1T03H

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
225
structure length
225
Chain Sequence
b'QITLKESGPGIVQPSQPFRLTCTFSGFSLSTSGIGVTWIRQPSGKGLEWLATIWWDDDNRYNPSLKSRLTVSKDTSNNQAFLNMMTVETADTAIYYCAQSAITSVTDSAMDHWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPADC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synthetic oligonucleotide template
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
total genus 40
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t03H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t03H01
3AS1A 3UJIL 1HQ4B 4NQXB 2A74B 3N06B 3QQ9C 1I1FB 3CZFA 1BGXL 4IOFC 4KGLA 3WNPA 1EO8H 1IL1B 3GNML 2EDTA 5DFVC 3F58H 1YQ2A 3G5VA 1KB5H 3TH4T 2B0SH 2K1MA 2PXYB 1N6UA 5C6PB 4WI3A 3H0TB 4RGOL 5FDWA 3AB0B 4JFYB 1ADQH 2P5WE 1Q9KB 3TV3L 4PJFA 2NX5D 2J4WL 2IAMD 2VXTH 3ZDXF 4DKFL 5HYEA 1EPFA 5HHOA 2DLEA 1G0YR 2QSTA 3OR6A 4PJXB 1EVUA 1PY9A 4IIQB 1J1PL 3CMGA 4KJWC 3GIZH 4P5TA 5C0BD 1R3JB 4GH7B 1UCBL 5LAXB 1UZ8A 5E70A 1O5DT 2H9GA 5IB1A 2CLVB 1ODAA 4TUOA 4O2EB 3NFNB 1DQDL 3NIGE 1G7JA 4NYLA 2H6PB 3QWRA 4LVOC 4X6DA 3STLB 2V7NA 2XXMB 3CU1A 2DF3A 2OR8A 4Y4FD 1KGCE 4Q0XL 4WHTA 1NBZB 1A14H 3GMOA 5IQ9A 3VRLF 1QRNA 2GTWB 3ESVF 3EUUA 1BVLA 3ZHDA 3QO0B 1CLOL 1KIPB 4MNHA 2X70A 5IP4A 1NCDH 1NGPL 1QR1B 2NY4C 2HJLA 5E94A 2UWEA 3DX7A 4ZO9A 1QACA 4XGZB 4Y4KD 2WP3O 4GAYB 4YXLL 3FHQA 3MLXH 3L3DA 3AM8A 2J8UF 4HG4K 1RIUL 1S7QA 2QL1A 3UJJL 1VESA 2J12B 5HGHA 1OT1A 1I7RA 1ZGLB 3GSNA 3MRBB 1MFDH 2LVEA 1XMWA 3QJFA 3QULA 2Z8WC 1I8KB 4PY7B 4QRUB 2HTKC 1A6AA 5DWUH 3LQAC 2VIRB 5L8JB 5CLTA 4UZGA 2WWKO 3K7UA 4C57C 4L9DA 4ZO8A 4G7YL 1WBYB 3RVUD 5ESVB 4U2ZA 3QIBC 2H8PB 3D2UB 1T1WB 5B38A 4HGWA 2DQFB 4KQ3L 3ILPB 1RZGA 4C56A 3LRHA 5DMIL 4YDVB 4YGVA 3E3QE 2GAZB 4LBEA 4MA8L 4HV8B 2OM5A 2X89A 4K94C 4RFOL 4GLRI 1T20A 1G6RA 4OUUA 4MJIB 4LEXL 3MRPB 2JIXA 4NO0D 5KSUB 4S1QH 4KHTH 8FABB 5KANG 1B0WA 1MJUL 3SE3C 2AABL 1L7TL 3GMPB 3KDMA 2GSIB 1BQHG 4G9DA 3V8OA 4PTUA 2W65B 4ZQKB 5DO2D 1AXIB 1F42A 2IFFH 4WI2A 1I85C 1X6NA 5DLMH 2EE6A 1QSFD 2ED7A 3QJHB 4JY4A 5GSRA 2HN7A 1EFXB 1FN4B 2AJVH 3D85D 4KKLC 2M1KA 3IS0X 4WUUA 2P49B 1NCBL 1J1XH 2EDYA 3NCBB 5HPMA 1I8IA 2B4CL 4FQIH 5FGCE 1C1EH 2BFVH 2G60L 3QUZD 2OZ4L 1OAYL 5JDJA 4UI2A 1NL0H 5DJAA 3TFKC 2WWMC 4X99A 1AQKH 5ISZD 4YBQD 2I9TA 4U6VL 4M9OA 1N4XH 3MLTB 3MXWH 4QRTB 1GGIH 4PGDB 3VXOB 1KT2A 3MOBH 1I4FA 3SE8L 2GJZB 1AH1A 4B7IA 2VLKE 3ZDZF 4L5FL 3HRZA 5E1HB 4LVOB 4PJAA 4PJHB 2P5EB 3K4ZA 3T3PF 1F00I 5IWLC 1EHLH 2BK8A 2E9JA 4NNXB 1AR1D 5CZKA 5K93A 1UWXK 5F3BB 3C60C 2B1AL 4KK9C 3UTOA 1BZ7A 3U36B 1NBYA 1KCSH 4IMKA 4P0DA 4LLDB 3EAKA 3LS5L 5D7IA 3RVTC 2RIKA 3MRFB 3MYJA 4JFEA 3U4BL 5HVGB 2J88L 1CGSL 4N9GB 2HJKA 2VQTA 2WV3A 5DD5H 3GRWA 3OPZL 5EU6D 1LNUA 3FOLB 1ZAGA 4OGXL 3G9VA 1BFSA 4MNGE 1MPAH 4TNVF 4E0RA 1PVHA 3VFOB 1N6QH 2NW3B 2W0PA 4KJYA 4EI5D 3TT1L 1ZE3C 1X5ZA 1A9BB 3IKCA 2X4TB 1I3VA 4U1SA 1DCLA 2FO4B 4L8BA 2V5MA 3O81A 4QRQB 5IW1A 2A77H 1S5IL 1U36A 2CK2A 2D03L 4M93B 3ZKXB 3CVIL 4X8XA 3T4AA 4M1DH 4JFFD 1S7WA 1X44A 1E27B 3QIBB 1F4YL 3FN9A 2F8OA 2ZCKH 1HXMA 4HH8A 5ITBL 3O6FB 3KPLA 3REWA 3D18A 1YEFH 2KBGA 1SBBA 4N8VA 1RMFL 4MS8C 3L3GB 2CKBB 3PIQB 4E41D 3QUYD 1T7YA 2KKQA 3QEQD 3EYSL 5H8DA 1A9EA 4P9HH 3GMMA 3QH3A 3RWEA 1JHKH 2CRIA 3PWNB 4Y1AD 5T1DH 2EICA 3FQXA 4XXCC 4QF1B 8CGTA 2ADGB 3G6AB 2ZUXA 1AD9B 3DX9B 3L5JA 5I8KL 1VGKB 4XVUC 3FAXA 4CADB 1QSFE 4M48H 4ZUTB 1NFIA 2OQJA 2ICWB 3OJDB 4NKQB 2DMBA 1J8KA 2Q7NA 4QHMB 5E2TH 3DHJA 1U3HD 4N0CC 4YHPA 5DRZB 4DGIL 2GEEA 2PCPB 4M62L 5AD0A 1CYGA 1T3FA 1P7QA 3THML 1OB1A 2ICWJ 3VGHA 1FFOB 5DF0A 5IV2B 3D0LB 4GBXB 4KDTA 4UT9L 4PB0H 5GS1C 5CJOL 1BQHA 5ISZE 1BF2A 4WFFD 3QB7C 1U8PB 1W72H 4WGVB 2VH5L 3BE1H 1HEZA 5JOEA 1GXEA 2WAHA 3W11C 1DQMH 2QQKH 1BHGA 2DYPB 4NQCA 4L4JA 3AC0A 5GGQH 1VGEL 2R56H 3LEXB 4PRDB 1VENA 1PKQE 4FFZL 4ODHL 4P5MA 1RSFA 4Y19B 4Q9CA 1MFCL 4P2QB 4V1DA 3H8NA 1LK2B 5ALCL 4JZJA 4XP5H 5DK2A 5F6IC 3T2NL 3RWDB 4Y5XB 5HJ3A 2YWZA 2EC8A 1ORQB 1Q94B 1QYGL 4XPHH 4XBGA 1QA9A 1TZIA 4KPHH 1VKXA 4NRZA 3TJEL 2D7PA 2E6JA 3CK0L 2ADIB 2QR0A 1MH5A 4X98A 2EIDA 1S7XB 5J8OA 3ILQD 2ITDA 4ZPTA 5C0EB 2VLLA 4Q9QL 4JDTL 5CIPA 1TVHA 4G6JH 3T77A 5ANMA 1TIUA 3MV8D 3O2VH 1CFSB 2LE9A 5EU6E 3DMMD 4OCWH 3HNVH 3AM8C 1X7QA 1A3RL 1T83C 2GY5A 2ZSVB 3ZKSD 2M26A 1BBJA 1D5MB 3P77B 1XAUA 3JV4B 5C08B 2XWJB 4WU7B 1CXKA 2FHFA 3GM0A 2R2EB 1FNSH 4EUPG 2DBLL 4XP6L 4HQQL 5B39G 1Q9OB 4WFED 3HE6D 2XZZA 4FNLL 1B9ZA 3O41A 5IKCB 3ZE1F 4G43A 2W38A 4JO2L 2H41A 5I18L 3U0PA 4P2YA 3EFFA 1DUYB 4J4PD 3B3IB 4JFFE 4GQ9L 2YKLL 4MB3A 1KPUB 5FUOL 2ZUQC 1N5YL 1YEGL 3DJ9A 3B5TA 1EAJA 4FQCH 5EOCH 3LEYH 1NCWL 4EBQL 3SE9H 3ULUD 1U95B 2R23B 1IAKB 3BO8A 3WIIL 1QBMH 2NY5H 4ETYA 2VYRE 3QEQE 5MP6H 1RZJL 2UZYB 2X4QA 4I18A 4KHXL 2XKNA 4MQ7B 3I6GB 1EEYA 3L6FA 2PXYD 3MV11 5E6IC 2K9UA 5F89B 5DUPH 1AGEB 3WUWG 3WFEH 3EFDL 5I1JL 5L6YH 1CDUA 1H3VA 2HT4D 1KV3A 1DANT 4P3CH 3P9MA 2OJZL 1J0KA 3CZFB 5GRVK 1UWXH 3SOBL 2Y7QA 3QI9B 2Y06L 4GRWF 3MLVH 2EEBA 3G5VB 1KJ3L 4JO1L 5DVKA 5C0DA 1G9ML 4M1GL 4KY1L 4UU9A 2ZUTA 5M7QA 4HJJL 1I1AA 1KFAH 5FDWB 4Z0BL 4JY6A 2J6EL 4BZ1L 1R3KA 5HHOB 3RZWA 3IAPA 1PD6A 1E6OL 3OR6B 1DFBL 4Z5RA 4OZFH 5DD0L 4TSAL 4WFFE 4P5TB 4LK4A 2EZ0C 3KG5A 1PG7L 3BSZH 4LLWA 1UZ8B 5I19L 4NZJA 2H9GB 5IB1B 1U92A 3PF2A 3IFLH 3OAUH 4QO1A 4TUOB 3WO3B 5IF0A 1WIOA 1H3GA 1G7JB 1BAFL 4NYLB 1C5BH 4X6DB 2P46B 4LCYB 4OLYH 4L3EA 2C3GA 4QXUL 2HKFL 3HC3L 5F6IB 1PQZA 4PJEF 2PTTA 1Q0XL 4WHTB 3T0VA 3GMOB 5IQ9B 4HCRH 1QRNB 5D2NA 3FO0L 2BZDA 2F5AL 1BVLB 4L4TE 4XHJD 4XPTL 4L29A 4MNHB 2X70B 5DD1L 5TQ0L 1KULA 2BJML 1JZ2A 1AC6A 3UTPE 4M6AA 4B0MM 2HVJA 2YBRA 2HJLB 5E94B 3TWCL 2UWEB 3DX7B 1CXIA 1KJ2A 2D0FA 1MJ7H 3SPVA 5EIIA 1HINL 3V79C 3FMGH 3L3DB 5E00A 3MV8E 1FSKB 1D9KA 5AYUH 1S7QB 1FZKA 5DD3L 5EC1A 4I2XA 5HGHB 4LLQA 3S36H 1I7RB 3SDYH 4YHLH 3D2UD 5CZVL 4XP1H 2AEPL 2BHUA 3GSNB 1A7PH 1FDLL 3MLUL 3N9GL 4JGMA 3V0VB 3QJFB 1RD6A 3DI2B 3QULB 1B3JA 3ORJA 2Y6SD 3HNTL 4WFEE 3VW3L 1JWSA 2ERJB 5FYKL 4DOHB 5DZNA 1A6AB 1MFBL 4MJID 3ZSSA 4PJIA 5E99L 4Y5VA 2P1YA 3VDBA 1DBKH 3RWIA 3IU4L 2C26A 2CDGB 3KPPB 3CC5A 3GI9L 4JO3L 3GMNA 1YNLH 5HHVL 4XPFL 3MREA 32C2A 1JMXA 2A9ML 4HGWB 4OD1H 2VZ1A 5B38B 3ALWA 1FPTH 4HSQA 1F2QA 2M8XA 1RZGB 4C56B 3HFMH 1UQSA 4YGVB 5HDBE 3ULUE 1EFXD 5KVFL 4LBEB 1JWMA 1PKOA 5DFVD 2O61A 4WUKH 2R2BA 1T20B 1G6RB 2W9EL 4OUUB 3SQOL 5B39A 5KN5A 1MNUL 2JIXB 1R3LA 4GAGL 1OM3H 1UWEH 2HG5A 2WBJA 4PGZA 4LFHG 4NWUH 3DVFA 1B6UA 4MB4A 4G9DB 1LILA 4PTUB 4DKAA 3WXWL 4WTZG 4M43L 4YC2C 4OGYH 5IB4A 2H2PD 4JY4B 5GSRB 1RIHH 2HN7B 1JV5A 4AEEA 2X4UA 1TTUA 4WUUB 4HMCA 5FM5O 3V8CA 2VDQL 3OXSA 4AM0A 5BQ7A 5HPMB 1I8IB 1FIGL 3QCUH 2GSGA 2P5ED 2NY3C 3MRDA 3CVHL 3HMXL 2XQBL 5DJAB 2UVEA 4X99B 2IPTH 5EZOL 2I9TB 5IHLB 4TN9A 5D5MA 3NZHH 1EGJH 1DBAH 1FGNH 1K4CA 3EDEA 1KT2B 1I4FB 3UBXG 1T0MA 4RBPK 1VEOA 2Y07L 5EBWA 2IH3A 3ARVA 3RY4A 2A6IA 3HRZB 1R6VA 2DJUA 4PJAB 5CZXC 2YA1A 3VXUA 3LS4H 2G5RA 3GK8L 4NC2B 4BFGA 2XICA 3VWKA 3VXRA 3CLEL 4QRPB 4HEME 4OGAC 1JF1A 1ZEAH 1ZHNA 1G9MC 5DVLA 1A3LH 4KTDH 1BZ7B 2DQIH 3GKWL 3M1BA 5EU7E 1NBYB 2BVUA 4KUZL 5HHMB 5D7IB 3D6GA 4TPRL 1TVBA 4ZODA 1OSPH 4J3VA 1PX4A 3MYJB 5IVOA 4JFEB 2VDRH 3BDXA 5KS9A 1A21A 4H1LA 5TDOA 2HTKD 1NGQL 2YD1A 5JIPA 2NCMA 2HJKB 4TSCH 5D2LE 1CXLA 1LNUB 1JMZA 4OLUL 4LSQH 1R24A 3QIBD 3ZT6A 4E0RB 5D93C 5I8OH 1UACL 3O6FD 1ES0A 5IT2H 2IPKA 4KJYB 4YHZL 3OJ2C 1X4XA 1G6VK 1HQRA 2VUOA 1D3CA 3IKCB 4U1SB 3KHQA 1PEZA 4L8BB 5IW1B 1SEQH 5SV3A 1X5FA 5DC9B 5FAAA 3T4AB 3WS6A 1HKLL 4MJIE 1S7WB 1EUUA 4NJ9L 2R8SH 2DQHL 2DLFH 1S5HA 3V4PL 3KPLB 3REWB 3D18B 4I3GA 3CDFA 2UUDH 3BGMA 3ROLA 3FOMA 2DDQL 1JJUA 3QFDA 4ZUUA 1URLA 2JE8A 3T0BA 5CD5C 2EH8L 2ZG3A 3MACH 2E27H 2XY1A 3P0VL 4O02H 4QTIL 4YXKL 1IM9A 3OWEA 4MDJA 2C4FT 2YR3A 3QCVH 1UKQA 5DHVH 1A9EB 3EGSA 5J7CC 4ZSOA 3GMMB 3QH3B 3RWEB 3R8QA 1ZWIA 4QLRA 4LARH 3G6DL 3FQXB 4K7PL 4TVPE 3HCVA 4E42A 2XACC 2JJSC 1U2HA 4GBXD 4YC2B 4F3FA 3WHE1 2B1HL 4ZD3L 3C08H 1KBGL 2HRPL 5FYJL 3WFBL 3A6OA 3LKOA 4F7EA 4QRSA 3SCMA 3ULUH 3VCLA 2JB5H 5D70L 1NFIB 2OQJB 3WBDA 1MSPA 3VXNA 4YHPB 3RA7L 3UROR 1CF8L 4HC1L 1F45A 2DYPD 5AD0B 2V5YA 1T3FB 1P7QB 1W8NA 2RJMA 1OB1B 1EEQA 3MV7A 4FP8H 4PJHE 1I1AC 4Y19D 3VJ6A 4PG2A 1X5JA 4OZHF 4BJLA 2FCBA 1BQHB 4P2QD 5FUZH 4JRXA 4KK9D 5CEZE 4MA1C 5DMYA 1WFNA 3EYUH 2YD8A 4BELD 1HEZB 4PRHA 2GCYA 2ZCHL 2VC2L 3IAGC 5D1QA 4U0QB 4AYFA 4NQCB 1RJLA 2YUWA 3LSOA 4P5MB 2DD8L 3MCG1 3V4UH 4POZC 3P9WB 1T4KA 5CGYC 2X1XR 4V1DB 2BOCA 5TDNA 4JZJB 5DK2B 4XC3H 3C8HA 1GH7A 1U2CA 5FO9B 4XBGB 3DNKA 1QA9B 1TZIB 4OCSL 4NRZB 4MA7L 3RUGF 5C08D 3BAEH 2QR0B 5DZOA 3SO5A 1MH5B 4K3DH 4X98B 1OD9A 3UBXA 4M5YL 1HHIA 2PUQT 1A7NH 2ITDB 4ZPTB 2VLLB 4PJGA 2FH8A 5CIPB 3WFHA 4A6YB 3T77B 4W68A 5ANMB 5GHWL 3PQYB 4Q9RL 1BQSA 3OKYA 4KXZH 1X7QB 5D93B 1BBJB 4DQOL 5TFSH 1FYTA 3M8OH 1KENL 1PBYA 5I71C 3ARWA 5BO1H 4D2NA 2CDFA 4MS8D 1CXEA 3FT2A 4PRNA 3BP7A 4MQTB 1YZZA 3TYGL 5DMJB 1YMMA 1NAKL 3N1FC 3O41B 1YQVH 3MO1A 1EO7A 2LV4A 4G43B 4GG6E 3U0PB 4X9GA 3EFFB 2P47B 3B2UD 5AUMA 1NMCB 3ARBC 4PS4L 4Y5VC 4LSPH 5IMLA 3WIHL 5E4EC 4URTB 4XWOC 5DJYB 3BQUC 4F8TA 5HDOA 1TQCB 3D87B 1FNHA 4QNPE 1DBBH 3LRSB 4N0CD 3BO8B 3QEGL 4OAWA 3QI9D 3UYRL 1EAPA 1KN2H 3RNKA 2X4QB 4I18B 1AGDA 2XKNB 15C8L 4NFCA 3OV6A 1EEYB 3L6FB 1SY6L 4RBPH 3HAEA 1MY7A 2L7JA 2WBJC 4I13B 3VGAC 2IBZY 3BT2H 3QUMA 1FORH 4S10A 1CE1L 1AFVL 1P69B 3BDBA 5HHOD 1FP5A 2DIBA 1WSST 4OKDA 3P9MB 5HPOA 4MJ5A 2ZKHL 2FLRT 4J23A 4P5TD 1A6UL 2Y7QB 5FOJA 1LVEA 1HIMH 4KZEL 2HYMA 1X5AA 1TFHA 1QHOA 5C0DB 3OHXA 3SDXF 2KH2B 5TE6L 1RULL 4UU9B 3K80A 1LP9A 1N3NA 2PYEA 3EYVA 4YO0A 1I1AB 2DI7A 1MHPH 2WSKA 5E7FA 1LD9A 3QWRD 4JY6B 1GCFA 1R3KB 4Y19E 2VDOH 3HA0A 2BVPA 2YUVA 4LLYA 5F7HA 5K33A 1MQ8A 2YS4A 3LN5A 4K23L 4P2QE 5ILTL 3ARFA 3MRQA 4Z5RB 2IG2L 3ET9F 2EKSA 1QRND 1I8MA 2DIJA 4LLWB 3EDKA 3DXAA 3ZO0A 1U92B 4OT1H 1CGXA 4KMLB 5EWIH 5EO0A 4YXHL 2VOTA 4DK3A 4PRIA 4JAMA 2O5ZL 1NMBH 3OGOE 4L3EB 1FBIL 2H1PL 4ZOAA 3GGWA 1PQZB 2XQYK 2JJWA 3QZWG 2PTTB 2CLZA 5D2NB 5CFHA 1J12A 3GMRA 4L29B 5JA9A 3NCJL 1CFVL 5FB8A 1OLZA 3KR3H 1R3IL 1J8HA 1FH5L 4HPYH 5C08E 4XC1H 2HVJB 5FHBL 3TJHC 3HUJF 2YN3A 1KJ2B 2H3NA 4G6AD 5EIIB 1A7QL 3S88L 2HTLC 3MODH 5SWZA 1N0XL 5E00B 1D9KB 1RU9H 4XVJH 3KLSA 1J1OH 1FZKB 1P4IH 5EC1B 4I2XB 1LWRA 4LLQB 1KN4H 2ADFH 2IBGA 4LCWA 5I71B 4ZFGL 5EA0L 4NKIL 1U9KA 4DUXA 5GGTH 4C56D 4S11A 3WV0A 3C5ZC 1JWSB 1H8OA 2X89D 5E0QA 4OM1H 2EDEA 4PYHA 2JIXD 4EVNA 3ULVD 4PJIB 2AXGB 4Y5VB 4YZFF 3RWIB 1PDKA 2OTPA 3CC5B 3GMNB 1I1YA 3IJSA 5ERWA 2Y23A 3MREB 32C2B 1QKZL 1LHZA 4X80H 4JPKL 4X7SH 5I1GH 4NO5A 4K94H 1UQSB 2I27N 4KV5F 2CKBH 4GXVH 4CVXA 3BUYA 4OSUH 2O61B 1YEJL 1RFDH 2BY2A 2R2BB 5C3TA 5BVJA 5KN5B 3MRHA 4WUUD 5B39B 1DUZA 3QWQB 4NN7B 5T33L 4FG6D 1R3LB 2Z93A 2HG5B 1P1ZA 2WBJB 1J10A 4AT6A 3P11L 4YHKL 3NOIA 3QXWA 1CQKA 4XI5C 1IGIH 2M2DA 3GHEL 2ZUYA 3MJ6A 4PJFE 4YHYB 4JQXC 3TEUA 5IB4B 2Y36L 1JZ4A 5HHOE 3S3SA 2EZ0D 5GS0L 1A1OA 5EUOF 1JV5B 2B20A 4PJDB 2X4UB 5L9DL 4AL8H 1MIML 1CK0H 1D5IL 3OXSB 2AAVA 3C9NA 3NIFF 5GIRA 4AM0B 1V3JA 2KZ1B 5BQ7B 1A1NA 1BOYA 2G5BA 4DJMA 3TBYA 4JFHE 4F33A 5EZIH 3EDDA 2GSGB 3B9DA 3VE0A 3MRDB 3N85H 4LL9A 2UV3A 1WTLA 2XWTA 1ZTXH 3G6JB 5BW7A 3MRMA 1DQTA 3X3GH 5I15L 2E7LA 3HG1E 5D5MB 4CW1A 4QRPD 4JN1H 3DGGA 3QRGH 3CNKA 4KC3B 1QRNE 1K4CB 1DQJA 2P48B 5EBLA 4IHOA 1T0MB 2A9NH 1NMAL 5HHMD 2IH3B 2A6IB 4JFED 4I5BA 4Z78B 3GBMH 3RVWC 4OLVL 4FOMA 2UWEE 4JG1L 4Z7VE 2VKXA 1JZ6A 1V7ML 5KJRL 1VSCA 4S0TD 3VXRB 3VWKB 4OLXH 3V6BR 4JG0H 2OL3A 1KNOA 1JF1B 3O2DA 1ZHNB 2JTDA 4X6FB 3RPKA 1X4ZA 3KJ6L 3M1BB 3PGDA 2J4WH 4OQTA 3RL1A 3NCCB 4W6XB 3X14A 3LN4A 1TVBB 1UADC 4BQCA 5KS9B 1IC4H 4QOKA 2EDLA 4H1LB 4HF5H 5TDOB 1FRGL 4R7DA 4JANA 4ELKA 4M03A 4PLOB 3UJTH 1PGRB 4DOHE 1S9VA 4P9MH 5I0ZA 2XTLA 5CSBA 3L3HA 4WVRA 2Z91A 4YWGL 1R24B 3SDDC 4NM8H 3QZWA 4HWBL 4LU5L 4NWTH 3UTTE 1H9VA 1U42A 5F7YC 2DI8A 1TETL 2I9LA 1ES0B 5A43C 2D7QA 1MWAA 1ZT4A 2IPKB 2NYYC 5TDPA 1PEWA 1HSAA 2CJUH 1HQRB 2F58L 4RAUA 1Z3GH 3DUSA 3VDAA 2VWEC 2NW2A 4WO4B 4K55A 2FB4L 5HDQH 3WDJA 2ORBL 1VFUA 3U83A 1I3RA 4HKZA 5TE4L 3ULVE 5KVEH 1F3JA 5E8DL 1S5HB 4U1JA 1OTTC 1HHGA 1S9KC 5LBSL 2HT2C 4ZXBC 3BGMB 5I8EA 3ROLB 3FOMB 3QFDB 4ZUUB 2EKJA 3EO0B 1IM9B 4BUGA 3H3PH 4MDJB 3U7YH 3RWFA 2MCPH 2F8VA 4KK8D 3EGSB 4LSTH 4ZSOB 1OARH 5FCUL 1ZWIB 1P7QD 1NGXA 3K4AA 1VFBA 4ZTOH 3PL6A 3ZTNH 3HCVB 4E42B 3P4OB 4F3FB 3FKUS 5DI8A 3WO4B 1MAMH 3LKOB 1FVDA 4QRSB 3BUTA 3SCMB 3VCLB 4MD0A 1Z6JT 4N5ED 2ATPA 1OGTA 3O3DA 3WJJA 4PB9H 2B7DT 3S35L 3VXNB 5K9QI 4LSUL 4M6NL 3W5NA 4MQXC 2OR9L 4G9FA 1ORSA 4BFIA 4NQCD 3LAFA 4RAVA 1GOFA 3ARZA 5CZXD 4F9LA 3MV7B 3PUCA 4ZUWA 5C2BH 4PJAE 4UILH 2HJFA 1CD0A 3QWOA 3VJ6B 5CD3A 5CAYB 2N7AA 3DURA 1WBZA 2P8PA 4V1DD 4JRXB 1P9MC 4OCRL 3U9PH 3ARFC 1KLUA 2V7HA 1KB9K 4PRHB 4Z95L 1CBVH 1KCUH 1REIA 2GCYB 5D1QB 2VQUA 5IFAH 2R29L 1RJLB 1CFBA 3VFGH 5EB9A 1MCLA 5D7IE 3LSOB 1VPOH 4NQEA 4JFEE 3T3ME 1GC1L 3HB3D 5LXGL 4N1CA 5GS0C 1U8MB 3RNQA 1T4KB 9CGTA 2PTUA 2BOCB 3PQYD 5TDNB 1FZMB 1ZOXA 2ICWI 5DMKA 4DN4H 3L7EA 1OCWH 2GK0A 4OKVA 4MAUL 3S37X 1LMKA 3WXVL 4OI7A 4R4NC 2HMIC 3C6LA 4KI5C 3UBXB 1D5XA 1HHIB 2QQLL 3MGAA 1MLBB 1U3JA 3U48A 4PJGB 1MELA 1IEBA 3QDGA 3WFHB 4LDLB 5F1OB 2VJXA 4WW1A 2IH1A 2J8UA 3HI6L 2ZSWA 5DYOB 1A5FL 3B2VH 5TE7H 4TRPH 4N0RA 1TJHH 1BBDH 4PJCF 3GSNH 3T0XA 4HFWA 5CCKL 2CDFB 1F6FB 3FT2B 2R0WH 4PRNB 1LK3L 3BP7B 5T5FL 4XP9H 3T65A 3F62A 4Z6AT 3PWJA 3U30C 4KK6C 1YMMB 3MO1B 4YQXH 4MGXA 1YECH 4MXVE 2AJXL 5AUMB 2V2WA 4UAOB 3LY6A 2NTSP 2YUXA 5IMLB 4ZAKC 5DVNA 1CGSH 3MC0A 4G7VL 1H3PH 4XMKH 3BIAX 4Y88A 1JNNL 4DW2H 4BQ8A 3MLSL 3PGCA 2V17H 3GM8A 4FFWC 3ARDB 1U6AL 1RUKL 3BHBA 3H9HA 4OAWB 5CGTA 1G6RH 3FT3A 4XNXH 4YHOL 3CX5J 3N1PC 1EAPB 1PY4A 5KVGL 3FFCE 3ULVH 3RNKB 1GGCL 1AGDB 1M7IA 4Z7QF 1PSKH 2VZTA 1I1AD 1W0WA 1PZUB 3QUMB 1T5WA 4RZCA 2NY6C 5DQ9A 2BP3A 2EXWC 3BEVB 4BH8A 4X7DC 1DLHA 5FYLD 4MJ5B 4N90D 2CUIA 3FQUA 4N0YH 1F4YH 3C87A 4X7FC 3U1SH 4NQUA 4JKWA 4UT7L 4G80A 3CLFH 3BP4A 5MEQA 3OHXB 2JK5A 5I73B 3ECBA 5CILH 4NQCE 1LP9B 2HLAA 1P7KA 5T3XD 5C7XH 1N3NB 3EYVB 2OP4H 2PYEB 4YO0B 3QIWC 5C0AA 4U7KA 4U33A 5K59E 1LD9B 3QUKA 4G42B 4L3ED 2BVPB 4LLYB 5BW7C 4JHBA 3LN5B 5KSAA 4UV7H 3ARFB 1MCOL 3MRQB 2QSQA 4HLJA 2VR5A 2ILLA 5HYJA 2E7LC 1I8MB 4QHLA 1T04A 2O5XL 3DLQR 3DXAB 3IDNA 4K7FA 5DEFA 2DLTA 3TT3H 5D72H 2HH0H 1GGYA 5EO0B 5JW4R 2OJEA 2XFXA 2VLRA 4W70A 4CMHB 5BRZE 4NHCL 4JAMB 1G7IA 3PDGA 1FHGA 3C09C 1WT5A 3GGWB 2EH7H 1ZLWK 3MNWA 2CLZB 1D9KD 3HMWH 3OB0K 3H6JA 4MXQD 3BPOC 1RK1A 3GMRB 5J1SC 3MRLA 1RHHA 4ZNEA 1BJ1J 5FB8B 4ZOCA 1J8HB 1JPTL 3VFNA 4PP1C 2VO5A 4PRBA 2H3NB 3F65A 5D4QA 3GRWH 5SWZB 1FYHB 1AJ7L 2AI0L 1OQXA 1Z0NA 4XWOD 4JFDE 4LCWB 5LGHL 3RWJA 4ZYKA 4PLNC 4Q74A 2QTEA 1GC1C 2XOTA 2VE6A 3D9AL 3OAZK 4LIQH 2YZ1A 1QVOB 3KPRA 5A2JH 3U6RA 3I50L 4GAFB 3TPUA 1HWGB 1L0QA 1HHJB 3TJEH 7FABH 3W0WA 4EVNB 5EN2A 4R2GB 5ALBH 1OVZA 2WBJD 1VFMA 5HI5D 5I1HH 3CAFA 1QFWL 4XAWH 3FB6A 4I9WD 1XFPA 4KKCC 1J5OH 1I1YB 3IJSB 5ERWB 1VFAA 2VN4A 3RKDC 2ZUUA 4NO5B 1KYOJ 3QP3A 4NOFA 1KLGA 4CVXB 1D5ZA 3IGAB 3UXFA 4TQEH 5BVJB 3MRHB 1DUZB 3TA3A 1T6WA 4PJBA 4AIOA 1AXTH 3LRGA 1QFUL 2Z93B 1P1ZB 1ZA3A 4U6HA 5E7BA 4AT6B 5JW3H 4UDTA 4I4WA 2NY6B 3R4DA 4F57H 4FNLH 2ESVA 1LGVA 4I3SL 3RU8L 1NCAL 1I8LA 4JO2H 4S1RL 2JCCB 1JGVL 4ERSL 3LKRA 4Q6YA 1NFDF 2HKHH 5FYLE 1FE8L 4N90E 1A1OB 5CINH 4A6YL 2QEJA 3BKCL 1UFUA 1YJDL 3IDXH 3C9NB 5GIRB 4HX1A 1A1NB 3NA9L 2G5BB 3G08A 5EOQL 5CBAA 3TBYB 4F33B 4KZDL 3FO1A 3MTRA 1CDBA 3VE0B 1EMTH 1F6AA 2XWTB 4XVSL 3WIIH 5C86A 4F9LC 3MRMB 4QXTA 4L3EE 1KCVL 3QDJA 3VXRD 3VWKD 4JHAH 4JKPL 4CW1B 2F8XC 3DGGB 5L0QB 2D9CA 3FN0L 4XWGL 1DQJB 5EBLB 1G0XA 4IHOB 5ABDE 5FYKU 1OY3B 1WFTA 3RVXC 5D1XA 3L3KA 5HI3C 1CU4H 4OF8A 1Z2KA 1MIEH 3VI4F 4I5BB 3UEZA 4DUWA 3QXUA 35C8L 4LPXA 3C09B 1X3DA 1E4KA 2UZIL 1T5XA 1OLLA 3ZE2F 2A1WL 2OL3B 1KNOB 1LO3L 1NSNL 3VRJA 3PGDB 3RL1B 1XEDA 4LVNB 1EH9A 3X14B 3B5HA 4YGAB 1QLEL 4YE4L 4LHUG 1GGBL 4QOKB 1JF6A 3C6LC 4HK0A 4HGKC 4BFBD 5CIPH 4R7DB 4JANB 4ELKB 4WO4D 4MD5A 4NDMA 5EZJA 1S9VB 3L3HB 1I9JH 2PYFA 4YH6A 2Z91B 5AAWA 3QZWB 5HBBA 4C58B 5F7MC 1KEGH 2FGZA 1GL4B 4J6RL 5D71H 1MWAB 1ZT4B 5TDPB 1KIRA 4U6TA 1HSAB 1IC5L 4RAUB 3MGTA 1GPOL 3DUSB 1EZVY 2NW2B 1WCBA 1BM3H 1IM9D 4LF3A 5TPWH 1F2XK 2DQCH 4YLQT 5M94B 1MAJA 2CD0A 3CFCL 1I3RB 3LIZL 4HKZB 4M61A 4JDZA 4WW2F 2D9QB 1F3JB 1XZ0A 4XI5D 1ACYL 4U1JB 4RISH 1K5NA 1HHGB 2BHYA 2FJGA 1RURH 1F4AA 1ZVYA 4O58L 2LFGA 5T3XL 3INUL 2VB5A 4XCYA 3CXDH 1LO2H 2VDML 2HWZL 3SGJA 5I8EB 3SCMD 1LE5A 5E5MA 1WWAX 3EJYD 4HAFA 4RWYL 4M6OL 1TPXB 4FZ8H 3RWFB 1IZKA 2AXFA 1NBVH 3AS0A 2EC9T 2BXYA 4HZAA 1NGXB 3IDUA 5JDSA 1VFBB 4P59L 1KACB 3PL6B 3MV7D 5JOFA 3MZTA 4HFUL 1S78C 3MR9A 3AY4C 5DI8B 4I8DA 2Y5TA 1IAOA 5BVPL 4PBWD 5C0JA 2FBJL 5LWYH 1FVDB 1MCEA 1LEGA 4JR9L 2F5BL 1CXFA 1ZHLA 4JRXD 1ZLUK 4AMKH 4MD0B 4R90H 1XIWA 5CJQH 2ATPB 3KLHD 1OGTB 3O3DB 2CGRH 3FN3A 1CGTA 1ZLWH 4PRHD 1IQWH 2FR4A 4DKEL 3NPSB 4G9FB 4DZBA 2YA0A 3OB0H 1ORSB 3QSKB 5D1QD 4BFIB 4RAVB 2IQ9L 4UOW0 4XT1C 4JVPA 5FYJE 4N8CL 3KHOA 4LOUD 3RVWD 3IFNH 4ZUWB 1MRFL 1C08A 4FFYL 4P5KA 4NC1C 3REVA 2HJFB 2AV1A 1HE7A 4OI9A 3QWOB 5CD3B 4I0PA 3QXAA 3VXUE 5FYLH 2A0LC 1WBZB 1YY9C 2P8PB 2CKNA 3WFDH 5KSAC 3GIVA 3VXRE 3KS0J 1MFNA 2HRLA 3ZYJA 1KLUB 2V7HB 4JFZL 4M7ZB 4GFTB 2ARJA 2QBWA 1UT9A 5E8OA 2EIEA 2YD7A 3ZDYF 3DVIA 4OZFG 4Y2OA 3UC0H 5AZ2H 3RZCA 5D1ZA 5IHUH 4L8CA 4NQEB 1V5JA 3MOAL 2G2RA 1QBAA 3OAZH 1L7IL 1ROWA 3GUTA 5MERB 3RNQB 4XCEA 4PJEA 2AJUH 1BF8A 1T0PB 1YEEL 5FFLA 2DL2A 4HS8H 4E5XA 3L7EB 2OBGA 2GK0B 4OKVB 2BOBA 1TZGL 2NYYD 2R4RL 3KYKH 4OZIE 4D3CL 3C6LB 3SGDH 3CX2A 1JTTA 5DTFA 5C3LD 1D5XB 4EIGB 1KJ2H 3CCHA 3DV4A 1W8OA 5KANI 1IEBB 3QDGB 1SBSL 1YMMD 2B5IB 4K3JH 4WW1B 2IH1B 2J8UB 5FYJU 4M3JA 5CP3A 1A47A 4ZUSA 2ZSWB 1MREH 4LLMA 2X40A 1OTTD 3U7WL 5HHQA 1G9NH 5DQDH 4M8VA 4KRLB 4J12A 3P0YH 1OPGH 1RZFH 3VI3E 1FG2A 1EBPA 3BZDA 4WJ5A 4HFWB 4UTAL 12E8L 3SGEH 1DQLL 3ARDD 4C54A 3T65B 1ETZA 3BEWA 4LHUA 1EHXA 3PWJB 1N26A 3F8UB 3OF6A 5JW4N 5KTEL 4ZSOE 2V2WB 3EKCA 3KYNB 5I30H 5C9KA 1WJ3A 4LSVL 3A6BH 5B3JF 1T2XA 4R0LA 1MFEH 4OF7A 3HI5H 5ICXB 3PGCB 5CSGA 1JCKA 4L4VA 2IJ0C 2W9DL 2DQEH 3PDDA 4Q6IA 3BHBB 4MQXD 3C2SA 3H9HB 1CTOA 2BSED 4M9PA 3FT3B 1RQ5A 4NRYA 4PJ7F 4S0SD 4WEBH 2JJTA 1M7IB 1IKFH 4JJ5A 1UM6H 3TA3C 2PYED 4HJ0C 4D0DA 2EE3A 1NDGA 2IFGA 5E5RB 1W0WB 5IBTH 4CVWA 4ESKA 5FDYA 1T5WB 2DOCA 5L7XL 4RZCB 5DQ9B 3EJZC 3VFVA 4BH8B 1YEKH 1G84A 1LDPL 1DLHB 2ZUSA 4PV9B 3VG9C 3ARFD 3FQUB 4JRXE 4U3XA 4KTEH 3EOBA 3MV9A 2V9RA 4PRHE 3BP4B 3DXAD 5MEQB 2JK5B 3LZFH 3ECBB 4GAJL 4K2UL 5INDA 4QKXB 3WNLA 2HLAB 1P7KB 1Z9OA 4FQJH 5C0AB 5T1KA 2OLDA 4J3UA 5HI4C 4LLVA 5ID0A 2BDNL 3QUKB 2CK0L 3VWJC 2X44D 5KSAB 2XZAH 2IEPA 4KVNL 1OHQA 1DBMH 4RX4A 3S7GA 3O2WL 5HYJB 4QHLB 1ZANH 4IRSA 5HHPA 3WS3A 1T04B 2GW5A 4R4ND 5KSBE 1T7WA 2HMID 3IDNB 4E9LA 1J0HA 3PP4H 3PP3H 4K7FB 5DEFB 1J8HD 3SGKC 3T4YA 2OJEB 5D1XC 2XFXB 3PNWA 2VLRB 3BXNA 3QISA 4F15C 2H45A 1G7IB 4U05A 4PJGE 4RMTA 5SWZD 3NGBC 1GSMA 5BV7L 4K8RC 1EHNA 1E4KC 4ODBD 1P84K 5FUCC 2D7NA 4F37F 1E6JL 4LCWD 3MRLB 1QOKA 3IYLW 3BZFA 3QPXL 1HYSC 1RHHB 1FYTE 1Q38A 2FZ3A 3V6OA 1B4RA 3QG6A 4H1LH 3FO9A 3VFNB 2VWEE 3UYPA 4OZFA 3S96A 4PRBB 1S7UA 1YMME 5F7EH 1NLDL 5FK9A 4BSWA 1TTGA 4ODSL 4HXBH 4R2GD 4OBSA 2OK0L 1IFHH 3OBAA 5CWSA 1OAQH 5GRXG 1DSFL 3QDMA 4NZDA 4FQ1H 4NJAL 1AE6L 2NZ9C 4JQVA 3RWJB 1E28A 2VDNH 5GS3A 1ED3A 2VE6B 4FFWD 5JNYA 3KPRB 3C8DA 1YMHA 4YFDB 4OZGA 3U6RB 4FQPA 3X3FH 3TPUB 4MAYC 4Y5YA 4AEHL 4OB5H 3W0WB 5DJXA 4OCXL 4QGYA 4OIIH 5IW6A 1Y6MR 4YX2H 3FB6B 2NY6D 4IRZH 3VXTA 1VFAB 3U0WL 2YPVL 4IRJA 4KROC 5TF1H 1I9RL 5GPRA 5F9OH 4P4KA 3FRPA 4NP4H 2DQDH 4Z7NE 4NZRL 3RX7A 2O93L 2PTVA 1KLGB 1KXTB 4M7JH 4WWKC 5F9JA 1FZOA 1D5ZB 5CS7A 4HXAL 4FQ2H 3DTXA 1CLYH 5DVOA 4RIRA 2EDKA 2UZXB 1IGYA 4JLRB 3TA3B 4PJBB 1IC7L 3WDHA 3TZVA 3A67L 1ZA3B 1WISA 4U6HB 3MPCA 4UDTB 3V5KB 4I4WB 4J3WA 1EUTA 5E2UL 3TH3T 4DGYH 2ESVB 3O6LL 3VG9B 3TN0C 3ZE0F 2R0LH 3LKRB 2E8ZA 2VZUA 5I74C 4JHWH 3UAJC 4LASH 1X5KA 3EDFA 3SGEI 3TC9A 3WYRA 1XIWC 3NZ8A 1UKSA 4YEEA 2Q8AL 1I9IL 2WW8A 1MCKA 4W6YB 4HX1B 5J56B 2ED8A 2ZPKL 3BPNC 3MRJA 4J3SA 1H3WM 3DXAE 1T7ZA 3G08B 3T1WA 5CBAB 5EUKA 3ZKMD 5HDBF 1AGBA 4JVWA 4RRPA 3FO1B 4H88L 3Q1SH 1Q72H 1DL7L 2BCKB 3HZMB 1F6AB 4NKMA 4I77L 1JYXA 3QNYA 1CLZH 4OLZL 4QXTB 2APVA 4PRIE 5C6TL 3I9GH 3QDJB 4N0UB 1F02I 3ROOA 2YPLE 2RCSH 4TTGA 1WZ1L 1VB9A 4NO2A 1YPZE 2ZNWA 1F58L 3T0EA 4R26L 3MJ9A 5IQ7L 5K9KA 4M7LL 1MCSA 2N1KA 5D1XB 3L3KB 3NCYS 2OXHA 4F15B 1UWGL 4KI5E 4PJXF 4NUGL 1J8HE 5D7KD 4QOKD 3MUHL 2F54A 3RZCC 2XYCA 3SDAC 3NGBB 4M5ZL 3RIAK 4LDEB 1NAML 5JXAH 5F96H 1TZHA 4GRMA 1T5XB 3CDCA 4XMPH 4KKBD 7CGTA 3VRJB 1MF2L 1UM5H 2XRAH 1HZHH 4K3EL 4P2OA 2IANE 5A40E 5C1MB 1P6FA 2AJZA 2YMXH 4HK0B 1F8TH 3D39A 2PR4H 4K71C 4MD5B 4DAGH 5HTSA 4LQFL 5EZJB 3AFLA 1CS6A 3DI3B 4H0GA 2PYFB 5J1AA 5IFJA 4H8WC 4KKCD 4RGMC 4ACPA 2DQGL 1U58A 2P5WB 4KMQA 2MFNA 4KJPD 4UV4H 4CDGC 1CR9H 3AMLA 1KIRB 4BZ2L 4U1IA 2PKDA 4KK5D 3LPGA 3MGTB 2JKXA 2BXZA 1P5VA 3BKJH 4R4FH 5BV7C 5I1EH 5L88L 3PXHA 1WCBB 4LF3B 5IESH 1P4BH 5GGSY 4PGCA 4JO4L 1ZSDB 3GI8H 1BWMA 4M61B 2LTQB 4JDZB 4OCYL 1O0VA 1XZ0B 2AEQH 2WMPA 4GKSA 4WFGD 3PL6D 5SX4H 1K5NB 2YD5A 4KROB 2FJGB 4K3GA 2DLIA 3GBNH 2P8LA 1YN6A 4R0LC 1U8QA 4XCYB 2E7BA 2GKIA 1LE5B 1DVFA 5E5MB 2FHCA 4YUEH 2FGWH 2DWDA 2NY7H 4ENED 4L1HA 3S34L 1B4JH 4BQ9A 2X1QA 4NN6C 4L4TA 5DUMH 3SY0A 2XT1B 2AXFB 4G9FD 3J7HA 4P2RE 2QQNL 4D94A 5ESAA 5JDSB 3HAEH 2JJTC 3F5WA 1YEIH 3QUMH 3TBSA 1RPQA 2BSTA 5JOFB 3MR9B 5F1KC 5I1KL 4WGWB 5EU3A 3DSFH 2Y5TB 1IAOB 5C0JB 2R2CA 4KRMB 3IAQA 1LEGB 5F1IA 1WEJH 1ZHLB 1XIWB 1NCCH 1I7UA 5LGJA 4B7LA 2FR4B 5LCVH 2K7QA 3RVXD 4DZBB 1CCZA 5HI3D 3ME0A 5J13C 4KAQH 2J3SA 1RUPH 4NQED 1C08B 1Y18A 4P5KB 3REVB 2AV1B 5LQBH 1YEJH 2WINA 4I0PB 3V5DA 2VLMD 2ZOKA 3QXAB 4JM2F 5GRJH 2FH6A 4FABL 5CEYA 4GSDH 1CL7L 3RBGA 3GIVB 2ZNXA 2EDXA 2WQRA 4YHML 3ZL4H 2VDPH 2ARJB 1WZMA 2Y25A 5E8OB 3FO2A 1I3GL 3BD4A 3NFSL 3AAZA 3C6LD 4P46C 1CDYA 3DUUA 4NPYA 5D1ZB 3RZCB 2R4SL 1SVZA 3RDTC 3WJLA 4EOWH 2F19L 4L8CB 5HGBA 1NUGA 2G2RB 3IS1X 5EIQA 1TENA 4QOKE 1LO0H 4K3HA 3ZYZA 5L9DH 1UZ6F 4LCUA 2O5YL 3QDGD 4Z0XA 3GUTB 3W2DL 4G3YL 4XCEB 4X9HA 4GS7C 4LAJH 4PJEB 2FX8H 4TUKL 3H3KA 1KEMH 4TTDC 4E5XB 1F5WA 2DMCA 1JNLL 1FO0A 1I7TA 4NGHL 1FGVH 3MJGX 4YEFA 3LMJH 1JPGA 5DTFB 1QFOA 3BH8A 3HUJA 2XV6B 2YK1L 5AZEL 3V6OC 3CCHB 3DV4B 3HLAA 2VDLH 1ZLVK 2DL9A 3SKJH 4BFEA 3RGVA 3CFEB 4ZUSB 1S7SA 4AENA 4LLMB 3LKNB 2W07A 2L7UA 5FGCB 5HHQB 4WRLA 2FWOA 1JPSL 1FG2B 4XPGL 4NBZB 4WJ5B 2DM2A 3EOYG 5I6XC 1LO5A 1FAIL 3BVNA 4OFDA 3WE6A 3GO1L 4MJ2A 4ZFOA 1NUDA 4OTXH 2CIIA 1ETZB 3BEWB 4LHUB 4YPGA 4LSSL 5D6DA 4O4YL 1CICA 4Y5YC 2VLKB 5JORA 1XGYH 1N59A 5IB5A 5K9QG 4R0LB 1S7TA 4DN3L 3NTCH 1EJOL 4NZTL 5E08L 5DSCB 4R4BA 4IRJC 3UBXI 4P4KC 4Q6IB 3NACH 4NRYB 4PJ9A 1RZ7H 3O8XC 4G9FE 4MXWH 2NTFA 2LU7A 3MA9L 4JJ5B 5C0AD 3TZVC 4D0DB 5KVMC 1A4JA 4CU7A 1Q9LA 3P3YA 1E4WH 3VFVB 3ZDXE 2AQ2A 4ODVH 5KSAD 3S3JA 4QCIA 3VFTA 3GDBA 5EUOA 1CDHA 5HYJD 4PUBH 3WFCH 3EOBB 1FLTX 4WV1A 5IMOA 5C0RL 4UMGA 5J13B 3MV9B 1MQKH 5INDB 1GOGA 3RIFF 4QNPF 1J05A 5T1KB 4PGEA 2VLRD 4QGTA 4LLVB 5A2LH 5ID0B 3MRIA 4NQEE 5F9WC 2NY1C 5SX4I 2FX9L 1QLFA 3L1OH 4CNIA 4NKOA 2MSPA 3PGFH 1MCNA 2VLME 1C7TA 1UM4H 4S1SH 5DJDA 5FCUH 4FQLH 5EOCJ 1K3IA 1BIIA 1ITCA 4DVRH 5E03A 4DGVL 1S9WA 3RVVC 1BD2A 3VRLE 4IRSB 3LH2H 5HHPB 3WS3B 4ODXA 1MRCH 1YYLL 2GY7B 1CFQA 4GO6B 3T4YB 3PNWB 3MBXH 3BXNB 4Z7UA 3VMNA 1A6TA 1OAUL 4ODTH 4F8QA 4LSUH 4JQIH 4GS7B 1EERB 1I1CA 3K2UH 2OL3H 1WK0A 2FYYA 4XB8A 5JXEC 2YD6A 4KI1A 2J8UE 3O2DH 2I07A 1T80A 2VXQH 4OQTH 5C09A 3SDCC 3F7PC 4HPOL 3QHZH 3BZFB 4Y4HB 2FZ3B 4I1NB 1YNKL 4KRPB 1A0QL 2X4SA 3FO9B 3KPRD 3QG6B 3I02A 4OZFB 4RMSA 3S96B 4BA8A 4ONGH 4ZTPH 1S7UB 4LGRB 4D9RD 2XWBA 5FK9B 3W0WD 4X9IA 4BSWB 4TULH 5T1MA 5CWSB 3CSYA 3QDMB 1AO7E 3DX8A 4FS0A 5MHSE 4OM0H 1E28B 1R3HA 4PREA 1MWAH 1N64L 1ED3B 1F4WH 1RZKL 5I6XB 3EO9L 1BFVL 1JGUL 4UTBH 2ZCLL 1J18A 1N7ML 5JNYB 1ZA6A 4HW6A 5HXMA 4OZGB 2EDRA 3B6SA 4Y5YB 3JWDC 5HHXL 4NBXB 3TCXA 3B8SA 5T3ZL 4OF6A 2DQUL 1XGPA 5DJXB 3VMOA 3TA3D 2H32H 1MCQA 3UP1A 5IJKA 2ITCA 4JM4H 5IW6B 2C5DC 3WSQL 4C59B 1J9CT 1OAZH 1PKQB 4Z77A 2QQLH 1E4XL 3IT8D 3MXVH 5D7SL 5FECA 4D9LH 3NAAH 1IEAA 3VXTB 2J5LC 2YRZA 3HZKA 4X7EC 4ALAL 1AGCA 1ZT1A 2ESVD 2QSCH 4CGTA 4XNQB 4IRJB 2A6DA 1IKNA 4P4KB 2P43B 4WCYL 5J11B 3JV6A 4O9HL 4ONFH 5E24E 1FZOB 3U4AA 1I1RA 1FZJA 4APQA 2NXZC 4TNVK 1NCTA 5GISL 1NANI 4RIRB 3HS0A 1IGYB 3U4EA 2BRRL 5IFHL 1WWWX 3TZVB 4FA8A 4FHBD 3MLWH 1QEWA 1B6DA 5DK0A 5C0AE 1BEYH 4D0CA 4NC1E 4FZEL 4G5ZH 1HXYA 4RGNC 2HFEA 4TOYL 3NMEA 1Z5LA 5A3ID 2EYTA 3QDJD 4JKMA 3RJDA 4CU6A 4XPAH 2YA2A 3NZ8B 5HYJE 2I60H 3E0GA 3KYMA 2FO1A 4G7VH 1MCPH 1MY5A 4XVTH 5IR1A 1N5AA 3FQWA 3MRJB 3JWOL 5D1XD 4P3WA 5EUKB 3KS0H 2YD4A 1AGBB 4LRIA 3ZDZE 3PV7A 2XQYG 4NKMB 1FLRH 3T3PE 3GZKA 3QNYB 4EDWH 4K8RD 2ARJQ 1VADA 5JR1L 3JVGA 4EDXA 3ROOB 3QHFL 4NO2B 2P24A 4D0BA 3LQMA 1HYSD 4AG4L 3ABZA 3LDBB 3CDYA 2VDKH 3T0EB 3V0AC 4LKCA 1I85A 6FABH 2NZIA 5K9JL 4NNPL 3FB8B 3O6MH 4WENB 1XCQA 4XCFH 4ZNEE 3WHE0 43C9A 2F54B 4LCCC 5DD6A 5JQHC 3MNZA 4ODWA 5D7LE 5KSVA 5GJTH 1TZHB 2WQ8A 4GRMB 3VXSA 3K3QA 4MVBC 2P5WD 4X6DF 4P2OB 2R9HD 3F7RA 3OMZA 3CMOL 5JQ6H 1BX2A 1DE4A 3KPRE 3WNKA 3BDYL 4UIKH 2IGFL 4R96A 3D39B 4NZUH 1IJ9A 3VG0L 4HJGA 4KQ4H 3UZEA 4UDUA 3W0WE 5J1AB 1S8DA 3OZ9H 3LHPL 4Z8FL 4HT1H 3RGVC 1UA6L 1ZHBA 3MLZL 4KMTH 4KROD 5AWNH 3WLWC 4LMQE 1IGCL 1A7OH 4YDIL 5FHAL 2QJDA 2XG5A 3C60A 4U1IB 4IOIA 4F7TA 4MJ6A 1OAKL 3PDOA 3KXFA 2AV7A 4YDKL 2Q8BH 4FMKA 3VD5A 4PGCB 3BMWA 3ZT5A 5D6DC 4JFQA 4LAQH 4PJBE 1CICC 4XXDA 4L8DA 4NQVA 4GKSB 3OQ3B 1JZ8A 4FQQA 3SKNB 2P8LB 1YN6B 5I1IH 2ESVE 4Z7WF 1U8QB 3MJ8B 2X9YA 1DVFB 1XIWD 3O6KH 4I3RH 4J3XA 4P4RA 2NXZB 2Z92A 5B38G 4L4TB 5IVZA 3SY0B 3S36X 1EO8L 3F58L 4HWEH 4QY8A 1KIUA 1KB5L 3BP5A 4PJ9C 5GGSA 1IBGH 2B0SL 2WM0A 4U3CA 5ESAB 5J3HC 4RGNB 5DGRA 3F5WB 5EU5A 3TBSB 2BSTB 1MJJA 1ADQL 4LPTA 2VXTL 5EU3B 1PG7X 1TNNA 4H0IA 4I0PD 2A2QT 2APWA 1XR8A 1HH9A 3ULVF 5F1IB 3QDJE 2EO9A 2VLJA 3GIZL 1I7UB 3QIUC 4XNZC 5LGJB 3FZUC 3R1GH 4IJ3C 1YNTA 1QPXA 2CO7B 3QAZC 3RHWF 4U6XA 3BIKA 4W4OC 4OF0A 3RZCD 5D1ZD 5C6WH 1ZHKA 5KZCB 4DKDC 1CG9A 1Y18B 4NHUA 2WINB 3V5DB 2ZOKB 1GJIA 1DP0A 5CEYB 5GRWA 1BFOA 4NRXA 5DHVB 3V0WH 2E7HA 1A14L 5FUCE 3RY5A 1Y6NR 3UO1H 4LGPB 1EEZA 3FO2B 2RR3A 3ZKNC 1NH6A 1NCDL 3AAZB 3EYQC 4P99A 4NPYB 1F3RB 5GZND 5HGBB 5TH2A 2LU3A 4GKOA 4X8JA 4UT6H 4X5LA 4LCUB 4Z0XB 4JY5H 3MLXL 4IOSD 2P8MA 2VABA 3FB7A 2CMRH 3JWOC 2GQHA 3EHBC 5ID1A 1F4HA 1OP3K 5GS1A 1BZ9A 5F7NC 1FO0B 1I7TB 3KYAA 3FAWA 1K8IA 4U0RB 1MFDL 1JPGB 5C92A 4QRRA 3BRGC 1IGMH 3BH8B 3HUJB 4LKXA 4KU1A 4LHUD 3E6HB 5DWUL 4KDVA 2CIKA 4M1CD 4JRWA 2VLKD 3T08A 1JTOA 4DEPC 3RGVB 5F7LB 4AENB 1OAXH 3ARYA 2FWOB 3WFZA 3N1QC 1E4XI 2Q20A 3IKKA 2R0KH 2UZIH 3HG1A 3ES6A 3WNNA 3BN9D 4XBEH 1LO5B 3BVNB 3H42H 3WE6B 2DICA 4G8FA 4NFDA 4ZFOB 4X0KA 1F90H 1FVEA 3CH1B 1DQQA 1CVRA 2OZ4A 5A2FA 1CICB 2DTMH 1QG3A 3TIEA 4Z76A 4S1QL 3F12A 1Q9WB 4EKXA 1N59B 5IB5B 1L6ZA 5IJKC 4UQ3A 4ZOBA 4Z7VA 1S7TB 5DLML 2X2YA 4NN5C 4R4BB 3T1FA 1T83A 1IKNC 1KTRL 1U8HA 5MEOA 2AJVL 2DB8A 2XN9A 1INQA 1EHAA 4MMXC 3MV9D 4PJ9B 4ZS6C 1D6VH 3E2HB 4N8VG 4BKLA 4APQC 1J1XL 4LEOA 2NTFB 5T1KD 2OSLA 3P30H 4FQIL 5E4IA 1A4JB 1C1EL 2BFVL 3LKPA 1MAKA 1FCGA 3DECA 4JKLA 1Q9LB 1NL0L 5D2LB 5KW9H 1AQKL 3DARA 1N4XL 3MUZ1 1NFDA 3MXWL 4H5SA 5KOMC 4QCIB 2GT9B 3S98A 4CMMA 4RX4D 3VFTB 4IJ3B 3KNBA 5EUOB 1GGIL 3UTTA 4UBDC 4WV1B 4IRSD 5IMOB 3MOBL 2GTZA 3IF1A 5TF0A 5E8NA 5D96C 2X4NA 3Q48A 2IPUK 3GJFA 1J05B 2JELH 4ELMF 4PGEB 2D7TH 2NY2C 3MCLH 3DRQA 3MRIB 4LRIC 3NVQA 5BMFH 1QLFB 4CNIB 5FGBA 4NKOB 4L9LC 5DJDB 3MRNA 2FX7H 5FO8A 3NABH 2VKWA 1LO4H 5E6IA 1BIIB 4PJEE 1MCCA 5SWQA 1S9WB 4AQ1B 3JVGC 5B22A 5KVDH 1WGOA 2Q3ZA 4HWNA 4D8PA 4ODXB 5DQJA 4Y4HD 5DRWA 1MHHA 1KCSL 5DFWH 1CFQB 3VFPA 4JR9H 1WCQA 2ZJSL 4KRPD 2EIBA 2OI9C 4PYGA 4Z7UB 4U2YA 1A6TB 1AI1H 4K8RH 25C8H 5DD5L 4X4XA 2AJSH 4W4NA 1UXSA 4MSWA 3D25B 1AP2A 2FYYB 2BVOA 1NC2A 3L9RA 2I07B 1MFAH 2L0DA 3SN6N 1MLCA 1MPAL 2VISA 4JZOA 3TLRA 3QDMD 5C09B 3CUPA 3RAJH 1N6QL 2B8OT 1G7MA 3R0MA 3V6FA 2VQ1A 2X4SB 2FEDC 4LPUA 4NM4H 3I02B 3L95A 5A2IH 1WZKA 3QQ4A 2A77L 1U8LA 1RIVH 4DEPB 1A6WH 2XWBB 4M1DL 1MCRA 5T1MB 2D2OA 2GJJA 3CSYB 3DX8B 2ZCKL 1R3HB 4PREB 1UG9A 4IRJD 1YEFL 4P4KD 1B90A 3VD3A 1ZA6B 1QZ1A 3KVQA 4L4VE 3B6SB 2EXYC 4FMFA 2DLGA 4K7PX 2VXUH 5E9DA 5H35A 1BIHA 1XGPB 4P9HL 4PJ5A 2NY4B 3TZVD 2ITCB 4WW2A 1JHKL 4QTHA 3RTQA 5HY9A 4Z77B 5JUEH 5T1DL 5FECB 1QNZH 1IEAB 3HZKB 5E5UB 1AGCB 1SBSH 1L4IA 3E8UH 2A6DB 5C0ND 5E95B 3UYOD 1PLGH 4M48L 1GGTA 3JV6B 2MCG1 2Z9TA 5E2TL 3TYFA 1CIDA 1FZJB 1TCMA 4APQB 1U8OA 3HS0B 3CX5K 3MV9E 3U4EB 3O0RH 3TO4A 1QEWB 5DK0B 5AAMA 2XZCH 1UEMA 1HXYB 1NLBH 4PB0L 2NR6C 1XR9A 2HFEB 2APXA 1Z5LB 1J88A 2EYTB 3MRCA 4LSDA 3L5WA 1IAIH 1W72L 2FATH 5J4MA 2B39A 5D96B 3BE1L 3KYMB 3MRKA 3T0ED 2C7UA 1DQML 2QQKL 5IR1B 3V52H 1N5AB 3FQWB 5GGQL 2R56L 1OP3H 2VN7A 3EOAA 2W9DH 2F54D 3WDIA 4OIBA 3EOTH 1TJIH 4X83A 4GG6B 2Y9RT 1QBLH 1VADB 4XP5L 4EDXB 2AK1H 3D48R 3T0AA 2P24B 3Q3GB 4D0BB 3S37H 4XPHL 4HBCH 4P2OD 5ADPH 4KPHL 3G5YA 1FNLA 4FXKA 1XCQB 43C9B 1FNFA 5BS0A 2D3VA 1N6VA 3V6OE 3R8BB 1E4JA 4Z18A 2QADC 5DD6B 4GMTH 3D39D 3MNZB 4G6JL 3FFCA 1RI8A 4ODWB 3O2VL 5KSVB 4OCWL 2C1PA 3HNVL 4PJ8C 4LCIH 3VXSB 1B2WH 2DI9A 2EE9A 3F7VA 3QDME 2FJHA 4OJFH 5E2VH 3U0TA 3BPCA 4MCZA 1BX2B 1DR9A 1DE4B 5J12C 1FNSL 4NFBA 1CGYA 1PYWA 1WBXA 4HUKB 5J6HA 3W81A 4OZGE 1GAFH 5IBLD 4H8WH 4HJGB 3SJVA 4CU8A 5CP3H 4UDUB 1S8DB 2A6JB 3MLYH 4FQHA 4KFZC 4JRYA 1ZHBB 2DKSA 3IVKA 2V2TB 2GK2A 4FQCL 4FXLA 5EOCL 3LEYL 4LLUA 3C60B 3SE9L 1A7RH 1DVFD 4F7TB 4MJ6B 4OF3A 3PDOB 3KXFB 2AV7B 2BNUB 2DQJH 5FKAA 3D69A 1U0QA 3U46A 1FFNA 2B2XH 2NXZD 4L4TD 1QBML 2NY5L 5IG7A 5CEXA 2B4CC 4JFQB 2J6EA 3MFFA 4O5LH 4HZLA 5MP6L 1T03H 3UTPD 2QHLA 4WFHD 4XXDB 2CO6B 3AU1B 5BXFA 3NH7H 4L8DB 5BRZA 5DUPL 4NQVB 4RGND 3WFEL 5JO5A 4FQQB 5L6YL 1S3KH 3QRFM 1R5IA 1KOAA 2CDEA 4UOJA 3JV0A 3HE7C 1RUMH 3AUVA 2G75A 3OG4B 4P3CL 4PJIF 2XA3A 4R7NA 5GRUH 1YYMH 1KYOK 3AS3A 4P4RB 3SEPA 2Z92B 3KWWA 5IVZB 4L8SA 3GHBH 4PJ7A 3MLVL 4K07A 1CT8A 4QY8B 4ZS7H 5HYSG 4R9HA 1G7LA 1PX3A 5GGSB 4Q97A 5E2WH 5DHYA 3SKUD 1CVSC 2CH8A 4M00A 1KFAL 5KZCD 4OIAA 5EU5B 3DETD 1MJJB 4UUJA 3DYPA 3QR2A 1XR8B 1HH9B 3DPBA 3KAAA 2VLJB 4JFDA 3TVMC 4JB9H 3DVGA 1UH3A 1X5XA 1IZJA 4ISVB 3BSZL 3K1KC 1LQSR 2BNQA 1CZ8H 1YNTB 4GMSH 3T0EE 3AXLA 3IFOA 3K74B 2MNUA 3IFLL 3OAUL 4U6XB 3BIKB 3W9EA 1T2QH 1ZHKB 1CG9B 2C3VA 3HNSH 3E3QC 1C5BL 4M6MH 4HXAH 4NHUB 2F54E 4PJDF 1KCRH 4OLYL 3W39B 5JZ7C 1IGFH 4OZ4A 5FGBC 1BFOB 2W60A 3LKSA 2R69H 1HI6A 4NRXB 4CN6A 4MVBD 3W9DA 4HCRL 1MHEA 2JJSA 3PWPA 1K3ZA 2N7BA 3G6JF 1EEZB 4NOBA 3L5IA 3BZEA 2XZQH 4ZO6A 2QADB 5D5MF 3SKMA 4AEIH 5TH2B 2VSCA 4NO3A 3RPIA 2YRLA 3KPSA 4X8JB 4WI4A 1MJ7L 4OF5A 1AR2A 1CGWA 3B9EA 5JMRA 3D39E 1E0OB 3FMGL 3JTSA 2P8MB 2VABB 2WUBH 3RGVD 2WIMA 2GUOA 5AYUL 3FB7B 3F7YA 2JLLA 2KZWA 4GT7A 5ID1B 1L9NA 3WLWD 3S36L 3MYZA 5GS1B 1BZ9B 4LRNH 4XPBH 4H20H 3SDYL 4YHLL 4PJFB 1I7ZA 4XP1L 1K8IB 3QEHA 2IAMC 1A7PL 4XBPA 4QRRB 4Y8AA 2EDFA 1WZ1H 4LKXB 3LD8C 4WU5A 3K8KA 4DZ8A 1K6QH 4MDIA 2CIKB 2CUMA 1CICD 4H1LG 2BNRA 3PJSA 1DBKL 5EPMA 5KS9F 2IWGA 1FFPA 1KC5H 1KPVA 5H94A 1AY1H 4OD1L 4X6CF 2V7NB 1FPTL 3TNMA 5LVEA 5GGVH 3HG1B 3ES6B 3HTLX 2D31A 3OXRA 3HFML 1FV1A 4G8FB 2D7OA 3RQ3A 4WUKL 5ADOH 1DQQB 3CVHA 3HMXA 4PJ9D 3JZ7A 4HWZA 3TIEB 4M8QA 4ONHA 1OM3L 1H3UA 1UWEL 4PFEA 4WFHE 4NWUL 4RA0C 4UQ3B 4WW2C 3RTQC 2JJUA 2FJFA 4RGNE 4X9BA 2VZSA 4Z7VB 2DTSA 5IGXH 2WP3T 2Q6WA 4OGYL 4Y4KC 4XNYH 3SO3C 1RIHL 3T1FB 1U8HB 2R1XA 5HGDA 5MEOB 4V2BA 2XN9B 4U1LA 3UX9B 1INQB 2X05A 2WBWB 5F6HJ 2EDQA 4BKLB 1RVFH 1HOCA 4LEOB 3SDXE 4HIXH 1T6VN 1MRDH 2OSLB 1NUFA 4U1HA 3QCUL 1N2RA 3TO4C 3LKPB 2CRYA 2BRQA 4POUB 5DT1H 5F3HA 3FTGA 2IPTL 2H2SC 4WY7H 4J8RA 3ZT7A 2MPAH 1NFDB 4H5SB 1INDH 2NY5C 3NZHL 3ARBA 4CMMB 1EGJL 2ZUQB 3KNBB 4TVSa 3UTTB 1DBAL 1FGNL 3RVUC 3QG7H 4HKJA 4U3HA 3BQUA 3ZKND 1OL0A 2GTZB 3IF1B 4OFYA 1QQDA 3ALXA 5E8NB 3GJFB 2X5PA 1UXWA 3QQ9D 5HYSA 4IOFD 3DRQB 4B5EA 5SX5K 2I5YH 4NCC2 4UINH 5ACZA 1IL1A 3LS4L 1GHFH 3QDHA 1C8PA 3O4OC 4WI5A 3RJQB 1F4XH 3MRNB 4F7PA 6CGTA 5FO8B 2A83A 2YHGA 5E6IB 3MNVA 2VZVA 5BOZG 3EHBD 3SE4C 1NCUA 5SWQB 1ZEAL 5IM7A 3KDMB 1A3LL 4TVPD 5C09D 1A3QA 1Q9KA 3MJ9H 4KTDL 4WTWA 2DQIL 5DQJB 4D8PB 4MJ4A 1FL3A 5DRWB 1MHHB 5DO2C 3VFPB 1OSPL 2VDRL 5I17A 4KJWD 4CBPA 3HUJE 3AS2A 1M71A 4TSCL 1MEXH 4X4XB 1TJGH 3CZJA 1AC0A 1UXSB 4MSWB 1AP2B 4U1GC 1FC1A 2BVOB 1NC2B 3L9RB 1FVCA 4LSQL 3S5LG 5F7KC 4XMLH 1MLCB 2VISB 4JPVH 5GJSH 5I8OL 3SHSA 3BRFA 2IMMA 3QUZC 5IT2L 5DJCA 3NCFB 4HS6A 5CEZD 3LD8B 3V6FB 2VQ1B 3H3BC 3B5GA 1RZJC 3L95B 3RY6A 1SEQL 3QQ4B 1U8LB 1N8ZA 2V9QA 1I9EA 4HUUA 2WUCH 3NIDE 4LGSB 5GRVL 2NY4D 5DR5H 5I76A 3I2CH 4CUCA 3OKKA 2R8SL 4U49A 3MLRH 2DLFL 1EBAA 1Q0YH 4S1DC 5FM4A 4CRPA 4HD9A 3GSOA 5INCA 1S7RA 4HLZH 2FIKA 4HC1A 4WHDA 2KL6A 5SWSA 3JWDH 1BP3B 3DOSA 4Q2ZA 4KV5E 3MACL 2E27L 4O02L 4G6MH 5E9DB 4APQD 2YOCA 3QCVL 3S8WA 5H35B 4JPWH 4PJ5B 1NEZA 4WW2B 4QTHB 4LARL 3RTQB 3GFUA 5KAQG 5LG1A 5HY9B 1MCDA 1XH3A 5KAQF 3S35X 2EC9U 3WNMA 3SKOA 3IDMA 3V2AR 3C08L 3ULUL 4KGJA 1UKTA 4XAKE 1C5CH 2JB5L 2AJYH 1ZLSH 3VGEA 3DWTA 2MWCA 5EUOE 1UYWH 1U8OB 4OZIA 4L8SC 3NIFE 1WF5A 3TO4B 2ATKA 3ILPA 1UCTA 4EI5C 5JOPE 3C5ZA 4FP8L 4QEGA 4JREC 4UB0H 1JRHH 5FUZL 2HVKA 3L5XH 3HAEG 3MRCB 3LKQA 3L5WB 3EYUL 4HULB 4WEMB 1BD2E 1KCKA 3MRKB 2C7UB 1HXMB 5JIHA 1EJOH 3QJHA 1MUJA 2YUZA 3BGAA 3EOAB 4N8VB 1B0RA 5IW3A 4O00A 4Z7UE 4JFXA 4KKLD 1OGAE 5CP7A 2RQ8A 3V4UL 4JM2A 5D8JH 2R0ZH 3C2AH 1OP9A 1EA9C 43CAA 1INEH 1LP9F 4XC3L 3UTQA 4K9EH 3VXSD 1GIGH 1OD7A 3TFKD 2WWMD 1M6OA 5C09E 3G5YB 3LOWA 4JQXA 5I8CA 4FXKB 1SYVA 3BAEL 2FEDD 5BS0B 4K3DL 1KF9B 1A7NL 4F58H 1KB9J 4DTGH 3ESUF 3WIHA 3FFCB 1U3HC 4MMZC 2C1PB 2NY3B 4DCQA 3F7VB 1FO0H 3BGFC 5TFSL 3LCYA 3M8OL 2FJHB 2MMXA 4IM8A 4EN3A 1KXQE 1YEHH 5FXCH 5IROA 3U0TB 1HWHB 3BPCB 4MCZB 4LSRH 5BO1L 3C60D 3OR7A 1PYWB 1WBXB 4DGVH 3KXFD 5J6HB 3ZTJH 4IS6A 5F1SA 1SY6A 3LB6C 1RZ8A 3IB4A 3L3OA 1YQVL 3SJVB 2MKLC 3B9AA 3RVTD 3C5JA 4IDJH 4FQHB 4JFOA 4JRYB 4LSPL 5C07A 3A6CH 3WLBA 1V7NH 1VDGA 3S5LA 3IVKB 1F6LL 1RUQH 4LLUB 3IXTA 1DLFH 3HC4H 1A2YA 5IVXA 1DBBL 1QSZA 3PE9A 5FKAB 1PAMA 2DKUA 3D69B 3Q6GH 1FFNB 3U46B 5KSBA 4OD3H 5HJ3B 2GITA 5IG7B 4O2CA 5CEXB 1VKXB 1MJ8H 1NKOA 3MFFB 1KN2L 4HZLB 3IFPA 1YNKH 1CLCA 3V7MA 5BXFB 2C3WA 5BRZB 2NR6D 5JO5B 3BX7C 3T2QA 4Z7OF 3BT2L 2K7PA 4EIZC 2CDEB 1JFQH 1FORL 1TVHB 2VXSH 3I6LD 2G75B 3V4VH 5SX5H 4R7NB 5F9AC 4M7KH 3SDDA 1HNFA 3VGBA 1SM3H 5H37H 2VLJD 4OD2A 3KWWB 5DFTA 2VXVH 1HIML 1QBBA 4YK4C 3O6FA 4PJ7B 3RX8A 1CT8B 3BISA 1G7LB 5DHYB 4TSBH 4HIHA 4BYHA 5I1CH 1MHPL 4HK3J 1G7HA 2VERN 4UUJB 5I9QC 3HE6C 1JGEA 3NCEB 2VDOL 4JCMA 5EORH 4ZO7A 4PV8A 5IK3A 4J4PC 4JFDB 3VA6A 3BKYH 3DVGB 5TQ2H 4AIZA 2BNQB 4ZXBA 2Y72A 1DN0A 3AXLB 3IFOB 4XVUD 5A16A 4OT1L 2JCCF 4CADA 5EWIL 3W9EB 1LE9A 5B8CA 3N0PB 2QADD 4J1UA 2C3VB 2FNBA 4BK5A 2DQTH 1JPFA 1NMBL 2JF1A 2ZOLA 2W60B 3WKMH 3LKSB 1HI6B 4QXGH 3QDAA 3W9DB 1MHEB 3VXSE 4KKNA 4AZ8A 4Y8DC 3PWPB 3WD5H 2JJVA 4AY0A 1M05A 2ZZUT 4MA3A 5IIEA 3BZEB 3KR3L 4HPYL 3UZVB 4XC1L 3VH8A 4QRRD 3SKMB 5CUSH 4NO3B 3RPIB 2OX5A 3KPSB 3W11D 3MSPA 4H25A 3MODL 2APFA 4GOSA 3JTSB 1RU9L 4XVJL 1JRHI 2GUOB 3P2TA 4JFHD 1J1OL 3F7YB 4TVPH 3BGFB 4G6FB 1P4IL 3Q6FA 2FD6H 1WAAA 1KN4L 2ADFL 1J11A 1I7ZB 3QEHB 1H0DA 4PJCE 1P9MA 1QR4A 4MA1B 3O3UN 4XBPB 3HG1D 5GGTL 1R0AH 2QHRH 1BVZA 3KXFE 4DZ8B 1M1SA 4PG9A 4MDIB 4OM1L 1P4LA 3RY6C 2XA8H 2BNRB 4PD4K 4QXWA 3PJSB 5IF0B 5EPMB 1FFPB 5IUSA 1BJ8A 4GLRH 1KPVB 1UJ3A 5H94B 4X6EA 4KVCH 2WK2A 3T04D 3QCTH 3KPMA 4X5WA 5CEZH 3TNMB 4X80L 5I1GL 4X7SL 2D31B 2YPLA 3OXRB 3V7AE 5JA8B 3V5HA 1FV1B 2CKBL 3MOQA 4GXVL 1IT9H 1YPZA 4OSUL 2XN9D 3P73A 1RFDL 5DJ6A 3CVHB 4PRAA 4R97C 5EU7C 2FSEA 1BQLH 4HWZB 4M8QB 1Z0MA 4ONHB 2OYPA 5CJBA 2YBRB 1HH6A 1IGIL 3SPVB 2Q6WB 1H5BA 3EYFA 2YD3A 1JI2A 3I6LE 4NC0B 1IGTA 2R1XB 5HGDB 4NT6A 2UVFA 1KPUA 2DM4A 3OTTA 4YK4B 4FTVA 4U1LB 3UTTD 2VLJE 1MVUA 2X09A 1KELH 1RUAH 4UOW1 4AL8L 1CK0L 2IANA 1F3DH 2J7LA 3LEVH 5D7JA 1T2JA 1HOCB 1U95A 3AREA 5EZIL 4U1HB 1N2RB 3N85L 1JGLH 2HFGH 3LQAH 1ZTXL 1Q1JH 2FIRT 5F3HB 2GYSA 3FTGB 2AGJH 4J8RB 5E6ID 3ARBB 1KIQA 1SJHA 4JN1L 4ZAKA 3QRGL 5E4EB 4HKJB 5J57B 3BQUB 1QQDB 2A9NL 1KG0A 4OLWH 2YZ8A 1JP5A 1UXWB 5HYSB 1HHKA 1FAKT 3MROA 3GBML 5ACZB 3PV6A 2UYLA 1JWMB 3QI9A 3TBVA 5IMMA 4CN4A 3ARGA 4PRPA 4G6KH 4HWBA 4ORZC 1MCWW 1TMCB 4LP5A 3BN3B 1OSZA 4JM2C 3NN8A 4F7PB 3B9KA 2A83B 4OLXL 3MNVB 2V5SA 1NC2D 4JG0L 4XHQA 4ZPVA 5IM7B 4JZNA 4KXZI 3VGAB 1EO5A 5DA0B 5JPNA 1FL3B 4XNUH 4RFEA 1A6VH 1IC4L 2H2PC 5I17B 4QRRE 2Z35A 3LPFA 1DBJH 4HF5L 1M71B 5JHLH 4WDIA 3UJTL 4IEFB 4P9ML 1KXVC 4P2RA 3QIWA 5FV1L 1FVCB 3GJFK 3S4SA 4NM8L 4NWTL 3HC0A 4LCYA 2A38A 1OP5K 5DJCB 1CQYA 4H26A 4HS6B 4EN3C 5IROC 2CJUL 1JHLH 4R8WH 1Z3GL 3STZA 2ED9A 4YDJA 2W0FA 5E9DD 5HDQL 1N8ZB 3BKMH 3QUXA 3EDJA 1F11A 3EO1A 5F1NA 3BIBX 4HUUB 2CUHA 3UJIH 4PJ5D 5EBWB 5I76B 2P42B 3RTQD 3OKKB 5KVEL 1A7BA 1BGXH 1SHMA 3ZSTA 4WEUD 5E6ZA 3VXUB 4BM7A 3GNMH 3GSOB 5INCB 1S7RB 2FIKB 5SWSB 4Q2ZB 4RGOH 4R97B 1BVKA 2Q3AA 3H3PL 2XN9E 3U7YL 3TV3H 4DKFH 2MCPL 3QEUA 4LSTL 1NEZB 1OARL 3V0VA 4NNYA 3TO4D 2Z31A 1TDQA 1JVKA 4ZTOL 1J1PH 1XH3B 3ZTNL 4X4MA 1X6LA 2H2SD 2W59A 3SKOB 1UCBH 4Z7WA 3IDMB 1MAML 4M93C 3ZKXC 3MCKA 2PW1A 1NFDE 2CDGA 3KPPA 4PB9L 1DQDH 4N1EA 1L9MA 1K2DA 4OZIB 2GFBA 3I3EA 2VR4A 3O6FC 4YBHA 2ATKB 1IMHC 3C5ZB 4Q0XH 3F6LA 5C2BL 3FQTA 5L8KB 4RDQG 4UILL 1HNGA 3NFPA 5EH1A 1CLOH 3DO7A 1AKJA 4RDQF 4C83A 4LQ1A 4OFIA 3GMQA 1NGPH 2HVKB 3RP1A 4P3DA 3LKQB 2H32A 3U9PL 2WLYA 1FCCA 1CBVL 1KCUL 1WICA 3DVNA 1U8NA 5GQBA 5IFAL 4YXLH 3VFGL 1MUJB 1JYWA 5BS0D 1VPOL 3UTSA 5ECJE 3VI4E 1RIUH 1B0RB 1CDJA 5B8CC 1X4YA 3UJJH 4JFXB 1NDMA 5CP7B 4FFVC 4JM2B 2DKMA 3FFCD 2XPGA 4MZ2A 1BQUA 4Y2DA 5EBMA 43CAB 1LEIA 5AG8A 5C71A 3UTQB 2NY3D 4BQBA 3ZE2E 4DN4L 1OCWL 1JN6A 3TH2T 1M6OB 3B83A 4MCYA 1F13A 2NX5E 4GBXC 5I8CB 1SYVB 2QKIA 2AP2A 4F7EB 4G7YH 2E6QA 3X13A 5C0BE 3NCYP 3V6ZA 5J6GA 1CFNA 3SJVD 2ICEA 1DDHA 5F93C 4HMEA 5B3NA 2F74A 1QFHA 4KQ3H 1PZ5A 4JRYD 2DAVA 3B2VL 5DMIH 5TE7L 4DCQB 4TRPL 1TJHL 4S1DD 4MA8H 4N0FA 1BBDL 3GSNL 4RFOH 4EN3B 4PP2A 3DX6A 4NCC1 1JYVA 1ZGLP 4LEXH 3NBNA 3EYOA 4QRPA 1MJUH 3OR7B 4GW4A 4OGAD 2AABH 4WTXA 2R0WL 1L7TH 4IS6B 4XP9L 5HVHC 3HHRB 1CD8A 4Y5XC 1RZ8B 3L3OB 5E9DE 4YQXL 3C5JB 2ZJSH 5F8RC 1YECL 2P4AB 4ZG1A 4JFOB 4PJ5E 5BRZD 3TF7C 4WHYH 5C07B 2HFFA 3WLBB 1CGVA 3S5LB 1H3PL 2ADJA 4XMKL 1UJ3C 4DW2L 1OTUC 3IXTB 1NCBH 2V17L 1XF4A 4N68A 4J3OC 1A2YB 4GRLA 3BZ4A 2Z0BA 5IVXB 1FL6A 1K8DA 2B4CH 5I1DA 5KSBB 1GOHA 1T7VA 2FECL 2G60H 4GKNA 1G6RL 2OZ4H 4OUOA 2GITB 1OAYH 2OTUA 4XNXL 4O2CB 3ULVL 5CBEA 3IFPB 1L0XA 4U6VH 3RKPA 1DZBA 1PSKL 1BECA 1X9QA 5ACMA 1W0VA 3OG6B 3SE8H 1YEDA 2I25N 2W92A 1H5BC 4N0YL 4L5FH 3SDDB 5EC2A 4JFDD 4OD2B 5DURB 3U1SL 1XGRA 1CN4A 3GJEA 2BNQD 1FYTB 1ZGLM 3CLFL 4UNVA 5CILL 1T66C 5DC4B 4HIHB 5D7JC 5C7XL 2OP4L 5CD5D 2B1AH 3AREC 1G7HB 4TNWF 1JGEB 3E1F1 3IDIA 4PJBF 4UV7L 1DTUA 3LS5H 4NQDA 3LPWA 4PV8B 5IK3B 5F70A 2Y5EA 3B2UC 4OBRA 1AO7A 1QRKA 3U4BH 2J88H 3PWPD 4AIZB 1ZXQA 5CSZA 4U1KA 4ZXBB 1T1XA 1DN0B 2IADA 3GJFH 5A16B 5FYKD 3OPZH 3TT3L 3ZDYE 3K8LA 4ELMA 5D72L 2HH0L 5B8CB 1LE9B 3ZHLA 1UENA 3RWGA 3BI9X 4J1UB 4OGXH 5BS0E 1DJSA 5IBUG 1OP5H 4KWUA 3ETBF 3KPSD 2EIZA 1T1YA 1JPFB 3U2SA 3CFIC 5BJTA 3QI9C 2ZOLB 1P7HL 2EH7L 3ARGC 4MX7A 2BY0A 5GSVA 3HMWL 3TT1H 3DGCR 4M7LT 3B9KC 1RK0A 4G6FD 2IALA 3VGDA 3S9DB 3AY4A 3HAEB 1M05B 3BYTA 4MA3B 3JTTA 5IIEB 1S5IH 2BMKA 2D03H 3CVIH 3MUGA 3VH8B 5FGSA 3RRQA 4X7TA 3LB6D 1TVDA 4MLIA 4P5TC 1BJMA 4H25B 3GRWL 5I16A 4RMQA 1HDMA 5ITBH 3PABA 4XP4L 3SJVE 2BNRD 1IQDA 3OX8A 1JI1A 3ARUA 1RMFH 3Q6FB 2YWYA 4JRYE 1RY7B 4P23A 2V2XA 3WNOA 4B41A 2Q1EA 4KUCD 2EDOA 4POZD 4G8EA 5CGYD 1H0DB 3EYSH 2MKWA 4LIQL 1P84J 1HKFA 2MHAA 5HVHB 2D4FA 5B4MC 2EKSB 4M4PA 5FO9A 4PG9B 1T89A 3S3PA 7FABL 2X9WA 1M4KA 1P4LB 2ZWLT 5I8KH 3QUXC 5ALBL 5I1HL 5EBGA 1HCVA 2XTJC 4XAWL 1J5OL 2CLRA 2V9TA 4ONOA 1UJ3B 4X6EB 5B3JE 4PRIB 4A6YA 4DGIH 3H9YA 1J0YA 2LAGB 3KPMB 4X5WB 4M62H 3PQYA 2YPLB 5D9SA 3THMH 3V5HB 1A64A 1FSKC 2J8HA 5HSFA 5IEKA 1YPZB 4F9PA 3P73B 4F37K 5DJ6B 4UT9H 4TQEL 2FRGP 4PRAB 2FSEB 4N1HB 5CJOH 4PJ7E 3RI5F 5GGVY 2RAMA 1AXTL 5F72S 5JW3L 3IRZA 4O51A 1ND0A 2Z31C 4F57L 1RAMA 2VH5H 1HH6B 1H5BB 2ERJC 3EYFB 4G6AC 4NIKB 5SV4A 5D7LA 2KPNA 1IGTB 1BREA 1MHCA 2HKHL 1VGEH 3L3IA 2WIIA 3ARBD 5GRYA 4NT6B 1V3KA 3NIGF 5CINL 4FFZH 4FTVB 4ODHH 1MVUB 3IDXL 3BQUD 4OFYD 5DJYA 4HHAA 3L7FA 2IANB 2COQA 1MFCH 5D7JB 3X17A 2BNQE 4P57A 2DMKA 2AQ3A 5ALCH 3AREB 1ZKAA 3LRSA 3T2NH 3RX5A 3U30B 1EMTL 1A4KA 2AEWA 1QYGH 4E41E 5LGKA 3CK0H 3P4LA 3QT2A 4JHAL 3ULVC 1KIQB 1SJHB 4ZAKB 1A6PA 5HYFA 4Y1AE 4Q9QH 3PWPE 4JDTH 2F53A 2W9LA 1KG0B 3O9WA 2VSDA 4HIEA 1CU4L 1MIEL 5FYKE 2E8YA 1HHKB 3MROB 1A3RH 3PV6B 2UYLB 3IDJA 3BUYB 3QO1A 3KPSE 3TBVB 5IMMB 3ARGB 4PRPB 1X5LA 5F6HI 1OSZB 2K3TA 3NN8B 3B9KB 4FG6C 4MB5A 4Y2DC 4ZPVB 4ETQA 2Z8VC 4JZNB 2DBLH 4XP6H 4HQQH 2UUDK 5JPNB 1IC1A 4AEFA 4J7RA 4U1MA 4RFEB 5E8PA 5I18H 2Z35B 4GQ9H 2YKLH 3K0