4NRXA

Crystal structure of hiv-1 neutralizing antibody m66 in complex with gp41 mper peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
229
Chain Sequence
QVQLVQSGAEVKKPGESLKISCKVSGYNFASEWIGWVRQMPGKGLEWMGIIYPGDSDTKYSPSFQGQVIISADKSINTAYLQWSSLKASDTAIYYCARQNHYGSGSYFYRTAYYYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for HIV-1 Neutralization by 2F5-Like Antibodies m66 and m66.6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Envelope glycoprotein gp41
total genus 40
structure length 229
sequence length 231
chains with identical sequence D, H
ec nomenclature
pdb deposition date 2013-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nrxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nrxA01
2DQDL 5GGTL 3ZKMD 1N2RB 4HW6A 1CLOL 2HWZH 2F53B 5FK9B 2DQGH 2VLKD 4E41A 1G0XA 1QFOA 4F7PA 5AYQA 3P9LA 3PL6C 3QNYB 3TBTB 5JDJA 2EH8H 4U6HB 3VFUA 2PYEB 3MLRL 4BH7A 4HC1L 3FN3A 1EFQA 3MBEA 5EC1A 1FVDB 2Y72A 2CXGA 2EC9T 3O3DA 4NQDD 4UBDC 5DK0B 1QBMH 1S5HA 1K4DA 2D31A 2MWCA 1INQA 1HH9B 2A6DB 5GHWH 5CHNB 3C6LD 4XZUB 4XX1E 4YXHH 2XKUA 5JHDA 5JHDB 3G08B 2ZG3A 2ED7A 4A6YH 4PD4K 4PJDA 4F7MB 2VZSA 3DROA 4U6YB 1N4XL 3ALXA 4R97C 3R4DA 4P0DA 1KN2H 4TSAL 4Z7UF 3ET9F 4I4WA 4HJGB 4D0CA 3QNXA 1RZGB 4HFWB 1MNUH 3DO7A 1V7ML 1FPTH 4N0YH 4Y0GA 4HK0B 4KJWD 4YE4H 4K9EH 3MJ7A 2VXSL 5FCSH 1EJOH 4DZ8A 1PG7L 2LAAA 4MS8D 3FQRA 5F7WC 3FOMB 2ILLA 2ITCB 1S9VB 4XVJH 4KJWC 2R1YA 1Q1JL 3OKDB 3QBTB 2FZ3B 2IALA 4KTDH 4TUKH 2QADC 4YXHL 1G6RL 3G04B 4XBPA 5DO2D 1RK0B 1MHEB 3NTCH 3VI3F 3D25B 3OKKA 3X11B 4WIQA 4GXVH 1OM3H 2FEDD 3RJQB 3LN4B 1T2QL 3F12B 1XGUB 3D3VB 3ROLB 5IHZB 5EG6C 5E08L 3D1MC 1BEYH 5C8JA 5EUOF 5SWZE 1G9MH 1CDCA 1I1YB 1UM4L 4PY8I 3D2UA 1VKXA 3D6GA 5HGDA 3MCKA 1NCTA 4QNPF 5HY9B 1CLYL 5D93C 5F7KC 3U6RA 5MEQB 3G9VA 4Z7WA 4YDVB 5F7EL 4GW4B 3RZCB 2ZNXA 4M5ZH 4AEIL 3QXTA 4F8QA 4C56A 3MRGA 3RZWA 5AD0A 5J12C 3H9HA 4ZO8A 1JGEA 1UM4H 4JN2A 5EU4B 1PKQA 4LSRL 2VLRD 4HKJB 3TJHD 1VERA 2XN9D 3OGCB 4NQCA 3MRPA 1X5GA 5HYEA 4IRJD 2DBJA 3ULUE 1WAAA 3HRZB 4MJID 1EAPB 3HE6B 4XRCA 3QYCA 3CMGA 4OLXL 1ZHKB 5E9DA 3WLWC 5CINL 3V8CA 4ZOBA 4HXBH 1UQSA 1IGFH 2AXFB 4P3CL 2W9EL 1ZHNA 5D1ZA 2HJKB 4M7ZB 5CIPB 1F3DH 3UBXG 2YKLH 4L1DA 2JLLA 3P0GB 5CGYC 2AEPL 2VXSH 5D5MF 1IEBA 3O6ML 2MNUA 5D96C 2FR4A 2P5WE 1NC4B 4XX1G 4Y2OA 1RURL 3RQ3A 4JVPA 1JN6B 2DLFL 3NGBC 1Y18A 3OGOE 4KDTA 3QG6A 4ODTH 4APQB 4N0CC 4JHWL 2NTFB 3QUYC 2CLVB 3MOQA 2NY0B 3VXMD 5CS7A 1IEAB 2XZZA 5HVFB 4JFFB 4C58B 5GRYA 1SHMA 3GSUB 4UU9B 5E1AB 3LKOA 3HE6C 3O3EA 1X44A 5L2KE 3DUSB 4I2XE 5DK3A 1RJCA 4J6RH 4O02H 4PJIB 3BKCL 2HT3D 2DDQH 3TESA 1KPVA 4Z7VF 5I74B 2ADJB 3G5YB 1G7QB 2OK0H 5HGBA 2G5BB 4KTEL 1E4XI 2YWZA 3QSKB 2CD0A 5C9JB 1Y0LA 1VFBB 2CRIA 3SKJH 5JZ7C 4WHTA 2N1KA 2A77H 1NCAL 5D4QA 4PJ5E 1S7QB 3GRWH 4U1JA 1P2CB 4FMFA 2X9YA 4UIMB 1ZHNB 4L4VD 4GKNB 2XTJC 5I0DA 4PGDB 3U0WL 1WIOA 3TIDB 1NDGA 1Q94A 1RZJC 5T1MB 2XICA 3F58H 3ULVD 1FFPA 4QY8B 5IKCB 4Y4FA 4QOKE 4ENED 2K1MA 5E2VH 1RU9L 5GGQL 1DR9A 2VXQL 4I5BB 3OXSA 1CXIA 2DQIL 5T3XD 1KTDA 3HI1A 2ZSWB 4DN4L 2ZSVB 1OAXH 5EU6B 2IFGA 2KQMA 3WJJA 5FHBH 5DJCA 1NAKL 2F5AH 3IF1A 4AT6A 5KANI 5FYKU 4LCCB 2Z35A 3S3JA 5MEOA 4N1CA 4LPWA 2HLFD 3KPLA 4JFEB 1P69B 4CW1A 3OF6D 3DI2B 3JUZA 3WN5C 5TDNB 1Q94B 1NDGB 4YWGH 1GGUA 5F6IC 5D1XB 5AYUL 4QYOB 3TLRA 3BDYH 4PV9B 2EECA 4OD3H 1ZS8A 3FCTB 3H0TA 5C0JB 1IAKA 5FDWB 3W5MA 1P9MA 2QHRL 3QULB 1J88A 3V5KA 3EGSA 2EDBA 1B4RA 3IKCB 1AE6L 1KENL 4JKLA 1MRDH 4LASL 3L5WA 2X89A 1Q0YH 5D5MB 2H9GA 5I75C 4YDLB 5DJ2A 5BRZB 1AI1L 5I1HL 4MQXC 1HZHL 5CKAA 5B38G 1H8NA 5DMKA 4DKFH 3MBEC 1U8KA 2CMRL 5DJ6B 1KTRL 4JDTL 4K71C 3AS0A 5IFJB 4U05A 4DW2L 1BOYA 4PTUA 5DYOA 4NHCL 5KS9E 1PQZB 4Y89A 4YDLC 1KJMB 4EVNB 5EBGA 1CDIA 4N9GA 4IOFC 4FQ2H 5JXED 1NKRA 2OBGA 5FA3A 1QSFE 3FB5A 1QNZH 1GC1L 5IB5A 2C7UA 4Z7QE 4KZDH 5IGXH 4R8WL 5J56B 3TBTA 2ICEA 1GGBH 3MLXL 4XC1L 4YHIA 4M48L 5HI3D 1J5OH 3PGCB 5GS1C 3DVGA 3L3JA 3G6JF 3HRPA 5LXGL 4XNUL 5C09E 1NPUA 4OCRL 4HCRA 3FQNB 2OMBA 1UEYA 1EUTA 2YPLA 4GKOA 1HNFA 1FZMB 1QRNE 3DXAB 2X4PA 1QR1B 1GHFH 4XNMB 1GYAA 1RAMA 5GRVK 1WT5A 3CVHL 4BSVA 2WZPD 3P3YA 5J11C 4WI5A 3DYOA 1EERB 3MJ9A 1TJHH 4MDIB 4U3XA 1WFTA 3D85A 2MOVA 5ADOH 2ADFH 4QHLB 3GNMH 3I2CL 3B2VL 4LSVH 1B6DA 4OF6A 5FYJL 3MNWA 1A3RL 1LDPL 2DI7A 3PWPE 5SX5K 1J5OL 5FKAA 3UXFA 5GSVA 1UXSB 2A77L 4X98B 4JFFE 2AEQH 5J06A 3QRGH 4U1SA 3HUJB 4HGMA 1KIRA 3V9FA 4KKNA 4JQVA 5FGBC 1FVCA 3JTTA 4RMWA 1ADQL 2EC9U 1YNLL 4G42B 3MUJA 1T1XB 5DJZA 1XGUA 1YYLH 1OTTD 2RR3A 3BVNA 3ARBC 2ESVD 2DQUH 4XI5D 4XMPH 3GIZH 4I48A 2WUCH 3BKJH 5C6WH 2I26N 5J1AA 4FQXC 5JMRA 5T1LA 4M00A 3TNNB 3KDMA 3Q5OA 1ACYL 3LS5H 2P49B 5I1CL 1E4XL 4GMSL 5I1GL 3OPZH 5M94B 3O8XB 4LSUL 1UXWB 4JDZA 2C3VA 1MQKH 3I9GH 4UQ3B 2VL5B 43C9A 4HWZA 3BT2H 5E2TL 4PJGF 3EHBC 4Q6IC 5CZVL 1UZ6F 2V5MA 2V6HA 1BGXL 5KSAA 1Q9KB 2R2EA 2PXYC 1RFDH 4P2RA 2NR6C 2Q7YA 4HMDA 4JVWA 3B6SB 5C07B 1E27B 4ODTL 4MNHA 2Z4QA 4I13B 2O5XH 3BT2L 2UWEA 2CGRL 4M8VA 4X6CE 3L5IA 1A2YB 1WFOA 2ESVB 2NR6D 3N1PC 4ZD3H 3CDYA 2V2TA 5IUSA 4F7PB 1W0YT 4RAVB 1I3VA 1XF2A 1ADQH 3UCRA 3ZKMC 1BIHA 2OMNA 2YSSB 3W39B 3OKYA 1VB9A 1T83C 2UZIL 3BEVB 5L2JB 4HWBH 2NLJB 3QRFM 3QEQA 1XGPB 43CAA 1QVOB 2GI7A 3GSQA 2G2RA 4EBQL 5F8QC 3VRLE 1HSBA 4NQXA 4ZTOH 3L9RB 5ENWB 3K7UA 4PRHB 1MCKA 4OZHA 4RISH 1ZEAL 1I3GL 2ZPKH 5BRZE 2WBKA 3ZE1F 1RZ8B 2BNUA 4LLYB 3T04D 3TCLB 1EX0A 1YNLH 3C5ZA 2SEBB 2EDDA 4NNXA 4JFDA 2WWKT 1V7NL 3I6KB 4S1SL 1N7MH 2Q76B 4EI5A 3BRDA 5FA4B 3U7WH 1KGCE 2JCCA 3T0EA 3RWCA 4DVRL 4KGJA 4OCRH 1I8LA 3QIUD 2JB5L 2YD4A 2YWYA 4WFFD 5DEFA 1QFPA 1IEHA 4PJFB 1KT2A 4MXVF 1H5BC 1E4KC 1S3KL 5TGBA 4EUPA 3CVIH 1KPUB 2ARJA 2CPCA 4GFTB 1FNSL 5DT1L 2V9TA 4M5YL 5T5NF 5JLZB 1NUGA 1NCWH 1FYHB 1URLA 3RPIB 5DC4B 2IQ9L 1RPQA 4A6YL 2P42B 2QADD 3C6SB 3VWJC 1FGVL 1NC2B 2YA1A 1EIBA 2FEEL 4LMQI 3GJFA 4DTGL 1C5CH 1J1XH 4JVUA 4ZDHA 2YXMA 3RBGA 1RK1B 4OKVB 1S7QA 3SE9L 5J1AB 3NOIA 3EO1B 4PGCB 3RVUC 5DUBB 1ETZA 4NGHL 4J4PD 3WFHA 1NL0H 4HAFA 5GS1A 1NFDE 4KV5E 4LSPH 3I3BA 3ZLQC 3DX7A 4OQTH 1TJGH 4P4KC 2YUZA 5GISL 3SKMB 5EN2A 5I8CA 5HHPA 1J10A 4J12A 2LE9A 2VL4A 1ULVA 4LLDA 3CK0L 4PV8B 5T3ZE 3S37L 2BNQA 4Z5RB 5DHVH 5I76B 4OGYH 2WUCL 2CIKA 1LP9B 4TVPH 4XWGL 4KJQD 4TUOA 1FG9C 2Y1VA 4OCYL 3MBXH 3RVXD 2I24N 4APQA 4M1DL 4HWBL 3VXQB 1DBKL 1H9VA 4M5ZL 4AEIH 1NH6A 1UVQB 4XP6H 2CKBL 2D9QB 4HIIB 4P46A 5KBNC 4OAWB 3U83A 2NCMA 1G7LB 3VFPB 5TQ2L 4NNPH 3U46A 1UT9A 1FCCA 3RNQB 2ZPKL 2DMBA 1D9KA 3IB4A 2YHGA 5EO0A 5KSBF 4YH6A 2NX5D 1BMGA 4G8FB 4QHMB 2JIXD 3ZE0F 12E8H 2PXYB 5IBLC 3BAEH 3MJGX 2MKLC 5C0EA 4R3SB 3MA7B 1NGYA 1KACB 4H8WH 1KB9K 3SY0A 5SWSD 5E6YA 1CVRA 5F9WC 2F5BH 5JA9A 2GAZB 4JB9H 4P4RB 1GGIH 4F7TB 3EKCA 4YAQB 3T3MF 3V6FA 4D3CH 4G43A 2BY2A 3TT1H 3BPLC 3PP4L 1MCWW 2H3NA 3OZ9L 4RWYL 1WTLA 1AQDB 3TH2T 3MRGB 4P3WA 3U4EB 5EA0H 1TCRA 3D5OF 2DWDB 4OLWL 4OZFH 4ZAKC 3LIZH 4HUXA 4K94C 4O2CA 3S35L 3GK8L 3MV8D 1IKFH 1CFQB 3O6FD 4G6AC 4MMZC 3SCMB 5BQ7A 2B20A 3K74B 2A6IB 4FQXB 5ANMA 4ORGB 5CSBA 3R8BB 2VXQH 5D2LF 2ICWI 4YNYB 5C0AB 3TH4T 4LCIH 4ZFOB 3RU8L 5IR1B 4UT6L 5IR1A 5DQJB 3U1SL 5FO9B 1MJUL 3WDJA 1EGJA 4PJ8A 1EEUA 2EYSA 1Q72H 3ZYZA 2HVJA 1NCBH 3BO8A 1HINH 4QRRA 2GTWA 3VGGA 5FKPA 4HUUA 4MNGB 4KQ3H 3IVKB 4YIQA 1KCSH 1WWWX 4ZFFA 5HGGS 5F88A 4Z18A 5B3JE 3VE0A 1INDL 1RV6X 3ZKSD 4XMPL 5I16A 1YECL 4APQD 5D71H 4UINH 5F9JA 3VGBA 2A9MH 3BRFA 2JCCF 1MJJA 1FZOB 1JZ3A 4U33A 4Q9RL 2Q7NA 4HUXB 4Z95H 3LSOB 3V8OA 4L4JA 1DEEB 1NFDF 3QA3B 1XGQB 3MV8E 2Q8BH 3G6JE 4RIRB 1FE8H 3OPZL 4KK6C 1JNHA 3P4MB 3VI3E 1X5YA 3DMMD 1R5WA 4NKOA 3O9WA 4F7EA 2HAZA 4K8RL 4G8GE 3X3FL 5EORL 1NGYB 1UCTA 4OB5L 2PYFA 4QRTA 5C6TH 3EYQD 3RWHA 4J7RA 4XCNA 3B8YA 5AAWA 3FAWA 3SDXB 5L8KB 3MMEB 2X2YA 4PP2A 3HC0A 2ITDB 1AXSA 1N2RA 3F7YB 3FO2A 3OKNA 3BXNA 1BF8A 4ODUB 1S8DB 2RQ8A 3O0RL 4J3SA 4U0QB 2FD6H 4XCYA 1Z0MA 2KL6A 1K85A 5FO7B 2W92A 1EO7A 1CFSA 4L8CB 5EZJB 3S37X 5GZOC 3ARDA 5FYKD 1Y6NR 4HJ0D 1ND0B 4I2XB 2UWEF 1IM9B 4Q9CA 2XWBB 5DSCA 4NOBA 5HHXH 3UTSA 1GXEA 2JIXA 3JV4B 3MV9A 2QSQA 2IPUG 5DMYA 4LFHD 2BRQA 1T03H 3VMNA 2Y6SD 4KK5D 3HA0A 1YECH 4PJGA 3IYLW 2CIKB 3ZO0A 5B4MC 3V7AG 3BSZL 4PREB 4MX7B 1XR9B 1SY6H 3C5ZD 5ESQA 1XCQB 2BJMH 4PJEE 3PWPB 4K7PY 3MCLH 5KVEL 1FHGA 1OGTB 5F70A 4GKZA 1VEPA 3M17B 5FUCC 4PJBF 2GUOA 1LILA 4PGEA 4JJ5A 4YX2L 4KC3B 3CH8A 2CIIB 3GIVB 5GQBA 5IB1A 2VQ1B 1QRNA 3SDDC 3QUZC 1SYVB 2V2XA 1EH9A 3L5HA 4PJBA 3QUXA 4OM0L 2QADB 1NFIA 5BJTB 2Y25A 2GK2A 4EOWH 2VH5L 4OLWH 1UH4A 3FQWB 3NCCB 3ARGB 2H6PB 2NY3C 1CDHA 3RJDA 2LU7A 3C09B 1FNHA 1A4KB 1EJOL 2X4SA 3RA7L 1F45A 3HCVA 4OLUH 4UV7L 3RWCB 1QR4A 4LP5A 4UOJA 1QBLL 3HRZA 4HHAA 1IAIM 2WWMD 3BZ4A 2FSEA 3W11C 1KT2B 1DANU 1NGQL 25C8H 3V4VH 4PREA 1VEOA 3JV6A 4LEXL 4KVCL 3C8KA 3RA7H 3R0NA 3BPOB 4HKXB 2E27H 2W07A 4LL9A 2Q76A 1DN0B 1NLBL 3QIBD 2YXFA 1BEYL 4M6MH 2W9LA 4Y5XA 5HSFA 4ZSOE 2C4FU 1AKJB 3TO4B 4GRWB 5J9PA 1EO8L 1EHLH 2D7NA 2YUVA 1XGPA 3QDAA 3THML 5DSCB 3FT2B 1G7MB 3LCYA 1HHGA 3O3AB 4JREB 3DV6B 3TEUA 4FA8A 4POUB 4O4YL 1HSBB 4NQXB 3TVMD 3D39D 1OWRM 1YDPB 2P8MB 1NBVL 1QBAA 2RIKA 1N59B 2DM7A 3UTOA 3QPXL 2Q6WA 5EZIL 1X5JA 3Q1SL 3RGVD 1IVLA 1YY9C 2AJYH 5JOPD 4F58L 2XZAH 4G8GA 4U7KA 3QUMA 3WFBL 4ACPA 3UTTA 4Z0XA 3MUGA 3OL2A 1DVFA 5GPRA 3JTSB 3RI5K 1JP5A 3BPLB 4HZLB 4Z7WE 3RY5A 4L9LA 5DLML 1AIFB 4LHUG 3GB7A 4I4WB 4EN3D 4WU7A 3MRRA 4HKZA 1ZANL 4CU7A 2DQCH 2VXTH 2XNAA 2CDEB 3AVEA 3VW3L 2YD8A 2EXYD 1YJDC 5D1QA 3E3QC 1XGQA 1MUJA 1BZ9A 2AJXL 1CBVH 1FLRH 3P4LA 4KKLC 3LSOA 1DBBL 5DD6B 5B39G 1A6TB 3IT8D 4JDZB 5C09B 2WM0A 5I9QB 5C2BH 5MENB 2J3SA 2H6PA 1HH9A 1INQB 2C4XA 4X99A 5IOPA 1AY1L 2R56H 1KPRA 4YDJA 1FL3B 1AGCA 1T6VN 5C0AD 1CLOH 2HWZL 1Q9WA 2C5DC 1UB5A 2NY5H 1P5UA 2PYEA 4PJBB 1DLFH 3IDNA 5I1KL 3T0VA 1IL1A 4WV1B 1LK3L 3KAAA 3SCMD 2V5TA 35C8L 4I3RL 4MZ3A 1C7SA 2ADFL 1NSNL 4KWUA 5TE7H 2MMXA 2J7LA 2P5EA 4XBGB 3FMGL 1FLRL 2E9WA 3RTQC 3UMTA 2PF6A 4G9FB 3MNVA 1TZGH 1S5IH 5KOVC 2AK1L 2AEPH 1ZT4B 2MCPL 4H1LB 1ZT1A 3NZ8A 5C7XL 3P2TA 3VH8G 1SQ2N 1MCPH 4I3SH 2E6PA 4MAYA 12E8L 2DWEA 5D2NE 3ARQA 2BVQA 1W72A 1KYOJ 4F37K 3VH8A 1KIQB 5T33L 4J8RB 3TVMA 4P9MH 5T3ZD 1SEQL 5JW5A 1IFHH 4JCMA 2BFVH 4FFYL 2ICES 4O00A 5DEGB 4PJEB 4ZPVA 5SX4I 3QHZL 1N7ML 1JJUA 1W8NA 4UILL 2Z31A 5DMIH 4JFYA 3GHEL 4ZO6A 1Q9OA 5IW1B 3S6CA 3FQXA 5INCA 5KSUB 1JRHL 2AJVH 4PJ9D 1HEZA 3V0WL 3BAEL 5IEKB 5DUPL 2Y07L 4OZIA 3IJYA 2C1OB 3W9EA 1V7MH 5I18H 2GKIA 4MLIA 5CILL 2YPLB 3TCXA 1OAKL 3BGMB 1BM3H 3WS3A 3GSNA 2X1PA 1P4BH 3R1GH 1OW0C 1J05A 1EDQA 4MD5B 1KPRB 4YDJB 5T1KD 3WXVL 1Q8MA 3DX6B 2BCKA 3W9DB 4MAYC 2VERN 3CSPA 5ECJE 5FGCB 1BP3B 3DX9B 1CXEA 4M03A 4PB9H 4EI5C 1HKLH 4XP9L 1R3LB 2BXZA 1MUJB 3HZMA 2DDQL 4KGLA 5B39A 5CZXD 4KMQA 5F9JB 3IDJB 4FQ1L 4S1DC 32C2B 1T7XA 3I50H 4Q58C 3ECBB 2A6JB 4IMKC 2P1YA 4UQ2B 4HH9A 2EIDA 1HZHH 2HFEA 2VISA 3RRQA 2EE6A 4X7SH 2H9GB 3DXAE 3SKMA 5I8CB 3LRGA 1MJ8H 3T2NL 3T3PF 2PTTA 4FQ1H 4F57H 2F5AL 1LO5B 4PJ8B 3MNZB 3I9GL 2O61A 5D5MA 4HT1L 2ZUXA 1A6UL 2GTZA 3ES6A 4XNXL 2JJTC 4BUGA 1F2XK 2IEPA 3R8QA 1ZS8B 5C0JA 3BKCH 3A6CH 5EZOH 1OAQL 4ZQKA 3MRQA 4ELME 3AS1A 4H20L 5TE6H 3VFGH 1X7QB 5TDNA 3MOBH 4EI6A 4ORGA 5EIQA 1MCHA 2CK0L 5C0BB 5F7MC 1A1NB 4U6XA 5EU3A 3O81A 1EXUA 4FG6C 5IF0A 3LN9A 3KYMB 2Z35B 3KHQA 4LCCA 2FHCA 3WL9B 4DZBB 2BFVL 3TA3B 1M71B 3CDCA 15C8L 3AB0C 1V8HA 2E9IA 2DQHL 1EBPA 2ZG2A 4JFXB 4ZFGH 4HS6A 1I9JH 4Z7VE 4F7TA 1HXMB 2VZOA 4X0KA 3INUL 1QSFA 1G6RA 1PG7X 4P5TB 3U4BH 5FA4A 4PY8J 1QBBA 2IWGA 4XH2A 1J8HA 3QQ9D 5IMOA 1V3LA 5IB4A 3MXWH 1KTDB 4YDKL 3OG6B 5C0EB 1EZVX 2VSCA 3B9VA 4OTXL 4ODXB 1WEJL 4FFVC 4PJ5D 5FUOL 5EDXA 4GBXC 1G0DA 4BFIB 3ARWA 1OAKH 3I02B 1H3TA 1EEYA 2G9HA 2NY1B 3IFPA 1OM3L 2VR5A 3L9RA 5ENWA 4UV4L 4RGOL 4Q6YA 5GGRB 5LGHL 4ZQKB 1GC1H 3OKMB 1KJ2L 2VAAA 3L1OL 1FN4B 1J0HA 5FUZH 4UNVA 5CJXA 4EI6B 3RVUD 4K8RH 4UNUA 1U8LA 4L9LC 1IQDB 5JR1H 1OAZL 4QHKI 2DD8H 3SDCD 5EZOL 4F33A 2AW2A 4Z95L 4UT6H 4TVPL 4XWGH 3ZYJA 4JPIA 1E28B 4X9BA 4NHCH 3PWPA 1LO5A 3GSRA 2UYLA 32C2A 5KSAC 1D6VL 1IMHC 1F6AB 3JWDC 4G80A 1A64A 4OZIE 3H8NA 4FNLL 1KJ2H 1A22B 4QRPD 1S7RB 4LOUC 4JFPA 2QHRH 3MRMB 1S7VB 4OZHE 2YEZB 1T7VA 4K55A 1MFBH 2OTUA 4F33B 4M7KH 3QISA 6FABL 3W0WA 3KJ4C 1DANT 4I8DA 1OT2A 2WLYA 3KPMB 4FQIL 1XF3B 4KUZL 4YDKH 1WCBA 2LQRA 5E6ID 3L3GA 4AM0B 4P59L 2Z8RA 5HI5C 2E5EA 2XWTA 1NC2A 5I1HH 2B5IB 4PGJA 1L9NA 4ODUA 4HSQA 3QDJA 1OY3B 4JQXC 1HEZB 1RUML 5CLTA 5MI0C 2BOCB 2VLJD 1H3XA 4YWGL 4NZRH 3V4UH 4WI8A 4ELKA 2G9HB 2CGRH 2ZUUA 1JWMA 2HG5A 4U0RB 4XHJC 3Q48A 1YEGL 4ONGH 4Y88A 3PGFH 3LEYH 3PUCA 4CJ1A 4YPJA 1RIVL 2R15A 3UO1L 5IB3A 5J0BA 1P7QA 2Z93B 2H32A 4KPHL 2E7LA 1BOGA 4JZNA 3ULUL 1QSFD 4JN2B 3CFJA 3OB8A 4JM4H 5DRXA 2J2ZA 1QKZL 3NCJL 3OHXA 3AUVA 4TN9A 4GQ9L 4PJAF 1EHLL 1I1YA 4NCC2 2AJUH 2W0KA 4R6UA 4K3EH 4EN3A 1G7JA 1IGTB 2FD6L 4G6AD 1AJ7H 3FB8B 4WI7A 5DGRA 1B2WL 3GSVB 3DVFA 2X4TA 3RL1A 4JGJA 2B5IC 1RK0A 5EO1A 4X8JB 4DFIA 1FFQA 2VR4A 1LE5A 4D0BA 4EOWL 5E2UH 5IHZA 5JW4N 1CU4L 3O41B 1JF1B 3J7HA 1CWVA 4X5LA 5HHOE 1HQRB 1U3ZA 4G9FD 5DHXB 1MHEA 3SGDI 3O2VH 2ZUQB 2DLEA 1OPGH 4DGIL 5FO9A 4LVOC 5DA0B 3V7AE 2WBJD 2FGWL 4POZC 2X1QA 3VXUD 4OKDA 3WN5A 5CJBA 4Y1AA 4MNHB 1I1AD 4W4OA 3L6FB 3LOWA 4N8PA 4FTVD 1EUUA 5F96H 3NVQA 1Q9KA 1Z9LA 2XA3A 5HGAB 1S7SA 3EYVB 5E00B 5FYKE 3VD7A 1HE7A 1ONQB 3PWJB 4JM2D 3AAZB 3OMZA 3ALWA 3HR6A 2RJMA 1MI5D 2IAND 5DQ9A 4EKXA 5IT2L 4WCYL 4LKCB 4Y4FC 5C09D 4GKSA 4QF1B 1MAML 1BBJB 5A16B 3B9EA 5F71A 1TJHL 5GRJH 1ONQA 3PWJA 5K59E 5ISZE 4L9LB 1DQLL 5JPNB 2FGWH 4U1NB 5FV1L 5CD3B 5SWZB 1I1FA 1BQSA 2AK4E 2CLRA 2VLKB 4WY7L 3RGHA 4H25A 3H3PL 3MA7A 3GB7B 1YJDH 3QFJA 2BX5A 5ACMA 2NY5C 1UYWH 3RX5A 3P9LB 3QNYA 3JTSA 3P0YL 4FFYH 5DJXA 3FAXA 1KJVA 1IZKA 3ZMRA 4R4BA 2R0KL 3O9WD 4M6OL 4V2CB 1FNSH 5DT1H 3BDXA 2ZZUT 3T8XA 3VGHA 3LQZA 2Q86A 3AU1B 4CN6A 3FO0H 5JIHA 3SE8L 4HIIA 3FFCE 1RI8A 4NUJB 4NOFA 5I1AA 4PRID 5D7JC 3UJJH 5F7YC 2AXHA 5KSVB 1TQBC 4OIBA 3RL1B 3ZT5A 2YZ1A 1AKJA 1V7NH 2XG4A 4KRPB 1FV1A 2W9EH 1CS6A 1NMBL 4BELD 5EO9A 3SDYH 1G7MA 1EHNA 5H2BB 1YMME 2HRPH 4OCNC 3NFNB 1MFAL 3U79A 1E6OL 3BUYB 3GKWL 1LGVA 3BHBA 5CBAB 1XCTA 4NFDA 2VLLA 2AABL 3F62A 4JO4H 4WHCA 1ZT1B 3Q6FA 3MFFA 4X5XB 2HT2C 1PVHA 4NQDA 4P5MA 2ICWA 2UZIH 3WEXA 4ZNCD 4DVBB 3EFDL 4XPAL 3FMGH 1QSEE 3BP6B 4ZOCA 1QACA 1ETZB 4J3XA 5F7FA 5JW3L 2HFFA 1I1CA 2X1OA 2QSCH 1P1ZB 2VN7A 1I7ZB 4ZXBB 3PGCA 3ARGD 4AEFA 4LCWE 5IEHB 3GJFB 2XWTB 1J11A 2M8XA 4GG6A 4UIMA 3VW3H 1CDJA 2X5PA 5EBWA 1TVBA 3HNTL 1ZHLA 2GITA 5JNYA 4K94L 5KZCB 4U1KB 1BPVA 2JJVA 2IF7A 5DFWH 2IQ9H 1MLCB 1VFBA 3GJFK 2X1WL 4TYUA 4AENB 4M1CD 1A6ZB 3PHOA 5GS2D 1HN1A 1GC1C 5BVJA 1RURH 4DGVL 3VXMA 4JKMA 1CQKA 1L4IA 4HUKB 1NC4D 5JIIA 3T4YB 3ZSSA 2IPKA 2W65A 3RWEB 1MRFL 4UU9A 3V52H 4PJXB 4JO3H 5BOPA 1N6VA 1S9YB 1T4KA 1L9MA 4AIXA 5IVNA 3MUGB 4K7FB 2RBLA 2JJUA 4JFDE 4K94H 4Y5YB 5SV4A 2AKRB 1HI6B 1R3KB 4NT6B 4U0RC 1LE9B 3SN6N 2OYPA 4YHLH 4IDLA 5A43C 1HSAA 2D7MA 4JFQA 4AEHL 3WIFA 4BH8B 4NUJA 5MHSE 5E94A 2R4SL 3MRNA 5EBMB 3S5LB 4JFHE 1CLCA 4X83A 4TULL 3MMEA 3TNMB 4P48A 1JNLL 4QCIB 4NJAH 3MLPA 2HLAA 1T7YA 3MRIA 1S8DA 4CW1B 5EPMB 3KPLB 4JFEA 4P2OB 4MXVE 2O5YL 2ICCA 1YY8A 3J8F7 3VXRD 4FZ8H 2VDOL 3IF1B 2FX8L 2E7BA 5CILH 2YRLA 5CBEA 1K3ZA 4XCNB 3U7YH 4YPGA 1G6RB 1NCUA 1N8ZB 3UYPA 1JUFA 1CTOA 1A5FH 5L9DH 1ZLUK 1JRHH 5EUOA 4I5BA 1ZHBB 3ARFA 2QQKL 3PL6B 4YEFA 3DMMB 1WZMA 4QGYA 1XH3B 3OV6A 4LLMB 3W2DL 4M6AA 2B0SL 4NCC1 4UQ3A 1DEEA 3QA3A 1LMKA 3QT2A 5MEQA 4ZUVB 4OSUL 4L29B 1MCDA 3HG1B 1SJVA 2ZNWA 1T04A 2AJZA 4PRBA 1CICB 2DICA 4NNYB 1Z3GL 5CEXB 3IVKA 4HUUB 4JRXA 1NKOA 2GY5A 2OQJB 4MVBC 2KUTA 1HHJB 1WWAX 2GFBA 4ZO7A 3P40A 1M7XA 4JFHD 1OT1A 3B3IB 3B3IA 1QNZL 3TYGH 1AR1D 5IB1B 4MA3A 4PJ8C 5JHDD 4FQIH 4HCRH 4FABL 3C6LB 1FG2B 3VXRE 2FJHA 2VLRE 3PG2A 3CXDL 1TENA 2XN9E 4H8WC 4TSCL 3MOAH 1PDKA 4JPVH 3SCMA 4DGYL 4ZFOA 5EO1B 2O5ZH 4P23C 3MXWL 3RWIA 3KWWB 2CRMA 4K07A 3IDXH 3F7QA 1XGRB 3BWAA 4V1DE 1UXSA 4CBPA 5I73B 2BC4A 4AL8L 1PX4A 1R3LA 4C57C 5T5FL 4O2CB 5HHXL 1P7QD 3AB0B 4NKQB 5E2WH 3W0WD 1KLFA 5F96L 5B3JF 3BH9B 1NGXB 4YPGB 1JWSB 1S5HB 4O2EB 4FQCH 3KLHD 3VXTB 2DQIH 1IT9H 3QI9C 1KCKA 1U8MB 1X5ZA 4QT5B 2BHUA 2AK1H 2FLBT 4OCXL 1BF2A 1FZKA 1UH3A 3ARBB 4M1DH 1KCVH 2XTJD 3C5JB 4GMTL 2LVCA 3VXME 7CGTA 1YNKH 3IFLL 2EYTB 4TRPL 4OAWA 4NKIL 3N1QC 2CXKA 2CLZA 4LCWB 4HT1H 1D7FA 3RGVA 1NCCL 5ITFB 2DLTA 4GG8A 3VFRB 1AHWC 3CLEL 2NX5E 3TN0C 3MQIA 2BZDA 4KRNA 3W0WB 1KC5H 3UX9B 2HTKD 4UZGA 3P0YH 5FA3B 1RIHH 3KR3H 3NCJH 1H3WM 4MNGE 2PKDA 3BWAB 4YC2C 1A0QH 4OB5H 5B21A 5D8JH 2Q3AA 1CT8A 3CVHH 4HS8L 4TPRH 4NBZB 1T66D 4WWKB 3UP1A 5HJ3B 3WIHA 2RHEA 5T3ZH 5E8NA 4AYFA 3V6ZA 4WWKC 3EYQC 1TJIL 1U92A 5DDHB 3RX7A 1JTOA 1QFWM 3ULUD 5CZKA 1L7TL 3C6LA 4HH8A 2J6EL 4GRWE 3GSRB 3RPKA 1FL5A 4KXZI 1I3RB 3UJTL 3CX5K 5JW4M 1SVZA 3TF7C 4XPTL 5EU5B 3WLBA 1BHGA 1OAUH 1TZIA 4NJ9H 3T0EE 5HDOA 4U1LA 4LVHC 3LPGA 2Y06L 4DN3H 3OG4B 3FRPG 3ULVL 1MIML 3GEWB 4N0UE 2YD6A 2WBJB 1P1ZA 5LQBL 2B1HL 1T5XB 4HWEH 2I5YL 4U6YA 3T65B 3QEHB 3DROB 4XVSL 5ESAA 4D9RE 1IAMA 4LCUB 3G6DL 4C83A 3P4NA 1CG9B 2Y6SC 3FONB 1IKFL 1FNAA 3X12B 4HUNB 3VG9C 5B4MD 2XKNA 4PIRF 5FYLE 1N8ZA 1A02N 2W91A 1D5BA 1KC5L 3BZFA 3OJVC 3UC0H 4IJ3C 3H9YA 3QEQD 3ARFB 3MRRB 1RMFL 3BESR 1MQKL 3QNZA 4OV6F 4W4NA 4NRZB 1VDGA 4LGPB 9CGTA 4RWHA 4MQTB 4NO0B 1OTUD 4KQ4H 3QUZD 1BX2B 1DFBH 5EWIL 4KHXL 4MGXA 2JELH 4G8GD 5CUSL 4PJBE 4Y4KC 2D7TH 4GKNA 3VD3A 3DRTA 1UADC 5F6IB 1A4JA 1ZOXA 3WV0A 1T1ZB 2ZCLL 15C8H 1ZVHA 5ID0B 2R1WB 1YDPA 3UPAA 4JKKA 4NT6A 4PG2C 1TNMA 1GPOL 3P30L 1TXKA 3K0WA 1WBYB 3FHAA 1A4JB 1Y0LB 4C54A 5L2JA 4WY7H 5TFSL 2FLRT 5GS2H 3QIWA 3PWUB 5E2TH 1FSKC 4JO2L 1FE8L 5FM4A 1T7ZA 4O5LL 1ZK9A 1MFEL 4HAGA 3D87B 5TE7L 1JPFB 1NJ9A 4YHOL 3MV01 2R1XB 3LKOB 4OCWH 5I1LA 3SE9H 1WISA 1YC7A 3C2AL 1IE5A 4NN7B 3HNSH 3HZMB 1DUYA 5IHUL 2XKNB 4P9HH 1XGTB 1WK0A 4BM7A 4JHZA 4K9EC 5GJTL 2E6QA 2VC2L 4LASH 1F4YL 4JM2A 1GGCL 2CR6A 3B5TA 3EO1A 1JV5B 2IH3A 4LLVA 3ILQD 3VMOA 5C71A 1TVBB 4NM4L 3RVTD 1DL7L 3OAYH 3DNKA 5IEHA 3VU2A 2ZKHL 4NRXB 2ICWB 3O2VL 3RVTC 3VFSA 1WWBX 1F4AA 3DOSA 3EOYG 4RRPA 3P30H 4XPBL 2J1KA 4GAYB 2J6EH 3IXTB 3RIFF 4DVBA 3WEXB 5ID1B 1BBDH 1C1EH 1XR9A 2HMIC 5DEGA 1LEGB 3NACL 4NO5B 2XRAL 4GOSA 4OV5A 2A1WH 4QEGA 5IROC 2D2OA 2KBGA 1QO3B 3TWCH 5KW9H 1MFEH 4MD0A 4OGAC 2YRZA 4WNQB 5DRXB 2VDML 3QEGH 5HDQH 4K7PH 2FO4A 1KB5A 4ODHL 3IKKA 4DOHB 3T3PE 4N0RA 1UCBL 3MLZH 4X98A 1IC5L 1UWEH 3QZWB 4GAJL 4G6MH 2MJWA 5JXAL 5BZWA 1ZT4A 4X5WB 4NO5A 2VXVH 1NLBH 4RGNC 5EBLB 3ARGC 1MJ7L 3MNVB 4XNMA 4R4NC 2AXGB 2DI8A 1ZMYA 1SBSH 2IADB 4P2RE 3SDAB 3HNVH 1BFTA 5DVKA 5F44A 1EEZB 4KMLB 1TIUA 4U3CA 5EOQL 3QFDB 2MHAB 2DOCA 2EYTA 2XA8H 1RZKC 5GZND 1TZHA 4LVEA 1FCGA 2ICEB 4TTDD 4CMHC 1DL7H 4DCQA 2FNBA 5K9OB 4K9EL 4QO1A 3LKPB 1I8IA 4YJZL 4IRSC 3DWTA 2V5YA 3MJ8A 5IBUB 2R9HC 4LNRA 2DQFA 3STLA 4WI3A 4LDOB 3FN0L 3TYGL 2VXVL 3VXOB 1U41A 4FQHB 4IMLA 2WUBH 3KPRE 3N9GL 4R7DA 5KSAB 4CNIA 5HHOB 3RWDA 3KJ6L 5HYQA 2AAVA 2C7UB 3QJFA 2D03L 2XPGB 3CU1A 2VDLH 4JDVA 3FB5B 5JOFA 5DQ9B 4GW1A 2XNAB 1XGRA 4OM0H 4HUVA 5DMKB 5ALBL 4HKZB 4LNRB 3MJ8B 4CADB 2J12B 3S34L 4HUWA 3EFFA 3T0AA 1A7BA 3OZ9H 2NXZD 1CL7H 3V4PH 1RUAH 4AJ0A 3UTSE 5TE4H 2VZ3A 4XP9H 3EDDA 1U6AH 3MGOA 1AGDA 1A3LH 3OTTA 4TPRL 1JZ6A 1RZIB 2APFA 2HH0H 1FG2A 4KJPD 3S37H 4HLZG 1A6WH 3O9WC 4L9DA 1D5ZA 4XPAH 2NY1C 1I8KA 1D5IH 3JXAA 4F3FB 4DK3A 5GISH 1NCWL 4MNQD 2LU4A 1IAKB 1K2DB 2P8MA 4DAGL 1RZFL 4WJ5A 1HQRA 5C0DA 3QULA 4UV4H 3TP4A 4N90D 4UOW1 5BZWB 4S2SB 5F1SA 5CEXA 1G7JB 1IGTA 3QDGA 1U8IB 4JFZH 4BFIA 1YNKL 2Y5TA 4AY0A 4C55A 1X9QA 5C07E 4IOSD 2B2XL 5DXWA 4EN3C 1M1SA 5MEOB 3FT3A 1TTUA 3OB0K 5F9DC 5JR1L 3BEWA 3BPNB 4WFEE 2HJLB 3R06B 1MSPA 3Q0HA 3ARTA 3B2UC 1BVKB 3GMNA 4P3DA 2P24B 3MLWL 4MCYB 4MB5A 3HI1B 5FV2A 4XP5H 1F8TL 2H32B 3NH7H 1JUFB 5DJCB 5L2KB 3EJJX 3K4AA 1GGTA 4NKMB 1G84A 2XY1A 4DAGH 4DZBA 1P5VA 2AGJH 2ZSWA 3E8UH 4R0LC 4KKAD 3HMWH 3MOBL 2BOCA 1YY8B 3RDTB 3MLWH 3IFLH 1Z0NA 2YRPA 1KTKE 4GW5B 3HE7B 4KKBC 5HGHA 3X3FH 4XNQB 3U4AA 3UTTD 5IW6A 5DRWB 4JLRA 4FXGB 3DVGB 2QR0A 4XGZA 3ZTNL 1OARL 2OTUB 5DWUH 3WIFB 1UVQA 5HD8D 4QXWA 4YFLI 2A9NH 5BO1H 2VDNH 3C08L 4JFPB 3QUXC 1XF3A 3E1F1 3QH3B 3QIUA 2HKHH 1ZV5A 3VI4E 1UEMA 3ARDD 3KXFB 1ZXQA 5T5FH 5F3BB 5K33A 4NSKB 3T3ME 3LY6A 4LSQL 1BQLH 3QG7L 1QA9A 3BPNC 3QDMD 1C5BL 4JM2F 1JZ7A 3QQ9C 3IRZA 2ZUSA 2UUDK 3FFCB 3CAFA 4UUJA 3QZWG 5DURB 3DGCR 2ADJA 1U6AL 5A2IH 4G80B 4LCIL 1R5VA 5B39B 1ZGLP 1MJUH 4JO2H 3MV7D 1TITA 2UYLB 2VR9A 4OD2B 1FJ1B 3QG7H 5KTEL 4CVZA 2ICWJ 5J4MA 1Y18B 3MV9E 3L3KB 1CT8B 2WNGA 4KKCC 5CD5C 5IROA 1QA9B 4O9HL 4YBLB 2FIRT 3UBXA 1YMMA 1A0QL 2NTFA 3L5WB 1A7PL 3ARDB 2FR4B 2XOTA 4MMXC 3QDJD 5IW6B 2PNDA 1SYSB 2PO6B 3W5NA 2MFNA 4OT1H 4GG6B 4JQXA 2WINA 2CLZB 2R2HB 1HKLL 3FT4B 5HYIA 1HKFA 3N85L 5E6IA 4QYOA 2MTPA 3RPIA 4FQPA 2ITDA 4P2QD 3WMSA 3MLVL 5IMOB 4P4KD 3BYTA 3OKOB 4V1DB 2XWJB 1K9TA 1T6WA 3RKDD 3GZKA 5FHAL 4GBXB 4X6CF 1YNTA 3W2DH 1UQSB 2AXFA 4NZUL 3MODL 4PJFA 1S7UB 3BUTA 2PYFB 1RMFH 1PKQB 4MCYA 5J89A 4NQEA 3TO4D 3WNPA 5ACZA 1Q0XL 1BJMA 2CO6B 2BDNL 3Q6GL 1IAII 3SE3C 5IFAL 5ISZA 2I27N 4XP6L 4JR9H 3AY4A 3X13B 4KTDL 1RZ8A 3DRQB 2M2DA 2BC4B 5ESAB 3QDGB 4AL8H 4GSDL 5D8JL 4PJFF 3VFWB 1SJHB 4JG0L 3VFGL 4Z7WB 5KS9A 3FT3B 1CI5A 4N8VA 4L1HA 3D25A 2BRRL 3MLYH 2XZCH 5F1IB 4MAUH 4E41D 3QEQB 4XXCA 4PJCA 4QXTA 1SEBA 4PJ8D 4N5UA 1EMTH 4R4BB 1B0WA 1CDYA 1UJTA 4HFUH 5DQJA 2D0FA 2EKSA 4LEOB 4P46C 2XZQL 4UDTB 3RNKA 1A2YA 3WFZA 3MNZA 2F54A 1W0WB 3BKJL 3QXWA 2JJWA 4YQXH 2I25N 3BH8B 2Q8AH 4FXKB 4PJIA 4P2RB 3WNMA 4B7LA 5SWZA 2HFEB 5CD3A 5GRJL 2DAVA 3MC0A 5DJYA 5MENA 5HJ3A 4MAUL 5C0IB 2OSLB 3CUPB 4M62L 2IBZX 3PDOA 2BCKB 1CGXA 3VXOA 1K4DB 1NCDH 3DMMA 1EMTL 2F19H 4FQJL 2RB8A 3V0VA 3GSWB 4HZAA 1P7KA 4MHHG 1HINL 2D31B 4YHOH 5GHWL 2YPLD 4F9PC 1I7TB 3IJYB 5IHBA 2E7LC 1K6QL 3KPTA 2RAMA 4YK4B 4QHUA 1P7HL 3IU3B 4G7VH 2MHAA 4OJFH 1IGIL 1R24A 2AJYL 3WS3B 4DCQB 4ZUTB 5J1TC 3HZVB 2D7PA 2OTWB 1Q9OB 5I66B 1DFBL 5EWIH 3RNQA 5D1XD 3TNMA 3QO1B 1F4XH 4HS3A 4ZPVB 5E2UL 3C60C 2IPTL 3QFDA 4P46B 1OLZA 2BDNH 3Q6GH 3LKSB 5FGBA 1KELL 4XNUH 1EAPA 3TZVC 4JQIL 4X4YB 3NCFB 3RDTC 5D7IE 1ITBB 4R26L 4Y19E 2EO9A 1DEDA 5KJRL 1KB5B 3BI9X 4JRYE 3TO4A 3PV7A 5BV7H 4WFHE 4WEMB 3RTQB 5DEZA 4R0LB 1MCRA 4ODHH 1Q38A 3EJZD 2ZOLA 2ZOLB 1A1OA 2WV3A 1OGAD 3DMMC 4NC1C 1S5IL 2X4QA 4RFEB 1U91A 4IOIA 4JZNB 4MD0B 2W38A 4OT1L 3DVIA 3LMJL 5SX5H 3UZVB 3M8OH 2E9BA 3BIKA 4YHZH 3UYRH 5FCUL 3S36L 3HNVL 5DQDL 4LVOB 5IT2H 1YEEH 1W0VB 5D70H 2IAMB 2ZOKA 4PJFE 5D2LB 5LGJB 5C0GB 2E27L 1N4XH 4H0HB 1JWMB 2I07B 3RBSA 3SKUD 4BSWA 4ZS6C 4DUWA 1P4LB 3OX8B 3C9NA 1FFRA 3DTXB 1XZ0A 1F11A 4JRXB 3K81A 3L3JB 5I1JL 3BP4A 4L4TB 1AQKH 1EFXA 3DHMA 3KYKL 1JTTA 4L3EB 2UVEA 3CVHB 1BFOA 1Z9MA 3EZ8A 3O4LA 3N06B 1MCIA 1J12A 2FB4L 8FABB 1IBGH 1JV5A 5TPWL 2APBA 1YPZA 5DK2A 1FO0B 1U36A 2IQAA 2VZ1A 2YK1L 4M7LT 3DIFB 4URTB 2I9TB 1MCWM 3EUUA 3ZKXB 4LLMA 4KRMB 3MRMA 2E7CA 4I3RH 4K7PX 4V2BA 4ZNEA 3EFDH 3G08A 5K9QI 3O6FB 1LO4H 5HDBE 2PUQT 3CDGA 1KCRH 3O2DL 3GHBH 2NY7H 3EYOB 1UACL 3SJVA 1MELA 3QXDB 3WDHA 4BFGA 4OCWL 1KV3A 1MY7A 3BUYA 3G9AB 3MA9L 3I84A 4XPHL 4U6HA 3JSSA 3G6AA 3I6GB 3PP4H 4NUGL 2DQGL 1CFTA 1UZ6E 1CBVL 4X7TB 2EEAA 2A83A 2EH8L 1ES0A 1CK0L 1I9JL 3H3BC 5IQ9A 1MCQA 3K2UH 4Z7NF 43CAB 3UPRA 1I3GH 3O2WH 3O3BB 4YO0A 4ERSH 3O3BA 4YO0B 1MHPL 5CEZE 4K3JH 2KZWA 3MYZA 1AKJD 5J12B 4I0PC 4E5XB 3IAQA 4GRMA 2F19L 4KVCH 4N90E 5CCKH 4RGNB 4UAOC 4XAWL 4PJXA 2JB5H 4PRPA 1MRFH 4R2GD 1MHPH 1T80A 1KG0A 1IC1A 3VGAC 5C0AE 4U6TA 4AT6B 2X42A 5IB4B 3RZCD 3VWKD 5JUEH 2Q7YB 1FC2D 3T08A 3ZKQD 4HHAB 5L88H 2X4OB 5CGTA 2UZXB 3G5ZB 3NFSL 1F6FB 4Z76B 3VXRA 4TSCH 2NXZC 1CD8A 1GGCH 4X9IA 3NACH 4S1QL 4PY7B 4FFWC 1RUQL 3FQTB 3TPUA 3ZE1E 1INDH 4XNYH 1PG7W 2Y23A 5B38B 5DK2B 1AO7E 1LEKB 2NW3A 2R69H 5F6HJ 1PKQE 1WGOA 5E5UB 1JZ5A 1D6VH 3IETA 2R2HA 4AH2B 2VJXA 4OLYH 1MCSA 2HFGL 1YEFH 1S9XA 2OI9C 2DBLL 2RFXA 4KY1L 4ZYKA 5M95B 4PGEB 4PRIE 4JFEE 5A3IC 4ORZC 1MFBL 4OCSH 1J0ZA 4LSQH 2E6JA 3BDYL 5IMLB 5ESQB 4U7SA 1QLRB 4DTGH 1OB1B 3MCG1 4IRZL 4OI7A 4PJ7B 4JJ5B 3FQUA 5DJZB 4MQSB 4N68A 4NZTH 3MRDB 2X7LA 4GKZB 3V6ZB 3ALPA 4QOKB 1SBBA 3WYRA 5JQHC 2IBZY 3T77A 3NIGE 1XCQA 5KVGL 3MREB 3QUYB 5HPMB 3I85A 4HQQH 4U1SB 3V6BR 3ZTNH 3FN0H 3KHOA 1U92B 2VDRL 1R3HA 4UT7L 5HVWA 1G1YA 4BZ1L 5MHSD 3MODH 4X7CC 3F5WB 3ULSB 4QHKJ 5EZIH 2F5BL 3WJLA 3WIIH 1I1RA 2VUOA 3CFJB 2P5ED 4Y16B 4FQQA 4KTYA 2BOBB 4D3CL 5GGTH 2UUDH 3G6JB 2NY2B 4MDIA 4EDXB 3CU7A 3NBNA 5FYKL 4I2XA 1W8OA 2NY6C 3JVGC 1U93A 3ORJA 4XTRC 3GGWB 3K46A 5I19H 4XNQA 1S9WA 4GXVL 3P9MA 4K3EL 1KCLA 4QRQB 4LK4A 3GUTA 3NPZB 3TBVB 1DE4A 4X6EB 5E99L 1HQ4A 1YUHA 2UVFA 3QEUB 4OI8A 4Y5VC 3UTZB 3VGEA 3CD4A 4OFYD 1RZJH 4OD3L 1IC7H 4EQ3A 2H26A 3PHQA 3VXTA 4NP4H 4NQUA 4FMKA 4L5FL 2YD1A 3VJ6A 1UFUA 4U1NA 3GSWA 4JE4B 3GO1H 1HHKB 3L3HB 1CDUA 4QF1A 2FECL 3H9HB 4ZS7L 4KROC 4LGSB 3HUJF 1N5AA 5C07D 4RMTA 3HI5H 4RAUA 5E70A 3MV9D 4HPYL 3BGAA 2V5SA 4MCZB 3WFDH 4ERSL 1MEXH 4X9FA 2YN5A 3HTLX 3VRJA 3W81A 3TJEH 3N1GC 3TV3H 3HNTH 1ERNA 4YGVB 3KLDA 1V5JA 4S2SA 5IIEA 1QBLH 4H0IA 4XC3H 3L6FA 3GMLB 5T1LD 4EUPH 3BH8A 2DKUA 4MB4A 2NYYC 3U0WH 1N5YH 4XBPB 2I9LA 2YOCA 3G04A 3RNKB 2JK5B 3RUGA 4AIZA 1J1OH 3F65A 3WFHB 3FKUS 1RHHB 2DF3A 3SDXE 3OKDA 1BECA 3DX8B 4L3ED 3TV3L 1DQJB 3EAKA 1D5ZB 1RK1A 4NZTL 2VO5A 4UINL 1NBZB 4K71B 1T2JA 3RKDC 4HBCL 1M7DA 3MRBA 1R5IA 2A6IA 1MPAL 1R3IH 4WV1A 1FBIL 4RRPG 5E8PA 3FCTA 3C6SA 3H0TB 1KLGA 4QXGH 1ZLSL 5GRZA 4JRYA 4ZMAT 1T03L 2ATPA 3GIZL 4Z77B 4N9OB 1L0YA 1TCRB 3VD9A 1J8HE 4PJ7F 4PRDA 5TGBB 4EUPB 4OSUH 1IAOA 3CFCH 4GG6E 1KF9B 3STZA 2R8SL 3KPQB 4NM8L 4OLYL 5AYUH 3V5HA 5J6GB 1FNGB 2X4OA 2P7TA 1JZ4A 4N0FB 4O5LH 2X70A 4Z8FL 5DK0A 2ZUTA 3KR3L 3LB6D 3NIFF 4FQLL 3TIEA 1Z9OA 4Y4FB 3VJ6B 5C0ND 3VFMB 4UTBH 1D9KB 2EXWC 4KI5E 4FN0A 4XNZB 2J8UA 3A6BH 4NZUH 1J0KA 4MA7L 1F97A 4H1LH 2ZG1A 1MHHA 5CGMA 5CWSA 3NCEB 5IK3B 5FYJU 4ODBD 3SGJA 3F8UB 2AXGA 3KPMA 4M7ZC 1LE9A 2XXCB 4MWFA 3MRQB 1GZPB 1GSMA 3MBXL 3M45A 4RAVA 1JE6A 2BSRA 2O61B 3FRUB 1TPXB 3BP7A 5L0QC 1QLEH 1NAKH 5D7JB 4NO2A 4ZUSB 3Q5TA 3V4UL 4F57L 4Y5YA 2VQTA 3B6SA 1QO3A 1XIWA 5IGXL 1KULA 4JY4B 3EYOA 3QDMA 1BQHG 4UQ2A 1AGFB 1FIGL 3WNNA 3WHXA 1HOCB 1VESA 1CE6A 4JZOB 1TZGL 3NAAH 4K8RC 5GRUH 3VXSB 3ZYOA 4FFVD 1E28A 1FC1A 5FIEA 4N0CD 4AENA 2CLVA 4M3JA 4PGCA 4KK9D 1DVFD 1YPZB 4BZ2H 1R0AH 1KCRL 3O2DH 1OAYL 2EICA 3BSZH 1IQDA 5EBWB 1A6ZA 4PG9A 3LQAC 4OGXH 1NAMA 4KDTC 4APQC 5SWQB 3BP4B 3K8MA 4XP4L 1TQCB 4Q6IA 1BQLL 5GGVH 2CQVA 1J05B 2EE2A 4D2NA 1N0LA 4OM1H 3VWJA 5D6CB 2ZUYA 1H8OA 5JDSA 3I6LE 3EO9L 3I02A 1YYLL 1QRNB 4HEPG 2MQCA 4JRYD 2R2CA 5CEZL 4ZXBD 5DR5H 3V6OC 4RA0C 3EO0A 2P8PA 1W0VA 3T1WA 4P2QA 4Z0BL 1BZ7A 1H5BA 1H0DB 1DUYB 2AJVL 4LMQE 4LARH 1T2XA 5MP6L 3Q6FB 3FB6B 1KXQE 2EKJA 2QKIB 3FQTA 1T66C 1LP9F 5EULV 1C12A 4HKJA 4XPGH 5K9JL 1AGFA 3HUJA 3CFKB 1QLEL 3L3DA 3CFBA 5D70L 4P2OC 5EZLB 3MGTA 1M71A 4O58H 5F9OL 4WEBH 5C3TA 1MJ7H 3WUWA 1KIQA 3DPBA 2H2PC 4PJ5B 2BP3A 4PGZA 1T3FB 2BNUB 4HIJA 4S0TD 2OL3H 5CGYD 3UTSB 2PW2A 4P9HC 4L4TE 3U9UB 4MAYB 3S96B 2MPAH 1GVIA 4X8XA 4DVRH 2ZUQC 3EZJB 3T0ED 5DD3L 1WBXB 3LEYL 2NMSA 1NGPL 5SWSA 4HV8B 3KLSA 4LSSL 3T0WA 3B83A 2NLJA 1VGKB 2FZ3A 3IFNL 2PYEE 4RISL 1R24B 1ZA3B 2NZ9C 3FO1B 5CEZD 5C2UB 1PZ5B 2V5RA 3BZDA 2X41A 1ZLWH 4R4FL 5CMAA 2HT4C 3MJ7B 4YHIB 1C5DA 5GS0D 1LK3H 3P73A 4JN1H 4MD4B 4HFWA 2O93L 2ZKHH 5D2LE 3LKNB 3L3IB 3QUKB 4YXKL 1TETH 3QQ3B 1AD9A 4QWWC 1S3KH 1P84K 3OR7B 4HWZB 4MSWB 3CDGB 4HCRL 1G9NC 1MVUB 1Y6KR 3QFJE 3LN5B 1UA6H 3SKOB 1FFNA 3BKMH 3F7VA 3FONA 3B43A 3X12A 5IQ7L 4FQHA 4IMLB 4LAQH 4IHOA 4U1MA 3OR7A 5DJAB 1DUZA 4R4ND 2VTFA 1K8IB 2DQFB 1M05B 2VXTL 1AO7B 3STLB 3LKNA 2P8LA 2GK0A 3IDMB 2RGSA 4NDMB 2WUBL 3N9GH 4XT1C 4IDJH 2WQRA 8FABA 1AIFA 1YYMH 1JYNA 2AABH 3EIFA 1YQ2A 4PP1C 4PLJC 5JPMB 4X6DB 1W72L 2OL3A 5FKPB 4LAQL 3WS6C 1UWXH 8CGTA 4QTHB 5JORA 2FBJH 3FO1A 3WN5B 1IZJA 3MYJA 4NRYA 3BZEA 4IRSD 3S36X 5JUEL 2W60B 2GSGB 3JWOH 1YZZA 5B8CA 1NGWB 4GXUM 1IGML 1OHQA 3RP1A 5C0AA 2PN5A 5DRNA 1D6EB 2Z91A 3MLSL 5IJVB 4LHJB 2Q3ZA 1IQWL 4G6FB 2YUWA 2QQKH 4G9DB 3TYFA 4MNQA 3LKRA 3GMPB 3RUGE 3LQAH 5L8JB 1MIEH 1QSED 4DWHA 2DIBA 4KZEH 4Q7DA 3NTCL 2R0LH 2C3WA 1TQBB 1A1OB 3GKZA 3ZTJH 5LWYH 1SM3L 4NQEB 2YA0A 3WNLA 1RZKH 2F58L 2R4SH 3MNWB 2B4CL 2QLVB 1BOGB 3HAEH 4P49A 2B2XH 1MCOL 3MXVH 2B1AH 3NN8B 4NQED 2FYYB 2HG5B 1CXLA 4V1DA 5I71C 2GJ6D 3INUH 4LVNC 3U4BL 4G8EB 1ZT7B 2GJ6A 2UWEE 2UY7A 4OLUL 4UV7H 4OGYL 3D3VD 3MROA 5I73C 1DLHB 4FZ8L 3D39A 3NIDE 5KVMC 3CMOL 5C0RH 4ONHB 3HZVA 3P9MB 4XMKL 1SYSA 2EYRB 1UJ3C 4MLSA 5H8DA 2BHZA 1MI5E 1MH5B 1FL3A 3TBWB 2V2XB 5GGRY 1FYTD 3I50L 1S7VA 1MWAL 5HI4D 1SMOA 3JWOC 4PTUB 5DYOB 4JFDD 2MCG1 1FJ1A 4OD2A 5B22A 2YEZA 1ODAA 4TUOB 4X6FA 1A3QA 3O3EB 3CH1B 2AS5M 4WU7B 1HOCA 4X7FC 2A74B 4NPYA 4KI5F 2JB6B 3OJDA 2HT2D 5DJYB 1JPFA 1NJ9B 2YZ8A 2XIDA 4HWUA 3UZQA 1AXTH 1F6LL 5I30H 4TVSa 2MQ3A 2P5WA 5EUOE 5JTWA 1OB1A 2Y07H 1QLRA 2EDHA 4Z7UB 4H1LG 2GJZA 2EKSB 3Q2CA 3MV7A 4LEOA 1A9BA 1MCOH 1J8KA 5DUBA 5HD8C 2OP4H 3RWGA 3ESUF 2DQCL 2AERT 5DMGC 5GJSL 1GIGH 3VDBA 2NY4D 1HHGB 3O3AA 5E6ZA 3MLUH 3FZUC 4LBEB 4QRUB 1ORQA 2D03H 3NCMA 3PNWA 3QIUC 2ZCKH 5F1IA 5D1QC 4YHKL 5BMFH 2KZ1B 4KROD 4XRCB 3HC0B 4MJ5A 1WVZA 2D4DA 1MREL 2Y4SA 1U8HB 2F8OA 5F7DA 4TRPH 3QHZH 1U3JA 2EDOA 2GSIB 3E6HB 2BVTA 1LK2A 5HVHC 2B1AL 1F4XL 4WTZG 3ARBD 5E5RB 3T0EB 5IMMB 2FCBA 3E0GA 3IAGC 1A3LL 4C56B 1R5WB 1CXFA 3ETBF 3BZ4B 4NKOB 3B5GA 4TNWK 4P5TD 6FABH 2QQLH 4PGBA 4NN7C 4OQTA 1D5MA 3UTSD 4LLYA 5IF0B 1RD6A 1A7NL 3I2CH 4LSVL 3MACL 1VKXB 1U8HA 2WP3O 5CP7A 3WUZA 3VWKA 2FL5A 3C6LC 2LV4A 5CJOL 3IDUA 1U8QA 4L3EE 2WANA 4WHYG 3SBWA 4YDIH 4MA8H 1FBIH 5F8RC 5ACLA 1AC0A 2VWEC 4X9GA 2O5YH 3MX0A 5FHAH 5KTEH 2OJZH 4KQ4L 1HSAB 1FAIH 4UT9L 4Y1AD 3UPRB 2BXYA 1P2CA 4U1JB 4YBHA 5ILTL 4KH2A 1BFVL 1FNFA 1RZIA 4Y19A 5DHYB 4G7VL 1A9BB 4PJHB 1IGCH 2JK5A 1WBZB 5LAXB 4QRRD 4XC3L 2A6JA 2H1PL 4YC2B 3S97C 4X7SL 1HXYA 4OUUA 3T4YA 2OM5A 3WKMH 2ORBL 2EO1A 1D5XA 2NY0D 3VXMB 2PR4L 4MCZA 4WHYH 3SQBA 4GRLB 2Z31C 3EJYC 4PFEA 3WJJC 4EUPG 3PDDA 1MCLA 3W9DA 3LH2L 4R7DB 4E41E 1FH5L 1NC4A 5I8KH 1PX3A 1OD9A 1DCLA 1KYOK 4BQBA 1MEXL 1WFUA 5K93A 5DHVA 4HEME 5K9OA 1ZGLB 1JPSL 3PL6D 4FS0A 5CIPA 2FECI 4P9HL 4PLKD 4KUCD 5GGUB 3QHFH 2R0WL 1LO2H 2R2BB 5E1HB 3GSNB 5JHDE 1OTSD 3UROR 4BSWB 5IW1A 1DE4B 4X6EA 3GUTB 4G3YH 3BYYA 3OAYK 4G6KL 5AEAA 4JM4L 1OTSC 5HXMA 4U3HA 5CUSH 5SX4H 1G7LA 3CLFH 1OAXL 4WUKL 4WW1B 4O2FB 1RUMH 1S78C 4F2MB 3L95A 3QPXH 5DD5L 4R2GB 3H9ZA 5JW5B 2EIBA 2WW8A 4Z7QF 2J8UF 3IS0X 3S88H 4H5SA 4HF5L 4B50A 1JGEB 1YEGH 1FZOA 5HTSA 3JV0A 2H2SC 4LSTH 1P84J 5AZEL 4MS8C 3THMH 1R3HB 1YEEL 5FKAB 1U3HD 2OR7A 3BEWB 3LN4A 3MRHB 4FP8H 3WD5H 5GGVL 2BSED 5ID1A 5D1ZC 4CN1A 1Z5LB 4LVNB 1NFDA 3RWJB 1QFHA 2YN3A 4GAYA 3VD4A 2Q20A 1T20A 3U2SA 3ROOA 2GTWB 5L6YL 1U8JA 5J3HD 1NCDL 4DGYH 4PJ7A 1J9CT 2DQEL 5E5MA 5GGVY 4LLQA 4LPUA 4JG1L 3FQRB 4MA3B 2W9DH 4F3FA 4PRAA 4CU6A 2QL1A 3A6BL 3S7GA 3FQNA 5JHLL 4Y19D 4QTHA 4HJGA 4D0CB 3Q3GA 1J0YA 1K8IA 2HTLC 2VE6B 4D8PA 4PJDB 1UYWL 1IL1B 3DJ9A 3ZDYE 1AGEA 5F3HB 4LVHB 1FFNB 3HG1A 4PJHF 1UB6A 3OKEA 1LEKA 2HTLD 1U95A 4CMHB 5GIRB 1E4JA 4UDUA 1PBYA 2A6DA 2H41A 3HB3C 5D7IB 3QXAB 3OKEB 4L4TD 3QJFB 2ADIA 4HPOL 5C0IA 1S7SB 1MVUA 5IBUG 4YAQA 2J88L 3FOLB 4HZLA 3G5ZA 1AGEB 4PJXE 5F3HA 4M8QB 4MDJA 1C5DB 3QPQC 3VRLF 3SY0B 5DLMH 1MPAH 1CLYH 1R3IL 4OGZA 1ACYH 3HFMH 4YHNA 4WWID 1BVZA 3VFUB 4IJ3B 2X4UA 4IBLT 2F8XC 4M6NH 4OZHB 1DSFH 4WU5B 4QCIA 4MB3A 3U7AA 2EDTA 2DJUA 4OLVH 2AEWA 3S5LG 1BD2A 1CFVH 3E2HB 4J3OC 4DN4H 1I3UA 3RIAK 3O4LE 4CMMB 4X6DE 2VKXA 5BZDB 1T0PB 1QQDA 5C0FA 1YN7B 1SVCP 5FOBA 4X8JA 5SWSB 4HX1B 2HMID 4HMEA 5DD3H 4GAFB 1T3FA 1JPST 3CXHJ 4PRIB 2BVPB 5CJ8A 1PFCA 2CDGA 4PJHE 1MRCL 3QRGL 4XMKH 4AMKH 3NA9L 1FL6B 1I75A 3C8KB 3G6AB 4KROB 5A2LH 3CFKA 2P4AB 3PJSA 2AJSH 4X9HA 1OAUL 2AV1B 3WNOA 1HYSD 1P7QB 2Z93A 3K4ZA 4NQCD 1NGPH 5FEBA 1MCBA 2R0WH 3QCTL 2X4SB 2B4CC 2Z9TA 5BVJB 4JKWA 5CZVH 3MBED 4I18C 2FSEB 1FFPB 4QY8A 5IKCA 4ONFH 1GAFL 4OF7A 4UIKH 4NQEE 2XFXA 4UTAL 4EEEA 3MLRH 4U1IB 4JPWL 5JXEC 5FDYA 2LAGB 3ZL4H 2H32H 1AD0B 4QOKD 5I30L 1AD0A 1Z9SA 3BQUD 5F89B 1KN2L 2A2QT 4TSAH 3ZKNC 2CRYA 1LO0L 5T3XE 3WSQH 3TNNA 2QHLA 2R9HD 4U1IA 3SQOL 3IDYB 5FECA 3A67L 3AMLA 4D9LL 1MFCL 5C0CA 2YBRB 1AJ7L 1OGTA 3PABA 5BW7C 3IDGA 3ARPA 4IEFB 2AI0L 5AAMA 5JZ7D 3GMRB 2OR9L 1MQ8A 2PO6C 1TVDA 4QRPA 4UT7H 3UTPE 1GAFH 1CL7L 3ARVA 3N1MC 4UIKL 3DYMA 3GSXA 1UM6L 1XIWB 1MWAB 3C5ZB 2IANA 3BHBB 3RY4A 5CBAA 1A7OH 1KIRB 4RDQF 3ZDZE 4ZO9A 5D7IF 1FORH 1AGBA 3WXVH 1GPOH 1CLZH 4NN6B 2XXMB 1JGLH 1FL6A 5JO5B 1S7WB 3DUUB 4PTTA 5DUPH 4HIEA 4NSKA 3KXFA 1WSST 4YEEA 2C9AA 3BD5A 2G2RB 3NFSH 3DVNB 3LIZL 4XPFH 2BVYA 3D85B 1U8LB 1GOFA 5ADOL 5ITFA 3U0TB 4X4YA 1CFBA 1IGJB 1ZLVK 2K7QA 4CKVX 3NCYP 4OZHF 3HI6H 3AU1A 2Q86B 5EC2A 3LQZB 1IEBB 3ZHDA 2R1WA 1DQQB 4KI1A 1BD2B 3IJSB 3PWLA 4DUVA 2M26A 3NPSC 3C5JA 3O11A 4S0SD 5DJ0B 1I8LC 4M7KL 3U30C 1YEJH 5CP3A 5CWSB 2V2TB 4HQQL 4AG4H 4WEBL 5F9WB 3GBMH 3IS1X 3CFEA 4PP2B 1F3RB 2VLKA 2VXUL 4YBQD 3C5ZC 3SDXA 5EIIA 5FM5O 2R2EB 4N0FA 3BH9A 2EDNA 3MRPB 5H94B 1DBKH 3QNZB 4HS6B 3BOVA 5CSGA 5EU4A 3BPOC 4OD1L 5F7DB 3MLUL 5HHQA 1IAOB 4ISVA 2W1NA 1IT9L 1O0VA 4IRSB 3KPOB 4XNXH 1FNGA 3WL9A 3V5HB 5J6GA 4WUKH 1UH2A 1EHAA 2OSLA 4JPVL 4ELMA 2X05A 3MPCA 5EU3B 3CIQA 1I8MB 1QEWB 4QRUA 4PLJD 1J1XL 3T65A 3GMQB 1TMCB 3K3QA 3O4OC 4HUMB 1G6RH 1LNUA 1TVHB 3FZUD 2F54B 4U2ZA 1AXIB 4LDEB 4WFED 3FHQA 5ALCL 4WFGE 1AP2B 1CE1H 1JK8A 3RWFA 3BW9A 1T21A 4H26A 2WWMC 4QRRB 5LGKA 5E8DH 2VDOH 1NBZA 2AJXH 3L5JA 4ZS7H 5L7XH 3RVWD 1ZVYA 4NHUA 1NANH 2IH1B 4YK4C 5L88L 2FDBP 1A6UH 3H7LA 4ELMF 4D0BB 1H3PH 1UWXK 2DJSA 1P4IH 2I9LB 1AXTL 3HC3L 2EDFA 4LIQL 4JRXD 5BVPH 1OPGL 4OZGB 4Z7OE 3GMLA 1CF8H 1VHPA 3KXFD 2HJFA 2MQ0A 4Y2DA 1DTUA 1UJ3A 1N5AB 4YR6B 2IFFH 3AREA 3WIHL 2H3NB 1EBAA 1ZHBA 2IAMD 4XI5C 4H5SB 5FB8A 1J1OL 3QWRD 4JANA 1JHLH 3GBNH 2V7NB 2FH6A 3I3EA 3OKLA 4A2MA 3DYPA 1CCZA 4KVNH 4PJIE 4JDTH 2NNAA 1NLDH 3LS4L 3HE7D 3QJHB 4JKPH 4WW1A 2PCPB 3QIBA 4LP4A 3H9SA 3V6FB 1JNLH 3LEVH 1NGQH 1FIGH 5TE6L 3BGMA 1QRKA 1GL4B 5EO0B 2OJEB 4P5KB 4BYHA 5HHMB 4FP8L 3AFLA 4R3SA 3MROB 5IJKA 4EIGB 5GGUA 4KV5F 1X5HA 1FVEB 5E7BA 3PGDA 2R0LL 1KEGL 2VDQH 4QRQA 1FZKB 2IADA 3EHBD 4ZPTA 3LPFA 1WCBB 1AHWA 3VG0H 4RWYH 3REWB 3ELAT 3GRWL 4M93C 2DM4A 4LSRH 2NNAB 4RQQA 3LD8B 5ICYA 1MOEA 1CGUA 4JKPL 1JBJA 1FNEA 1PG7H 3MLVH 2IPKB 5DO2C 1QUNA 5HYSB 3KYKH 4B53A 2OTPA 1F6AA 3GI8L 3DUSA 3GJEB 3NZ8B 1O7VA 4OV5B 4NJ9L 4M48H 2P5EE 1JI1A 4C4KT 2B39A 1T0MA 3L5XL 1MI5B 1NCAH 5ALCH 4PD4J 2NY6B 1ZTXL 2BERA 4MNQE 1WAAE 4K23L 4PJHA 4YUEL 2VLKE 4LFHG 3BN3B 5D72H 1X4XA 1KLUB 4I77L 4N8VG 5J13B 4WO4B 3D18B 4XWOC 2J88H 3TWCL 4ESKA 4PYHA 3EGSB 1ZHLB 2GITB 2D3VA 4CRPA 4JO1L 2NXZB 4X4XA 2W0PA 3MR9B 1DP0A 4IIQB 4TNVF 2DQTL 4Y8DC 1QP1A 1WC7B 4AZ8A 4MJIE 2YMXH 5GGRA 4ZTPL 3SGDH 1EVUA 3HR5A 4I77H 5EU7E 2V17H 1FYTB 2IFFL 3UZEA 1EEYB 1NC2D 3CSGA 4IHOB 5DJAA 1E0OB 4WHDA 5CP7B 1CD1A 1C08B 1SBSL 3UAJC 3QP3A 3FN9A 2YC1A 3FO0L 4F9PA 5IVZA 3IFNH 2HN7B 4OLXH 5AZ2L 3ZL4L 2VQUA 5FUOH 5ITBL 2X4NA 1QTYT 3O6LL 1J18A 5EU6A 1PSKH 4X0KB 2QEJA 4L8DB 5FAAA 3LDBB 4JZJC 3L3IA 5FCUH 2IPTH 3BIAX 4BZYA 7FABH 3DBXB 3E6HA 4FFZH 1YJDL 2DQEH 4RMUA 3SDYL 2JCCB 5H37G 1A9EA 1CN4A 1LVEA 1DBJH 4PJCE 4XAWH 5F7NC 4O4YH 3ARZA 1RUPH 4M9PA 5I8EB 3RL2A 4CL7A 5DMJB 1LHZA 4Y4HB 1KCUH 1YEDB 2IPUK 4LU5L 1HHIA 5EPMA 3D2UB 4J4PC 4PRPB 1ORQB 4KZEL 3JWNC 5C0BA 5FOBB 4ZAKD 1LO3H 4OZ4A 4PRHA 4ENEC 3CLEH 3L7EB 1JPTH 4GS7C 3D3VA 2OX5A 3ROLA 1J1PL 4F58H 1WBXA 4WJ5B 1P6FA 4LHQB 5IQ9B 4R8WH 2G60H 4GS7B 1JGLL 4KHXH 3HKFA 1CD0A 3JWDH 5C08D 3QQ4A 4GBXD 4OZ4B 2IALB 1RZ7L 3DRTB 3MXVL 4V1DD 1I85A 1I8KB 3U9UA 2MPAL 3MO1A 3QAZB 2DS4A 5MERA 1HI6A 1R3KA 1S9VA 4YHNB 1ES0B 1DBJL 2O26U 3I75B 1E27A 2XTLA 3WUWB 5I8EA 4DZ8B 4AEHH 3B9AA 1PZUB 4L4VB 5C0CD 2DTSA 2XN9A 4M61A 3E6FA 2ESVA 3WHE0 2DYPB 1EO8H 4GH7B 1CXHA 2GT9A 4HUWB 4LAJH 1WV7T 1W2KT 3DBXA 3RVVD 5K9KB 3QWOB 3CH1A 1NFKA 5I6XB 1IEAA 3D0VB 3MV8A 2I9TA 2JELL 4UDUB 3AAZA 4EDWL 2HN7A 4WDIB 2IMNA 4NWTL 2J4WH 4J4PA 4XVUC 5MEND 4K3HA 4L3EA 5EOTA 5HYJA 2VE6A 3NAAL 4U31A 5D93B 3WFEH 3ZDXE 3BQUA 4EZMA 5KSBE 1OP9A 5T1LB 1OF2B 3LKPA 1WC7A 4D9LH 3TC9A 2Q8AL 5SV3A 1SYVA 1KTLB 1B0GA 1X4YA 4JN1L 4HS8H 4DKFL 2C1OA 4ODVH 4PG9B 2F53A 4U1LB 2IAMA 2JJSA 5GS0C 2FWOA 2R29H 3MGAA 4HGWB 1HDMB 1ED3B 4GG6F 4BK5A 3WLBB 1ZT7A 3HE6A 5F7UA 3V0WH 1INEH 3NN8A 5AZEH 2NW2B 4KRPC 3OGCA 4UB0L 3I3DA 2QSCL 2X4TB 2E8ZA 2NX5A 4MX7A 1GZQA 4NN5B 4WEUD 3Q1SH 4RFEA 3KLAB 5JXEA 2BRRH 3O6MH 3LAFA 3KPSD 3RZCA 4P59H 3OHXB 3TVMB 4MA7H 2B7DT 4K8RD 1DBAH 5I1EH 3KPPA 4L8SA 4OBSA 3V5DA 3AM8C 1GCFA 4NO3A 3QUMH 3BRGC 3L7FA 2Z0BA 1CGYA 3MRJA 5LCVL 3KLAA 4K3JL 4MHHI 2NY3D 3REVB 1KSRA 1FO0L 1TFHA 1A14L 1I9RL 1JFQL 2VUYA 2ZJSH 1VFAB 2NY2D 3MRFA 3PP3K 2P5EB 1T7WA 4U1GC 4OCSL 1MHHB 5LWYL 4DKDC 5JORB 1PEZA 2FWOB 2Y36H 3T8XB 2ED8A 4MJIA 4P5KA 3O6FC 1KTLA 3ARFD 1BVLA 1BIIA 1U8NA 4X6BB 1WUNT 2DIAA 4QRTB 1J7VR 3QNXB 3IU3A 1Q9WB 2KH2B 5CJ5A 4WI6A 4O58L 2L0DA 1NSNH 4Y4HC 3SJVE 2I60H 1CLZL 4AIOA 3RIAF 1LO0H 5IOPB 1KCUL 4JANB 5JPNA 4LHUA 1A6TA 5C09A 3H3PH 4E42A 4OF8A 1A8JH 4LKCA 4RA3A 2AQ1A 4RMSA 3PWNB 4FXKA 3OAUH 4CDHA 1V05A 3QQ3A 5F9AC 1PY9A 5L8LB 3KGRA 4NM4H 1C5CL 4LSSH 4K2UH 3SE4A 3VE0B 3ZKXC 1I7UB 2GQHA 5E8PB 5I1JH 4UDTA 3PWPD 3U7WL 4YIQB 2DN7A 3QCTH 4NQVB 4WUUA 3HAEG 5E7FA 2QV2A 2E3VA 3PWUA 5FGSA 1NAMH 1K4CB 3TJEL 1G9EA 5E4IA 3EDJA 3VRIB 1WBYA 3U9PH 1KOAA 1OQXA 3MRCA 1JNJA 4RGMC 4PV9A 3V5KB 5I8OH 1C7TA 5KS9B 4QXTB 4OZFG 4JY6A 4D9QE 4JHBA 3U1SH 4I0CC 1ZA6B 1LE5B 3VWKB 3DURB 1RIUH 4JHAL 5CSZB 4U4BA 4ODXA 3X3GL 4OZGE 3X13A 2BVOB 1D5MB 3EDFA 3A6CL 2AEIT 4RGND 1NBYA 4ETQB 1ZGLM 1VSCA 1XH3A 2LU3A 1H15A 4NRZA 4P5TA 1Q0YL 1HXMA 5HHQB 1DZBA 5CINH 2EDLA 1G9ML 2Y7QA 3SDDA 4LCWD 3SDDD 1HHKA 2IBBA 3L3HA 4J3VA 1LEIA 5TQ2H 4IS6A 4NIKB 4OFVA 5EIIB 4XTRD 5BCAA 4MQXD 2Y36L 4KHTL 3ESVF 2XT1B 1WF5A 3CFEB 3M1BB 4KPHH 4PLOB 4M43H 1C08A 4ZFGL 4W4OC 3OXRA 4UB0H 3CXDH 3EYUH 3LKQB 1X7QA 1DQQA 2G75B 2R4RH 1L0XA 3FRPA 2C26A 1FH5H 1JWUB 3LDBC 5D2NB 5E4EB 3FFDA 4NQTA 1A7PH 2AK4A 3RIFK 3SGKC 1FIEA 3QIBC 1YMHB 3TN0B 5GJSH 5C9JA 2X44D 4K2UL 2A9NL 3DI3B 5BO1L 1FPTL 1B3JA 4N0YL 1BQHA 5DS8B 5DVNA 2DIJA 4JFFA 1R5VB 4FFWD 1D5XB 3IJHB 3GSXB 3LS5L 4WRLA 3PQYB 5GGSA 4Z7NE 2CKBB 1JCKA 5IHLB 1UG9A 4KXZH 3QO0A 1JVKA 3DGGB 4LHUD 4P57A 5J6HB 4LSUH 4FQXD 1MFCH 3SEPA 4NC0B 1U9KA 1S9KC 4BKLB 3STBA 4KJPC 2F9BT 5DHYA 1P4BL 4MD5A 4Y19B 2A6KA 5TDPB 3CDFA 4U1KA 1CICD 2BSSB 1D9KC 2G75A 5D2NC 2OK0L 3HG1D 2VDNL 2X09A 3OAZK 5FO7A 3RGVB 1WZLA 2XKSA 3M8OL 3OKMA 1T1WA 4OUOA 2VLMD 2GIYA 1IKNA 3DETD 1OGAB 1FYTE 1KBGL 2LTQB 2OZ4H 1JMXA 3AC0A 2BK8A 3CPLA 4YBQC 4LRNH 1J1PH 2XV6B 1VACA 4G5ZH 4OCYH 4XNYL 3M1BA 4ZODA 4KKAC 1NEZG 2Z31D 1LO2L 2WIIA 1A47A 4P3DB 3S4SG 4CVXA 1RJZB 3P4MA 1JNHB 2WK2A 4OTXH 1G7IB 3SKNB 5FB8B 4KZDL 1D5IL 3AREB 1IC4H 1PW3A 4P4KA 3VDAA 4AQOA 5HHNA 5HYJE 3LZFH 3PF2A 1KCVL 2V7HA 2YS4A 3HMXH 3R06A 1NL0L 1JGUL 2HJLA 2VMFA 1FV1B 4NCDA 3BP5B 5F72S 4PLKC 3RI5F 1DQTA 4FG6D 1EXUB 5B8CB 1X5LA 3HHRB 2Y5TB 4QTIL 2NTSP 4RFOH 5F88B 1BZQK 4LBEA 1QQDB 4YHKH 3TH3T 4JZJA 5B8CC 2AV7B 4W6WB 1FNLA 2EDYA 4GT7A 3OQ3B 3CK0H 3LRHA 5CEYA 2VAJA 4K23H 4I0KA 4H0GA 1AFVL 3DECA 1CF8L 3UAJD 4LLUB 4KUCF 1RY7B 5HYFA 1HNGA 1LD9A 4PG2A 3LPWA 3O2DA 4UOW0 1PKOA 3TT3L 4YNYA 1CL7I 4DEPC 4JO1H 2P44B 3OR6A 4L8BB 1KIUA 1M05A 4L3CB 1I7RB 3KYNB 5JOFB 4YHYC 2QQNH 2BMKB 1RZGA 4OM1L 3UDWC 1HWHB 5CP3H 1U3HC 2APVA 4CADA 2EH7H 3ZZ1A 1WWCA 5IB2A 5C92A 1U2HA 2FHBA 2XQBL 3QCUL 3NFPB 4KK9C 4MA8L 3NFPA 1BM3L 2VL5A 3O6KH 5JIKA 2DLHA 4ISVB 4DEPB 4HKBB 3O3DB 3BIBX 2IQAB 3H3KA 4RSVA 3P4OB 3H7BB 4NQSB 2D7OA 4CJ0A 4E41B 4Z0XB 3TBWA 3OR6B 4PB9L 1IM9D 2M1KA 1XMWA 3B9KA 3MBEB 1QPPA 5IW3A 4BH7B 5CAYB 4DUXA 4MJ4A 3ZDXF 3QEUA 1HQ4B 2JCCE 4YUEH 3VMPA 2Q6WB 4ZXBC 4WFFE 5IEKA 3HZYB 2OL3L 4IM8A 3KPNB 4KDVA 4OZFA 5I75B 4KK6D 3ISWA 2P48B 4KJYB 1MAKA 3RHWF 2N4IA 3SDAA 2Z31B 4EDXA 5E03A 1HYRC 5FXCH 4HIJB 1BGXH 3K80A 4O51A 2F54E 4C56D 4Y5XB 3L7FB 3HMXL 2FIKA 1S7WA 2VZVA 4PTTB 4PJDE 4HLZH 5E6IC 1B4JH 3V5DB 1IGMH 5DF0A 1GRWA 4H20H 4LQ1A 3VH8B 5TJWK 4KK8D 4YX2H 5MENE 1G7IA 1GOGA 2LFGA 3QDJE 3SKNA 3T77B 3ULVC 1MWAA 3O6LH 5BV7L 2QKIA 1FRGH 3ARXA 3WBDA 5I17B 4DJMA 4F8TA 4GUPB 4KJYA 4OFIA 3HCVB 4PJAB 5IJVA 1CIDA 4HGWA 5I71B 4HXAH 4LEXH 5IV2A 2VZUA 3OAZH 2GSGA 2GYSA 5I66A 1FORL 1OW0A 2YD2A 5H37H 1XF5B 3KPRB 4LLWA 3G6DH 4FTVA 2B4CH 2H8PB 2HA1A 4Q97A 4LOUD 4ZDHB 1S7TB 4M02A 4PYGA 4J6RL 5F89A 2Q8BL 1NAMB 4DKEL 5E8EB 4IRJC 1ZGLA 3P4OA 1VFUA 4DGVH 1BD2E 3AMKA 4OLZH 3O6KL 4JM2B 4Y5YC 3ZE0E 4YHPA 1DUZB 3F6LA 1HYSC 5EOTB 1ZTXH 1M4KA 3SJVD 4HXAL 1U8PB 1OSPL 1MF2H 1YEIH 5DD6A 3L1OH 5FUZL 3CVIL 5I1LB 1TJGL 4KI5D 3MV8B 5F1NB 4JY4A 1OP3K 3NZHH 4S1RH 4JFDB 2BY1A 4I3GA 1XCTB 3MOAL 3O4LD 4NO2B 1DVFC 4XXCC 5D7JA 3VXUE 1TETL 4AQ1B 4YZFE 1XF4B 3T0DA 2WWKO 4Y5VB 5D7SL 1I1AC 3TBYA 3WUWG 4BQ6A 5K59F 5EO9B 1T22B 1U42A 1CZ8L 4PRIA 3RDTD 1QFWI 3BQUC 3GI9L 4JAMA 5D7LE 2VDLL 5I1DA 5KSBB 1ZA3A 4HPYH 2GY7B 1NUDA 3ILPA 1U3HB 5L2KD 4B7IA 5IK3A 4M6NL 3EJZC 1H3VA 3KG5A 3D2UD 5GRXG 4TUJA 5KN5B 3TZVD 4GAGL 4Y4HD 3QFJD 4BUHA 3V4VL 2FX7H 4JFOA 4CAGA 1EGJL 1WIUA 4D9QD 1F4WL 3VFMA 4TSBH 4LF3A 1F90L 1TLKA 1KJ2A 4G9FE 3PV6B 5KW9L 4KUZH 2A38A 2YD7A 5D7SH 1RZKL 2F58H 2Z4QB 4H25B 5JOEA