1T03H

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
225
structure length
225
Chain Sequence
QITLKESGPGIVQPSQPFRLTCTFSGFSLSTSGIGVTWIRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNNQAFLNMMTVETADTAIYYCAQSAITSVTDSAMDHWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPADC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibody/dna
molecule keywords Synthetic oligonucleotide template
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 40
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t03H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t03H01
4YFEA 5DA4A 3UJIL 1MCPL 3WXVL 2X4TB 3I9GH 1WCQA 4XRCB 1BIIA 3OB8A 2YPVL 3T09A 4PLKD 4S1RH 4TYUA 3VXME 3MUY1 1DSFL 2BNRA 1UC6A 2BNQD 2X2YA 4CGTA 3NCFB 3RNKB 3V0WL 4PJBB 2KDGA 1A3LL 5EZLA 4WUKH 3KAAA 4N0UE 3CVHA 4GG6A 4JKKA 1J87A 1LO5B 2HT2C 4PB9H 5JNYA 1IFHL 2OQJA 4PLJC 5CP7A 2Z35A 4IEFB 4KKAC 1MIML 3QXUA 3HG1B 5IF0B 5BOZG 3MCLL 4LPYA 5L7XH 5EU7E 5FUOL 4WO4D 5T1KB 3HE6A 3WFBL 2C3XA 3AS2A 2DQUH 4Z7OE 4N8VB 5K33A 5SX4I 3ARFD 3ZTJH 5I30L 1KJVB 2YEZB 4ZUVB 1LHZA 4Z7WB 4I4WB 1DQJA 1P7QD 4MAUL 2OI9C 4G6FD 4J3WA 3O81A 2A6DA 4IRSB 4DK6A 1S3KL 5F9JB 1IGCH 1U93B 4L9LB 4DW2H 3TN0C 2HYMA 2VIRB 4W6YB 2R2HB 1A14H 1QA9B 4G6JL 3BPCA 4Z8FL 4HKZB 5CIPB 4E0RA 2EE3A 4JO1L 4JGMA 3ARDD 5HYSA 1AI1H 4HC1L 1AY1H 2P48B 1QSFA 1NMBL 3LEXA 4HXBH 4LEXH 3BDYH 3QUYB 1F90L 5GGRB 2K7PA 4P4KC 4Q2ZA 1JHKH 3SHSA 1CFBA 3SJVB 3FT3B 5EU4A 1ZLUK 4X6DF 3CH1A 2PW2A 4PG9B 3FT2B 1G6RA 3RWEA 1UCBH 5IBUG 3MGOB 1M71B 4NNYA 3P30L 1QLFA 4LCIH 5T1DL 2NCMA 1UM6L 4K3JH 3GMOA 5F1NB 5ADPL 2XN9B 7FABL 4G6MH 5EZOH 1S7RA 1XGPA 1HXMA 1MREH 3BISA 3UZVB 5CJQH 1FNAA 4KQ3H 4G43A 2NY5C 1O5DT 4JY4A 1GVIA 3GSNA 3MUZ1 3KWWB 4KGLA 1JNNH 4XI5D 4LIQL 5M7QA 5A2LH 2DWEA 2HLFC 4OD2B 1I1AA 1ZA6B 1INEL 4PJHE 1BVKB 1ZLVK 3GRWA 2HA1A 3O6FC 2FHBA 1YC8A 3R1GH 5DD1H 1W8OA 5IOPB 5C0CE 4ODTL 4ISVA 5F3BA 2APVA 5HHXL 3TFKC 1H8OA 4WFED 4YO0A 5EU5B 1I7RB 4J6RL 2XTJD 5FV1L 3ILQC 2VO5A 1LNUB 4YXLH 5CIPH 3VFPB 43C9B 4ZOBA 1Y18B 4A6YB 2VXTL 2G9HB 1KCVH 2HRPH 3VXUE 5DRXB 3FOMB 5GHWH 4NQEA 1CLYH 4UT7H 5I1JH 1AGFA 2ZUQB 5FYLH 3HMWL 4RWHA 4MQ7A 5HI5C 4X99A 3LRSB 1Z5LB 5IFAL 4E41D 4Z9KB 5IW6B 4OF6A 3WO4C 4F7TA 4X5XA 2W0KA 4W4NA 2C4FU 4X6DB 5D1QA 5IHUH 2HTLC 2CXKA 4CDHA 3VJ6A 5DQDL 3RHWF 1QFUL 3O2WH 3ULUE 1RI8A 2NXYD 2I9LB 2OR9L 3DPBA 2QADD 1JF6A 5LVEA 2BDNL 5DVOA 5SWSB 2BVQA 2NY0C 3DWTA 3KG5A 4Q97A 4Z7QE 1Q94B 3QUXD 4NQDB 5T3ZH 4FMKA 1QSZA 2CSPA 2EIZB 1L6ZA 4H25B 3BD4A 4LLDB 1C12A 3TGXA 2GI7A 1P4LB 2XY1A 2A0LC 4P57B 3FO2B 5I8OH 1DJSA 2H9GB 2BC4B 3MACH 4A6YH 4HKJA 1WZ1H 4RAUB 5KVGH 4A2LA 2FZ3A 1QACA 1TJGL 4P2OC 2VABA 2EXWD 3H7BA 1KELH 4XH2B 1IGIH 4L1HA 3L1OL 4F3FB 5MP6L 4HG4J 1A3RL 1AGEA 1U8LA 2UWEF 3UJTL 3UAJC 1A0QL 4YDVA 5FM4A 3DIFA 1O7VA 4JO3L 3DX8B 5BRZB 2COQA 2APTA 3BIKA 3QUZD 4FXKA 3TT1H 4BK4A 3BEWB 3KPQB 5KSVA 1H3VA 3FFCE 3GB7B 3IKCA 1KJ3H 4LPXA 1FC2D 5KN5B 1JI1A 4K7PX 5J13B 3MGAA 1JZ7A 4LKCB 3IDJB 1EZVX 1ED3B 4L4VB 4U1JA 5J3HD 3KPRA 3GSVB 1JWMA 4Y16A 4F58L 1AXSA 1TLKA 1HHJA 5K9JL 4HS6A 4UDUB 4YDKH 2EE6A 3LN4A 3MRCA 4WW1A 5EO1B 3B9KC 1AR1D 5DO2C 5FYKD 1R3HB 2FDBP 3FN3A 1S5HA 4PR5A 5E1AA 3T65A 3LDBC 4V1DE 5B4MD 1S7WB 4NPYB 1MCKA 5CP3A 2FR4A 1J1XL 3SDAA 5SX5K 3NPZB 1Z9OA 1JPTH 4OLXH 4HIHB 1XGTA 1RMFL 2BVYA 1A22B 4H8WH 1K5NA 3CAFA 2OZ4H 3Q1SH 4K7PY 4ZXBD 1XT5A 1EZVY 5ERWA 2K9UA 4M7KH 5T1LA 3TH2T 5MEPA 4MVBD 5K9OA 4EKXA 5C08E 5E1HB 1F4XL 3MRFB 1KN2H 5HHNB 5D7SL 1OD7A 1JGEB 4XWGL 3IFOA 4M61B 4FQXA 5BMFH 5E6ZA 1KXQE 2IPUK 3HZMB 4MA7L 4DUVA 4GMSL 2KBGA 4MMZC 1NJ9B 3SCMB 1G9MH 3HNVH 3TBWA 2V9RA 5JLZB 4YHZL 4N0UA 1UB6B 2UWEB 4MCYA 4MJ6A 1CDHA 5EO0B 3D9AL 1HHHB 2VDKL 2Z0BA 4KXZH 3FQNA 5FYJU 3LAFA 5HY9A 4OCXL 1J1OH 1U8JB 1XH3B 3FB6A 4U2YA 3HRPA 3P4NA 4RMTA 4HPYL 4OCMC 1NAMA 3QDME 1JBJA 3WUZA 4X6BB 1N59A 2MMXA 5C0RL 3VRLF 2R9HC 4OZ4B 5C07E 5ITFA 3P11H 2GUOB 3DVNB 1QG3A 1A5FH 2A6KB 2P43B 2YKLL 4C56A 1YQVH 4GKOA 4LARH 6CGTA 2ZUSA 2PO6C 4F7CA 4XMLL 1P1ZB 4GKSA 5HYJE 1I8MA 5JXED 2OJZL 4S2SB 4LSPH 4PGDA 1LE9B 2UV3A 4LASH 3VRJB 4LLQB 3T77A 3R8BB 2CR3A 2CDEA 2D31B 4IOSD 5ALCL 4ODXA 4NYLB 2VN7A 5HYEA 1ACYL 4U3CA 5C70A 1JMZA 3Q6GH 2K1MA 2Y9RT 3O2VH 1MI5B 3ARGC 2Z92A 4NT6B 1BZ7A 5LQBH 2JJTC 4LHUA 4NHUB 4PJIF 1FL3A 2HRLA 5SV4A 2X70A 1CGSL 4PJ5E 1V05A 2VH5H 1IJ9A 4MGXA 2AJZA 5SWQB 2R4SL 1BD2B 2R4RH 3NIGF 2AS5M 2ILLA 3TNMA 4WFFD 2BERA 3W9DB 1OGAD 1F3RB 3GMLA 5DLML 2YD8A 1XGYH 4MWFB 4D9RE 1OSZA 2PYEA 4JDZA 1KLUA 2HVKB 2GKIA 1I1FB 4MMXC 3GM8A 3V5KB 5D72H 2HKFH 1PEWA 1CD1B 4KGJA 4G8EB 5FO9A 5KTEH 4C83A 4OGAC 1SJHB 1IC1A 4LPCA 3VW3L 2QEJA 2F15A 4LCWD 1CE1H 4XNZB 3QBTB 4LSTH 2VL5A 3QXAB 2EDFA 5T3XL 2DM3A 4LF3A 4U1IB 3OKEA 4KDWA 1NC2B 3WUWG 2LAAA 2MKWA 5FECA 1G7MB 5BZDB 4Y4FC 4WI5A 3RWGB 3O4LE 2VLKD 2FH6A 3TBVA 1S78D 3L5XH 2IQAB 5CHNA 5IB1A 4AENB 3UDWA 4JPWH 1WWAX 2VDQL 2Z8VC 3DRTA 2GJJA 5HHVL 1CLCA 2W91A 3WS3A 2MOVA 3TPUB 1A6TA 3AROA 3GI8H 3U1SH 3ULVL 5L9DL 4K23H 4NO5A 2YRPA 4GO6B 1ZS8A 3ISWA 1K4CB 3S37H 2MNUA 3UXFA 5BZWB 2LU3A 3KYOB 4G9FB 1KCUL 3VFVA 1WJ3A 3H9HB 1J5OL 4E5XB 5JPMA 3GBMH 1RIVL 4WU5A 2FLBT 4QLRA 2VAJA 4G8GB 4PJIB 1TPXB 2AKRB 2J1KA 1MIEH 5DJZA 1V7NL 1X4YA 4MS8C 5IMKA 4KUCD 1IILE 5TH2B 3KPNA 3GM0A 4OIBA 4FQQA 1EIBA 4EUPA 5B38G 1RULL 5JQHC 1H9VA 2OI9B 5D6DC 1YPZA 2E5EA 5IBTH 5E8EB 3BUYB 2X4UB 4M7LL 2DQTL 4YHLL 1AQKH 4N5UA 3TN0B 5ISZE 3WFCH 1AE6L 3IJHB 2AXGA 3F62A 5E99H 4HWEH 2YPLE 4F9LA 1A6UL 2DBJA 4U7SA 4JRYD 3CFJA 3HMXH 2WANA 3BXNB 4X9IA 1D3CA 3WHXA 1HH6B 2H41A 4HKXA 1A47A 3MA7A 5DMKB 2NYYC 3FO1A 2R29L 2N1KA 4P4KB 2Z8SA 4M8VA 1KTKE 3VRIA 1H3PH 4OCSH 3WNLA 4HFUL 2OCFD 4KU1A 1FH5H 5EZIH 3ARBA 3VXRA 5I75C 3QFDA 3TEUA 5M94B 2BX5A 3BMWA 5IGXH 4U1KB 3GSUA 4MQXC 5IB3A 3CPLB 5GGSY 1F4AA 3SJVD 1I7ZA 5E5MA 3FFCA 2EH8H 2HFEB 3MJ7B 3AY4C 1U6AL 2VDNH 5IW3A 3HR5B 1NGPL 2YXFA 2A6IB 4LLWA 3LKOA 3OKNA 3PGDA 1QPPA 2ZG3A 4BZ2H 5MHSE 4K7PL 3BGAA 1BQLH 3GKWL 5L88H 3AMKA 3D5OF 4ODUA 5JIIA 3PGCA 4OM1L 4NO0A 2RIKA 3C8KB 4HEPG 4OUUA 5ICYB 4KUZL 4L4JA 1CDJA 4NO2A 1M7DB 4J3TA 4O2EB 3O6FB 4G42A 4RCAA 5HGHA 3SDDC 2DLHA 1DN0A 5FAAA 1XF2A 4TVPE 5HHOD 3ELAT 5J06A 3HLAB 1JGVL 4YEEA 1ZGLM 5T3ZD 2QQKH 3HFML 5I18L 4H88L 4PYHA 2P44B 3LKSA 2V2XA 15C8H 4LDEB 3M45A 4XPTL 2R2EA 4APQD 3KLHC 4XZUA 3D2UA 4M1DL 4G6KH 3QEUB 4DEPC 2Z93B 3SKUD 2DIBA 3F12A 1LO3H 4Z6AT 1T2QH 5B8CA 4EN3D 1HIMH 3NZ8A 1YECH 4J12A 1TETH 4MA3B 1KB9K 4MDIA 5DMIL 3VFMA 1T7WA 1BWMA 3F6LA 1OL0A 5IROC 3A6CL 2M2DA 3U7YL 4FOMA 5BQ7B 1G84A 4HBCL 4IHOB 5HVFB 4H5SA 1AKJB 5I2IA 4JVUA 5I71C 5MEND 3D48R 3WO4B 4RZCB 1G7IB 5AYQA 4JDTL 4Q58C 3C5SB 3WHE1 3V6OC 2NY5H 2GCYA 5EUOF 3WNNA 1HXYA 4AT6B 3TBSA 5EBWA 2RBLA 2NY0B 4AYFA 3NVQA 4FABH 3LS4H 4S0SD 1AR2A 4NQXB 2HH0H 2LVCA 1YNKH 2AV1B 5D70H 3TIDA 2BHUA 2IPKB 4GW5B 3O41A 4KJPD 2VWEE 3CMGA 3ALPA 1JWUA 3ESVF 4HV8B 4OGZA 1J8HA 1WCBB 1JP5A 3EYSL 4RX4D 3CX5K 4M62L 5FF6A 1QO3A 5DUML 1TJIH 3Q3GB 1D5XB 2ARWA 3RNQA 4PJ8A 3KPMA 1WAAF 5IEKB 2EDLA 4U6YA 1T1ZA 1EJ6A 2CH8A 5JIKA 2ICWJ 1BM3H 3HB3C 3MRKA 2Y7QA 2CKBL 3MLXH 1TIUA 5E56A 1OW0C 2W60A 1ZEAH 4D0DB 4U1LB 5I1LA 3MRLA 5KSAA 2WBJA 3VWKC 4P49A 4AEEA 1E4KA 3QNZB 4I0PA 4XPGL 3DLQR 4JFEB 4NBYB 1RFDL 3BDXA 3BT2L 1QZ1A 4XNXL 1CU4H 1S9YA 2J12B 3IF1B 3TM6A 5AD0A 3SQOH 2F54E 4F9PC 4TUJA 1KV3A 5IQ7L 1BOGB 2B2XH 1DUYA 5AZ2L 5I1CL 5DWUH 4RGNE 4KY1L 2C1PA 5EOQL 2OK0L 2DTML 1SVCP 3RIFF 2HG5B 3L5WA 3OTTA 3QIUD 1A1OB 4X6CE 5IIEA 1I8KB 4Y89A 4DAGH 4GMTH 4HWZB 1MWAA 4WCYH 3GO1H 1ZK9A 5HYQB 5D7LE 5I8CB 5DRZA 4U7KA 1M4KA 3BIBX 5IT2H 3CFBB 4KZDH 3B9KB 2JTDA 1DANU 1BJ8A 3LDBB 3NIDF 5TF1L 4NBZB 3S4SG 3OWEA 4C59B 1T1WA 3WXVH 4X4YB 1U36A 5DT1L 3V0VA 4M43H 5F6HI 2ITDB 1CTOA 1A7PH 4TSBH 1UEMA 3QISA 3GJEB 3MXWL 4ELKA 2WNGA 1XIWA 4HGWB 4X0KA 1NEUA 4PYGA 2CMRH 5DC9B 4QXUH 2CGRH 1IKNA 2EKSA 5E9DB 4JFXA 3HAEB 1IFHH 3TV3H 3NACH 4XPBL 1KIQB 5JR1L 3MX0A 3QEQD 2BOBA 3QI9C 4JHWH 3QUMA 1T20B 3V4UL 1FN4B 2GTWA 3EYVB 4R8WL 3VXPB 4H1LA 3UTQA 5BO1L 1CQYA 3MCLH 4PGBB 5JOFA 1NGZB 1ADQL 1U8IB 4P2RE 1QKZL 4XXDA 2ORBL 1CBVH 4WWID 2ED9A 4R0LC 4ONGH 1INDL 1KB5B 4MAUH 3V8OA 1PAMA 4YLQT 2X40A 4M7LT 4PJGF 4XPFL 4JM2A 4OQTA 5FM8A 2LU7A 5L2KB 4WEMB 2CRYA 3DURA 1L7IL 5CINL 3BH8B 5CCKL 2H32A 5ESVA 4R4FH 1GZPA 3U36A 4P3DA 5ISZA 2ZOLA 4OV5A 3GHBL 4FQIL 4POZC 1FCGA 5IMLB 5KVEH 2YPLA 2ZKHL 1AO7B 3RPIA 3GMRA 3GNMH 1WTLA 3QNXA 3ZKND 4RAHA 3V6FB 2YK1L 5D6CB 1QBML 4QRTA 3MV8A 4XBGA 2IAMB 3IFNL 4TULL 2R0KH 2W07A 5IUSA 2C3HA 1OHQA 2BNQA 3PQYB 4JFFE 2Q6WB 3ARGB 4LVNB 1QTYT 4HFWA 4PGEA 1NLBL 3HC4L 1JJUA 4GRWE 4OCWL 1G0DA 3DUUB 2EYTA 3E6HB 3V52L 4PRBB 5GSVA 3M1BA 1MI5D 3O8XC 4M3JA 3KYNB 2ZUVA 3FJTA 4FQ2L 1KB5H 4WO4A 5JUEH 4JAMA 4CVZB 1RIUH 1DVFD 2E7MA 1INEH 1HI6B 1LP9B 1WUNT 4FMFA 4KI5E 3LKNA 4YUEL 1BD2D 4IIQC 1P7QA 2XZCL 2P7TB 1R24A 4XC3L 3QB7C 1X5HA 2VLJE 4FP8L 4IMKA 4O02L 1H0DB 5D5ME 4M1CD 2W9EH 4KPHL 3CVHL 1DDHB 2JLLA 4ETQB 5HPMA 5CZVL 3TA3C 3DXAB 2HLAA 3CMOH 3LN5B 3ZHLA 5C8JB 5CEYA 1MRDL 3TCLA 3VFGH 1XGRA 1VFOA 1ZXQA 4ZAKA 3MCG1 4P3CH 3TC9A 3ARDA 1EHLL 1F13A 2A6JA 4HK3J 3LOWA 2V5YA 2H8PB 1QRND 1NC2D 2VRAA 3B8YA 3DBXA 4Z78B 2CIIA 3AREC 3BKMH 2UUDH 4GSDH 4P5TB 3CIQA 3QWRD 3P73A 1KF9B 2R56L 3SE8L 3V95A 5IESH 4OZFH 1JK8A 4QY8B 2P5WE 1E27A 5E94B 4L3AA 1NKOA 2HJFA 2VAAB 1BLNB 4QWWD 3VXSE 1C5BL 4Q0XH 5IMMA 1UWEL 5I17B 1OPGH 3MODH 4YR6A 4X6FB 1I7UA 2YPKA 3Q5TA 4CVUA 4JN2B 4G9FD 5DJ8A 5EOCH 2EYSB 5HHPA 4L4TD 2LVEA 2ERJC 3I6GB 1RUMH 4M02A 4JZNA 1FE8L 4TSAH 3QG7H 5FHAH 1YJDL 4G6AC 3U2SB 4D8PA 4GAYB 5DF0A 4UTBH 3BP7A 3FQRB 2EDBA 4P23C 4QXGL 1G6RL 1ROWA 2ADGA 4QNPE 5FYJD 5A16B 1S7VA 5LAXB 4GFTB 3JV0A 1RJLB 5DJAA 2NY2D 4KHXL 4XMPL 5BCAA 3CC5B 1JYVA 2XQBL 2RQ8A 1N7MH 4DK3A 3U0PA 1DBBL 3GSNL 4CVXA 1IAII 2JB5H 4X7TB 1XR8A 3UROR 5IG7B 4WI9A 1CXEA 4QGTA 1SM3L 5DD3H 3RWCB 3MGTB 1VGKA 3CSYA 1G7QA 1Q0XL 1ZT4B 3T1FB 1UZ6E 4J3XA 3W11C 3GRWL 5I75B 3CVIH 2CRMA 3LV3B 4Z5RB 4WJ5B 1EERB 2KPNA 2QQLH 4EBQL 1FHGA 4ALAL 5C92A 3TESA 2MPAL 3CFEA 4GUPB 4NUGL 3PWNA 5INCB 4M6MH 3LD8C 5TE4L 2D0GA 1R5VA 4N1EA 1IQWH 5KVFH 4OZHB 4OFYD 3VXTA 1ORQB 2ED7A 2JELL 3G08B 3HE7C 3HG1E 4RISL 4Y5VC 4LSSL 3BPNC 4Q74A 3B5HA 1SJVA 1HQ4B 1CGVA 4NUJA 5A3ID 1U8QA 4HF5L 1UQSB 3JV6A 3P2TA 3TF7C 5C86A 4UT6H 1UJ3C 3UO1H 1T5XB 3SE9L 4EIZC 3SDDB 3WV0A 3VI3E 2W0FA 2HLFD 4O4YL 4Z7VE 1IGYB 1HHIA 3P77A 3EO1A 1E6OH 4AIZB 1XGQA 3DRQB 3HC3H 3HZVA 1JPFA 1VKXB 4YQXH 2F5AL 2D7TH 1F11B 3TFKD 3T8XA 4DEPB 4R2GC 4KJWD 3L5HA 3OQ3B 4WEBH 4NKIL 2VLME 2FJGA 4D3CH 3U46B 3UTZB 3HA0A 3QT2A 2VXQL 3X12B 1RJCA 3HI5H 4JFPA 1TTGA 5E2VL 4NQCB 1AD9B 3DYMA 1SQ2N 5I71B 4Q7DA 3HPJB 3QUZA 4P9ML 5CUSL 2NY6D 4QOKB 3O6LH 4YHOL 4JG0H 1WZKA 3GSXA 1TZIB 1HKLL 4P2RA 1IM3A 1GSMA 4LAJH 4U1GC 5F21B 1BX2A 4QO1A 1M6OA 2M1KA 5AWNL 3PIQB 2IFFH 1WC7B 4O51B 1KG0B 4H0IA 1LEIA 4P2YA 4KKCC 2XN9E 1IBGL 5D7JC 3N9GH 1UXWA 4PIRF 1N2RA 2NY4D 5F7NC 4L3CA 3U4BL 4HBQA 1BHGA 1AFVL 1P9MA 3RVWD 1GHFH 2OJZH 5F88B 2H26B 5AG9A 3HNSL 2DI7A 1ITCA 4K3HA 3E2HC 3IDUA 3FMGL 4DN4H 5I1AB 3O3AA 5F1IB 2DDQL 3LVEA 4PBVC 1N0XH 1U95A 5ESQA 4WHYH 1NC4D 1ACYH 4XTRD 3INUH 4LRNL 2QJDA 2R0WH 4PRNA 1S8DB 5ADOL 3H9SB 4LNRB 3SO3C 3JV5A 1UVQB 4P5MB 2HP4A 5CLWA 1MFAL 3LQZA 3VWKB 4R7NA 1ZHLB 1XGUB 1BAFL 4P2OD 2NY3C 5ACLA 5EU6B 5D1ZC 2ADJB 1B0RB 2R4SH 4Z18A 3KNBA 4PB0H 5C0IB 1I1YB 4MDJB 2JK5B 3X14B 3OAUH 5FKPB 3B9DA 4WI8A 3MRHA 4FNLH 1HK6A 1FJ1A 2GITA 3MTRA 5GISL 4X6DE 4F57L 5CAYB 1KN4H 1IE5A 5EA0L 1WVZA 1C5CL 3GI9H 4XWOD 1MCCA 4H26A 2ZUUA 5T5NG 5SWSE 1OTSC 4OCNC 3VFOB 1JTTA 3I3DA 3HS0A 4NQDE 2QHRL 4W68A 2ZJSL 1MVFA 4QYOB 4ZS7L 4R90L 3IU3B 3Q48A 4NDMB 5JXEA 3BH9B 1IEBA 1T7XA 2DTSA 4NRXA 4W4OA 1JYNA 1BVLB 4QT5A 3SDXE 1PLGL 3CLEL 1KT2A 2CIKB 3C09C 4DZ8B 3QDGD 5HHVH 5BJTA 3TJHD 2YBRB 4YFLI 1FZKB 1HH9B 4GAJH 1I1AC 2CXGA 5GGVH 3ZTNL 1NAML 4ZFOA 3ET9F 4XHJC 1FG2A 2MSPA 3UPRA 4WV1A 4QHNA 2EDYA 1YZZA 4W6XB 4ZUSB 1Z0NA 3QI9B 1CE6B 3NN8B 4X6EA 3UMTA 3TO2A 1TVHB 4JREB 4K8RD 4HJJH 1EAPB 2P5WA 5KVMC 3VH8G 5BRZE 1MCLA 3A6BH 4R0LB 4FTVB 5INDB 1OGAA 4UDTB 4FQJH 4UBDC 1FFRA 3F7PC 3DX7B 1VHPA 2VQUA 2PW1B 4PBWD 1KIPB 4PJEF 3ROOA 5ITBL 3HZKB 5GS0D 4DVBA 4JHZA 2VITA 1D5MA 3SGEH 1T3FA 3VWJC 3IYLW 5CBEB 4ZYKB 1FLRL 1WSST 4LCWA 1CFQA 4JPKH 1OF2B 3PWLA 5JW5B 3LMJL 5IM7B 4YDJB 5DA0B 3MROA 5ENWA 5L2KD 4I18A 5GS2D 2XRAL 3QO1B 3O4OC 3F7VA 3NA4A 2PO6D 1UZ8B 1UKTA 4NRZB 1Z3GH 3EO0B 4YBHA 3GBNH 1UENA 1H3GA 1WISA 1EO5A 3STLB 1YEGH 4KHTL 3UC0H 4LMQE 5J1TC 4M6OH 1NCTA 2R0ZL 4NSKA 2F9BT 5DJXB 2QL1A 3I2CH 3F58H 3ME0A 1U6AH 1NGPH 5SX4H 1JGDB 4NN6C 2WW8A 5GRXG 3O8XB 3RNKA 3SY0B 3NCEB 2R2CA 2APWA 1SYSB 4PJBA 3ZYJA 1IGML 2XWJB 4LCUB 4NCC1 5I1EL 2XPGB 4XAWL 4YX2H 2UWEE 4NZTH 1ZLVH 3UYPA 3N1FC 4OM1H 5F9DC 1MLCB 2DOCA 1AGCA 3LS5H 5J4MA 3CDYA 4IIQB 2J8OA 5J1AA 1T03L 5T1KA 3OB0H 5F7UA 3ECBB 3WIHH 1BJ1H 3UYOD 1KB9J 3LCYA 3ZDXF 1DUZB 1KFAH 4H88H 4N8VA 2WP3T 5D71L 2AABH 1P2CB 1Y0LB 1WTGT 2VDRH 2FD6L 2YEZA 4Q6IA 1CDIA 4ZUVA 3S36X 3I50L 4I4WA 4Z7WA 3CUPA 4WW2C 3TA3B 2IF7A 3UJJL 1ITBB 3PP3K 4MJ2A 5F9JA 1PSKL 4K07A 1EEZB 4K3GA 1FVDB 1AGBB 1U93A 3BYYA 3MOBL 4L9LA 4LOUC 5BW7C 4PRPD 2VIRA 2I60L 4O58L 5BOPA 1EHXA 4FXGB 1BEYH 3U7YH 1GC1C 4UQ2A 1N5YL 2R2HA 3IS0X 2ESVB 1U8NB 3FB7A 5FUCC 5JORB 4Y4FD 3AREB 2CLZB 5FA4B 3QRGL 5CIPA 3OZ9L 3TH3T 1P4BL 1LD9B 1XF1A 3QXDB 3H3BC 1EXUB 5DD0H 2QSTA 1DFBL 5GGRA 3UTPE 4M6AA 3TIEB 3WIIL 2X1XR 5HI3D 2NX5E 2G5RA 5AAWA 1ZHBA 3CX5J 3SJVA 2AI0H 1UJTA 2V5MA 3VD4A 1E6JH 1N6VA 4PG9A 4CJ0A 2A77L 2J4WH 3FZUC 4GXUN 2R1WB 4OLYL 4BH7A 3ZYOA 4OLWH 5HYIA 1WV7T 3PG2A 2ERJB 4FQXC 5J11C 4JFOA 3HNTL 5F1NA 2XN9A 3UP1A 1CDGA 4PJ7A 4ONFL 2DQJH 4LGRB 4QRRE 4M1GL 2PR4H 1C16B 5HHQB 4D0CA 3I84A 4HQQH 4P23B 5GRWA 1B6DA 4OIIL 3AM8A 4YHKH 2IH3B 4I77H 3AU1B 4JHAH 4OD2A 1ZA6A 3BP6B 1NGWB 1S7XA 3VRLE 1H8NA 4R26H 3BGFC 2JJWA 1QBAA 5IOPA 1RZKC 4APQA 5JMOC 5FOBA 4N1HB 5EU5A 1I7RA 2NR6C 2R2BB 4EN3A 2LQRA 1LNUA 4R4NC 3VFPA 3V8CA 1Y18A 1I3GL 2OSLB 4DGVH 3BD5A 2DQCH 5LWYH 3O0RL 3FOMA 5DRXA 1X5XA 1MEXH 1NUFA 1T5WB 1PZ5B 3BW9B 5MENA 5I1CH 4N0RA 4HH9B 4KY1H 3W9EB 2PCPA 3KPPB 5D2NC 2OK0H 1A21A 2DQGH 1HZHH 2F53D 4RFEB 5MI0C 3LRSA 2AEIT 4EUPG 3LD8B 3Q6FB 3ZSTA 3JZ7A 2VC2L 5IW6A 1FZOA 4QHLB 1F58L 4GG6F 1MY7A 5F1SA 1C1EL 1NCCL 4HKBB 4Y5VB 5DR5L 4X6DA 3BPNB 3BGMA 4G8GE 4PJIE 4LSDA 4I0KA 3PL6D 3K74B 1MJJA 3Q2CA 4I3RH 2W65B 2I9LA 2NXZD 5DHXB 4MA8L 4LAQL 3OGCB 1UJ3B 3EDJA 4Q9CA 3NIGE 4EI5C 1GJIA 3QQ3B 5AEAA 3KJ6L 5CKGA 1CF8L 4JVPA 2BY2A 1YN7A 2IBGA 4LLUB 4NQUA 1Q94A 4NQDA 4RX4A 1DQLH 4WTZA 5GGSB 3BJ91 1Q0YL 1S9XA 4YWGL 4H25A 4LLDA 1U3HD 2XKSA 1EBAA 4XPAL 2SEBA 1LWRA 1P4LA 4F7EB 3AAZB 4LEOA 1J7VR 3D18B 3FO2A 4R2GB 2NNAA 35C8H 1RUKL 2VXVL 1BQHG 5KG9B 2ZZUT 3MV9D 2BC4A 2AVGA 4JQXA 4FQ1H 1CIDA 4LU5H 4U6VL 4RAUA 2F58L 4JZJC 2Q8BH 2OZ4A 4OBSA 2XWTB 1OOAA 4DOHB 1ZLWK 3P3YA 1YEHH 4ZSOB 1ZTXL 3FRPG 3A67L 4BZYA 1INDH 2Z9TA 4F3FA 5BV7C 4QRPE 4AMKH 5I1KL 3JXAA 3I85A 4U1GB 3DX8A 3C60D 3PGFH 4XPFH 2A9NL 4JRXB 1JHLH 5D7JB 1P7KA 3QIUA 1RUQL 5CINH 5KN5A 1GOHA 5CCKH 2OP4L 3RPKA 3PV6B 5DEGB 2JJVA 4GG6B 1F97A 4K9EC 5JNYB 4R4BA 4L4VA 4DKAA 1OAQL 4OLUL 3B6SB 3S6CA 3MRMB 3SBWC 1FAIH 3DI2B 3E2HB 3S96B 4HXAL 4LQ1A 1BQSA 5E2WH 4MAYC 5E5UB 1IC5H 3IFNH 5IJVB 1R3HA 3X3GL 5I1IL 1S7WA 4NPYA 1UFUA 1S5IL 3WHE0 1DQJB 1DBAL 1YUHA 2A6DB 3O3EA 4U2ZA 4QHKJ 3PWJA 3SO3B 3CCHA 1MWAL 2VDPL 2GQHA 2UY7A 1KIRB 1JNHA 2AJSL 3HB3D 4YE4H 1B9ZA 2NY3B 1N8ZA 2X4QA 5D1ZB 2DMKA 3MRFA 2ENYA 2YD3A 4Z0XB 1JGEA 5DJYB 5FHBL 2FECL 3VWKD 3BKYH 4E0RB 3BI9X 4L5FH 5IFJA 2O5XL 5HYSB 1OAZL 3KXFB 3LEXB 1EUTA 3SCMA 4QTHB 2F8XC 3ZZ1A 1YEFL 5JLZA 1X5GA 3KS0J 3NCJL 3JV4B 4PY8I 4XC3H 1UB6A 3LKRA 2I07A 3H6JA 1FNLA 1WIUA 5EO0A 2FHFA 3P0VL 4O02H 5E8NA 1E28B 4JFZL 5EU4B 3UBXB 4KRPC 4KPHH 3ARBC 3CH1B 3NIFF 2J7LA 2PW2B 2V5TA 2VN4A 1U8JA 1G6RB 2RGSA 3VU2A 1CR9H 1U8OB 4MJ4A 3QUML 2EE9A 1GCFA 1CICC 4X6BA 5GRJH 5C0AD 4XXCC 5LXGL 1MF2L 4CDGC 4OZ4A 1XGPB 1HXMB 3NCBB 1FNFA 4R9HA 2GUOA 3DVNA 3D87B 1IAIM 4G43B 3VG0H 4OJFL 4JY4B 2BFVH 3GSNB 4P59H 1AC6A 3C09B 5ANME 3IGAB 2QKIA 1P1ZA 2DWEB 2DJ4A 3KYKH 1I1AB 3K2UL 1LQSR 2XG5A 5DTFA 1I9IH 1W72A 3SE8H 1LE9A 4OQTL 1RK1A 5F3BB 1PGRB 1CFNB 4LLQA 5IP4A 1JRHL 2D31A 3JSSA 1MFDH 2PXYD 2BXZA 2X1OA 1DLHB 4NM4L 4DZBA 1MI5A 5GZNC 4JFEE 4NT6A 1MQKL 4WUUD 4KTDL 3FQTB 4NQEB 5KVDH 2DQEL 5B8CC 5CGTA 3KDMB 3S35X 3CSPA 4MQ7B 4L8BB 1W0VB 1FYTB 1A6ZA 2I27N 5EFIA 1SEBA 2OJEA 2AGJH 4JANB 4GQ9H 5SWQA 4BQ8A 1BD2A 1CLOL 1WBXB 1MJUL 5DSCA 5J89A 3CXDL 4F7TB 1DTUA 1IAOB 2EZ0C 4GBXD 4MWFA 5E6IC 4I2XA 2ZPKL 2HVKA 1DE4A 3DX9B 1I3VA 5EUOE 1UM5H 1I1FA 3VE0B 5DUPH 3V5KA 3WXWL 2XQBH 3RUGA 1CD1A 4JO2H 3O4OB 3CFCL 2EYRA 4RGOH 3WD5H 2BVQB 3MSPA 1DBML 5B3NA 2AXFB 4NC0B 2ATPA 4OF8A 4O5LL 4TSCL 1GAFL 4S1QH 3QXAA 1J0IA 4XHQA 3GJFK 4U1IA 2E6PA 1QRNA 4POZD 1NC2A 4P46C 1G7MA 3MRDB 3WS6A 4HWNA 3HMXA 3RWGA 1WAAE 4TOYH 1VEPA 2VKWA 1QFHA 5LBSH 1KPVA 3QWRA 1WK0A 2IQAA 4AENA 3L3OA 2BZDA 5E9DE 5F7WC 2PETA 3RFZC 4HKJB 2VZUA 4GXVL 3TPUA 4NN6B 4TVPL 4CJ1A 1U9KA 4LCYA 3L95A 3KR3L 4PGCB 4JM4L 5LGHL 2GEEA 3LQAL 4FFWD 1K4CA 2H3NA 4DQOH 4G9FA 3V7AE 1FLTX 1OAXH 1NANI 5KSAC 8CGTA 3H9HA 1FFQA 1E4KC 1U8LB 3QPQD 1VCAA 3QCTH 4YDVB 4LIQE 4PJIA 2AKRA 4OZGB 3EYOB 2WZPD 4ZPVB 3K81A 4U1HB 5IBUB 3BPLC 3T0WA 1QFOA 5TQ0H 1FYHB 1GIGL 3WJLA 5J57B 1N4XH 1MCHA 4Y19B 5JOEA 4U1JB 2X4UA 4HZLB 3KPRB 1JWMB 4Y16B 4YFDB 3SKJL 3IJHA 5HTSA 4PUBL 5C9KA 1YYLL 3NIDE 4KKLD 2IG2H 3MRCB 4WW1B 1AO7E 1NUDA 3HUJE 4GRLC 3BXNA 1S5HB 5E1AB 3T65B 3IDXH 4P9MH 4N1CA 1RURL 2HT3D 3SDAB 5DMKA 3PQYE 2ESVD 4KWUA 1NPUA 5C7XL 3SDYH 1XGTB 1K5NB 1KGCD 1W0YT 1T66D 5J7CC 2QSVA 3OKKB 2V9QA 5ERWB 1IBGH 5T1LB 4LLMA 1IT9H 4ZD3H 1EVUA 2CUIA 5K9OB 2RR3A 5CD5C 3OR6B 5SWZD 5DK0B 8FABA 4UI2A 4OFYA 4M5ZL 1GZQA 1AFVH 2YN3A 3CPLA 3UTOA 4MXWH 4FQXB 1I9JL 4KAQL 2HKHL 4XVJL 2HFEA 3MJ7A 4JY5L 2A6IA 5D1XC 2QQNL 1GGCH 1KCKA 5I16B 3FMGH 4U6HB 4MJ6B 2DDQH 3HHRB 5C6TH 4S1SL 3MCKA 3FQNB 3RVUC 4G6AD 3C8KA 3FB6B 1G9NL 1HEZB 4P4RB 4PJGE 3NFNA 1M7DA 1K3IA 4O2EA 9CGTA 3BGFB 3O6FA 5FKAA 5IV2B 1MFBL 5HI4D 3JBG7 1N59B 3DXAE 3HLAA 4LPVA 3HI6L 4ZUUB 5ITFB 1GC1H 4JM2C 1V3KA 4NHCL 4BUGA 4CU7A 4RWYL 1UM4L 1CD0A 4C56B 1J18A 2APFA 3I75B 4J23A 2BOCB 1NDGA 5I6XC 3Q5YA 1MJ7H 3F6IA 4F7CB 3ZT5A 4EVNA 2Y36L 3D69A 1CYGA 1RJZA 3S88L 1FVCA 3OAYK 3QEUA 1VGEH 2RB8A 4U49A 2AEPH 5CJOL 1VERA 5BVPH 1IVLA 4X7SH 5DRWB 1QSEB 5CEZH 1S7TA 5D2NB 3LEVL 1NEZG 3LIZL 5D7IF 5EC1A 5MI0B 3W11D 5BQ7A 4HIXH 2JCCF 4EDWH 3OKLB 3WNKA 1LEGA 4RZCA 3L3KB 2FX8L 4FFYH 4GAGH 1L0XA 1G7IA 4MD5B 1CXFA 3IAPA 1HE7A 2AJUL 4MB5A 1U8KA 5H35B 4NKDB 2BSRB 3FAXA 1X5KA 4HHAB 3PP4H 3G5XB 5TE6L 5E5RB 4AT6A 3QJFA 4C54A 1FL3B 3HE7D 1OAUL 4EI5B 1WGOA 2R23B 1MFEL 2AJYL 4M48L 5I15H 2B0SL 2R8SL 1KC5H 4TUKH 2AJZB 4JN1L 4P3WA 3GDBA 3MLTA 2IPKA 5D93C 5FGCB 4TNVF 4WO4C 1YPZF 4ODSH 1RZKH 3JTSA 1WCBA 1PFCA 3ARFC 3IB4A 4ELME 3UTTB 1TQCC 3IETB 3GEWB 1I3UA 2FLRT 4LQFL 1MY5A 3Q3GA 1D5XA 1A7RL 4XC1L 3QDJD 1RUPL 1R3IH 5IEKA 1PYWA 3D3VB 4IMKC 4ZO8A 5IVXE 4JZJB 3B5TA 5D2LB 1BQUA 1K6QH 4P2OA 4LF3B 2IH1A 3P4LA 2XG4A 3OKEB 5JHDD 5FECB 3IDGB 4D0DA 4U1LA 1BFOB 4YPGB 3L3HB 3WFDL 3LQAC 5BV7B 3VFRB 3QNZA 2GHWB 1EO8H 5KZCB 2HFFB 3ARDC 3MOQA 2DQDH 5CHNB 5IB1B 5E2UL 3RWHB 3DSFL 1J0KA 3RDTD 4EXKA 4QRRD 1RIHL 2J88H 3IF1A 5D7IB 5C09D 5C2UB 4JVWA 3WDHA 2JCCB 4ERSL 1BOGA 5IFHL 2P8MB 5I1HH 5DZNA 3MLWL 5DDHA 3S35L 3R4DA 3MLYH 1ZS8B 4NWUH 4KKCD 3VFVB 3FAWA 4LVOC 1NAKH 4DVRL 1NGQL 4WU5B 2IMMA 4JZOB 1P5VA 4HWZA 5MERB 4XP4H 2B1AH 5I8CA 3NABL 3CFBA 2DM7A 1MCWM 3FO9A 3GK8L 3B9KA 3HZYB 1ZWIB 3MC0A 2D9CA 3U0WL 4NNPH 2NY7L 4O9HL 3IAQA 3QDGA 4XI5C 1FQ9C 4JJ5A 4KHTH 1KSRA 1JE6A 3RGVC 2WUBL 1RZ7L 4NWTL 1RUAH 1CL7H 4NGHL 1CLZH 3CD4A 3GJEA 1R6VA 4KQ4L 3AXLA 4XMKH 4HGWA 4WTWA 5F7LB 4IBLT 1ND0A 2XTJC 3OL2A 4KMTL 3B2VL 3CFJB 5CSGA 1HQRA 2VZVA 4OFPA 1HDMB 5BV7H 4NQCE 1X5AA 4EOWL 5ACZB 4HIIB 2DQFB 4PRDB 4K3DH 4WFGE 2O5YL 2HT4D 3N50A 1T20A 1QNZH 3GSWA 3FO1B 4QOKE 3VXPA 3VXOA 4PGBA 1AD0B 3P9MB 3VRIB 2KUTA 1U8IA 2ZUWA 4G5ZL 2MQ0A 4OF0A 4KRPB 3ARBB 1IC7L 4K9EH 5FCUL 4AY0A 1KB5A 3I9GL 3UJJH 3GZKA 2YR3A 5L2JB 3S5LA 4DFIA 1CICB 2B4CC 5E5MB 2EICA 4S1RL 5HDBF 1XF3B 3C08H 3EYFA 4LPWA 3BQUC 4U4BA 5DD5H 2I60H 4HS8H 5L2KA 5T3XE 1HN1A 2DYPB 2QADC 2XYCA 3LKOB 3PGDB 4NJAH 5IJKC 1GGBH 3WDJA 2PO6A 4WUKL 3QUXC 4ODUB 4PB9L 3HTLX 3OZ9H 3PGCB 2AEWA 4OUUB 2Y5TB 5GXBB 4Z7UF 2YRLA 2EIEA 4N8CH 2VL4A 5L7XL 1NFDB 4RMUA 2XIDA 3H9SE 4QRPD 1B4JH 5D6CA 4DKDC 2D3VA 2DQUL 4X4XB 3LKSB 2V2XB 3AS1A 4XHJD 5J0BA 5F7YC 3PQYA 5I74C 4CUCA 2Q6WA 5IK3A 5EU6E 5E4EC 3AC0A 3D2UB 4I3GA 1IGCL 5ELIA 1TZGH 3F12B 2I25N 2JJTA 3SPVB 3TCXA 5B8CB 2BCKA 3C87A 1QP1A 3NZ8B 4DW2L 1R3LA 2ZUTA 4OZFA 3DUUA 1G7HA 1KCSL 3VFMB 4CBPA 1PEZA 4HAFA 3KYNA 5IEHB 3IS1X 1A14L 4NFBA 4KROC 3QUZC 2WIMA 3E8UH 1LP9A 4NCC2 1AY1L 1UT9A 4LEXL 5EORH 2HVJA 1A6AA 4HXBL 3BDYL 2WK2A 3QZWG 3ARZA 4JGJA 4KK6D 1JHKL 2ZCKH 1FL6A 1HXYB 2NY1C 3VWJD 1A3QA 1H0DA 5EBWB 2P5ED 2GIYA 4HLZH 2XZZA 5J3HC 1YEJH 3PE9A 2X05A 4ETQA 2PUQT 1I3GH 3UTSE 4N0CC 1UCBL 3RRQA 3S3SA 3TIDB 2YWZA 4LCIL 1LO0H 2PTVA 3WBDA 1J9CT 1E4JA 4K3JL 3ARXA 2J8HA 2R1XA 3O9WD 4Y4FA 1J8HB 4G6ML 5EZOL 3O2DH 4ODWA 1MREL 4IS6A 4RBPK 5T5FL 5CJQL 4KQ3L 3RNQB 5J9PA 4Z7UB 3KPMB 4YEFA 1DN2A 1JNNL 4G7YL 3MFFA 1VSCA 1MHCB 4U6YB 2VC2H 1T1ZB 5A2JH 4X98A 4ZXBC 4HDIB 1C1EH 1NCCH 3MRKB 4PTUB 3SN6N 4MVBC 1YEEH 2DLFH 3OX8B 3R1GL 4HX1B 5DD1L 1OD9A 1OTUD 3DROB 3CH8A 3VFWB 2D7OA 1K8DB 5KSAB 5DFVC 2AEQH 1DEEA 3OJDB 1BLNA 5D4QA 4FTVE 3IDIB 3GKZA 2BJMH 1YNTB 5I17A 1CZ8H 4WDIA 3QQ4A 4X6FA 3BE1L 4URTB 2FO1A 3OKYA 1QHPA 3BPLB 4JN2A 4OD3H 1KCVL 2HRPL 1WT5A 1S9YB 2X4PA 5GHWL 3V2AR 2O5ZH 1MCNA 2EYSA 1CLYL 4UT7L 4TUJB 5I1JL 3I6LD 3T2NH 2MQCA 3IU4H 1QPXA 1IAIH 1DUYB 3AVEA 4DFHA 5D6DA 5FYLL 3VD9A 3LY6A 3S37X 4YIQA 2VR9A 4JM2F 1N26A 3U2SA 3KPLA 2R69H 3FQRA 5IIEB 4U6VH 3C5JB 1U8PA 5DD6A 2FO4A 5DRZB 5EPMA 4QHUB 1I8IB 4Y19D 5IHUL 3RGHA 3FONA 4GRLB 2CDGB 4LOUD 3O2WL 2Q1EA 2MJWA 4V2CB 1XZ0A 3BRGC 5IW1B 1T1WB 1Y6NR 3VI4F 4J4PD 1CVRA 3RWCA 3MGTA 1K4DA 5T3ZL 1IM9D 1D9KD 1Q9LA 2A9NH 1ZT4A 2AK4B 2F53A 4X0KB 3DV4B 3DYOA 3DTXA 4Q6YA 3T2OA 4Z5RA 4JKMA 3C6SB 1UA6H 5ID0B 1RV6X 3SKOB 4PFEA 1HWGB 5GGTH 4JFXB 4WV1C 3T0ED 5I8OL 4HZAA 2BOBB 3AY4A 3QUMB 3MACL 3RX8A 3E0GA 3IRPX 1WZ1L 4YFLF 5D1XB 4H1LB 4OZHA 5KVGL 2DS4A 4L3ED 3RWFB 3DI3B 4WY7H 5JOFB 4Y2OA 1IGJA 3MRIB 5HGBB 4ZQKA 4X7CC 4XXDB 5L6YH 4MHHI 1HQ4A 1KELL 3IAGC 1UQSA 2EC9T 1IGIL 1T89A 4F33B 1WEJH 4OTXH 5KAQG 4PJEE 5CWSA 4XAKE 2ENSA 1UKSA 4BFGA 1T5XA 1U3HA 3RI5K 2VLLB 3IJYA 3SDDA 1Z9SA 3K1DA 1FRGH 3TT1L 3DGCR 4JM2B 3RVVD 3P4MB 1U92B 1KJ3L 3DURB 2E9IA 2HMIC 5I6XB 2NPLX 2R0LH 5ESVB 3MRQB 1F11A 4HG4K 4P3DB 4MNQD 2UY6A 5F97E 2ZOLB 2O5XH 5LG1A 4MX7A 2IADB 2NTSP 4QF1A 1S7QA 3RWIA 3UTZA 3FRUB 4MSWB 1A2YB 2P24A 5FFLA 1OARH 1PD6A 3DETC 3GMRB 3S8WA 4WEUD 5IROA 4YDKL 1S78C 3QNXB 4QRSA 4XBGB 4EDXB 3HPJA 1I9RL 2NLJB 4M9OA 3NA9H 3F8UB 3EOAA 3D39B 4R3SA 3QUMH 3C5ZC 1TZIA 3FN0L 4L1DA 2KZWA 4OLXL 4UZGA 3V6OA 4H8WL 3THMH 4HULB 2OZ4L 3Q1SL 5LXGH 3PIQA 4Y5YC 1KG0A 2XZQH 5GSVB 4YDIH 4M7KL 1I85C 5AZEH 5ICXB 2AQ3A 4JDVB 1KN2L 3S36H 5JMRA 1JPSH 2WBKA 5D93B 4WO4B 4JAMB 3K2UH 3BSZH 4AL8H 3ARFB 4CW1A 1TQCB 3LKNB 1G9ML 3HNVL 3ZDXE 1OP5H 1P7QB 3ULSA 1G7PB 5I1AA 4NFDA 5CS7A 1BBDH 5DYOB 1MVUB 1FNSH 3B3IA 2BY1A 3S4SB 5HPMB 1YDPA 1J1OL 4Q6IC 3W81A 4NM4H 1S8DA 2HJKB 1FZJB 3EFDH 4JKPH 1CGUA 3OBAA 5E2TH 3S34H 1OW0A 1UVQA 5CEYB 3KHQA 1XGRB 3VWKA 3P11L 1ZHLA 4JFDD 5CSBA 1A5FL 1XGUA 3ARDB 1EO7A 2WSKA 4DGYH 3F5WA 1KEMH 1YQVL 4LARL 3VFTB 2ADJA 2AJ3B 1B0RA 4L8SC 3O45A 4HEME 1HYRC 1LDSA 3PUCA 5C0IA 1VDGA 1I1YA 2XKNB 4F9PA 3X14A 1BREA 2O26U 5FKPA 3P73B 1NQBA 5BS0D 1H3WM 2ZPKH 3BX7C 3OAZK 4LSPL 4N90E 1P6AB 5CZXD 4LASL 1E27B 1MCJA 2YMXL 3QWQB 2BK8A 2HJFB 5HPOA 4LVOB 4UAOC 2DL9A 4OBRA 5C0AA 1E4XI 5JOPE 4O5LH 3Q6GL 1WBYA 3O2VL 1B2WH 2YPKB 4KK9D 5DJ8B 4TNWK 5LQBL 5HHPB 5DJ0B 4JZNB 4JPVH 1EFQA 1MUJA 4HMEA 5DHVH 3RGVB 4ZNEE 4UB0H 3G9VA 2VH5L 4MAYD 4PRHB 1VFMA 2Q87A 3BP7B 2CIKA 2R4RL 5CJXA 1CCZA 2ADGB 1EMTH 2GJ6D 1J12A 6FABH 4CL7A 1YMMD 3EW3B 1WITA 4RIRB 1XGYL 2XTJB 4JM4H 5DJAB 2PXYA 2HN7A 3LQAH 2GAZB 1A7QL 3QNYA 1T1XB 1MCRA 5D72L 4APQC 5KTEL 4ZSOE 4CVXB 3NN8A 5A2KH 4HUVB 1P5UA 3QWOA 4EN3C 2WV3A 3K4AA 5C2BH 1CE1L 1IGFH 4NKOB 1EAPA 1G7QB 4LSTL 1GOGA 3PWPD 3R06A 1LK3H 3SGDH 3PP3H 1G9EA 1Q9OA 3MLVH 1Z9MA 4FTVA 4E41B 5DURD 1GIGH 4UDTA 2EDHA 2D7PA 4GBXA 2JIXD 3L5XL 2EDXA 3DX7A 2GJZA 2PW1A 3H42H 2ADFL 3CFEB 4GG6E 3GSQA 2C3WA 3HZKA 5AG8A 1R5VB 1F6FB 2X9XA 1YY9C 1YMHB 2QADB 3GI8L 3U1SL 4RRPA 3WIHA 4K23L 2Q76B 4OCYH 4U1SA 2CPCA 4J3UA 1JZ6A 3OKOA 3QUKA 3QUXB 4NUJB 1U8QB 4LHJB 2CLVA 2XI9A 3S37L 3JV6B 5IM7A 1Z6JT 2X7LA 2EDEA 3C6LC 3RVXD 2DYPD 1OM3H 4F8TA 3QO1A 3AS0A 4KJPC 2DMBA 2A73B 4B7IA 4DWHA 1VACB 2UVFA 4PGZA 5C7XH 1UZ8A 3OMZA 2W0FB 1MIEL 1C7TA 3EO1B 5K9QG 4OB5H 1P7HL 5FGBC 3RWDA 3ALXA 4M6NH 2YZ8A 5I74B 3EDDA 1NLDL 2VZ3A 5E4EB 3T8XB 5IR1A 5IBTL 3NTCH 2CUHA 2FJGB 1AQKL 2P8LA 3IXTA 4B5EA 1JGDA 4UNUA 3WFCL 4YPJA 5F96H 3O8XA 3WLWC 3KXFE 5E99L 4HWEL 1W0WA 5AUMB 1N0LA 2XWJA 4LCUA 4S1SH 1EPFA 3HMXL 4LSUH 5KANI 5DFTA 4Y1AD 3QUZB 2XV6B 1X6LA 2B4CH 3QHFH 3ARVA 3GSXB 3G6DH 3GIVA 4IIQA 2EKJA 2XACC 1BX2B 1M6OB 1FFOA 1H3PL 2IMNA 1UACH 3ECBA 2NY1B 3IDYC 4OCSL 3KPSD 5E6ID 1DUZA 4ZFZB 1FH5L 5EZIL 2CRZA 1FGNH 1UXWB 4XCEA 1BMGA 1N2RB 2BVUA 1RHHB 1RVFH 3TA3A 5IGXL 2VISB 1OQXA 1WFOA 5H37H 3W5MA 1EEZA 2EH8L 4KK5C 2VDNL 3DYPA 3O3AB 5F6IC 3S9DB 4P46D 4BZ2L 2ESVA 1U8NA 4PLOB 5JORA 3QIWC 5L88L 4D94A 2CLZA 5FA4A 3U0TA 4MNGB 4ZXBB 3QXDA 3WNPA 2AXJA 1EXUA 3TYGH 4IJ3C 2EH7H 2AJUH 5SWZA 4AEFA 5JW4R 4XCCH 2XA8H 4I5BA 4NOBA 3TIEA 3MV7D 1MHHA 4NQEE 4R7NB 2QQKL 4UT9H 3T0AA 2ITCA 2AJYH 4X5LA 2YUWA 4KH2A 4O2FA 15C8L 1MQ8A 5IQ9B 3ULUC 4J8RB 2R1WA 4P9HC 1C5DA 3REVB 1ES0A 1FYTE 4G6KL 2V7NB 3TO4D 1WIOA 4MZ2A 4OZIF 3RX7A 1LO3L 1T2QL 3LQMA 1HIML 2WLZA 1FCCA 4KRLB 1YECL 4DTGH 1TETL 1FJ1B 4LQFH 3K8MA 3B8SA 5IB5B 1QYGH 5HHQA 2BRRH 3QFJD 5KW9H 4LSRH 32C2B 2P8PB 3NIFE 1RUPH 3FQUB 2HJLA 3L3GB 3SKMB 2ICWI 1ZLWH 5I73C 3AU1A 3X11A 4IRJD 3ULVD 1NGWA 1JWSA 3RVTC 5FYKH 3QQ9C 1BFVL 1A6VH 3HS0B 3I02B 43CAB 1QFWH 1QQDB 2NY5L 1NMCC 4FZ8H 4FQCH 4Y5XA 2QSCH 2R2BA 4NRXB 3W0WD 4FABL 3LS4L 4QT5B 2HH0L 4D9QD 3VMNA 1KT2B 2EDJA 3S97C 4CU6A 4HK0B 3TJEH 5D70L 1DL7L 4ZFOB 4ERSH 5IFHH 1OP3K 3BVNA 3ORJA 4HH9A 1FG2B 4N0FA 3W9EA 3UPRB 5TDOB 3KPPA 4WV1B 2R39A 1TJIL 4QHNB 4PJCB 3IVKA 5C6PB 4RFEA 1S9VA 5TFSH 4PJBF 5C0ND 3PHQB 5E8OA 1BM3L 3HE7A 4HKBA 1R3JB 4PV9A 2WMPA 4GW4A 3BZ4A 4KUCF 4O9HH 1ZEAL 3MR9B 2E3VA 1QR1A 2OTWB 5D1XD 3AMLA 1DVFC 1UJ3A 2WUBH 1RZ7H 1ZT7A 1S7UA 4OZIB 4LLUA 3P0GB 2LTQC 2ID5A 1MJ8H 3VXQA 1CU4L 2NW2B 5GGSA 2VITB 2H2PC 3KPRE 4F37F 1UCTA 1T3FB 3P40A 4V2BA 1T0PB 2C4FT 2B2XL 4M1CC 3MREA 1X5FA 3LPFA 3LKQA 2RFXA 3ARYA 4LCWB 5DWUL 4F7EA 5E8DH 3AAZA 4NC1C 1CFQB 4BSJA 3FQWA 3D18A 4X5WB 5FUCE 2X9WA 1MAMH 5DVKA 1HCVA 3F7VB 5KSUB 4DAGL 4GMTL 3P4OA 1ZV5A 4JR9H 1CDCA 4PJ9D 4S1DD 4WCYL 3GO1L 2VLKB 3T0VA 5L8KB 5IT2L 4ZODA 4KZDL 1OQOA 1EGJA 3QEGH 5FOJA 2DBLH 4DN3H 5CEZE 5C09A 4G8IB 2VOTA 1X4XA 1FPTH 1A4JA 4WWKC 3H2WA 5E8PB 4AZ8A 4NSKB 4M43L 1A7PL 4TSBL 1D6VH 4Y5YB 4E9LA 3HKFA 4JRXA 1ZKAA 3M8OH 3D39D 5D7JA 3MOAH 2CMRL 4QXUL 3M07A 4QWWC 3V6ZA 1I1RA 2CGRL 3ETBF 3PV6A 3WN5C 3OHXB 5DEGA 4XBEH 3GJFB 2QLVB 1AXIB 4PJ7F 4JY6B 4LBEA 2PYFA 3TV3L 3NACL 3D0LB 3VA2C 1G0YR 4JHWL 3B6SA 1AGCB 3SKNA 3MRMA 3S96A 5J1AB 1GGTA 3GUTB 1U3YA 1BPVA 5DQJB 1CBVL 5IJVA 4RFNC 4LP5A 3R0NA 1JI2A 4ONGL 4Q6IB 2DQIH 3CZFA 1H5BA 3CUPB 3WJLC 4C56E 1WF5A 1CVSC 4JRYB 1TTFA 5EOTB 3DMMD 2NY2C 4PTTB 4XP6H 1KIRA 5CILH 1KEGH 1KCSH 4X8JB 5D1ZA 1BFTA 4UQ2B 1YYMH 4L8SB 3P9WB 3FB7B 5D2NE 3GBLA 4Z0XA 5DJYA 4R4FL 1MPAH 4UILH 2DWDA 1RJYB 5T33H 5KVEL 3KXFA 4JG1H 4QTHA 2G5BB 5DEZA 3K8LA 3GNML 1J0JA 3JV4A 4XP1L 1A6PA 1ZHBB 4UAOB 4XAKD 3VH8B 5CBAB 1E28A 3UBXA 3WCYA 2R0KL 3GJFH 5D7KD 1JPGB 4M4PA 4U1NA 1NBVH 4BH7B 3U30C 4DKEH 4OAWA 1D5IL 1U8OA 1R3KA 2EDQA 1SBSH 4JFOB 5FGCE 2H1PL 2LFGA 4ZOEA 5A3IC 4PJ7B 3EYUH 5T5FH 1MAJA 2PYEE 4D0CB 3UTTE 5FB8A 4G7YH 4D2NA 3IGAA 4C58B 5H94A 1KB5L 3KHOA 5HHOB 5JUEL 3OKDB 4G8FA 3RGVD 2RAMA 1RIUL 3D3VE 1S7XB 4FQLH 4P2QD 2EEAA 4X9FA 4JQVC 3WO3B 4PRHD 4NQSA 3JWOL 4APQB 1CFNA 4PRID 5FOBB 2VDLH 5DJDB 4KJWC 2W9EL 2J3SA 4EN3B 3MYJB 5HDOA 1DLHA 3BE1H 1U8MB 4YK4C 5HXMA 3FHQA 5I0ZA 1J0YA 3CMOL 3FQTA 4M00A 2UZXB 3PNWB 2VLRD 5GS3A 5MENB 5D7IE 3VFGL 3KDMA 4LK4A 1ZLSH 5DK3A 2NY6C 2JCCE 4P3CL 4YDLC 2PCPB 1AC0A 4L8BA 1ZVSB 1W0VA 1FYTA 1N5AA 4P5KA 4JANA 1LEKA 4QRUA 3RA7L 1WBXA 3O6MH 3BKML 1FZOB 4GSDL 5C0BD 3VWJA 1IAOA 2P5EA 1FORH 4PJDF 3ZE1F 3SO5A 1YN6B 3BGMB 2VTFA 3DX9A 2E9JA 3H9ZA 3BMVA 5IESL 3VE0A 2NY4C 3BQUD 3VFUB 1D5ZB 1MJJB 1RZ8A 1NCWH 3A0OA 5C0DB 3RVWC 2AV7B 3ZT6A 4WU7B 3KVQA 4Q0XL 5BVJB 5AAMA 5GGVY 3HAEG 2X89D 1OPGL 1YN7B 3MODL 2AXFA 1YPZE 1DQDH 4G3YH 4KRNA 1T0MA 1IZJA 5EOCL 1S9XB 1RUML 1NANH 3MRDA 2SEBB 4TSAL 4XTRC 3MXVH 3QG7L 2ICES 5FHAL 1OAKH 4LEOB 2BMKB 3V7AG 4I48A 1FBIH 2NNAB 3I6KB 4UTBL 2PNDA 4N90D 4F8QA 2OX5A 1QVOA 4O2CA 4QKXB 2OTUA 4PGCA 3DJ9A 4OQ1A 4AG4H 4DGIH 1IGTB 1JF1A 4QRQB 1QEWA 5FO7A 5I1GH 4ONHA 1N7ML 3VXRE 1QD0A 2JB5L 4YNYB 5K9QI 2X44D 3EO9L 2D0HA 5FM5O 5DD3L 4KROD 4OZGA 3EYOA 1TENA 4ZPVA 3TNNB 3IDYB 4U1HA 4OCRH 1JFQH 3RU8H 1P7KB 3QIUB 4L9DA 2YN5A 4PJHB 3CVIL 4ZS6D 3OJMB 4XWOC 3OAYH 1UXSA 4WI3A 1F4WH 5F7MC 2JF1A 3MO1B 4WW2A 4HUWA 2QQLL 1TNNA 4GT7A 2NY1D 4PJDB 4R4BB 4Y19A 3QCUH 5FDWB 5GJSH 2E7LC 4GS7C 3BAEH 4HZLA 4OSUH 3B9EA 1FFNA 2AERT 4M6ML 5BW7A 1T80A 1IQWL 3K2MC 5KVFL 1NDMB 4TTGA 4N0CD 1KTLA 3WE6A 5F6IB 4D0BA 4MJID 4J4PA 4YXHL 1FNHA 1JZ5A 3QIWB 2YUZA 3RTQC 1I9RH 1IM9A 3TJHC 1PG7X 2YD2A 4BSVB 4IJ3B 1YUHB 4HT1L 4UT6L 2HFGH 1H3XA 3O3EB 3UO1L 2WWKO 1CT8A 3FN0H 3PWJB 2BNRD 5CSZA 3CCHB 3HN3A 2BXYA 1VFBB 3MJ9A 2X6MA 4XCFL 1JNHB 3O3BB 3OKKA 3T0EA 2Q8AL 3QEQB 1E6OL 1N8ZB 5L8LB 1ZT1B 1M05B 2X4QB 4TRPH 1RSFA 3HC3L 3OR6A 3IJSA 5DK0A 3C9NB 4X80H 4YQXL 2D7TL 4L3EA 4K8RC 2W0PA 5DFVD 4JFYA 1NCNA 5IFJB 1RAMA 1NGYB 4WEBL 3JWNC 4D3CL 4N8PA 3U4EB 4G9DA 5I16A 2LE9A 1JYWA 3NCMA 3MLZH 3HI5L 3B5GA 2X1PA 2I07B 3LKRB 4U6HA 4PBXA 1ZAGA 3NFPA 5E8NB 2VWEC 5I73B 4E42B 5GS0C 5HDBE 3O6LL 5I9QC 4JFHD 1HEZA 4P4RA 3RUGF 1BECA 4JG0L 5IV2A 3RX5A 1OY3B 5GS1C 1MCBA 5ALBL 1ZGLP 5K93A 1NMCB 4ZUUA 2IFFL 4NM8H 3EOTH 3JWOC 1IEAB 1J8HE 3N9GL 3I75A 2MKLC 2BOCA 3UYRH 3TP4A 1JGUH 5F9WC 2QKIB 3ZO0A 4Z7UE 1GHFL 1CI5A 1BQHB 1QSFD 5DTFB 1W72B 2KL6A 5B3JF 5DRWA 1QSEA 1RK1B 4HS3B 2YMXH 4YGAB 5D2NA 4DN4L 2YSSA 4NZUH 4DKFH 1V7MH 4L29A 1F3DH 4NZDA 1N0XL 4U05A 3ULUH 4ZPTB 4P9HH 4XNUH 1KPRA 3OKLA 2W0LA 3INUL 1WFNA 4AQOA 4FG6C 4Z77B 2Z91B 1WFTA 3L3KA 3MNZA 1X5LA 2R0WL 3ZKXC 4DZBB 2XT1B 1Q72H 5E6YA 3GIZH 4MD5A 5EBMB 5HHMD 1VENA 5H35A 4PD4K 3TH4T 4CMHC 4NKDA 4PP1D 2BSRA 4HHAA 3G5XA 1RZFL 2FSEA 5JHLH 1DVFB 4EI5A 2R23A 5DEFA 1J0ZA 3VGGA 4YHYC 1A6ZB 2LTQB 3IFLL 5EFIB 1SEBB 2OJEB 1MCDA 3EDFA 4M93C 1EJOH 1F2QA 4PB0L 3UPAA 5DSCB 4X9BA 2YOCA 3OAUL 1NCBL 4U1MA 3FHAA 4I2XB 3ARRA 2YS4A 4FNLL 1DE4B 2J8UA 1PW3A 2HWZH 3UTTA 5DRNA 3IETA 1A7QH 1A6WH 1XR9B 4K3EH 1KN4L 3RUGB 2FCBA 4PREB 4YBQD 3GI9L 3I3BA 1I8LC 2A9ML 2J6EH 3D3VA 2EYRB 1JCKA 2HMID 4JZJA 2N4IA 5IBLD 3UBXI 5D2LA 2ATPB 4JFDA 4KMLB 2FBJL 1T83C 4HIJB 3OXSA 3KLAB 1W72H 2Q20A 3CK0H 3MJ6A 1QRNB 1QHOA 3IDGA 3MV01 3DHMA 1T7VA 1BFOA 3K46A 4YPGA 1PZUB 2AK4E 3L3HA 2X10A 3DETD 3VFRA 1KPVB 2A1WH 2HFFA 4WWKB 5BS0A 3L3OB 1U42A 2ADFH 2Y6SD 3RWHA 5D7IA 5HI3C 2IBZX 3MRPA 4LCYB 3L95B 4GAJL 5GGVL 5IVNA 2JCCA 3C5ZD 4F7MA 2P8MA 2A74A 3WN5B 4OI7A 1BGXH 3SDCC 1PDKA 2H3NB 3KGRA 4OCLC 3EDEA 4L4TB 3SBWA 4JZOA 5MERA 1R0AH 2C1OB 4HJJL 5HYJB 2K3TA 4BFEA 5C6WH 3REWB 1SJXA 4MAYA 3HZYA 1WT5C 2EDKA 1LILA 1ZWIA 3A6BL 4RFNB 3L9RA 5F7DA 3F7RA 3L6FA 2GJ6A 5DUBA 1NLDH 1YMMA 4LRIC 4FQJL 4UV7H 2CK2A 5CZKA 1ZOXA 2IBZY 2D0FA 4B41A 5F44A 2NY2B 3CDGA 1EAJA 2FJFB 3IT8D 5IMOA 1MNUH 4TQEH 1FFPA 5F7FA 4KK8D 4AM0A 4MA1C 1DANT 2XWBB 4GKNB 4Q9BA 1HDMA 3VI4E 2LU4A 4JPKL 5ACZA 4HIIA 3PWPA 5E00B 3MV8E 2DQFA 4PRDA 5KBNC 4PJ5B 5C0EB 4EEEA 1CWVA 3GGWB 3C8DA 2VZ1A 4P99A 2Y72A 2BNQE 4CAGA 2WAHA 7CGTA 1AD0A 4Y4KC 3P9MA 1Z3GL 2JIXA 5LGKA 4F15C 3GBNL 4LLMB 3VDBA 4FRWA 8FABB 2FRGP 1YEGL 2X4RB 3UC0L 3U30B 1GZQB 4M6OL 5L2JA 3IFPA 1CXHA 2IAND 4J3SA 1CICA 2WWMC 4XXCA 1XF3A 3I2CL 3KPTA 3F58L 3PL6C 4I0CC 1DZBA 2NXZC 3UX9B 2DYPA 2IFGA 5FK9B 2RCSL 1DR9A 3JUZA 3MCKB 5EBGA 5FYJH 1ETZB 4YX2L 4NZTL 3G5YB 1T89C 4JHBA 3OF6D 5CJ5A 3NFNB 2Y5TA 3WMSA 3LS5L 1U3HC 5FKAB 4MCZB 1P6FA 1NFDA 3BZFB 3O2DA 3U82B 3WIHL 2ZSVB 1MELA 1KFAL 1T6VN 4X4XA 4WNQB 3WUWA 2AABL 1L9MA 3VXMD 1NDGB 2VDRL 4YK4B 2GSGA 4MD0B 4EVNB 2ZP0T 3D69B 2YUVA 5K9KB 4K94C 1RJZB 1FVCB 5DMGD 3SPVA 2EDRA 2CR6A 2IEPA 1KXTB 4Y1AA 3QHZH 2NY6B 4HK3N 1S7TB 1IC4L 5GIRA 4YDLB 5J6GB 1DLFH 2JB6B 1BEYL 4FFZH 5EC1B 5IEHA 3CFDB 3C60C 2BY0A 1LEGB 5E6IA 3ZE0F 3G5VA 5DD0L 4JB9H 5CFHA 1BFVH 3C2AL 2NY4B 1M7IA 2DIAA 1U8KB 5CMAB 1TVDA 1L7TH 1YY9D 1AHWC 3QJFB 3BWAB 2AI0L 5FUZH 4OD1H 1E6JL 5F7EH 1BZQK 5B38A 1UKQA 4IMLA 5TJWK 2J4WL 2PTUA 3VDCA 3MLTB 1DL7H 3C6LD 4OLWL 3CX2A 4P46A 1KJ2H 1XF4B 2QV2A 3STBA 3DSNA 3JTSB 4WFEE 1NC4B 1L4IA 2DQJL 5A1AA 2XXMB 2XTJE 2PR4L 4Z7UA 1EK3A 3CLFH 4HQQL 1PYWB 5IWLC 2P4AB 2ZUXA 1MHCA 3MV7A 4HSQA 4YHKL 5DHYB 3LEYH 4I77L 4HDIA 4JHAL 5E2JA 4WIQA 4LHQB 4GW1B 4P2OB 4MJ5B 3RIAF 5F3HB 4PTUA 2IH1B 4R26L 3OX8A 4HX1A 1EFXD 1LMKA 3DROA 3VA6A 3VFWA 1K8DA 3JWDL 1PG7W 3MQIA 3WLWD 5GGTA 3TO4A 3OJDA 2E9BA 3IDIA 1YNTA 2LAGB 1I3RA 4RFOH 3MV11 1FL5B 4DGVL 3QFJA 2DQCL 5LWYL 4RMSA 4FFVD 1XCQB 4W70A 1MEXL 5TPWH 5I76A 3CFKA 3QIBD 5DDHB 2C3VB 1F5WA 2EDTA 4IRSC 4PJAA 1NGXA 4GS7B 2DQGL 1HZHL 5DFWH 3C5JA 5EUKB 4MXVF 5C0CD 1PKOA 4HMCA 4QHUA 1I8IA 3EYQD 3FO9B 4GRLA 5GGQH 2CDGA 3N1MC 4KK5D 1J05A 4I3RL 3QDGB 4JJ5B 5IW1A 4UQ3B 3U9UB 1ZSDB 2FGZA 3R0MA 3VXUD 5B39G 5LGJB 1GL4B 4NZRH 3QUYC 3QIWD 3DX6B 4LNVA 1GOFA 1DQLL 5CJXC 4OM0H 2AK4A 4R7DA 1YC7A 3AXLB 3DV4A 3MRNA 1SYVB 2X1WL 5JTWA 3PDOA 1ND0B 2QTEA 2XXCB 3SGEI 2FNBA 2PXYC 1HQRB 2FIRT 3C6SA 4OLEA 3SKOA 5ID0A 3MRGA 4EI6A 3QHTC 35C8L 4FQ1L 1KIUA 4LU5L 3GSWB 3VXOB 1P84J 5D1XA 3ULUD 2Q8BL 3RWFA 3QG6B 1CL7I 2PN5A 3WFEH 1MRCH 3MRIA 5HGBA 1RZJC 1LP9F 1YEHL 4YHPB 1HINL 4F33A 5I9QB 2IQ9H 2ADIB 1MLBB 1OCWH 1LE5B 1GXEA 4QHKI 4AMKL 3S98A 1OP9A 4GBXC 3S5LB 2VLLA 3L7EB 5GS1B 5E08H 4YH6A 3PGFL 3EYFB 3QCVH 2ICEB 2FIKA 1YY8A 1JHLL 3P4MA 1U92A 5FYKE 3RIFK 3RVTD 3QQ9D 3S7GA 3EOBA 1D5BB 2Y06H 3STZA 2PO6B 3MRQA 3OAZH 4XCYB 3TZVC 2ZOKA 2X41A 2VDOH 1K3ZA 2IADA 4GJTB 3V7MA 1KENL 1U8HB 2VXUL 1FAIL 3FT4A 3FRUA 4MSWA 1A2YA 4BZ1L 3P0YH 5I19H 4XP1H 5E2WL 3BFOA 3PXHA 2F54B 5ICZB 5FIEA 1IC5L 4N5ED 1T2XA 3ARSA 4H20L 1AXTL 4EDXA 4K8RH 2P49B 5AYUH 2NLJA 1L9NA 5ID1A 4NFCA 3ZKXB 3D39A 5IK3B 5CEXB 3NH7H 2EXYD 2MTPA 3FFCD 1D5IH 3SGJA 5C1MB 5JW4N 4X6CB 1NFKA 4JO4H 4CMHB 1OAYH 2BCKB 2H1PH 3MBED 2L0DA 4FFWC 1R3LB 4OZFB 4OT1H 1G7HB 4YE4L 3WFHB 2F74B 5ICXA 4JDVA 1GGIH 4YHYB 3QPQC 3VGFA 5GS0H 4NO0D 2YA1A 2F19H 4M93B 3BKYL 2VUOA 5JW3H 4XNMB 1J8KA 1LO4H 4L5FL 3ARFA 5FGSA 2HVJB 1A6AB 4WGWB 4QTIH 4V1DD 3JWOH 5GS2H 1G7PA 2H2PD 5DHVA 4F2MB 1FL6B 3DMMA 5DYOA 1MVUA 1A1NA 4HAGA 4PGJA 1B6UA 3S4SA 4Y2DC 4PRPB 1CR9L 2HJKA 1FZJA 4K71C 4KKLC 5C08D 2R1XB 1A7OH 4Y4FB 4Z95H 5GRJL 5F7HA 1QLRB 4ODWB 4IS6B 3U7WL 3U9PH 5ACMA 4M3KB 2VMFA 1E4XH 3VG0L 3JWDC 2HT3C 2BFVL 5J9PB 3L7FA 4P59L 3VFTA 2AJ3A 3MFFB 5KOMC 3RA7H 5EH1A 3BHBA 1T66C 4X98B 4NQTA 2XKNA 3KYKL 4WWKD 4I9WE 3GMNA 4L8DB 3T1WA 1I9IL 3SDCB 2I9TB 2FATH 4U7MA 4OZHF 1DEEB 2CK0H 5IHLB 1MFDL 12E8H 3QDMD 4WFFE 1OGAE 4WDIB 3QQ4B 4KVNL 1BBJA 5C07D 4JQIH 4OZIE 2VSDA 5KJRL 1DBJH 1JGLH 2X4PB 4K7FA 5TE7H 5KVDL 5DJ0A 1JMXA 3RGVA 2EO1A 3BO8A 5HYJD 4P2QA 4YIQB 4M8QB 3MFGB 4PRHA 3KPLB 4M7JH 4LCWE 1JUFA 1UWXH 5TQ2H 5DK2B 1EA9C 1EVTC 2AGJL 4GQ9L 4LPTA 5HI4C 2BSSB 1U8PB 3PDGA 4PRIA 5DD6B 1IAKB 2FO4B 5C0FB 1G6VK 3AUVA 4RIRA 1WFUA 5EPMB 2FEDC 3KPOB 1D6EA 3FONB 5HSFA 4MA1B 2FB4L 2GAZA 2VLKE 4GKZA 1UM5L 2WBJD 5C0GA 5DUPL 1T1XA 4I0PD 1XZ0B 2VXSL 4UOJA 4JO2L 4MYWB 3TT3H 4Y5XC 4RGOL 3WD5L 1FVEA 4HUVA 2VLRA 3EO9H 4Y4KB 1K4DB 4NKOA 4S1QL 1Q9LB 2BVOB 1CK0H 3BP4A 5IHBA 4HUXA 4PJ5D 2F53B 2AK1H 3DTXB 1GPOH 1AQDB 3WSQH 4E41A 4TOYL 4NBXB 4LLVB 4QNPF 5C0BA 5LBSL 5C0JB 4PJBE 2R1YA 2D7NA 4D9RD 1HSBB 3BQUA 3PL6B 3IDMB 1CXKA 2NXZB 3TWCH 3RQ3A 1YMHA 5GRVL 5IJKA 1F45A 1B4RA 4YXHH 2Q76A 1IGJB 4ZQKB 2X89A 1Q8MA 2Y5EA 3EAKA 3QUXA 3QZWB 4DQOL 1QLEL 1OAXL 5CWSB 4HT1H 1AGDB 4KVCL 4NNXA 2A73A 1U3HB 1VACA 3QCTL 1FNGA 3IJYB 4Z7WE 3O4LD 2I5YL 2B5IC 4XCFH 4JRYE 5HYSG 5DMJB 2Q8AH 3LB6C 1KTRL 3MV9B 2BRQA 5TQ0L 4BA8A 3RY4A 3EZJB 2MWCA 4BYHA 1HNGA 3M17A 1N4XL 1IZKA 1T6WA 3MNWA 1B0GB 3B9AA 4MX7B 1DEDA 4QF1B 1S7QB 5HGAB 3RWIB 3PWVB 4HCRH 2P24B 4LKXA 5AUMA 4XX1E 2ICWB 2DB8A 2IG2L 4QRSB 1SY6A 3C60B 1M7XA 5B21A 3IDXL 4RDQF 5FYLE 3RDTC 3SJVE 3EOAB 4Z7VF 3LN9A 3WEXB 3T4YB 4R3SB 2MCPH 5ALBH 1YQ2A 5LKNA 3SDYL 4BFIA 3VXNB 1FGVH 1AHWB 3HC0B 4ZFZA 3U4AA 2DI8A 1IT9L 4ZD3L 1VA9A 1TNMA 4PJ7E 2DAVA 1JNJA 1RHHA 3V0AC 4N9GB 2C7UB 2VISA 4Y8DC 5ISZD 2Q7YB 1DCLA 4MXWL 4X8XA 1CTNA 1RPQA 2YPLD 5HHOE 1HYSC 1JNLH 5H8DA 4CW1B 5T3ZE 3NPSC 5ESAB 4PD4J 1GGCL 1T2JA 3ULSB 3MV8D 4ORZC 1H15B 2OL3B 5C6TL 4IRZH 2V17H 2OLDA 3LH2H 5GRZA 3B3IB 4K94H 1KBGH 4MNGA 4ZXBA 4OLZL 1YDPB 3OSKA 1H5BC 2V2WB 2C9AA 3VDAA 3MLUH 4FZEH 3MBXH 1RZFH 1GC1L 1KYOK 5MENE 2HT4C 1TPXC 3RAJH 3WKMH 3F5WB 3NFSH 1T4KB 3IFLH 3RY6A 1SJEA 5IQ9A 1MJ7L 1F3JA 3O45B 4J8RA 3VMPA 5JPNA 3REVA 2V7NA 1VGEL 2GYSA 2Z31D 4MNHB 1NCBH 5MHSD 2AEPL 2VQ1B 3BKCL 3MJ9L 4JFQB 2GW5A 5BVPL 4X7SL 5CEZL 4Z7VB 3E6FA 5IB5A 1MCSA 32C2A 2P8PA 3FQUA 2A9MH 4HIXL 4M5YH 4EDWL 3L3GA 5GJTH 5C0AB 3SKMA 4TVPD 1WBYB 4FFYL 2FBJH 3ARWA 4GAGL 3I02A 43CAA 1IKFL 5M95B 1QQDA 4ZAKD 3RL1A 2X4NB 5TDNA 2FX9H 2CRIA 3PP4L 1MUJB 4XGZA 2OL3H 4XVSH 3OV6A 5I15L 1FC1A 1KC5L 4TUKL 3RTQD 3FB8A 4CMMB 1X5YA 4HK0A 3FO0H 2AJXH 1LDPH 2OR8A 4ODSL 1RZKL 3NZHH 2PXYB 2HN7B 3QNYB 5TDOA 2MCG1 4PJCA 4WUUB 1R3IL 1G7JB 5K59F 5JQ6H 1JZ4A 4I3SL 3QWOB 4WRLA 4AJ0A 3PHQA 2H45A 1K6QL 3R06B 3G6AA 3C8HA 1R3JA 2X1QA 1GRWA 4YHIB 3TPKA 3SDXF 1Q9OB 3MR9A 4KJQD 2OTWA 2HTKD 1EEYA 2B20A 3LRHA 1EO8L 4GBXB 5LCVH 4OZIA 2ARJQ 2DQDL 4RA3A 2GJZB 5ILTH 3FCTA 3ILPA 4JJHA 4RNRB 3GSQB 4PJDE 4R97C 3ZE1E 4L4VE 1KCLA 2NW2A 3FKUS 2J88L 4KK6C 2EDNA 3VGAC 1N64H 4FHBD 4F7PA 3OB0K 5EC2A 1PQZA 4U1SB 5DJ2A 3W2DH 5I1HL 4BUHA 2B8OT 3OKOB 3RJDA 3ZKSD 3QUKB 3MLYL 2CLVB 4KZEH 1MHPH 4X5WA 1C08B 4NWUL 3SGDI 3TZVB 1TQBC 3MNVA 2X7LB 4OFKA 3TVMD 2ARJA 3MZGB 3V4VH 1NAKL 5KSUA 4HWBH 3HI1A 3O9WC 1ZLUH 1XF5B 4MD4A 5DGRA 3FN9A 4XP4L 2B1AL 1TCMA 2VLKA 2DICA 3G5ZA 1NCDH 2K7QA 3O3UN 4NNPL 3RWDB 2RJMA 4XPHH 1QRKA 4A2MA 4KC3B 2JJUA 4G8IA 3MA9H 3QEQE 4WHTB 1TITA 4LSQH 2E7CA 2XFXA 3C5ZA 5IR1B 5E8PA 2F54D 1MCOH 1RUAL 1CL7L 1CLZL 5KS9A 1OTUC 2P8LB 4Y5YA 4RGND 4FG6D 3IXTB 3FTGB 1RZJH 4XMKL 1I85A 2A38A 1KNOA 4PJXA 1W0WB 1T0NB 3ZL4H 3MLSH 1FSKC 2RCSH 3OHXA 4NOFA 2QR0A 3GJFA 5FA3A 4BKLA 5BV7L 4D9LL 4JY6A 2PTTA 5D7LD 1PKQA 3D0LA 4K3DL 4TTDD 2WBWB 3MUGB 3SDXB 2OXGA 2LV4A 3ZSSA 1QNZL 2B1HH 3FQXB 3GIVB 3OG6B 5I1DB 3GUTA 3RJQB 1FFOB 3MLRH 4XVTH 2X9YA 5DQJA 3ROLB 4OV6F 4K9EL 3EDKA 4XCEB 4Y2DB 4FN0A 4UV4H 1PG7H 1FV1A 1JTOA 4K71B 1J1PH 3X3FL 2YA2A 4JRYA 4U31A 3E1F1 5EOTA 3QH3B 4N0YH 3C08L 4AEIH 1SMOA 4PTTA 5DD5L 3VMOA 1IC4H 5DQ9B 4HS8L 3EKCA 4NJAL 4X8JA 1GGBL 4J4PC 4LHUG 4L8SA 3V5DA 3H3PH 4K55A 3D25A 1IQDA 3U0TB 2DMCA 1SEQH 1RJYA 1D9KC 1WICA 2YZ1A 4YGVA 4B7LA 1XMWA 4MB3A 2IWGA 4P2RD 4LPUA 3C2AH 3ARTA 4N8CL 4X4MA 5SWZB 4W6WB 1MI5E 2G5BA 1CFSA 4I5BB 3ZLQC 4POUB 1MHHB 4IOFC 1B4JL 1Q1JH 2IANA 3V9FA 3T0EC 3VH8A 5CBAA 3PHOB 2ITCB 1HHGA 1YEKH 1JPGA 4O2FB 3SDCD 1OT2A 4HUUB 1C5DB 1ES0B 3TYFA 3VD3A 1BD2E 1TZGL 4G7VH 4X83A 3OJVC 4XB8A 3PJSB 5IB4B 3OF6A 4I2XE 2Q3ZA 4NC1E 2HJLB 3RUGE 2WINA 5HHOA 1U3ZA 3F7YB 3OKDA 2FJHB 3X11B 3MPCA 3RVVC 1JWSB 1UADC 2ZCLL 5EB9A 3E3QE 3E8UL 3J7HA 5EORL 3VXMA 4HJGA 3TBTB 1N6QH 5E03A 3JWDH 4JFFD 1QRNE 2L7UA 2ZCKL 4Y5XB 5JZ7D 4IDJL 4LCCC 5DJDA 4J2XA 1YEJL 3EJZD 1J10A 1WZLA 3MYJA 3BEVB 4UTAH 1U8MA 3CSGA 1T04B 4XNYH 1F6LL 4ZTPH 3N1GC 3DO7B 1LO0L 4HIEB 5B3JE 3GHEL 5C71A 1FAKT 3PNWA 3O2DL 3BVNB 4N0FB 1OSPH 4Y4KD 25C8H 1FNEB 1UWGH 5GPRA 3DECA 3K0WA 1OT1A 1ZVSA 4Z0BH 3IVKB 1QFWI 4UUJB 2L4OA 4OKDA 5JDSB 1S9VB 2GK0A 4KI5D 3UZEA 4G9FE 1PY4A 1T1YB 4L4TE 1YEDB 5E8OB 1P4IH 3HR6A 3HE7B 4YXKH 3QRFM 2VLJD 1YN6A 4UMGA 1NKRA 4Z76A 2WWMD 4PV9B 5D8JH 5I8EA 1YEEL 2DLFL 4GW4B 2X4SA 3BZ4B 1D5ZA 5SX5H 3VFUA 1QR1B 4PJFF 3C6LA 2AEQL 1FG9C 5C0DA 2AV7A 3CGTA 4M03A 4WU7A 4Y7MA 1ZT7B 1S7UB 5BVJA 3WLBA 1CFVH 4ODVH 5FYJE 2BJML 1RU9H 1CGXA 1CZ8L 1MCFA 4KTEH 1T7YA 5KSBF 1JYXA 2B5IB 3VXQB 3CDFA 4KKBD 1TDQA 4OD3L 3QDJB 2IAMC 2O5ZL 5EDXA 5FGBA 3MLPA 3O6KH 3T2NL 3FOLB 3IU4L 3MREB 2M8XA 1IAIL 3LKQB 1P69B 2RFXB 1Q9WB 1X4ZA 4TPRH 2AQ1A 2BMKA 2NX5B 4LDLB 4LVNC 3FQWB 4J1UB 2CQVA 2GSIA 4I9WD 4U3HA 3I6KA 2R69L 4KTYA 5JHDB 1EFXA 1L6XA 4RAVB 2DM4A 3P4OB 1WWWX 2P5WD 5C9JB 3ZYIA 1TCRA 3VXSD 1IGTA 3PHSA 4OI8A 5BXFB 4QRQA 1BIHA 3RDTB 4QRRB 1HINH 5C09B 4PS4H 4UIKH 1A7NH 3NAAH 2NW3B 4HLZG 1A4JB 4KJYB 4YNYA 3KYAA </