1N7ML

Germline 7g12 with n-methylmesoporphyrin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
b'QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCTRRDSDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Germline Metal Chelatase Catalytic Antibody, chain H
molecule tags Immune system
source organism Mus musculus, homo sapiens
publication title Structural evidence for substrate strain in antibody catalysis
pubmed doi rcsb
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2002-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n7mL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n7mL02
2EE6A 1JZ7A 2DQHH 4M6NH 4OLXH 4PGCB 2R1WB 4O4YL 1XGYL 2BCKB 3RA7H 1S9VA 2X9YA 5I0ZA 5F7EH 5MEOA 5M7QA 3GSXA 3NPSC 4LSQL 3GSUB 1FL3A 3MRGB 2P24B 5HGHA 3OV6A 4XP5L 1FFNA 1U95B 25C8L 3UTTB 2NY0D 3BQUC 4YK4B 1KG0A 3IDIA 2B8OT 1JJUA 1G6RL 5CJOH 1UWEL 5IFHL 2C26A 3FQWB 1H8OA 4WRLA 5K93A 3Q5YA 5D70H 4X6FA 3D3VE 2YPKB 2P5EB 3FQUA 4G9DB 5T1DH 1CICD 3K46A 5T3ZH 2MHAA 1Z9MA 4QHMA 4I0KA 2H9GB 4IIQC 4PJHA 3HC3L 4KDTC 4LRNL 2W0FA 3QR2A 5D1QB 1A9BB 3MRRB 4YGVA 5E9DD 2X1WL 3MPCA 3HNSH 4OGYH 4A6YH 3VXPB 2BERA 2GTZA 1Y0LB 4RX4D 3VFUA 3BUTA 4LCCA 3THML 4Y4KC 4AEIL 5I1GL 4WW2F 1Q9OB 3D39B 3NACL 3OKNB 4AYFA 2ZOKA 4F2MA 3QIUD 1IARB 3KYNA 4Z0XA 2XT1B 4YPJA 1MCSA 3QUYB 3GJEB 1ONQA 4FQCH 3FN0H 3VWJB 4R97C 4F3FB 3UTTE 5K9OA 4Y88A 1KEGH 3GMQB 3VXUA 3VXSD 1YN6B 4PJFB 5FA4A 4C4KT 4CVZA 1WBXB 1KCRH 2BK8A 5BZDA 1J05A 2BOCA 1QFPA 3UTTD 4XPHL 3Q3GA 2HTKD 3VWKA 3ZHDA 5D9SA 5C0EA 3TZVC 4G9FA 2DI7A 2VXTL 1CWVA 1XCQA 2DQIH 3OKMB 5I8KL 2NMSA 2HTKC 4HPOH 4RMVA 1T5XB 4K71C 4WHDA 1MH5A 1KG0B 4WU7B 2YD7A 4M3JA 4M5ZH 4YLQT 3G5XA 5D2NE 5BO1H 4OT1H 5IMLB 1WFUA 1YUHA 3BZFA 1F3DJ 5DUPL 4OCSH 1UENA 1GHFL 3KPMA 2VXUH 1TZHA 2FLRT 4ZUTA 3MRBA 4FQPA 1W0YT 4XX1G 5EOQH 4CN6A 1MREH 3DXAD 3PIQB 3L3DB 3JTTA 4DGYH 3F7YB 4L4TE 1CGVA 1JZ6A 2WM0A 3VG9C 1ES0B 1XEDA 1IQDB 1G7LB 2VDQL 3QEQD 4ORGA 5E00A 2J5LC 4FN0A 3BISA 2BJML 3C6LC 3P73B 4XI5D 4HUXB 3HI1B 2AK4E 2D4FA 4MNHB 3B9EA 1EFXA 4LHJB 5EZJB 3PP3H 3BT2L 2BDNL 1DN0A 3UJTL 5KVEL 3LKRA 4PB0L 2ICWA 5F7WC 4PJIB 1UWXH 4G9FB 1T0NA 1NMBL 5IQ9B 4MD4A 3GMMA 2IFGA 3I02A 4U1LB 1U3HB 4Z76A 4JZOA 3H9YA 5C9JA 1GXEA 1G7IA 4MWFB 4X6DB 3KR3L 3ARED 4GT7A 4ZSOB 3L95A 4WGWB 1DBKL 4NCC2 5B38B 4AMKH 2FECL 2J88H 1VCAA 2A1WL 1MHHB 5KANI 4P46B 2YXMA 5IW6B 4TN9A 4MB4A 1S7SB 4W6YB 2QR0B 4Z7UF 5A16B 4JANB 1OAQL 3JV6B 4GRWB 1S7VB 3DRQB 4TNWF 1U8MA 2IPTL 3CLEH 2QSVA 5T5NF 4K3DL 5C0EB 3KLHC 4HEPG 3T4YA 2VZUA 3MCKB 3BH9A 5HI4C 3V8CA 1ZHLB 4QCIA 2B2XL 1FFRA 4OCYL 3ZL4L 5CJ8A 3IDYB 5C0AB 5IHLB 5MHSE 1PJ9A 2ATPB 3MLSH 5K9JH 4OLUH 4GRLB 4PLKC 3B9VA 1CGTA 3S96A 3UPAA 1YNKH 4XXDB 2BJMH 1FZKA 4V1DE 3Q6FB 3C6LB 3F7RA 4U1HA 5E70A 4TYUA 3K8LA 3C60C 3DYPA 5E5MA 1DUYB 3WE6B 3HE6D 1N5AA 4JB9H 1G7PB 1A6WL 1YYML 4CADB 4XVSL 1UCBH 3P40A 5EUKA 3BKCH 3MOBH 5HI4D 4WY7H 3ZE1E 2FIKA 4LVNC 1MSPA 2NXYC 3ME0A 4M1GH 4S0TD 4CVZB 3BP5B 4LCUB 3V0VA 5BRZE 2DQGH 4Z7WB 2NY3B 4JPKH 2B1HH 3VXNB 3CH1B 4KJQD 3WCYA 4YNYB 3QIUA 3BHBB 3FT4B 4ZPTA 1LE9A 5DYOB 1NAMB 3NFNB 4PTTB 2VLJA 3NFSL 4LVOC 4BH7B 1MVUA 1LILA 1AP2A 3WNPA 5EPMA 1JGVH 3ZYJA 4ZFZA 1BZ9A 4FFWC 4M62L 5I8KH 3JV4B 1Z2KA 3IB4A 4XCNA 2LAGB 5DVMA 5IVZA 5JLZB 5J13B 1VEMA 5C0CE 4LSSL 4QHNB 1EAJA 4HDIB 5EBWA 2P4AB 5D7IF 4QNPF 1DE4A 3PHQA 2YC1A 2APTA 5IJKA 1CZ8L 1IGFL 3KPSB 3D0VA 3TCLB 5HI5D 2WW8A 4Y4KA 2KH2B 5CKAA 1G9NH 3LMJH 1ZLUK 4CW1A 5H35A 2Z8VC 2HRPH 3FFDA 4WHTB 1BF8A 1IAOB 4YWGH 4JE4B 1FNEB 5C9JB 4PRPB 2BMKA 1A1OB 1XR8A 4NQCB 2A73A 3MV7D 1BD2A 4JEGB 3SKNA 3KLSA 4V1DD 1MY7A 3WXVH 2JB5L 3L3KB 3DVGA 1X5XA 3MNZA 4M61A 5ESAB 5A1AA 2BSSA 3BGFB 1OT2A 1AJ7H 4UNVA 1NFDE 3TH4T 3VFNA 3L3JA 2VXVH 1IJ9A 3ZDXE 3B8YA 1JWUB 1UACL 3VXQB 1I1YA 2F5BH 2XTJE 5GGSA 3UJIL 2XACC 5D70L 2R2HA 2X4RA 5E94A 4P2RE 4NCDA 3WDIA 1YPZE 2P5ED 4DGIH 3HZMB 4GW5B 2AQ1A 1R0AL 4YE4H 1XIWA 2VLRA 2ZUQC 2XTJD 3KYOB 5FYJH 1JPSL 5J6HB 5ACZB 2ITCB 5JPNB 1FRGL 1YEHL 3NZHH 1BECA 4J6RH 3HNSL 4OGYL 2CRIA 4J6RL 5F88A 1NDMA 3UCRA 3IETB 1RUAH 2A77H 4NN5B 3STLB 4CN4A 2NLJA 3NCYP 2X9XA 4Z7NF 5FYKD 4NC1C 5TE6H 2HH0L 1P4LA 3AREA 3AM8A 3F12B 3NABL 5T1KA 3QNZA 2L7UA 2J3SA 3UTQA 4EUPB 3G04A 4HJ0D 1ZHBA 3JV0A 3QIBB 3QO1A 5I1AA 4RQQA 2CRMA 3ESUF 1RJYA 3S98A 2YBRB 1ORQB 2OP4L 1FZMA 1R5IB 3ILPA 1JHKL 3MNWB 4NNPL 4RZCA 3VWJC 1FZKB 2YWYA 3RVVC 5EO0A 4M03A 1CDIA 1AD9B 2PXYC 1U8KB 4EKXA 2VL5B 3N85H 43CAB 1BWWA 2HG5B 1QZ1A 1X44A 3TBYB 1GAFH 2C4FT 4D9LH 2DIBA 1E6OH 3VXUE 1JV5B 3IU4L 5FUCC 5D8JH 4JZJC 4OIAA 3HR5B 3MJ9H 4UAOC 5AZEL 3S37X 4HDIA 1TNMA 1C1EH 3ARGC 4OCRL 1L7TH 1Q0YH 3MLXL 5JO5B 1TQBB 4TRPH 4XI5C 5IW1B 1PZUB 3CMOH 2XIDA 1UFUA 3ELAT 1PG7L 1B0GA 1JTPA 1BP3B 2Q8AH 1BOGA 4J1UB 2DQEH 3IDGB 5IHZB 2VISB 3K2MC 4WFEE 3FQRA 2FB4L 3BDYH 5JNYA 1JRHL 1BQLH 1SJHA 5IROA 4OZGB 1TPXB 1TITA 1NGWA 4PGBA 4WI2A 1ACYL 3TIEA 4JG0L 1AKJD 5FDWB 2ED7A 4P3DA 2PO6C 4F7MB 4W68A 4RBPH 3RWCB 1GZPA 3CLFH 3TZVA 2LFGA 5I2IB 3S3PA 4XNXH 4OFDA 3MRQB 4XNXL 4LBEA 2XZCL 1KIPA 4QNPE 3BMWA 3LIZL 5GZNC 1NJ9A 3RKDD 2VZ1A 4JJHA 4PJAB 5C0RH 4XVJL 5BZDB 2NZ9D 3KPNA 4QRQA 3TJEH 4JCMA 5I8CA 4WWKD 4E5XA 3HMWL 5LBSL 2O5ZH 2HRPL 1CXFA 3DIFA 2A73B 1IGIH 4NBYB 1DBJL 1MI5D 1WGOA 1X5GA 1A5FH 5BV7H 3ALWA 4OGZA 4TQEH 2CD0A 4OI7A 4LSPH 2VSDA 5D8JL 4N5ED 1DQDL 3OR7A 5E9DB 2D3VA 2HH0H 1CFVL 1MUJA 1EV2E 1LNUB 3E3QC 3V6FA 2AQ2A 3PWPA 2R1XA 5BVJA 4KV5E 4Z95L 3T0EA 3SDXA 4EQ2A 4XPHH 5KSUB 2C9AA 2OP4H 4QHNA 3QBTB 1DBBH 2CKBH 2LVEA 4NM8H 3MMEB 1U41A 1EEZA 2MHAB 3GIVB 4OLVH 4QRTB 1I9JL 3ARFA 4M4RA 4YE4L 2CDEA 1FORL 3RPKA 4TSCH 1OCWL 3DO7A 2F8VA 2UV3A 2CUIA 3BE1L 3F5WB 4QO1A 1G84A 3QFDB 1AD9A 3WKNA 3ZYZA 1UEYA 3PNWA 5EG6C 3CLFL 4IOSD 2YR3A 1IC7H 3DBXB 3WV0A 3SJVE 3HZKB 4H8WC 2FBOJ 3LS4H 3MRJA 1TQBC 3DURA 4JG1L 2ILLA 3DV4A 3RZCA 5FB8B 3K4DA 3G9VA 1JL8A 3L9RB 1Q8MA 2P43B 3SKUD 4NYLB 3RJQB 2B1HL 2OJEB 4EI6B 1EVUA 3DNKA 5IVOA 4I8DA 5GGVY 2CMRH 3UTPE 1RK0A 2ADGA 2YD4A 5DWUL 1PVHA 2MJWA 3KPRD 5GGVL 1XIWC 4MA8H 4OCWH 1KENH 3MX0A 3NTCH 4K3DH 3S5LA 3W0WE 2FX7H 3KAAA 1KGCD 3S88H 3MV9D 1HCVA 4GRWF 3TO2B 3SDDB 3IU4H 5T5FL 4GRWH 1TZGH 3RUGE 4MDIA 4R4NC 4MYWB 1I9IL 4U1JB 1MIEL 2AVGA 1J8HD 3R4DA 1I1AC 1H0DB 3TESA 3VG0L 3TO4C 3I75A 1U6AL 2EYRB 1MCOH 1ZHKB 1YMHB 2D2OA 4NQCD 5DHVA 1CFVH 3ULVD 1WZMA 5D6DA 1ZVSA 4LLYA 1U8PA 4HXBH 1GRWA 1UCBL 4I0PA 3MACH 3B9KC 3C09C 5CHNA 5TF1H 3VFTB 5B8CA 5D7LE 4G5ZH 2HJKB 2XY1A 4K2UH 4AG4L 4FZ8L 1LK3H 3AS0A 1DQTA 1QO3A 4NQVA 1A6ZA 32C2A 3VA2C 4R90L 3QFJE 4PY7A 4WENB 2E9BA 3TJHC 1I7ZB 4WFFE 1MELA 2W0PA 3DV6B 4N8VG 4QRQB 2X89D 3ZDZE 5DJAB 3EDDA 4WIQA 2C1OB 3EOBA 1NGQL 4ZNCD 1JGVL 1D9KC 1H5BC 1RV6X 1S78C 3SQBA 5DSCB 3DETD 4H0HB 4F8QA 3IDXH 4A6YL 2BVOB 2J8UB 3AUVA 4PV8A 3IXTA 3IVKA 3GSQB 5C09E 3GMLB 2DAVA 1MWAA 4AEHH 3LS4L 3M8OL 4N9OB 2X10A 3F62A 4U2YA 4XGZB 4ZUTB 4QRUB 4NKMA 4XTRD 5JW4M 2JB6A 2QEJA 1K4DB 1A1NA 5KJRH 3HN3A 3FO1A 2HFTA 5GGUA 3HE6B 2V17L 5AWNL 4I1NB 1LP9B 1QSFD 5IEHA 1IGMH 4FXLA 5EO0B 2F53B 5ITFB 1FHGA 5DD6B 4YDLB 3O3UN 5I1KL 5JW5B 1MIML 3TNNA 1I1AA 4HCRH 5L88H 4GRMA 5IQ7L 4LHUD 4NO0A 3QP3A 3RIAK 4F9PC 3EO9H 1JNJA 5KVDH 3X12B 5HYSB 5TF1L 1A3LH 3R1GH 1HHJB 3NCJL 4PRHD 4TUKH 3LQMA 3KYKL 4UTBH 4IRJC 2MCG1 4NWUL 3DUSA 4MD5B 1JZ4A 1U8HB 1Y18B 5DRZA 4HFWB 4G80B 1LQSR 3CK0H 5DQDH 2OLDA 4MAYD 4DW2H 2A0LC 2QJDA 4DGIL 1B0RA 4P23B 1MOEA 1XF5A 1NCTA 5B8CC 4PJXA 2UWEB 3EJJX 3P3YA 4FRWA 1OGAE 2QQLL 1HEZB 2JIXA 3RGVA 3U0WL 1E4JA 4NYLA 4ELKA 5T3XD 3PJSB 2QQLH 1JNNL 3CFBB 3V4VH 4YPGA 3WFEL 2GT9A 4L5FH 3UO1L 2ZUYA 2AXHA 3LV3B 1JWMA 3V5KB 2A38A 1EBAA 2P8MB 3IDXL 5B3JF 3REWA 1AFVL 4LKCA 2X09A 2J6EH 3L3GB 2CLRB 4PTUA 3BQUB 4N0UE 1CFQB 3MLTB 1UWEH 1QRND 1I3UA 1LEIA 3ARUA 5DD3L 5SWQA 1DBMH 2RB8A 3WUWA 5DS8A 4ZQKA 5MENB 3DMMA 2YPVH 3L3IA 3I6GA 2NY5C 4L4VE 1JPGA 1FV1B 3VGDA 1QRNE 1UC6A 1T3FB 2WINA 4FQQB 4OUOA 1R6VA 2VC2L 4QRPD 3VWKD 3MRJB 1PEZA 1WBXA 5CJXA 1AY1H 3W82A 4R8WL 1MHPL 4G42B 5HY9A 1C12B 1R5WA 4H88H 1BQHA 2WZPD 4G8FB 3V6FB 3G6JA 2C1PA 9CGTA 1YJDL 4Y1AA 3VG0H 1YDPA 3QEHB 5D5MB 3GSNA 5HHNB 5KS9F 3CZJA 3QIWC 4OBSA 3BP5A 4LCUA 2YPLD 3LB6C 5D96C 5KSAA 3BW9B 4OZGF 5I1EL 3GHEH 4QXWA 4Z8FH 3CSYA 4XPGH 4AH2B 2JIXD 3RGVD 4MQTB 2Z31C 1U8IB 4WUUD 1KYOK 2N7BA 4ZAKC 4AM0B 1QRNB 1QTYT 8FABB 2DQFA 3GJFK 3RAJH 3RVTC 3HZMA 3MA9L 4WTWA 4UIMB 1RZ8A 4NBXB 3RA7L 1J12A 1NL0H 1QLEL 4E42B 2J5LB 1F8TH 3MA9H 2D9CA 3BGMB 2DJSA 1IEAB 2P7TB 1A0QH 3W9DA 4YBHA 4RRPA 3GMOB 1YNKL 5DO2C 3ZYOA 1PG7W 3NCYS 1FGNL 2FRGP 3BP4A 1JTTA 3M45A 4JY5L 1XMWA 3BIAX 1TENA 5E00B 1S8DA 2NZIA 4PJEA 5T1LA 5JHDE 4HKBA 3FB8A 4CNIA 3H3KA 2KBGA 5CEZD 5E6IA 1JNNH 4M5YH 5L6YL 4G6KH 3AB0B 5H94B 3V7MA 2GQHA 2EKSB 5CSZB 5JORB 1T1YA 1OTTC 2P1YA 3TVMD 1MFNA 4YJZL 2B39A 4Y1AB 4F8TA 1AQKH 3FO2A 1S3KH 4OD3H 3QZWG 5T3XH 2PTVA 2DQUH 5FGRA 1NKOA 1YUHB 4IMLB 1A6ZB 2HLAB 2QL1A 4CMMB 1KJ2L 2B1AH 2FL5B 1AGDB 3GO1L 4MVBD 2ZP0T 5IWLA 1SM3H 4JFYA 1CI5A 1R24A 2EC8A 3CCHB 1HNFA 1RULL 4OB5L 4QRSA 5DR5L 3C5JA 1YPZA 1DLHA 3D3VD 4KUZH 5D2LF 1JGUL 3TN0D 2AGJH 4LSTH 4PV8B 4JO3L 1CZ8H 5J9PA 3U7AA 3L7EB 4P3WA 3VD4A 4QYOB 4WU5A 1INEL 1EAPB 2VDPH 6CGTA 2VLME 1I4FB 5IV2A 1E4XI 5C3TA 3WFEH 3F12A 1FGNH 1RHFA 2OR8A 5DUBA 3REWB 2HFGH 3I50L 3DI3B 3RHWF 1BGXL 5B21A 2EZ0D 3U2SA 3WXVL 1WAAF 3WDHA 2QADD 3MNWA 2CR6A 4RZCB 4U0RC 3FZUD 5I1CL 4M1GL 5I18L 3BSZL 3CUPA 4KH2A 5IFJB 2HT4D 3BP6A 5EO9B 5L2JB 4I9WE 2FD6L 5CFHA 2BNQA 5IESH 2EDLA 5FUZH 4JPWH 5F7YC 1AXTL 2XA8H 3STZB 4OIIH 3TH3T 2OJZH 1JF6A 4IRJA 2NY1B 3KPLA 1IBGL 5JHLL 5LGJA 4XVTL 2P48B 2OJEA 5F9WB 1SYSA 3OJ2C 3SGDI 1NLBH 3LN9A 3U46A 4RFNB 1F3DH 5L7XH 4JY5H 4PRPE 3HRPA 2E7BA 3CZFA 1IEAA 2P5EE 5IBTL 4H88L 1JGEA 1I1CA 1JNHA 1MHEA 1VB9A 2XG4A 2EDEA 3V5HA 3D0LB 3FB5B 4JY4B 4KHXH 3EJZD 3U0PB 4JVPA 5TGBA 1SMOA 2BFVL 5I8EB 1U92A 4LLUA 1P7KA 1QR1B 1TNNA 2BVPB 4JRXA 2HVJA 3B6SB 3GJEA 5IBLC 4Y19B 1PY9A 3BAEH 3RVWC 4X6BA 4DCQA 4QHKJ 2VN4A 3QDMB 5DJ0A 5F7HA 1QLFB 4XPAL 5HYJE 3TT3H 3SGJC 4KRPD 2VDLL 2YZ8A 5DVOA 4WWKA 3ROOB 3MLRH 4L9DA 1KN2H 1TTGA 1W72H 2ZG2A 1HYSD 5H2BB 2R0WH 3OXSB 5I71C 2DL2A 3T4AA 4YC2B 2V5RA 4HPYH 3DWTA 3REVA 3LS5H 4FFZH 5ENWB 3GSVB 3MRQA 4G5ZL 4FQXA 3DECA 3QQ9D 4Q2ZB 1DQJA 2PYEA 1JVKA 4LPCA 1EXUA 3PJSA 1CFSB 3FFCD 3PQYE 1VPOL 4R4FH 1RUQH 4XMPL 1Z6JT 5DMJB 3CFCH 5FCSH 1NSNL 1Q38A 4Z0BH 3QPQD 5CSZA 1WJ3A 5EU7E 1OGAA 1XIWD 1YEHH 1I8IA 4GMTH 4YFLF 2DLFL 3QNYB 2XFXB 5BQ7A 3NVQA 5FCUH 2E9JA 4NKIH 4TSAL 5I16B 4P5KA 3WSQH 5EA0L 3TBVB 5IP4A 1PLGL 4IJ3B 4HUWB 1T89A 2DQDL 1OB1A 2A9NL 4G7YL 2PN5A 3IKCA 4H5SA 3WE6A 5I1CH 1H0DA 2BVOA 1VACB 1X5YA 1CBVH 3P4OA 2J8OA 3GNML 4KJYB 1A6AB 5GJTL 4RMTA 1ROWA 4UNTA 2C5DC 3VXME 5K9QI 3ARFB 2FH8A 1U3YA 5EBGA 3TN0B 2Q8BL 5GGUB 4AL8L 3UPRB 1QA9B 1S9XA 4FG6C 5I1KH 1WCQA 1TVHA 4HKJA 2VXQL 4HG4K 2HJLA 2HLFD 1LO3H 5F89A 4U1IA 2R1WA 2DIAA 1T03H 1RJZA 4IHOB 3QXDB 1AD0A 2VR4A 4ZYKB 3VFSB 3IGAB 5TDOA 3O4OB 1P2CB 4GJTB 4NGHH 2DWEA 3SKMB 4K55A 3AMKA 4TTDD 1L7TL 3RUGA 5I75B 4LNRB 5ETUB 1BVLB 1YEJL 4U31A 4EI5C 4Z7WA 4HWEH 2MPAL 4KTDL 1MCWW 5IMKB 2W0LA 4NKOA 5B22A 2J1KA 4JFEB 1PEWA 3FQNB 3G5YA 5F88B 2VDKL 1TVDA 4KKCD 3EYFB 2OS7A 4I3RL 3D9AH 3ZL4H 1CR9H 2YMXH 1XF2A 5GRJL 1INDL 1MHCA 1I3GH 3B5GA 3RIFK 4OLVL 1FGVL 1DSFL 4JQXA 5ICYB 2VXSH 1CLOH 5F9WC 3K2UH 2VXSL 3PG2A 1UH4A 4FMFA 1AJ7L 4JG0H 2YSSB 3JZ7A 4I48B 2OK0H 3TVMC 5MI0C 4XXDA 2EIEA 3VH8B 4UTAL 4XBGA 2EYSB 2FH6A 5JR1H 3HB3C 4PTUB 1N64H 4QRRE 2HTLC 5TF0A 3VFGH 3QXTA 2ARJB 3SPVA 3MJ9A 3MV9B 3ULVE 1T7WA 3EYSH 1NSNH 1NEZA 1F6FB 1TCRA 3QJHA 2MSPA 3QUMB 4ZO7A 1CD1B 4UBDC 3ZT7A 5I1LB 4F33A 5I1IH 3DTXA 4P2RA 3INUH 3VFSA 4G6MH 4BUGA 3GBLA 1W0WA 2DQCL 1UJ3B 4HSQA 5FK9B 5HPOA 4PLKD 4ALAH 1HXYB 1HH6B 3OAYH 5JDSB 4WO4A 4ZUWA 3GKZA 3W9EB 1T83A 3ZHKA 3BWAA 1J1OL 1QBMH 3MFFA 3RY6C 5I1EH 4KVCH 3DX6A 3NFPA 3G5ZA 4XAWL 3QCVL 3TC9A 1OGTB 2NY5H 4RAUB 4AQ1B 4WTXA 4JHAH 3BPNB 4L8SB 1D5XB 1DBBL 2CKBL 3TH2T 1P1ZA 2YD1A 2X9WA 5IBUG 5E8PA 5E24E 4LCYB 3PQYA 4XMPH 5TGBB 4MX7A 3IDJA 1KCUL 3UTSE 1ZLWK 2XKNA 4XP1H 2W9DH 4WNQB 2V7HB 4HH9A 3KXFA 3OKDB 1OAZH 2XFXA 1K4DA 5GPRA 1HHKA 4KGLA 5ETUA 1J0JA 4J23A 1T80A 2X4OB 4M1DL 3P77A 4F80A 3Q5OA 4BSWA 1BLNA 1FNGB 1OP9A 5C0CA 1FE8L 5CBAA 1JUFA 2ESVA 4UT7L 3K1DA 2RFXB 4OCRH 1Q0YL 2D0HA 3MLXH 4NO3B 2N56A 1QFWL 4S11A 5JO5A 4XAKD 3ARBA 3AGVA 3FB8B 3ROLB 1HEZA 2JIXB 3RGVB 1OSPL 3ARTA 2APVA 3GJFH 4P5MB 5EOTA 2FD6H 4UDUB 3KNBA 3PABA 4JHWH 1A7NL 2V2XB 1WEJH 4S2SA 4M7LL 1BFOB 4ONFH 5C0AE 2HA1A 5IM7A 3T0EE 5DRZB 4PRHB 2YPKA 1U8KA 2VXQH 4C56E 3K2UL 3ILQC 1IEBB 3RGHA 4OGAC 3LKPB 2WWKO 2XQBL 3P0YH 4PGBB 3L3DA 2ORBL 3PP4L 4XCCH 3SDAD 2XTJC 2DJUA 1RZGA 2Q7YA 3LVEA 4HWZA 1IAKB 3EO1A 4XCEB 1CU4H 4WTZG 4M7ZC 5I8CB 4I5BA 1G7JB 3ZE1F 1NEUA 4LIQH 4P5KB 2AJYL 5DHYA 5ILTL 3QHZL 3OPZH 3O6FB 4M7KH 3OG6B 3SGKC 3P11L 1VHPA 3JWOH 1ZT4A 2X70B 3LMJL 3FB7A 5D2LB 1F02I 3WFZA 1NGZA 3EO0A 2D7TH 1QEWB 4HWEL 2Q20A 3TPUA 4Z7NE 2OTPA 1K85A 4TUOA 2FWOA 2ZKHL 2ZNXA 3O4LB 1CGXA 2I07A 4P9HC 4NQED 4XRCB 2YUZA 2YKLL 1HDMB 5HJ3A 5ID0B 4LLAA 3HE7B 5E6IB 4DGVL 4KROD 2IQAA 4RAVB 4BQCA 4Y1AD 4PUBH 4OFKA 4F7TA 3KLHD 3Q1SL 3N85L 4ODSL 4CMHC 2VL5A 1F00I 1UJ3C 1KJMA 2VXVL 4YDJB 2I9TA 4JZNB 5DVKA 3CFEB 4X5XA 3BEVB 4MA3A 5ID1A 1FZOA 2BP3A 4JHAL 3AB0C 1U8PB 1M6OA 2XA8L 1DL7L 1KIPB 2EH7L 4C59B 4F37F 4PJDA 4PREA 2CIKB 5IG7A 1TZIA 2ZUQB 4TTDC 4ZPTB 3RNKA 4DW2L 1RUKL 3RPIB 3MLUL 4X9HA 1QPXA 4NRXA 4KAQL 5FYJL 2GK0A 4G6AD 4Y2OA 2CKBB 3LRGA 5C6WH 1PG7H 1F6AA 2BNRE 5DA4A 5EIIB 4D9RE 5AYUL 2C7UA 2PETA 3WKML 1WK0A 1GCFA 2LABA 5FECA 4LSUH 1WF5A 5DMYA 4A6YA 5HGDB 1EDQA 2WNGA 2GCYB 2KPNA 3GUTB 4ZXBB 2P5WA 2AJ3B 2HN7A 1JGEB 1FN4A 1Z9SA 4JR9H 5JXAH 3FOMB 1JP5A 5I66B 5E4EB 2LAAA 4N5UA 4OD1L 1OAUH 4OQTA 2V17H 1U8OB 2OSLB 5AWNH 2JJUA 4HUXA 5E8EA 5ANMA 3GIVA 1MFEH 4H8WH 1A7QL 2RHEA 3L7FB 2E6PA 5BVPL 5FDYA 1C5DB 4MB5A 4ETQB 4NM4H 3OL2A 4Y5YB 4MSWB 2LVCA 1IKNA 4MD4B 3B9DA 1MLCA 3VFNB 1IMHC 4X7SL 4JFPB 1EVTC 3GBNH 2W9LA 5MHSD 1RJLA 3UROR 5GRUL 2ERJC 5HPMB 2X4UA 3GI9H 5DMGC 3GI9L 3QHZH 1KPUA 4MLSA 3VFPB 4JGMA 2FHBA 5CLTA 1F42A 1FH5L 4ZPVA 1YNTB 3LDBB 4BZYA 5KW9H 1FIEA 4L8DA 3EHBC 4PRDA 4Y4HA 3QUZC 3B2VL 2YD5A 1MCDA 4Y7MA 2X4TB 3MUGB 1NCWH 5DUML 1CLZL 4IMKA 5FF6B 5EUOB 3D18B 3BIBX 3SDXE 3ARQA 3VFOB 4JFFD 1LEKB 3BIKB 3QWQB 3HZYA 1WEJL 4KJWD 4ZOCA 3O9WD 2EDTA 2L0DA 1MFBH 1ZLVH 4YHLH 4LLVB 4Q9CA 3LS5L 3MUZ1 3QYCA 25C8H 4JFHD 2VLKE 5C08B 2VNCA 4RMWA 2NNAA 1KJVA 1EZVX 3UAJD 5JDJA 2HJKA 1GJIA 4EBQH 4CU7A 1IC7L 1PY4A 2AAVA 5GQBA 1DFBL 1LE5B 3VXRE 1J10A 2EIDA 4OSUH 4V2BA 2DL9A 5BOPA 3IXTB 4TULH 3R0NA 4PREB 2FEEI 3Q6GH 4QLRA 1IC5H 4UILH 5ID1B 4LFHD 1AKJA 2E6JA 4HUVA 5JW4R 3QISA 3WSQL 1BOYA 2KQMA 3WL9A 1QSEB 1YJDH 4MXVF 2DN7A 1CLYH 1D5IH 2CR3A 4PBWD 4HLZG 3OF6A 4EI5A 5AD0B 1Q0XH 4OZGE 4LARL 5TQ0H 5F96H 1CFNB 5JA9A 4OFPA 5LQBH 1NAMA 1G0XA 2R0KL 5CCKL 5C0JA 1UJTA 3GFUA 2DWEB 1HHHA 4OLWH 1KPRB 3S7GA 4J3TA 1CLZH 5FGCE 1J1PH 5HDQL 4LAJH 4PGEB 1LO4L 5EBLA 2X4NA 3O2VH 4M93B 3VWJD 1RPQA 4PPTA 1GVIA 4WFFD 1F4WL 4MDJA 1NL0L 2CLRA 2C1OA 4IRZL 1ZLVK 4XWGL 5BRZA 3HR6A 2DBLL 4M6NL 4OLXL 4OZ4B 4HIEA 3SO3B 3VXUB 5FECB 3C9NA 2DMKA 4Z78A 2MCPL 3KYKH 4UTBL 4YDVB 3OB0H 4UT9L 4JREB 1EO5A 1U2HA 4D3CL 1ZWIA 3IDIB 2P7TA 5HYFA 1DQJB 4KPHH 4YEFA 1QFWM 1RHHB 5T1LD 5DC4B 1BOGB 4XBPB 4AT6A 4M5YL 1BWMA 3DJ9A 4HUUB 1SY6A 5E99L 3B9KA 3JUZA 2EEDA 4N0CD 3QJFB 4GW1A 5H2BA 5FEBA 1N7ML 5FOBA 3MODL 4DGYL 3OGCB 5EU6B 1I3GL 2X1OA 3UPRA 4LSVH 1R5IA 3ILPB 4JRWA 3QHFH 3WFHB 5IF0A 2XG5A 2FCBA 4Y2DA 1YEFH 4Y19E 5FXCH 2V2WA 3T3PE 4DVBA 3O2DA 5HGBB 1RIHL 3TT1L 1A4KA 1YA5A 3FFCB 5GIRA 3AY4C 1DBML 1AO7D 3E6HB 1WIPA 4J8RB 2X6MA 4ODUA 3QG7L 2IH1A 4BQ9A 5FA4B 5J12C 3FN0L 5ESVA 4U7MA 2P46B 3QFJA 3OPZL 5DJ8B 4DJMA 4XGZA 3UJJH 1FYTE 1R5VB 5FGSA 4DQOH 1LO5B 1VFOA 2N7AA 5FYKL 3BJ91 4APQA 3AREB 2MMXA 1HOCB 5HBBA 3VRLE 4NQDA 4I0PC 3AREC 1QFOA 3BKML 3O6FC 4LRIA 5ANMB 3ULUE 4HBQA 2CJUH 1DE4B 2IBBA 1FYHB 4YFDB 4HXBL 2I27N 5HYQB 2GK2A 2X4NB 1TTFA 2XRAL 4JPVL 3MLYL 5J0BA 1KB5A 4JFFA 4NN5C 3QDGD 4ZTPH 2VR9A 4L1DA 4JO3H 4JY6A 5D2NB 5F7LB 5I2IA 2B2XH 4LCWA 3UPCA 3BPCB 4FZ8H 3VI3F 3O8XB 2GJ6E 5IMOA 1FJ1A 4GKNA 2BNQD 5DT1H 3KS0J 1KACB 3RAJL 4CAGA 5HDOA 4BZ2L 1XR8B 4NQCA 1T2JA 3SOBH 4N0UB 5AG8A 5DDHB 3QCUH 5T1MB 5A2JH 1AIFB 4Y4HB 3VXMB 4D8PB 3WEXB 1CDHA 4W4OA 3L95B 1J88A 1KJ2A 2K7PA 4KRPC 1T1ZB 1CU4L 3CDGA 4Y2DC 5CILL 3PQYB 4QTIL 1ZLSL 2DJ4A 3HC4H 3WDJA 4S1RH 5EDXA 3TFKC 4PJIF 5IB1B 1JMZA 3SBWC 3PXJA 1BJ1J 2AJUH 1MCJA 1MFAL 4I5BB 4U6YB 1IZJA 3C6SA 3CPLB 4RGNB 3FTGA 4P57A 4HG4J 1AGDA 1LO0H 1J11A 4KC3B 4ONFL 4JJ5B 2KZ1B 4WW1A 3MLWH 5DQ9B 2Z4QA 1J8KA 1LO3L 2P8PA 4GQPH 1JFQH 4MJ5B 3EO9L 1LEGB 4TNVF 4EDWL 4U4BA 1C5BL 4YDVA 5JIIA 4PJFF 3QSKB 2VRAA 1RZIA 1JI2A 4X6EB 1YECH 3WFBH 2EYTB 3IFOB 2DKSA 2JJTA 1TZGL 5I15L 3X13B 3MV9E 5DFWH 3HMXH 1QYGH 5DJ6B 1KIUA 3ZE0F 1F4XL 3MLUH 2WUCL 2VZOA 4RA3A 5DDHA 1MCPH 3BD3A 3I3DA 5CBEA 1T21A 5D4QA 3W11C 4PJHE 2X40A 4O5LH 5JPMB 3FO2B 1HHHB 2EC9T 3TPKA 1FVDB 4LLWB 5HHPB 4FABL 1T0MB 5CHNB 3O6MH 5F7EL 4JFFB 4I3SL 3QQ3B 4OZIB 1OTUD 4HWBH 2O61A 1EEZB 5IB2A 4OV5B 1I9RH 4P46D 1EUUA 3O9WB 1J7VR 3T4YB 3OKYA 3LRSA 1TJIH 5I18H 1RZFL 4U6VL 1UCTA 2WIMA 4ONHB 4HWZB 2Q7YB 5D93C 1A6WH 1HDMA 3OKOA 2OJZL 2ZNWA 4XNYH 3BH8A 4MA7H 4N68A 5CJXC 2X4OA 3ARBD 3SCMC 3WEXA 3QO0A 4YNYA 1X5LA 4KK5D 2Q86B 1P53A 1NCAL 4X4YA 3VXTB 5B8CB 3Q6GL 4ZFOA 3U7WL 1UYWL 3AS1A 1KTLA 5L7XL 1YEGL 2HT2D 3BP7B 1F58L 1XGRB 2WWMC 2VB5A 1FNEA 2PCPA 3GSWA 2DD8H 1M7XA 2HT2C 5DJYB 5AG9A 2VSCA 3FFDB 4ZD3L 3S36X 4WI4A 2DWDA 4G8IB 2BSRB 4S1RL 1G7MA 2VDNL 4TPRH 2F58L 1ZANL 1NFIB 4YHYB 4X99A 4Q9RL 2Y4SA 4M8VA 5JXED 1KPUB 3FAWA 4G9DA 3L3JB 1U91B 1DQLL 3O3AA 4MA3B 1T22A 1WZKA 3MLZH 3H2WA 4IEFB 1EPFA 4FXGA 1OARL 1QSFA 2HKHL 1YEIH 3VDAA 2W1NA 3HE6C 3O6ML 1I8KB 2YD2A 3AVEA 2VLRB 4FG6D 3FN9A 5C70A 2YRLA 1INQB 3GDBA 1B6UA 4OFVA 3QIBD 5K9OB 4G8GD 5E8EB 4LHUA 3PWLA 3DGCR 3MBEA 4K8RL 1ZS8A 4PP1C 1AR1D 3WUWB 3CDGB 3TPUB 4M1CC 4ORGB 5FYLE 1B2WH 3WS6A 5HHOD 1KELH 3QG6B 4ZUSA 5MERA 3CFDB 4KXZI 3VH8A 1CFSA 3HI5H 2H3NA 4JDTH 3O3BB 2H2SD 1U8JB 3E8UH 4OKDA 3BPLC 4KVNH 5KAQG 4KDWA 2D4DA 4MQ7A 4PS4H 5DMGD 1DSFH 3BDYL 2DQUL 2DDQH 4M61B 1VFBB 3U4EA 2R2BA 4O2CA 1LP9E 1QBAA 2NY4C 4WUUB 1TZIB 3ZKMD 4KHTL 5E7FA 3GNMH 3WIHA 2YBRA 4UB0H 4WEMB 1M6OB 4OF8A 3ZSSA 1S5HA 3P73A 5J6GB 1J0HA 1RMFH 3GSOA 2ADFL 2ORBH 4XCCL 1II4E 5JIPA 1QFUL 3HCVB 4BQ8A 3L9RA 3QCTH 2FATL 3F7PC 3PHSA 1JHTB 3DMMC 4X6CA 1NC4D 5HGGS 3OKLA 1NGYB 5I76B 3BP7A 2YD3A 1S7VA 3DRQA 3ALPA 1Z3GL 3OF6D 3PIQA 3SE8L 2GUOA 2MTPA 4ZUUB 3F58H 2BHZA 1VFUA 2R1YB 3CFBA 4R96B 2GW5A 2VZ3A 4MDJB 4ZFGH 1YJDC 1XGQA 4P46C 4UV4H 4YH6A 1GGCL 4XAKE 2DQCH 4TQEL 3CH8A 1FL6A 1H3TA 1N3NA 4K8RH 5IBLD 4TNWK 4PRHE 1DQDH 1AGCB 1D5BB 2VDNH 2VWEE 4FQ2H 4Z78B 4KPHL 3PGDA 1T7VA 1U2CA 4U3CA 5K9KA 3UP1A 4RDQG 1ZOXA 1A9EA 1I1FA 3LY6A 4XAWH 3TO4D 1IQWH 1XZ0A 2UUDK 3BSZH 1E4XL 2OXHA 4IRSB 1FFOB 1E4XH 2D0GA 5GS1A 5HGHB 5ICYA 5L2KA 1NAKL 3AS2A 3X14B 1IC4H 1NAKH 1XF1A 1TFHA 4J7RA 5A3IC 1OAKH 3LN4A 4K7PX 2FIKB 3FQNA 4J4PA 5FOBB 3GRWL 1SBSL 3OQ3B 2H26A 1CGSH 3V6BR 4PG2C 3V6OA 1S5IH 1G7HB 3RWEA 3PDOB 2FB4H 1PKOA 5JQ6L 1F58H 5BMFL 1FDLH 1N6UA 5BW7A 5JQ6H 1FNAA 4WUKH 1UVQB 4JKPH 4MJ6A 3EYSL 4X6CF 3SY0B 2BNRD 2MQ0A 3U79A 4D9RD 3ZMRA 2JCCF 4X7DC 3DX9A 3VCLB 4LBEB 5C07B 3WUWG 3O6KL 3ET9F 3NOIA 2C3GA 2D7OA 1VGKA 5GS0H 1GIGL 3PNWB 3VGHA 5CSGA 4HKBB 3TT3L 1CN4A 1Q9WB 4R4BB 1K5NB 1KJ2H 1IAMA 4PYGA 2VZSA 3WJJA 2EDOA 4IDLA 1CG9A 5JOFA 1U93B 4PJHF 3GK8H 4HJGB 4JRXD 5BJTA 2FWOB 1SEQH 4Y5XA 2WUBL 5T1KD 4LHUB 3MMEA 4Q6YA 1KENL 5LGKA 4PJCA 3ILQD 3M07A 4X7SH 1K3IA 4EI5D 3DX8A 3S3SA 3U36B 3UZEA 4ZNEA 4HJ0C 2IALB 3PE9A 3IDJB 3LEVH 4R2GD 4NOBA 4HW6A 4ENED 5B39A 3EYOB 4OGXL 1CXEA 1HCFX 4ZTOL 1MIEH 2B20A 1HNGA 2ADGB 1AKJB 3ZDYF 2C3VB 4NRYA 3ARRA 4I0CC 3QAZC 1KCUH 1JNLH 5F1IB 3X3FH 4RNRA 5DUMH 2WQ8A 4YQXH 3C9NB 4X9GA 5T3XE 2NX5B 3MXVH 4HFUH 2A6KB 1KGCE 2NYYC 4MCYB 3DVFA 4MD5A 4ERSL 1KIQB 2XRAH 4XPBL 3BZEA 4KHTH 2LE9A 4UB0L 1ZA6B 4WW2C 3QT2A 1RZFH 2DLTA 3E6HA 3BH9B 2PNDA 3FT2A 1YPZB 4AEEA 1UM5L 3H7BB 4L8SA 1ACZA 4IRSA 4KK9C 3MYZA 5IB1A 2FZ3A 1JBJA 1FCCA 4MZ3A 2PTTB 4U05A 1GGYA 5H35B 2IANE 4PG9B 4C57C 3HRZA 5K9KB 1QSVA 1UZ6E 3NPSB 5C2BH 2H45A 1FAIL 1K5NA 5I6XB 1Y0LA 2XN9B 2OSLA 4JN1H 3ARGD 3FO0L 1MAMH 1V7MH 3WNLA 4DOHE 4G8IA 1WBYA 1L9MA 1AC0A 4NJAL 3L3KA 4K71B 2BOBB 3ES6A 1QD0A 3QJFA 2DM2A 3N1MC 4GW1B 4F58H 4F9PA 1T1YB 4PJDB 4P9HH 1FFPB 4YHPA 1FNSL 5JXAL 2EDBA 3RTQD 3HE7C 1D5MB 3SKOA 5TE6L 1M7DA 4XC3H 4CVXA 4GW5A 4WHTA 5DGRA 1UA6H 4LARH 5TQ0L 1FV1A 4MJ6B 3T0EC 1FYTA 3Q3GB 3VWKB 1P6FA 2AABL 4WO4C 4Z18A 1EXUB 1IKFL 2AABH 4LHQB 5ADPL 3QA3B 4JFYB 4OQTH 1I8LC 3CH1A 4NZDA 1KXVC 4LU5H 4Z5RA 3PWVA 1ZKAA 1BFOA 2ICCA 1KPVA 3CDCA 3MV8B 1R3HB 5F7UA 4QCIB 1PD6A 1X5HA 2GHWB 4EUPG 2IH3A 1DVFC 1A1MB 4KROB 3RNQB 2CDFB 4NQUA 3MRPA 5C2UB 5GGRB 4ZUUA 2P8MA 5FKAB 2FLBT 3FHQA 3VFUB 4MD0A 4DCQB 1ZT7A 2ZG3A 4U1NB 1XT5A 4NZUL 1JF5A 4O2FA 4WWID 3C6LA 4J4PD 1IT9L 3O3BA 4WUKL 4R4FL 5LGHH 4I4WB 1KELL 5D1ZC 1MCPL 3IKKA 1QNZH 3SDDD 1LGVA 5ICXB 2C4XA 1A1NB 4P2OB 2IG2H 4TVPE 2Y6SC 3IETA 4PJXF 1VFBA 5SWZB 3C60D 4QRUA 1RJLB 4ONOA 5IR1A 1GIGH 1WTGT 3EGSB 3VXSE 1GGIH 4K7PH 4JQVA 1PYWA 4NP4L 5D72L 5E0QA 3PHOB 4GRMB 5GS0D 1SJEB 1P84K 3LEXB 3LPFA 4KDTA 1TJIL 5DD6A 1XGUB 1IEBA 2X44D 5L8LB 2I60H 1CE1H 3QWOB 4HK0B 3VXSA 4UNUA 5DJCB 2ZCHH 4EI5B 4ODHH 1YMMD 2FJHA 5K33A 3ULSA 2R2CA 1KBGH 3KDMB 4JM2A 4GS7B 3LPGA 5D7JC 4X5WB 3LB6D 4ISVA 1EIBA 2PTTA 3HPLB 4J1UA 4QRPB 2NW2A 3O4OC 3WFCL 2YA1A 1P2CA 4M93C 2Z9TA 3D85B 1RIVH 1AGEB 3MRHB 4MD0B 2J8UA 1D5MA 5A16A 5JXEA 4N1EA 3P30H 4KTEL 4UT9H 5KVGH 3WHE1 2VDMH 3TBVA 4P2OD 4HBCL 4PRAA 4NRZB 4GKSA 4QKXB 1RU9L 5IHUL 2AK4B 2Q86A 4NQXA 1JF1A 1UB6A 5HDBE 4OBRA 5FM5O 5SV3A 15C8H 3O6LH 2AJSH 3ZE2F 1TDQA 1MCQA 3FFCE 3PQYD 1EA9C 5CGYD 2AJSL 3V7AG 5DEZA 1CFQA 1VERA 1EHLH 3BXNB 3SGJA 1IVLA 1QSZA 3SN6N 1MHCB 4K07A 3DXAA 5DJYA 2PYFA 3FHAA 4RGND 1FZMB 2LU7A 2CGRH 4ENEC 5TDNB 4HS8L 4XBEL 5IVXE 1J8HE 3D25B 3PV6A 2GTWB 1RI8A 1EFXB 1G0YR 2CRZA 4G8GB 1OTTD 1WTLA 1JPGB 4KUCD 3O41A 1F4AA 4JKKA 2FYYB 2VDQH 3PWUA 2P42B 1JRHH 4ELMA 2LTQC 3RVUD 1YQVL 3MGTA 2OZ4A 2NPLX 4YUEH 4TUJA 5IFJA 5SWQB 2OQJA 1ES0A 1ZT7B 4Y5VC 3GMNA 4DEPB 2QV2A 4YFLI 5E1HB 2G60H 1ZMYA 5I9QB 1TJHL 4TULL 3H9SD 1ZVYA 3UJJL 3SCMA 2BNRB 2YSSA 4MXWH 1SJVA 3MNVB 4XPFL 4RMUA 2FSEB 3IFLH 2NY6B 5ESVB 2WWMD 4POZD 4OQTL 3P2TA 3F6IA 2Y72A 3SDAA 3T1WA 1J1XH 2FO4A 1MFEL 4H8WL 4NP4H 1ZK9A 5CEZE 3KPTA 1KT2B 4WHYG 4HBCH 4G43B 2BY3A 4P2OA 4KKAC 2Q3ZA 1LEIB 3FB6B 1HOCA 4PUBL 1UXWA 1FL5A 2HYMA 2MQCA 1XGTA 4OZFG 2ERJB 1F5WA 4HQQH 4QRTA 3LOWA 4P5MA 1WZLA 4GMSL 5F3BA 2C3VA 4MMXC 3RZCB 1HSBB 3U9PL 1I7TB 4YXLL 4H0GA 3VXRD 5CZVH 5GGTL 2F54A 1MCWM 1C16B 4H26A 3HI6H 3VFPA 4OI8A 4PLNC 3BP6B 1KTLB 3ARFC 4PJ8D 5EO9A 4GBXB 5J8OA 4LPWA 1BM3L 2EDJA 4K3HA 1IM3B 4GXUM 4N90D 4BSWB 4MXQD 1BVLA 1L6XA 4N8VB 2NX5D 2Q76B 3C8HA 4FQHB 5ESQB 2ADJA 4PRHA 3QNXA 4PP1D 4GG6A 1Z5LB 4EJ1C 3U1SL 4EQ3A 3T1FA 3DSFH 1S9WB 1YQVH 1H3VA 3GKWL 2A6IB 4U7SA 1AH1A 3JVGC 5TFSH 1EEYA 3RWEB 15C8L 3O6LL 5FV2A 2G75B 4RIRA 2V9TA 3KHQA 1UM6H 3OGCA 3AM8C 1F90H 1PGRB 2H32A 3QEQA 2J7LA 1KOAA 1OGTA 4PJHB 1OWWA 4X80L 1ADQH 4UT6H 3DX9B 5A43C 1JUFB 1A7NH 3O81A 5I74C 2VUYA 4OZFH 4LSVL 1NGYA 1D5ZA 4L9LB 1JMXA 3U2SB 5F1KC 3U4AA 3BRFA 1V7NH 5J1SC 3FONA 3C2SA 3C08H 5CD3B 1LP9A 1K2DA 3QUKB 3RKPA 5HHMD 4BK5A 3QUYD 1IFHL 1KCVL 4JJ5A 2WUBH 3K4ZA 1G9ML 1NCBH 4Q7DA 4PJ8B 1LHZA 1XCTA 4N5EC 3PV7A 2X7LA 4QRRD 5ACLA 5CILH 3O8XA 5IMOB 3TBSB 3H0TB 3WL9B 2HP4A 1NBVH 3GMPA 2ED9A 4NPYB 3IJSB 2NZ9C 5ENWA 2FX7L 2AERT 3OB0K 4HEME 4PJ5A 3CGTA 4Z7OF 2YWZA 5TQ2H 4Z77A 4TNVK 2ZCLH 4TOYL 5JQHC 2XXMB 3DYMA 5GRZA 5E08H 5L88L 4RWHA 1J5OL 1T89C 2IBZX 5C07A 3T0BA 3L6FB 3MJGX 3B83A 3MV01 3PWUB 4M43L 5F21B 2EXYD 3W0WB 3IXAA 2HRLA 4L3EB 4NWUH 1M7IA 3CD4A 4LSQH 3DYOA 5FUOL 3MXWH 3SKNB 3RBGA 5GSVB 3KYOA 3QXVA 1O7SA 3CC5B 5HVHB 4GKSB 5DF0A 2FJFA 1MCBA 2XY2A 3NMEA 5SX5K 5T5NG 5SWSA 2Y07H 4JFDE 5F70A 5HYJB 1GSMA 1K6QL 4EDXB 4HAGA 2F74B 5F7FA 3A6BH 5L8JB 1A7RL 4IBLT 2GT9B 5LWYH 2KUTA 4LQFH 1F4YH 1JNHB 1MHEB 4P2YA 5EN2B 4S2SB 1B0RB 1NBZB 1R5WB 4P23A 1H3XA 5EOCL 4JM2B 4BFIA 2QSCL 2WBJB 1P4BL 4Z7WF 1B9ZA 1KLGA 3N9GL 4R7DA 1RZ7H 2C7UB 2XWTB 3UC0H 2WLZA 1MY5A 2QKIA 3QDJE 3T65B 2A6IA 4G7VL 2X05A 1RURH 4KK5C 4RAHA 4IRJB 5HDQH 4HGMA 3BKCL 3MOBL 4LEXL 3V0AC 3LN5A 5FKPB 5C8JB 1OLLA 4JN1L 2H1PL 12E8L 1AE6L 1MCIA 1KCRL 1T1WA 3ECBA 2AI0H 3GGWB 4GFTB 5HVGB 1Q9KB 2R56L 1Y18A 2NY1D 4EDWH 3UYRH 4UV7L 3HAEB 4XVUD 1WT5C 3VD5A 1OF2A 5BVJB 3TN0A 1XF4B 4JAMA 1EHNA 4PJ8A 3U48A 1EFQA 5J12B 3B9AA 1WUNT 4NKMB 5EC2A 1GH7A 1YEJH 4W6XB 4EOWH 4G6AC 3DVIA 4AENA 3DMMB 2RIKA 3W39B 5BRZD 5BV7C 4N8CH 4YDIH 5DI8B 4LCCB 5KOMC 2O5YH 2V5TA 3IKCB 1WICA 4ZYKA 3FCTB 3OJDA 2DKUA 3QEGL 2VJXA 2HWZH 1HSBA 1MPAL 3RWGA 2YEZA 2F54E 2X5PA 2DQEL 3LD8C 1X7QA 3QXUA 1DBAH 5KSAB 3QQ3A 3V79C 3CAFA 5C0FB 1DN2A 5EUOA 2ID5A 4FQ1H 5EULV 1LE5A 4TTGA 4X4YB 5HVHC 3D2UD 4KRLB 4NUGL 1Z5LA 1ZGLA 1FO0H 4HZLB 5MI0B 1MJ7H 4NUGH 4JN2A 1I7RA 2M26A 4MA7L 3H9SB 2ZPKH 4IOFD 1KIRA 4YR6A 3L3OA 1Q1JL 1AXSA 3HFMH 3OKOB 5MEQB 1NAML 1KEGL 1G6RB 3LRHA 1ORSB 1TJHH 2NW3B 4QHUA 3TWCL 1NC4B 1BBDH 1IC5L 2W92A 1M7IB 1HIML 5CZXD 2NY0B 3GMMB 2KKQA 3CNKA 3PGFH 4P4KD 3HC0B 5F93C 4C83A 5GS0L 4KU1A 2NQCA 3N1GC 4P99A 1QQDA 5EU4A 5C0IB 1KCSL 2Y25A 3RDTD 5JZ7C 2A6DB 4H1LH 4GSDL 4XMKH 4MJID 4PJGA 4JDZA 3HMWH 5SWSB 4MCZB 4XMKL 5HI5C 3Q6FA 2H3NB 3RDTC 5JZ7D 3PWJA 2P8PB 3HUJB 1J1OH 1QBML 3H7BA 1G7MB 5DJ2B 1SEQL 4MNQA 2D03H 2F5AL 2ICES 5JMRA 2IPUG 4J3SA 4O58L 3ALXA 4DTGL 1NGZB 2WBJA 4ZODA 4ODXB 4LGRB 4DKFL 2XN9A 3MUHL 3EOAA 4WI5A 4PP2A 4PJEF 1EK3A 3TIDA 3D39D 1F4WH 1MQKH 4L4TA 2DYPA 2Q6WA 1MQKL 2CLVB 5TPWH 4MJIE 3EJZC 4HIHB 5EFIB 5IB3A 2H41A 5KSBF 3DRTB 1NUGA 1DN0B 4PJXB 1GL4B 3P0VH 1NEZB 3DUUA 3DOSA 3ULSB 4M1DH 4P5TB 1I4FA 3WD5H 5BMFH 5D5MA 1S7WA 4LCWD 3ORJA 4PIRF 1MRFL 4ZG1A 4X8JA 3K1KC 5FIEA 3ULUL 4PG2A 5FK9A 3FOLB 4MS8D 4I3SH 2OZ4L 1QACA 1UACH 3MZTA 2CIKA 1U8LA 2EICA 4FMKA 5EOCH 1ZHNB 1TMCB 5D5ME 2VAAA 2YC1B 3LKNA 3VFMA 3CFKB 5F9JA 5DMIH 1R5VA 1A6UL 4G9FE 4KKNA 3L5XL 4UINH 4X4ZA 4OFYD 4BK4A 3C60A 2F8OA 4Y19A 5J3HD 2R69H 4I4WA 4XCFL 3U7WH 2I5YH 5I73C 5JDSA 3KJ6H 3SCMD 4QXGL 3CVHA 3KXFB 3OKDA 3HG1D 4F9LA 2XZAL 3TYGL 4EIGB 1SJXA 3BN9C 4HT1H 4M48L 3PDGA 4NO2A 1PBYA 1G7QA 1M4KA 3IU3A 3G6JB 2YN5A 3CMGA 5I1LA 4TVPL 4LCWB 2XNAA 3LQZA 4GLRI 3BT2H 4QEGA 4JFDB 5D6CB 3IJHA 4WDIA 3WN5C 4TVPH 4QWWD 2JLLA 4ZFZB 2UVFA 2V9RA 3MO1A 1MVFA 1DDHA 3PL6B 3KYAA 4PY7B 4WHCA 1KTDB 1URLA 1KCSH 1BD2E 2QQNH 3O6FD 4WEBL 3L1OH 2EH8L 3V9FA 1K9TA 5L2JA 1BQHG 1XH3B 2R0WL 3BN9D 5HD8C 4KQ4H 4NC0B 3VRJA 2IGFL 3QPXH 2V2XA 3EYVB 1WCBA 3BJLA 4OZIF 3GSUA 1N6VA 2DQJH 1S7RA 1M1SA 1A9EB 1HWGB 1I1FB 3CDFA 2GITB 4FHBD 5JW3H 2JJSC 5EU7C 4YDKH 4U6XB 4ZXBC 1EH9A 4KV5F 1BD2B 4PJ7E 5TPWL 3FQXA 2W65B 4NZRH 1TPXC 3HI5L 5HYJD 1VKXA 3W5NA 1KTKE 1JPTL 4MJ5A 3RL2B 1RUMH 3NIGF 3GBML 1XGQB 2YD6A 3CVHB 3W39A 2XZQL 3QUXA 1MI5E 4MDIB 2GY5A 5CLWA 4Y1AE 1S7TA 4OLUL 3QWRD 4NJAH 2FHFA 4Q6IC 3IFNL 2OTWB 2R4RL 4JRYE 3D39E 4FP8L 3MRGA 2NNAB 1J0ZA 2BVTA 4QRPE 1NLBL 3MYJB 4TPRL 3SHSA 3RX7A 5HYQA 1G7JA 2UZIH 4L4VD 3EOBB 4N0CC 3X3GL 1EEUA 4NDMB 4X4XB 4PGCA 1H3GA 2AXFB 3JXAA 1PAMA 3NIFE 4PRIE 3QEQE 1FYTD 1JV5A 4WWKB 5HHME 1I1AB 2A9ML 3L3HB 4Z7VA 4H1LB 4DKFH 3QQ4A 4EN3C 3MLWL 4AZ8A 4XPTH 2IQ9L 4G8FA 3VFRA 1JHTA 1T21B 4YHIA 5ALCL 1N59A 3ZSTA 2IAND 4ZOEA 2PR4H 4PRBB 3MV8D 4AMKL 4NT6A 5LAXB 3O3DB 3PDOA 5GISH 1UM4H 4CVWA 4LPUA 1OB1B 1MEXL 1NMCB 2W9EH 2XV6B 1ED3B 3GIZL 1JK8B 43CAA 2FX8L 2XNAB 3LQZB 3PGCA 1N6QL 4NGHL 1MNUL 3VWKC 1Q94A 1UADC 5DLML 3I2CH 1FO0B 5C0DA 1KB5H 4LLDB 1QA9A 1S9XB 3A6OA 4HULB 4Y4KB 4Z9KB 2GJ6D 5EBLB 2D7MA 5EIQA 3SDCD 1UH2A 1WFNA 3OR6A 5CUSL 1J0KA 3LEYL 5EO1A 5ISZA 5GGQH 3TBTB 1R3JA 4TRPL 3HZVA 5IB2B 1DDHB 3PL6A 1GGIL 1L4IA 4PJAF 1FGVH 1F4YL 4BQ6A 3BE1H 4X9BA 1NFDB 5D93B 2G9HB 1H3WM 2F19L 4LVHB 1XGYH 2AJ3A 4GG8B 4RGOL 1PLGH 1I1YB 2A9NH 4G7VH 2CH8A 3BZFB 1VKXB 1G6RA 1RUAL 2A77L 4PJCE 5I30L 4YUEL 2G5RA 4X99B 2AK1L 3KYMA 3TCXA 3T04D 4U6HA 1YMMA 1I85C 1RK1A 5ECJE 5ITBH 1E28A 3QZWB 5F6HJ 4RX4A 4K2UL 4PRBA 5C71A 2MOVA 4W4OC 5SWSE 3RP1A 3WLBB 2JK5B 2AI0L 4HLZH 1NDGA 5C08A 1A64A 2XWBA 1A7RH 2GJ6B 2HFFB 2YPLE 3MGOA 3CX2A 4FTVA 4LLMB 4NOFA 1D5XA 1MAKA 3VGFA 4FP8H 4JHZA 2NR6D 3SO3C 3H9SE 5A3ID 3BRDA 3L3IB 1Q94B 3TV3L 2P5WB 1TZHB 2V7NB 4ODVH 2O5ZL 2D7QA 4LASH 5DQ9A 1SHMA 4DUXA 5F44A 4YX2L 4PGZA 2ATPA 3H42L 3MYJA 1HK6A 3RL1B 1RIUL 3EOYG 1DQQA 4WO4B 4PR5A 2E8YA 4LL9A 3O45A 2VDOL 3PP3K 3TBTA 4DZ8A 2FDBP 3T3MF 3B2UC 3QIWD 5E6ZA 2VR5A 4EN3B 5JW3L 4N1HB 4HXAL 3S9DB 4PD4K 3P4MA 3HI6L 3ZZ1A 1R3KB 1ZT1A 3ARYA 3V52L 4RWYL 1JGLL 1KCKA 4RFOH 2FGWH 4Y16A 4N0FB 3H0TA 3WN5A 2FR4A 1OSZB 5I73B 3WHE0 3HR5A 3FN3A 5I17B 1MRFH 1U3HA 4NT6B 3FQTA 3QPQC 4LVNB 5IFHH 1CYGA 3MRNA 3DI2B 1V3KA 5FV1L 1ZSDA 3FT4A 4OTXH 4D0DB 4MMZC 5IJVB 1EJ6A 4PY8J 3U30B 1K8IB 5LJYH 2QKIB 1LD9B 3RTQC 4R96A 4OIBA 3KPSD 3L3HA 5DK2A 2JTDA 5J9PB 3BPLB 1OF2B 4J12A 3HUJF 3VFOA 2BRRL 4AM0A 2ICEB 2IPUK 4HUVB 5EBWB 1CL7I 5DEGA 5DD5H 3JUYA 2DICA 4WTZA 3C5SB 1CGWA 4GAYA 2FJGB 1T1WB 3ECBB 1YEFL 2RQ8A 3EUUA 5HXMA 1AQDB 1OM3L 4GRLC 1N2RB 1G0DA 2EC9U 1OM3H 3U9UB 5I1GH 1D5BA 5EU6D 2BXYA 3CFIC 1TCMA 4HX1A 5I75C 4LCIL 4PBXA 2CSPA 3S96B 1YC8A 5IGXL 4K3EL 1TLKA 4I0PB 2WBWB 5CZVL 1OAQH 2HKFL 4XC3L 2AS5M 4KVCL 3QH3A 4AK1A 5I1JH 4JPIA 2BDNH 4OM1L 3QIBC 5TE7L 2A74B 2UUDH 3ZYIA 5E5UB 5HHQB 4O2EB 1D6VH 1S7UA 1WAAA 1IGJA 4ZFGL 5DGQA 5FYKE 3UTZA 2ZKHH 2VC2H 2ED8A 3O3AB 3GMNB 1I9JH 1SYSB 3BXNA 4CN1A 3VXQA 2DMCA 4N1CA 4KY1H 1V3JA 3RFZC 2JK5A 1P4IL 2JELH 4XRCA 2BY0A 3UDWC 1ZSDB 4WUUA 3S34L 1WWBX 2ADJB 1RIUH 4UQ3A 3WNMA 1RZJC 1CXIA 5D71H 2EXWD 1FE8H 1DZBA 4ZTPL 4X98A 4DUWA 5J06A 5HGDA 2R8SH 1TIUA 2DQJL 2Y6SD 3N0PB 3VCLA 3ARXA 3SQOL 5E4EC 2E7HA 4K3GA 4IRJD 3GHEL 1YPZF 5LGHL 4U2ZA 1KN4L 2APBA 5F9JB 4N9GA 2IPKB 1HILA 4WV1B 4LGPB 3QDGE 4Z7UE 1RZGB 3G6JF 4U33A 2Y5EA 1ZV5A 3V95A 4NM8L 3WS6C 5HHVL 4LPXA 3G6DL 2CIIB 5DURD 3E6FA 1GC1H 1K6QH 3L7FA 5KOVC 3G08A 5DJDB 2PW1B 2AK4A 1X6LA 3G5VA 5BW7C 1X6NA 2RBLA 3ARDB 3EYOA 5HI3D 3DURB 4X83A 3QH3B 5IBTH 4MHHI 4PJDF 3O3EB 1CCZA 4LVEA 5DRNA 4YX2H 5IT2L 1FN4B 4F7CA 3IDYC 1CE6A 5MP6L 1P5UA 5HJ3B 1SYVB 2BNRA 3GI8L 2JJWA 4DVRH 1A8JH 2Z92A 3MLPA 3QIUB 2IANB 1FSKB 3NA4A 3C08L 4RNRB 3RVUC 1ZHBB 4XPTL 5C0IA 4UDTA 5AUMA 1OW0A 3B3IB 1E28B 3ZKNC 3L3OB 4HF5L 3WN5B 2IGFH 1AIFA 2OR9L 3EYQD 4HAFA 5T3ZD 2GSIB 3FAXA 1U6AH 4UU9A 4MWFA 4X6DA 2DQTH 3EAKA 3X12A 3OWEA 1NBQA 3Q2CA 2CJUL 3KHOA 1YN7B 4GBXA 3CSBA 3WO4B 2GAZB 4U1SA 2CO6B 1BVKB 5C0AD 5DURB 3VWJA 5CGMA 4GRWE 1A6VL 3VGAB 3BESR 2DS4A 1IGCL 4L4TB 5HHOB 4X7FC 4K94H 2PW2A 5C0ND 4FQIH 4WI9A 5T5FH 8CGTA 3EIFA 4RFEA 1RUKH 4BZ2H 2CQVA 3V4PH 5E7BA 2EYSA 3WFDL 3F6LA 1A3QA 4Z0XB 3QDMD 1YYLH 2NTSP 1U8OA 1A14L 1RUPH 1KJ3H 4NUJB 1O0VA 4GMTL 4QHMB 4PV9A 4GG6E 4CVXB 4O4YH 3WKMH 1RUPL 5D7LB 3I9GH 3IGAA 3OSKA 4LAQL 4U6VH 5A2LH 3D6GA 2VMFA 3MLVH 3QUMH 4HX1B 3U30C 2J6EL 3WUZA 4G6FB 1FVDA 3RGVC 3BVNB 3WXWL 5KS9A 3ULVF 5F89B 2R23B 3UTPD 2Y06L 3ZT6A 2Y5TA 2QQQA 3BFOA 1AO7A 5JXEC 5IHBA 1SEBB 3PWVB 1RUML 2AJVL 2AKRB 4JVWA 5L0QC 1QSEE 4D0DA 3W0WA 4B7IA 3LN5B 5D2NC 4JDVA 5F9DC 1OTUC 3C8KA 4OUUA 1A6TA 2OR9H 2Y1VA 3F7VB 4KFZC 5GXBB 4LQFL 3S35X 2DQTL 2VAAB 3DX6B 3NFPB 4FZEL 4ETYA 3RVVD 1U3ZA 1Q9LB 1NBVL 3MCKA 5D9SB 1XH3A 1B3JA 3TA3D 2KDGA 4KI5D 1A3LL 1UZ8A 2H6PA 1UXSA 3JV5A 3ARBC 4GRLA 3TA3C 1UXWB 4M5ZL 2JJVA 4UDTB 3P4MB 2PYEE 2F74A 2BFVH 1MJ8L 4NJ9L 5D7LD 5JNYB 5C0BB 5GGQL 3IJYA 2LU4A 4NFCA 2IADA 2EECA 4RA0C 3ZDXF 3HRZB 5ALCH 1HILB 2HWZL 4OJFL 4QOKB 1DEDA 1FYTB 5CIPB 1F3JA 5GGSY 5H94A 1CE6B 2BHUA 3EDFA 1XCTB 3MV7E 5DRXA 2OL3B 1N6QH 1MNUH 1P7QD 4HUNB 1GC1L 3LKRB 1IL1A 4UMGA 2PO6B 3ETBF 3VFRB 2WIIA 4J3OC 5TFSL 1HZHL 3LCYA 1XF5B 1MCEA 2Y06H 3RTQB 5BXFA 1U3JA 1NFIA 1FAKT 4XMLL 5E56A 3RUGF 1BBJA 4KI5F 2DTSA 4OKVB 4P49A 3MRFA 4YK4C 5F3HA 4WFGD 2DWDB 4XMLH 4J3VA 1H9VA 2ADIB 2M8XA 4Z6AT 2QSTA 3AAZB 4N0YH 5GRYA 3PWNB 1BVKA 3SDDA 4W81A 2BRRH 3LEXA 3JV4A 3AC0A 1KYOJ 4OZIA 4CJ0A 5DEFA 1A14H 4XNZB 2IAMB 5B3JE 4WW2A 3RVTD 2BC4A 5INCA 3V5HB 5TDPB 1VFAB 2AV1B 3V5DA 1CD1A 1WC7B 1MFDL 2OXGA 4OD2B 5F6HI 5HHXH 5FA3A 4KHXL 4R0LA 3JWNC 2ZCHL 4HQQL 4ELME 1KTRL 5E6IC 4NQSA 3EO0B 4KJQC 1Q0XL 2XOTA 1AXIB 1VENA 3FQXB 3IFPB 4HT1L 1ZXQA 1FO0A 5ITBL 4IIQA 3HUJA 3QDGB 4WNQA 4OB5H 1EJOH 1DANU 4L4TD 2BNQB 1NKRA 3E1F1 1E6JH 4L8BA 3BUYA 5I1HL 4H1LG 4KTEH 1T0NB 3LIZH 5IQ9A 2XQYK 1RHHA 4FZEH 3KWWA 3V7AE 2R2EB 3QEUA 3CSGA 3LHPL 4XXCA 5DRWB 3O2DH 1GZQB 5IKCA 2W9DL 2ESVD 2N4IA 4H1LA 3JWDH 3S35H 4D2NA 5I17A 3HLAA 3KNBB 1W0VA 1HXYA 1MAJA 2QHLA 4I77L 3BVNA 1L6ZA 3GSNL 4M6AA 2P45B 3S36L 4XP4L 5D7JD 4M7LT 4Z0BL 4BH8A 3A0OA 3MV8E 2VLLB 3WXWH 3EDJA 4OJFH 4Z8FL 1Z0MA 1MVUB 1FCGA 1MPAH 5DK2B 4WGVB 1SQ2N 1I8MA 3BOVA 1CDCA 4M02A 1LE9B 3E2HC 3MGTB 1CGSL 4XHJD 4TUOB 4JN2B 4UOW0 1XZ0B 3O4LE 1W2KT 1NBYB 3VGBA 1I7ZA 1EZVY 3OKNA 1TTUA 5JW4Q 3D85D 1F8TL 3TYGH 4MGXA 1CDUA 4LPVA 4ODXA 4XVTH 3KPSA 3U6RA 2A6JA 5C0FA 4FQJH 3HPJA 4YHKL 4OCMC 2P5EA 4E41E 1AGCA 1OLZA 5F3BB 3TWCH 1JYVA 1ZGLM 2FNBA 5JORA 2XZCH 1LO0L 4PBVC 1K8DA 1KNOB 5HGAA 2XWBB 2VO5A 3MOAL 5L6YH 4O02H 5DJAA 5DHYB 5DC9B 4YDLC 4JKWA 4P0DA 2VDPL 1Z9OA 5F7NC 1F4HA 5DZNA 2Y5TB 3GK8L 3GHBH 4JRXB 4LKXB 3NA9H 1MJJA 2CXKA 4F3FA 2BY2A 3ZO0A 1F2QA 3SGDH 3NA9L 4U6YA 3CU1A 3X17A 3N06B 3I3BA 3B5TA 4JVUA 1FC2D 2FX8H 2NYYD 4KJWC 3EW3B 1KT2A 3SE3C 3NZ8A 4Y5YC 4DKEL 4MA8L 5CJBA 3TN0C 2IMMA 4KTDH 2C3HA 3UEZA 3D18A 3VFVB 3CU7A 5E8DL 1WBZA 3BRGC 5DR5H 5ACZA 3LAFA 3RWIA 1JHLH 1HI6A 4KQ3H 2IF7A 5FOJA 4I3RH 1T66C 5FUZL 3PWNA 2Z4QB 1EBPA 2VH5L 4I0PD 3U1SH 5K9JL 1P9MA 2B4CL 2G2RB 5A2KH 4M3KB 4NO2B 5A2FA 3QWRA 4YHKH 2P8LB 4NZTH 4OFIA 2HFGL 2VERN 2NY1C 3M1BA 5DRWA 5C07E 1F90L 2OBGA 4OT1L 3LZFL 1WZ1L 1IGYA 2NXYD 4GXVH 4YHPB 3KPOA 1U3HD 2PCPB 3GSWB 1UM5H 5SV4A 3U0TB 5E1AA 5BQ7B 3QI9A 2F9BT 4QOKE 4R26H 1MREL 5DJZA 2Q8AL 4EZMA 4M1CD 3EFDL 4GUPA 3TO4B 4LIQE 4NRXB 4JFQA 2R56H 2YK1H 2IANA 3ZKMC 1R3LB 4E9LA 4QXGH 2R29L 3GO1H 3LH2H 4NRYB 1DLFH 1JPSH 3HC0A 1VEOA 4C83B 2BNUA 4XH2B 3BQUA 5IQ7H 1MWAH 3S3JA 4E42A 2W0FB 3DUHA 4PJ5B 4NSKB 3ZKXB 2APXA 2R0ZH 1TVHB 4KZEL 3KDMA 2YD8A 2MQ3A 5F1SA 3S88L 1H3UA 2BSED 2GEEA 4L3AA 1GAFL 1XFPA 3LV3A 1A7BA 4M9PA 3LEVL 2D03L 1T0MA 2F5AH 3FO9A 4J4PC 3T77A 5CMAB 3OMZA 1FPTH 1KV3A 3K8KA 5D7JB 1MJ8H 4NJ9H 3S36H 2QQNL 4WEBH 1N5YH 3IT8D 1N2RA 4ZDHA 4HCRA 1NGXA 3U0WH 5D2LE 4N9GB 5MEOB 4K9EL 4YWGL 4ZSOA 5GSVA 1OPGH 1S7XB 2VDLH 4RGOH 1INQA 5IMKA 5LCVH 1DR9A 4JM4H 3FQUB 4IJ3C 1HINL 4FQJL 4XPBH 1LNUA 3RVXD 1T6WA 5TJWK 5C8JA 3ULUD 2QLVB 1S7TB 4CDHA 2PYED 2IH3B 1T22B 1MH5B 3NIGE 4I18B 4Y0GA 4WEUD 3EFDH 2MKLC 3WMSA 3GSOB 5T33L 1U8LB 4B41A 1C1EL 1FVEA 2MFNA 1IAII 4NHCH 1CTOA 3SDCC 3CFCL 2N1KA 3PXHA 2PTUA 3FTGB 4RRPG 5JUEL 2L7JA 4WUUE 4OAWA 4LOUC 4HKXB 4JLRA 4M62H 2R1YA 3FO0H 2HLFC 4WVRA 3CX5J 2UWEF 3C87A 4XNQA 2ZUXA 1KB9K 4FTVB 1BZ7A 3QDAA 4GG6F 5KVFL 1HN1A 4AEHL 1CE1L 5I71B 3SEPA 3IF1A 3B43A 1N59B 3LDBC 4NC1E 1BLNB 1FNGA 4QWWC 3QULB 1I1RA 3TJHD 5IK3A 4POUB 5J6GA 4IOIB 2QADB 4L4JA 4HXAH 2DQGL 2J2ZA 1JYNA 5AD0A 2IQ9H 3GSRA 1IAIL 1L7IH 3NAAH 4PD4J 5EBMA 2ZSWB 1X5AA 3BAEL 3QHTC 4RGNE 3BKYL 4O2CB 2PW2B 3S4SB 4U0QB 3CXHK 3LKSA 1FZJB 1I7UA 3VMOA 1YEIL 5DWUH 1TJGL 4HIXL 1U8NB 2O5XL 1KB5B 3H9ZA 3WIHH 3RHWK 3EZ8A 1U8QA 4HPOL 3TNNB 4LSSH 5FFLA 2OX5A 2Q3AA 2W91A 1QUNA 2DYPD 1I85A 3HCVA 4JFOB 4C55A 4M7ZB 1TQCB 1BIHA 2EDNA 3NN8A 3SE4C 2HMID 1QRKA 3BYTA 2O5YL 5T3ZE 1MI5B 3FRUA 5F1NB 4X8XA 4W6WB 3BMVA 1UGNA 3JTTB 2VWEC 2YS4A 3HC3H 4CKVX 1NH6A 1O7VA 3LKOB 2VKXA 4ZOBA 4S0SD 5I74B 1CDGA 4A6YB 4P2OC 4PYHA 1OPGL 4I2XA 4UBDD 3S5LB 4PV9B 5DFTA 1YN7A 4OCXH 4G6ML 3THMH 4DZ8B 3DXAB 2R29H 1E27B 1FO0L 3LH2L 3BYYA 3ARGA 4ZS6D 1BFSA 3ROOA 2H2PD 3LQAL 4RFEB 5DFVC 1G1CA 1CXLA 4N90E 2Q87A 4AIXA 5I0DA 3G9AB 1IILE 3O6KH 1EJOL 4XC1H 1A3RH 3I02B 4U1LA 5F9OH 2NCMA 4U1JA 2D7PA 4NRZA 5T3ZL 3DVGB 1S7QB 1NFKA 1M05B 3AY4A 4P48A 4FFYH 5J11C 1IGFH 2DYPB 4RMQA 2Q6WB 1DVFA 4MSWA 2P24A 4JFXA 1X9QA 1VGKB 4HV8B 4G6KL 3QRFM 1ZVSB 4NQDD 2EO9A 2O5XH 3RRQA 1BPVA 1MCFA 1IAOA 4HC1H 4FXKB 4GKOA 5HHOE 1VFMA 5GZOD 4OZHE 2HT3D 5LBSH 4GG6B 3I6KB 4WFED 3RDTA 1UVQA 5HGBA 4WO4D 1P7HL 1BMGA 2AEWA 4ELMB 1A02N 1A7PH 3TA3A 5LCVL 3UDWA 2C1PB 1A7PL 4JZNA 2AV7B 3OKLB 2VTFA 6FABL 1QFWH 1FQ9C 1V5JA 4CRPA 5IJKC 5D7IE 4QXUL 4XCNB 2V5SA 4NZRL 5DJ8A 1RVFL 5E8DH 4ZO8A 2GTWA 2F5BL 4PRNA 2JE8A 4BSVB 1LO4H 4KMQA 1FL5B 4AG4H 3AAZA 3KPQB 2DLGA 2CKBA 2NY2D 1OOAA 4PJGE 3FONB 4MAUL 5DK0B 3GB7B 1CD0A 3BEWB 4MS8C 2BY1A 5JUEH 4O51B 1JYWA 3QQNA 3IJYB 1QEWA 1NLDH 5C92A 3J8F7 1P7QA 4I77H 4XC1L 2HN7B 3QXDA 5FO9A 4AY0A 5F9OL 2CDGA 2FJFB 1V05A 4JB9L 3C5SA 4K7FA 1IGJB 2VUOA 3TZVD 1S7XA 4QTIH 4Q74A 4HJJL 5E2UH 3TVMB 1GPOH 4I2XB 3T09A 3GSQA 1NEZG 5FO8B 4G6JH 1EEYB 1T1XA 3BDXA 4C56B 5C0RL 4MXWL 1YN6A 3W5MA 1PW3A 3K80A 1OSPH 3UBXB 3CIQA 2YD9A 3VXOA 1PX3A 4CUCA 1YDPB 2OTUA 2VQUA 5I76A 5E2WH 4JM2D 5FUCE 3S37L 4I3GA 1QP1A 4P3DB 3VXMA 4D8PA 5E9DA 3RWFA 1K3ZA 3RJDA 5CAYB 5C1MB 1CFNA 3FT2B 1WWCA 1D3CA 4YC2C 4H5SB 4MQSB 2ENYA 4LF3A 5BOZG 1SJHB 3MCLH 1FL6B 2P44B 4LLVA 1NANI 1C08A 3FQRB 4MB3A 1XAUA 2V7NA 4X9FA 4D0BA 3KPPB 3DVNB 1OY3B 1W0VB 2WK2A 3MV11 4GMSH 4JANA 5DD1H 1FVCA 4PRIA 3S5LG 1HQ4A 3VXUD 4N8PA 4Y8DC 2XTLA 3HI1A 4GLRH 2Q76A 3FMGH 3O0RH 4G43A 3KR3H 2FEEL 3KWWB 1KC5H 3L5WA 1UWXK 2CLZA 1A6AA 5CJQL 5I1DB 5L0QB 3GSRB 4OZHF 1M7DB 1I1AD 5FYKU 1HHIA 2A2QT 2NY6D 4PG9A 3FRPG 4LSUL 3MLRL 1AFVH 3U36A 4N0FA 1CQKA 2PF6A 2VLKA 5ANME 5E5MB 4X6DE 2EDHA 3ABZA 3KPMB 1CBVL 4MQ7B 4S1DC 4JZJA 4OM0H 5BS0A 3ZLQC 3IDNA 3RZCD 1MHHA 3GB7A 3MQIA 1U8HA 1DL7H 1T4KA 4D94A 2YK1L 4MNQE 4M4PA 4GAGH 5HY9B 3IFNH 1T5XA 2R4RH 5E2TH 5AEAA 2H8PB 1W8NA 5E2TL 4P4KB 1NQBA 3QCUL 3BWUC 5F71A 3CVHH 1ERNA 3STLA 3CXDL 1YEKL 3S6CA 1QSEA 5KSBA 1YEGH 1T3FA 1Y6NR 1EHAA 2HT4C 2BNUB 1AO7E 5EA0H 4JFEA 5MENE 4G42A 2GUOB 4HJJH 5E2UL 5MP6H 1ORSA 1I8LA 3EHBD 4PJBA 5IMMA 1IRAY 2NXZB 1E4WH 2XXCB 3WO4C 5IB5A 1JF1B 1UB6B 1CTNA 5LAXA 2H2PC 1E27A 1BIIA 2H1PH 2IBGA 3BQUD 3P4NB 2ZUVA 5CEZH 3LKQB 4KK6C 1X5ZA 1L7IL 4NQCE 1G7LA 1IQDA 5DS8B 4K9EH 3GMRA 1YNLL 4E41D 3MROB 3W9DB 1U3HC 5I1HH 2AP2A 1M05A 2XA3A 1SMAA 2EDKA 5HPMA 3DVNA 1FFOA 4R2GB 1NC2B 4MXQC 2DQFB 4HWBA 4Q0XH 4YHLL 3PUCA 1OAXL 4H0IA 3EOTH 1XGRA 4OLYL 1FLRH 1I8KA 2AEPH 1QLRB 2EDXA 1ND0A 4LF3B 4QY8B 5EH1A 4EUPH 1KFAH 3AFLA 4Y89A 1VESA 2HMIC 5F7DA 2EDRA 3ARDC 3NFNA 4HZLA 4PTTA 5T1DL 4KI5E 5HI3C 3HMXL 3GSNH 2VLMD 5E95B 2OM5A 4EBQL 1AHWC 4ZS6C 1SJEA 2GY7B 3QQ4B 4WFHD 1X3DA 4XNZC 1X5IA 2DLEA 3VXOB 3JTSA 3MC0A 3MREA 4MA1C 5E8OA 1UQSA 2YUWA 3RIFF 1CLCA 1LO5A 5AYUH 3U4BL 2X70A 2V5YA 5D2LA 4ZO9A 2DLFH 3PHQB 3WJJC 5I1IL 4UILL 4M6ML 1DBAL 1PKQA 3D9AL 5GS0C 5C0GB 1AQKL 3B9KB 4OD3L 1YEDA 4FOMA 3WJLC 2ARWA 4MLIA 3KLAB 4I9WD 1XF3B 3W81A 3CVIH 2QSCH 4UTAH 4R7NA 2HKFH 3DX7B 1EAPA 5DZOA 2R2BB 3DO7B 4Q6IA 4QHLA 3RBSA 4QRRA 2DTML 5F7KC 5KS9E 4ODHL 3NGBB 1JZ5A 3L7EA 4EXPX 5LXGH 4JZJB 1A7QH 1HQ4B 1AO7B 1NUDA 4HMDA 4XNMA 1QVOA 5BVPH 2VXTH 4PJDE 2FSEA 3MBXL 1IL1B 5I1AB 1NC2A 3TVMA 4YDJA 1U8JA 1G7PA 3LHPH 3L5IA 3WIHL 2QBWA 1WVZA 4FTVD 5MEQA 3FCTA 2Z0BA 1WIUA 3UYRL 4H20H 4BZ1H 1YECL 5CEXB 4X6FB 5E9DE 4H20L 4EN3A 4OI9A 5IJVA 1B4JH 3TO4A 1A1MA 4FQCL 4FQ2L 7FABL 1SM3L 3QUYC 4EVNA 1IAIH 3VXNA 2R0KH 5CCKH 4G8GA 1CT8A 1KTDA 3T2QA 2VAJA 2DQHL 2W07A 3QEQB 4X7EC 2ICEA 3O11A 5T1MA 5E2VH 3U46B 4ZFFB 1P7QB 1FNLA 2SEBB 4LEOB 3WFDH 3S35L 3O2WH 1OCWH 2P5WD 2X4QA 2FZ3B 4F9LC 3VD7A 1G6RH 5CJOL 4GAFB 5FAAA 4H25A 4M8QB 1DQQB 1U92B 4LLUB 4FQXB 3U6RB 4LAQH 4JO2H 1BF2A 1GHFH 3BUYB 2NTFB 2BSTB 4L4VB 4IDJH 4ZAKA 2JB6B 1H15B 2VYRE 1YYMH 3X13A 1NCUA 4XWOC 2W60A 3IDMB 1S7QA 1V8HA 4XPFH 5KBNC 4X0KA 4X5WA 5CD5C 3IFPA 1FBIL 4HMEA 4YHML 5T3XL 2I5YL 3BD5A 1G7HA 3DSNA 1K2DB 4E5XB 2PYEB 5ISZE 5F96L 1MLBA 3NFSH 2CUMA 1S7WB 1AC6A 2W59A 1HHJA 1JWUA 4WW1B 1NMCC 4YXKH 4TVSa 1W0WB 35C8L 5IGXH 3BZEB 5DZLA 4NKDB 2H32H 4MJ2A 1A6VH 1JGDB 3JWDC 5KSAD 4ODSH 3UX9B 4NQEA 2NY5L 4Z95H 1PQZB 3VA6A 1XCQB 2FGZA 3MNVA 2R2EA 2ZZUT 1K8IA 4POZC 3I3EA 3UXFA 4PJCB 3MRIA 1J0YA 4OZFA 3QDJA 5F8RC 4KK9D 4PLJD 1MRDL 2M2DA 1ORQA 3S97C 1FNFA 2DM3A 2B4CH 3TIEB 4XTRC 2VABA 3HAEH 3SE8H 1MHPH 3BGAA 4GAJL 4Q97A 4XP1L 1AR1C 4JO4H 1JN6A 2ICWJ 1MCKA 3QIUC 3VXTA 2HT3C 3FO1B 2MCPH 4IOIA 5CJQH 3O2WL 3QNZB 3U4BH 3KXFE 5DJ2A 3GJFB 2DI9A 4YQXL 3C8DA 3QULA 5BJTB 3SJVB 3RQ3A 2IAMC 2XKNB 4NKIL 4TSAH 3FT3B 1K8DB 1KXQE 5JA8B 4HV8A 2JB5H 4P3CH 2D9QB 2P47B 4KRPB 2Z92B 1FZJA 1I7UB 3M1BB 5INDB 3PDDA 1LEGA 2R15A 2PUQT 4R26L 4E0RB 2A83B 4K7FB 3MODH 4P2QA 4PJXE 1N8ZA 3KG5A 4K3JH 3HPJB 1MJJB 4K8RD 3UJIH 1MFCH 3BP4B 3GZKA 4NNYA 3NN8B 3SO5A 4YHIB 2DRUA 1CLOL 2E9WA 3GRWH 1CL7L 4NZTL 1OP5K 3O8XC 3LQAC 3BZ4B 1WFOA 4WU7A 3OJVC 2JCCB 5H8DA 1GGTA 1KNOA 2W65A 2YZ1A 3FOMA 5KANG 4HIEB 1X4YA 2H32B 2FJGA 4GAYB 4KUZL 2ZG1A 4QRPA 1GPOL 1LK2B 3P4NA 2YA2A 3D3VA 1HYRC 1E0OB 3VGAC 1ZANH 5B38A 3WLWD 4LKXA 5DTFA 3CFDA 3EYVA 12E8H 5E8NB 3TBWB 1BEYH 4EN3D 3V4UL 3KPRA 3H3PL 1Z0NA 1CIDA 2E7LA 1FFQA 2K1MA