1N7ML

Germline 7g12 with n-methylmesoporphyrin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
216
Chain Sequence
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCTRRDSDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Germline Metal Chelatase Catalytic Antibody, chain H
publication title Structural evidence for substrate strain in antibody catalysis
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 42
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2002-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n7mL01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1n7mL02
3GSOB 2A1WL 3Q5YA 5HHOA 2AJZA 3CUPA 3U9PH 4HIHA 3SPVB 3SE4C 4ZSOE 3BPNC 3RX8A 1LP9B 2HKFL 4LLUB 3N1PC 1WITA 1IGCH 3ARRA 3MRLB 4G42B 5KG9B 4L3EA 1S9XB 2YD5A 3WNPA 1X5JA 1X4YA 5AD0A 1VFBA 3IJYB 2X70B 3IXTB 4HWBA 1AJ7L 1URLA 4WWKB 4E42B 1KCKA 2Y72A 3C6LB 4PJDF 3WO4B 4XPGL 2X44D 2KKQA 4TNVF 5F7UA 3V0WL 1CICC 5JUEL 4MA1B 2IALA 3H9ZA 3C6SB 3D39D 1H3WM 4KMTH 3BP4A 2YSSA 1YNKH 5ETUA 4JQVA 3ZDYF 3EYVB 4XWGL 1RQ5A 1LQSR 1OF2A 3ZTNH 1IC4L 1YYMH 1LO3L 3VA6A 4B7LA 3ULSB 3GI8H 3C5JA 2HT2D 3CC5A 4ZG1A 3B43A 5CWSA 3U4AA 2IPTL 1DANT 2MSPA 2MJWA 2R39A 5IBTH 5F1IB 2ESVD 1KF9B 1EH9A 2BNRE 5CAYB 2Q1EA 3TF7C 1FZKA 4OZIA 4PRHD 4Q58C 3B9KA 4UT6H 1NAML 4IRSA 2AJVH 3VXUD 1HHIA 4HK3N 3ZYJA 1R3LB 1A4KB 1NL0L 4YHNB 2HLAB 5EU6D 1H3PH 1DQTA 5DJ2A 1KT2A 1ULVA 1U3YA 2XQYK 2E7CA 2F53D 3I9GH 5DQDL 1E27A 3BYTA 2H3NA 1LDPL 1EJOH 1DE4B 4FFWC 4KKBC 4ZFGH 3FO9B 1NFKA 2CDFB 2GYSA 2X4OB 3QNYB 1FRGH 2VXQH 5FB8B 3SGDH 2J8HA 3F5WB 1D5ZB 3D25A 1JPSL 1XIWB 5ID1B 5M7QA 3DO7B 3UMTA 3VFMB 1QBMH 2HP4A 1IGYA 3PWLA 4IRZH 5D1QA 2HJKA 5D2LA 1A1OB 5DZLA 3H0TA 4DOHB 4Y8DC 3IFPB 3WJJC 5KSBF 1CFNB 1HILB 1CXKA 2E27L 4N68A 4Y1AA 3BN3B 4JRYA 2R56L 2EKJA 1PG7L 4S1RH 1MFAH 2WV3A 4JKPH 2WLZA 1UM5L 3PWUB 2H6PA 2YEZA 1YMME 5AWNH 3RWGB 5ISZD 1CGUA 3R1GL 4HMCA 1F6AB 3BH8A 1JE6A 4JY6B 1J87A 2VAAA 3B2VL 1AXTL 3KJ4C 4OAWB 4MGXA 4NUJA 3IVKB 2XRAL 3VXNB 3QWRA 3ARGD 1MHEA 1MJJB 2PYFB 3HE6D 1GPOL 2I9LA 3PV7A 4JFXB 3RL1B 4K23H 4R0LA 3DIFA 43C9A 4HIJA 3ILPB 1QLRB 2JIXA 3ETBF 3CMOH 3RL2B 2P5EB 3CVHB 5GGSY 3GGWA 2Z91A 3C09B 3VFRA 2EYRA 3UBXA 2GIYA 4M3JA 2VXSH 4G9DA 4ZUVB 2UWEE 3BIKB 4CBPA 3VGEA 1U8IB 1ZHLA 3O4OB 3IU3A 1WEJH 2VYRE 3RVXC 1JI1A 3CAFA 1JNLH 5T33H 2CRIA 5KZCB 4GRLC 2AJSH 3T2OA 3QNXA 4KI5D 3L95A 5ERWB 4RQQA 1FNFA 4OLZH 3CDYA 4F58H 2J2ZA 1MCJA 1G9ML 5ID0B 1CLCA 4EUPB 4GW5B 5DMKB 3RPKA 2VQ1A 1UKQA 5EG6C 4OZGF 1UG9A 2WIIB 3GEWB 1NC2D 3E2HB 4FQXA 5DD5H 1D5MB 1PSKH 3MRDB 3MO1B 4MJIB 3QH3B 5CSGA 4MD0A 4PGEA 4KRPB 5DT1L 1YY8A 5I9QB 4OLWL 4NYLB 1AFVH 5CKGA 1A2YB 2XQYG 3KYKH 3T4AB 3KPPA 4KRMB 3EJJX 5KAQG 5I1AA 2DF3A 5IMMB 4X6DA 2DLEA 3WFBH 1IL1A 3GSXA 3MCLH 1UQSB 5GS1B 4IEFB 1HHJB 3HTLX 5D1XA 3QDMD 3P77B 1I9JL 1MHCB 2BNRB 1B3JA 1EHXA 4PJXE 3RY5A 1DLHA 3WE6B 5I6XB 3TWCL 5MEOA 2Y25A 3QUZB 1AHWA 4GG8A 1FE8H 4Q0XH 2YOCA 4JQXC 3QAZC 4HKJB 1G6RA 3CX5J 3SKNB 3FT3A 1XZ0A 4LF3B 5JW5B 2W65A 1RZJL 3HLAB 1P7KB 5DR5L 3U9UA 2ZSVA 1AR1D 3DROA 2JCCA 2F15A 3M8OH 2NW2A 4PGBB 5IK3B 4ERSH 2BNQA 2YPLA 5CIPA 3QCVH 2ICEB 5FKAB 4KVNL 1TMCB 4L4JA 2QQNL 1UJ3B 5B3NA 4DCQA 4UV7H 3ULVL 1TJHL 5J6GB 3VGDA 3P4LA 4NGHH 3VI3F 5CBAA 4KGLA 1FSKC 4O9HH 5I1KL 4OLEA 1U3JA 5GGSA 3SE9L 4FQCH 3WLWC 5CBEB 4M93B 2ADJB 4BK4A 3VGFA 2VXTH 5MEQA 3QUXD 4QRRB 4YDKH 4HSQA 5FYJE 1FFRA 1AD0A 3QDGD 4JY5H 4UOJA 5BRZB 3ULUL 1Z9LA 2AV7B 2EXWD 4Q9QH 1GXEA 2DQIH 1HQ4A 2J4WL 4K07A 3CFIC 4PJ5D 2OTPA 5HYFA 1FL6A 3DV6B 2AXHA 5FCUL 4WY7H 5GS0D 1HK6A 3NTCL 4YHPA 1YMMB 4UIMB 3RDTB 1OP3H 3K8MA 4HMEA 3MRMA 4POZD 5D7KE 2OL3A 4P2RA 3F12A 1HNFA 2GTWB 4KK6C 1F6FB 4ZS7L 1N0LA 2CIIB 3RI5F 1A4JA 1WBXA 3RUGA 2IQAB 1A0QL 1DBKH 1VACA 3CVHL 1IC7H 2GAZA 2J8UA 4N8CL 3PDGA 2P7TB 5DJDB 4OZIF 1VFAB 4X5WA 1QFWM 2X4PA 3BUYA 1F4WH 3O3EB 3AAZA 2AV1A 1G84A 2UWEB 1BZ7B 1K8IA 4WO4C 1WTGT 5F3HB 4JY4B 3IU4H 4EXPX 1U8MB 1U95A 2K7PA 1NBQA 4P9HL 4G8IB 4BSWB 3VG0L 4MXQD 1FNHA 3SDXA 5EO0A 5T5FH 3D18B 5JHLH 3UJJH 1P2CA 4D3CL 5K59E 1Z5LA 3NIGE 3L5WB 3MJ9L 2ICWI 3U0WL 3KLAB 1FG2A 2GFBB 5I73C 1A3LL 3QRGH 3GMNA 4XNZC 3V4VL 2WWKO 4UNTA 2H8PB 2QJDA 5IVZA 1EGJA 2GK0B 4M7LT 1Q9LA 1RJCA 3H9SA 4JJ5A 5CP7A 2RCSH 5CCKL 5D1ZA 3W11D 5C0AB 2UVEA 2B2XH 3PGFH 2JJVA 3O3AA 3HAEH 2UUDK 2ZUXA 1FGNL 2FHFA 2EH7L 1NSNH 1XGPA 4I2XA 5D2LF 1NGPH 1FL5B 4HG4K 5DLMH 4FQJH 4XBEL 3AY4A 3IDGA 3HFMH 1RFDH 3GSNB 5A40E 2CPCA 2EDRA 3R8QA 1QSEB 3LKNA 2VZUA 4P5KB 2H26A 5I76B 2JTDA 1Z6JT 5HXMA 5FF6A 2YD6A 4QRTA 3VRJA 4G6JL 3SE8L 2LV4A 3VXQA 3C8DA 3KPSD 4XHJD 4Y4HC 3JV6A 4M48L 3VFPA 3G6DL 4NHUA 5EOTB 2Y06L 5GGQH 1FBIL 3QI9A 3QQ4B 3V79C 3UTZB 5E2TH 4ZXBB 4HUVA 3TBYA 1D5XB 3LB6D 1CXFA 1QPPA 5DVMA 4U1HA 4Y5YB 2L4OA 1BQHA 2WK2A 2Q6WB 4KY1L 1KCVL 3KR3L 4DKAA 5IHZB 5JQ6L 1BIIB 4JZNB 1A6AA 1B2WL 5EU7C 2ZPKH 4LQFH 2OS7A 5B3JE 1FDLL 5HYJB 4YDVB 1KEGH 4RSVA 3VWJC 5C0EB 5DRWA 3KPRE 3UTSE 1EXUA 3LVEA 4EDXA 1FO0B 1ZLVK 4OM1L 2VR9A 3TM6A 4FXKB 1AD9A 2YWYA 5IFAH 2XICA 2XOTA 5E2UL 3GIVB 5JA9A 1N7MH 1M6OA 5IGXL 5IM7A 3C60A 1NFDB 4U33A 3TT1H 1QRNA 4D9RE 4JVPA 4QHNA 5ESVA 2EO9A 5GS2D 3F7VA 5DVNA 4POYA 1KFAL 4P4RB 2WINA 2OJZL 1U3ZA 3VFTB 1KTLA 4XMLL 4CMHB 2OXGA 3CLFL 5LBSL 4M43L 2H9GB 4UV4L 3CH1B 4HULB 2LU7A 1BWMA 2CQVA 1KCUH 3WYRA 3NACL 1A6PA 2BHUA 3IKCB 1OGAA 5I15L 3BGFB 4HGWB 3BP6B 3VGBA 5AZ2H 2AP2A 2PXYC 3CSGA 3OTTA 3HAEG 5FUZL 1FIEA 1F2XK 5ACMA 1AE6L 2OSLB 5T1KD 4OGAC 4PP1C 1RMFL 1YECL 4GQ9H 3O45B 5D93B 4LSUH 2CDEA 5E8EA 4NQEE 5AAMA 1H15A 2DKSA 1PKQB 4HC1H 3MACL 2BNUA 4X6DF 5GGRB 2WUBH 4LLQA 3WIHL 1A3RH 5EZIL 3NFSH 4L4TA 3VRIB 2HVKB 4LK4A 3QXDB 1TLKA 4O2EB 1HDMB 3GK8L 1EIBA 4JFEE 4LSSL 1V5JA 2DBLH 3SGEI 1LEKA 1J05A 2HJFB 3BXNA 4WI8A 5ACLA 4BZYA 1A6VL 4A6YA 5CP3H 3MXWH 2Y4SA 1QR1B 1J7VR 4KK8D 6FABH 5A3ID 3MFGB 2DQUL 3B83A 2ZOLA 2QKIB 2Y5EA 4W4NA 1RZ8B 4Y2DC 5I8OH 1R3KA 1Z0NA 3AB0B 5JA8B 2Z93A 2R0LL 3EDDA 1YQ2A 2V2TB 3GB7A 5EU7E 5IHLB 2JCCF 2CMRL 3KPMB 4GMTH 4ZQKA 3C08L 1DLFL 3V6OA 4IIQC 5D71L 2OYPA 1ED3B 1KELH 2HFGH 3ARFD 5AG9A 4F8TA 3SGKA 1FG9C 3AU1B 4LSQH 4OF3A 2AQ2A 3CSYB 1JGVL 1GOGA 1RIUL 1G1CA 3O9WC 1JZ3A 3P2TA 5H35A 3BN9D 5DSCA 1DUYB 3GSNL 2UYLB 3MFFA 1IGFL 5F97E 4ORZC 5F7KC 1NMBL 5TQ2H 2NZIA 3DYMA 4LRIA 4BZ2L 2A6DA 1FJ1A 5D9SB 3OKOA 3T0BA 4Q6IC 2J6EH 3IDXL 3L5HA 1T4KA 1AGFB 5I1GH 2EC9T 3PG2A 4FS0A 1HWGB 3C8KB 2PYED 1ZLUH 4PJ7E 5DC4B 5CLWA 3LSOB 1CQKA 4LCWE 1F3DJ 1QSZA 1G7LB 3MRCB 2P8PB 2VWEC 4KJPC 4ODVL 1T7YA 5DHVA 3HRZB 2YR3A 4PBVC 3RUGF 5D72H 4ZYKA 4GBXB 3P11H 1KGCE 5E9DA 5JHDA 1PZUB 5BXFB 1FC2D 5IOPA 4UQ3A 5DRZB 1G7IB 2J8UF 1UCTA 1P7QA 4OIIH 5T3ZD 5MENB 2XZAL 2I24N 1S7UA 3BQUA 1FO0L 4X7SL 1BPVA 1HSAA 4ZODA 1RZ7L 1A6UH 3HNSL 4MAYB 2DRUA 1QFWI 4EN3B 3K80A 3KPRB 1ORQB 2R0KL 5K9QG 3U2SA 3ZE2F 5F6IB 2X4SA 1DR9A 3FN3A 3TNMA 3KXFD 3ARBC 4JCLA 2R1WA 4HXAH 3UPAA 3QFJE 3SDXF 3NH7L 2OM5A 4RGMC 4YWGL 2X4QA 5ELIA 1XGYH 5ENWA 5JW4R 4BFIB 5BO1L 1XGUB 4KDTC 4MDIA 2X42A 4X5LA 4M03A 4NFCA 3UEZA 4LVOC 1TFHA 1JPGA 1UC6A 1PX4A 5C0CB 2KUTA 2NY7H 3PWPD 4M7JL 1ZHBB 1F3JA 4N90D 4N0UA 3U9PL 1EFQA 3TBVA 4ORGB 4YR6A 4FABH 1IGMH 2NY2C 1AP2B 4NZRL 4M7LL 5DK0B 3IDIB 4MNQB 4F8QA 3D39A 4NQCB 1CI5A 4NQEB 4G8GA 1BVKA 3MUGA 3VWKB 4IMLB 4NOBA 4XMPH 4Z7VE 5IT2H 2W9LA 3QEQE 1DN2A 1B0GA 1T20B 3UTTD 4BELD 1CLYL 1WWWX 4WTZG 2YZ1A 1JJUA 3OR6B 4MX7B 1R5VA 1YNKL 1B0RB 2Q86B 1N8ZB 1M7IB 2VWEE 4YHZH 3AFLA 4HFWA 2ESVA 3SDDC 1KIQA 2O26U 2VZTA 4PRHA 2IH1B 5ANME 3GM8A 4XBGA 3GI8L 4TUKH 4XBPA 4CU7A 3VXUA 4QTIH 4D8PB 3RZCA 1KN4H 4S1QL 2BP3A 4PB9L 5AUMB 1A9BA 1G7MB 3MA7B 4HUUA 4BSVA 5EU6A 5IBTL 1CD1A 1NDMA 5J3HD 2BC4B 3DGGB 5FHBH 3ARDB 2SEBA 1CD8A 4GAYA 2AJVL 2VN4A 3VMPA 3TO4D 1EERB 4KUCD 3PNWA 4QRUA 1T04A 5F89B 3SJVB 5CD5D 4KXZI 3HI6H 2PO6B 4XAWH 4Y4FD 1MHPH 4YBLB 3SOBH 4J3SA 5IB3A 4MS8C 3BVNB 3WIIL 3MZTA 1I1RA 1EJOL 3CZJA 2VN7A 4B5EA 4BJLA 4ZFGL 1DN0B 1X7QA 2UY6A 4I3RH 4I77L 3KLHD 1JNNH 4Y8AA 1LO2H 4U7SA 3KLSA 5FYLD 5TE6L 4QKXB 1CLOL 1HYSC 5JW3H 4KKCC 2A6IA 3UTQB 3DHJA 1QBML 1NFIB 4GAGH 4QTHA 2VDMH 3L7EA 1YEHH 4QHMA 1SJHB 4IRZL 3H7LA 3HR5A 2ITDA 4ZDHA 4HK0B 4P23B 1WUNT 4I8DA 3HE7C 4HDIB 3HC0B 3IDJA 4WW1B 4HH9B 4MA3A 4KJWC 3QZWA 2P8MB 2WM0A 5BVPH 2X9YA 4HWBH 4JKLA 1SJXA 4L9LC 1KPVB 2BSTA 3W5MA 5HI5C 1HINL 2COQA 5B8CC 5C71A 2AK1L 5LGHH 1FL3A 4JKPL 3ARGA 2ZSWA 5AWNL 2XKNA 1PYWA 3HE6A 1EFXB 5HD8D 5DZOA 3SGEH 3PP3H 3HZVA 2WWMC 3TBTA 32C2A 4AZ8A 3NCJH 4WEBH 4KDVA 4J3UA 1QLEH 4M7ZB 5KN5B 3B8YA 1YN6B 1A47A 1JPTH 5CEZL 1S5HB 1MSPA 4K23L 4NZTL 3QFJB 4OZ4B 4KQ3H 1NGXB 4TSAH 3DLQR 5DHXB 3CMOL 2EYTB 1NCWL 4MZ3A 4HV8A 1WLHA 2VXSL 3MNVA 2F54A 4XAKD 4EDWL 1M7DB 1WEJL 4L4VE 4HK3J 5D96C 4O2CA 2BMKB 3LRGA 3SCMB 2AJSL 1I3RB 2DMCA 4L8BB 2ATPA 4JANB 3T09A 3QG7L 1K4DA 1U92A 4DKFH 4WI3A 2VH5H 4OLZL 4F58L 3CFBB 3ZL4H 4K9EL 1GH7A 4XPTH 1NKOA 1CXLA 5CUSH 4U6VH 2VUYA 4FN0A 1QSFE 5DMGC 4U2ZA 4UNVA 3ALPA 4K94C 3IT8D 5I75C 1VESA 1VDGA 4G9FE 4KHXH 3MNWA 2NY6B 2L0DA 3QDMA 1KB5A 5HHVH 1AFVL 4NRXB 4X4MA 3AXLB 3KYKL 2AKRA 4UBDD 4UTAH 1FNEA 2C7UB 4G43A 5ANMB 4HQQH 1RSFA 1PQZA 4YEEA 3HAEB 4R4BA 1NUNB 2A9MH 3INUL 5DD3L 2W38A 3MCLL 5EN2B 2VZ1A 3MLWH 4EZMA 3K7UA 5DWUH 1YEIL 1EJ6A 5HJ3A 4NJAH 3I3DA 2BVOB 3GDBA 4PD4K 5LJYH 3KYOA 4AEIH 3TPUA 1FFNB 3MCKB 5F7DA 3RWCB 4OI7A 1FE8L 1T66D 4HIIB 3QA3A 4Q0XL 2FJFB 4XVUD 5F96L 2XTJB 3MREA 3U4EA 1UJTA 3SDCD 3PV6B 1QFWH 5L0QC 5F7FA 3AREC 4IMKA 1OD7A 4NO0D 1YDPA 1C7SA 3LQZB 3M8OL 4M1DL 1AO7D 5DYOB 5BJTB 5TDNA 3QCVL 3PL6B 4LP4A 2X1OA 4GKOA 5MERA 5FA4B 2QADD 4IJ3C 2YC1B 3MXVH 4U1JA 3ZKNC 5GIRB 1ES0A 4PRPB 3HG1D 4YHOH 4HT1H 1CDCA 3GMOA 4YDLC 4JFOA 4NGHL 4CADA 4WNQA 3NPSC 4O9HL 3S35L 4FQCL 4LLWB 4U1MA 3KPNA 1ZANL 2NY3D 2V2XB 3FB8A 4HKZA 5I8EB 1A7PH 4P2OC 1EEZB 5JW4Q 3BEWB 2VXTL 5D5MB 5I2IA 1YUHB 2K7QA 1HWHB 4MHHI 2DYPB 2APWA 3ARWA 4U1GC 5DRNA 4JY5L 3VE0A 5KBNC 1CF8L 1VENA 3MUY1 1S7QA 1U3HC 5TDPA 4Q9QL 1MAMH 4YBHA 3BDXA 5E2WH 5CJBA 1HSBA 1ACYL 5CD3B 3KYAA 2VLRD 5IVNA 2YD9A 1UB6A 1I4FA 3ZE1F 1QD0A 5SWSD 5IMLA 4JFFD 1YEFH 2VOTA 2R1XB 5H94A 5ICYB 3UJIH 2IADB 3D2UB 3DMMB 1S78C 3FT2A 1PVHA 3FB6A 5K9KB 3FQNB 4RA3A 5DJYB 4JFDE 5F88B 4HF5L 2XIDA 4DGIH 2N1KA 2CKBL 3TV3H 3V0VA 1DBKL 1K85A 1NMAH 3QPXH 2I27N 4EOWH 5DI8B 4PJAA 4PJDB 1NEZA 3GJEB 2DKMA 4Z0XA 5J06A 5KS9A 1XGQB 3EOTH 5IWLA 3BKYH 2GY7B 2IAMA 2Q7NA 3PIQA 4LKXA 4R90L 5I1CL 4DKEH 3MLPA 3REWB 1BAFL 5DUBB 4W4OA 1ZE3C 5F70A 3X11A 3IU4L 2AK4D 2J12B 3Q3GA 2AI0H 1J1XH 3D69B 4L4VB 4KXZH 4DN3H 4H8WC 4P5TB 3H3BC 4MMZC 1F11A 5T5FL 2X1WL 5JHLL 4RGOH 2KL6A 4PJHA 3WFZA 3ZKMC 5CIPH 3SDAC 4NN6C 4JGMA 1CD9B 2PW1B 4CKVX 3QRGL 2VDOL 3ZSTA 3GRWH 3GSVB 5BZDB 1M71A 1UXSA 4HS3A 5FA3B 4PJ9D 4P2CG 5GGTL 4LKCB 4NDMA 2CK2A 5DRXB 4OIBA 4NT6A 8FABB 4XH2A 4R2GB 1CCZA 4KUZL 4RMVA 4NRZB 3D3VA 3VD9A 3HI1A 3OAZK 1KSRA 3C5ZB 1BJ1H 3OKNA 1DSFL 4U1IB 2B2XL 3W82A 3E6HA 3RQ3A 2D0GA 1NSNL 1NGPL 4FQJL 3QJFA 2AEPH 4Y19B 1K3IA 5FIEA 2QSQA 3QJHB 2NY1D 5FOBA 3RY6C 4NWTL 4A2LA 4P9MH 4ZD3L 3T3ME 2BOBA 1YC7A 1EUUA 2HVJA 3WS6C 5E2VH 5C09A 5LQBL 3QO0B 3QHZH 2A6KB 2FYYB 1TVBB 5HHOE 1SQ2N 1J88A 1AKJA 2OL3H 4WI4A 5GGQL 5B39G 3BZEB 4XCEB 5HHXL 3DBXB 4X7EC 5HY9A 1ND0B 1MWAH 2EEBA 1HE7A 5KSBB 1G7PB 2D9QB 1UACH 3RGVC 1KEML 2ENSA 2NW3A 3SQOL 5IB1B 3BPOB 4RRPG 4PP2A 3RVUC 1FZOB 3CDGB 2AJUL 4LLVB 3QUMA 1NCDH 3EHBD 3G04B 3MRFB 3V6FA 2ZUQC 3ME0A 1QYGH 2H32A 2E6JA 5C6WH 3DX6B 4GRMB 5T3XH 2R2HB 1KEGL 4K8RH 1NCTA 3QQ9D 1MEXL 4X8JB 4KK5C 3BHBA 1UGNA 5GHWH 4BA8A 3F6IA 2K3TA 3KS0H 5E24E 5E5MB 4RDQF 1FQ9C 5IFAL 4IHOA 4QRQB 1N7ML 5AYUH 3GMLB 4H0IA 5B4MD 4HWUA 2QBWA 1DFBH 4PG9A 3FB5A 1RJLA 1FHGA 2C5DC 4LPXA 3SO3B 2YUVA 3MJ6A 1ONQA 4LCYB 1H5BA 5E95B 3TGXA 3QEGH 3X14A 3OXSA 4I5BB 3IFOB 5EUOA 5F9WB 3MRRB 1EGJH 4HLZH 3WXVH 5LGJB 4AMKH 4TNWF 1J1PH 3IDNB 5DQJB 5I75B 4X7FC 5EBLA 5C07A 1CBVH 1AQDA 4OTXL 1EO8H 1CICD 5AZ2L 3HI5L 3B9AA 1YEEH 4ZAKD 5SWQB 5A2FA 4DZBB 4R3SA 1YEDB 1WZLA 4GQ9L 4URTB 3GMQA 3ZDZF 4LSUL 4RFEB 4MD4B 3RWFA 1JTOA 4KU1A 4QO1A 1J0JA 2WUBL 3ARQA 3VGAC 1A3RL 2FIRT 2CXGA 5I19H 3BZ4B 3MJ7B 2MPAH 4OZGB 4QHKJ 4XVTH 5HHMB 1X5AA 3DXAD 5JPMB 1W0VA 4X9FA 1GIGH 3MOAL 2VE6A 3REVA 2DBLL 4UTBH 1X3DA 2HRPH 3DVFA 4MNGE 4PLKC 1ZGLP 2NY4C 1OTUC 5BV7C 3N06B 5KSAC 3QHTC 3E6FA 1XF3A 6FABL 5F9JB 5JIPA 2HG5A 2WBJD 4H5SA 2EDYA 3R0NA 1N59A 1JGEA 4HX1B 5M95B 4OCNC 5L2KA 3V6ZA 4RMSA 2FO4B 4GAFB 4CVZB 1R3IH 2XYCA 4GMTL 4NO5B 3HPLA 2QTEA 1J8HE 3DX8A 1KELL 2F74B 5C0FB 5D7LE 4QCIA 4LSQL 1WT5A 3LH2H 2JELH 4P3WA 5IF0B 5JOFB 1T1YA 3DX7B 2NXYC 4D9QE 1JWUA 2P5WD 4X7TB 4GG6A 1T5WB 3S36H 1MI5E 2PYEA 4LLDA 4Q2ZA 3ZT7A 5TQ2L 5BW7A 3MV7B 4YX2L 4WHTB 5I66B 2JJTA 1S9KC 1I1AC 3ZKXB 2VLKD 3KWWB 3G08A 3ARPA 2J6EL 4ETQA 3O3DA 3RX7A 5I1GL 1AH1A 1Q8MA 4BH7B 1IGIH 2NXZB 4EVNA 2R0ZH 1XGTB 5EBWA 1E28A 2AJZB 5HHOB 1OWWA 1I3VA 1VFMA 4HIHB 3CFDA 2ZUYA 4LIQL 3PF2A 1U36A 2IC2A 2XFXA 5DUPL 1L9MA 2RJMA 5F93C 1UB5A 2Z31C 4L3EB 4LEOA 1YN7A 4ODWA 2EDKA 2J8OA 5D72L 5AD0B 1AI1L 1YEJL 3RNKB 5IFHL 1OAXH 3D85D 5E6IC 4PJAF 4ZUWA 3MGOA 4PB0L 4RX4D 2IALB 3PABB 4OCLC 3GSWA 3RWDA 1A6UL 2AERT 5KS9F 3O8XB 3BP4B 2YSSB 3T8XA 5J8OA 2W0LA 5ETUB 3RKDD 2DQTH 4GKNB 3SBWC 1OF2B 4XB7A 5MP6H 4CVXA 4Y4KC 3NFNA 4LHUG 3PWPA 1ZMYA 3C5JB 3CC5B 1OB1A 4D0BA 1JZ8A 5CWSB 4PJHF 5J6HB 1XGYL 4I9WE 3P4OB 3FJTA 3PXHA 1N6QL 3T77A 1FZKB 2RBLA 5C2UB 4OZIB 4YGVA 1KLUA 3GFUA 1W0YT 3B9KB 3DETD 2KH2B 4IRSB 3UC0L 5J12C 1GRWA 1HHIB 1FNLA 1T5XA 2AXGA 5DO2C 4FABL 4N0FA 5DJ2B 1KT2B 1LHZA 3UTTA 4O58L 3EYOA 1E27B 1TENA 1U0QA 5D7KD 3KPOA 3MODL 4DAGH 4PV8B 3O6MH 3DVGA 4XMPL 3L5JA 5IT2L 4GKZA 3MBEC 3RTQA 1OP5K 5JDJA 2R23B 5HI4C 4FQ2H 1IGYB 3Q2CA 3PWLB 4QEGA 1JYWA 1L0QA 5D1QB 3LQAL 1GAFH 2HJKB 1T89C 5D2LB 4DEPB 1NCUA 3H0TB 1X4XA 3MJGX 3RGVB 43CAA 4ZFOL 4XNMB 4S11A 2A73A 4KJQC 3CX5K 3TO4A 5DUMH 4BUHA 1KN4L 1ZTXH 2QR0A 4Y1AB 2DB8A 4JRYB 4DK6A 4PJIE 4GW1A 1ZT7A 4Y4FA 1I3UA 4FTVD 5IHUH 3MRBA 4U1NA 5C08E 4GXUM 2JLLA 2YEZB 2ZWLT 1Q38A 3F62A 2DQDL 1J0HA 1B9ZA 1RPQA 3D0VA 3QSKB 4QXGH 3BH8B 2XY1A 5I30H 2VAAB 5GSVA 4P2RE 4QGTA 2X41A 5DD6A 4XAWL 3MA9H 4NUJB 4HS6A 1J5OH 3SOBL 3O2DA 1JK8A 1TJIH 1OGTA 3WLWD 2GSGA 3SE3C 1MHEB 2I9LB 1MI5B 4NZUH 3BJLA 4R0LB 4I3RL 3DIFB 3QO1A 4HIJB 4JHWH 43C9B 2DJUA 1LO2L 5EUOF 4GRWH 3VI4F 5C70A 3MLZH 1KXQE 2B8OT 4PJGF 3GGWB 2Z91B 4WI9A 3VFRB 2EYRB 2WQRA 4G9DB 4OKVA 4Q6YA 5ESQA 2EICA 3QDJD 2VDML 4JRWA 1ZHLB 3IU3B 3IS1X 1RAMA 4JREC 2I07A 4NKMA 1D5IL 3V4UH 1UZ6E 3GNMH 3JXAA 1TETH 3ECBA 4APQD 4MB4A 2V9RA 3QNXB 3L95B 35C8H 5J13C 1QPXA 4HWBL 4KK6D 1KIPA 4RQQB 3L3JA 5FHAH 4OFVA 3TO2A 5TE7H 4YXKH 2VQ1B 1JHTA 2P24A 3BDBA 4K7FA 2NY4B 4F57H 4JDTH 1MCKA 1NCAH 1YYLH 1YY8B 4OCYL 3RWIB 1P4IH 3TH4T 3MV8D 2CLZA 3NCJL 4I2XE 3KPPB 3S37H 5B39B 3HC3H 1QLEL 5I1AB 3UTSD 4NC1C 1CQYA 2DWEA 4WJ5A 1ZT4A 4X6DB 2W60A 3W9DA 1IL1B 1QBLH 3GSXB 4KQ3L 3VD7A 5I8CA 5D1XB 3NGBB 4XCNA 4D9RD 5E4EB 4MMXC 3G9AB 2J5LC 1KG0A 5CMAA 3HUJA 4K9EC 5MEOB 3P0VH 12E8L 1AHWB 4GG8B 4E5XA 1OTSC 2XA3A 4LLUA 2NXYB 3PWJA 1I9IH 4G42A 2ED7A 1F42A 3TFKC 5BMFH 3FT3B 1XZ0B 3EFDL 4NNYA 4S0SD 2W65B 4MQSB 1I1FA 4I0PA 3IXTA 2X70A 3I85A 4GG6F 1RIVH 4OGYH 3U9UB 4PGCA 5ILTH 3DROB 5HVFB 1H3VA 2AQ3A 2JCCB 5FGBA 2NW2B 2VH5L 1ZVYA 5HYEA 3ZL4L 1OSZA 4XPTL 1BZQK 2YPLB 1MRFH 2ARJQ 5CIPB 3RHWF 2VR4A 3G5XB 4IS6B 4IRJC 4U6VL 4XNXH 4DCQB 5CJXA 3QCTL 3OJVC 4KQ4H 5F6HI 3OF6D 3WXWH 5SX5K 3GO1H 4Y4HD 5CBAB 1FLTX 4P3DA 4QWWC 1E4JA 3BRGC 2K1MA 3EAKA 3BT2L 5M94B 5GGSB 3CFCH 1S9VA 1IAOA 2BDNH 3SKJH 1DVFD 2F8XC 2DLFL 2Z31B 3LN4A 4HQQL 2A9ML 5MEQB 4J6RL 1XF5A 4RFOH 2EDJA 2HKHL 4WENB 4EI5D 5CLTA 5DWUL 1T6WA 3SDCA 4TNVK 3LEXA 4MQ7A 4U6XA 4GFTB 5CKAA 1HQ4B 4WFGE 4R4FL 1R3LA 3GKZA 1T1WA 1FL6B 4AEIL 4NZDA 1UT9A 3RWJA 1MJUL 3QULA 4NO0A 4YHPB 1QKZH 2A9NL 1QHPA 4NKOA 4PJEE 4OQTA 1H3UA 4P2QE 3VWJD 4EI6B 3T1FA 3WKNA 3MRMB 2OL3B 4P2RB 3F12B 4NC1E 1QFWL 4EXKA 3T2NH 3F7RA 1E4KA 3FO9A 2NX5E 5IJKA 3LD8C 3QNYA 3HG1A 1A4JB 3TBWA 3RUGB 1D5ZA 2Y5TB 1MIEH 4F33A 5CZVH 4OI8A 4OD3H 4YZFF 1VACB 1XIWA 2GAZB 2J8UB 4FQIH 2R29H 3CVIL 1QO3A 1MCWW 4PREA 4X5WB 2X4PB 3BUYB 1YZZA 3AAZB 2AV1B 1FP5A 3AC0A 4OD2A 3B8SA 1K8IB 2BVYA 3TYFB 1U95B 3DV4A 1MVUA 2MCPH 4WV1A 2YK1L 2VLRA 2CLVA 3SDXB 5EO0B 5ITBL 4OGAD 4OSUH 1P2CB 4LCWD 4J1UA 4MVBC 4F2MA 1Z5LB 2DLTA 1MPAH 4N8PA 1FG2B 1DEDA 3GMNB 1MAML 3MYZA 3IFLH 5E2WL 5I1DA 1UENA 3KYNA 5MI0B 1A7RH 2NZ9D 3LKRA 5IVZB 1Q9LB 3H9SB 3RWHA 4JJ5B 2HFFA 3G6JA 5CP7B 3GSQA 1KGCD 4XVJH 1KB5H 5KVGH 5D1ZB 3TZVD 4UT9L 1X5HA 2BVQA 5F7EL 1BMGA 1F2QA 3O3AB 4JFXA 3RL1A 1RULL 3IGAA 3CLEL 2BRRH 3ILPA 4I2XB 4MCYA 4Y2DD 4RISL 3IDGB 2IMNA 4DGIL 5F1KC 2P47B 3TV3L 1S7XA 1P9MA 2XN9E 5IQ7H 3LKNB 3QPXL 2E7HA 1GGCH 4KUCF 2H26B 3WHXA 1SY6A 2IANE 5DJ8A 4QRTB 4XWOC 3TBSB 3VRJB 3WN5B 3EOTL 2Q76A 2XQBH 3BKYL 1G6RL 1TZGH 4ZSOA 3JV6B 1J1OL 4TVPE 3VFPB 1GZPA 3U30C 2EDEA 2DJ4A 3QI9B 2FH8A 4PJ9A 5JXAH 3I3EA 1CDGA 1IKNC 1Q72H 4HUVB 4Z9KB 3TBYB 4GW5A 1BQHB 3I2CH 4L8SC 4RGOL 5B38G 3JTSA 1FFPB 3VXTA 4LHUB 2G60H 4LRNH 5JMRA 1A6AB 3OB8A 4NYLA 2BY3A 3CFKA 2DIJA 1WC7A 5DRWB 3QIUC 4MJ2A 2N7BA 3QEQD 1MFCL 4EDXB 3K46A 2BY1A 5GS0H 1ZHNA 2YUWA 5CGYD 4MJ6A 1M6OB 3FFDA 5IM7B 2FL5B 2O93L 3C60B 4PYHA 1I8IB 3P9LA 1QRNB 3P77A 4QHNB 5ESVB 1MHCA 3AMLA 2BNRA 3F7VB 4LMQE 2WINB 4TN9A 3X12A 1KTLB 4GAJH 4P9ML 3QNZB 3LS4H 3S5LG 3T08A 1FZJA 4GRWE 5E2VL 2BOCA 4HIXL 5I17A 1OGAB 3VW3H 5ICXB 1Q9KA 2OL3L 3S98A 3SO5A 2HH0H 3L1OL 4PGBA 1Y18A 4F7MA 1UACL 1CTNA 2CDEB 3DSFH 5FKAA 2OCFD 1F3DH 3U7AA 3ZT6A 4KTDH 4XZUA 4YHML 1H15B 1UJ3A 3OZ9L 2BNUB 3ARBD 4LLQB 2FGWH 1NMCC 1NCDL 1VGKB 5HVWA 1BD2E 4Y5VC 2GJ6E 4QOKE 5T3XL 1LEKB 1J05B 3BXNB 5CSZB 5FYKU 4K8RL 1A5FL 3HUJF 5HGBA 1B90A 3OL2A 3UYRH 2OI9B 5GJSH 1MCEA 4X4ZA 3EDFA 2ZOLB 1BEYL 5I71B 2IG2L 4NHCH 5AYUL 3LEYH 2HFEA 2ZUVA 5KTEH 1DFBL 4OZHE 1JBJA 4G80A 2Z93B 5FM4A 1XT5A 4AH2A 1CICA 1JNJA 1UM4H 4ZQKB 3F8UB 1EGJL 1YMMA 4WHYG 3OKLA 3QIWC 4AMKL 2F53E 2X89A 2G75A 3KHQA 1A3QA 4KI5C 1CBVL 2AABH 3FOLA 4N0CC 1YEEL 2DM7A 2Q3ZA 2HRLA 2P8LA 5H35B 2QL1A 5DSCB 2B4CC 4XCCL 1IFHH 2W07A 4NM8H 1UWEL 3AS2A 5ESAA 3MFFB 2BCKB 4YFDB 1JUFA 3WUWA 1WCBA 4HH8A 2FSEA 5DJDA 1T2QL 2A6DB 1FJ1B 2XN9B 1E0OB 3HCVB 4WFED 4AEHL 3OKOB 5EO9A 2Y6SC 3FN0H 4YGAB 1GIGL 1T4KB 4NQTA 4JDZA 4CN6A 4UTBL 1BVZA 2H1PL 2HRPL 3MV9D 3OR7A 2BXYA 4S1SH 3FQXB 5FUOH 4EJ1C 4G8IA 1WWBX 5FYKL 3JBG7 2Z8RA 4C58B 1TTFA 3I6GB 1SM3H 5HVHB 1NBVH 3RI5K 2YPVL 5ISZE 3S97C 4HWZA 3WS3A 5DHVB 1R3IL 4MS8D 3VRLE 2UZXB 4ZYKB 4OCXH 1KJ2H 1OY3B 1A9EA 3C2SA 1RUAH 4UQ3B 1P7QB 5GS2H 1HOCA 1R3JB 3K4ZA 3MCG1 1S7UB 3LRSA 3BQUB 3DVIA 3E3QC 4KKCD 4M62H 3LH2L 3WJJA 1D9KC 2JELL 4KZDL 5EH1A 1IC5H 1QSFD 3MRGA 1EEYA 4MXWH 1PBYA 1TNNA 1JGUH 1FNSL 4U0QB 4UZGA 4O02H 3U2SB 4U1KA 3UPRB 1A7NH 3O6FC 2X4SB 9CGTA 3F7QA 3TNMB 2GTZA 2R1WB 1DL7H 4NCDA 3HE7D 3NAAH 5D70H 1WZ1H 3ZHLA 2X4QB 4KJWD 3ULUF 5JR1H 4PJXA 5ENWB 4HZAA 3IYLW 4MDIB 5HI5D 1I1YA 2NMSA 1MRCH 2CJUL 4KI5E 4U31A 1IGIL 1JPGB 3ZDXE 3MZGB 4Q9RH 3QQ4A 2R0ZL 3UTZA 3JV0A 1CDUA 4N0UB 3G6JF 4U0RC 4YR6B 3D85A 4PJCE 3RNQB 4K71B 2V6HA 2WWMD 5FCSH 4G7YH 5DA4A 4RX4A 5KANI 2ZKHL 3Q6FA 1C5DA 3D39B 5CILH 3RIAK 4G8GB 1BVKB 3MUGB 4JKKA 4ZMAT 3MLXH 2M26A 3NN8B 5C6TL 1C5CH 1EMTH 4A6YL 1B0GB 2B20A 3FHQA 1VA9A 4GRLA 3C6LD 1HCVA 3ARVA 1R5VB 1P5VA 3KVQA 4R4NC 4X4ME 2DQTL 1NPUA 4HFWB 2ESVB 3FMGH 1KIQB 1UM6H 4PRHB 5CINH 5EOCH 4P4RA 5MP6L 2NPLX 4XBGB 4F3FA 5J4MA 2VKXA 1I85C 1U8LA 4XBPB 4NCC1 1FNGB 3EYSL 3VXUB 3CH1A 1K4CA 3RZCB 4YXLH 3MTRA 4HUUB 4Z7WE 5ADPH 4BSVB 1EBAA 3O2VL 5EU6B 4M61A 5EPMA 1NDMB 5C86A 4HGWA 3E3QE 3OSKA 4PFEA 1KV3A 2SEBB 2F53B 3PP4H 3GIZH 3CCHA 4LCCC 4MQXC 4Y7MA 5HGHA 3B5TA 3EW3B 5D2NC 3PNWB 4QRUB 1T04B 1NUDA 3EBAA 1CG9A 3O81A 5HGDB 5IB3B 1VFOA 3TPKA 3TT3H 3EO1A 1GZQA 4IOFC 4KAQH 2E9WA 4K2UH 1X7QB 1OTTC 1MAJA 3OBAA 3W11C 5T1DH 3O6ML 3QUYC 4JFDD 4JQXA 4OGXH 1A64A 4QXTA 1X6LA 2VUOA 2A6IB 3V5HA 4KROC 3LMJH 2DJSA 3QDGE 5B21A 4WW2C 4HUWA 5IVXE 1QA9A 4MDJA 4QTHB 3DHMA 5T3ZH 3L7EB 3GM0A 4PJ5E 4QHMB 4FTVA 2ITDB 4ZDHB 1G9EA 1GAFL 4WUUD 1U8PA 3IDJB 4TVSa 4MA3B 3RKPA 4Q9BA 5ISZB 1GYAA 3ARED 3QZWB 4AG4H 5J57B 4D0DA 2BSTB 1NMCB 5DQ9A 3OB0K 4GT7A 3DTXB 3RWEB 3L6FA 1FL3B 1OOAA 2QQLH 4H88L 3ARGB 3G5VB 2ZSWB 2C3HA 1CXEA 2XKNB 3HE6B 3TYGH 1GL4B 1GGIH 4N8VG 4QXGL 4N5UA 3ZKND 2APVA 2OP4H 3Q1SH 4LU5H 3HZVB 3TBTB 32C2B 5CS7A 5DTFB 2I5YL 3E8UL 4JDVB 1YPZE 5C0RH 1IAMA 4NZUL 2IF7A 5F71A 4CN1A 4NNXA 1L9NA 3WHE1 4B7IA 1U3HD 4HV8B 4OUUA 3IAPA 5HDQH 2HT4D 4FG6D 1REIA 3MNVB 5D2NE 2F54B 3S34L 3ZZ1A 3WFEH 2F19H 2G5BA 1CS6A 2DQCH 3HRZA 4GS7B 3W81A 4O2CB 1EEQA 1S78D 5I74B 3HKFA 4PJBE 1RJYA 35C8L 4P3CL 2ATPB 4OZFH 1OW0C 1K4DB 1U92B 5FHAL 1CFBA 4P4KC 4Z7QE 2Q8BH 3WNNA 5CHNA 1W0WA 1WTLA 5TE7L 1KUMA 2PCPA 4YXKL 4WO4A 4OJFH 5C7XH 4WIQA 3BI9X 4YC2C 3KPRA 3UTSA 2UWEF 2R8SL 2XZQH 4WWID 1NBYA 2JB6A 5TQ0L 3Q6GH 2ADFL 4JDTL 4HAGA 1NCAL 1YYLL 1BF2A 3MNWB 5C0ND 1MAKA 3QDMB 3WO3B 1KB5B 1O0VA 5FM5O 3KG5A 1MRDL 2X4TA 4JHZA 4KRPD 1LK3H 1GOFA 2AKRB 3KPSE 1FNEB 2CO6B 3CFEA 4G43B 4ODTH 4HWNA 4PBXA 5IQ9A 1PQZB 1HHKA 3VDAA 4R4BB 3R06A 4UINH 3LZFH 3K2MC 1QBLL 2HMIC 4FQLH 3VFVA 1IAKB 3ZKMD 5HJ3B 5A3IC 3DOSA 3SDAD 3OXRA 1PFCA 4ZTPL 4ZPVA 4UOW1 2BVEA 2IQ9L 3KYOB 3TPUB 3P0VL 5F7DB 1AP2A 3FRPG 3GHEH 3QA3B 4N9OB 4ZO8A 2E3VA 5FYLH 1I9IL 3V2AR 1KOAA 5BMFL 3MREB 3O2DH 3UYPA 1N64H 3IRPX 3MLYH 3WFCH 5GSRA 2FB4L 1RIVL 3OJDA 4IMLA 3ARFC 4OGYL 2EIEA 3OF6A 3Q5TA 5GRYA 5ILTL 3WKML 4JVUA 1YDPB 4RZCA 4Y4HA 2F9BT 5GGVY 4JFEA 5TDNB 1MRFL 1YQVH 3JWOH 1DBBH 4PJXF 4WTXA 1MFBH 4WEMB 5JMOC 3I6LE 3BN9C 1B0RA 1CFSA 1CFTA 1X4ZA 4OCWH 1RK0A 1ES0B 3QUXB 3QWOA 3GMOB 4LVHC 5DEGA 4JFOB 4AM0A 4CADB 3ARSA 4WNQB 5IVXB 1PAMA 3AS0A 4TULH 2ZG2A 4KK9D 4TTDC 4U1MB 1ZLSH 4JFZH 4PJ5B 3S3JA 2BDNL 4TRPL 1JPFA 1G7MA 2OR9L 3SKJL 3FB8B 1HIMH 1KTKE 4BYHA 4OZFG 2Y7QA 3NCCB 4RFOL 5DRNB 4DW2H 2GW5A 1S7QB 3HMXA 4QRRD 4MD5A 3FTGB 3RVUD 3TH3T 1HSBB 2ITCA 4P5MA 2ICCA 1UB6B 1I4FB 1CLZH 5IMLB 2OTWA 3TVMC 3BEVA 1J8HD 5H94B 5INCB 5F7YC 3BVNA 3L3KB 4F9PC 5LVEA 1NFDF 3FT2B 3CK0H 3FB6B 3QYCA 2UZIH 1A14L 3KPLA 2GQHA 4XXCC 3RDTD 5EDXA 4ZOAA 1F4YH 5FGCE 1UA6H 3ELAT 3ZHKA 4D9QD 3V0VB 5A16A 4OD3L 3TIDA 4FQIL 4Z7OE 3DUSA 1D5BA 4PJAB 2R29L 1TNMA 2PXYA 3L3DB 1NEZB 5A1AA 5EC1A 1GJIA 4PJ7A 3VXPA 4XP6L 2D31A 1WISA 5KS9B 1LVEA 2IAMB 4LCWA 1RURH 3VFGH 4FQXC 3WMSA 3X11B 3MRQA 4HH9A 4YPGA 2WBWB 4CAGA 3Q3GB 1MREH 4YHYC 3D48R 5FO9A 2MCPL 4PRNA 1F11B 1MY7A 4PJBB 1UH2A 1MFEL 5CEYA 3IFLL 3JWDC 1UXSB 4HS3B 3UO1L 4X4YA 4YXHH 4NDMB 1JF5A 2EH8H 4Y2DA 4NT6B 2FECI 5KVDL 2BX5A 4XH2B 5TDOA 3RU8L 1KB5L 2G2RA 3HI1B 4XNYH 4PLKD 3GZKA 3OKNB 1S9YA 2HTLC 3E6HB 5KSAD 5T5NF 4OD1H 3QFJA 5HHQA 5K59F 3NIGF 3QJFB 5E4IA 1N5YL 5KANG 3U1SH 1TCRA 5DMIH 4XP1H 4WFFD 5L88L 5FOBB 4XHQA 4AT6A 4OGZA 3CXHJ 1KIRA 2HVJB 3O9WA 5L7XH 5C09B 5DC9B 3RGHA 4OT1H 2G5RA 4OQTH 5SWZD 4LASL 1ODAA 1TZGL 3IS0X 3I3BA 2MHAA 3CSPA 3RAJL 5T3ZE 5HYQB 1E6OL 5JXAL 4NBZB 2IH3A 4RFNC 5TE4H 5K9OA 5C0JA 3I2CL 2NW3B 3DX9A 1YEGL 3V7MA 4ZXBD 4Z7VA 5F3BA 1OL0A 3QEQA 5E6YA 1BWWA 5F9DC 2G60L 3WDHA 4PLJC 1T6VN 4LRNL 1F02I 5CD5C 4M7KH 15C8H 3KXFE 1II4E 1I1AD 1TJGH 3V6FB 1CDYA 1KJ2B 1HXMA 2H32B 3CZFA 1WWAX 2RR3A 2E7BA 3BHBB 4UT7H 5ANMA 5EZOL 3HAEA 5GRWA 5HYJD 3QCUH 2FX7H 5GS0L 2XG4A 1OAQH 5KAQF 2FD6H 4PG9B 3FB5B 4JGUA 1T83C 1ONQB 3MNZA 3MROA 1DQMH 3DRQA 3QIBD 1LEIA 3OXSB 5EUOB 1F5WA 3MCKA 3LS4L 4ZOEA 3WBDA 5B3JF 1EDQA 4DGYL 1BECA 4LAJH 2L7JA 5T1KB 1P84J 3QQNA 1INEH 2RB8A 4ONHA 3MPCA 2FJGB 5DD0H 2H45A 3BGMA 1SBBA 5EBLB 5C07B 3VW3L 1RZFH 2KDGA 1AQDB 3ARBA 5E56A 1JIBA 3VD3A 2HH0L 4NIKB 1I75A 5D7IE 3G6AA 4KDTA 3K0WA 5DYOA 2ZCLH 5IW3A 3H3PL 3PL6A 3RWFB 4Y4KD 1AQKH 4KTDL 1J0IA 5HD8C 4JCMA 1DBJL 4Y0GA 1SY6H 2YC1A 4ODBD 4YH6A 2LTQB 1LO0H 1T7ZA 2OZ4H 4UB0L 1W0VB 3BIAX 2XNAA 1KULA 2VE6B 1U6AH 1FC1A 3VDBA 3VD4A 2W92A 3JV5A 2V2XA 1H8OA 3UYRL 5EU3A 5IB4A 3E6FB 1J8KA 2BZDA 4HHAA 4FMKA 4O4YH 2HG5B 5J11B 1D6VL 2HJLB 3E0GA 4H5SB 3V5KA 4J2XA 4NHCL 2OTUB 3WV0A 1N59B 5KTEL 5FM5M 4ALAL 1JGEB 3N1FC 3V6ZB 2NYYD 2D7MA 4ELME 4YK4C 1UWXH 2GY5A 1UM4L 3HPLB 5T1LD 2DI9A 3SDDA 3DX8B 3HR6A 4HLJA 3HPJA 1U58A 5K9KA 3FQNA 3QRFM 4QCIB 5HI4D 2AABL 3TEUA 4PRIE 3BRDA 4NKIL 5IG7A 5CGTA 5EU4A 1T1YB 4JM2C 5BQ7A 1JWUB 1J18A 3ROLA 3MLVL 4GG6B 4N0YH 4HC1A 2CRYA 5FEBA 2PYEB 4LLDB 1SMAA 4Q2ZB 3GJEA 4KJQD 4AY0A 5JOPE 3S8WA 1P6AB 1BIHA 3G08B 3FN0L 4ETQB 3P9MA 3REWA 4IDJH 3O3DB 3EYQD 1MJ8H 1KCRH 5ECJE 4S1SL 4W70A 2CR6A 4EVNB 5JORA 2FLRT 3CU7A 4JPWH 4L4VA 5EBWB 1E28B 1OLLA 1ZWIA 5FDWA 1ZEAH 3QXTA 4P57A 1NBVL 1ZOXA 2EIZA 1XCTA 3CNKA 4NNPH 5EORL 2PW1A 3P0YL 4PY7B 3RVTC 1BOGA 1N4XH 4LEOB 1YN7B 3QUML 2D03H 5CEXA 1JHKH 1BBDH 5FO8A 1T66C 1U8OA 2YMXH 1QSFA 2Z8WC 2W0PA 1JGLH 3O6LL 4XMKH 2DQFA 2DQGL 5JOEA 4C59B 2K9UA 3BD4A 4ZUWB 3MGOB 4G9FA 4GBXD 4I0CC 3DYOA 4U1IA 5FO7B 4PJ7F 3P9WB 4M62L 3RWDB 3GSWB 3HE7A 3B9DA 3BMVA 5ITFA 4LARH 5F9OH 3S4SG 4ZFFA 1JPST 1IC5L 4L9LA 5FK9B 1EBPA 1JGUL 4MAYD 1A7NL 1NLDH 1GVIA 4S2SA 4CVXB 1GCFA 2QADC 4EN3D 1W72H 4C83B 3BKJL 5CJOH 3PWPB 3GHBL 1DL7L 4DKDC 1OB1B 4D0BB 3NAAL 4MWFA 4DTGH 3QO0A 4HD9A 3NBNA 5JR1L 2A6KA 2D2OA 2FYYA 4U49A 4PJFE 1S3KH 3OAUL 2GT9A 4YGVB 3BZEA 1KLUB 4WTZA 2V9QA 4XCEA 2XV6B 4OB5L 4IBLT 4Q9RL 3U6RA 5CEZD 3QEUA 5FKPA 2XACC 3ESVF 1T5XB 2AXGB 5C0CD 5K9JH 4CVUA 1BFSA 4N0FB 3IDYB 3OGOE 2IGFL 4BM7A 3UTTB 1KCSL 4PV9A 4G7YL 3EYOB 5CJQH 4P2QD 2YD1A 1OVZA 5CILL 3TCLA 3W0WD 3KPOB 3DX6A 3I6KA 4OFYD 1IILE 1RZGB 2ZZUT 3GMMA 1UZ8A 4MNQD 5KJRL 2NX5D 4OZFB 3DVGB 1RV6X 3MLXL 4NQCD 1BLNB 1EMTL 4LSVL 4MNHA 4L5FH 5E5MA 4G5ZL 1RJZA 1JZ2A 2R69H 3UCRA 1VSCA 2B5IC 3SGKC 3P4NA 3ARUA 3UPCA 1OTSD 1P53A 3FMGL 3L9RA 1UM6L 5CINL 5EOCL 3IFOA 1HXYA 43CAB 1T03H 3MRRA 3HZMA 3NIFE 1G9NH 2ADGA 3TO4B 5LGJA 1XEDA 1T21A 4YXLL 2QR0B 2XKSA 4W81A 5ADPL 2ICWA 4Z7VF 2F8OA 5DQJA 5A2LH 1ZT7B 2IPKA 4Y4FB 4PY8J 3MRBB 1RHHA 4U1NB 4JZJC 2Q20A 1AO7E 1CN4A 4MJ5A 1RZKH 3D0VB 3STZA 1TPXC 1E6JH 5GSVB 1K3ZA 4JFDA 5DD6B 4F7PA 4YBQC 4HS6B 5AYQA 4QWWD 3HNTL 1JK8B 2QSCH 1NKRA 3HZKA 4YHKH 1OGTB 3TT3L 4TPRL 3LS5L 4KTEH 2GSGB 2PO6D 4YDIH 1RVFL 5T1DL 1RUPH 1TZIA 1NGQH 2EKSA 2XWBB 1IC1A 1V8HA 2Z0BA 3BIBX 3TA3C 2RFXA 3AREA 5ICZB 3V52H 1DEEA 4OKVB 2M8XA 2IAND 3CJJA 4Z7NE 1KJ3H 3LKOA 2W59A 2I07B 4AIOA 1VEPA 4CVZA 3ECBB 4UDTA 5SWSE 4JFFE 4TVPD 1CDJA 1B6UA 1W8NA 4JR9L 4NCC2 1KIPB 3VMNA 1KBGL 4L1DA 1T1XA 3L3JB 4OUOA 1INDL 5A2IH 3ISWA 3TO2B 1MQKH 1HCFX 4XTRD 4PR5A 5HHPA 4BKLA 1WF5A 5IF0A 1JHTB 2P24B 4JG0H 4K7FB 1PLGH 4X7TA 4P2OA 1GGIL 1U91A 4HGMA 2OP4L 4LU5L 4DK3A 1SBSL 5FYJH 1MCNA 1EFXD 2CLZB 4LAQL 3QB7C 1OT1A 1U3HA 1HEZA 4WHTA 1A1NA 1FFQA 4E0RA 4PLOB 1EAPA 1WJ3A 2DWEB 1ZT4B 2W60B 3W9DB 3QQ9C 5E2JA 1QEWA 2AK4E 4ONOA 3WDIA 5I8CB 1NCNA 1IARB 4MVBD 1LK2A 2W9EL 4XCNB 5I1IL 4HJJH 2A74A 4HKXA 4ODSH 4MAUH 3MGTA 1OAKH 1KG0B 3VXME 5CMAB 5B4MC 3HUJB 5D7JC 3T4YA 1PKOA 5EB9A 1C12A 4JRXE 2F19L 5DK2A 3WFEL 4E5XB 4FFZH 4R97C 3PWJB 3WJLC 4UAOB 2VITA 2D7NA 4L29A 4NNYB 3RFZC 1I1FB 4I0PB 3LRHA 3RNKA 1OAUH 4PGCB 1CU4H 5C0BD 3CSBA 1F58H 3V4PL 2Q8BL 1I7RB 1OSZB 3PABA 4ZAKC 3F7PC 3O8XA 1AIFA 1ORSA 2XZQL 4GKNA 1I3GH 4XWOD 1OD9A 4FQHA 2R4RL 3LEVH 3IETB 1L7TL 2VNCA 1BD2D 4P3DB 2GJ6D 4QOKD 3SDAA 25C8H 1S9VB 1IAOB 5J6HA 1LK3L 1F4XH 1MLCA 2NY6D 3P4OA 1F6LL 3LN4B 4CW1A 4JPIA 1BFOB 1YJDC 3LZFL 5IMOA 1XF5B 3UTPE 4DVRH 1M7XA 3TIEA 3U7WH 5I18H 4FQLL 2YD7A 4GJTB 3SDCB 3LEXB 4MQ7B 2ZCHH 4U6XB 4FFYL 2WBJC 2ZOKA 1T1WB 4H1LG 3QHFL 4PRBB 3A6CH 3RWJB 4F80A 5DEFA 2IPUK 3QULB 4NO0B 4LBEA 4NKOB 5FYLL 4BFGA 1AO7B 3O2DL 3T1FB 3QIUD 4LSRL 3RY6A 3WFCL 2OJEA 3LAFA 1AGBA 2NY5L 3ALXA 4PV8A 4KVCH 2XTJD 2VXUH 3WS6A 5I1LA 2D7QA 3HG1B 3TBWB 1HKFA 5EFIA 1MIML 4JN2B 2RAMA 4F33B 2R23A 4QLRA 3WSQH 4BZ1H 4U3CA 1G9NC 3GSRA 3JWOL 1DBBL 3P3YA 1MFBL 4MNGA 2NY3B 3TNNB 1JWMA 3F7YA 4RAVB 1INQA 4XPHH 1QO3B 2FATH 3ZSSA 4PREB 4OKDA 1I9RH 4AEFA 3RGVA 4XNMA 1MCHA 4OD2B 4M8VA 3MRKB 4ONFL 4EBQH 2LAAA 4JFZL 2V7NA 3CXDH 1RZKC 1MVUB 3DV4B 4WV1B 2VLRB 2CLVB 3H9HA 1XFPA 4J1UB 4F2MB 1J8HA 1NAKH 4DW2L 4OF8A 3WFDH 4J3OC 5D7LA 1MH5A 5I1DB 4R7NA 3KYNB 1IEAB 3LKRB 3RWHB 2B5IB 1CLZL 2HFFB 3G6JB 3GSQB 1MFDH 3PHOB 4CL7A 1K6QL 4BQBA 3DXAE 4Y16C 2BVQB 3CK0L 5GRVK 1R0AL 1MI5A 3O4LD 1N26A 4Z8FH 1OAZH 3PGCA 3IGAB 4O2FA 5DJZA 4MCYB 2QHRH 1F4YL 4IDLA 2CR3A 1UA6L 4R96A 3MLUH 4F9LC 3MLRH 1PG7W 1S7XB 4YUEH 1ZVSB 2QHLA 2MFNA 3VXRD 3RRQA 3NFPA 2AK4B 4MA7L 3WHXB 1WBZA 3RKDC 3N85H 5DJ8B 3QIWD 4YHLH 4OBRA 3AUVA 1CGTA 3UZEA 2Q76B 2O5ZL 3VFGL 1TPXB 4ZSOB 2OK0H 1GZPB 2WW8A 2HN7A 1ZLWK 3KGRA 4XC1H 5DA0B 4ONGH 4JO2H 1OHQA 4N0CD 4PJ9B 3VCLB 1MCFA 2I60H 3DETC 3NIDE 3LDBB 4FHBD 4FQQA 3JTSB 2P5WE 3VXTB 1DQLH 5KW9H 4RBPK 2ZP0T 5F1SA 3HNVH 3T2QA 4MB5A 4LSPH 4D94A 4H20H 3H42H 1CE1L 2EH8L 3RWIA 1B88A 2Y6SD 1FAKT 3CFKB 1V7ML 2ORBL 1WC7B 4RIRB 4ISVA 5B39A 4XNYL 1CR9H 2VLKE 4KC3B 2NY1B 3OPZH 1ZHNB 1AXSA 4XXDA 1JCKA 1QQDA 4WI5A 5E1HB 5HYIA 1JHLH 3FFDB 4MJ6B 4Z76A 4JEGB 3P9LB 3KYMA 5SWZA 4ODHH 4RRPA 1S7VA 3U1SL 3HMXH 5DJAB 2Y07H 1H3TA 1UCBH 3TN0C 3X12B 3ORJA 5CJ5A 2VIRB 4Y19D 2FEEL 1FZJB 1XR8A 5HYSG 4R7DA 4DQOH 4F15B 5C6PB 2BOCB 5I17B 5K9QI 3EOBA 1QACA 4OQTL 1EZVY 4OT1L 1FFOA 2E7LC 3KDMA 3EJYC 3BPLB 1Q9KB 3VFSB 4Z78A 5JO5A 5MHSD 2VC2L 4L8DA 1D9KD 2F5BL 1I1AA 1U2HA 2ERJB 1KCLA 1QG3A 1Y18B 4F7MB 5TE4L 1CDIA 3VDCA 1JV5A 2B0SH 3G5XA 3O6FD 4IS6A 4XZUB 2A2QT 4Q9CA 2AXFA 5E8DH 3T3MF 4JLRA 3GRWA 4WI2A 4JFYA 4M7KL 15C8L 3S36X 1F97A 4PGDA 3BPNB 3T0EC 4C56D 1QP1A 3FT4A 5HGBB 3EIFA 2Z31A 2NTFA 1JRHL 4LVNC 3STBA 4LDOB 3QCUL 1EAJA 3EO9H 3B3IB 1T7VA 4V1DE 2Q7YA 2HFEB 3QR2A 5HPOA 2FD6L 5E6IA 5EWIH 4PJIA 4G80B 2QEJA 4AIZB 1FVDA 4JPKL 3RHWK 4AH2B 1CICB 3SY0A 5C08A 4HWEH 4NJ9H 1CDHA 3OKLB 7CGTA 3OJ2C 4LLYB 4EI6A 5GGVH 1INEL 2G75B 3SBWA 4EQ2A 1ITCA 5J9PA 4APQC 4WHCA 5DD0L 4Y4KA 1G0DA 1RZFL 1VFUA 4X99A 1OCWH 1MWAA 4FXGB 2VR5A 4AQOA 3FOLB 4OQ1A 2BK8A 2Y5TA 2P8LB 2FZ3B 3K1DA 3DXAB 1ETZA 5DMJB 4R4ND 1GC1C 3WNLA 5ESAB 2YA2A 1RUMH 1JUFB 2Z4QB 2VL5A 1CD0A 1WCBB 1AQKL 5GS3A 3WUWB 1A7OL 1SY6L 2F5AH 2FSEB 1S7SA 1WCQA 1LO0L 5L9DH 2M2DA 1DBAL 5EO9B 4P0DA 3QXVA 4TUOA 3BKML 3LPGA 4JDZB 1U6AL 1GGBH 4X4XB 3TYFA 1XR9A 3OR7B 4QF1A 4WFHE 2GCYA 3BZDA 1HQRB 5EZJA 4R6UA 4FTVE 4MQXD 2DM2A 3OHXA 2JJSC 3C2AL 4K3JH 5JIHA 4JHAH 5T1LA 3VFWA 5KVEL 1TVHA 1DZBA 1QFUL 3MBEA 4LL9A 4NM4L 4YAQA 4HWZB 3WS3B 4LHJB 3AM8C 3WD5H 3IAQA 3V6BR 4KRNA 2EDBA 4IOFD 2P5WB 3T0EE 1A9EB 2BHYA 4XPFH 4ZS6C 1OTTD 4XP4H 1HOCB 3QUYD 1KTDA 4XP5H 1T89A 3RZWA 3LRSB 4FMFA 4FZ8L 3BKCH 3GJFK 2YD3A 3U36A 4KROD 1V3LA 2X2YA 3GBLA 1RZIA 3MRGB 1EEYB 2AJYL 4U1KB 1B0WA 4NWUH 3QDJE 2GTZB 3GKWH 3TBSA 1FH5H 2G9HA 1J10A 3QPQD 1P4LA 3WN5A 4PJXB 4WUKL 3T3PE 4JQIH 4GKSB 5C3TA 4NN7C 2A1WH 3KJ4B 3MV7D 1I1YB 1OARH 2Z8VC 4KZEL 3DSNA 4NUGH 1DVFC 1MJ8L 1QBAA 4G3YL 2UUDH 2NY0C 3SE3A 3SDYH 1IRAY 4KV5E 3CDCA 2HFTA 2JJWA 1I7ZA 1ZEAL 3QUKB 4EI5C 2CXKA 3D85B 4ZOBA 3KNBA 1FFPA 4LHUA 3I50H 5EOQH 4C4KO 1AJ7H 3PJSA 1N4XL 3VG9C 1T1ZB 3Q6FB 2WAHA 1C5DB 1JHKL 2D03L 2P1YA 4IOIA 3MV8E 3PWNA 2YMXL 1KIUA 2D7OA 1JGLL 5JUEH 4CJ0A 4XMKL 3V5DA 3VXOA 4FFVD 5EIQA 1QVOA 1OM3H 4TYUA 4GRLB 4PG2C 1IC4H 4XX1G 1LO3H 2FL5A 1U8HA 5F9OL 1EO5A 1I8IA 3RIFK 4PTUA 3I6LD 4L1HA 2AEWA 4PTTA 4IOSD 1NLDL 1DQDH 4F3FB 3QNZA 4JPVH 5CJOL 1U8LB 3C5SA 1K4CB 1P4BH 2UV3A 2D3VA 2A77L 1NAMH 1YA5A 4M61B 4OLYH 1M1SA 1S3KL 5EPMB 3ESUF 5ICXA 2Q87A 4P4KD 1ZLVH 2WLYA 5BCAA 4PJEA 4P2QA 3CCHB 4Q7DA 3FRUA 5HGHB 4OFDA 4B41A 2VMFA 2FECL 1N6UA 2NX5A 5K9JL 1FAIL 5DQDH 2EIDA 3FQUA 3ZO0A 5TFSL 5GXBB 1CG9B 1VGKA 2ED8A 4Z7UE 2NNAA 2NZ9C 3EO1B 5CJQL 1ZGLA 1GZQB 1RUKH 4WRLA 1H3XA 1L0YA 4RMRA 5CSZA 7FABH 1A21A 2W0FB 3S37X 4S0TD 3TZVC 2HMID 3QAZB 4QXTB 4U6YA 4D9LH 5D8JL 4DUVA 3W39A 1C5BL 2R69L 3V5HB 1HHGA 4HUWB 1WGOA 3NABL 1JL8A 1QA9B 4MDJB 3PDDA 4FTVB 3MMEA 4HFUH 2EE6A 1KJMA 2NLJA 1T03L 2FX8L 4JJHA 1PG7H 1U8PB 4IRJA 1UWGH 2MQ3A 3VI4E 4D0DB 4I1NB 1UM5H 5DVOA 3PUCA 1CZ8H 5BW7C 5DQ9B 4PJGE 2WBKA 1V3MA 2JJTC 2P45B 5EO1A 3L6FB 1FSKB 4ZTOH 3B2VH 4FP8H 2FBOJ 1AXTH 4HMDA 5B22A 3UYOD 4F7EA 1S5IL 1QFHA 2P42B 2E8YA 3L7FA 5FYJU 1E6JL 2BCKA 4KKAD 1A8JH 4L9DA 1XF2A 3H2WA 2C26A 2XZZA 4YHKL 2DI7A 2XN9A 3HCVA 4TTDD 1NGZA 4PLNC 5AAWA 2CD0A 3QDJB 2IANA 4PJIF 2VDNL 5JNYA 1G0XA 3VMOA 1HH6B 4RGND 1IGTA 3FQXA 2CK0L 4NNXB 2RQ8A 2MQCA 1W2KT 3I6GA 4OUUB 5CGYC 1G1YA 4XCYA 2JIXD 2JF1A 2H2SC 3V52L 4X7DC 1KJ3L 2G5BB 5IBUG 2X4RA 3MSPA 3TVMD 3RX5A 2VERN 2ZCKL 2HWZH 4C4KT 4TOYL 1G9MH 1RJYB 2EO1A 4I3GA 1S7WA 1R3JA 4M6MH 4NRYA 5CHNB 1W0WB 1KB9J 3MV8B 2PCPB 4WO4B 1T0NA 2AJXL 3GBMH 1ZKAA 4HIEA 4JG0L 3UTSB 1PLGL 1F8TL 1NBYB 2JB6B 3QP3A 2BSSA 4KPHH 3UPRA 1UZ6F 1NLBH 3IXAA 3GBNL 3MV01 5FYJL 4FQXD 1VGEH 3K2UH 4B50A 5I73B 2X4TB 4XNZB 1CT8A 3CFEB 4K94H 5IQ9B 1ACZA 1HHKB 1LO4H 4ODUA 1I9JH 2F58L 3R06B 2KPNA 3NCFB 3TWCH 2YKLL 2Z8SA 3VFVB 4HJJL 3A6OA 3OXRB 4ODSL 4ZPVB 2GJZA 4WI7A 1OAKL 2Z35A 4M6OH 2ZJSH 3RTQC 2BXZA 4YHIA 3RNQA 4WHDA 5C0BA 1FYTE 5EBGA 1IGCL 5DR5H 2DM3A 1NGYA 4XX1E 1FLRH 5GSRB 2HTLD 3PGDA 3OJDB 1OAUL 4K3HA 3NN8A 1CU4L 4RZCB 1F58L 1BD2A 4Y4HB 1GSMA 2A0LC 2GJ6A 4RAUA 1TJHH 5DD1H 4JFEB 3FO0H 4QOKA 4U1SA 3VFNB 3TJHC 4KMTL 3BPCA 3X3FH 4KDWA 3MV11 4K7PY 1CFSB 1CFTB 1RK0B 1IKNA 2BNQD 2YPLD 3SE9H 3W2DH 2IMMA 3QWOB 1YYML 3R8BB 3ZTNL 3CXHK 1ZT1A 5DEGB 1ZGLM 3GSUB 1AGEA 4CNIA 4AM0B 4L8SA 3N9GH 4EI5B 1FNGA 4XP9H 3AS1A 4OZHA 2XT1B 1U41A 25C8L 4PRAA 4HW6A 4HKBB 1JPFB 4X9HA 2R2BA 4XRCA 3ZE0F 1U8NA 1BQLH 4CRPA 1JYNA 1U8QA 2Y7QB 4DVRL 3U7WL 5I18L 4G6AD 2F53A 4UT6L 5FCUH 3VWJB 4G6MH 3QIUA 5LAXA 4MD5B 3FZUC 3E1F1 4I4WA 4PLJD 2ITCB 3A6CL 4P5MB 1H3PL 4EKXA 4LPTA 5HHNB 2PTTA 3M1BA 4LNVA 5HGDA 2OTWB 4QYOA 2X7LA 3BEVB 4OLVH 4ZS7H 4E41D 4XI5D 3I9GL 4YE4H 1X5KA 2DIAA 1A0QH 3KPLB 4KVCL 3CVHH 2VXUL 4PRID 1FRGL 2VXQL 5DJCA 1JGDA 4M8QA 3WLBA 5A16B 1BQUA 3WSQL 3TIDB 5IFJA 4BZ1L 2FR4A 3DUSB 1D5BB 3ZYIA 2PXYB 4X6CA 4GO6B 5EC1B 4U1LA 4PJ7B 1TQBC 3R4DA 3VXPB 2FATL 2DICA 1G7QA 3G5ZA 2D31B 1QFPA 4PJEF 5JOPD 2ED9A 4I18C 4LCWB 3STLA 3FQWA 2F8VA 1P84K 4HBQA 4OBSA 3MRQB 5IBLC 5ISZA 4NQDE 4YPGB 3DURA 1BF8A 4D3CH 3CXDL 5FO9B 1ITBB 3U0WH 4K55A 4PRNB 4S1RL 1A3LH 4Y5VA 3DTXA 1MFAL 3RWEA 3GUTA 4GSDH 1NAKL 3G5VA 1IM3A 2B7DT 5CEYB 5IESH 1EHNA 3WFDL 1OP9A 4MB3A 4P46C 4OLUH 3PQYD 4PJ8C 4X4YB 4H8WH 5TGBB 4Y2DB 3EKCA 3P73A 3JVGC 5TPWH 2Q3AA 4P99A 5TDOB 5DTFA 1MFDL 2G2RB 3HRPA 4WFEE 5DURD 1KYOJ 4JDVA 4H25A 3VXRA 4UU9A 1S9YB 3N1GC 3EZJB 3MV9E 1OAZL 3QIWA 5HHQB 2QHRL 4IIQB 1TTUA 4M4RA 1YNTB 4WWKC 3MLRL 5B38A 4YUEL 1TCRB 2PTVA 4G6JH 4Z5RA 2O5XH 3C6LC 3OKEA 3WO4C 1G9MC 2J7LA 4JB9H 4AT6B 3B9EA 3N85L 4MA1C 3UDWC 1KIRB 3O9WB 1DQQA 3G6DH 4Z95H 3PWVA 2XKUA 3KHOA 4YHLL 2C9AA 2VZVA 2P43B 4UILH 2OK0L 1JNLL 5T33L 4QRSA 2MHAB 4PJCA 1NC2A 4GOSA 2EDHA 3RPIB 2X40A 3FONA 2DL9A 3UJTH 2HAZA 5CSBA 1PDKA 4JO2L 4ONGL 4BH8A 3FKUS 3CFJB 2IH3B 4JM2D 4Q6IB 2HYMA 4X0KA 4FQ1H 5K9OB 4LLAA 1J9CT 5C0JB 5FYKD 3DX9B 3ARYA 5F3BB 4Z7VB 3QEQB 3FO1A 3S5LA 1DQLL 5KW9L 2UY7A 3NMEA 4XPBH 4ZOCA 2ID5A 5DD5L 2EDTA 5C8JB 4FQPA 1PSKL 3DRTA 1N2RB 4H20L 1G6VK 3H42L 2GJJA 1HXMB 3CZFB 5IMKB 3T1WA 1LD9A 4EIGB 5IR1A 4XNQA 1CR9L 1MLBA 4EUPG 2RIKA 3WFBL 3BAEH 1RZJC 2EEAA 4K3EH 4L3CA 1UADC 4XMLH 1IAKA 1N3NA 3CLFH 4Z7WA 4M43H 4ODHL 3T2PA 2HT3D 2YA0A 3PHQA 3HMXL 1CL7I 2Y07L 3MNZB 3MROB 3DRQB 3RVTD 3QISA 2MQ0A 3C60D 4HGKC 1LEIB 2KBGA 1QRND 1D9KA 1XIWC 5I16A 4DQOL 2PW2A 3HMWH 4YFLI 3ULVC 2H2PC 4MZ2A 3JSSA 3O41B 1LP9E 2IJ0C 2DQEH 4ONHB 3O6FA 4U7MA 2VO5A 3BGMB 3QXAA 1YECH 3ARBB 4CMMA 4LOUD 4OFKA 5F7NC 4HZLA 4LGRB 1L4IA 3G6AB 4RGMB 2J3SA 3MACH 4OCSH 3WIHH 1F3RB 1EA9C 2VKWA 4ERSL 5EZIH 6CGTA 1X5LA 2B0SL 5HGGS 4LVOB 3GK8H 1KJVA 3OKDB 4UV7L 2C4FU 4LSSH 3ULUC 3C87A 3O2WH 3QUXA 3ZLQC 4GRWF 4JG1H 2R2EB 2YPKA 3QDGA 5IVXA 4X98A 2XNAB 3MUZ1 4WEUD 2LQRA 2NY2B 4GW4A 1KLFA 1WIOA 4L4TD 4PJ5A 1FORH 5EU3B 5IB4B 4HHAB 4YDKL 1JWSB 3V5KB 4LPCA 4NO2A 2Y36H 3C08H 1HZHH 2DQIL 2HT4C 3FTGA 4FG6C 1R24A 5BV7H 5L8LB 1BJ1J 4WY7L 4HWEL 3C09C 2IFFH 3N1QC 3J7HA 5INCA 1JGVH 1NAMB 3SDDB 5EIIA 1RIUH 3L3KA 5GGVL 3WL9B 2JE8A 3O4OC 3HPJB 1U58B 2WNGA 1X5IA 1I85A 3S3PA 5IG7B 5EU4B 5BQ7B 1PEZA 1YPZA 4P9HC 1BREA 3ROLB 4OZHF 3OKMA 1IC7L 3L3DA 4X6EA 3IDXH 4LCCA 3ES6A 3ULVE 5L9DL 1RK1B 5C0NC 5LXGH 4WUUE 1F4WL 5D2NA 3P9MB 2DBJA 1DBMH 3U0PA 2LVEA 3ROOA 1SYSA 1TITA 1GGBL 5H37H 3VJ6A 4KRPC 4CU8A 4DOHE 5I9QC 5JORB 3DI3B 4JAMA 4XVSH 2NR6C 3T0WA 2AVGA 1ZWIB 5FDWB 4PJBA 3UJJL 3TH2T 4P57B 3VXMD 5DJ0A 4JHAL 5HPMA 5TF0A 2EIZB 1XCTB 3GMRA 3QUYA 4JRXD 1LNUA 1FNAA 4YBQD 1H9VA 1J11A 1BOGB 5GS1C 4YO0A 2VZSA 3WD5L 2DAVA 5CEXB 5FO8B 1MFNA 3VFUA 3RVVC 3KS0J 1U8OB 4WW2A 1QSFB 4XPAH 5I6XC 2RCSL 3QUZC 2DQFB 1RZ7H 1HHHA 2MWCA 1HH9A 4G9FB 3X17A 3PGFL 5E9DD 2A38A 5JHDD 3HE7B 2P44B 1P7QD 3BKCL 5ITFB 4NQSA 5DLML 3TA3D 3KPSA 4ZFFB 3HFML 4L9LB 1RFDL 3NH7H 5TF1H 5B8CB 1XMWA 1PJ9A 4HAFA 4S2SB 4YWGH 1WVZA 4NWUL 1PGRB 2P5EE 1IJ9A 3FN9A 3MRJB 3VRLF 5LKNA 4MWFB 1FH5L 1A6ZA 3PDOB 5DF0A 4M00A 4S10A 1I8KA 3OAZH 4KK9C 2CKNA 1OARL 2GT9B 5SX4I 4JFHE 4NUGL 3UTPD 3L3HA 5HYQA 3U6RB 3FFCD 5E2TL 3QEUB 4KHTH 5FKPB 4NZRH 3SDYL 4M7LH 4M93C 1IBGH 1NC4D 1UEYA 3I50L 2IEPA 2W1NA 4PV9B 5E99H 5EOQL 4GXUN 1CXIA 2ZPKL 4LQFL 1KJ2A 2BVPB 3M17A 3TCLB 1X5XA 3I6KB 1CLYH 1UZ8B 3GMMB 4LPVA 4MJIE 2FNBA 4KI5F 5H37G 3ZDXF 5ADOH 4G8GD 1PZ5A 4MNHB 1OM3L 3I75A 5D96B 1RJZB 3RDTC 4PUBH 4HBCH 1LEGA 4LMQI 5D7JD 4JZOA 1T7XA 3TT1L 3P4NB 4PJCF 1OW0A 2VLLB 4OF7A 3L9RB 4S1QH 4PB9H 4P4KA 3K1KC 1DQDL 5IEKA 1HXYB 1R5IA 5HI3D 4JPVL 3HZMB 2ADGB 5T1KA 1QFOA 3UTOA 1KCUL 1P4BL 1F90H 1T21B 4KKNA 5E8PA 1Z0MA 2ICWB 1CXHA 2FJGA 3IFNH 2IPKB 4OLYL 3RZCD 1RHHB 1F13A 1UXWA 4MJ5B 4JFPA 3STZB 1JF1B 4ODXA 2V5RA 2ZG3A 4JFDB 3WIIH 4F7PB 3OG6B 4HC1L 5IW1A 5C1MB 3HZKB 3T65B 3NFSL 3JTTA 4I77H 5CZXC 4ZPTA 1RUKL 5TE6H 3PXJA 4Z7WF 1CLOH 7FABL 3C9NA 3FCTA 1CL7H 1TZIB 2EKSB 3MXWL 4S1DC 4WUUB 4D9LL 2E5EA 4KTYA 5L0QB 5I8OL 2HJLA 3D87B 4N8VA 2RFXB 3AREB 2OTUA 1DEEB 3OKKA 3ARFA 4QRRE 3LKOB 1PX3A 2DLIA 3EYFA 1AGCA 4HFUL 5BRZE 4CDHA 1HINH 4UDTB 4X7CC 1NGWA 1FPTH 4IJ3B 1UWGL 2AK1H 2C4XA 2YXFA 1BOYA 2HFGL 1T1XB 1CZ8L 4YDLB 3FQRA 5F1OB 1L6XA 3NPSB 4PR5B 5HHPB 4HS8H 3BH9B 4ZTOL 4FP8L 4BKLB 1BHGA 3NPZB 5IVXF 5T5NG 4AEEA 2WANA 3HB3C 4LLMA 4P2OB 1U91B 4I48A 3AROA 4LCUA 4ZXBC 4HPOH 3TP4A 3VH8G 5F8QC 4U1GB 3K8LA 4Y5YC 2DDQH 5CEZH 4J3WA 2GI7A 4NZTH 1U3HB 1HEZB 1X44A 3VXSD 1A1NB 4E0RB 4ZNEE 2EC8A 1EAPB 1NCWH 3IJHB 1T0MA 1QEWB 4EDWH 3TVMA 1LK2B 1N5AA 2A74B 1IAIM 4HKXB 2OR8A 4F9PA 2Z92A 3MGTB 4Y5XC 4KRLB 3L3IA 3EZ8A 4XXCA 3OJMB 3T4YB 1NUGA 1C12B 5DK2B 5I0ZA 4XNUH 1FYHB 4PY7A 4DZ8B 5IB5A 3QIBC 1IZJA 2F54D 2VITB 3QG7H 4L29B 1YPZF 4Y16D 2HWZL 3MOBH 3P11L 4K9EH 5JQHC 1A1MA 4CMHC 5C0GA 5DFTA 4MYWB 5AZEH 4OIIL 5DJXA 3KXFA 4M6ML 5FO7A 5C0AE 5IEHB 4Y89A 3GBML 4HUMB 5IIEA 1Q1JH 3BGFC 3NA4A 1AIFB 1ORSB 5FK9A 3DJ9A 4KPHL 3FRPA 4FQHB 1AC6A 4WFFE 2V5YA 1VADA 1NLBL 1CGWA 1WBYB 4C83A 2CO7B 4HXAL 1QSEE 2YWZA 5D93C 5C9JA 3INUH 2C1OB 1GHFH 5DD3H 2DMKA 1ZK9A 4NN6B 1VGEL 3K2UL 3K4DA 3SDAB 4PJBF 3LPFA 5SWZE 1MLCB 4K94L 5T1MA 4CW1B 1YEIH 4WU7A 1LO4L 4JPIB 3HS0A 2P49B 5IMOB 3U82B 4EQ3A 4Z7QF 2YBRA 3TIEB 4V1DD 2NY7L 3NCYP 4WW2F 1XGRB 5DVKA 2ZOKB 5F96H 5BOZG 4ELKA 4M6OL 2ZJSL 1IGML 3SKMA 3VD5A 5DEFB 5D7IA 4LBEB 4P48A 2NYYC 4LFHD 3AB0C 3CIQA 1FLRL 2OJEB 1AGBB 3OG4B 3UAJC 1RZGA 4M1DH 1BVLA 2PNDA 4KJYB 2E8ZA 4OZFA 4X5XA 5I1LB 2X4NA 5JPNA 1I1CA 1X5ZA 3LKQB 5EFIB 1BLNA 5HYJE 1J0KA 5L8KB 4P49A 5EULV 5DD1L 3EO0B 1DANU 3FO0L 4AENA 1PY4A 4TVPH 3GSRB 4NSKA 4MNGB 3TN0D 3X3FL 2XI9A 1JWMB 3CMGA 3F7YB 3LKPB 4UIKH 1INQB 4YHZL 3S35H 1OP3K 3GMPA 1H0DA 4LPWA 3W2DL 5SX4H 4F7TA 1NFDE 1EVTC 1KNOA 1ZANH 2ZG1A 3N9GL 4TUKL 4XP9L 1EVUA 5EA0H 3EJYD 4QTIL 3VA2C 2V7NB 4WFHD 1CF8H 2VXVH 4RAHA 4GQPH 4ELMA 3EYQC 4MXVE 2AQ1A 2ZUQB 1CE6A 1BQLL 3LV3A 5FHBL 1OP5H 3H9HB 2JK5A 2GSIA 1ACYH 1J8HB 4E41A 3BP5B 4G6ML 5GZOD 4AK1A 5D7LB 3TJEH 1MH5B 3ABZA 4R7NB 5E5RB 4PRIA 3HI6L 5KSVA 2D0FA 1U9KA 5E7BA 2V17H 1MHPL 4BQCA 1SEQH 3T0ED 2DWDA 4OLVL 1P69B 1T83A 1M05A 4HF5H 4YE4L 1PKQE 1MCWM 5KVFH 2CKBH 4EEEA 1AXIB 3PGCB 4O2FB 5DJZB 3IJSA 1JNNL 1KN2H 4GBXC 2VLJD 2XWBA 3NCBB 4R96B 5JW3L 4E9LA 3QBTB 4L8CB 5ABDE 3NFPB 5ICZA 2E9BA 1WBZB 4R90H 5I1CH 4GAGL 4OM0H 1BAFH 3WCYA 2O61A 2BERA 4MAYC 1YEHL 3A67H 2GITA 4EN3C 4UDUB 1L6ZA 1Z9SA 1A22B 5JIIA 3S3SA 5F6IC 1B4JH 2HN7B 2LU4A 5BVPL 3VGAB 2IAMD 1T7WA 2IBBA 1CGSH 3PQYA 4GUPA 1IEBA 3MJ8A 3MRNA 3LPWA 2VDOH 3JUZA 5LGHL 5GGTH 4GSDL 4FQQB 3U48A 4Z7OF 5IESL 1JN6A 4PRDA 5BV7B 4KUZH 5BS0D 5KSAB 2D4DA 3D0LA 4LPYA 4OLUL 4H8WL 4N1EA 1DSFH 5TPWL 3DARA 2V9TA 3WNKA 1WICA 4WEBL 2FWOA 4ISVB 1T22A 4TUJA 5H8DA 3IKKA 1MCLA 4MSWA 1JPTL 2NQCA 3D3VD 1AXSB 4XXDB 1QQDB 4M1GH 4TSAL 4Z76B 4NWTH 4ZD3H 1NCCH 3KYMB 5SWZB 3VWKC 3RIAF 4PJFA 1S7VB 1VERA 5LQBH 2O5XL 4F37F 3IDUA 3BZFA 4JB9L 3TESA 4JN1H 2C3GA 1XR8B 4R7DB 4JM2A 4Z95L 1X5GA 4LNRA 3J8F7 5HHXH 4ZS6D 3EOBB 1FFOB 1QRKA 3KDMB 4UILL 3QXWA 3B4NA 3RVWC 3ZTJH 4Z78B 5IKCA 2OBGA 5C09D 5JO5B 1KEMH 3BYYA 4L8DB 3SQOH 3UJTL 3B2UC 1I1AB 4DKFL 5DDHA 1AKJD 1I7RA 4FQ1L 2AJUH 5MENE 1JV5B 5CUSL 3K3QA 4RMWA 1JZ5A 2AXFB 4LSTH 3ARDC 1Z3GH 3LKSB 4JLRB 4XPBL 2VZ3A 4JFYB 1MEXH 3IETA 3SN6N 4KHXL 4Y5XB 2R1YA 3NZHH 4PGDB 5HHVL 1IAII 1CVRA 2PO6C 3FT4B 4UTAL 5HDBF 3QIBB 2NTFB 4YBLC 2NY0D 5E8OB 4G6FD 3TCXA 1BFOA