4MMZC 3V4PH 3O2VL 3WHE0 3ZL4H 4XVSL 2BY1A 5IMKB 5CWSB 3AY4C 3CX5J 4JDTL 3E1F1 3HE7C 1JN6A 4LOUD 1OTTD 1S5IL 4OZGF 5HPMA 2P1YA 4X7FC 2W65B 1M7IB 4I0PB 1AXIB 1UA6L 4OUUA 2EH8H 2AABH 4PLKC 1JNLH 1RFDH 4NZTL 1KPVB 5J13B 3BPOC 3FB7B 5IW6A 2UYLA 1GGTA 3QUXD 5CIPH 4XP1H 3X3FH 1T83A 5HD8C 4ZUSB 1C7SA 3UTSB 3RKPA 2AP2A 1ES0A 3WXWH 5FGCE 3U0TA 3RVVD 3K7UA 3PHQB 2PF6A 1IEAB 1PX4A 4KKCC 3KPNB 2UWEA 5MENE 1AGBA 3L6FA 5DZLA 3C5SA 2NCMA 4G8GA 2YC1A 5I1AB 4OV5B 3O41B 4KRPC 4MA8L 3SO3C 4ELME 1MCQA 4G7YH 4X6CE 4QKXB 4KUZH 5ANMB 3L7FB 5F7NC 2QQNH 1KJ2L 4JFYA 5L8KB 3GK8H 4ZOBA 3J8F7 2YBRA 1MI5E 4X9BA 3L3GA 4C54A 4M03A 1X5HA 3BPLC 3RUGF 2B1AL 4OGZA 2YEZB 1ZT4B 2AK4B 2E27L 1BVKB 4HDIB 3NGBC 4L4VB 2VERN 2D7PA 1PFCA 3BZFB 2EDFA 3CU7A 3HE6A 3UTQA 1MPAL 4G3YH 1GHFL 3CK0H 1EO8L 3E6FB 1VGEL 1PAMA 5CKAA 2HFGH 3PWUA 3WJJC 5GGQH 5FV1L 3BGFC 3QWRD 4DGIH 4BQ8A 3U48A 1HSBB 1X6NA 5E9DB 3RVVC 1HINH 4RGMB 2IH1A 4PGJA 3REWA 5KOVC 5JA9A 1N0XL 4JFQA 3WE6A 1KJVB 5HD8D 2J6EA 4LSRL 2FECL 4MJ6A 4M9PA 5F44A 4LVNB 4OF8A 1A0QH 3T0EB 3QNZA 3QUXA 4I48A 5FO9B 5D7IB 2H9GA 3CMGA 4FFYH 4Q74A 1M7DB 4OZGE 1QFUH 4P2RB 3TO2B 3IXTA 3CSYA 3RU8H 2Y25A 1MH5A 2YD7A 4MS8D 2FH6A 1D5MB 1EHLH 2Z92A 3O0RH 1OTTC 4KPHH 4DGVL 5F3HA 1BFVH 4G8GD 4MAYA 4TSCH 3FOLB 1ZLWH 4DQOL 3SDYH 4LCWE 4R4FH 1IGYB 4X6EA 4XRCB 3MUGA 4CMMB 2OLDA 4ZTPH 5BW7A 1A7OH 1BEYL 1MRDH 3I6GB 4FQ2L 1C5CL 3V7MA 4CADB 2KZ1B 4BUGA 5ADPH 2EYTA 1KPRA 4XNUH 3B5HA 2WUBL 4FMKA 4WW2B 2VLRE 5CBEA 4PUBL 3LRGA 2W0KA 4LCIL 4P5TC 1FAIH 4ZUUB 1FNFA 4PV8B 4D9QE 2GK0B 4J6RL 3WIFB 3D18B 4PJXA 5BS0D 5CUSH 4HZAA 4CNIB 5KJRH 4EUPG 1J1PH 5EZOH 4XGZA 4Z5RA 1H9VA 3X14A 1FG9C 2WMPA 5KW9H 4K9EL 3HE6B 2AXHA 1VFAA 1BQLL 4Z76A 3MV11 1NBYA 5DUBB 4XWOC 1J8HB 3BN9C 4HLJA 2KL6A 3JV6B 2PKDA 1MWAL 5LBSH 3S4SB 1KLUA 4Z7UA 1H3PL 4ZUVA 1VKXB 4P3CH 4FQLH 1G9MH 2EECA 4OCYH 1OP3H 1IGML 3OKKB 2RIKA 1S9XA 4PD4J 2P5WD 1I7TB 4CMHB 1DSFL 4C4KT 3VXQB 3HE7A 2AKRA 5ESVA 3OXSB 2R2BB 3KYNB 4DVRL 5ADOL 1LO0L 1QFPA 3P0VL 4JFFB 3CDGB 2IANA 1SY6L 2X1XR 3Q5OA 3PGFH 4JDZA 2YC1B 2OXHA 3HG1B 2DJSA 3PWPA 2QLVB 1WEJH 4MVBC 4ZTOH 3RZCB 1IC5L 4R3SB 1INDH 1U8LA 1LDPH 1KTLB 1HXMB 4CVUA 5BV7B 4E0RA 5IHLB 2Q1EA 4R26L 4F58L 3ZTJH 3HTLX 4HIJA 1NFIB 2CQVA 3MNVB 5TF1L 4LEOB 1XIWB 4ZOEA 1KYOK 5LGHL 4LFHD 1I8KB 5HYFA 4JM4H 4X83A 1T5WA 3LQAH 1X5FA 5I73C 4GMTL 1II4E 4LNRA 3OZ9L 4LRIC 3ESUF 1XGRB 4U0RC 5H94B 1S9YA 3V8OA 4PJ5D 2DQIL 2VLKD 4MA1B 3IJSB 1I85C 5ALCL 4HWEH 2Y06H 3MRRA 2Q6WB 3GSQB 3SGDI 4AEIH 4WNQB 3IETB 5MEPB 2BOBA 3RDTB 3RWFA 4PYHA 1QKZH 3O2DA 3TT1L 4WY7H 3BP7A 4YXLL 3O6KH 2GTWA 1JZ8A 1I9JH 1QO3B 5D2LE 3ZDXE 2HKHL 1G9NC 3L3HB 1VFAB 2N7BA 1OLLA 4QHNA 4YO0B 5T3ZE 2AERT 4AQOA 4NKOA 5TFSL 2DQUL 1CU4L 5EU6B 3NFSL 1MOEA 4G6ML 2R8SH 3SQOL 4ONHB 1RIVH 1KLGB 3LKQA 5GS0L 1BD2E 4NQEB 5EO0B 9CGTA 4S1SH 1OD7A 1AGFB 3OF6A 1KEMH 1GGCL 1ZGLA 5A43C 3KYKL 3DUUB 3X3FL 3QDJB 2V17H 5C0JB 1DUZB 3WXWL 1AE6L 3KYNA 1BVZA 4YDLC 3CMOL 5BZDB 1C1EL 2OXGA 2Y07H 4N0UB 1U8QA 2A9MH 3PWPD 3CAFA 3UX9B 3MGTB 2FL5A 5DK2A 5F9OH 2QSCH 5JXEC 3QNYA 3EJJX 3IDNA 1FJ1A 1OL0A 4YNYB 2R9HC 3AREC 4KJPC 2XFXA 3U0PA 3HI5H 3ARDC 2B0SH 3BP7B 1CLZL 2CH8A 1U3YA 3MLTB 3QXUA 4QXUL 4GKSB 2ZNWA 4PRDB 5CILH 2G9HA 4X0KA 2NY4D 4I77L 1QSFA 1JTPA 3TN0D 1H5BB 1ZANH 2BHYA 3D39D 5IM7A 4PRPA 3NFPB 1MRFH 4PG2A 4BA8A 4DW2H 1ZT7A 2ZNXA 1IT9H 1NUGA 4ZOAA 3WFHB 2BNRD 4GG8B 1N3NB 3UTQB 3WFCH 5A2IH 2VDOL 4ZUUA 3NIGF 4TNVK 5I8EB 4OQTH 1A2YA 3L3IB 2YEZA 4C56E 4JVUA 4KMQA 1JFQL 2MHAB 1UXSA 5LBSL 5E03A 2HFGL 2FNBA 2HVKB 3SN6N 3VGBA 3FRUB 5CEZL 5DJ8B 4OCYL 3PWNA 3HS0A 1WZKA 2CK0L 1P4LA 1G0YR 1U8MB 1QSZA 5BVPH 3DUSB 3RGVC 1UJ3A 1ZS8B 1J8HE 1RJLB 1QEWB 1NBZB 4LFHG 1CS6A 3QO0A 4NQVB 4YC2C 5L6YL 4P3DA 1OAXL 3BWAA 3LVEA 2P7TA 4QCIA 1A6WL 1YJDC 1S9VB 2WBKA 1HYRC 4LMQI 4MSWB 4N8VB 1S9XB 4FQPA 2ZUQC 4JM2C 3GHBH 5AUMB 4QWWC 1UH4A 3U30C 2Y5TA 1KN2L 2C1PA 3IU3B 2WWMD 1QA9B 1EHLL 5BZDA 4NQCA 1D5XA 5D7LB 4TSCL 3F7PC 4DAGL 3OKEA 4NSKB 3VH8B 4OFVA 5DRXA 2XQYK 2H2PC 4L4VD 4QLRA 1KCSL 2CPCA 1IAKB 4HXAH 3CZFB 2LU3A 4XAKD 4LVOB 5DK0B 4A2LA 3TBVA 2WANA 1MNUH 1L7TH 4R4BB 3EO9L 1K9TA 1CF8H 3P77B 2DQTL 3V52L 1MQKH 4NZRH 2WUBH 1QR1B 1KN4H 1FFRA 3OG6B 3VI4F 3RX7A 1U93A 6FABH 2IFFH 4G9FB 3EFDL 5B8CB 1N0XH 3ZKXB 1W72B 1MFBH 3PGCA 3O3AA 4Y4HA 3CVIH 3LH2L 1KULA 1D5ZA 3VXPA 5DC4B 3DXAA 5SWSD 3MLSH 3O8XC 3U1SL 2E7BA 4PJHF 5L2KE 2D4FA 4M7LT 3TBVB 3P0YH 3G5YA 4YHIA 1IC4L 2YKLH 1CYGA 1QRKA 2B1HL 4GOSA 1AO7B 4OLYH 4N9GB 4FQLL 4P46C 2IBBA 3FQTA 1LEIA 2K1MA 4ELMF 2QADD 2NW3B 4PRBB 5IJVA 3DO7B 2IPKB 5DJCB 5KVGH 5T1LD 1YN6B 3KLAA 3ARSA 3BWAB 5F7EL 5TGBA 2L7JA 4JG1L 2QBWA 5JW4M 1RK0A 5ESQA 4NRYA 4KROD 4W6WB 2X2YA 1JGDA 3U83A 1RV6X 4KI5F 4ZAKC 4GRWB 5D70L 2HG5A 4LKCB 2AK4E 5GJTL 4ZTOL 1YEKL 4IBLT 1CLZH 4JZNA 1FO0H 2GK2A 1E4XH 1B6DA 1I8IA 3ZLQC 5BOPA 1Q72H 1ZA3B 4WENB 1QD0A 5FGCB 2YD2A 4PRPB 4JPVL 3TNNA 2VDNL 4PREB 1EEUA 4P49A 1SJHA 1FCCA 2EC9U 2F5AH 2OJZL 1HCFX 4JRXA 1NCBL 4EIZC 1UWGH 2A6IA 3HC0B 3BDYH 5B21A 1F90H 2EC8A 3ESVF 4U1MA 3QJHA 1XFPA 2W92A 3T3PF 4F7MA 4Y2DB 3K46A 3MV8A 3WFCL 5FXCH 5DYOA 4U6VL 5C0BE 1P53A 4P59L 1H3PH 4EN3C 1P5VA 2HJFB 3CVHB 3OTTA 5IW1A 4YAQA 4KQ3H 2IANE 3QYCA 3HNVL 1A1OA 4LDOB 5C86A 3GMPA 5TE7L 4MNQE 3ARGB 1FGNH 3KXFD 3QRGL 1XCQB 2HKHH 3MV9E 3OGOE 1EJ6A 5IBLD 3UPRA 3GBLA 2NW2B 3KHQA 2MHAA 4WWID 4PJFE 4Z7VE 1VENA 3D3VA 2PYEB 5DQJB 1CGTA 4LCWD 1WEJL 3KS0H 4MJ5B 2Q3ZA 1IZKA 3EW3B 1VACB 25C8H 1QHOA 1WZ1H 1OAQL 3G6JA 4YO0A 4PLKD 3L9RB 2VISB 3LAFA 3S36X 2IEPA 2H26A 5FUZH 1G84A 4FXGB 4KUCD 3QA3B 4JG0L 5A40E 1F4HA 3TPKA 4PG9B 1QG3A 5GHWH 3C6LB 3W0WB 4JPIB 4A6YH 3EOTL 3FO0L 3T08A 4PRIA 3KYMA 1AGFA 2J88H 3MJ8A 3RZCD 3ZSTA 3LN4A 5JLZA 1DEEB 4TQEL 4LARH 3OKLA 2EICA 3RY6A 1EUUA 2G2RA 2CKBA 4X98A 4UIMB 4D0BB 2VWEE 5ICZB 1HOCB 4MHHG 3B8YA 4ODXA 1UC6A 1KB5H 2WWKT 4O9HH 2OBGA 5EU5B 3D87B 1MAKA 1UKQA 1F3DH 4GUPB 3QDJE 1MRFL 5B4MD 2VH5L 3OXRB 1FV1A 3QWOB 1MY7A 2VZTA 2UVEA 5I74B 2YSSB 1CGSH 1NL0H 2ADGA 3MRHB 3PNWA 2VL5A 3ULVC 5HGBB 1JPSL 1WZMA 5FCSH 5INCA 1J05B 1MFEL 3QI9A 4X4XA 2YWYA 1NFDF 1CFNB 3QB7C 3MCKA 1FDLH 4OGYH 5J9PB 3FOMB 5K9QI 2IANB 1C5DA 4JY4A 1DBMH 3UP1A 4UTAH 3S34L 4PPTA 5C0CD 3GI9L 4DKDC 1GPOL 3KYKH 1CLYL 1HNGA 1RU9H 4YIQB 1KTLA 4OJFL 5GIRA 1IGCH 1UZ6E 3F6IA 2F5BL 2AGJL 4K7FB 1VSCA 5HHVL 5F9OL 2ORBH 4GSDL 4TTGA 3ZKQD 3S98A 1V05A 2HFEB 4MD0B 3CD4A 5DD0L 1A4KB 4PBVC 2GJ6E 4U05A 4XCCL 5FUOL 4F57H 1L0XA 4PRPE 3QDMD 3WFDL 2Q8BH 3BQUB 3NABL 4KTYA 4ESKA 4PYGA 3W2DL 1MCEA 1T3FA 2DI7A 1DBAL 3QUYD 3L3KA 1AP2A 2RHEA 4X9GA 4TULH 3H9ZA 4LEOA 2X4NB 1H8SA 4YFLF 5JHDE 3V6FB 2D7NA 3KHOA 4LHJB 4HWUA 1INQB 2QQNL 3UTSA 2CR3A 1MF2H 5CLTA 1IT9L 2GJ6A 1U8OB 3WO4B 4WW2A 5CBEB 2O93L 1X5GA 3IJSA 1MCIA 2VE6A 1MEXL 2NNAA 1Z0MA 3TLRA 1KG0B 3DROB 3F7QA 5L2JB 1OP9A 4UV7H 5C09A 3ZDYE 4UQ3B 2E27H 5JMRA 1N4XL 3HUJF 1FLTX 1HIML 1MQKL 3ZDXF 1I1YB 3GIVB 1JK8A 2OTWB 4WFFD 5GSVA 1H3WM 2AJXL 4N9OB 1MFNA 2DWDB 3RZCC 4BK5A 3QDMB 4RX4A 4H26A 3T1FA 3MX0A 3K4DA 3HNVH 3H9SA 1KJMB 2EKSA 2PYFB 3DUUA 4JY6A 3MROA 4K7PL 4CADA 1T0PB 4IJ3C 2BHZA 2AS5M 1MJJA 2XWBB 4RISH 5JORB 3MGTA 4NC2B 2F54B 5CSZB 4GKNB 3S5LA 1DDHB 1G7JA 2ATKB 3U9UA 4QF1A 4M7JH 1ZVSB 3OG4B 4UILL 2YKLL 1CT8A 2R1XB 4HS8L 3UPRB 3MUHL 1ZOXA 1GL4B 5DHXB 4K7FA 3KGRA 3BPLB 1QFUL 1U42A 1EJOH 1RJZB 4P5TA 2Z35B 3NCJL 3MA7B 1EZVY 3QDMA 4U1GC 3S97C 4AIZA 4MX7A 4ZD3H 3IXAB 4NKIL 1CBVL 1KBGL 4H25B 3QJFA 5EUOE 1FO0B 5FYJH 5IHZA 3CVHH 4ZFFB 1PX3A 4BJLA 1ERNA 4OV6F 5I1JL 4HWNA 4OGXH 1DDHA 1G7JB 4JY6B 5AZEL 4K8RD 4L8SB 5HI3C 3O3BB 4D0CB 1NGZA 2HVJA 2UY6A 2WWKO 3FQUA 2HWZH 4PUBH 1MFBL 2ICEB 3IDYC 2FJHA 5C0NC 4K23H 4NYLA 5DMKA 1NL0L 1JMZA 1XGYH 3HLAA 3P4NA 2X4SA 5ACZA 3LV3A 3P4MB 1FPTH 1J10A 2R0KH 2A0LD 1HHKA 2AEQL 5TPWL 2B4CC 4IRJA 4LLDB 1QVOA 3MRBA 1EO5A 3WD5L 3IRPX 3RVXD 3MRLA 1R3LB 4Y4FA 3VXTA 4HLZG 4OI8A 3PL6B 4EXPX 2ZOLB 3MOQA 3CPLB 3ARGA 2P49B 3T0BA 4KTDL 3GDBA 5DQDH 2FRGP 1CDHA 3HNSH 4OFPA 2FIKA 4ZSOB 1A47A 5CMAB 2RJMA 1EDQA 2HTKD 5D1ZB 5E94A 5F7KC 4P2OA 4LAJH 5EO1A 2XZCH 3SOBH 1OTUC 3P11H 2YZ1A 3VXOA 3W39A 1UZ8A 3LKNA 3P0VH 4LSTH 1CE1L 1ED3B 1MUJB 3PGFL 2P4AB 4Z6AT 3AM8A 3U4EA 4KK6C 1Q72L 5GS1A 1T7XA 1FQ9C 1T03L 1A7QL 2R69L 4FQXD 5JXED 2VDLH 4WEBH 4LSUH 3FQXA 4NGHH 4FTVA 1NC2B 3DX6B 4LLUA 3O4OB 3LQAL 2R1YB 3QAZC 1A7OL 4ZNCD 3HI1B 3AMLA 4OBSA 5MEOA 1KIRB 3QFDB 4GRLD 1I85A 3F65A 2O26U 2DB8A 4R6UA 4W68A 5EWIL 1MPAH 2J2ZA 4G3YL 1MJ7L 1CD1B 3NZ8A 3CLEL 5CP3A 4D9QD 2AV1A 5FO7A 3WKMH 4KQ3L 1F5WA 1RZKL 4UIKH 3B2UC 5D93B 2FYYA 4JDVA 4IOIA 2X4PB 5BV7H 4OLWH 4H1LG 4HFWA 1CGSL 4OGAD 4WHYH 5IVXE 2B8OT 5IK3B 3T77A 5C07E 2QHLA 2EYSB 4Y4FD 1IE5A 1LK3H 5L88H 1NGXB 2DDQH 25C8L 2MWCA 1EZVX 5DJ8A 5BRZD 4HFUL 5ACLA 2K3TA 5D2LA 4MXWH 1UH3A 1GGBL 3K8KA 5IBTL 2XZAH 3RWDA 4LLMA 1W2KT 3F6LA 2PR4H 4KK6D 1RUQH 1TVHA 2GK0A 4NQTA 5EH1A 5GGUB 1M4KA 5GRVL 2BXYA 1SBBA 1OPGL 1J1OL 1E4WL 3OR6B 4LLUB 2HT2D 3RWEA 5HDBF 1LEGA 2DYPB 4BSWB 2DKUA 2HFFA 2VR9A 4M02A 2FO4B 2V5TA 2VUOA 4TN9A 3UPAA 1R3HA 2DM3A 1TQBC 3EUUA 1ZLWK 5C0FB 3MJ7B 2QTEA 1J87A 1MCBA 3MLRL 3IU4L 5FUOH 1S7XA 4YXKL 4RFNB 1UZ6F 2FYYB 1QSEA 1SY6H 4HJGA 3NABH 4YQXH 4UUJA 5IFHL 3PXJA 2NY6D 3ILQC 3DETC 3PQYA 2XY2A 3O8XB 5MP6L 3T77B 3RWDB 4L8SA 3T3ME 5JDJA 3ZE0E 4QTIL 1M6OA 1VPOL 2IADB 1NEZB 2FBJH 4H20H 2QKIA 4YZFF 2CXGA 3C60A 3CFIC 4YHMH 4K8RH 2Q7YA 2IBZY 4FS0A 4XWGH 1EA9C 3F5WA 4P46B 3WO3B 4F2MA 4A2MA 5D1XA 4Y2DA 2DICA 4K9EH 3QIBB 3TZVD 1UQSA 1KIPA 1W8NA 3NH7L 4P5MA 1TVBB 3MCLL 4JFFD 4I3GA 3O6FA 1L4IA 4X6DB 2BCKA 3U79A 4D94A 4J2XA 3UYRL 1I3VA 4X99B 4WFGE 5HI3D 4PIRF 3SBWC 4OI9A 5GS2H 1I8LA 4XWOD 4OQTL 4HMEA 1ITCA 1PYWB 4PJAA 3ARDD 4NQDA 4QT5B 4XBPB 3TCLB 3U6RA 4OJFH 1BQHA 4N1HB 2YUWA 3FT3A 4I18B 2AJ3B 3OGCB 4U1JB 1QFWH 2MCPH 4LCYB 4F8QA 3QEQB 3S6CA 3BP5A 3HZVB 3ZYIA 1LK2B 1AO7A 1A7PH 5ALBH 5INDB 3SJVD 5EZJA 5JPMB 3DJ9A 4LLMB 4LPTA 4ONGH 4Z0BH 2EIZA 2X70B 2HG5B 2BJMH 4LKCA 3QDAA 3QWQB 4PRNA 4PGBA 3DWTA 5I19L 5GS0H 4BSWA 4F37F 5LKNA 1N5YL 2VDKH 5F93C 3OAYH 5T1DH 2V17L 1J5OH 2A6KA 3V4UL 4HJJH 2E3VA 4J1UA 2VJXA 4JM4L 1GOFA 4HEPG 2V2WB 3ARBA 3CMOH 3QIUD 1B9ZA 5IHBA 3QPQD 4OQTA 5FYJL 2J4WL 3VWJB 3B2VL 4M62H 1BBJB 5DVMA 5CZKA 2R2CA 2JJUA 1MHCB 3AM8C 3HI5L 2Y06L 3O8XA 3V6BR 1K8IA 4U4BA 1XF5B 3VFVB 4EVNB 3WIHL 1XGRA 4X6DE 2XIDA 2AQ2A 3EIFA 5ENWA 2ILLA 1RVFL 5IJVB 2X44D 1WUNT 4GKOA 4MZ3A 1FFOB 2WUCH 5LXGH 2QSTA 2K7PA 1YA5A 5JW4N 5C08A 4B5EA 4AYFA 1MCPL 3QEGH 5BV7L 2X4SB 3C6SB 1RUKL 4NN6C 2Q8AL 2DS4A 5IF0B 5IB3A 3PWLA 2ZJSH 3WSQL 1JVKA 2GJZB 3ETBF 1A9BB 1OSZB 4YE4H 1QRNE 3F58H 3SJVE 3LMJL 1CU4H 1UACH 4HIHB 2J3SA 1ZLUK 2ICEA 2FBOJ 5DRWB 2DQEH 4RGND 4FG6D 5LAXB 3LPWA 2A9NL 4L3CA 1T2JA 3MRFA 1PKQA 2PO6A 5HI5D 5IK3A 2R2EB 3QIWB 5DUBA 5FAAA 4PJBF 2PTUA 4NZTH 3PF2A 5EU6D 1F2XK 5GS3A 4JEGB 2VIRB 1XF2B 4TVPL 3SJVA 1T1XA 4M6ML 4ODWB 5H37G 5AWNH 2I9TA 1B90A 4Q6IB 2IC2A 1S7RB 2IGFH 1FFNB 3P9WB 3PWLB 1MCDA 3VFPB 4U1HB 2QL1A 4EI6B 3IT8D 1U95A 3QUMB 5KBNC 4R7NB 1RUPH 3MJ9L 2ICWI 1JRHI 3QFJA 4Z95L 2KKQA 5GGTA 3CH1A 1QBLL 4PS4H 3C09C 3D6GA 5F7MC 1W72H 4QOKA 1PG7L 3K8LA 5EZLA 4YK4B 3RVTC 5KSVB 1NLBH 3BUTA 1UZ8B 3IB4A 3ZKXC 1LO3H 2W0FB 1JUFB 3O4LB 1RJLA 3TFKD 2VZUA 1VPOH 1Q0YL 1P69B 4WEUD 5T5FL 4E42A 1GOHA 3MMEB 3GMOB 4P9HC 4ZPVB 3VG9B 1WV7T 1D9KB 4UNUA 4UT7H 1I7RB 4XH2B 4AG4L 4J4PD 2F5AL 3WHE1 2WBJC 3BPNC 2B1AH 2UWEE 4Y1AB 5J56B 4HJ0C 4TOYL 3IDIB 4KKNA 5F3BA 5JXAL 3DI2B 3GSXA 4K94H 4IS6B 3QG7L 4JKPH 3VRJA 4O51A 4E5XB 2M1KA 3QEHB 2J1KA 3P9MB 4K94C 4BKLB 4UTBL 5J0BA 4NDMB 2H8PB 4GG6B 4M43H 3O11B 3V5DB 2CDFA 3R0NA 4AENA 2VLJE 4GLRH 3OAZH 5C0RH 5E1AB 3AB0B 3G6AA 3SCMC 4P5TB 4M7ZB 2OL3B 4UT9H 5L9DH 2AEIT 2CIIB 3QCTL 4O2FA 3RGHA 3LH2H 4R96B 1FYHB 3RFZC 3HZVA 3I6LE 2X9XA 4NQEA 4PY8I 1T1WB 3IFNH 5ID1A 2GAZB 3DGGB 4R7DB 3GJFH 3WCYA 1FO0A 1E27A 4OCWL 1ZLVK 2AK1H 3S3SA 1F97A 4LPCA 3WNNA 5EU6A 3QJFB 2EDJA 3T4YB 1F3RB 2ZPKL 1DUZA 3RY6C 4IJ3B 3DO3A 2HFEA 4MD0A 3MRMA 3EFFB 1J1OH 3MUGB 1YJDL 4F9LA 1FCGA 4PJ5B 3S8WA 1PBYA 3HFMH 4XP9H 5KZCD 3DOSA 4JO3L 4OZHE 1BWWA 4RIRA 4N90E 2DIBA 5E00B 5D2NC 4A6YL 1U8HA 4KHTH 2NY3B 1F42A 4XTRC 3KPMB 4BKLA 3TP4A 1DE4B 3EO9H 4ZTPL 1YMHA 4U1GB 1Q9WA 4NO0A 1S7SA 2CDEB 4UIKL 2VAJA 2W9DH 4ODTH 4WHYG 4IIQC 2V7NA 2VE6B 2PYEA 1LO2H 1OWWA 4YHLL 1A9EA 1CXKA 1GXEA 1CQKA 1U8IB 4UV4L 5LGJA 4J4PA 3HPJA 3TBYB 1YNLL 3FFDB 1SM3H 1K5NB 2APTA 4OZHA 4KRPB 2V2TA 4HPYH 4OZFB 1S8DA 3PWUB 1XIWC 3MLWL 1NCDL 4U6YA 5GSRA 3TIEA 4Z7OF 3MLSL 5HYJB 5JQHC 2QQKL 5CSZA 5C08B 2R23B 1URLA 2P5WA 4GQPH 4E5XA 2FX7L 5SWZD 4F3FA 1BQLH 1MJ8H 4NCDA 4K3JL 4MNGB 5D1QB 4ZYKA 4N1EA 1T2QL 2HN7A 4WTZA 4WU7B 2F54A 4HS6A 3CFBA 5D7SL 1KCUL 5I30H 2NYYC 5D6CB 2BNUB 4KU1A 1A5FH 4HV8B 2Q20A 3LEVH 5BJTA 3JVGA 1P7HL 5CEXA 2BVPA 3AROA 3TJEL 4G8GE 3KPLB 3HG1A 4OLVL 3IU4H 3TBTA 1OGTB 3MRPA 4ZNEE 5D9SA 5BQ7A 3BSZH 1YUHA 1D5BB 1Z2KA 3FT3B 1FL5B 4Y89A 1TZHB 5CSBA 1LILA 1N26A 3PIQA 4TVPE 1SVCP 5CZXD 1DVFA 4Z95H 4DK6A 4OCLC 4OFDA 4NC0B 4YDVA 3TJHD 4JFHE 3CIQA 2EIZB 2CMRH 2VTFA 4LOUC 1TJIH 3VXNA 5TE6H 5DK0A 1FFPB 1SYSB 4DGVH 3HI1A 3BEWB 2OR9L 4NO2B 4DQOH 4AEHL 2PXYD 4P9HH 2DQHL 5IV2A 3BUYB 1JRHL 2E9WA 1OP3K 3KLHC 2X1QA 2VQTA 4X8XA 3TPUB 5ENWB 5D8JL 1MEXH 4QRRE 5T5NG 4FQQA 4ZMAT 3DRQB 1QSFD 5CJQL 2H2SC 1Z9MA 1AP2B 3ELAT 1GHFH 4XNMB 5DO2D 2DM7A 4N0CC 4BZ1L 3O41A 2ARJB 1W0WB 4MDIB 3HI6H 4LLYB 2MMXA 4PP1D 3VFWB 1XF4A 5DYOB 4UTBH 2VXVL 2G75A 3ULUF 3CUPA 3IRZA 1K8DB 5IQ9A 3U0WH 1UWXK 4I4WA 1BECA 5K33A 3F7YB 4JCLA 4XZUA 1NGQH 2XN9A 4WFED 5FA4A 1IKFH 5ID0B 3LMJH 4UQ2A 5DD1L 1I9JL 1R3JB 4DOHB 2DQGL 3IFNL 4N9GA 4HS3A 4NRXB 1T1ZB 3LS4L 5HYQB 1C16A 5I1EH 4QY8B 3WIIH 3CX5K 1A6ZB 5DJ6A 1A6TA 2ICWB 4LPUA 5TDNB 5TFSH 1NAML 1OSZA 3GI9H 2ATPB 2F53B 3CFBB 5HHMB 5FM5M 1WAAF 2R8SL 2P47B 2ADGB 1Y18A 3HG1D 1ACYH 4RFEA 3Q6FB 1JZ7A 4RGNB 5E5RB 1A6PA 4AEFA 3JWDH 5DMIH 5T3XL 2PCPA 3X12A 4YDIH 1CD9B 2IPKA 3EDKA 1BEYH 5DJCA 3BPCA 2AJZA 1LO0H 2W65A 5FYKL 1DQMH 4CVXB 5CD3A 3GKWL 2P5ED 4J7RA 2YPLA 2IFGA 1AY1H 1YMMB 5D1ZD 2Z93B 4F37K 4JFDA 2IAMB 4NQSA 4WW2C 1NFDB 1JHKH 4U7SA 3KXFE 4IDJH 1MVUA 4GAGH 4KROB 4POZD 3RI5F 1NGYA 5ITBL 3O6FB 5D7KE 2QQLL 5MEQB 5F3HB 3OKLB 3E3QE 4U7KA 4LCIH 3MZGB 2N1KA 3GKZA 5ELIA 4Q97A 4QXUH 3RTQD 3MUJA 2PXYA 4DCQA 6CGTA 1H15A 1AGCA 4RRPG 1YYLL 4DZ8B 4M1DL 3EO1A 1XCTB 1G7QB 3F58L 1FN4A 4YDJB 2BXZA 5BV7C 2BRRH 1HYSC 3MBEC 2YD9A 3HC0A 2R0LL 1AHWA 5JOPE 5TPWH 3GMQB 1IC1A 1M1SA 1UM5H 4X9FA 1XF4B 4GRMB 4MAYC 5EULV 3QQ4A 2F74B 2AJUH 4BSVB 2XN9D 1ZT4A 2AK4A 4EI5D 4CGTA 1T2QH 3ARED 4KJPD 1IGCL 1Y6MR 1KCUH 1EFXD 1KIQB 1MCWM 4QHUB 3W9EA 5J4MA 3X11B 4G9FD 4KDTA 1T7WA 3L1OH 2IAMA 1T22A 1XCQA 2XXCB 3ROOA 4R7DA 3QO1B 5T3XE 3O6KL 1XCTA 2ADFH 2D7OA 4IRSC 4F57L 4U1SB 5I17B 4Z0XB 2CRMA 3MYJB 5EBWB 1RMFL 1BIIA 5E2WL 3G6AB 1S5HA 1DBAH 1N7ML 2PTVA 4PTTA 5L6YH 3NFSH 4M7JL 3VGAB 3PL6A 2CLRB 4X6FA 5A16B 3KJ6H 1RIVL 3BZEA 1BMGA 4PP2B 5CP7A 4X7DC 5DJZB 4IRJB 3FT4B 5IGXH 2DQDH 1FVDA 3HB3C 4PY7B 2NY1C 2QKIB 3PIQB 3QEQE 2EDKA 4XPBH 3OAUH 2ERJB 2XYCA 3RWGB 2YPLD 4K3EH 1U3JA 1JPGB 4JFDD 4UOJA 3QUZA 4TUJA 3HRPA 2X7LA 3LQAC 4HCRH 3IJHB 5JXAH 3OX8A 2MKWA 2NPLX 2UUDH 5H35A 5F9JB 1RZJC 2Y23A 1HIMH 1VA9A 1FNEB 5B8CA 4ODTL 3FQRB 2CK2A 5I1KH 2X4OA 2XNAB 3FTGA 3PGDB 1QRNB 5MHSD 1JWUB 3D9AL 1A9BA 2A1WL 4X6CF 1WIOA 5TDOB 4JJ5B 6FABL 2W1NA 3GEWB 4XZUB 3GBNL 4OM1H 3G5YB 3MV8D 4WI3A 4MD4B 1S7UB 4HIEB 1Z5LA 2XV6B 1S7QB 4IIQA 1LK3L 3E8UL 2FD6H 3MJ6A 5DD1H 1K5NA 3GSNB 3FZUC 5HDQL 4JHBA 3VW3H 4P0DA 2GSGB 1DLFL 2MCG1 5C92A 3V8CA 4KI5D 4ZDHB 4MVBD 2F53A 5GZOC 3GO1H 3T3PE 1QHPA 1FZKA 2X5PA 1ZE3C 4L9DA 3TH2T 4NRXA 1YEEH 4OLYL 2V5SA 1C1EH 2Y07L 4PG2C 4C83B 5D7LA 3X17A 3D25A 1G7LB 3AS2A 3FT2A 1ZTXL 5SV4A 3FKUS 2DTMH 4JRYA 4LVNC 3A67H 2BVTA 4YZFE 3OAZK 3FRPG 4K07A 4FQHA 3UTTA 1T0NA 3TBSA 4K3DL 1U3ZA 2M8XA 3GSOB 2D9CA 3SBWA 1ZT1B 4ZO8A 4LQFL 4JFEE 4RMTA 1KPRB 1VFUA 2QQLH 2J6EH 3CLFH 5T33H 4KK5C 4HH8A 5C6TL 1PEWA 4TUKH 5TE6L 1YQ2A 4FFVC 4DTGL 2ZUVA 4TVSa 5IKCB 3U4EB 4OCXL 1M05B 2OX5A 5DC0A 4ZS6D 5SWSE 3GSWA 4Y19D 5C0DB 2ZSVA 2V7HA 3SGEI 1MNUL 1FORH 2FX8L 4R3SA 5L2KD 1BJ1J 4XCEB 3GB7A 5DS8A 3WKML 2M2DA 1I75A 3GMRB 4ODUA 1QLEH 3BPNB 1CDBA 5AZ2L 4KJQC 1E4JA 1JCKA 4JZJB 3Q1SL 4X4ME 1MWAB 1N6UA 3O9WD 3RWCA 5HVHC 3F5WB 4F2MB 4YUEL 3EJZD 3O2VH 5FECA 2W9EL 4I0PD 1YEHL 1X5YA 2B5IC 1KB9K 2DDQL 1DQQB 5FKPA 3TO4A 1J12A 3IKCB 3I84A 2H41A 3CDGA 3SQBA 4QF1B 3DX8A 3NCBB 3LEXA 1Q9WB 2EH7H 1PLGH 2P44B 3IDXH 1DBJH 5F1NB 4L4JA 1FBIL 2GHWB 2VQ1A 1ZHBB 4JRYD 2X4TA 3EYOB 2PETA 2VXSH 1HZHH 3MLRH 1G0XA 4MJIB 1XR8A 3QSKB 3SCMB 4GUPA 4OD3H 1A7RH 1LNUA 4ONHA 5HHOD 1CCZA 4JFYB 1RY7B 4P9ML 1Z9OA 5C6WH 4Z7OE 2FJFA 2EE9A 4RDQG 3UBXG 1XGQA 3UC0H 3NPSB 3R0MA 4KUZL 1FJ1B 1G6VK 4YNYA 5C0GA 1PD6A 3CFDB 4KUCF 1YYLH 3IETA 2Y1VA 2YPKA 5MEPA 1P2CB 1KJ2H 2BVOA 3MCKB 4KK9D 1U8OA 5CP3H 5IB2B 1U91B 3D9AH 2F8XC 4N0UA 3NIGE 1RZKC 5CD5C 3HMXH 1MI5D 4ZXBD 3EYQC 4OCMC 1ZVYA 3HMWH 4HFUH 3CSGA 1HQ4B 3JBG7 1UA6H 4Q0XH 1I1YA 1D9KD 3OAYK 1FDLL 5M7QA 3C2AL 3C5JB 4PJ8A 1A4KA 4D0DB 4OIIL 4ONFL 1FIGH 5D96C 4XP1L 7FABL 4OUUB 1I7RA 2VITA 1HI6A 4K2UH 3VD3A 3VA2C 3HA0A 3WLWC 4Z7UB 3QZWB 3WLWD 1XT5A 1A7PL 2F8VA 5ALBL 4P2CG 4QHMA 2WLZA 1EFXB 3QUXC 3N85L 3IJYA 3DURB 5IFHH 2YRZA 4OZIE 5DRNA 1U91A 3V4VL 1Z3GL 1XF3A 4PGDA 4G7YL 3EYUL 1C5BH 3BQUD 4WU5B 3VGAC 1MCCA 5DMYA 5F1KC 1PG7H 3W9DA 1CGWA 3PDDA 5JZ7D 1XIWA 4XNZB 4PJ9B 4QEGA 1DCLA 3DROA 1QP1A 1SVZA 5AEAA 3ME0A 4XWGL 3LKOA 5D1QC 3WS3A 2PW1A 3HCVB 2YD5A 1N5AB 1YEGH 2CLZB 2AXGB 5SWQB 4QRRB 4KTEH 4KGJA 3NN8B 2APWA 4Y0GA 4Q9QH 2YWZA 3DX6A 2ESVA 4DUXA 1XF2A 2E7LC 5DFVD 1A1OB 4U6VH 1I8IB 2WZPD 5IEHB 4FQ2H 5DD6B 1KJ2B 5K93A 3STLB 4V1DD 5EUOF 3ECBA 3F7VA 1Z0NA 2BSSB 3JWOC 3L6FB 2VLRD 3BGMB 4NNXB 4XBEL 3VXMB 1VACA 2ZSVB 3D85D 1KC5L 1OAZL 4OIBA 3M8OL 1RURH 3QJHB 1HNFA 1SBSH 3TIDB 3S35X 1I7TA 1QFHA 1D9KA 4JZOB 5IVZA 3KPRD 2BC4B 5TE4H 2NZ9C 4PGCA 4IHOA 1MCWW 5ISZD 2N4IA 3QEQA 1FFOA 4PRHB 4HW6A 3I6KB 3R8QA 5KSUB 5B38G 4J8RB 4L1DA 5FIEA 3K1KC 3GHEL 5J1AB 5IGXL 1YY9C 2FB4L 4MJ6B 3S5LG 1IAIM 1PZ5B 4S1DC 3T0AA 1NGYB 2CO7B 3ARQA 1YEEL 4R8WL 2CLVA 1RZJL 5LVEA 4K3EL 2Y6SD 4HJGB 2GT9B 1GZPB 2WBJB 1TJGH 3HZKA 3L3OA 1G9EA 1FNHA 2OQJB 2A83A 1FG2A 3TYGL 5CGYC 4LRNL 1LP9F 1DQTA 3QEUB 4QRTB 5GISL 2DKSA 5CJXA 1I3GL 1RI8A 5I1GL 1P7QB 3BDXA 3DV6B 1IVLA 4UBDD 4PRBA 3QIUB 5C0CE 2VLRB 1CDUA 1DTUA 1LDSA 4Y19B 3BEVB 1UCBL 1AGCB 2P48B 1Y6NR 4UDUA 3GJEA 4TULL 3NMEA 1H8NA 1E27B 1TETL 3QCUH 4FQJL 3PQYB 1MHEA 1FAIL 4M6NH 5EBLA 1RUKH 2Q8AH 2YPVL 4HUWB 5T5FH 1JN6B 1HQRB 5TF1H 2XA8L 3C5ZB 1W8OA 3ARGD 2UZYB 3KPRE 4FOMA 3QDME 1A7NL 4HPYL 1U8PB 3QQ9C 2NY2B 1TVBA 4FFVD 4QRTA 2BVUA 3WDHA 4U3XA 1A6VL 3IXTB 1WICA 4NJ9L 5E2VH 3IS0X 3N1FC 1FE8L 2QQKH 1ZHNA 4BQBA 5EC2B 2VLRA 4NWTH 5I73B 3O81A 2IH3A 2V5RA 5F1IB 5K9OA 4RFEB 2O5YH 5AZ2H 2LTQC 2PTTA 4HFWB 4KDWA 1ZVSA 1D5IL 1A3LL 3PHQA 4XVJH 4OZIA 4KAQH 3U2SA 5JPMA 5JW3L 1HDMA 4GW4A 3IFLH 5T5NF 3IDMB 1ZS8A 3MYJA 2I07A 3NZHL 5IB4A 3VWKC 4YXHH 2XZQH 3A6CL 2JJTC 4FN0A 4XNMA 1T20A 5HHQA 4ZS7L 2VLKA 4JCMA 4ISVB 4YH6A 2OI9B 1BOGB 4L8BB 4HC1L 5D2NA 3D2UB 5I66A 1K8DA 3TA3D 4IOFD 4I0KA 4AT6A 5KTEH 1AQKL 3V7AG 1YJDH 5BZWA 1QYGL 3ILPB 3VXSE 1MLCB 1QFWI 5JHDB 2BDNH 4MJIE 1Z9LA 4LPWA 4PJBA 3NCJH 3V5HB 3VFUB 3QUKB 4JKMA 4RBPK 4BFIB 1TCMA 5K9KA 1IAKA 3LY6A 1CBVH 1CLCA 1FZMA 3BZ4A 4DN4H 4G42A 4FFZH 2A6JB 2YUXA 3DVNA 4KKLD 4J3WA 4OD3L 4G8GB 3RIAF 3CVHL 1E28B 32C2B 3TVMD 4Q2ZB 4ISVA 5D8JH 1FZOA 3UTPE 4JQXC 4W4OC 3RUGA 1QPPA 5EWIH 1FVEB 5FKAB 2LE9A 2ESVB 1OW0C 3Q1SH 5DMJB 3KPOB 3G5VB 3EYSH 3ARFC 1FL6A 2FZ3A 4Y4HB 2CKNA 4GG8A 4JR9L 3SDDC 1OAZH 3D39E 4J3SA 4YHZL 4XNQB 1KIPB 1S78D 3UTSE 3UZEA 4CVZB 4RISL 4YBQD 1NCDH 4CU8A 5ESVB 3HMWL 4RNRA 3SE9H 2P8LA 5L88L 3RWEB 3AGVA 3NA9L 3GMMB 1G7PB 1PQZB 2VSDA 2BNRE 2ARJQ 2EIBA 1H15B 3DMMA 1TPXB 1WTLA 4OZFA 2PR4L 4ZPTB 1GGCH 3TA3C 5D7SH 2XQYG 4K2UL 5GS1B 4JFED 3LRHA 2HRPH 1J0HA 2OTUB 4OLVH 1WVZA 2IPUG 3QEUA 5HGDA 2WIMA 5F97E 1OY3B 1RZGB 2XPGB 1DQML 2B0SL 4OGXL 3RWJA 4FZEH 3I3BA 4MNQA 3MA9H 1JF6A 4MXVF 5ID0A 3ZTNL 4P5KB 3H3BC 3Q3GA 5DJDB 4YC2B 3L5HA 3QXDA 2C3WA 4FQJH 1HH9B 3QCUL 4PJ9C 5GXBB 1UB5A 5EBWA 4LLWA 1BWMA 2YPVH 1R3LA 5KANG 3LS5L 3VGDA 1QBAA 3ARDA 3NA4A 3M17A 1FH5L 1KUMA 1Y0LB 2MQ3A 5F9AC 1Z6JT 3HPLB 3MUY1 4IRZL 4TUOB 3VMPA 1JZ3A 1ZGLM 1JF1A 4HD9A 2ZUTA 1N59A 1L0QA 5E6ZA 3W0WE 2LFGA 5HYJD 1PKOA 1CWVA 3IAPA 5EOCJ 4O2FB 3V52H 2BNRB 1U8JB 4HKZB 5DD5L 5DEFB 2OP4L 4WUUA 4WCYH 4AENB 2DJUA 1UVQA 1MCJA 3HLAB 5J6HB 1IAII 4X5LA 4Y1AE 3GIVA 2YA1A 4JFPA 3NZHH 4PRHA 4MA3A 1XH3B 5AD0B 2MCPL 3RVWD 3EFFA 1HHJA 1OGAA 1UM4L 3KLDA 3A6CH 3SDDD 2BVPB 5GRYA 1HSBA 4X0KB 4X5XA 4MJIA 1YEIH 2DM2A 2PYFA 2Y6SC 3TIDA 1YUHB 3I75B 2IG2H 4KMLB 1MIEL 5GPRA 1JWMA 2VQ1B 1ZT7B 3M45A 4Y4FB 3SGDH 2UV3A 1CDYA 1E6OH 5DRZA 5I1IL 1YEGL 2J8UA 3WFHA 2F19H 1U3HA 2AJSH 1MSPA 3MO1B 4R2GC 5DHVH 1YEJH 1S9YB 1UJTA 3U7AA 1WWAX 3FQWB 1G7MB 2XY1A 4LLQB 4Y5VA 2C9AA 3MRRB 3FRPA 1MJ7H 3MRNA 4M62L 1IM9A 3FFCA 2B5IB 2A6DA 3STZB 3ULSA 4I1NB 1HXMA 1M05A 2GITB 1TETH 2E8YA 3ZYJA 3NTCH 1FO0L 3U0WL 1J86A 3M17B 3L3HA 4TSBL 5IESL 1ZLVH 2P5WB 1I8KA 1KYOJ 2XKNA 2G5RA 4V1DE 4JFEB 2MTPA 5J6GB 3RIFF 3O2DL 5E5MB 2Z8SA 3E3QC 1U93B 3VD9A 1S8DB 3GSOA 3NH7H 1OLZA 4XVUC 4GBXA 4XPHH 3DV4B 5CBAA 5IBTH 3GMMA 1AJ7L 4WHDA 5FB8B 2C3VA 2YD8A 2NLJB 3GMNA 3VW3L 1RZ7L 4YIQA 4DZBB 4PJ7E 3D85B 1MCHA 1E4WH 3O3UN 3L95B 2HN7B 4G80B 4JGJA 3WFZA 1DN0A 3KXFB 5C07B 5D1QA 4UOW1 1J0KA 3SDDA 5IOPB 4ZUWA 5JHDD 3DRTA 4CAGA 1X5AA 4PGEA 5GISH 1QFWL 3CH1B 4WHCA 1QO3A 1T5XA 1UYWL 4H0HB 4NPYB 5F7DB 2AXGA 4NM8H 5SWQA 2C7UA 4QNPE 3HCVA 4D3CL 4H1LH 5D96B 1K8IB 3VFVA 3UTZB 3JV6A 3LZFL 5TQ2L 5C0EB 1JZ6A 1N7MH 2VZOA 4JO1L 4JREC 2NYYD 3DV4A 5CBAB 1NCCL 1RZFL 3HRZA 5I19H 3VGFA 5KAQF 3LKNB 1NLBL 5J13C 2BVQA 3KDMA 3V5KB 4X7SH 1U2HA 3KXFA 4Z8FH 4WGWB 4HKXB 1OWRM 5C6TH 3RVUD 3U7YL 5JDSA 3IKCA 4OF7A 4F9PA 1FVCA 1LEKB 1CQYA 2NLJA 2GTZA 4ELKA 5LAXA 1A6VH 3PWPB 2N56A 1A4JA 5B38A 4DUWA 2MSPA 4GJTB 1O7SA 1IEBA 4RGNE 3V6OE 2EXWC 3A6OA 1F3DJ 4KKAC 3H3KA 1N8ZB 1ZSDA 1EK3A 2F53E 2FO1A 2WM0A 4JVWA 1Y0LA 1EH9A 4HXBL 5B39G 3EHBC 3QUZB 4TUJB 3HZYA 3UJTL 1C8PA 3AAZB 2IPTH 5EN2A 1JHLH 3IDYB 4M43L 1UVQB 5J6HA 1ZLUH 4P3DB 2EXYD 4MNHA 1GC1C 3PDOB 4R9HA 4GMSH 3NBNA 5FYJU 1D6VL 2YD1A 2D7QA 4L8DA 1A6UL 4FNLL 4KY1H 1K6QL 3QO1A 3CCHA 5KTEL 1I9RL 3KPQB 4YR6B 5FOBB 4M93B 1KNOB 3PL6C 4J23A 3MV7D 4JZNB 2IF7A 2BDNL 5K9JL 3HC3L 5T1DL 3VFGH 3VFOA 4HUVA 3U6RB 3GI8L 4L3EA 2YOCA 3MRGA 5LG1A 4IM8A 1BFVL 1NCWH 3RNKB 4V2CB 5H2BA 1OB1A 5JOPD 2DQJL 1G6RB 2H32A 3TV3H 3C08L 4Y1AA 2EO9A 2G60H 2EYTB 3RL1B 2XN9E 1WAAE 2HJKB 3EJZC 3FO2A 3EBAA 5F8QC 3MOBL 4QYOA 4ZPVA 2VLLB 1LGVA 1AFVH 4CVXA 1CE6B 4KJQD 1EV2E 2DI9A 4KK8C 3W2DH 5EU6E 1BVKA 1JGVH 4NNYB 5T3XD 4QRPB 5DLML 4DWHA 2NR6C 4HKJA 1JNJA 1N64H 5IT2H 1TXKA 4UUJB 4HJ0D 2WBJD 1JPSH 5F72S 1IAIL 1YPZF 3MRDB 3R06B 5DXWA 4YBLB 4PJEF 5EORL 4N0UE 5KAQG 5F88A 1ZHLB 5CJ8A 3T3MF 3FMGH 3QA3A 3I6KA 1CFSA 4ODWA 4JFQB 1BLNA 2QADB 4NOBA 4G6KL 2BC4A 2HTLC 5F89A 3T0EA 5DI8A 1L6ZA 1DN0B 4I3SL 4I4WB 1DVFD 1DQJB 4AEIL 1A1MB 1CGXA 1IM3B 2BOCB 3JV5A 3HZKB 4F7CA 5BXFB 4Y5XC 2APBA 3N06B 3ZE1E 2DTML 4BFBD 4MXQD 1KENL 4RBPH 4HEME 4G42B 1Y6KR 2GJZA 5SX4H 4I18A 5J1TC 3GM0A 3MFFB 2VYRE 3TNMB 2YMXL 5DJAA 1G7LA 4L3ED 1W72L 3MLZL 4X6BA 2EH7L 3L5XL 4UILH 1MCNA 5GZOD 2VZ3A 5BRZB 1JZ5A 3SKMA 4TUKL 4WHTA 4QTHA 3VDBA 3H9SD 3MRCA 2JCCE 2EDTA 4S1SL 5F88B 5CWSA 1YYMH 2VDRH 4FHBD 2GSIB 3IU3A 2NY0C 1SEQL 3NAAH 4RA0C 5FOJA 2R1WB 3CFCH 5FHBL 2VXQH 4P46A 1HILB 4LLYA 3WV0A 4HGKC 2Z8VC 3EJYD 3KNBA 5C3LD 3QXWA 4HUNB 1A7RL 2FHBA 3UPCA 5HI4C 4ZUTA 1EERB 1U3HC 4JKPL 4P9MH 5FDWB 5AYUL 3BKYH 4XPTL 1I7ZA 2X4PA 3H3PH 5B3JF 4XMKL 2JELL 2LABA 3MQIA 3UJTH 4Y4KD 4P23D 2CLZA 4WY7L 3NZ8B 4Y16B 3SE8H 2UWEB 4LL9A 4HS6B 4HUMB 5T1LB 4LSPL 2GSIA 4P57A 1X5JA 1L9NA 2DBJA 4GXVH 2WBWB 4OF5A 1V3KA 3GSNH 3EOBA 3BO8A 4OCWH 3JTTA 1WFUA 1GRWA 4NNPL 2OZ4L 4GG6E 4XX1E 2X89A 3I3EA 5F9WC 1AJ7H 2DQCH 2ED7A 4G6MH 4OAWB 5IB4B 3B5TA 2NY1D 5CEZD 3AU1A 3RAJH 4HWBA 4KRMB 1D6EB 2F19L 1BQHG 5C1MB 2IAMD 5D1ZA 5E94B 4FABH 5DK3A 5DQDL 1YEJL 1WC7A 1ACYL 3O6MH 3HFML 4XP9L 1JYVA 2NY3C 4PJ7F 4NKIH 2W0PA 2AJVL 3B6SA 1A7BA 4NHCH 4M7LH 5C0BD 3H9HB 3TV3L 4PJCB 5MI0B 3QO0B 3QXTA 1TTFA 3RY5A 2ZUWA 5TQ2H 3VRIB 4YDLB 4XBGB 5FK9A 5GGVH 4Z77A 3G6JE 3C60C 3GKWH 5I6XB 4M1CD 1P6AB 3SCMA 3UC0L 3O6LL 3H42H 2NY5H 2W07A 3RL1A 1F58L 2I24N 2G5BA 1YNLH 1R3KA 5I9QC 5IT2L 1NGWA 1MAML 1KXTB 4P2OD 3Q0HA 3SDCB 4XP5H 4EI5A 4D9RE 3CFDA 3TZVC 1HEZB 1KT2B 4NKQB 2CJUH 5I75B 2EYSA 3WFBH 1J7VR 1AIFA 5I16A 4FRWA 1A7NH 2AEQH 1U8HB 1S7WB 1S3KH 2NXYD 3VXRD 1RZ7H 4GKNA 3LKRA 5DMKB 2A83B 1CFBA 2X40A 3JV4B 4QHNB 1DE4A 2FJGB 4HUXA 1FE8H 1JTTA 2Z4QA 3FFDA 4P4KB 1P7QA 3DV6A 4KTDH 1CDGA 4OM0L 3SE3C 3Q6GL 1U0QA 5EBLB 3R4DA 1HWGB 4PR5B 1MREH 3HKFA 4LCWA 4MNHB 4P57B 4FQCH 2Z35A 3T0VA 3GJFK 4TNWK 4UDUB 1RIHL 4U1NA 1EXUB 1CG9B 5D93C 2IFFL 2J8UB 2QJDA 3L1OL 3ZE2F 1IKFL 3G08B 12E8H 4JPWL 1WISA 5GQBA 2C1OA 3V4VH 1NCCH 5IHUH 1QFOA 4XNYL 3QDGB 5I1EL 1PSKL 3EO0A 4PRID 1OSPH