3PAVA

The reduced form of cueo
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
487
structure length
466
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title The reduced form of CueO
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 135
structure length 466
sequence length 487
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA03
1X9RA 1HAWA 3T6VA 1ASQA 1ZDQA 4K9JA 3IN2A 4JHUA 1FA4A 1GY2A 4BWTA 1OV8A 3UACA 2BHFA 1TU2A 3G5WA 2B3IA 1BXUA 1B3IA 2UXTA 3QJUB 4KOBA 2XVBA 1AZRA 1BXAA 1HFUA 2IDTA 9PCYA 2H5UA 4F2EA 1XMEB 1PLBA 4ENZA 4M4RB 3WKQA 1WA1X 2MTAA 2XU9A 3OMAB 3FYIB 1PZBA 2YAFA 3NJJA 2YAQA 1WAEA 2YXVA 1AG0A 3TA4D 1NIDA 1PZCA 1L9QA 1PNDA 1AS7A 2EIJB 3FS9A 3V9CA 3X1NA 3FSWA 2YAPA 2DWTA 3FPXA 3GYRA 1JZFA 2N0MA 4GXFA 4A2FA 2AANA 4DP1X 4HHGA 1BYOA 5IY5B 1XB3A 2W8CA 3WNIA 3OD3A 1QLEB 1ZV2A 2DYSB 2JXMA 2HX9A 4CSPA 1I53A 1CC3A 4BXSV 1R1CA 2OJ1A 1OE3A 2H47C 5ANHA 1AZNA 1L9SA 2E86A 2YAEA 4YVNA 4N4YB 2BW4A 1XB6A 5PAZA 3FSVA 4KNSA 5F7AA 4DPCX 1DZ0A 3ZX1A 3ABKB 2YQBA 2DY2A 1TKWA 1IBYA 1WA0X 2P80D 3OQRA 1CURA 1W6LA 2PPCA 3L45A 5I5JA 1W8EA 2PCFA 3NJHA 4PAZA 2Y69B 1AOZA 8PAZA 4A2HA 4MFHA 4P5RA 3QJSB 1PF3A 1URIA 1OF0A 2GI0A 1X9UA 2IDSA 3ABMB 1RCYA 3AW5A 3NSYA 3AG3B 3S3DB 1PLAA 3X1GA 4W9ZA 4G7RB 3TBCA 3DKHA 3PPSA 3WNJA 4G71B 3NP3A 2AVFA 2PP7A 3NJKA 4NAJA 3JT2A 2R7EB 2GIMA 3BQVA 4E9RA 1JOIA 2FT7A 1AZBA 3AY2A 1NWPA 1TEGA 3DIVA 1SF3A 1M9WA 1CYXA 4JHVA 4E9QA 3N55A 3IN0A 1GYCA 1E30A 2ZOOA 1MG2C 1E5YA 2QT6A 2FNWA 1YLBB 2WSDA 5PCYA 4DPBX 3QJTB 5AFAA 4HIPA 1ZIBA 2PLTA 1TEFA 3T6XA 3EHBB 2IWEA 3UABA 2BZCA 4YSQA 2YAOA 4GP8B 4DP5X 4BDVB 1ET8A 3FU7B 2GB2A 6PAZA 2TSAA 1SHXA 3FT0A 4GP5B 1ETJA 2CUAA 3FU9A 3ABGA 1AS6A 1J9QA 1FFTB 3KW8A 3NJFA 3NJLA 2PPFA 3EF4A 4YSPA 1JZIA 1WS8A 5I5MA 1WA2X 3PLYA 2BWDA 2X88A 1NWOA 2QDVA 2H3XC 5B1KA 2ZXWB 1KDJA 2IDFA 1JXGA 2QPDB 3PAUA 5B1JC 1BQKA 3C75A 1JVOA 2FJSA 4DP7X 2VSMB 4AI7A 2DYRB 4HCGA 1AAJA 1AANA 1SF5A 1SDDA 2EINB 3EH5B 4G72B 1GS8A 3PCYA 3QJQB 2VSKB 5D4HA 3WIAA 2Q5BA 2BP0B 2XX1A 3AG4B 4N8UA 2EIMB 3WG7B 3QJRB 4YSCA 2FQDA 4NERA 1AQ8A 3T6WA 4HAKA 4G7SB 4YSRA 5B7EA 2PPDA 1EHKB 1A4AA 2XYBA 4F2FA 3ZBMA 2HXAA 3H4FA 4YSSA 3HB3B 3NP4A 1MZYA 7PCYA 3AZUA 2FQFA 1KBVA 3CDZB 4KO9A 7PAZA 5B3SB 2PP8A 2XV2A 3TASA 1CYWA 2GSMB 2BP8A 4DP9X 4RH4A 3T71A 2PPAA 2PP9A 4KO6A 1FWXA 3NSDA 4KO5A 4EF3A 2UXGA 2OV0A 1RKRA 2DV6A 1JZHA 3ERXA 2J5WA 4E9VA 4AKQA 2CBPA 4DP6X 4TXVB 3S3CB 1SFHA 3WI9A 1ZIAA 1AZCA 3SQRA 4PCYA 2UX7A 1NINA 3H4HA 2PPEA 4DP8X 4YSUA 3EH4B 1J9RA 1IBZA 4BK5C 1SNRA 2YXWA 2AZAA 1AIZA 3CVDA 1OCCB 1GW0A 2VW7A 1AACA 1J9SA 2FTAA 5B1AB 1E67A 2RACA 1BYPA 3FSAA 2HZHA 2IDQA 1A65A 2XWZA 4A2GA 1F56A 2VM3A 5B1JA 1KYAA 2XXFA 4YSTA 5D4JA 3X1EA 1JVLA 4A68A 2TSBA 3NSCA 4AX3A 1VLXA 2A3TA 4ZK8A 2YARA 5AKRA 2IAAC 1OE2A 5EHFA 3SBRA 3OMIB 1ASPA 3FQYA 2OCCB 2ZWNA 3CVCA 1ET5A 1JZEA 4WKXA 1QHQA 2LLNA 3OM3B 4F7KA 2WO3B 4AKOA 2JKWA 3UADA 5F7BA 1ILSA 1PNCA 2XXGA 4W1TA 2Y1AA 3S8FB 4Q8BA 1JZGA 4A67A 1ILUA 1IKOP 4AKPA 1BQRA 1JZJA 4WTQA 4DPAX 2J57A 3T9WA 3D12B 4G70B 1L9PA 5D4IA 1ZPUA 1A4CA 3GDCA 3ASNB 4QLWA 2XV3A 1JXFA 1IUZA 4P5SA 4HZ1A 4A66A 4UF7C 4NB7A 3SBQA 5I6KA 1OCOB 2UXFA 4GP4B 1NTDA 3N2JA 4L0PB 3JTBA 3CG8A 3UGEA 1NDTA 1CUOA 1PMYA 1XB8A 5LDUA 4Q89A 1BXVA 4BXVA 2R7EA 1EZLA 2DWSA 4X4KA 3S3BB 2FT8A 1KBWA 4GY4A 2Q9OA 2I7OA 3FSZA 5B1BB 4FA7B 1GSKA 4DP4X 2JFCA 4YSOA 1J5CA 3FPYA 2NRDA 5I28A 1PZAA 2WO2B 3H56A 3NJIA 2EILB 2FWLB 3TU6A 3OMNB 1NPNA 4DP2X 1N68A 4YVUA 5B7MA 1BEXA 1JXDA 3QPKA 4M3HA 4E9TA 1KCWA 4E9YA 1ET7A 2MRYA 3S8GB 5FC9A 4BDVA 3ZDWA 3FU7A 2UX6A 1E5ZA 1RZQA 1BQ5A 2XV0A 3UAAA 1NIFA 2XX0A 2VM4A 2BWIA 1BAWA 1MDAA 1PAZA 2IDUA 4YSAA 4A2EA 1NIBA 1SFDA 4KNUA 4E9XA 1PY0A 3AG1B 2J56A 4UAHA 1MZZA 1KGYE 2AZUA 3X2QB 2IH9A 1V55B 2X87A 1SJMA 1PCSA 3ASOB 1NICA 1PLCA 3FQ1A 2BP0A 1M56B 2BO0A 1V10A 2XLLA 3NJMA 6PCYA 1GS7A 1A3ZA 2ZONA 1ADWA 2FQEA 3CVBA 1NPJA 4YSDA 1ASOA 3MBWB 2W88A 2HRHA 1ID2A 2CCWA 3X1BA 3IE9A 3WKPA 1W6WA 3NYKA 1GS6X 1GR7A 1NIEA 2I85A 3PAZA 1A4BA 1KV7A 1AS8A 1OCZB 1E65A 2IH8A 2PCYA 4BWWA 2XUWA 4HCIA 1OCRB 3CDZA 3FU8A 3HEIB 4UANA 4FAAB 1MG3C 3T6ZA 3QJVB 1M57B 3SBPA 4YL4A 1A8ZA 4JKNA 1QNIA 3ZIYA 3EH3B 4BWUA 5I6OA 5I6PA 2IWFA 3TBBA 3NJNA 2BW5A 3FYEB 3IEAA 1L9TA 3UAEA 1L9OA 2VMJA 2CALA 1JERA 1KCBA 4KNTA 3PAVA 1AZUA 1GY1A 1KDIA 3DTUB 5E9NA 2GC4C 3GXUB 5I26A 2FT6A 2GBAA 4HHWA 1V54B 2HRGA 2FQGA 2QDWA 2HX7A 2GC7C 4HCFA 1UATA 5TK4A 1SDDB 1NIAA 2GHZA 1OE1A 2CJ3A 3ABLB 3U25A 5A7EA 1N70A 4E9SA 3FQ2A 1OOWA 2YAHA 4AZUA 3NSFA 5I6LA 4CSZA 1ZDSA 4G7QB 5TK2A 2HLEB 1HAUA 2UXVA 4YSEA 1WS7A 2J55A 2QPEB 1NZRA 1AG6A 2CAKA 4E9WA 2IWKA 2P80A 2YAMA 2VN3A 1J9TA 3MX0B 1AR1B 3KW7A 3IBOA 5I6NA 2EIKB 2I7SA 1IC0A 1DYZA 4QKTA 5I6MA 3NJGA 4HALA 1T5KA 4KO7A 3RYMA 3V9EA 4KOCA 3CZUB 3QQXA 4DP0X 4GYBA 2HX8A 2VW4A 1J5DA 3PXLA 2B08A 1RZPA 1L9RA 2BZ7A 3BVDB 5B7FA 5I5IA 3NT0A 3AG2B 5AZUA 2VW6A 3X1FA 2AFNA 4A2DA 2BP8B 1SHWA
chains in the Genus database with same CATH superfamily
3H2QA 2X3CA 5C3IA 2ZJSH 2CM5A 4PRPE 2EDHA 1EEUA 4WDIB 2JJSC 2AJSH 4F1SA 5CZKA 5DMKA 3WFBL 4L8CB 2E7LC 2CK2A 3ARVA 2VDPB 3TN0D 3RUGF 5DJXB 4JPVL 4ONHA 4WSJA 3QNYA 4JQIL 3VQ2C 1IQDB 5GISH 1SXCA 3LH2H 4WO4A 3W9DA 1KV3A 3R4RA 4ODVH 3OMAB 4ZO6A 2F54B 2LLLA 4O58H 5E99L 1KXQA 3DVIA 3PJSB 1EEYA 2X4NA 4MD5A 3L7FB 3MLVH 3L2NA 1BF8A 1MW3A 4PS4H 4JJ5A 2V4LA 4L8SC 3JV6A 1OAZH 4GQQA 5K9KA 1UM4H 1O9WA 4WUUE 3G6JB 3FPXA 4QGTA 4WV1A 4MGXA 1H9DA 1KB5L 2VN4A 3D3VB 4BUGA 1L7TH 1FYTA 1J8RA 4E0RA 2I9LB 3IRZA 3X12B 3N41F 5ADOL 4DP1X 2B5IC 1L9MA 1DVUA 1ZVHA 2AXFB 3EBIA 2R1WA 1DO6A 4TL5A 4YLQT 4IHOA 4GBXC 1UXWA 4ELDA 3TNMA 2R2BB 2QQQA 4W9LC 5IROD 4BH7A 1I7RB 4MNHB 3SKJL 1NC4B 2BSED 2WY3B 1FZJB 1SJEA 2UZPA 4WTZA 4PD4J 3FRPG 3RWFA 1TO5A 2BOCA 3JWOC 3MNDA 4GKZB 4XCFH 4AMXA 1YN7A 5CJQH 1J8HA 1I9IL 3C5JB 4IGBA 4PB9H 1VACA 3GTTA 3BVXA 3Q06A 1CURA 4NQSB 3UOAB 1JL8A 3GSVB 1XF4A 2X0VA 4LL9A 4XVTL 3C5ZA 1RK0B 1KGWA 4E41E 1UB5A 1KY7A 3RG1C 1Y1DA 2OMXA 5IFAH 3AQDA 5AW9B 2OL3H 5D1QC 2D7PA 3T2OA 4CGUB 5C07D 3MHZA 4PMEA 1PFOA 1CF1A 3HC3L 2W0FB 3TBCA 4J4PD 2FATH 3PPSA 2WXHA 1T89A 3P2BA 1E4WH 2PW1A 3ESUF 3F65A 2DIBA 1I3GH 5MERA 1A7OL 1A3RL 2HRPH 1U8OB 3VYOA 3A4DA 5D1QE 1KB9K 3E8UL 1BOGA 2K3TA 2P5EB 1Q38A 3RI5K 2QLVB 4A04A 3B7TA 2ETWA 4XNUH 5CU5A 1RSFA 2OMUA 2JCCA 1Z9NA 4N0FA 4FFYA 4XAWH 4GRLD 2BVPA 2SEBA 3V4PB 2H6PB 2ZXBA 2D2OA 3QULB 1E7VA 4J27A 4U1HA 5A6IA 1DEEB 2JLLA 4IMLB 4R90H 3O3EA 4Z95H 2R51A 1OCWH 3Q7JA 5LBGA 4M6MH 2C34A 2RIKA 3MUJA 3ZQWA 1XF3A 2IPKB 5D1XB 1SEBB 1YC7A 3KJ6H 2HN7A 4NAMA 5T1LD 1QSVA 5JW5A 2R0WH 1P0SE 4Y16D 1X7QB 4P05A 1VKXA 4MNGB 3TBYB 3RWEA 1E2WA 4IKKA 1J9QA 1UFGA 2XZCH 4M6OH 1WWBX 3SBWC 1U21A 1WA2X 2HKFH 3J27A 5IEHA 1KB3A 4Z78A 4NN5B 1YSOA 3L3HB 3V5HA 4BZ1A 1TQBC 1B3JA 1Y18A 3K0WA 2OM5A 4F58L 4PJAA 1Z32X 5ICZB 4KVCL 3L3IA 3RUGE 2R69L 3QJQB 4IU2A 4YXHH 1S78C 5I8EA 5A2BA 3TEZA 1X5AA 1K8IB 2WCGA 4LSSL 1N67A 4QOKD 5BUPA 4AYBA 1EA9C 2XQYA 4NERA 4WTZG 1BFVH 4G1EA 5EFIB 2CLVB 5HY9B 3B9KA 4IDJL 1YEFH 1E3XA 5JW4R 4YHOH 3ULVL 3TURA 1U4EA 1MCPL 2HXAA 3IFLL 1Y07A 3L17A 4XCCH 4XT1C 5F0LB 2VR6A 4AYDC 4N0UB 4FQ2L 4LLVB 1BPLB 1I75A 2P3YA 4F92B 1MEXL 5F0MB 3Q6GH 2QQKH 4BE6A 3IFOA 4HFUH 1E27B 4AQ1C 1J12A 4ICWA 2KZWA 1FWXA 3U0PA 2C3VA 4BRVA 3UCQA 2QZQA 4MASA 2DH3A 2VXQL 5IP4A 1YNKH 2ITDA 1OWWA 1EXHA 1CF8L 1FIEA 2WQXA 4NBYB 2PUQT 5DVLA 2D8KA 4B3EA 4WRLA 1E4JA 4N2CA 43C9A 3WLBB 3VXRD 2WBJA 5ECJE 4H8WL 3SE4C 2G2RB 3WEXA 5DD5L 4M4RA 3RWCB 1ZD6A 3BKYH 1PG7H 1ZLUK 4U0RB 5FHAH 2DBLL 2LFEA 2ZPKH 4P57B 1IGTB 1UQSA 1N26A 2BSRA 5DT1L 5C0GA 4Z5RB 5GZNC 1NSNL 1S9XA 2VDNB 4MS8D 4PJIE 3STZB 2HJKB 3EYVB 2WZAA 1UZGA 2A83A 1H5BA 4PRHA 4RA3A 2L7JA 4HYTB 4L5FH 5DLML 3R18A 3S36L 4B9ZA 1KSRA 4PIBA 1NEZA 4BSVB 1G7HA 2BFVH 2FHFA 5JPMB 1Q9KB 2NXYC 4AX3A 2QGCA 1OW0C 2HVKB 5D2LA 1MWOA 3UXFA 4WNQB 1ZK5A 3ARYA 4WHTA 4XH2A 2A9DA 4U31A 4XPFH 1MAJA 3FKUS 5ICXB 5JW3H 1YAIA 3OMIB 3PHOA 3WAJA 1XBRA 4BUHA 3QH3A 2BY3A 2X1PA 5CLTA 4G8FA 3TA3C 2ZXDA 1YEKH 3M1CA 4HKBA 4XPTL 2HAZA 5GS1C 5EIIB 1LM8V 4M48H 3UGUA 2H8PB 2HTKD 3CDFA 3N44B 4KI5D 2WNGA 4DAGH 2J12B 4AT6B 3COOA 5FYLH 3WYRA 3G5VB 3FUIA 5AYUH 1CLOL 2X2HA 2O93L 5DS8A 3U4KA 4OV5A 4R26H 4PHZA 1QRNE 2BRRL 2VXVH 4GRLB 4RBPK 2DYPB 3CFDA 3D2UD 4LCYA 4MBOA 4LPVA 5KOMC 2O5YH 1WZAA 3MJ7B 4M4PA 4DO5A 1RK1A 1Z3GH 4XCEB 3BUPA 1J5OH 3BKCL 1DQQB 3ELAT 2HFEA 1YYCA 1WSST 1RJZA 5T1LB 4OI8A 1F3RB 2IGFL 5EV7A 3EYFB 3TT1H 1KLGB 2JELL 2Q8BL 2V3DA 2YHGA 3JTBA 2ODIA 5KSUA 1CUOA 2AJXL 1X9LA 5H94A 3LEVL 5F2FA 2C1PA 4JGMA 1MWAB 4Q89A 1HXMB 2GUYA 4P0DA 4Y16B 3UYPB 3HLKA 4RWHA 1JHLH 3VD7A 3SYPA 2VDMB 1T21A 5T5FA 1XD1A 2CWRA 3R19A 4GY4A 5D7SL 3G5YB 2AV1B 4J28A 1SYVB 2AK1H 4LGRB 3LVTA 3HAEB 4HKJB 3C9NA 1FH5L 2CCLA 1KEML 2YGQA 4LF3A 5DWPA 1WFUA 3EDFA 1NOLA 4BK5A 5GJSL 2FWLB 3OMNB 4ZFGL 1FC2D 4BGLA 1HDMB 1EFXA 1A6WL 4U6HB 5B7MA 2WQRA 4KROD 4H7VA 4DZBA 4WW1B 1NMAH 3DX8A 4OB5H 2VLKE 4WF7A 4RA0C 5JW4Q 4PWGA 1OAQL 4P3CH 4Z3GA 3V0WH 4IIQB 4LT7A 3QCUH 4QOKB 5E51A 4ZMQA 2AABL 1ZHNA 3BPOB 3IDXH 1SJXA 1RZ7H 2YIHA 5I1AA 1HQ4B 1IJ9A 1PAZA 3E0GA 2IDUA 3E3QC 1I8KB 1A7NH 5A40E 3NZSA 3CFCL 5EU7C 2A9MH 1HHHA 2H4EA 5FYKE 5B1CA 2ED9A 1PZ5A 3TBTA 2JCCF 2IG2L 4G6KH 1YEJL 3MRBA 4KFZC 1NEZG 1DSFL 2CJUH 3QQ3A 4OKVA 4X4XA 3FTVA 4XNQA 2CDFB 3W5NA 4MXWL 4L1LA 5IQ7H 1UXSA 3QPQC 4PJCB 1DN2A 3VTAA 5EU7E 1ZAGA 3C6LC 4HK3J 2WQAA 4LOEA 4CVWA 1NBZA 1X4ZA 3GB7B 3HC4L 5CP3A 1GOFA 3T3PB 3K1KC 2C3WA 2E7DA 1JWMB 1RUKL 4HUMB 3WDIA 1T04B 5BW7A 1U8PB 1UVQB 5KVMC 3PWPA 1JXKA 2CPUA 4ALAC 1DBAH 2MNJB 3A47A 4LEOB 3V0AC 2D7NA 2ZSVB 3ETBF 1MIML 4N2FA 1G7MA 1U8CB 4JPWH 3VXRB 4ZMOA 4NM8H 4EPSA 2B1HH 4S0HA 3MXVH 4JX0A 1KV7A 5I71C 4HCIA 4TNVK 1ZT4A 2F08A 3LB6C 3BJLA 4P99A 5KSBB 4WO4C 1WEJL 3QJVB 1HU8A 4MHHI 3ISWA 1UH3A 1BEYL 2Z31D 4PJAF 2VDRB 4MCZA 4BD4A 3NA9L 1NAKL 3PFUA 1J87A 1UJ3B 4E41D 3WMSA 2ZKHL 2J71A 4CDHA 3BWSA 5IQMA 3AU1A 1KT2A 3VRLF 3P77A 4O2EA 5DMJB 4UT9L 2UWEB 4WV1C 3W37A 2FX9H 5EZLA 1NUFA 1JGEB 1FPTL 3OTTA 3PGCB 4ELMB 5GHWH 5A3IC 4H13C 1KXQE 4NYLB 2ZKWA 2F7RA 2DIEA 4BK8A 4XO8A 4NKOA 1DVSA 2CM6A 4GAYB 5D1QD 1A6TA 3BD3A 3MNWB 5B8CC 5TE7L 2DMCA 3FDWA 5IFJB 4L0YA 5BPPA 5AYQA 1RIUL 2FJGB 3MRMB 1FYTE 4OVUA 4AYMC 2E5EA 3AGWA 1KBGL 4GAJL 3CC1A 1K5WA 1CXKA 1S5HA 5HD8D 2HA1A 4KTDL 2L8AA 3LD8C 3GJFK 5KVEL 4U7KA 5E94B 4IGBC 1A9EA 3QQDB 2ZCHL 4K5OA 4FNLH 2Y7SA 1BAGA 3IMUA 4OT1L 4ZPTB 3RWIA 4AEFA 2YEZB 2VQ4A 5I5IA 3HBPA 4LNRA 1Z9MA 4X0KB 5LGJB 3BIKA 3C5ZC 4M43H 1J8HE 3PWNB 5F89B 4TPRH 1XCWA 3N9GL 2XI9A 4YBQC 2ARJQ 3D0VA 1FI8C 3DGDA 3IDNA 4OZGB 4JHUA 4X8JB 2IQAA 5DFWH 1AJ7L 5TF1L 3X3FL 2CBQA 1GY2A 4PWEA 4QNPF 4Z7QF 1GGIH 3KNBB 1T89C 5EO1A 3HMXL 5ID0B 1N5AB 3GDBA 2UVEA 4Y4HD 4RFOL 5DD1L 4ZG1A 3NZ8A 4HCRA 4A55A 4M56A 4WU5B 3WFBH 1DSYA 1GJIA 4XNZC 9PCYA 5EBMA 4S1RL 4XCNB 1PTZA 3FT3B 4NKIL 5F9WB 1ADQA 3DRQA 4AEIL 3TNNA 3B2UC 1KYOJ 5D2LF 1T4KB 1CFSB 3IU4L 4KROB 3NJJA 4CRPA 3OKLA 1WAEA 1WISA 4H44C 1JZ4A 3SY0A 3V9CA 1LE5B 3WKYA 3QG6B 1Z5LA 4NQXB 4B0MB 2JCCE 1BQSA 2A9AA 1H3VA 2DQHL 2D4DA 4HG4J 4OLYL 3BWAB 1E6JH 4YPGA 1MQ8A 2VLMD 2G3ZA 1QYGH 3PL6D 4BFFA 4B5ZA 2GJZB 3ZL1A 1JI1A 1BYOA 4KXCA 5JORA 2DQJH 4EJ1C 32C2B 5ADOH 4JQVC 1PY4A 2CO7B 1WD8A 4JFTA 3ZSTA 5MEQA 3Q1SL 2DZEA 2UYLA 5DC0A 3CHOA 3BH9B 5EBGA 1VFAB 4H1LH 1FBIH 4YPJA 3T0XA 3FSVA 4FC3E 4XP9L 4DPCX 3RFZA 2EIZA 3KXFA 3ZSSA 3T5WA 1FH2A 2YQBA 4MKMA 3VSTA 4EZLA 3CVIL 4AM0B 4F8TA 1JGDA 2PCFA 2OSXA 2AGJL 4KJPD 4ZOBA 5E95B 4FS0A 4MFHA 5DMGC 2VITA 5E6YA 4PJAE 2JI3A 3N85L 4FZEH 1X5HA 2CRZA 1P4LB 3B9KC 3FSOA 2HVBA 3MRQB 3VRLE 4LLUA 2WXPA 4IU3B 5FO9B 3EGXA 2CO6A 1T6VN 2XZQL 3IXTA 2Z31B 1MCNA 3FT4B 3AADB 5HGGS 3HC3H 1OAUH 2Q7YB 5A6LA 3Q43A 1AXIB 4QRTB 5IEKA 3NZHH 4GXVH 1C8QA 4X2UA 4A7TA 2ENPA 3WFEL 5BCAA 1VPOH 2J72A 1TEGA 1A3RH 3CUPB 3D39A 1PG7X 5FYJH 5DUBA 4PJXA 3UJJL 3VFOB 2FNWA 3GHEL 4F8QA 5DEFB 1YLBB 1BQHG 1TF4A 1HHJB 3ZXAC 1E7UA 2PLTA 1TEFA 4EUPA 2ATKB 4NUQA 2BZCA 5EUOB 4YSQA 3BFWA 3MR9B 4PLKD 2R9HD 3Q8CA 2YAOA 3GK8L 2C1OB 3L3DB 1OSEA 5C0NC 1QACA 3WOVA 2CRMA 3EJQA 3P3SA 2WVTA 3G5ZB 5J11B 4KZDL 3HZYB 5SX4H 3BD5A 3H7LA 3MUUA 4BZ2L 1QRND 1OP5K 3BMVA 4GP5B 1G1KA 2WSPA 4BQ6A 4Z7AA 4K4KA 5CF3A 5ABZA 1G0YR 3BH4A 3ARBA 3DHUA 1ZA3B 2VYRE 4KMQA 1H5BC 3KYOB 1XIWC 3F85A 4U1LA 3HNTH 4ZFZA 3RX5A 3QXDB 5DUML 5FDWA 4QNPE 4Z7QE 3HZKB 1R0AL 4CW1B 1XCTB 2NZ1A 5AKSA 5AAMC 4OGZA 4XNYL 1HXKA 1NOAA 2BNQA 3MREA 4YO0A 5CLYA 1EO7A 4PRHE 5FLVA 5AW6B 2L7UA 3WIAA 2BP0B 3QEHB 4AGPA 4N8UA 4KVCH 2I32A 1OAKL 2R69H 4HV8B 5E8NB 2EXYD 3SE9L 2YUXA 5D2LE 3RL2B 4I1PA 4XO5A 4Y4HB 5JO5A 1NMBL 4LSSH 5B39B 2J1WA 2VL4A 1C16A 2EDQA 4UTAA 6TAAA 3QHTC 3JV0A 2QSQA 2CKNA 4EN2A 2RQEA 3RUGB 5L0QC 4FLRA 2WXFA 3ZBMA 2N7SA 3PNWA 1BD2A 1E28B 2OR7A 2ZUWA 4YSSA 1WCBA 3ULVH 3L2LA 3NG5A 3MRJA 5SWQA 3MGTA 5K59E 1NFIB 2XV2A 4X5XB 4HDIB 3VSVA 3LN4B 4G59C 4M7LT 4NS0A 4CMMB 2HFFA 4OZFA 1XAKA 4ZD3L 5I2IB 1H8OA 1MEXH 2IFGA 2EUVA 4IBSA 3Q8AA 1MLCB 4TSCL 5I0VA 3CBKB 1P4BL 4MDIB 3MCLL 5FYKD 1J0HA 4HX1A 3PL6B 1XXFC 5DD0H 3IU3B 3GHBH 2GK0A 4I4WB 2MQGA 1CLVA 4L8DA 4XWOD 2GI7A 1GOHA 2KS0A 4WI2A 2NQ3A 1Q72L 1CBVL 2IGLA 1XSJA 3FUFA 4NSKA 4QYOB 1U8QB 4OJAA 1QASA 5EOTB 1LNUB 2GEQA 3MRFB 2FK9A 5CIPA 2Y3AA 4H8WH 4ESKA 4BK5C 2LU5A 3RWHB 4XTRD 5LDSA 4EUPG 4ANXA 2P24B 1Z5YD 3OXSA 4UQDA 3UTZB 3VFRB 4S1QL 4OH2A 3HVDA 5DT1H 1MVUB 2A9NH 3KGRA 3VE0B 1XR8A 3NK4A 1NSNH 2DWEB 2XXFA 1IM9B 1UZ6F 3FO1B 4YBHA 3T8XA 3S97C 5DCCA 1FO0B 4FQ1L 3S36H 4ZK8A 3O81A 5HHPA 2C5DC 3AABA 4Q56A 1P53A 5BXFA 4AEHL 3QRFM 1ODUA 1DBBH 5L2JB 3PQYD 3T2NH 1EERB 2OP4L 4GINA 1CGXA 2XICA 4AENB 1HL5A 5FLUA 3LB6D 2GJ6A 1RZKC 4KHTL 5D6CA 2PXYA 1X6LA 2W92A 4X6EA 5JQHC 4Z3EA 4AZ8B 3X11A 2JB5H 3EGDA 2Z7UA 5DJAB 3U2IA 4DPAX 4ECNA 1DQDL 3S35H 3L3KA 5BW7C 5BS0D 1BZ7A 2EKJA 4CNIB 3EZ8A 2WXRA 4YEFA 1D6EA 1GGBL 2FH6A 3MACL 2JF1A 1AQKL 5AL0A 4R7XA 4X99B 1Z9PA 5E1GA 2WXQA 1EBAA 3LZOA 1FE8H 4O2CA 2H7WA 1I1YB 4JFYB 4ODUA 1FZOA 3BKCH 3SKOB 3CPUA 3W56A 3PWPE 3R06B 1MRDL 3HB3C 1P6FA 5LDUA 4DWHA 1QRNB 2Q10A 3HC0A 3SGKA 1WC7B 4JCWA 3QUHA 2R7EA 3KCPA 2AJXH 2XPZA 4B41A 1FVCB 4XGZB 2VTFA 3NJVA 3Q1EA 3IJEA 4I7ZC 1M3IA 1NJ9A 1QFWL 2ITCA 4K0OA 2JIXA 1J8HD 4N2DA 1CZ8L 5D7SH 2WO2B 1NPUA 1RUAH 1ZHBB 3HC2A 3JTSA 4DNLA 1GSMA 4IS6A 2ENSA 1VENA 4BFOA 4M8VA 4F20A 4ZW3A 5IQOA 3BE1L 3MUHL 2J88H 1FH5H 2GTZA 4AQZA 4R2GC 2FBJL 3GSNL 3KL5A 3NJXA 6FABL 1K4CB 1UCTA 4ZFGH 5KG9A 1IBDA 1OTTC 3DBXA 1A6WH 2R8SH 2YK1H 2Q8AL 4PH8A 4HLEA 1BJ1J 3CHPA 3IB4A 1OAQH 2OMYA 3BZFB 3BYTA 1PQZB 2DQGL 1IAIL 3RPIA 1ZGLM 2WV3A 3ZE2E 1N7ML 4UM9A 2AABH 3O2VL 1D7FA 4P2QA 4XE5B 1SMOA 3UG5A 5FUZH 1U6AH 4DUXA 1WUNT 2V9TA 3AG1B 4UTCA 4PJXF 4YR6B 4FOMA 1GPOL 3CFCH 1QSZA 3LPGA 1KGYE 4FNQA 1P7QA 3L3GB 4WENB 2IG2H 1N59B 3FRPB 1X5XA 1YEJH 1DSFH 2C9SA 1PLCA 4QXUL 5EOCJ 4LQFL 1QWUA 2W65B 2B1OA 4YHYB 3V0DA 3HC4H 2G4EA 4FXGA 1ROWA 4TUKL 4F7TA 1A21A 5BO0D 1RUKH 3O2DA 3IE9A 1KULA 5BNXD 5GS0L 2NNXA 1GR7A 2X09A 1NIEA 3L3JA 2K7PA 5D1XC 2VDOH 5GRUL 4C83B 1AS8A 4RWYL 1KC5L 5F9JB 5D4QA 5J8OA 1ZVSA 3WY3A 1IAOB 3MAWA 3EYUL 3N3EA 7CGTA 2WXKA 2ICWA 1ZXQA 3UAFA 4H8UA 1XH3B 5C0BA 4FLSA 1IAKB 4ANVA 4RMQA 1HH6A 4IQHA 3P3UA 4NZTL 1BEYH 1PZ2A 3PGDA 4U6TA 1QPPA 3QUXA 1OD7A 5HGBB 3FZUC 1NAKH 3V2AR 3VYNA 2LR4A 3MRRA 1DCLA 4CN1A 3TM6A 3DOIA 2J1XA 5EUKB 4UT9H 5DZVA 4JFOA 4WFHD 1FPTH 3PQYB 1NGQL 2CBTA 5HJ3A 3QNYB 3MNVA 3LX9A 4EQ2A 3QZLA 1X5MA 2H1PL 5I1LA 3WIHA 3EOAA 1BX2B 5I6LA 5CR1A 1ZDSA 1R3LA 1ZLUH 5IW6B 3T2LA 1MJJB 1S3KL 4PGBA 1MW2A 4UQ9A 1RIUH 3CFEB 4MD5B 4JFZL 1R3IL 4HUUB 1F4YL 1KBGH 1F8TH 3RFZC 4JJ5B 4GAJH 5GGSA 1PX4A 5BS0B 4JKWA 3GIVA 2H1LM 1M2VA 2IPTL 4DP0X 1GHFH 2J2ZA 2HP4A 4YLBA 1OGTB 4U6YB 4OT1H 4UQ2A 3BH8A 3P73B 2X4TA 3KXFE 2VISA 5DC9B 4XVSL 2WK2A 1SHWA 4WU7A 5DZAA 4BFBD 1XL6A 5C97A 3KPNA 4LBEA 2WBWB 2WBJD 2BP5M 4BH7B 4BWTA 4F57L 3B9AA 4FKEA 1X4XA 4Z7OE 2MHAA 4GI6A 4HSAC 1SJEB 3CE1A 5GIRA 4WWKD 2BVEA 3VFNB 3WN5B 3X3FH 4YZWA 2WYTA 5EO0A 3K71A 4XHQA 3RZCD 2UXTA 3HMXH 1YN7B 3OLDA 1J8HB 5EEWA 1O5DT 2WIIA 2MEJB 1HFUA 2R2CA 3MA7A 4RFOH 1IC7H 2H3KA 4PRHD 4OJDH 2ZQKA 3ZDYF 1U8NA 5E8DL 1QTYT 3CCHB 2MTAA 3GMMB 4RBPH 1XF4B 2CGYA 4S1RH 5DYFA 4AK2A 3K6NA 5AVTB 5AVWB 2C3XA 4AEIH 1OM3L 3WEOA 2EIJB 1N64L 3D39E 1E4XH 1WBZB 1A6AB 5EBLA 5A2JH 4PJXE 2GAZB 2NY3C 4LSTL 2WTRB 2ZSWB 1H3PL 1HCFX 2WQ8A 1JHKL 2AXHA 3C6SB 4Y5VA 2QHRL 1L4IA 4KPHH 2NNAB 4NT6A 4PUBL 4OLYH 3HPJB 3P54A 3ZZQA 1LE9A 3MLTB 3W3BA 1OF2B 3ARBC 5LCVL 2X05A 4GAFB 2VGLM 3EF7A 4PGCB 1BGXH 3FQRB 3NRQA 4PRNA 4OLEA 4AIZA 4D9QE 3ARFD 3BSZH 4KNQA 2H47C 4YXLL 4ELKA 1CI3M 1HSBB 4NC1C 1A47A 1M6OB 1HOEA 3OSKA 5DR5H 1I3RB 3A6BL 4WEBL 2BM3A 5AKTA 4JREB 5PAZA 3PHSA 1DZ0A 2Y5QA 5EF2A 1TKWA 1WA0X 2WTOA 2VDKL 5HYSG 1U8KA 1PDKA 3FF7A 1MVYA 4XP9H 1AOZA 3CZEA 4FQCL 1NCJA 1UWEL 4GLRH 3U4BH 4A7SA 3CVIH 2B9AA 5I19L 4NC1E 2J73A 2BNQE 1F13A 1K8DA 3QXAB 4MZIA 2NUTA 2AGJH 5JUEH 4HJIA 5ABAA 3BRDA 2AJUL 3I75B 4KKCD 1T4WA 2XBTA 3WKML 5CZVL 3GIZH 2YUZA 3JVFC 4G7RB 3CTTA 4C57C 1PZUB 5H8DA 2A2QT 4DT2A 5IEHB 3H7BA 1AGDB 5I8CB 1WE5A 1WIUA 3FCUB 3G04A 3K72B 5BMFH 4PV9A 1ETB1 3NJKA 5JPNB 1OARH 5T1JA 1HHGA 4FG6D 2B20A 1P7KB 1I1FA 1LO3L 2XZQH 2JI2A 3L6FA 2EEAA 4I77L 5DRXA 1AZBA 3F64A 3NCYP 3I02A 3OX8A 1M9WA 4XBMA 2LE9A 1BD2E 1HZLA 4ADIA 2X6AA 3WGVB 3MJ9A 1E5YA 1HNYA 2R1YB 3T3MF 3TJPA 2W38A 3DV6A 1JYWA 2QVMA 4B96A 5C9KA 4GSQA 1H6FA 4P9HC 5DRWB 5ANMB 4J6IA 2OXHB 2YMTA 4HSCX 4PFEA 4BM7A 4P5MB 4OCXH 3AACA 4PJ8D 4RISL 2VXSL 3VWKA 4JRFA 1HHIA 1P7BA 4J39A 2WZ0A 4K71C 4Z18A 1EDHA 2ZUQC 2XYCA 4PJ5A 4ODWA 3MGAA 3S36X 5F1IB 3GNML 1WFTA 3GMOB 1NGYB 1LDSA 3K4ZA 5C08A 1N6QL 4MS6A 4UILL 3LRSB 1YEIL 2BVQA 4KJWD 4KZDH 4PJDB 3KWVA 2IALB 3O41B 4APQD 4M8QB 2EH8L 4L3EA 2OTUA 4HZLA 3X3GL 3MCKA 1VCBC 4ZUUA 2H3XC 1KDJA 1FJ1A 4G7VL 5C0EA 1SXNA 1B0GB 2VSCA 2VZOA 2WWKT 1YC8A 2DQIL 4JRYA 5E2WL 2ZNWA 1EHLL 2V17L 3HFFA 1AANA 4JL1A 4NUGL 1DVXA 1UOWA 2X10A 1YPZB 2WBJB 4AJYV 3T04D 2XX1A 3WEXB 2R56L 3WHE1 3KPOB 1AD9B 5FECB 4JNXA 3IGUA 4N0CC 3ZDYE 1FDLL 4ATWA 4LIQE 5LN8A 3MOBL 4WWKB 2F0CA 3PV6A 2BC4B 1V3JA 3GMQA 3RZCB 1OAKH 5BRZA 3QFDB 2ZX7A 4IEFA 3SE9H 1EHKB 4MB3A 4PRHB 1NMBH 3DX1A 3GJFH 1OP3K 3H4FA 1RZJH 4N26A 2GJ6E 2R59A 1T7ZA 4KO9A 5C8JA 1C5BL 2EP6A 2GKIA 3UTTA 1U8MB 3HG1A 2FIKA 4N2IA 3TEXA 1NDGA 3CVHL 4X98A 3U9WA 3RBSA 3LQMA 4KO6A 3QIBD 5FF6A 1TLKA 4MZRA 1FVEA 3RKPA 1HNFA 1DANT 2OV0A 5HVHB 3VWJD 2A7BA 5DJDA 5C0JB 1Z9SB 2E76C 4B7IA 3G08A 1QUNB 4ZTEA 3SGKC 1VFBB 1IC4L 2AW2A 1KJ2H 4QXTA 4AKQA 3MCLH 2EVGA 1G6RL 1CXLA 3FRUB 4KMTH 2IV8A 2NW3B 3OR6A 2BVOB 4KVNL 2UY6B 5E9DD 3ZE0B 1CLZH 1MXDA 3REWA 4XOAA 1NINA 2E4TA 4YHLH 4AG4L 2Z35A 3ARFB 1HQRA 1U9KA 5I75C 3OJDA 1SNRA 5I76A 2NNCA 4TS6A 3N5AA 4JW3A 4IW4C 3T65A 1BYPA 1HI6B 5AW3B 3F7YA 3S98A 1JWSA 3QHZL 2WN2A 4H25B 1MQKH 1YUHA 3AQZA 2VM3A 4OGXL 2Z1PA 4YSTA 1RJCA 3X1EA 4S1QH 2C1PB 4LDCA 2K70A 1QEWA 3DYMA 2JTYA 4JN2A 3FCBA 3P2DA 5HHVL 4BHUA 2BSCA 2VDPL 4GQ9H 3BW9A 1OE2A 2LAGB 3SBRA 1ASPA 2OCCB 1XQ4A 2G75B 3GRGA 2EH7L 3EADA 5KS9A 2JI1A 2RHEA 1M7XA 2ICEB 2E6JA 4KU1A 1CDJA 3BX7C 1QTSA 1BQLH 4AUYA 1EMTH 4FZ8L 3T3ME 3ZDXB 3ZIMA 4CJ1A 3CBRA 3Q44A 4YL9A 5HHME 1WGVA 4HC1H 4MX7A 4P2QE 4GO8A 4URKA 1UUNA 5KYXA 3ARDD 4JANA 5CXPA 4QHNB 5GJTH 3U1PA 4IBUA 3GHPA 1F4HA 1AR1D 3DPDA 1G87A 1PPIA 3VG9C 1JK9B 1I8UA 4PWIA 4QO1B 2DD8H 1NOFA 4FXGC 1ZHNB 3C8DA 5E2TL 1GIGL 4P04A 4Z3FA 3ECBB 4LGSB 2BH0A 5FUCC 2JJVA 1S7XA 3NCYS 4NHCL 3HRZB 1BAFL 4B9KC 5IQ9B 4PJ8B 1GGBH 4JPIB 5IQNA 3K91A 4GP4B 3MODL 1AQKH 4FA6A 4FG4A 4O02A 4AY0A 1FFPA 1MJ8L 2X41A 2YPLD 1QLEH 1BXVA 5FUCE 4X4XB 3HMWH 1MRDH 2OTWA 4W9FC 4TSAH 4X5PA 4HWBA 3I50L 3V4VA 4APQB 1EO8L 1PFCA 5CGBA 4DKFL 4QJ5B 1YMMD 4O2FA 4P4KA 2KHAA 1YO4A 3RVUD 4FA7B 5F6IC 5DEGA 3QUXC 3NESA 2DQMA 2QQLL 4JO1L 1ZA6A 4LASH 1QFWH 2VLJD 2N4IA 3F5WB 3KR3L 3RA7L 3LZLA 3CXDH 4N6RA 5CN2A 1G6VK 1N68A 5C0BE 1CZ8H 2VJXA 1EZVX 4JM4L 4XWGL 4OQ1A 1BEXA 4X6CA 3O8XA 4AH2B 3RILA 1XF1A 1UWGL 4PY8J 1L5GB 4MTMA 4BDVA 4WJ5B 3QJOA 3ULAB 2VZVA 3TPUA 2XV0A 4GIPD 3GSNH 1NIFA 3UPRB 4XOBA 4PREB 4NJ9H 1JBJA 2BWIA 1ZKAA 3LPFA 3AWEA 3LPOA 4LKCB 2Q8AH 5BO1H 1OP5H 5IM7B 2I60L 4PJHA 1CMOA 1IAIH 1T80A 4HGKC 4RAUA 5JHLH 4UWQB 3QORA 1CFTB 5EU5A 3O2VH 3E38A 3AU1B 2NSQA 4XE0A 3P77B 4XMTA 3LKOB 2DTML 3ZYZA 1XR9A 3MSPA 3KWWA 3V4PL 3LIUA 1BMGA 1AXTL 2CU9A 4HW6A 1KCLA 1SJMA 5B38A 4QHKJ 2CKBB 3QIBB 5D7JD 3GXPA 4BSWB 4QCIA 2XCMC 4N90E 4NKOB 4KKBC 4P3DB 5KUMA 3VWJB 3LN5A 4LDEB 1A6TB 2CIIB 3SPGA 4YHKL 5F1OB 2W1NA 5IJVB 4LLQB 4QXUH 1A7PL 1D5BA 1NPJA 4H8VA 4LCCA 4YSDA 3NVQA 4F37F 4RRPM 3ARQA 3KMDA 4PP2B 1OOAA 5J3HD 3FF8A 4D9QD 3VACA 5E9DB 2YPKB 4I13B 3ZYJA 3OHXB 1C5DB 1QKZL 3CV5A 3EJCA 2N7BA 4R7NA 1GZQA 1PKOA 4P59H 4U1JA 3WO4B 5GS0H 3ARBD 3R0MA 2YSSB 1AMYA 4XI5C 4LAQL 1G84A 3C60A 2IMNA 4L1SA 2F7QA 4RWYH 2C4FU 3H9HB 1WK0A 3HHMA 1WIOA 1U58A 3PGFL 4KZEL 3EO0B 2BNQD 5KVFE 2NY2D 3B34A 1BFTA 1BVKA 4XAKE 4Z8FL 1SMDA 3SDDA 2WXLA 3K4DA 5DZ9A 2KI6A 4Y8AA 2GC4C 3VVVA 2EO7A 4UINL 1BQHB 4FQJL 4YK4C 4ZS6D 1V54B 1GGCH 1G7QA 2AJZA 1NUDA 2HX7A 3SYAA 3IM1A 3NZ8B 1BJMA 4U05A 1UT1A 1LEIB 2XZZA 1SBSL 4K73A 3U7YL 1P1ZB 2IOIA 3KHQA 2YLKA 4OD3L 3HR5A 1KBKA 1NGQH 1YECL 3EJZC 2FNBA 2W91A 1QEXA 3MRPA 1NZRA 5H2BA 4N5EC 1JXJA 4OLZH 3CXHK 3ARDB 3OKLB 1QVOB 4J3UA 3SQBB 1LD9B 1AR1B 1XH0A 3L5HA 3HG5A 3MJ8B 3CLFH 3QZBA 1PVHA 4HH9B 1NMCC 2R4SL 5ESAA 4B27A 4HALA 4GKSB 5HXMA 4JFZH 1F4YH 1OY3B 3WJMB 3TZVA 3MMEB 4PY8I 3UC0L 1UOLA 1SXBA 2Q20A 2RCSH 2L3BA 4LNVA 3VAEA 1WHPA 2QVTA 4FCHA 4Q9RL 5E5LA 4IOIB 2R2EB 2YR3A 4FL4B 5HDBB 5IK3A 3JV4A 4PLNC 5LNGA 3VFGL 2YPLB 4XMKH 2DW5A 2CLZA 4ZYKA 4G6MH 4HF5H 3U4EB 2Q3XA 3IRCA 1TDQA 3UBXA 4B3VA 3KEHA 1EAPA 1YMMB 1CFNA 2VDNL 5IG7B 4F57H 3RP1A 5AZEL 3WXVH 1ACZA 1PBYA 5FEBA 1QBBA 1TNMA 3OC5A 4RMWA 4LLWA 3V0IA 4QHKI 2VLJB 2I69A 3NMEA 4Y4FD 1TZOA 1NA8A 1LK2A 3TS8A 4MJ2A 3GPSA 2ATPB 1NC2A 3EO9H 3VB8A 5E8DH 4Z76A 5E4EB 3CIAA 3IAQA 3VGGA 1JSYA 2AQNA 4K3EL 5G4MA 3FTZA 5KS9F 3Q5YA 5CFHA 5LBSL 1T1XB 1OM3H 3QDGD 2E59A 4XMPL 4F7CB 1KIUA 1MHCB 4JUTA 3MN8A 1PSKH 3IDIB 4UV4H 1CFVH 2D7TH 1DL7L 2DS4A 2GJ6D 2X12A 4NKQB 5E1HB 4N8CL 5IEKB 4K7PL 3P11H 2PXYD 3OHMB 3DOSB 2X70A 4LSTH 5HP5A 4NLHA 1N0LA 2Y72A 4I3RL 1DQML 1H3PH 2K1MA 3MNZB 5EO9A 4PUBH 1IQWH 1URLA 3E6FA 5DUBB 4PJ5E 3QIWB 5BVJB 4PV8A 3PWVA 1RULL 5LCVH 1YA5A 4UIKH 2B2XL 5C08E 1B0RA 5CILL 5D7JB 2YAEA 4EUPB 4JY6A 2FHBA 2FO1A 4L3EE 4JPKL 3T4YB 4WAFA 4UTBL 4YXLH 4R4FL 5JW4M 1QBLL 2J44A 5K39B 3A6BH 4WEBH 4CVXA 1MWAL 43CAB 3EBHA 4FERA 2EUZA 2JK5B 1H9VA 5B22A 2EDDA 2E9JA 4JFXB 5K9QI 2X2YA 4JRYE 2VDML 5BV7H 3LNFA 4E2OA 4FQCH 1UWEH 1X9UA 4NIYE 3MBED 5H37G 5I19H 5AW1B 2DQCL 1IMHC 1UACL 3X1GA 2YXMA 2V37A 2OQJA 2OJZL 1KIPA 3LRKA 2JIXD 4ZMYA 1TTRA 2ENYA 3U7WL 4D7BA 5CZVH 3WKMH 3O9WA 4J3OG 1TCRA 2J43A 1UD8A 2RTTA 3DYPA 4U6XA 3TC9A 4F33A 2Z1KA 2V2TB 2F58L 4X6CF 5BRZE 4G43A 5HTSA 3GEWB 3VRJB 1FN4B 1MDTA 5AD0B 2YSTA 1S6NA 2P8LB 2NY2B 2NYZA 2OJEB 3FK3A 2AEPH 3FU6A 1AY1L 3KYKL 2A74A 1MRFL 4ZO9A 4HIQA 2XZAL 1KN4L 1DBJL 3RVXC 1LO3H 3HZVB 4PBWD 5IVOA 3ZT6A 4BFIA 4QRUB 3KPRA 4WHYH 2WWKO 3UTTE 3VI4A 3BVVA 3HG1E 2WSDA 1QA9A 1R5WA 5GGRY 1AD0B 5AFAA 3MLUL 3WTVA 4HIPA 5E0FA 1XEDA 3LJ3A 3QI9D 4JFWA 5ALBH 1EO5A 4FP8L 1JRHL 2ZX5A 1C16B 4UT6H 1KPUB 1ZLDA 1S9WB 4Y19B 5FHBL 5F96H 5HHMD 4P2QD 2ITFA 1UM5L 1T20B 1EZSA 5HDLA 3FU7B 3CSBA 3KCWA 5HHQB 2XA8H 3BP6B 1RJYA 1SHXA 2VXSH 1F3DJ 3QUMA 4NP4L 3AAZA 3MGTB 5FYJU 4L1TA 3ARGD 5F7DA 4TUOA 3VGEA 2WQWA 1TJGH 2G9HB 1HE7A 1W72L 3LXCA 5FKAB 1JZIA 5HI4D 4EXPX 1N6QH 1QSED 3CSTA 1YEIH 1ACYL 2O72A 1OVZA 3GBNH 3ZO0A 1RHFA 5D7EA 3X3GH 4F7PA 4HUVA 4WI0B 4TQPA 4JHWL 2UV3A 3ABZA 4GQRA 3GJEA 1CVSC 2VDQB 2I9TA 4HUKB 1F4WL 4QLRA 2H32A 2V17H 3ZYOA 3Q8FA 2DRUA 3WJLA 3BUBA 5I8KL 5KBDA 5CKGA 2EEDA 1DN0A 1N10A 1V3KA 1X9QA 1T0NA 3OWRA 3U6XS 4Z6AT 1CVRA 1ND0B 5BZWA 1RHHB 2VDRL 1FDLH 2BNRB 3MOBH 2PPDA 1Q9OB 3OXSB 3V6ZB 1S7WA 3WFCL 2DQUL 5SX5K 1T2XA 2XHNA 4ZUSB 2YC1B 5KS9E 4ZODA 1DQJB 3QQ9C 5BVPL 2ZIDA 4Y4FB 1NCBL 2CIKA 3HS8A 1Q9WA 3OF6A 3JUZA 2ZKMX 5I1CL 4WW2A 3DMMA 3RNQB 1E0OB 1HN1A 3RGBA 3SOBH 3PXHA 2V2XA 4DP9X 1F3JB 5HDRA 1C5BH 3RVTC 5KVDH 5L6YL 4CVZA 4EF3A 1DJZA 1D5XB 3LNDA 5HVFB 1MHHB 4GKNB 3QDGB 2DI9A 2XFGB 1F1GA 2J8OA 3GXDA 3FTGB 4WVRA 2A1WH 1AE6L 2A0LC 2AKRB 2DV6A 2K78A 3CU1A 4HLZG 4P07A 2VIRB 3MCYA 4QUOA 4GG6B 2GCYB 4RMSA 5D6CB 3I6GA 4R7DA 4TXVB 2FL5A 3INOA 4X6EB 2A6IA 1ETA1 2AQQA 1O0VA 2H0PA 3OBAA 1G6RH 2WZ5A 5LGKA 1N6VA 2HT4C 3BZEB 2DQFA 2FZ3A 2O5ZL 3U7AA 3DURA 4A1RA 4J3OF 4MYPA 12E8L 3O45A 1K5NA 3KYNB 4P49A 4HEMA 3EHBC 1KFAL 1ZGLA 4AG4H 5FA4A 4C56A 2KQMA 2J6EL 5GGTL 1NGWA 1DLHB 2ED6A 3TT3H 1M9SA 1PJ9A 2JE8A 1A65A 1G9HA 5F3BB 3ORJA 3S5LA 4HS8L 4B9YA 1SUJA 3QHZH 3ME0B 2R4RL 2OYLA 4A68A 1CDGA 4NWUL 3SE8L 4I3GA 1D7DA 2BNUB 1JRHI 1OB0A 2LU4A 3MBEB 4FFVD 4GKLA 4NKMB 4X6CE 3I9GH 4HKZB 5AW0B 1MAKA 3OVUB 2IPUG 1D2OA 3DXAA 4WSGA 4Z23A 4QRRD 4WKXA 5HHVH 2JIXB 3RTQA 2VDPH 3W0WD 3QORC 1CT8B 4XI5D 1DJWA 2ICES 3JTSB 4XAKD 2EDFA 2WLLA 4PBDA 3HNVL 3LEXA 1T7VA 4YFDB 3DROA 4YQXL 4CC4A 4PJHE 1TVBA 1ILUA 2ORBH 1NCUA 3GI8L 4BCXA 2MFNA 2IBZX 4LEBA 3DBXB 1RZGA 4G8IB 4LPTA 4Y89A 3N1FC 1OSZA 3AC0A 4NRXA 3KDMA 1OT1A 3CJJA 1NEUA 2HWZL 3EGSB 3QI9B 4LCCC 2FIRT 3RPIB 5L8JB 5I73B 4Y2DA 3P4NA 5KSVA 5JIKA 1LO5B 3L9RA 5EZJA 2IBGA 4MMZA 1DCEA 3ZGIA 4HS6B 2ADJA 4NHCH 5I17A 5G55A 1XL4A 2ICWJ 1UC6A 4ZJ9A 4JJHA 5DD3H 4FYSA 3C60C 1NAMA 3MODH 3NACH 5AB0A 3ARGB 2GSIA 1EZLA 3DPBA 2FO4A 2MH4A 1EAQA 1KBWA 4M3JA 1O9VA 3ZKXB 1QSEB 4UNUA 4PRBB 4D0BA 5GRWA 1C9SA 1EO8H 1W9XA 4DKFH 1KIQB 1A02N 1MCIA 3BSGA 3SDDC 4DGVL 3ARWA 4WI7A 4CMHC 4H8PA 4XR8C 4P4RA 2WZ6A 3KLHD 2D03L 2QQLH 4MJJA 5D2NB 4M3HA 4M61B 2MRYA 1AXSA 1P6WA 3Q8BA 2A6KB 3F58L 5DZJA 3S8GB 1GTNA 3UJTL 1F6AA 2Y5EA 4XWGH 3V0VB 4N87A 1SYSB 1SRDA 4AMKL 2LU7A 1I31A 4LARH 1UWGH 3REVA 4EDXB 3BWUF 3MYZA 3FHQA 3T0ED 3LRMA 3WMPA 1MDAA 1A1MA 4JJOA 1CD9B 3HFML 3C2AL 2A4ZA 1HEJC 5AYTA 3IGLA 4ERSL 4U3SA 4JFQA 1CICA 2NY5C 5FV1L 5IBUG 4DJMA 1MZZA 2Z4QB 2I60H 4WWPA 1TFHA 4AJVA 2BP3A 3I6LE 2WKOA 4U1MB 3TZVC 3GD1C 4KDTA 1JPFB 5EBWA 2X87A 3D69B 2W94A 1AH1A 4GUPA 4NO2B 4XP1L 3V4PH 3MDJA 5E8PA 1AXTH 3K74B 4LPUA 3MV9A 1W0VA 4NZUL 4XPBH 2JNZA 1BIIB 5BJTA 2YKLH 4DH2A 5HYSB 3Q48A 2BXZA 5FFOA 3VWKD 3VXPA 4F9PA 3EYSL 5DQ9A 1A9BA 3EOAB 5ESVB 1TPXC 4EXKA 4PJ5D 5TDPB 1HXYA 4X50A 4YHKH 3QS2A 3CFTA 4YDIL 5C08D 3QC6X 2D7MA 4GO6B 1AFVL 3PAZA 1EBPA 1FZKB 1RY7B 2ZOLA 2NOYA 3ES6B 2GYSA 4L3ED 3CDZA 2XWTA 1OP3H 3K8KA 3GI9L 2YGPA 1IARB 4HIHA 1M57B 3UTOA 2AEQL 1TVHB 2ZE0A 4LAQH 1R5IA 5EOQH 3TESA 2VMDA 5J9PA 1WT5A 1ZHKA 4JRYD 2ADGB 4HOWA 2X4RB 3F62A 4WU7B 2TAAA 4JKPH 4HFWB 1AC0A 3R1GL 3NCJL 2X9XA 2Y7MA 3LKNB 3PGFH 5BUAA 4KZEH 3E9UA 4POZD 4ZMXA 2KPWA 3CQQA 2NY4C 2DMBA 3M07A 4JFFB 4YBLB 2CLRA 4F24A 5A16A 5KZCD 3PABA 2OI9C 4OZIF 5TK4A 4BQ8A 3UEQA 3I2CL 2VC2B 1NCAL 5KVGE 4QRRB 4UINH 4HT1L 4FQJH 3W0WB 1ICTA 1S3RA 5IQLA 4ZOEA 4JDEA 5IMKB 1F58H 3BXNA 3EOYG 2J55A 4YGVB 1RFDL 2OR9H 4GSDL 4O51B 5DO2C 3UTTD 3ZVVA 3THML 2IWKA 4P23A 1YECH 4D3CH 3AM8A 3D48R 5I6NA 3FQNA 3WO3B 3MRHB 1HT6A 2B8OT 4YHNA 1JNHB 3W2DL 2HPOA 1G9NL 4E5XG 3SKMB 2XIDA 2J20A 4OF0A 1EXUB 4QAWA 4F2MB 1RZPA 3BVDB 1I7UA 2R4SH 2XWCA 1R4XA 3EJPA 3O3BA 4L18A 3B1TA 5AOMA 4Y5VB 3AT0A 3FUEA 4M62H 5FK9A 3LVEA 4LP4A 4QD2E 4Q9RH 2GTWA 3LSOA 2R0KL 3QWOA 3OKMA 2GBVA 5MHSE 4EBQH 3MOAL 1DTUA 4JHAL 3O9WC 4PQXA 3MFFB 4KRPB 3QFGA 5DRZB 2XG5B 5F3HA 2ZCKL 1P5UB 1UD6A 4HWZA 3QJUB 3V5DA 3SQOL 3IE4A 3DO7A 2RFXB 2AK4A 5J6GA 2A74C 1A1OB 2VCOA 4NPJA 2VDNH 3MRCB 4Z1PA 2N56A 2X9WA 3D18B 2B0SH 1WHOA 1VZHA 2APTA 3VFPA 2FX8L 1FO0L 1GYVA 2CQVA 3SN6N 2YXVA 1BW8A 1YEEL 3LV3B 2NUTB 2V5RA 2DICA 3IMSA 3NAAL 3V6OA 3UTSA 4DTGL 5C0RL 1AS7A 4ZW5A 4Z0BL 3HS0B 3WTUA 3FQUB 4I0PD 3KPRE 3KE0A 1CK0H 2OL3A 3T0EB 1L3NA 4K3EH 3VI4E 5JNYB 1T0MA 4CC0A 5A1AA 2AANA 2WAHA 4GMSL 4MA1B 3UX9B 3ISYA 3LKRA 1FUNA 2PWDA 3B3IA 3MZGB 5T3ZH 1MAML 1NGPL 2WTPA 3FO0L 3PWLA 1T5WA 4GW1A 4K7PH 4PP1D 4KTEH 1HC1A 4OF7A 1XCQA 3MO1B 3CC5B 2P52A 1SEQL 2WUCL 2HJLA 3H3BC 4OJFL 3DJTA 1DQMH 1Z66A 4ODSL 1YY9C 5J13B 1FVDB 3M17A 4G8AC 4XVOA 4EEEA 5LNEA 1TTAA 5BRPA 3V5KA 1F0LA 4HK3N 1GVIA 4U1GB 3G9VA 2WLIB 3L9BA 2B2XH 2FB4L 2FLRT 3ZX1A 5CILH 4N3UA 3SDAA 5A2KH 3OQRA 1JHTA 1WAAA 4LCUA 3ZTCC 5I5JA 3VG0L 1HHIB 1LILA 4ONFH 4JPKH 3WJLC 4UTBH 1J1OL 3WBDA 2YPVL 4C55A 3I3BA 4M00A 4YC2B 5DC2A 4XVJL 3VQMA 1F02I 1ULVA 3ILDA 4ORGB 1BXXA 2F1EA 3MRKB 4Z77A 1JZ8A 4X5WA 3F7KA 1QQDB 4HZLB 4U1KB 2KZKA 1LP9A 4FTVA 4NDMA 4P4KD 1NCIA 5I6XB 1OP4A 3JWNC 3MV8D 2OMNA 1KN2H 1Q9LB 2DQCH 1FJ1B 4G71B 5CN1A 4DOHE 4N22A 5CLXA 2PP7A 3IK2A 4KH9A 4MDJB 4WW2C 2ADIB 3DMMC 2I26N 4JRYB 4QIRA 5B21A 5LWYL 1Q94A 1W0YT 4OF8A 4LPWA 3PPEA 1YNLL 3U7WH 4ZFFB 2UVFA 4OZIE 3BHBB 5C6PB 1U3HC 4JFED 3O8XD 4M03A 3S48A 4M1CC 3T2PA 3JWNE 1RURL 1KBPA 2DEYX 5ENWA 2H9GB 3MBWA 4K8RD 1AY1H 1UURA 5KZCB 1MRFH 4AVKA 5HGAB 3BGMB 3L3OA 1MI5D 3CBJB 4OBSA 2ILLA 2XWXA 5I23A 5C70A 2X6VA 5TFSL 4JO4H 1RZ8A 4TLKA 1XSIA 3MZTA 3WFZA 3DRTB 4M6NH 1SOKA 2GK2A 4LOVA 2GT9B 3BN9D 1Q0EA 4LCWA 2JKXA 1FG9C 2WKOF 1KTDB 4FE9A 5G4NA 3RVWC 3MJGX 3KLAB 2TSAA 3AXLB 3UTTB 4F8LA 5I0YA 4ONGH 1E8ZA 2NZ9D 4AVJA 4NLAA 1ZCRA 2LW3A 4H0GA 4X98B 5ES4B 3QBTB 4NP4H 1KTLB 3B8SA 1LEGA 2H0JA 4X4ZA 4YAQB 5IOPA 1VZIA 5HJBA 2EDWA 1LMKA 2APXA 4D9RD 2BLFA 4NN7B 3AXIA 1JVOA 1SJHB 4HEME 5KBPA 4TQEH 3QNZB 1MVFA 3N40P 3P1VA 4WTXA 1ETZA 5DK0A 2HLAA 4FQXC 2HPTA 1U8JA 2DYRB 4C56E 1CDHA 1M2OA 3PCYA 5D93C 4GO9A 4JCLA 2ERJC 2HJFA 2Q5BA 3AG4B 3QZWG 2LABA 5KWYC 1U0QA 2V2WB 3LQZA 1F4WH 2AJ3A 4AM0Q 3NN8A 3BKMH 3C60D 5IF0A 3T6WA 3WUZA 4UIMA 3BI9X 2VE6B 3TYFB 3B3BA 3RB7A 5I8KH 1OD9A 4WEMB 3T65B 4CC4C 1AGEA 3AWGA 3WFDL 1NCDH 3DXAE 1CIDA 3O3DB 4FNUA 2VRKA 4PV1C 4PVNA 4YDJA 5D5MA 2WCPA 3D9AL 3WFCH 1OAXL 2DQUH 4FMKA 4LLDB 1AHWA 4XXDA 4LOUC 2DQEH 3EH2A 3ULUC 4QTIL 4KJQD 4ATTA 4JN2B 1S7VB 4Y2DC 3T71A 5IB4B 5AOZA 4YHIB 2NX5A 2NY7L 3NSDA 1XGPA 1A6UH 1OZUA 3G9AB 4U1IA 2QZ5A 3PHQB 1AGCB 4HHAA 4I0PB 1A1NA 4LSUL 5KS9B 2Y9RT 4MMZC 4M02A 3U2SB 1RZFH 3ZKMD 4WY7H 1IRAY 1EV2E 3ERXA 3GKWH 3OAYH 5A2CA 5L6YH 3FMGL 4RZCA 1JPSL 1NFAA 3L5WA 3PRZA 4OSUH 5I1GL 2DEWX 2VO5A 3I6LD 1EHXA 3NTCH 3D0LA 4MX7B 4N25A 1BJ8A 2EKSA 4UOQA 3DJSA 3MXWL 1T22B 1YEGL 1VCAA 1FL6A 4Z7NB 3HG0A 4HSQA 2R1XA 1IBZA 4MJ5A 3MA9L 5I15L 2YXWA 4XC3H 4U2ZA 1G9MC 2VW7A 1PLGL 2O5ZH 1H3XA 1J9SA 1NDMA 4HQQH 3FUDA 4J3OD 3CZLA 3VXNB 12E8H 3G7TA 4WK2B 3VTTA 3HG4A 3QUYA 2Q0ZX 1KFAH 4HOXA 2QBWA 1TQUA 3VNZA 2BDNL 1QLRA 4Y5XC 3GSXA 1AKJA 1ZTXL 2IH1A 1JV5A 3LHPL 3X14B 4DIXA 2GUOA 5CSBA 4TOYL 2ADFH 5EU3B 4HS8H 2YARA 4JLRA 2WB1A 1MCCA 3ILEA 1UT9A 4FQPA 4OQTL 5K69A 2R4RH 2W5PA 4L9LA 5T3XE 1E9PB 4JDVB 4P4KB 2WVVB 3CVCA 5CEZL 1F1DA 1BVOA 1QHQA 3HG3A 3MV8B 5AW4B 1LK3L 4MJIA 4ZDHB 1FFQA 1VGEL 2AJVL 2COQA 3QJFB 4WK0B 1NCNA 4PGDB 3GRBA 5F7BA 3TO2A 1QSFB 2KMWA 3MRGA 2XXGA 4RRPA 5CMAA 4JS7A 4KDTC 1WFOA 4JFEB 4OLVL 3O8XB 3BFOA 4ICXA 4GRMB 5TQ2L 4BHUI 1ORQA 4UU9A 1HKFA 3GBEA 1JV2A 3LY6A 1U2HA 5D7LA 4HK0A 3HNVH 4R4BB 1I7TB 5GRYA 3FFCD 3TVMA 2OYPA 4JM2F 4FEMA 2V9UA 4ZMAT 3VQ1C 3GI8H 1JPGA 3RIAF 3WNLA 4F9PC 1YDPA 4AQ8C 1MI5B 5E5MB 3WLWC 2EIDA 4MYWB 1X6NA 2XJKA 1TEYA 4HIEB 3TXAA 3SBQA 4NENA 3QDAA 1TIUA 1MHEB 1OCOB 3MV9E 5HYQB 1NBYA 35C8L 3OJMB 3PDOA 2EEBA 3UGEA 1FHNA 1PMYA 4QHUB 2ZF8A 3VMOA 4HXBL 2WGXA 2HKHH 3TO4A 3SCMA 4UQEA 1A7RL 4DEPC 4Y5YB 3UZVA 3V6BR 5AB2A 4X4KA 4XHJC 3MCG1 2I5YH 2HLFC 5JHMA 4KTYA 1WT5C 4GG8A 5B1BB 4NO3B 1A0QL 1WAAF 4HOMA 3WIFB 4XP5L 1AGBA 3ZKSD 1A2YB 8FABB 1OT2A 1D5BB 1IE4A 2E9GA 4BFJA 1BVZA 5MHSD 2ZUTA 5EC1A 4E9YA 5F88A 1I8IB 5CD5C 2PW2A 3VMNA 1LP9F 4H0IA 4R7NB 4U1JB 3IVKB 3Q13A 4R96B 3T09A 4G42B 2ZOUA 5MI0B 3PWJA 3QQ4B 1WZMA 3F58H 3V0FA 4QDGA 2ZWZA 1TZIA 1H6TA 4AMKH 1FL5B 1BMWA 1SOQA 3FOMB 1U4FA 1U58B 3N04A 1O7DC 4X6BB 3S2CA 2EO9A 4P23C 2WQUA 5GGRA 3AM8C 5L4IA 1XGZA 3CZJA 3JWOH 2QSCH 1BVKB 3HFMH 5E08L 1VEMA 3KEDA 1GC1L 1XGYL 3TBVA 3C2AH 4KY1L 3U9PL 4BFRA 5EZIL 5E7FA 1ERNA 3KPRD 3HUJA 5GRJH 1FG2B 4HS3A 4XO3A 1O7DE 1G7QB 3P0YH 5BQDA 3H6JA 4IRSC 5HYJA 1R5VA 5I9QB 3BQUA 1V10A 2XKNB 2XLLA 1DJXA 4I18A 4FEIA 5CGYD 1D9KD 4Q6KA 4EI5A 3VFVA 4YFLF 1FFNA 3CVBA 3FQXA 4NCDA 1MJUL 4A2MA 1U36A 4NZUH 3BRFA 1W6WA 1QFWM 1VGKA 3OG6B 2DOCA 1OTSD 2H3NA 3T77A 1U91A 1WQVT 4FQIH 4KHXH 3OAUL 4LZKA 4OZHA 1ZOXA 4XNMB 4MJ6A 2NXZD 2XNAA 1JF1B 3WTWA 1XGTA 1AFVH 2PCPB 1PS3A 1XMWA 4LESA 1BBDH 3S4SB 2XWJB 3GO1L 1DQVA 4ZXBD 3GI9H 4IBYA 4TN9A 4LCVA 3UPAA 2V3EA 4PJ9A 3WY1A 2XG4A 4K7PX 2AK4E 5CNHA 5EC2A 2AEQH 2GJJA 4RSYA 3IEAA 5L4FA 4WCYH 1IAIM 4KNTA 1OQOA 3VO0A 4P5TA 4PSPA 1CG9A 3OKKA 4ZPVB 2CLZB 1UA3A 5EU6D 3R1GH 3V6OE 3OKEB 3UTSE 1EAPB 1LO4L 1CFNB 2HVJB 1UATA 3KS0H 1NIAA 2GHZA 1OE1A 5KJRL 1BZEA 4I0KA 3M1BB 2CMRL 2AITA 4IRJA 5D5MF 1OOWA 4YDVB 5D8JL 4RIRA 3I2CH 1NCAH 4EKJA 4HT1H 4I2XA 4G7QB 4XBPB 5TK2A 1J0JA 4G1MB 3RRQA 3RY5A 3KGTA 5F9AC 3FUHA 2QPEB 3OF6D 1XF2A 3P0GB 4Q6IC 2K9UA 1M7IA 2P80A 1GXEA 1J9TA 1SOSA 4YDMA 1UYWL 4JQIA 4OTXL 3FFCB 2I7SA 1IC0A 3TBSA 3BP4A 1RFDH 3F83A 4GSDH 3ALPA 5I6MA 3SDAC 3V9EA 5AZ2L 1U8HA 1IKNA 3ZPDA 3QO1B 5CS7A 2E46A 3L9YA 1E5AA 4UB0L 2VDOB 3W2DH 5DU7A 1FIGL 3RLSA 1LTXA 4G6JL 2MCAA 1X9RA 1WAAE 4UOW1 1N0LB 3U0TA 1KB5A 1UHVA 5EO9B 1S7TA 2PKDA 4H8QA 3MV11 3VXTB 2ZWKA 3PWVB 4TUJA 4D0CA 4MMYA 5IMMA 2YUWA 3P9LA 1DVFA 3G5WA 3K6DA 1BXUA 3IDJA 4JY6B 2R0KH 2DWYA 2XN9D 3DVNA 4YHML 2V3FA 4PRID 2OK0H 3EFOB 1G9EA 2XVBA 2WINA 4C56D 2FX7H 4JHAH 4MQSB 3PWUB 1E5CA 1LP9E 2QTVA 4FTVE 5CUSL 3S3SA 4OCLC 1GZPA 2IADA 4H1LA 1JGUL 2ZCKH 3RGVA 5GZOC 1TZHA 2DMGA 3KWTA 2J25A 1USQA 2YAFA 4XNXH 4S1DC 2AXJA 3K7UA 3VJ6A 3L3OC 2HMID 2ZWYA 2UZIL 3PG2A 3EO1A 3ROOA 1QG3A 2FX8H 2QR0B 3X1NA 4V2CB 5ITFA 1YEEH 1CTNA 4I5BA 5F9OH 1JZFA 1NBVL 1IKFH 1IGJA 1TJXA 3OKDB 3RTQD 2CD0A 4N2KA 3V6FB 4ZMNA 1TCRB 2NY0D 4PJ7A 4U6XB 4F33B 1KPVA 4UZSA 3G6AB 4G43B 3PJNA 1OIOA 4KXBA 3ZRFC 4JFDA 4LP8A 3HE7A 3O6FD 4A7GA 2N0KA 3QR0A 5DFVD 5HHNB 4OCYL 4LCWE 2AHIA 1YN6A 3KPRB 3SB3A 1MAMH 1NGPH 3IDUA 3BYYA 3FO0H 5GGQL 1ED3B 1L9SA 4YVNA 1IB5A 5GGUA 3GM0A 1MUJA 1AGFA 1JN6A 5DSCA 3QRGL 2WUCH 3DX6B 3HBQA 2X6BA 4J3WA 2B39A 5I1DB 1D9KB 1MFAL 4QT5B 2IV9A 2CK0L 5LLIC 1UUSA 3BCDA 2FSEB 2CR6A 2FB4H 3BDBA 2DWDA 3B83A 3UFIA 3HIZA 2F74A 3ESNA 2KZ1B 4UZUA 4TLTA 4GAGL 1CR9L 1PF3A 3VG0H 1H8NA 1URIA 3P9MA 4HUXB 1B9KA 3FB8B 1XX9C 1J1OH 2YOCA 2P8PA 3G3LA 3WS3B 1C5CL 5FS5A 5ACZA 5LXVA 4OFKA 2NXZB 2K4AA 4FD0A 5IB2A 2V7HB 1YAZA 1WD9A 2ARJA 3UTQB 5CEXB 1HYSC 3VI3A 4FFWC 5INDA 4ZXBB 1AHWC 1AVAA 5C2BL 2GTQA 2VL5A 3JT2A 3VFMB 3LNHA 3BUDA 3GMRA 4GNKB 2OX5B 2BIIA 5JIDA 4JCMA 4PLJC 1CYXA 2PABA 3NUKA 1B4JH 4L29B 4YX2H 1ECZA 5D5ME 3BUYA 2HT3D 1OPOA 2KPNA 4X7TA 5JXAL 5AALA 2C7UB 1PYWA 3D07A 1KIRB 5EU6B 3RPBA 1NGZA 4FABH 1JMXA 2OZ4L 1RURH 3WD5L 1DN0B 5I18H 2KYIA 3PXJA 4N8VA 2B1AL 5FGBA 2R69A 1OANA 2NX5E 3NPSC 1WFNA 3BAYA 4G6AC 5IV2A 4OZIB 1MW1A 1Z9OA 5HHOA 3EYOA 3HPLA 4AYSA 1J8SA 5IB5A 2A4CA 5TFSH 4C4KT 1CICD 3RKDD 3B6SA 4GQZA 3HUJF 4XMXA 2W80C 4EI0A 3ZTEA 2Q6WA 4FLOA 4UYQA 4XZUA 2WSKA 2WNXA 2DM3A 4OCSL 2CUAA 2CKBL 3HI1A 3U30C 4ENED 5L9DL 3FCSA 4P2RB 4D2NA 3QEQD 4PRDA 4OD2A 5SV4A 3QIUA 4FQHB 3QUYC 2Q7NA 1P7HL 3I85A 4HEPA 5B1KA 4YWGH 3DDGA 3FW6A 5IBLD 5DTFB 5FYKH 4JM0A 2J1YA 1DQKA 3MGOA 1JUFB 2A6IB 4LFHG 2IBBA 1XXDC 4L9LC 4OZHF 3VRIA 3WN6A 1TT6A 1NCGA 2BSDA 5KSAA 2VXQA 1ZV5A 2EDXA 3W81A 4AITA 4LVOB 5I1IH 2BCKA 1B90A 4LKXA 4YSCA 4G6FD 3RWGB 3QR1A 1K5NB 3QWRD 3PJLA 1E50A 2XN9B 3DX7A 2VAAB 3ULUL 1KEGH 1JFHA 1YMHA 4PRIB 1J11A 4YSRA 4ZO8A 5LAPA 4C56B 3IXAA 3IS0X 1B2YA 5FO8B 1F6FB 2NQDA 2KT6A 3CPLB 5AUMA 1JFQL 3BD4A 2BMKA 2IDCA 4NRYA 4PBVC 4MJIE 5HHXL 5TQ0L 3WXWL 4NZJA 5LUMA 1CD0A 2OSWA 1JGVL 1ZEAL 3RIFF 1EVTC 2X89D 5CBEA 1ZANL 4PJEB 3D9AH 5F93C 3UG4A 2YFNA 3KYMB 4HIIA 4XBGB 5D7LE 3UO1L 5FA3B 3KPLA 2UXGA 1T1WB 3OB0K 4TVPL 1TYJA 3RTQB 1JZHA 5HSFA 1OSYA 2NY7H 3QP3A 2NY0B 2EDNA 4R4NC 3OL2A 1NLDL 4UDTA 1AI1H 2NUPA 3OPZH 4NBXB 3SCMC 2K7QA 4DP6X 1IC5H 3LEXB 3S3PA 1U41A 2KKQA 4KX8A 1ZIAA 5C0IB 3O6FB 3OKNB 4QI3A 4LHJB 4F3FA 2UZXB 3FMGH 3D0AA 4YS4A 4OIBA 4KKRA 3EFDL 5I1GH 2UX7A 4GXUN 3HCVB 1B4RA 1YQ2A 1NCWL 4QHPA 5I24A 2I07A 1I7ZA 1AIZA 4N8VG 4A2LA 1E8WA 4PJBA 4TQHA 2NTFA 4UM8B 6CGTA 3MA9H 5I15H 3O0RH 1NCCL 3D5OF 1DJYA 5EZJB 1PLGH 5SWZD 3AT8A 5B1JA 2ADJB 5BQ7B 5B3JF 5J5EA 1ITCA 3NCXA 3FCTA 1YNTA 2TSBA 1J88A 5EZOH 3ZW3A 5E56A 1A6ZA 3DPBB 1JIBA 2IAAC 3LHPH 1KGCE 4Z7VA 1C08A 3VFWB 4X6FB 1ET5A 4XX1G 4RCAA 4OQTH 3B5TA 4HEPG 4U4IA 1EJ6A 4IRZL 4MQ7B 1ML0A 1TJIL 4KRPC 5DRNB 3U46A 2M8XA 3RZWA 2FYVA 4JGNA 3Q6FA 1FNHA 4Y1AD 5T1DH 5JHBA 1VGEH 2AJVH 2WJ7A 1T5XA 1CXFA 3JV5A 2Y6SD 2ZP0T 1B88A 3BGFC 5DI8A 1AXSB 3UTSD 4RAVA 3P4OA 1ZSHA 3BQUC 3L1FA 1F6AB 5E6ID 1JNJA 4MZ2A 3IMTA 4I18C 1KJ2B 1J0KA 5TQ2H 4E5XB 4EI5C 3REVB 4PJ7F 1UCBL 1U92B 3HUJE 4JM2D 3QAZB 3C12A 4LVNB 3GDCA 5E70A 2WLKA 1JWUB 4NNPL 4CBPA 3EXLA 5HYJE 3BIAX 2XKSA 3CDCA 2X1XR 4TNEA 4RNRB 3H53A 1CICB 5DF0A 3M1OA 3T4AC 3K6FA 3UZQA 2D31A 4XMUA 4MAUL 4YNYA 3WSQH 35C8H 3QEQB 3N1GC 2YEVB 2ZJSL 3JT0A 3H0TB 1A7RH 3QZPA 3QUZA 1P4UA 4OZHE 2XKUA 3NFSH 2JFCA 1MCBA 4ZAKD 5GPRA 1ZVYA 2JXMB 4HISA 4MWFA 4AL8C 2LOEA 1QBMH 1BIHA 2J8UA 4YVUA 1IBHA 4L8BA 1HH9A 1JXDA 1IT9H 3IJSB 4AC2A 3SYCA 1AP2A 1G5GA 2B77A 3IGAB 4XOCA 4ODVL 1KJMB 2ESVA 3CLEL 4IRJC 4MHHG 4F8OA 4G6FB 2XWTB 3WENA 1RJLB 2JB6A 3NSJA 4FTVD 4ES9A 3MLVL 5JR1H 4ZO7A 3GSQB 4UUJA 1NIBA 1R5IB 1A7QH 1HEZB 1UM4L 4OGAD 3RE0A 2P49B 2ID5A 1MOEA 3CFUA 1OGSA 3PHAA 1L7TL 3QFJA 3WE6B 3TIDB 2GIYA 4I2XE 5ESQB 2AQ2A 2XTLA 3KPQA 4L1HA 1IKNC 2P42B 5JHDA 2W9LA 1ZS8A 4HP5A 4YHPB 4HJEA 1GC1H 1XGYH 3U9PH 4KY1H 4FXLA 2F1AA 2P7TB 5FX3A 1M56B 2F53B 2XY2A 4ZOCA 4UT9A 1HHKA 3NJMA 3KPMA 1UZ8A 4JRXD 4AV5A 2HG0A 5IHZB 2VAJA 4NXSA 1PEZA 2H6OA 2YWZA 4ZFQA 3RJOA 4LRIA 4XCFL 1ZLWK 1EK3A 5CJQL 1DUYA 3C8KA 2IOOA 4KXAA 4U4BA 4PB9L 4NQVA 1NL0L 3NGBC 1DVFC 4KQ4L 1AO7A 4DEUA 1MJUH 4LL1A 4Q52A 1B4LA 4NRZA 3K6IA 1L6PA 5DK2A 2AQTA 2IOMA 2CDEB 2P4AB 2NY6C 5TD4A 1CU4L 2ZCLH 3RGVC 1MG3C 3OAUH 1BZ9B 3GLDA 5C86A 4MAYA 1KJ3H 5IUCA 1U2CA 3C2SA 5I0XA 4HJ0D 2LTQC 5E8OB 4LHQB 4HJGA 4KQ0A 3ECUA 5C0CD 4HXAH 3KJ4B 2IWFA 2VDQL 5SWZB 3E2HC 1E4WL 4KK9D 1L9TA 1I3GL 4QAMB 1UJTA 1JERA 2HRPL 1RMFH 2XC8A 1V7MH 3LKSB 3NIGF 4G8GB 1BLNB 2CBMA 4N2EA 4PGEB 1MFNA 2GEEA 2X4UA 5I74B 1EJFA 1WV7T 4HWZB 4DHLA 3HE7C 4XAWL 3DO7B 2XVGA 4CUCA 5LVEA 3EOTL 3WTSA 3EFFA 3HMXA 5KJRH 1UXMA 2L04A 2BIHA 1NFDA 3D25A 2EDRA 2CDGA 4PJ7E 4Y1AB 4M6ML 2XRAH 1GCFA 4G9DA 4QJ4B 1HEHC 2CAKA 5JDSB 5FKPA 2X4SA 4JFDE 4J2QA 3R8QA 3L1GA 3HZMB 3NIFF 1XF5B 2WMPB 5D9SA 5E6IB 2R0WL 4JZJA 3NQKA 4GEJA 1UYWH 5IREA 3SY6A 4JM2B 3BFQG 1T0MB 4M6OL 1YRKA 5IVXF 2OMBA 3AG2B 4ANKA 4N28A 5AZ2H 1CPUA 2AFNA 2BP8B 5D96C 4UB0H 3HE6C 4RLDA 4ZI8A 1KWKA 1KXTA 4G8EA 3IN2A 2V7NB 5TE6H 1RLBA 3QZWB 1FIGH 1XEUA 1AIFB 1T5WB 2FEJA 4GW1B 5D7IA 3BAKA 2WUBL 5CD3B 1BYNA 4H4NA 4YXHL 4PJBF 2Y24A 1BVLA 1JMZA 3N42F 4N20A 4OBRA 4KK5D 4XRCA 3ARTA 3M7OA 4QTHA 5G5DB 4BIKA 4MD4B 3S96A 2OW6A 4ZAKB 3U48A 3IETA 2Y7QA 1NUNB 4LRNH 3D51A 1DQIA 3QZNA 1BFVL 3MFGB 1YNTF 4CSSA 5EEZA 2BXYA 2VLRB 3VI3E 3JUYA 1UB6A 2BSTA 5CUSH 1YEFL 1CLCA 1WG3A 4YHOL 3MKGA 3WNPA 1VESA 2EYTB 4A63A 4DERA 4S0TD 3KLQA 4Z7VF 4ZTPH 4Y4KA 4GRWF 5KTEL 3S3JA 3FS9A 5JTWA 3DSNB 4X5WB 5T5FH 3HJ0A 1PKQB 1JAEA 2NR6D 1QATA 2QQKL 2RA1A 4RZKA 1INQA 2R29L 4GXFA 5DJ2B 4WGKA 1ONQB 3LAFA 3FONA 2XWBA 3QCTL 3EKCA 4QXWA 4YDLB 2CR0A 1NBVH 3GC3A 2MIZA 3NABH 3ULVC 2O6DA 2ZXAA 1YNKL 1BZQK 2A9CA 5HHOE 1E8XA 3QIUC 4Z7UF 1A9VA 5ENWB 3TVMD 4BXSV 2E75C 1TJHL 4BZYA 1OE3A 3BUIA 4JB9H 1AZNA 15C8H 5DQJB 3ULVE 2BW4A 2OMWA 4B9FA 2YBGA 3LS5L 3BJ91 3BKYL 1WIPA 2EE9A 3QDMA 4JRXB 5FHAL 1M1XB 2HB0A 4XX1E 3WKNA 1T6WA 4GW5B 4Y7MA 4CJ0A 2OCFD 1BG1A 3FFDA 3W9EA 2HT2D 3NJHA 2QSVA 3O3AA 3GGWB 3IF1A 4LLMA 4A2HA 4JVUA 2HG5A 3QJSB 1MFAH 3EUUA 3WHXB 3K46A 3TO4D 1HILA 4L5FL 1RZKH 1RCYA 1RZIA 3NPZB 1BFSA 4GW4B 4H8WC 5HI5C 3KM1A 3S3DB 5IB3A 1LEGB 2BOBB 5CSGA 2WANA 4C4KO 4TV3A 4NUMA 3RDJA 3DECA 2BERA 5CP3H 4BZ2A 4M29A 3NP3A 1QO3B 3IJ7A 2J8UF 4QHMA 3VD2A 4XPFL 3VFTB 2JCWA 3NIGE 5JW3L 5JQIB 2HLAB 5C0CB 4AJ0A 3OG4B 5AKVA 3BQVA 4XX5A 5F7MC 2M1KA 1YEKL 3DUUA 4JHVA 2BHZA 5C2BH 5IKCB 2Z92A 3VXUA 4D0DA 1KGCD 4DAGL 3MKKA 3HKZA 1IIIA 3H1ZA 4UAOB 5FYLL 4RFEB 3LQZB 2EC8A 4BKLB 2AJ3B 3QJTB 1C7SA 3WUWG 2IWEA 1DDHA 2ROXA 3EH1A 4XO9A 1XZ0B 5JXAH 4ZUWA 1PX8A 3MLRH 4UV7L 4FQQB 3AXHA 4U1SA 4F37K 2OZ4H 3WD5H 3F12A 3U6RA 3NIFE 2O5YL 3LQAL 2B1AH 2OSLB 1G7JB 2UZYA 5J6HB 5IMOA 2KZBA 1ORSB 1QHOA 1DJHA 3GJFA 2WM0A 1YCSA 1S7SA 3TT1L 3H3PL 2CXKA 1H0DA 3QUKB 4W9JC 1T1YB 5I30H 4BFGA 4YSPA 4HUWB 4V1DA 4HHAB 1ACCA 1JHLL 3L95B 2ZF9A 4J8RA 5B1JC 2X6UA 2XOTA 4AYID 5ELIA 2MNUA 4PSRA 4EOWL 4KKLC 1NM9A 2WXIA 4RZCB 1WBYA 3WFHA 3L7EA 3BPNB 3CHQA 2FGWH 4PJBE 2EINB 4OZ4A 3SDXF 1ZSDA 3D0LB 1IGMH 4Q2ZA 4RGMC 2EKSB 4LQ1A 1H15A 1H3GA 1T66C 3GMLB 5F1NA 1TTUA 4DGIH 4M93B 1HX0A 4