4NRXA

Crystal structure of hiv-1 neutralizing antibody m66 in complex with gp41 mper peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
229
Chain Sequence
QVQLVQSGAEVKKPGESLKISCKVSGYNFASEWIGWVRQMPGKGLEWMGIIYPGDSDTKYSPSFQGQVIISADKSINTAYLQWSSLKASDTAIYYCARQNHYGSGSYFYRTAYYYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Envelope glycoprotein gp41
publication title Structural Basis for HIV-1 Neutralization by 2F5-Like Antibodies m66 and m66.6.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 229
sequence length 231
chains with identical sequence D, H
ec nomenclature
pdb deposition date 2013-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nrxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nrxA01
4K9EL 3O9WB 4R4BB 3TBWA 2FSEA 4FQHB 3NA9H 2HYMA 4M8VA 4NZUL 1EMTL 1DLFL 2YZ8A 4IDJL 5KS9B 4XX1G 2C3VA 1I1YA 4MA8L 4PJGE 5KW9H 4FRWA 2RCSH 1ZEAL 4P3DB 4PJ8B 4I48A 3CLFL 1E6OL 3E3QE 4MXVF 5DC9B 4PRDA 2DJUA 4TUOB 5C0AA 3BT2L 4N0UB 2IQ9L 4O2FA 3VE0B 3V6OC 2BOCB 4L8SC 1J0HA 3D2UD 1WLHA 3HNVL 3QXDA 3QR2A 3FB6B 1A7OL 4PGCA 5EDXA 4Z0BL 4YHYC 1JZ4A 5GRJL 3RZCB 2XY2A 1YECL 4CN6A 1EIBA 3QDGA 3V4UH 2W0LA 1XCTA 2CO7B 3TJHC 4TTDD 1BEYL 3GKZA 4M8QB 4Z7OF 5JOFB 4J3VA 4OZGE 4R6UA 4ZOCA 2ZPKH 1WZ1H 2CIKA 3MXWH 2VC2H 4JO1H 4QRTB 3VXUA 2HKHH 2AXFA 4YHLH 3WEXB 1S7QB 4HQQL 3WLWD 2F8VA 2NMSA 3L3HA 4U1NB 2W0FA 1TNMA 2ZCKL 5BO1L 4Y5VB 1U0QA 2NXZC 2RBLA 4TQEH 2CGRL 5DJXB 1NDGA 4X6CF 4KHXH 4HXBL 5DS8B 3ARSA 4P2RE 3QH3A 3R8QA 4AH2A 1QLRA 3GKWL 4X6EA 5IQ9B 2XN9B 5DRXB 2J8UF 1DQJA 3MLYL 2GCYB 4MAYC 3FONA 5J6HA 3LEVL 4TNVK 1NSNH 2UZXB 4OF8A 3RFZC 1C1EH 3PWLA 2VDNH 4BJLA 2I9TA 1UB6B 3KYOB 5EUOA 5DD5H 3CSBA 2QV2A 2O5XH 5F7DA 1CLZH 4JO4H 3SDAB 4WFFE 3TBSA 2BSSB 1JGUL 1KIRA 3TIDA 4AEEA 1F8TH 1LVEA 3SDDD 3GM8A 1S7WA 3KYMA 4G7YL 2IADB 4NO0B 4P23D 4QYOA 3HZMB 1R3KB 2OS7A 1OAXL 1BIIA 5IFJB 4J2XA 4EKXA 1YEDA 4Y5XC 3HR6A 3DGCR 5FYLE 1FL6A 3JTTA 2VDQH 1CCZA 3NIFE 4OD2B 5FM5O 3E6FB 3P0VL 3BMVA 3GRWL 5C0RL 1B3JA 1AXTH 4FZ8H 1IGIH 1GYAA 1R3HA 4YAQB 2Z35B 4DKEL 3E8UL 1TIUA 1MEXH 5LWYL 3RAJL 3D69B 4BZ1H 4XCYB 1N6QL 3GHEH 1FG2A 4K3DL 3K4ZA 4KRPB 1OAYL 4Y2DA 3QO1A 2I07B 4QNPE 4XAKE 3RWIB 5GGTH 1PX3A 4K3EH 3NTCL 2YRLA 5KN5B 3F58L 5KVFL 3P40A 1W72L 5A43C 3U0TA 3KWWB 3S36X 1MCNA 4H0HB 1ZKAA 4OZ4A 4P4KC 3KPTA 2D31A 3VXQA 3UTSA 5CSZB 4DTGH 4OQTA 2H2SD 1PKOA 3IDJA 3SY0B 1RI8A 2BC4B 1GGIH 1TVHA 25C8L 1OQOA 4YDVB 3KLDA 4E41E 2YK1L 3GSRA 3B5HA 3AGVA 1XAUA 3VXME 4N1HB 4IMLB 5INCB 1QBLL 4MD5B 4WUUA 2UZIL 2W9DL 2R0ZL 3GSOB 3HTLX 4KKCD 2ESVD 3UYRL 4GUPB 3WUWB 4WRLA 3VXRA 4P9ML 4U1KA 4OAWB 4NNPL 4HEME 4UQ2B 4GKSA 3U36A 3T0ED 4HJGB 4WTWA 2WBJC 4U1GC 4U6YB 1UZ8B 2ATKB 1L7IL 4KROC 4OD1H 5HHMB 3SQBA 1LE5A 1DQQA 2O61B 3RTQD 5SWQA 4JRYD 1IKNA 1L0YA 3ZE1E 3BZEB 3UBXI 1UJ3B 4GXVL 3JUZA 1X6NA 3BH9B 3OJVC 3UJJH 5IUSA 1BVKB 4X80H 2BHYA 1DUZB 5JPMB 1S7UA 3VFTA 3HNSH 2HRPH 5GS3A 5E99H 5F7YC 1RZFL 2ZSVB 1TTGA 3O6FB 3X3GH 5FV1L 3KPRE 4LEXH 4PBWD 4JCLA 5H2BA 1KN4H 1LK2B 4OUUB 3PL6A 4JQIH 2YD3A 2PO6C 3RWFB 1YQ2A 3U2SB 2F53B 5KANG 1RJLA 4X6CB 4P57B 4AEIL 2HFGH 5I19L 2I60L 4PREB 4G6KL 2R29L 1FZMB 2OQJB 1TQCB 3V79C 4JQXA 1J05A 5MENE 2ZSWB 2J8UB 1A1MB 4P3CH 3I6KB 1UWEL 4YDIL 4ODTH 1YY9C 1H15B 3CMOL 2FGZA 4WGVB 1ADQL 3PWPE 4X4XB 5A1AA 5JQHC 3RHWF 6FABH 4X8XA 4CW1A 5DUPL 1WK0A 3QUKB 2AI0L 1DEEA 2GFBA 2C4XA 2QQKL 2VLJA 3AM8C 3REVA 3S6CA 5HYSA 5DEGB 3QSKB 1JNNH 3QHTC 3QI9C 1JZ2A 4LEOB 3DX7B 4ZO7A 5DMJB 5IHLB 2DQTH 1I7UB 2X4UA 3TYFA 4QHMB 1T1XB 4PJAF 2NY4D 1HDMB 2V2TA 5J1SC 4HK0B 1DN0A 4X7SH 4OBSA 3G5ZB 5JW4M 1CGUA 3QEHA 4PP2A 3KG5A 4MB4A 2JE8A 2PETA 3BYTA 1T0NB 4NZRH 3MPCA 4Q6YA 3AU1A 1TZHB 3S5LB 5EOTB 4OF5A 5D9SB 3FZUD 2X89D 2CDEB 2CUMA 1ETZB 2V5TA 3ZHLA 3QWOB 3G6JA 4GQ9H 1U8OA 3K4AA 4RQQA 1MQ8A 4M7KH 4YHOL 4XC3L 5CD5D 5IFAH 2ITDB 5C08B 2B4CC 3ULVD 3MRCB 4BSWB 3TGXA 1R3IL 4IEFB 1B2WH 1KPRB 3FQNB 4JDTH 4NRYB 2OTPA 1RZJC 1U3ZA 1OHQA 5EIIA 1KUMA 1H3XA 4OKVB 3FQTB 2V9TA 5D7IF 5DFWH 1GOFA 3LQAC 4YBLB 1JTOA 1FGNL 1G0YR 4N8VB 1TJGL 4X9IA 3OXRB 1HNFA 4QT5A 2VZTA 1EHLH 1A2YA 4TOYL 2NLJB 5K33A 3V6FB 4ORGB 4GAYB 2X1PA 1IQDB 1RUQL 5E9DE 3P3YA 1U8PA 4LCWE 5I2IA 2RAMA 3UPRA 1SBSL 1U3JA 3DX8B 4HBCH 1GGCL 3NCCB 3PV6A 2XNAA 5HYFA 5J13B 4WWKC 1R5IA 2VB5A 3ULUD 2Y7QA 1A3RH 2XXMB 5E94A 5LGHL 2GYSA 1RK0A 1B4JL 4U1HB 5DK2B 4UV7L 5C2UB 5I73C 1U8QB 4KZEH 4ZTPL 2WSKA 5HGDB 1EDQA 1MCWM 3IDNA 5BOZG 5IV2B 2DF3A 3TNNB 1I3UA 2JB6B 2CKBL 4LSPH 5BMFL 1HQ4A 4D9LH 2G9HA 2UWEA 1IAOA 4JG0H 4NP4H 2A6IB 1NCNA 5E8DL 3S37H 4YWGL 2QBWA 5A2KH 3ARGA 5D96C 2EH7L 4ETYA 2PR4L 4HIIA 3A6BL 5SX5K 5FUCC 1YDPB 4QLRA 2WWKO 3QPQD 2R23B 2ZJSH 2UVFA 3I50H 5CJXA 3K1KC 4OZHE 5GISH 4WDIA 3RNKB 4UDUA 1U92B 3DSFH 1FO0H 2C7UA 2EE6A 2HT3C 4F9LA 3MRBA 3S4SA 4Z7VE 3EDEA 2A0LD 3RWJB 1I1FB 3DI3B 2GQHA 4G9DB 4QCIB 4PB9H 1CLCA 1UZ6F 4WGWB 1TLKA 4A2LA 4ZYKB 3TF7C 1JHKL 4JPIB 4R0LA 4PGZA 5I1CH 2WUCH 3F7QA 3Q0HA 5ACZB 4Z8FL 3LEXA 1ZLUH 4EN3C 1IAKA 3OJDB 1W8NA 3C5SB 4RFOL 3KNBA 2J6EA 3SCMC 4OZIA 2FR4A 3OZ9H 4LVNC 1RUML 1KJ2H 4K23H 1X7QB 4M4RA 5LCVH 1K6QL 1J5OH 5T1LB 3GJFA 3KPOA 4PB0L 2YPLA 1D3CA 3OSKA 1TJHH 5DJAB 5BVPH 5D1QD 4ZXBC 4JFDE 3UX9B 2QQNL 5E2UL 5MEND 4NJAH 4NBXB 4X5XB 4OGXL 3AXLA 1OTTD 4L4TE 5F7FA 3WJJA 2LQRA 2HH0H 5FEBA 1GZPA 2VDML 4NWUH 3DRQA 4N0CC 1G6RB 4M62H 4NN5C 2J6EL 5IROA 4BH8B 3MV01 5E6IC 4QHKI 2CLZB 4BK4A 4PJAB 5LBSL 3GMRA 2HG5B 2NY0B 1GHFH 1CT8A 5IBUG 4Y19E 1IGMH 2HFFA 4R8WL 2HTLC 5EUKB 2JIXD 1NMAH 2NY6B 4N0YL 4CN1A 5JIIA 2M1KA 3D1MC 4MQXC 2IQAA 4JY5H 3I85A 4JLRB 1I75A 3VXTB 5DI8A 4JEGB 5C7XL 5FGCE 2D7QA 5FDWA 3IKCB 3C6LD 4G8GE 2P5WD 3EYFA 3ARQA 2VO5A 4U1SA 1Q9WB 4U1LB 5K9JL 3VGAB 1FCGA 4QXTA 1X4ZA 4HIXH 3DSNA 3WL9A 1WFUA 2HLAA 4ZPVB 4ACPA 1QFPA 2HN7B 5ISZE 5C09B 1LD9B 5F21B 4BH7A 1YEHH 1S5HA 5D7IB 4XCFL 1QD0A 5DF0A 1ZWIB 5IFHL 3BXNA 2GSIA 3TCLB 4JJ5B 2FEEL 2DRUA 4XB7A 3UTTE 4E5XA 4XP4L 1JHTB 3DVNB 3UROR 2D0FA 3CX2A 2ZUWA 3F8UB 4Q7DA 3CD4A 3EYOB 4WW2C 1OSPH 4C56E 1PD6A 5JOEA 2A83B 3KDMB 2BSRB 1G1YA 1YZZA 4DVBB 3G9AB 5GZOD 2XWBB 2ZUUA 1OTSD 4IRSD 3WE6A 1QFWM 5E03A 1EUTA 3DETC 3EFDH 5DQ9A 5CWSB 3QDMD 2V5YA 5E9DD 1JYXA 1J1PH 4GMSH 1U9KA 2C3XA 2FB4L 5SWZE 3H2WA 3MLTA 2YRPA 5CJBA 2ZUYA 1LEGB 3H3BC 5F7MC 3U79A 1HHKA 3MV8A 4IS6A 2EIEA 4N1CA 3ROOB 1EVUA 5E6ZA 2OQJA 3EO1B 3PWUA 4KKNA 2R2EA 2ATPA 5EOCJ 1QHPA 3D85A 3NBNA 2YD4A 5KVGH 4JKWA 1QTYT 3ILQD 5LAXB 4LQFH 4UT7L 5FYJU 1A6UH 3ARBC 1KCKA 1DE4B 1J10A 4MD4B 3CLEH 2HT4D 2YUZA 1BP3B 3BZ4A 3LKSB 3L5HA 4WHCA 3C09C 5L2KB 1HINH 1I7TB 4Q9QL 2YXMA 5ITFB 2A1WL 3HE6C 2ARJQ 5ID0A 1Z9MA 4NQEE 4I2XB 3DO7B 1FFPA 1N6UA 3EOBA 1CBVH 4Z7NE 1QSFE 3QNXB 3STZA 5IW1A 5TE7L 4AG4H 3IFLH 4LDEB 3SJVA 3QPXH 5I0DA 4QHUA 1RZ8B 1TCRB 3GSUA 3G6AB 3QG7H 4K8RD 4YR6A 4WI3A 4MDIA 2J8OA 1FGVH 2GY7B 1NGQH 1RVFH 3HNTH 5I1JH 3ZO0A 3TYGH 3B9KA 4KK6C 1UKTA 1ED3B 3BPOB 5EORH 4EI5A 4YEFA 3OHXB 1NGPH 2XFXA 5HJ3B 3TEUA 1XF4B 4ZFFB 3VJ6B 1DFBH 5FYKL 2AGJH 1CVRA 5D71H 4X9GA 4U3CA 5C0IB 4OFPA 2H6PA 1KSRA 2I5YH 3CSPA 4F7CA 1FORL 2OTUA 3NIDF 1RZIB 1O5DT 4RGNE 5C9JB 3O8XA 1VFBB 1DSFL 2EYSA 4P5TC 4HIHB 1KIQB 1D5IH 2XTJD 1IGFH 2CK2A 1XGRB 5EOCL 1CK0L 3BSZL 1YN6A 3K8KA 3GSNB 1D5XA 3LQAH 4QTIL 4RFEB 5CGYD 4DCQA 4LLUA 2NYYC 3JWOH 5INDB 5A3IC 3QULB 3LQMA 4YC2B 4NHCL 1U8JA 1PY9A 3V5HA 2F8XC 3C87A 4MNQB 3QO0A 4MS8C 3KYNA 4KJYA 2IAMB 5KSUB 1JTTA 5IR1A 1T22B 4ONGH 4YGAB 4RWYH 4R26L 4XWGH 1V3MA 4A6YL 5CZXC 4ETQB 1U6AL 1MH5A 5EWIH 3U9PH 2AJ3B 1W0VA 1VFUA 4S0TD 3QXAA 3FCTB 5CMAB 4GW1B 1QRNB 2H2PD 4DVRH 3MRPB 5DMGC 4ENED 5BV7H 4NO5B 3S34L 1U58B 2CJUH 3PJSB 2L0DA 1DTUA 2VIRB 4L4JA 1J8HE 1OAUL 2AJZB 3PUCA 3U0WH 4L5FL 1Q9LB 3RNKA 4XMKL 5D6CA 1FNGB 1P9MC 4NO3A 3VWJD 3W0WA 2DM7A 1XGPB 3A67L 5I30L 1N4XH 3KLAA 3L5WA 1LP9F 1H5BA 4Y16B 4MCYB 1KLGB 1J7VR 4DZBA 5E4EC 4JN1L 1WWBX 3RGVA 4WNQB 1F3DJ 3LB6D 2IANB 1AXSA 2B1HH 4LCYA 4PD4J 3WNLA 2DLTA 4Y2DC 5ACZA 5GS2H 4NO2A 4Q6IB 3DBXB 5AZEH 4RISH 2JLLA 5BS0B 3WIHH 4LSSH 3H9SE 1FJ1B 2H8PB 4LSTL 4OIIH 5DJDA 5F3HA 5CIPA 3OAUH 4NYLB 3MLXL 5IBUB 1MNUL 1T89C 1NFIA 2HLFD 4RIRB 1I8KA 4KUZH 3OKLB 1JZ3A 3NCMA 5DR5H 1R6VA 3OKKB 2HTKD 2A6KB 1EEQA 1YNLH 1KTLA 1RMFH 1UM6H 3GFUA 1LO0L 2VQ1A 1NDMA 4J7RA 5LQBL 1KFAL 5J6GB 3VFGH 4CMMB 4P2OD 4M43H 4R2GB 3V0VB 1U8LA 5CZVH 3U4EA 5DRNB 3BKJH 4NQED 3VXOA 3OBAA 3VI3F 4OB5L 3GK8L 5I1GH 3P9MB 1NQBA 5ETUA 3PABB 4HK3N 4WU7A 4CUCA 2BCKA 3F7RA 1VENA 3EYVA 4O58H 3PWPB 4ZUVB 1A9BB 3JTSB 5JW5A 2PTUA 4XNUL 3D39B 2VLRE 1VACA 3EDDA 1IKNC 1W2KT 1F6LL 1BX2A 2ZG1A 5E95B 3ILPB 3U4BH 5TH2B 1FYHB 1YEGL 1OP9A 1IEBA 1MHEA 5F7KC 1T20B 3WSQL 1I7RB 1X5KA 4FXGB 3QBTB 1HHGA 1ZWIA 2FCBA 4NOBA 5HTSA 4OGZA 4HFUH 1BWMA 4APQC 5KSAD 2NX5B 4W6XB 2BXZA 3MV7D 2VITA 5FAAA 1MREL 2ED8A 3MA7B 3CVHL 4NCDA 3UO1H 1CD0A 4LASH 2DQGL 2G5BA 3BWAB 1OF2B 2FHCA 4JFOA 1YQVL 4XVUC 5D1ZC 1FZOA 4JQXC 3OJ2C 4QHLB 4RFNB 2F54E 2F58L 3LS4L 5HHXL 1M05B 2CUIA 4GG6E 4PRAA 1WGOA 1LO3H 1YNTA 2FD6L 3W11D 2IALB 4LLQA 4OZFA 1U8MB 3BDXA 3DX9B 3K2UL 1S7VA 3SKJL 1X4YA 1T1YA 1X3DA 4HUVA 2YXFA 5K9KB 3S4SG 2Y23A 1W72B 2X4SA 4PJGA 4PV9B 5GGQH 3TVMD 4JFXB 4S2SA 4XPBH 1TENA 2DQEL 1F4WL 1ZV5A 2DMBA 5HHOE 4TSCL 3W39B 1A5FL 3WFCL 2W9EH 4Y8AA 2QJDA 4BFIA 2X4QA 4PR5A 1Q9OA 2L7UA 1XH3B 5CBEA 4X7FC 1L6ZA 1L0XA 3TC9A 2DJSA 1S78C 3WN5C 1F4AA 2PXYD 3MLVL 4G8FA 1MFCL 4FQCH 4UT6H 3X14A 3PGCB 1J0JA 1RZGB 4X6FB 4TUKH 2Z91A 3O3AA 1BOYA 3N0PB 1UKQA 1FFNB 1LP9B 5BVJB 4OZGA 1HOCA 4Z9KB 1WQVT 2IG2H 3EYSH 3O3DA 1FNEA 1FLRL 5ICYA 1HZHH 1CDGA 1F4XH 1A6PA 1MVUA 2R1XA 4HKBA 3EZ8A 5EPMA 1INEL 4HMEA 3QQNA 3ZT5A 3MRDB 4UUJB 5HYIA 3P4NA 1G7IA 1NCWH 1FQ9C 1UCBL 3IETB 2D03L 3LRSA 2C1PB 4KAQL 3H42L 5I71B 4OLVH 4UV4L 3OX8A 4JY4B 1BZ7B 4UNVA 4PJ8C 4H0IA 2AV1B 4JRXD 3HUJE 4P2RA 4YBQD 3CUPB 3WD5H 1H3PL 4MJID 2B1AH 1ZK9A 4G9FD 1JVKA 4K7FB 4HUMB 1CF8L 4O51A 2YUVA 3O4LD 1RIHL 4GSDL 4H26A 5EU6B 4JFYB 4O02L 1CFSA 2IGFL 2ILLA 1YPZE 4KPHL 1UXSB 1FZKA 2QHRL 3RZCC 5EO9B 5F97E 4NQDB 4MCZA 4CU8A 4NC1E 1DBJL 1OGAB 2DI7A 1XF2A 5GJTH 4QXGL 1X5IA 1Y0LB 2EXWC 3ARUA 1KJ3H 1GGYA 5I6XB 3C8HA 4NQSB 2A74B 5HGHB 4TN9A 3CDGB 1G7MA 2B2XH 1VPOH 2FL5B 3UTZB 1HK6A 1P7QA 3MLUH 4Y5VC 4Y1AE 4LLDB 5H37G 1E4WH 1MHPL 4XH2A 5D2NB 1LO2L 2Z8VC 1Z3GH 2DWEB 1AE6L 3PQYD 4RFEA 3HI1B 2EO1A 4ONOA 3SE9L 2OL3H 1E4KA 4PJ9B 2Q86B 3NACL 3B6SA 1Q94B 5IBLD 4OFKA 2DIJA 3QIUB 5FYLL 5FUOH 5CJXC 4PRPE 2HFEB 1H0DA 5CKGA 5AWNH 3SDYH 1IGCH 5TE4L 1MWAH 3R0MA 4HV8B 4FFYL 3QG6B 3ULVL 3OG4B 5EU4B 2WM0A 5B4MD 1YEFH 4HZLA 1ZTXH 4RCAA 3GI8H 1SM3H 1KXQE 3GMPB 1QVOA 2CK0H 2HWZL 3CFJB 3W81A 3Q3GA 1T2QH 1KTRL 3DMMD 5TGBB 1NMCC 2XWTA 1WEJL 3SBWC 4X7TB 1I1AB 4YDKL 4KVNL 3RY5A 3L3IA 4HUUA 5J9PB 1OB1A 5BQ7B 4NJ9H 4O2EA 4YQXH 4E41A 3BIKB 3TWCL 4RMUA 3HPLA 3K0WA 4LFHG 3VXMA 1ZGLM 3FT4B 5HGBA 5JOPE 4D0DA 5IM7B 4H8WC 4FTVB 1DLHB 4H5SB 4FABH 4N90D 4K2UL 5E70A 1KCVH 2A6DB 2GJ6D 5IG7B 1UEYA 3CSGA 1DBBH 2MQ3A 1FVCB 4LLWB 3VXPB 3WJJC 3N1GC 4NPYA 3IRPX 4OKDA 5F88A 4HXAH 4EQ2A 2VKXA 4KRPC 2OCFD 3ULUL 4E9LA 2VISB 1TPXC 2D7TL 3AUVA 5IROC 2KBGA 1G7JB 3T65A 4HWZB 3UTTB 1CDUA 3U6RA 5I1DB 4FA8A 4ELKB 4EDWH 3GMLA 5A16B 3JV4B 2H8PA 3BJLA 3MUGA 2Z31D 2YEZA 4C56B 1R5WB 4EBQL 4WEBL 3IFPB 3NFPB 3QB7C 3WFHB 2XZZA 1ROWA 1YEKH 4JB9H 4AM0B 5F9JA 4WV1A 3SN6N 5HHOD 5E2WL 1DBAL 2VXQL 5TQ2L 1R3LA 5ILTH 4N5UA 3K8MA 1FZJA 3EUUA 2DJ4A 5JPNB 4ODSL 1I9RH 3WS3B 1KJMA 4LCCA 4H25B 1KOAA 5CILL 2DTMH 4ONFH 3KPRA 1QEWB 4GBXD 2CKBB 2DM3A 3IXTA 5CUSL 5HVWA 1DQMH 3TZVB 3VW3L 3HRZB 5L8LB 3FB7A 3HMXH 3T04D 5A2IH 2AS5M 4XVJH 4XCEB 5MENA 1QHOA 1HHJB 4CAGA 3QQ9D 3T3ME 3P9MA 4OCXL 4KV5E 4QO1A 1FL3A 1BHGA 1KG0A 3P2TA 1WITA 1NGZA 2A6JB 1V7ML 2P46B 2WWMC 3MRIB 5EBLA 1H9VA 3MZTA 4PRBB 3KPNA 4IRJD 4NFDA 1KV3A 5J11B 4QRUB 3OF6D 2XKNB 3HPJB 1EPFA 1UJ3C 2BNRE 3RUGE 4F7MB 3WCYA 3STLA 1G7LA 3U7AA 3QDAA 4CGTA 1BBDH 3O2VL 4U2YA 1MY5A 2YPVL 3SGJA 5GIRA 1FSKB 5F7EH 5C0BD 5KZCD 3MCLL 1OD9A 3ZE2F 5KVEH 4RSVA 3IFOB 5M95B 3MA9H 5AEAA 5M94B 5CHNA 3O6FC 4KZDL 5ESVB 5IW6A 3RBGA 4XPFL 4HPOL 3F12A 3RWGA 4UDTA 3LKPB 3NCJH 3MBXH 3P30L 4I9WD 4L29B 4JDVB 3QCUH 3U7WL 3A6OA 4HULB 2AK1H 4ZSOB 1TQCC 4JO2L 3FFDA 5E1AB 1VGEL 1SEQH 2R1YB 3G6DL 5I1IL 2B0SH 4FZEL 1HSBB 3HN3A 5ADPL 5KVDL 2ADGB 2DYPB 4HFWB 2DQCH 4Y1AD 5DVOA 4F57L 3HE7D 1D6VH 4Y4HA 3D48R 4JRWA 3IDGB 1F90H 2BRQA 1RK1A 1OAZH 4JN2A 3VI4E 1C16A 1YYML 4NQVB 5FYJD 3HAEA 4PRPD 3F7VA 3VWKD 4LU5L 3LQZA 4PS4H 5JO5B 4JFPA 3ROLB 3VFSB 3Q6FA 1WBZB 1II4E 3X12A 3KJ6L 5IQ7H 4Z0XA 4H20L 3D87B 1F45A 3C5ZD 4Y4KB 1AJ7L 3VRLF 4L3AA 5FA3B 1NC2B 4EQ3A 2DLFL 3LN5B 3P4LA 2AK4E 4P46D 3S96A 1RZGA 1ORSA 4X6FA 3MO1B 5E9DA 4PP1D 4LCWA 4M1CC 2NZ9C 4KRMB 1AQDA 1JHLH 3M45A 5TDOB 3RY4A 4QOKE 1KGCE 1UG9A 1MCOL 4EVNA 2G2RB 5GZNC 1P53A 3OKOA 3GIVA 4PLJC 3V0AC 3QUZD 5ICZB 3X17A 2A9MH 2F74A 4HWUA 1KB5L 2OSLA 4WVRA 3B3IA 3HR5A 3H3PL 5T1MB 3QEUB 2C1PA 3I9GH 3GJFK 1HILA 2ORBL 1AGEB 4XVTH 5D1XA 5CEZE 5JNYA 3O8XC 4LNRB 4L8DA 3GI9L 4YBLC 2JB5H 1K4CB 3PG2A 5GJSL 3KJ4B 4I5BA 3QIBA 4OZHA 5FUZL 3V6OE 3FT3A 2J8HA 4PJEE 2ZCHH 5EFIA 1VFMA 4UAOC 4E42B 2NR6D 1KEGH 3EOAB 2YUWA 3ZE0E 3VFNA 5IJVB 4Z7VA 4NQCE 2P7TB 1Y0LA 4NRZA 3ARWA 4PJIF 1Z0MA 1PJ9A 5J13C 2X9WA 4RBPH 3ELAT 1BLNB 4AIZA 3ZDXE 3TO2B 3IAQA 5MP6L 3RVTC 3BPNC 4WCYH 3JWDL 3WUZA 3CFEA 5I1HH 2NTFA 1TITA 5JW4N 4LSRL 2BNQB 5C0FB 1ZSDA 4B5EA 3H9SB 1ACZA 1Z5LB 5DC0A 1I8LA 1UGNA 3S36H 1KC5H 4JHWH 3T4AB 3EDKA 1EH9A 4K8RL 4JFDA 5IGXL 1ZHKA 5L7XH 2ZOKB 1RD6A 4JKLA 4L4TA 4MA7H 3O2DL 3WNKA 4LSUH 4HC1H 4UBDC 5ALCH 1UB5A 2EZ0D 3MGOB 4TULH 1AP2B 2Y36H 4LOUD 5FHBL 1U95A 1HHHA 3RJDA 4PJFA 2CDGA 5E56A 5HDBF 1CTNA 2O5YL 5FGBA 3I2CL 4MNGB 4Y19A 2BNRD 3SDCA 4RGOH 3P4MA 3U30B 1P84K 4ZUUA 2O5ZH 1DL7L 4LCUB 3DV6A 2FATH 5DRWA 1ZT7B 5TGBA 1KIPB 4XBGA 4HEPG 1FN4A 5DURB 4LPYA 5ENWB 4MJ6A 3QIWD 2GSGB 1JL8A 2IJ0C 4NQTA 1QRKA 1HH6B 2JK5B 2UV3A 5GHWL 3B8SA 2VLRB 4G8GA 3IAPA 3TNMA 4OCYL 2FJFA 5E2VH 3BH8A 3TV3H 2H1PL 2E7MA 3O3EB 4LIQL 5AG8A 2W0KA 1SY6A 5F7HA 3NCYS 4JR9H 1X5LA 1JNLL 2CXKA 5ISZA 4JY6B 3T0AA 2W91A 3BP5B 3LAFA 4FXKA 5LXGH 4RMTA 1UVQA 1MRCL 1G7JA 1EEYA 3S9DB 4XP9H 2G75A 1OW0A 1CICB 1SJEB 3BP4A 3DOSA 4AYFA 1VEPA 2NY0C 1OOAA 4Z7QF 1V7NL 3ZT6A 5C07E 4FG6C 5KJRL 3NIGF 3BP7A 1GC1L 5D7KE 4XP1L 1HI6B 3O3BA 3CCHA 1MFNA 2NY6C 2AV7B 3L3KB 3U7YL 2JTDA 2BRRH 4GG6B 1U8IB 3IU3A 3BN9C 3E0GA 4KK5C 4P2QB 5DK0A 3HC0B 3FB5B 4GG8A 1BREA 1YUHA 1INQA 4J1UB 4A6YB 4YXLH 2MOVA 3R06A 3ARED 3VGAC 5SWZA 3RI5K 2Y5EA 4JAMA 2DQUH 1U3HD 4YFLF 1AO7D 1KCSH 4M3KB 1JZ6A 1VADA 1LDPH 4X0KB 1DQDL 5TPWH 4XVSH 5F96L 4L1DA 3L3JB 3FT2B 5IHUH 3V5KB 1T83C 1ZLVK 1FE8L 2HP4A 5TFSH 5GS0D 4KH2A 1RU9H 3RVUC 3D2UB 1OARL 5CJ8A 5GGSY 1AGCB 1X5FA 2VLKD 2VXTH 1JGEB 2CLRA 5DRZA 5CD3B 1CL7L 1EFXA 1BJ1H 3CFCL 3KPPB 4IOSD 3QEQB 1SEBA 1C5DB 4M1DH 2C4FT 5CEZD 3TPKA 4WFHD 1JK8B 4YHKH 4U6XB 5CSGA 3ZYJA 1NL0L 3D3VE 4PJIB 8FABA 1D9KB 4NQEA 2V9QA 3M1BB 1IGYB 3G04A 4YHIB 1QNZL 1AI1L 1XGYL 2PW1B 5C0JB 5I16B 1AGFA 1QSFA 2XV6B 4MA3B 1KB9J 5JHDE 2D9CA 2DQJL 2CDFB 3KPSD 4WWID 2MPAH 1P6FA 3PP4H 3VFVB 4CADA 5MERA 1DBKL 4U6VH 1CQKA 5AZ2L 2VOTA 3FTGA 4MGXA 4M6NL 3V7AG 5GS1A 1NFKA 3FFCD 43CAA 2YPKB 3TJHD 2X4TA 2FX8H 3E3QC 1GZQA 5C8JA 3RL1A 3LKOB 1E6JH 2VERN 4NKMA 5F9OH 1QFUL 3PGDB 5JLZA 1VCAA 1LK3L 3ARFD 4WW1B 5D7LD 3VMPA 3N9GL 1JPSH 3ZTNL 1T6WA 2DN7A 3HS0B 3TIEB 1PLGL 4IJ3B 3BAEL 3HG1E 3OKDB 5DDHA 2NXZD 4WHYH 4BUHA 3JWNC 5E2JA 3TT1H 1CZ8H 4L8CA 3NGBB 5GGVH 4POYA 3SDDB 3O2WH 5EU5A 5L9DL 3ARDA 4R3SB 5L2JB 4P5KB 4P23B 4ZTOL 4XP5H 4N9OB 4U1MA 2R0LH 5K9OB 2Q8BL 4MAYD 4H1LH 5TDNB 2AXGB 2AKRA 5ANMB 3FOLA 1UC6A 5LG1A 2FX9L 3H9HA 5B39G 5GGSB 4V1DB 2BX5A 4PG9A 3GJEB 3THMH 4X5WB 4Z7UF 1S7SA 5E2TL 3PWVA 4FQQB 1QR1B 4U0QB 3VGDA 3UC0H 4E0RA 1QYGL 5FM4A 4XGZB 3BPOC 2MCG1 2E27L 1YEEH 1IVLA 3EDFA 3NPSB 1XCQB 4M6MH 1DVFD 1BJMA 1KLUB 4IBLT 4KDTC 1MRFL 1ITCA 3ULVF 7FABL 3FAXA 4MQTB 4X4ME 5CJOL 2PXYA 1EV2E 1DDHB 2QADD 4FS0A 3CVHB 4JQVA 1ORQA 2NW2B 4X98A 3FRPG 1NUGA 4OCWH 3B5GA 1Q8MA 3BVNA 4M7LH 5IWLC 1A1NB 4PGEB 4JDZB 3MYZA 3NABH 2OP4H 4P2YA 4XZUB 3TBTB 1J8HA 5C0CD 3QUXA 1VKXB 1OWRM 5I17A 3LY6A 3OR6B 2BFVL 1N59B 4OGAC 4S1DD 4AQOA 4ZFOA 1HKLH 5IMMA 3RZWA 4HK3J 4Q58C 3QUMA 4ODBD 3OAZH 5SX5H 1ZVHA 1T6VN 4YXKH 1XF3B 1PY4A 4D2NA 4M02A 2WINB 2AJVH 4RNRA 1E4KC 4XI5C 2ESVB 4FQXA 4G3YL 3T3PE 3DIFA 1GH7A 5I1AA 4FFZH 4TPRL 1PYWA 4ZQKB 3ULUF 3JV6B 4GO6B 4R97C 2BDNL 4OSUL 3IT8D 4XTRC 2IAMC 3T0EB 2P8PA 1ERNA 2C5DC 1D5BA 1I9IL 2YBRA 2KUTA 3RTQB 4XNZC 4JRYB 1KIUA 3BZFB 2EDNA 4MD0B 4GXUM 4ZD3L 1M71A 2X7LB 2AQ3A 2E9WA 4JGJA 1NAMA 4HWBA 4WI2A 4DFHA 3MV11 2HVJA 2EEDA 4DOHE 2APWA 1TZGH 5FUCE 1H3VA 2I27N 1XR8A 3WFEH 1PQZA 4K9EC 3UAJC 5I8CB 2LU3A 2FGWH 3T0XA 4PLOB 3BEVA 5JXEA 3GMNA 3OKEB 2XPGA 1JZ7A 1Q9KB 4KGLA 3S98A 2H32A 5DC4B 5DD3L 2QSVA 3V8CA 5E5MB 2WANA 4G5ZL 5T1KD 5I1KH 2X42A 4EZMA 4HWBL 2DTSA 4PYHA 2LAAA 4C4KT 4QF1A 4LLYA 1ZHLB 1UWXK 4Q6IC 4G42B 3G5YA 4GRLD 3FHQA 1EEUA 2XA8H 2NY1C 3CAFA 2VDLL 4X9HA 2HRLA 3QFJD 2VLRA 5E8EA 1BFVL 5DJ8A 4D3CL 2X4RB 4Q2ZB 4XXDB 1R3JB 1QPXA 3RA7L 4TVPE 1EAJA 3EYUL 3TN0B 1JF1A 2DKUA 3RIFK 5HYEA 3GMOB 12E8L 5EC1B 5FB8B 3NFSH 1DCLA 2V7NB 1YY9D 3IDXL 1K2DB 1T7XA 5L88H 2H41A 3HZYB 4KK8D 4J3XA 3BI9X 5IT2H 4GOSA 5D7SL 4FQ1L 4Z7UB 4R2GC 3L5XL 2P44B 3FO0H 3PHQA 2ADJA 3QEGL 3CXDH 2QR0A 1FVDA 1UT9A 3LOWA 5ID1A 2F54A 3MLRH 1S9VA 5B3JF 4POUB 1NBZA 4HUWB 2VMFA 4MWFA 3LRHA 5TE6H 3G5XB 5DJZA 5EBMA 1JRHL 2GUOB 4X5LA 4XCNA 2XZQL 3FO2B 3QFDA 4X4YB 5BRZE 5IKCB 4GMTL 3E6HB 4POZD 3UJIL 5EB9A 1BVLA 2DLGA 3SDXF 3EO0A 3SE3A 4CMHB 4D9RD 1NCDH 4JE4B 3T09A 4PJBF 4W70A 2VZVA 2G5RA 5DD1H 1TQBB 4OLXL 4RAVB 5KANI 2X4NA 5HHOA 3GBNL 3MOQA 1GPOH 3WHXB 3BEWB 4UT9H 3P4OB 4JG1L 3MRJA 3RNQB 1A3LH 1MCFA 1DUYA 1JGVH 1AC6A 4NC0B 4NT6A 4WFEE 5T33H 3U9UA 3N85L 3SE8L 1ZANH 5ADOL 1YEJH 1A22B 4H0GA 4Y89A 2X9YA 3MRHB 4PJXF 5GRUL 1CLYL 4IRZL 3O11B 3CFKA 3VFPA 3TJEL 3GBMH 1F2XK 1S3KH 3O4OC 1M7XA 3S35H 4RFNC 3LHPH 5IVZA 5IMLB 2ZOLA 4J8RB 4W81A 1QBML 5I76B 4JPKH 3S3JA 4G6AC 3M1BA 1JFQH 1T7YA 5TF1H 2GK2A 2LU4A 1A8JH 1CDYA 5MEOA 1N0XH 43C9B 1WCBB 5CJ5A 4U6HA 3K8LA 4Y4HC 4MJ5A 3CU7A 1IC4H 5JXAH 4QRPD 4ONHB 1NLBH 4KTEL 1GIGH 3D25B 4PBXA 1OAKH 4OD3L 3OF6A 3HUJA 3FO9A 1FDLL 2DQHL 1IJ9A 4YXHL 1RZKC 5F7NC 1AHWA 2CRIA 4Y5YB 3WFDH 5E0QA 3MJ9H 2V17L 4WWKD 4GKOA 4I3RL 4YZFF 1CD8A 3MBED 4M6OH 4DW2H 1PG7H 2DLIA 4HKZA 4PJ5D 3U1SH 4D0CA 4S1SL 1YPZA 1XGQB 4LF3B 5B39B 2IPKB 2F9BT 2BXYA 2VSDA 1RV6X 4NKDA 4PJ7B 3LPGA 2NY2D 1BPVA 3RWCA 3JVGC 5DQDL 1XR9B 2YD1A 3VGHA 2Q8AH 5DHVH 4CVZB 3ALXA 4LKCB 35C8H 4F3FA 1A6ZB 4RWHA 2GTZB 4WHDA 3SKUD 1MCEA 1A1OA 2EKSB 5C6PB 1C7SA 2PUQT 5FDYA 4Q9RL 4F37F 5GGSA 1AY1L 4PIRF 1QQDA 1WAAF 3V6BR 3EGSA 4Y1AA 2P1YA 2R15A 3BUYA 5I71C 3HE7A 4LHUA 2VLLA 1XF5A 5DA4A 3WIIL 2HT3D 5D1XC 2MWCA 2YS4A 3C6SA 5F7UA 1R0AH 5D1QB 5IOPA 1OLZA 3ARZA 4X99A 3U0PA 3PIQA 1DBMH 4PRPA 1KN2H 5HI3C 3CC5A 3O6KL 3P9LB 4LMQI 9CGTA 5HY9A 4KMTH 5A40E 4FNLH 4TSAL 3PDGA 2IPTL 4PRID 2J88L 1MOEA 3SCMD 5GGUB 2VDRL 4XCCH 4V2BA 4JFFD 4TVPD 2B7DT 4P46A 1EJOH 2PYFA 3GSVA 3QNYB 3QHZH 3SOBH 4ZXBD 2BOBA 3OKNB 1KJ2B 2JIXB 5IVXE 3X11A 1VFOA 5ICXA 5FYJL 5I6XC 3MACL 4Y4FD 4NC2B 4L3EE 5SX4I 4PJFF 5FCUH 4Z5RB 1LDSA 2X70A 1FH5H 3PWNB 2ZUSA 2HJKA 1A6WH 3X13A 4LAQH 4LVOB 5J56B 5D2NC 5KOVC 1EJ6A 3C6LB 2V2WB 1RFDH 2P5WB 3RL2A 2X09A 4NZTL 2GAZA 3ETBF 1XGTB 3SDXB 4NNYB 2YOCA 3WKML 4PJ9C 4PJBB 3AAZB 3TPUA 1KJVA 4F58H 4P59L 1BQHA 3MYJB 3QIUC 4YLQT 4ZQKA 1DANT 2I9LA 4F33B 4MQXD 1KPVB 3KPQA 3QJFA 1JGDA 2GY5A 1UKSA 4PRHD 2AABH 3OKMA 1DJSA 4F7TB 1JN6A 2R1WA 4L4VB 5T1DH 1QP1A 1YMHA 5E24E 1BAFH 5SX4H 4PJXB 1S7XA 2BVOB 3NPZB 2YSSA 2VDOH 3AMLA 1I1AC 4WFED 4IRSB 1TTUA 1NBQA 3KXFE 1T04A 2CSPA 3GO1H 4M9PA 5JMOC 5DA0B 3TO4D 4FQ2H 1FNAA 2WUBH 1VA9A 3TH2T 1XGUB 3BRFA 1MCDA 4O4YL 1AGBB 4R7DB 4ZS7L 4DGYL 2LV4A 3S3SA 1KB5B 2JCCE 3QDMB 3MRMB 3OPZH 3BQUA 1EO8H 1ZLSH 1S9XA 1VGKB 3LS5H 2P8MB 4ELMF 5DZOA 3IF1A 4XPHH 5ESAA 2ZUQB 1BZ9A 4MMZC 1X9QA 3FB8A 4K9EH 2EDQA 1MAKA 1H3TA 3PNWA 1CXFA 4NZUH 1EMTH 1DLFH 1HSAB 4IDJH 3VD5A 3MNWA 4MAUL 4MA8H 5HHVL 2VE6B 4I0PD 1ZEAH 2YRZA 1OM3L 4NCC1 2Y1VA 3CLFH 3P73A 1E6OH 3BT2H 3OGCB 2LFGA 2IQ9H 4JM2D 1SYSA 3FOMA 3VXSE 2BNRA 1MI5D 3LMJL 3RUGA 1NFDE 3ORJA 4NN6B 4D94A 5GRXG 2VUOA 2QLVB 4M1GL 3HNVH 1OTUD 5EN2B 1A7OH 3SKOB 4Z0BH 5SV3A 5EC1A 4HGWA 1DQLL 5GRJH 4NQUA 1YECH 4HUXB 4OV5B 3I02A 1I7ZA 5DUBB 1BEYH 1WV7T 2BSED 2CH8A 4KHTL 2J5LC 2MCPL 3MRLB 3ARBD 1TJIL 1G9NL 1WBYA 3OXSB 3TZVC 3VH8G 4GQPH 3C60A 3UBXA 3HE6D 2Y06L 4HQQH 4UIMA 2PYED 4XNXL 2ZCKH 5BO1H 2DQDL 3BP6B 2K3TA 2CGRH 1FYTE 1K8DA 1YNKL 4HXBH 2VDKL 5J11C 3L3DA 2E3VA 4RX4A 1IBGL 3DROB 3GMQB 3GKWH 1MJ7L 4NBYB 3MLYH 4RZCA 4ZFGL 4YE4L 3LEVH 5K9QG 5C0AD 3ZKSD 3VFMA 3NZ8A 1FSKC 3MRRB 4HW6A 4U6TA 2W92A 4M5ZL 1ES0B 1MJJA 1QO3B 3DYPA 4KUCF 1JGUH 2ENSA 4AZ8A 1YMMB 3DUSA 3MNVA 2OMNA 4PRNB 2OJEB 1F3RB 4F2MB 2XTJB 4RDQF 4G7YH 1A9EA 5FA4A 1CFTA 4NKIL 2AK4A 1N8ZB 32C2B 3QDGD 1Q0YL 2YA2A 3U46B 1BJ1J 1OAXH 2DQTL 2DQFA 3EFFB 3VFRA 4QOKA 5IJKC 5H8DA 4GRMB 1K8IB 2JJTA 2QQLL 1Y18A 3ARYA 3EOTL 2X41A 4JANB 1D5MA 5CEXB 2BJML 2VXVL 3P0VH 5DJYA 3W2DL 5DMKB 3GRWH 5I0ZA 5C0RH 5HYQA 1AD9A 3QDJB 2GJJA 1WCBA 4JZJB 1IM3A 3KYKL 4DKEH 4YGVB 3B2VL 1NBVL 2HJFB 3BO8B 3E8UH 4IM8A 2RIKA 1MLBA 2VTFA 3F62A 5LWYH 3RAJH 2DI9A 1N6QH 4ZDHB 4NUJB 4K3DH 3I6LD 1OAYH 4YHPB 4D9QD 3QRFM 3O45B 3J7HA 3MV9B 5A3ID 1T1ZB 4X6BB 5KSVB 3MOBL 3NTCH 2C1OA 2BZDA 1NMBL 3OAYK 3F58H 3MRKB 5KVFH 1ITBB 1M7DB 5GS0L 1AKJA 1W72H 3IGAB 3V6OA 4L8SA 2DDQL 4GKZB 4MSWB 4PJEA 2BERA 5EU7E 4Y4KC 1XGQA 2OR8A 2NY5C 1XEDA 3TBYB 5CZXD 1ZA6A 3VWJB 3SKNA 4MVBC 2R9HC 4NQCA 4ISVA 4JZNB 3H9YA 5CEZL 5DMGD 4JZOB 4ELMB 25C8H 4LKCA 5I8KL 2YK1H 1N5AB 1RUPL 4PFEA 1GL4B 1QSEE 1OY3B 1S9YB 4OCLC 1SHMA 1QBLH 5IMKB 2UZIH 3AFLA 4JO3L 2W9DH 2JF1A 2R0ZH 5E7BA 5BV7B 5J4MA 4HPYL 3UYRH 4EXKA 4DN3L 1KCLA 4AEHL 5B38A 1PSKL 4P9MH 4UILL 4NNPH 3JBG7 1IE5A 3HLAB 5KS9E 1M7IA 2GT9B 4PJCF 3Q5TA 2YC1B 1BFOB 3TCXA 4KTDL 4EUPG 4ZFZA 1FO0A 5C71A 2BVPA 4NUGL 1B6UA 4JPVL 4N0UE 1L7IH 1IM9A 4LRNL 4Y2DD 1WC7B 4MAYA 3P9LA 4C83B 2Q6WA 3B2UD 3EJZC 4AENA 4LSDA 3OB0K 5FKPB 2MHAA 4GXVH 3ZL4L 2ICWJ 4LPCA 1AGDA 5T5NF 4R4FL 3L3OA 4P2OB 2NPLX 5FHAL 3UTSD 2BVEA 2DD8L 1OSZB 5HDOA 2Y5TB 2QSCL 1IZJA 4WIQA 4Z95L 1RZFH 1U91B 4X6DF 1WFOA 5JZ7C 2JJSA 4JFEB 4Y5XA 5TQ0L 4FQJL 1ZT4B 5D5MF 4UQ3B 4AT6B 5F72S 3IVKB 4KJPD 4WUUD 4AEIH 5I19H 2I60H 4G6KH 2R29H 4OJFL 4I3SL 3F5WB 3VXRD 3LKRA 4Z7WF 3TH3T 1UWEH 3OR7B 4WO4B 4YDIH 5EBWB 1JPGB 3SGEI 3CMOH 4XAWL 1ADQH 2XN9E 4HKXA 3WXVL 5HHPB 5DUPH 4HMDA 4V2CB 3CH1A 5F93C 1Q1JL 2AI0H 5IHBA 5DFVC 3AVEA 4WHTB 5KSAB 5F9WB 5C07A 3MV7B 3FN9A 2QQKH 1WWCA 3U30C 2DBLL 2YD2A 4DKAA 2Z8SA 2AERT 3K81A 4RA3A 1U8KB 2CKNA 2DIBA 2AJSL 2NNAB 2UYLB 4P4KA 4ZUTB 4GKNA 3CFBB 2VNCA 4KRNA 1EUUA 1Z2KA 4R96A 4HDIB 5I1EL 5J8OA 3REWB 1P1ZA 1E27B 1EEZA 4QGTA 3LN4B 1HHIB 5F3BB 2BHUA 4APQD 2N7BA 3RGHA 2Q7YA 3PL6D 5DJ2A 1IC7L 1IGTA 1PBYA 3SGEH 2YWYA 1JPFA 1CD1B 3BGFB 5B22A 3TVMB 1U41A 3QA3A 2IH1B 2VXUL 4MDJA 2VR5A 4YHOH 4XC3H 2FECL 4LBEB 1R3IH 2MNUA 2VL5B 4OF7A 3INUL 2EEAA 2WBJA 5EULV 5H35B 4OF3A 4LLMB 4PGBA 5ACLA 1C5BL 4X7DC 3HA0A 3MJ8A 4LLVA 4XHQA 1C08A 1FGNH 4I4WB 4LHJB 1IAIL 2Y9RT 2VLJD 1TJGH 3G5VA 3VH8B 5IEHA 2ZKHL 3D3VA 1U93B 4TOYH 1F3JA 2ADFL 5JHDA 1S78D 1RUQH 5GSVB 5IF0B 1EXUA 1SBSH 4JPWL 1IEAA 1GGCH 4KKLC 3V5DB 3QFJA 5F89B 1I3RA 3RWEA 5E8NA 2PO6A 5LGHH 3ULSB 1B4JH 4JRXB 4UV7H 4Y0GA 4PJCB 1Y6KR 2RJMA 4MJIB 4ZTPH 4IHOA 4G9FB 2HJLA 3FMGL 4GW4B 4MXVE 4F7EA 1H3UA 2CKBH 5BMFH 3O4LB 5I18L 2BSTB 2Q76A 3HG1A 5E8DH 2RFXA 4YWGH 1BQLL 1JI2A 5AD0B 2IEPA 4N0FA 3UPAA 5IEKB 5DVMA 3B43A 1IAMA 5HHME 2EH7H 2XACC 4A2MA 2PR4H 4Z6AT 3A6BH 5F71A 3VCLB 1OCWL 1ZHNB 2R4SL 4DJMA 4PJ8D 4DQOL 3W9EB 1JE6A 2W9LA 3PDOB 3DXAE 1D9KC 3BPLB 4Z7OE 1NC4A 5AUMA 3RVVC 3WLBB 3WDHA 2R4RL 2A9NL 4HHAB 3IDIB 4DWHA 3QI9A 4X6DB 1JNJA 3F7YA 3JSSA 3WLWC 5JIHA 5D5MB 4EI6A 1OGTB 3QZWB 1U8NA 4K3JL 1JHKH 4MNHB 4LARL 3BZDA 1BFTA 3KVQA 1A6AB 2EXWD 2F53E 4Z8FH 4JVUA 2FWOB 3PQYB 2D0GA 4X6CE 3ET9F 4NSKA 3PHSA 4RFOH 4NHUA 4Z7WB 3QUYB 2CO6B 5DJ0A 5CLTA 1RUMH 3HKFA 4JANA 1T3FB 1K6QH 2J8UE 4PB0H 1QFWL 4IJ3C 2ZUTA 1G0DA 2A77L 2OTWA 2XA3A 3C2AL 3SEPA 3VG9B 3MRQA 1KXVC 3VDAA 4X4MA 1JPST 2QQNH 2FRGP 5E2UH 5T3XD 1QACA 2XQBL 4OGXH 4QXUL 5I66B 2A2QT 3NGBC 3SDDC 1CDJA 2FEDC 2Y4SA 4NQXB 3ARGD 4W4OC 2VDMH 5C6TL 4P23C 2FYYB 2J6EH 3RX8A 2FZ3A 3DMMB 3DO3A 5C0GA 3RKPA 3M07A 1YA5A 4PLKD 5LBSH 2R2HA 3I75B 3PGFL 2OL3B 3KPMA 3PXHA 5IK3B 2FEEI 2IBZY 4QRRB 1A14L 1AD0B 2WBWB 4R8WH 4LLAA 2B4CL 3QXVA 3LKQA 3MCG1 4WEMB 1S9WB 5SWSE 2ZWLT 4N0YH 3F6IA 3C8KB 2EC9T 1SJHB 3VMOA 2W65A 1I85A 3FQUB 1IGFL 3GBLA 5D7JB 1ZVSB 1RZJL 2V2XA 3IJHA 1P4LB 2GJ6B 4NO0D 5J3HD 4XX1E 3VG0L 3RWHA 5C7XH 4WU5A 4LDLB 4Y8DC 4EUPB 1ZGLP 5JDSA 3NPSC 1WZKA 4CKVX 3VFOA 1NGXB 3B9AA 1B0GB 4I1NB 3MRGB 3QJHB 4HS3A 4WI8A 5K9JH 1K3IA 1A4KB 2BMKB 2EDYA 2W60B 5C08E 4TVSa 2YPLD 4YEEA 4ZUWB 2Z31B 1NCAL 4NRXB 4EIZC 1FFRA 3L3GA 1FFOA 2WP3T 1RJYB 4WENB 5IB2B 4XCFH 5IFHH 4DKDC 3NVQA 2WIIA 4O5LL 1X5HA 2HAZA 3H0TA 4M7LT 4KRPD 4XP4H 1T0PB 4HWEL 3F65A 1W0YT 5FOJA 1A4JA 3FQRB 2YD6A 3GSQB 4LKXA 2VH5L 4YHNB 4GBXB 3ISWA 4DZ8B 3MR9A 3T4YB 3IDMA 2A73B 3HI6L 4DGIL 4YJZL 4LP4A 3WIHA 5IB1B 5GPRA 2VZOA 1BZQK 3RQ3A 5C0NC 1EGJL 3RPIB 3VDCA 4HX1B 5IVOA 3T0EC 2ADIB 4JREB 1S5IL 5H37H 2FB4H 4TUJB 2FH6A 3FJTA 1P5UA 4EN3A 3BIBX 4AK1A 1B0RA 3SCMA 1UH4A 2QL1A 4IRJB 2Z8WC 1UEMA 4NWTL 3RTQC 2R0WL 4HCRA 5F70A 3A6CL 1FL5B 3IXAA 4YIQA 3SGKC 4YHZL 4R7NA 4TNVF 4ZXBA 3CFDB 1MHHB 3MGAA 4XC1L 3P77A 1F00I 5DJ6B 5KSBF 5J1TC 3QQ3B 5C0BB 4UT7H 5KZCB 2VL4A 4CN4A 3UEZA 2WWMD 4M3JA 5DTFA 3LZFL 5EC2B 4Q9QH 5HHQA 5E6IA 4NGHL 2XRAL 3W5MA 2E8YA 2F19L 2A1WH 4U3HA 4HCRL 4TVPL 2ARWA 3FKUS 1TVBA 3UDWC 1K4DB 1UM6L 4EIGB 5TE7H 2JJUA 2PKDA 5CP3H 4ZUTA 5FECB 2DAVA 2OK0L 2UUDH 1Y6NR 1MCIA 1IQWL 1HKFA 1JTPA 3O6FD 1HEZA 5BRZA 3RX5A 1MFDL 5IHZB 4GAGL 4CNIB 2VABB 4ZAKA 3Q2CA 4KQ4L 1CG9A 5MHSE 3MV8D 5F1IA 3TN0C 1T1WA 1U8HA 3PXJA 2HFTA 2VZ3A 5JA9A 4L8BB 3AC0A 3VWKB 5FYKH 4IOIB 4YO0B 3T0VA 4MX7A 3D85D 5CBAA 1I8IA 5GXBB 3WIFA 4UU9A 4XBPA 3T1WA 1VFAB 4OLUL 2MMXA 5FK9A 3DVGA 4YPJA 1FORH 3SKMA 3VRJB 4RMSA 5DEFB 2NW3A 4GXUN 1T5WA 4OLEA 3MJ7A 4PJAE 5FO8A 1TNNA 1ZLVH 5D72L 3CDCA 4WW2A 2Z92B 1RIUL 4C58B 1DSFH 1B90A 3D0LB 2IBZX 3BOVA 5EOCH 1CK0H 5EH1A 3BSZH 1YEIL 2G60L 3LH2L 5IB3B 1BD2E 2BVQB 4J4PC 4Z77B 3L95B 3SJVD 4QTIH 1N7ML 3DGGA 3ULVC 4LPTA 2HVKB 3QUZB 4XNMB 4CMHC 5ECJE 3BPCB 3O6LL 1BOGA 4NHCH 2DMCA 2F8OA 4HIEA 1TQBC 3G9VA 4J6RL 4NDMA 1NGYA 3B9KD 5FKAB 3BFOA 3KAAA 4GAJL 1MJ8L 4L9DA 3TT3L 4F7PA 5C09E 4R26H 4PTUA 2CD0A 4A6YH 4EI5D 2QSQA 4BQ8A 2EYTA 1U6AH 5D7IE 4P4RB 1RQ5A 2AJXL 1QLFB 2EYRB 5EU3A 5GSRA 1KT2A 3S34H 4HIJA 4XRCA 2EDEA 5E00B 2D9QB 3T8XA 4P5MB 1TXKA 2W0PA 3I6GA 2JJTC 1OAUH 2FO4B 3O8XD 3DRTB 3PDOA 1BWWA 5ELIA 5JW3L 4L5FH 2CPCA 3HE6A 4KY1L 4XMKH 3ULUC 4CRPA 3A67H 5I30H 2VZSA 5EO1B 5T3ZD 3NFNA 5LKNA 2H9GB 4K7PL 1BBJA 4FQIL 4CDHA 4JN1H 2X4PA 3MFFB 4PY7B 3UCRA 2P5EB 4KMQA 4Y5YC 2FWOA 4OFDA 1F02I 3H7BB 2E6PA 2Y25A 1VDGA 5BZDA 1I4FB 4K3GA 3CSYA 3QPQC 3ZTJG 5KSBB 1F11A 4PV8A 4LSTH 4B7LA 3BHBB 1J1OL 1MLCB 5F1NA 3UJTL 4MQ7A 2ICCA 4XP6L 3MLXH 4ALAL 1MNUH 4NZDA 1S8DB 5A2LH 1FVEB 5DQJB 5I1LA 1TTFA 5FF6B 1KTDA 5I8EB 2BNUB 4OLZL 3T77B 5L2KE 2A0LC 1X5XA 2AEQL 3DYOA 5IVXA 4PGDB 4QHNB 1QA9A 2JJVA 3FRUB 1LO0H 4NKOB 4UBDD 4L3EA 1UZ6E 4I2XE 3WBDA 5LQBH 1KNOA 3QIWB 1K5NA 2AVGA 3FQWB 4FQLL 4J3WA 1KFAH 4L3CB 4P5TA 1NLDL 1S7TA 3W0WD 1TMCB 4NZJA 4XPAL 5B3NA 3TBVB 1QLEH 1T7ZA 4OFVA 2J4WL 4OB5H 4G6JL 1MWAA 3DX6B 5D1QC 3HRPA 3B83A 4RRPA 4JFQA 3RGVD 1FAIL 1E4XL 1OTTC 3EO9L 5D70L 1ZA3A 3MRFA 4XNUH 4CVXB 4JKMA 2OX5A 4P9HL 1FNLA 1SYVA 5IIEA 4HGKC 4LCIL 3VFWA 1YEGH 2CIIA 3V6ZA 1Z0NA 5MI0B 2V5SA 3WSQH 5C92A 4TSBL 1NBYB 1FNHA 4OM0L 5H94A 2FJGA 1F3DH 1ZT1A 3DVFA 4YFLI 3MCKA 1X5JA 2X1XR 5HVHB 1MF2L 2JJSC 1TFHA 4EDXB 3KXFA 1MREH 1LQSR 2XIDA 5ESQB 3CVHH 4OIBA 1D5ZA 3KS0H 4LMQE 2DQGH 3L6FB 3VFUB 3HC3L 3MUY1 4CJ1A 5EA0L 1YY8A 3GSQA 1YQVH 3C6LC 2JCCA 3WFBL 1P9MA 4FG6D 2R2BB 3AREB 4UOW1 1FIGL 2F58H 3LS4H 2APVA 1MCLA 5HHXH 1GJIA 2D3VA 2EDXA 5DYOA 1G7HA 2NY6D 1TZIB 1U3HB 2ITCB 2FD6H 1AO7B 5DJCB 4HJ0C 2CLVA 2ICEA 3VRIB 3K2UH 3SKJH 3T2NL 2H26B 4TYUA 3HZKB 3BN9D 4MNQE 4Q0XL 1TETL 2GW5A 1D7FA 1M1SA 2VLKB 2DQEH 1F4WH 2D7NA 2VAAB 4TSCH 3VA6A 3QYCA 2W07A 1A5FH 3VXSA 3L9RA 3MGTB 3WFCH 1NGWA 2MSPA 1LO4H 1NFDA 5E8OB 4QRQB 3DUUB 4RGMB 5K59F 1QRNE 1I8MB 5D2LF 1ZS8B 2AEPL 1T89A 3MLVH 1MFCH 1OTSC 3MOAL 1VESA 2IC2A 2QSTA 3ES6B 4IRSC 3EYQD 2XKUA 5GGVY 8CGTA 2PCPB 5CEYA 3HMXA 4G8IB 1IMHC 3KPSB 3CVIL 2C3WA 2I24N 5I74B 3LRGA 4I18B 3PHOB 3MTRA 3FFCB 1UQSB 3HZVA 1ZGLA 1FLRH 3DECA 3GSWB 3MRNA 4QRSB 5LGJB 1JWSB 1FLTX 1INEH 4OQTL 4U1JB 1GAFL 5J7CC 5BXFB 2LABA 2IANE 1UCBH 2D03H 2GK0B 3H42H 1CXIA 1FYTA 3ARFB 5D7LB 4UV4H 3SE4C 5FOBB 3O41A 4KRLB 5ERWA 1HH9B 5EO0A 5BS0E 3ILQC 1E28A 3WJLC 4R9HA 2D0HA 5JORA 1H3PH 5CP7A 2NXZB 4RAUA 4ZS6C 2VXSL 2GITB 2PTTA 2HT4C 1BF2A 1CF8H 2DMKA 1F6AB 4NN6C 3DXAB 4X4ZA 1AFVL 1RIHH 4GSDH 4XHJC 1BQUA 4JGMA 4TRPL 4NNXA 4O02H 4D8PA 2IGFH 4M03A 3QRGL 4KPHH 3MROA 1U42A 2VLME 3DV4A 1UWGL 2QHRH 1OAQL 4B7IA 1HXMA 2FIKB 3LV3A 2Y07L 1DBJH 4LHQB 1MPAL 4QXGH 4ZODA 2VQUA 5I9QB 1CFNA 1P4BL 5E8PA 4APQA 1P2CB 1NJ9A 4WJ5A 4OCRL 1ND0B 4K8RC 5DVNA 1PZUB 2H3NA 4OLWL 4G80A 5MEPA 3G08B 3VXNA 3HCVB 2X4OA 4EOWL 5HGAB 2E7BA 5D1ZA 3N06B 5CINL 1UFUA 3SPVA 3VXUE 2J2ZA 1K3ZA 1MHPH 1T7WA 3RWDB 4LVHB 1LO2H 3KPLB 4ERSL 1DVFB 2YD7A 4KMLB 3NN8A 2DM2A 3WO3B 1AE6H 3SE9H 1NEZG 1WSST 4H1LB 2Z4QB 3NACH 4HKJB 3D39E 2QADB 3CZFA 2DWDB 4P2RD 5FYLH 4UI2A 5C0DB 1LE9B 4G43B 1C12B 4PLNC 2DQIL 3MREA 5TE4H 1FG9C 3ECBA 4AIOA 5MEQB 3DTXA 4FFYH 1IGJB 1LGVA 4XXCC 5JMRA 5IB4A 4WI5A 3NIDE 3ULVH 1KCRL 4YUEL 3UZQA 4PTTA 4RMWA 3VMNA 1BM3L 5C0CB 1HE7A 2FJHB 4NM4L 2XTJC 4WFFD 2HWZH 5SWSB 3WN5A 1PEWA 1QLFA 1UXWA 4HS6B 2NX5E 3EDJA 1MSPA 3LCYA 1WEJH 2B20A 4YDKH 2Z93B 4KVNH 2ICWB 4YNYA 1ZLUK 2HA1A 4OM1L 1LNUB 1N3NA 3C5JB 3QQ4B 3ZKXB 3V95A 1X4XA 1HQRB 4HBQA 3TWCH 4BELD 2EDJA 4I13B 5FYLD 1QSEA 2VR9A 3U48A 3GMMB 5HYJB 2OYPA 4L9LB 5KVMC 1P7QD 1GRWA 4JZJC 1FRGL 4K2UH 3IJSB 3O9WA 4R4BA 2IMNA 4JFHE 3PWJB 4FQHA 4XWOD 2B39A 1PKQB 5TJWK 3VGEA 3QNZB 3K4DA 5KS9A 3ULUH 4XI5D 2D7TH 2H2PC 4P3DA 4PJ8A 5D2LB 4TUOA 4WY7L 5DSCB 4N0UA 4MNQD 2X05A 3JWOC 4ODUB 3TFKC 4XTRD 1RUAL 4XAKD 3VE0A 1FP5A 1T5XB 4EBQH 2BOCA 1HWHB 4WEBH 4M7ZC 4K71B 3SQOL 1CFBA 4YDLB 3FB6A 3B5TA 5E2WH 1DBAH 2VXQH 3D0VB 1I85C 5TQ2H 2VKWA 5D6DC 3RZCA 3MZGB 4NKQB 4UTBL 1QRND 1JUFB 2VDPL 4PJDF 4ODSH 4M8QA 1LP9E 5JOFA 5E5RB 5T1KB 5CILH 1IKFL 3LB6C 4QRTA 4E41D 2E7LC 5BV7C 5CUSH 3WEXA 2B8OT 1S7QA 4GRLB 3V4VL 3VXMD 3VW3H 1A6TB 4U1NA 2NY7L 4HC1A 5LGKA 2P8LB 4Y5VA 4XNQB 4D0BB 3MNZB 1XT5A 5DJXA 2DKSA 3IKKA 4OCXH 3DX6A 2ARJB 5IW3A 1JV5B 5DS8A 1CDBA 1EZVY 1V7MH 2HLFC 1T03L 1JWMB 5IQ9A 2XN9A 5DRXA 5JW4Q 4LRIA 1JPTL 4Q9BA 2GCYA 3LKNB 4YDJB 2QTEA 2HTKC 2NY1D 3DURB 5EU6E 1RHHB 1S7RB 1UB6A 3KYOA 1NAKL 5BW7A 1CFQB 3DVIA 3SDAA 2BSSA 3O2VH 5T3XL 3BW9B 2YPVH 2QEJA 4ODXB 4NQDE 4H88L 4P2OC 1OGAE 3MCLH 2CMRL 2IADA 4NO0A 1EHNA 2KZWA 3HZMA 5BOPA 4M5YL 4XMLL 2VLMD 1R3KA 4KZDH 5IFJA 3SBWA 1RIVL 4XPFH 4HPOH 4QY8B 4WI4A 3VI3E 4N8CL 3P30H 1AIFB 3FO1B 3KPRD 3U7WH 3F6LA 1D6EB 4OD2A 1ULVA 3E6FA 1J88A 4JO2H 5D2NE 4ODHL 1VGEH 4KK9D 1CR9L 1T21B 2AQ2A 3G6DH 4FZEH 4ZMAT 5I1IH 1BGXL 4WO4C 4YAQA 2Z35A 2OZ4A 5ADPH 5KVDH 4PJHF 5HPOA 3D69A 4XCYA 4F57H 1XIWB 1X5YA 3DHMA 4NFCA 1IL1B 2WNGA 1NCCL 1X5AA 3PWPD 2I07A 5CZKA 3RWIA 1P84J 3UTQB 5KSAC 5F9WC 4KTYA 4Y2OA 5ACMA 1YYMH 3EIFA 5KN5A 3LSOB 1CDCA 4H8WL 2V9RA 4LU5H 2Y6SC 3KWWA 4BKLB 2OZ4L 2IH3B 1F97A 2BY3A 3SO5A 5ALBL 3KJ6H 4LSQL 4N8PA 1MAML 4H20H 5CSZA 1AJ7H 3T0WA 3SY0A 3M17B 1OVZA 1BD2B 2DLFH 5C9KA 2YD5A 2BC4A 4NCC2 1QR4A 4YDVA 1PFCA 2NX5D 3DWTA 3BD5A 4IMLA 1MCOH 4ZAKC 5F7LB 5INCA 4BSVB 4MD5A 4LNVA 4QRPB 3GSOA 4FTVE 3BGFC 3TVMC 1KPUB 3HB3D 1G6VK 1MUJB 4GUPA 3FQXB 5DHYB 3WUWA 3EHBD 4YBHA 4HH9B 4OAWA 3O3UN 4UQ2A 2YR3A 4Z78B 3MXVL 4G6AD 1YC7A 3OG6B 1V3JA 1MCHA 3MBEB 1KB5H 3H3PH 4HJGA 3IFNL 4PJ5B 2SEBB 4U6YA 5I73B 2ORBH 4N1EA 4Y4HD 2D7OA 1UZ8A 1JNHB 2ATKA 2FBJL 3GI9H 4JM2F 2O61A 2NY2B 5GJSH 4IMKC 4DKFL 2IPUK 3MLWL 1XZ0B 3HFML 5FUZH 3BZEA 1UJ3A 3N50A 4PJDB 1RJZB 3HMWL 5D96B 4BQ6A 3BH9A 1AQKL 1BVKA 4ODWB 2F15A 2UVEA 5T5FL 2V7HB 1FBIL 1DUZA 5JPMA 1Z9SA 3V9FA 3P11L 2ZSVA 3O6FA 3M8OL 4F15B 5E6YA 2X5PA 1P2CA 5GGRY 3ESUF 3D18B 1LK2A 3C9NB 4LCWD 4OUUA 1NEZB 2OR9L 5MP6H 3RWFA 3U2SA 2F53A 5BCAA 3JWDH 2QKIB 4X6CA 1WZLA 4P57A 4YBQC 1S9KC 4PREA 1OLLA 1IILE 1FZMA 3WXWL 1QFOA 2R0KL 2EIZB 5HPMB 2ZSWA 2J8UA 3MMEB 3V52L 5DHVB 1A1MA 2PN5A 1P7HL 5FGSA 3I6KA 3DNKA 3QT2A 4X9FA 4YPGB 4K8RH 1J18A 1H15A 4PRIB 3BWUC 1PZ5B 4G8EB 5IGXH 4X4XA 5FO7B 4LVNB 1EZVX 4JFFB 1A7NL 2MQ0A 3O2DH 3QUKA 4W4NA 2FLBT 5D1XD 1EAPB 3GHBL 3MLPA 1KCUL 1G7PB 4N9GB 5FHBH 4HMCA 2Q7NA 3BPLC 6CGTA 1LEKB 1JWUB 1T0MB 5F1SA 3RX7A 5DEGA 4Y4FB 3QIBD 4MYWB 4HG4K 2O5YH 3Q5YA 4LEOA 3DX7A 4QTHB 4FP8L 3I2CH 3WMSA 1I7UA 4QHMA 4U1IB 1T1XA 2GJZB 1DL7H 4Z76B 1CE6B 1HDMA 1OP3K 3GIZL 1EFQA 4HK0A 1OP5H 4ZPTB 1LO5B 3OAYH 3G5ZA 2WW8A 3NAAH 1T0NA 2EDWA 3QUYC 1I3GL 1TZHA 4ZSOE 3S5LA 4DGVL 3GUTB 2YA0A 5EOTA 1N2RB 5D9SA 2CDEA 1M6OB 5GHWH 1ETZA 3S35X 4PJHB 3QWOA 5BZWB 2XWJB 4XT1C 4OCYH 3W9DB 2H45A 3VG9C 1J8KA 2H1PH 3QWRA 4LIQH 2F5AL 2O93L 2EDTA 2ITDA 5GGRB 1FV1B 5C08A 4BZ2L 1ONQB 4PRHB 3MRCA 1IRAY 4BSWA 5KTEL 1JNLH 1GGTA 1KPRA 3FQNA 4X8JB 4JFDD 4NRYA 2YN3A 1ZHBB 5HI5C 4L4TD 1MCPL 1MRCH 4OKVA 1A0QL 2I26N 3DMMC 3FQTA 3BMWA 3QIUD 2HKFL 3L7EB 3RDTB 3RJQB 1RULL 1V7NH 3CPLB 4XPTL 5EUOF 5KJRH 5I75B 4N8VA 1J0IA 4G6ML 3TO4B 3OXRA 3BKYL 3WV0A 3NABL 1GC1H 4OFYA 1PG7X 2N1KA 2V5RA 1G1CA 4XP1H 5JIPA 1CL7I 5B8CB 1BFSA 4MMXC 2NLJA 5EZJB 4Y19D 3SDCD 3U7YH 1WBXB 3V6FA 3BDYL 4ORGA 4GAYA 5D7JC 3GNML 1IQDA 2AQ1A 5F8RC 1NUDA 1JYWA 3OB0H 3DX8A 1NCUA 2WLYA 1A64A 5HDQL 5DLML 1R5VB 2ZUVA 4U1HA 5DK2A 1OPGL 5IMOB 1U8QA 1HXYB 5T3ZL 3WDJA 3ME0A 3VD9A 4G8GD 3L7FB 5HGDA 4I0PB 5IV2A 3TNNA 2JB6A 4F9PC 1DQDH 1N5YL 4QEGA 5F96H 3LVEA 5FO9B 4JM2B 3BKML 4JJHA 2A6IA 1MI5B 5ISZD 1FE8H 5F6HJ 1SQ2N 1OARH 1CL7H 1YDPA 4ZUSB 4DAGL 3CFCH 1MHCB 1N26A 2R23A 4KJWC 1F42A 2EXYC 3UTTD 5DVLA 5E08L 3AB0B 5EZLB 1U92A 4GBXC 4C56D 1NL0H 3ARBB 3TA3B 1QNZH 1AI1H 1XGYH 3WS6C 5HYSG 2GTWB 3RWJA 1I1FA 4G9DA 4QCIA 3BGMB 2DQJH 3GGWB 4ZYKA 1LEIB 1R24B 4JPIA 5CSBA 3QQ9C 1DBKH 2PYEB 5AZ2H 4JREC 4M6NH 5BJTB 1DN2A 1ZAGA 3OJDA 3R1GL 3C5SA 2FSEB 3TBWB 1J9CT 2BNQE 3KS0J 2VN4A 1X7QA 4KKAC 3PDDA 5SWZD 2MTPA 5T1LA 3TZVD 4BYHA 2VRAA 2C3VB 4UOW0 1FNSL 5DJAA 1QFUH 4I48B 1LK3H 3N9GH 3ZTNH 4PRDB 5C0AB 4X5XA 2DI8A 1PLGH 4OTXL 3BAEH 4OIAA 1ZMYA 1BVZA 4O2FB 3WNNA 3V2AR 2YZ1A 3X3FL 3BE1L 2APXA 3QXDB 1G6RA 4BH8A 2C3GA 2XT1B 3I3DA 3ZE2E 1EFXD 3UTPE 2CLZA 4PGCB 4KQ3L 5L9DH 4PJAA 1KEML 2HG5A 3QDGB 4ZTOH 1XCTB 4MNGE 4AIXA 2Q8BH 4S1RL 5D93B 3MODL 2FX9H 5EUKA 3S88L 4AMKL 4M4PA 1QSFD 2CIKB 3VXUB 1KBGL 4JHAL 2AXFB 4KWUA 1BD2A 5E2TH 3IRZA 1G6RL 3B4NA 4JLRA 3VXTA 3L3HB 2W0FB 3IKCA 1QYGH 4QGYA 4GRWF 1NDGB 1Q9WA 4U1LA 2E27H 5F6IB 1FC1A 3QH3B 4AH2B 1QLRB 4ZPVA 4X6EB 3QHFL 1MRFH 2HN7A 4AY0A 1DQJB 5C09A 1LD9A 7FABH 3VWKC 3FONB 5J6HB 5CJOH 4Y88A 5D7IA 3FL7A 2DYPD 3PWLB 3QP3A 1T83A 2I9TB 2YMXL 3TCLA 4JJ5A 5EUOB 5C1MB 5F7DB 3TBSB 1KIRB 1JHTA 3TIDB 3DVNA 3Q5OA 4RMQA 5FM8A 3EYOA 3VRLE 4LAJH 1S7WB 3KYMB 4KKBD 4PP1C 4MXWL 3ARDD 2WQRA 2A83A 4RGND 1CD9B 4PBVC 3KDMA 4QYOB 2BFVH 2BSRA 1J86A 5K9QI 3CH8A 4DVBA 1BIIB 2XWBA 1YEDB 5EZOL 4JHZA 1FL6B 5EOQL 3JTTB 4P2QE 4Y4KD 3MJ9A 4G3YH 2FO1A 5CWSA 2HT2C 4TNWK 4TPRH 2R9HD 2AJUL 2P45B 1R3HB 2BDNH 4OSUH 1LEGA 4HJJL 5J1AB 3EJYD 1DEDA 3ROOA 3G6JF 4B50A 1A7RL 1FG2B 1I9IH 5DD0L 3EO1A 1UH2A 4Y2DB 3QO1B 5EU7C 2FX7L 1CIDA 2MJWA 3MC0A 5FFLA 1AXIB 1INDL 2VR4A 5LAXA 4ZD3H 1DE4A 3QEQE 4MD4A 3U0TB 3LKSA 5L2KA 4OZ4B 1I7TA 2D31B 3UTSB 5ITFA 1J8HD 3ZDYF 4PJIE 3IDJB 3QUXD 2EIDA 4I2XA 3DO7A 3IAGC 3QNXA 1TVHB 2OI9B 2AP2A 3O9WC 3GSRB 5I8OL 2EDLA 3P0GB 5DD3H 4WUUB 4G5ZH 1RZ8A 1TCRA 1X5GA 4HWBH 4O00A 1RZ7L 3G6AA 1BIHA 4FQXD 3ESVF 3VXRB 3FN0H 4U1KB 4GKSB 1ED3A 2VDLH 1Z9OA 1BFVH 2FH8A 4D3CH 3OHXA 3WNOA 1JRHI 2BNQD 5HJ3A 3RA7H 3H9SD 2H32H 4KDTA 1XF4A 4ZFFA 2R69L 2RQ8A 4JM4L 3EYUH 3VJ6A 1CFVL 2UWEF 1SVCP 1LE5B 1DQQB 4HAGA 3AS1A 5HDBE 3NA4A 4WUKL 5C0IA 5SWQB 3ZYIA 4X8JA 4HS8L 12E8H 4ESKA 5E7FA 4YFEA 1F58L 1RZIA 3Q6GL 4FN0A 3IDXH 3DYMA 5C9JA 5IWLA 4U2ZA 1EERB 3B8YA 1VFBA 3CFIC 3QIWC 3OWEA 5D7SH 5ANME 2XYCA 1S7UB 1A7BA 4FQ1H 4HIHA 4KJQD 3VFTB 4G6FD 1KIQA 3L5XH 3LD8B 2D7PA 2PF6A 2W1NA 3UPCA 1XGRA 4V1DE 4YH6A 3QEGH 5H2BB 5JXED 1EK3A 3GSNA 3PL6B 1X44A 2JELL 4GRWB 1RJLB 2E9BA 5INDA 4P49A 3IDUA 1JRHH 4LRIC 3QULA 1J05B 1NCTA 2XZQH 3VGBA 4GMTH 3UJIH 4MNQA 3BUTA 4OZIF 2IAMA 5KSUA 5BW7C 1FIEA 1T22A 2C4FU 2VLRD 3SDAC 4OLXH 1IC1A 3GSNL 4CW1B 1E4JA 4ETQA 3GBNH 1DEEB 2AJ3A 4EUPH 1YJDL 2GFBB 1F13A 2EH8H 4Z7QE 3FCTA 4JG1H 5CMAA 4GW1A 1QRNA 3NIGE 3MRPA 3N85H 4NO5A 3SE8H 2VLJB 3REVB 1U58A 4UINL 5HYSB 5HVHC 2E7CA 3PJSA 2VIRA 5ADOH 3WDIA 4CVWA 1KTKE 5JTWA 5GRUH 2X4UB 1CLYH 2AJZA 3TYFB 4IRZH 2WWKT 3TJEH 1Q9LA 4JCMA 4BM7A 1FNGA 1DN0B 1XGPA 3QEHB 1QBMH 4PP2B 2HMID 2K1MA 4Y16A 4MCYA 1KLGA 2X44D 1NEUA 2ESVE 2F54D 3AU1B 3QCTL 1G0XA 4FHBD 1PVHA 4NM8L 3ZDZF 4CL7A 3L1OL 3G6JB 4WNQA 2IANA 1U8OB 1U2HA 3BKCL 4RQQB 3SGDI 1JMZA 4Q6IA 2F5BL 3DBXA 4KTEH 3T0EE 4XNYL 4OD3H 1ZLWK 5BS0A 3TP4A 1FDLH 2DQHH 3D6GA 4YXHH 1FJ1A 3NZHL 4KDVA 4KKLD 1ZVYA 1RUKL 2APFA 2V17H 4I3RH 5IP4A 4RGMC 4NYLA 5EIIB 3S5LG 4JRYE 4KI5F 4RIRA 4S1SH 1A3QA 3AROA 3OKLA 3MUZ1 3WO4B 3OKKA 4PY8I 4QT5B 1QPPA 2A6KA 5DQDH 3RY6C 1L9NA 3K46A 3NH7L 1A2YB 5I74C 4XMPL 3QEQD 4I18C 5LJYH 3FN3A 5J6GA 5JUEL 1U8PB 3VD3A 4CMMA 5I2IB 1BQSA 3UPRB 1HYRC 3V0VA 3SGDH 4Q9RH 3PV6B 2XNAB 5DRNA 1D9KD 1AY1H 1R5IB 1UM4L 4MZ3A 3RVVD 1GGUA 2Y7QB 4N8VG 5E94B 3PABA 1RK0B 3ARFC 1JP5A 3WIIH 1MCQA 2Q1EA 3IDNB 3PWPA 1IC5L 4ZUVA 1A9BA 3JTSA 1HQ4B 1P4IL 1CXEA 3D39A 2G9HB 3O6MH 2UWEB 1IAOB 5JDJA 1UCTA 2LVEA 2XQYK 3ILPA 3O6KH 3ARGB 5TH2A 4BA8A 4TSAH 3VGFA 4HIIB 2IPTH 2J88H 4K55A 1T20A 2VDRH 1I7RA 4FXGA 4WDIB 1UH3A 5I9QC 4UDUB 1ZXQA 2NX5A 4OCNC 4RBPK 5K93A 2EDDA 1JJUA 3MFGB 2C7UB 3MA7A 5FYJH 1G7QB 3MACH 15C8L 3MRBB 3GRWA 1V3KA 3S4SB 2FEDD 4Z7UE 2J1KA 2YN5A 3BWAA 3HI5L 4G7VL 1Q0XL 1OF2A 4DN4L 4R0LB 4QHLA 1NMCB 4R90L 1M05A 3MUHL 3LEXB 4MQSB 4LVHC 1DVFC 1IAKB 1A02N 4V1DD 3KNBB 4NZTH 2IALA 3MQIA 4OZIB 4U0RB 1U8MA 2FR4B 3DX9A 4HT1L 3RI5F 3WKMH 4EJ1C 4LHUD 3GJFB 4P59H 3ULVE 5K9KA 3KPOB 2QADC 2XOTA 2YPLB 1W72A 4PV9A 4JFXA 4HLZG 1Q38A 5J1AA 4X9BA 3AXLB 4BZYA 3W39A 3KHQA 1QUNA 3SHSA 1GZPB 3DRQB 5HVGB 1TPXB 3H7LA 3RKDD 1XH3A 4S1DC 1BJ8A 4U4BA 3GMRB 4MXQD 3PGCA 1CT8B 5F8QC 2HFFB 3JVGA 3V7AE 1MELA 1FFNA 1LP9A 3ZKXC 5JQ6L 5BVJA 1RZKL 2PTVA 3RVXC 1CLOL 1L7TL 3CXHK 2IQAB 4O4YH 4YK4B 4ZS7H 4DGYH 4L9LC 3N1PC 1NCBL 1UADC 3ULUE 3OV6A 5DI8B 2NTSP 2ED7A 5C2BL 5FDWB 3MRDA 4UUJA 4X83A 5JOPD 3EYFB 2BY1A 4U1SB 3IETA 5D8JL 3NOIA 4QXTB 4JY4A 1BZ7A 1MJUL 3WL9B 2HLAB 2AV1A 3CUPA 1KENL 1QKZL 4MAUH 5HHVH 4BH7B 2X10A 1S5HB 4K7FA 5C0ND 1OM3H 2XZAL 1AR2A 3BXNB 2NY3D 2GSIB 2L7JA 4K71C 2R56L 5EU6A 4JFYA 4YDLC 3LMJH 1FPTL 2V6HA 4E5XB 2AJYL 2NXYD 3LIZL 1UXSA 5EO9A 4PJ7E 4M1GH 4NQDA 4S1QL 2OXHA 5HBBA 5J12B 1OGAA 3RU8L 4F8TA 1MCWW 4AL8L 1DQLH 4C59B 3WE6B 3MLZL 4KHTH 1MIML 2MCPH 1MCRA 4NQSA 2A74A 5HGHA 4HUKB 1TJIH 1G9NH 4GRLC 1MY7A 3CDGA 5GRZA 2JJWA 3MLSL 1EBAA 5DQ9B 2FL5A 3UTZA 3JUYA 1ADQA 3BQUD 4LLDA 3GZKA 4FOMA 2Y06H 5D2NA 3MLTB 1O0VA 4XNXH 2DQDH 1JGLL 2DWEA 2WK2A 4FFWC 3HI1A 1HHKB 3MV8B 4IS6B 2DLEA 1RJCA 2Q86A 4PJ9A 1YNKH 1UA6L 1Q94A 2VDKH 2P24B 5GRVL 1Y6MR 3PWUB 4OZFG 4OGYL 3QIUA 1WZMA 1IBGH 2R2EB 2ATPB 2HFEA 2X1OA 1MJ7H 3D85B 2Q20A 3CGTA 4HV8A 3QG6A 4ZFGH 4KK8C 4YE4H 4ODVL 5EU4A 2ZUXA 5DMYA 4X7CC 4BUGA 3BZ4B 4LGRB 3BRDA 4M5ZH 3GMPA 3TN0D 4U7MA 1I1RA 3CFJA 5ID0B 4HF5L 4UTAL 1FFPB 3EOBB 1I1AA 4X7TA 4NKIH 3STZB 5IW1B 5M7QA 1CE1L 4R4NC 1C5CL 5J9PA 5B3JE 1Q0YH 5BQ7A 2V5MA 3BIKA 5CFHA 4XB8A 3SJVB 5L6YL 4QHUB 4POZC 3VD7A 2APTA 2QQLH 3FT4A 3GSUB 1MFAL 5IM7A 4YR6B 3EOTH 2P5WE 4FTVA 1DLHA 1CU4L 4H5SA 3O0RL 4MDIB 5JHLL 1SBBA 5IG7A 2A6DA 2BJMH 2VXVH 3C60D 3SDXE 3W2DH 1FVCA 4LLWA 4PJBE 3VXPA 5DT1L 2GIYA 3B9KB 4K94L 1MFEL 5E4IA 1XIWC 1N64L 3KYKH 4OF0A 3R4DA 3B2VH 1NBVH 4QWWD 4EI5B 2VISA 2YWZA 2XFXB 4FFVD 4J4PD 3V4PL 4HWZA 3K1DA 3UTTA 5FCSH 4RX4D 5I1DA 1WF5A 4ELKA 5A16A 4CDGC 3JV4A 4C56A 1R5WA 2H6PB 3MOBH 3IFPA 3NFPA 3WFHA 1SY6L 4F7CB 4L4VE 4AM0A 1NMBH 2OTUB 4PJXE 3C8DA 5GS0H 5IBTL 3O8XB 2DDQH 5HD8D 4U31A 2EYSB 5JPNA 4IOFD 5DO2D 3WS3A 4PUBL 4H25A 5CEZH 1YN6B 2AK4D 3MUJA 1QEWA 1JF6A 1D5XB 5I8KH 1H3WM 4YHML 2CKBA 3QDME 1RUPH 4UAOB 4QOKD 1KGCD 3TZVA 4DCQB 4LLUB 3K80A 1G9ML 4JO3H 3HRZA 1HYSC 4HPYH 1U8JB 4CU7A 4XCEA 3V5HB 1CXKA 1HHJA 4DN3H 3MBEC 4AEHH 3QO0B 3BPNB 3KYNB 1PSKH 4UILH 2A6JA 4KJYB 4YZFE 1KYOK 4OCMC 1H3GA 5IR1B 1PEZA 3MRIA 1RURL 4N5EC 1PW3A 4PRBA 3QXTA 4L1HA 1MH5B 4KTDH 4Q9CA 4PJGF 2NY2C 1W0VB 1OWWA 4QRUA 3QXAB 4NUGH 3FHAA 4JPVH 2XKNA 3RIFF 4LRNH 3HPJA 5DFTA 4UB0L 4F7MA 2XZCL 2IBBA 2DBJA 3OAZK 4RA0C 3ZL4H 1AKJD 3ZKMC 1IFHL 4R4FH 3IFOA 2XKSA 5D6CB 5FHAH 4F15C 4NO3B 3W0WB 5ESVA 4YX2L 2DD8H 1WAAE 3T0DA 2QSCH 3KLAB 3L5WB 2ICES 4NQCD 3LKPA 1H5BB 1G7QA 4OZGF <