3PAVA

The reduced form of cueo
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
487
structure length
466
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The reduced form of CueO
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 135
structure length 466
sequence length 487
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA03
4YVNA 2R7EA 2PLTA 3UADA 2IWFA 1SF5A 1BQ5A 1WS8A 3OMNB 1IBYA 1M57B 3WNIA 1TEGA 1J9SA 3S8GB 1ZIBA 5I5MA 2XLLA 1JXFA 1KCWA 2CJ3A 2VMJA 3FSAA 4HAKA 1AG0A 1AOZA 1URIA 3TBCA 4BXSV 1F56A 3EH4B 4YSEA 2GC4C 2BP8B 2PPDA 1PY0A 1RZPA 2XXFA 2Y69B 3N55A 4E9YA 2CCWA 4BK5C 1BXUA 2IH9A 1TU2A 3QQXA 1AANA 1RKRA 1ZV2A 5D4IA 4A2GA 4DP1X 2BO0A 1M9WA 5I6KA 2YAFA 1AZRA 2HXAA 1E65A 2FTAA 1GY2A 2Q9OA 4G72B 2FT6A 2PP9A 2I7OA 2RACA 4A66A 2Q5BA 2BP8A 1OOWA 4EF3A 2W88A 1NTDA 4DP2X 3CG8A 4WTQA 2YAEA 5I28A 5B1JC 4BDVB 2AVFA 3ZX1A 1N70A 1MG3C 1E5ZA 1PCSA 1MZZA 2BW5A 3PAVA 3T6WA 2IWKA 2GB2A 3BQVA 2UXVA 2IDFA 1NWOA 3SBQA 2VSMB 1AQ8A 3NJNA 3UAAA 2DYSB 2R7EB 4GYBA 4DP9X 3FU7B 1BAWA 2H47C 4P5SA 2P80A 2PPCA 3TBBA 4KNTA 4NERA 3UACA 1IKOP 3ERXA 3IN2A 4JHVA 4QLWA 1AAJA 5LDUA 1AZUA 2GI0A 3NP3A 4NB7A 2A3TA 2HRHA 5TK4A 1L9RA 9PCYA 1ADWA 1YLBB 3ABGA 1PMYA 1QHQA 3CVCA 4PAZA 5PAZA 2E86A 5B7MA 2XUWA 3D12B 1SHWA 1QNIA 2XYBA 4CSZA 2FQEA 3ASOB 5B1JA 1OE1A 2DWTA 3NJMA 3PAZA 2FT8A 3FPXA 5A7EA 2XV3A 3TA4D 2BW4A 4BDVA 1NPNA 5FC9A 3AZUA 1DYZA 4W9ZA 4YSQA 4JHUA 4TXVB 2QDVA 2EIKB 1E67A 3BVDB 7PAZA 2I85A 4YSSA 3X1FA 2PPAA 4A2DA 2BP0B 4DPBX 4GP4B 1ZPUA 5B1KA 3FQ1A 2GHZA 3H56A 3OD3A 4YSTA 1NIDA 2IDUA 3ABLB 3SBRA 1E30A 1HFUA 4W1TA 2TSAA 2NRDA 3G5WA 3ZIYA 1ET7A 1NPJA 2DWSA 2YAHA 3IE9A 3N2JA 1A8ZA 5E9NA 2HRGA 2VM3A 3KW8A 2ZWNA 1IUZA 4RH4A 1SDDA 3H4HA 4A67A 1TEFA 2TSBA 3X1EA 3PCYA 4YSDA 1GR7A 3X2QB 2QPDB 2YAMA 1I53A 5IY5B 1ZDQA 5AZUA 4UAHA 2QT6A 1KBWA 4ENZA 2PP8A 4G7SB 4GP5B 4DPCX 3V9EA 2J56A 3AY2A 2OJ1A 1AIZA 2GC7C 1JZHA 5AKRA 3WIAA 4GXFA 4FA7B 1OF0A 4F2FA 4A68A 4HALA 1L9PA 3EHBB 4AKQA 4YSOA 3NJGA 3FT0A 1QLEB 1AS7A 1BEXA 4HZ1A 2H5UA 3RYMA 4K9JA 3SBPA 2XU9A 4UF7C 3TU6A 2H3XC 3NP4A 3CVDA 2AANA 2CAKA 2BP0A 2IDQA 4YSAA 3OQRA 3NJJA 2CALA 1BQRA 1PNCA 2P80D 2XX0A 3NSFA 4G71B 3QJVB 2QDWA 1SJMA 1KDIA 1SHXA 4P5RA 1UATA 3JTBA 2FWLB 3OMAB 2UXFA 4FAAB 4A2FA 2B3IA 2J57A 2PPEA 1BYPA 1E5YA 2IAAC 3IN0A 1BQKA 2B08A 2UX7A 2AZUA 4N4YB 1PAZA 8PAZA 3X1BA 2WO3B 3UAEA 1A65A 4DP4X 4BWWA 2JXMA 3T6ZA 1JZGA 2VW6A 4BWTA 3NJHA 1MDAA 3CZUB 4E9QA 5I6NA 1ID2A 2N0MA 3QJQB 3FYEB 1KBVA 1NZRA 2FJSA 2VW7A 3CDZB 3QJTB 1JVLA 2XWZA 4AI7A 2VN3A 3IEAA 3FSZA 1XB6A 1SNRA 1A4CA 1ETJA 4HCGA 4QKTA 1JERA 1JZJA 3HB3B 3PPSA 1ILSA 1AZCA 1R1CA 2MTAA 4AX3A 1PZCA 1M56B 3X1GA 1BXAA 4GY4A 1IBZA 1NIAA 4L0PB 1J9TA 5ANHA 2PPFA 3WKPA 4M3HA 1A3ZA 1AS8A 3IBOA 3L45A 6PAZA 1W6WA 2HX8A 1PZAA 3GYRA 5F7AA 4G7QB 1GSKA 3WI9A 1CUOA 3EH3B 1AACA 4YSPA 3NJFA 1WA0X 2GIMA 3FU8A 4G7RB 1AZNA 3SQRA 1AG6A 1JXDA 5I6PA 2IDSA 1ET8A 2VM4A 3QJRB 1X9RA 5D4JA 1J5CA 2YAPA 1BYOA 1GS8A 2YARA 4HCIA 1GW0A 1SFDA 3NJLA 3PAUA 1EHKB 2FQFA 2XX1A 2OCCB 2BWIA 3DKHA 3KW7A 3TASA 1GY1A 1HAWA 5I6OA 3HEIB 2BZCA 1ZIAA 1CURA 2XVBA 3FSVA 3NYKA 3NSDA 1GYCA 4KO9A 1WA2X 2PCYA 1ASPA 3U25A 3CDZA 1NIEA 4YVUA 3S3CB 1TKWA 2HX7A 2UXGA 1MZYA 2AFNA 3EF4A 3H4FA 1OE3A 3ABKB 5AFAA 2IDTA 1CC3A 3C75A 1DZ0A 4HIPA 4KO6A 1XB8A 1T5KA 4M4RB 5TK2A 1WA1X 3OM3B 4E9TA 2UX6A 4DP6X 4KO7A 4MFHA 1JZFA 1FA4A 1W8EA 3V9CA 2VW4A 1W6LA 1OV8A 4E9VA 1PZBA 1VLXA 1L9SA 1ASQA 4CSPA 4UANA 1AZBA 4YSCA 2AZAA 4AKPA 2GSMB 4Q89A 2HZHA 4AKOA 2JKWA 2EINB 1JZIA 1V54B 4HHGA 1PNDA 3EH5B 3MBWB 1OCCB 7PCYA 1BXVA 2FQDA 2WSDA 1FWXA 2IH8A 3QPKA 4DP0X 5I5JA 1A4AA 2Y1AA 4F7KA 3ABMB 1SFHA 4X4KA 1NIFA 2XV0A 1L9TA 2YXVA 4A2EA 1AR1B 4YSUA 2PP7A 5B1AB 1NICA 4BWUA 2YQBA 2BZ7A 4HCFA 3FQYA 2VSKB 5I6LA 2IWEA 2ZONA 1XMEB 3NT0A 3T71A 3NSYA 3PXLA 1AS6A 1RZQA 2X87A 1NWPA 1A4BA 2EIMB 4E9RA 2PCFA 1V10A 1MG2C 4G70B 3T6VA 4E9WA 5I6MA 3MX0B 2X88A 1OE2A 2BHFA 4A2HA 4ZK8A 1CYWA 1PLAA 1PLBA 4KNUA 1OCOB 3FYIB 3AG4B 1OCRB 3GDCA 2I7SA 1ILUA 2LLNA 1V55B 3ASNB 1SDDB 3JT2A 2YAOA 3NJIA 3S3BB 2MRYA 2HX9A 1XB3A 3AG2B 2EIJB 3S3DB 5D4HA 5B1BB 4F2EA 3FU7A 3FU9A 2CBPA 1L9QA 1WS7A 2OV0A 4KOCA 5B7FA 3T6XA 1NINA 1NIBA 1JZEA 1HAUA 2J5WA 2CUAA 2YXWA 1PLCA 5F7BA 3PLYA 2WO2B 4DP5X 4BXVA 3ZBMA 4YSRA 1GS6X 5B7EA 3X1NA 1J5DA 1WAEA 2QPEB 1X9UA 2UXTA 3WKQA 4DP8X 4WKXA 4AZUA 1PF3A 1KGYE 4HHWA 2FNWA 1KDJA 2ZOOA 3DIVA 3FSWA 5PCYA 1L9OA 1NDTA 2DY2A 4N8UA 3WNJA 4DP7X 3CVBA 3FPYA 3FQ2A 4JKNA 5EHFA 3ZDWA 3AW5A 3DTUB 4NAJA 4KNSA 1SF3A 1JXGA 1KYAA 4GP8B 3NSCA 5B3SB 2J55A 1GS7A 2BWDA 1KV7A 3QJUB 4KOBA 1RCYA 2EILB 1JOIA 3OMIB 4KO5A 2W8CA 3UABA 5I5IA 5I26A 1ET5A 2HLEB 1KCBA 4Q8BA 4E9SA 3FS9A 1J9QA 3GXUB 1OCZB 2DV6A 2XXGA 3WG7B 4YL4A 3T9WA 1IC0A 3AG3B 1FFTB 1ASOA 3UGEA 4DPAX 3S8FB 2YAQA 3QJSB 6PCYA 1J9RA 1CYXA 2DYRB 1JVOA 2FQGA 1B3IA 2FT7A 2JFCA 2XV2A 2ZXWB 1EZLA 4PCYA 3NJKA 3AG1B 2GBAA 1ZDSA 4E9XA 1N68A
chains in the Genus database with same CATH superfamily
3CSYA 4MQXD 4H2AA 5K39A 4TLKA 2D3LA 3B34A 3D3VB 3BE1L 3FHEA 1FCGA 3WFEH 3BD4A 3ZZQA 3GLEA 1NMAH 2VL5B 4Y5XA 1ZTMA 3S8GB 3ARBA 4GUQA 4C4BA 2P28B 3QA3A 4XB7A 1IFHL 5T1LB 3CHRA 2E9JA 3ZE1B 1QSVA 1DANT 1IAIL 3DDFA 4G6AD 1Q1JL 3LSOA 4JDEB 4JRYA 4KX9A 5CD5C 3VXSA 3TPUA 1QPKA 3MRPB 2VR6A 1IZJA 2Y4SA 1OAKH 3OQ3B 5TH2B 4X4YB 4MB3A 3DX9A 1I8KB 2FZ3B 3K0YA 4K71C 5DFTA 3MRMA 3U9WA 5IMLA 3K4ZA 4JFZH 2D7MA 3BPCA 4GRMB 3FQWA 5BS0B 4TM9A 4YHIA 5EBMB 2DN7A 3LZQA 4YLBA 2CO4A 1FGVL 3NFSH 5I0YA 4WTXA 1R3HB 4AIEA 4JW3A 4KZDH 4WGKA 4ZAKD 1SLVA 3R06B 2WNWA 4NC2B 2RD0A 3QWRD 4O2EB 2OJZH 3WIHL 1NBVH 2BINA 2OR9H 3D09A 3IETA 4M62H 4WEMB 1I1AB 1UZ6E 2BP8A 4A66A 5KEZA 5L4FA 2G9HB 2W88A 1S9VB 3APDA 1IEBB 1LP9E 2AJZB 1INEL 2QHLA 4N2AA 3EYQC 4CU6A 3K4AA 4IOSA 2QEJA 2X0WA 5BMFH 3ZX1A 4YHIB 5EBMA 4BKTC 1F90H 3I2CH 4R26L 3E6FA 1YY9C 2E7BA 4Z7OF 3L2MA 1A64A 3TO4A 5IVXA 1XGTB 5C0FB 4N8VB 1GHFL 1UOLA 2X6BA 3NCYS 3SBQA 4FADA 3HAEB 1XWVA 4EOWH 2NY6B 3NJNA 1CTMA 4DIXA 5FUOL 4ZS6D 3F58L 4R4ND 2XTJB 4PJEF 2X4QA 4C83B 2AXGA 1QSFB 4NO0B 1KCRL 4O2CB 1S78D 1QZNA 4PD4J 4I18A 3U46B 2RTTA 5DEFA 1RHHA 2NW2A 4JZOA 1E3FA 5C08D 5JPMC 1KTDB 4Q52A 2V5RA 1FQ9C 1P5VB 2F8XC 3WIHH 5ID1A 2P7TA 1NSNH 1XR9A 4DH2A 4PJIF 3L3GA 4PRIB 1MFMA 1EGJH 3RTQB 3VFNA 3X17A 1BIHA 3SHSA 2WMPB 4KKCC 1KJVA 1NOFA 3QR1A 4DEWA 3D12B 1A4KA 5IFHH 4AXWA 2E7CA 3MFFA 4Z7UF 3WN5A 2JKSA 3BPNC 3DV6A 4FXGB 4PJ7E 3ASOB 3MGTA 1OE1A 1WC7A 4IKKA 2E0PA 4BQ9A 1E42A 3X13A 4X5LA 5I16A 1CXFA 1KIRA 4NJAL 3OZKA 4AIOA 3L7EB 1NAKL 4NUQA 4XMLL 4KWUA 4YFDB 3PP4H 2VERN 4JHUA 1EEYA 2UWEE 3C8KA 1OK8A 2AEIT 5HD8D 1CYGA 3KPOB 4YSSA 2K7PA 1J1XH 2JH2A 5SWZA 3ZZLA 1UXWA 1SRDA 1SJHA 3MLRL 5FWQA 3UROR 3IFNL 3P4NB 5IFJB 1NCAL 5HDLA 3ARPA 5B1KA 3VQMA 2GQHA 3SDDD 1OAXH 1JCKA 4I3SH 4ZW6A 2BFVL 1EV2E 4J3OG 4FNLL 2QQNH 3RWIB 4F2ME 5EO0A 3ZIYA 4OZHE 1D9KD 1X5GA 3OJVC 5CINH 5EB9A 5AVUB 3RPIB 3X12A 4AV4A 4L1DA 2FIRT 2K9FB 3EGXB 1F90L 2WPGA 1MCFA 2E8ZA 2MHAB 1IUZA 1CIDA 1DTUA 1JYXA 4P07A 3SJVA 4YSDA 1Q72L 1IEAA 3FUEA 4NQXA 4RGNC 2WQWA 3E7JA 5D1QA 5HHOD 3ARBC 1ETZA 1UXSB 1PYWA 1BJMA 5FFOA 1JZDC 4WHYG 2EKSA 1OGAD 1WHPA 5TDOB 3GWJA 2DLIA 2ZXGA 2BCKB 5KJ4A 1AIZA 1L0XA 3TM6A 3MA7B 4HD5A 4IEFA 3B56A 4NM8H 2WP3T 3T3PF 1K4DB 4MCYA 5CF3A 3P0VL 4JO2H 3KYOB 4XCCH 2L3BA 4U1IB 3ZDXE 4GRLD 2H5UA 1EMTL 2QPUA 2O61A 1C16B 1BD2D 1V7ML 2P8PA 5IQ9B 4UTBL 3W0WD 2X10A 5IFHL 1DVQA 4LKCA 3OGCA 2ZOLA 3RX7A 3KEHA 2WQUA 2XKNB 4TSCL 1IC4L 1KDIA 2X3BA 2H9GB 5I9QC 2UXFA 4FAAB 2IANB 2X70A 4G59C 4M3KB 4X9YA 3BDYH 4XNQA 3Q1SL 3MLYL 3FCTA 1XT5A 5EDXA 1P7BA 5ADPL 3B83A 5FO8B 1RULH 3WFHA 4UAOB 3QHTC 3RVXC 4BFIB 2ADGA 3TIDB 4Z7NF 4FXTA 2ARJQ 2JKJA 5EORL 3OPZL 2Z93A 4UDUB 5GGTL 3T2LA 3LKNA 5HDRA 2K4WA 4FD0A 3IE4A 4A7TA 5I8KL 2DLGA 5J13B 2D9QB 1CIUA 1DL7L 1NCOA 4NOFA 3RIKA 2VW7A 3FUNA 3UZEC 3O3EB 2NXYD 1JVLA 1DQLL 1MCPL 3HVDA 4OF5A 5E7BA 2A77L 4QHLB 1TETL 4G8IB 4WK2B 5JPNA 4HCGA 2V7NB 2DQ6A 3T4AC 4XWGH 2ZWZA 4NHUB 5GGTA 1RUML 2CDGA 1F4XL 3CSTA 3GMMA 4YO0B 3B5GA 4X0KA 5E08L 2PTVA 3RKPA 1A9VA 4R83A 5EUOB 3GRWL 2XFXA 3HMXL 1P6WA 1A6PA 5E6IC 2HH0L 2BVEA 2W0PA 3VX1A 4XAKD 3H7LA 1CUOA 4OCRH 4WHTA 2BIHA 3EFOA 4MJIB 5DHEA 4FQ2L 1G9NH 2EDTA 2IPTH 2YRPA 4U49A 4EIBA 3UJTH 4RGNE 3BCDA 1AQMA 5CZVH 3FT4A 3JWDH 4IRJD 2MTPA 5D1QD 5J6HB 4Z7QB 1YEEH 2QFPA 3ZHFA 3GRWA 2D0GA 3PIQB 4JFYA 1FIEA 4JG1L 3VTMA 4GSUA 1L6ZA 5AZ2H 1EMTH 4NNXB 5LBSA 2W59A 4F1ZA 1ASPA 4MAYA 3C5JB 2UY6B 4K3GA 5IROA 4EEEA 4LASH 4KQ4H 2VZTA 1M7UA 3VXMB 2K4AA 1OP5K 3ZSTA 4RIRA 2X42A 5CBEA 1QBML 1VEPA 1YUHB 2D9CA 1BF8A 1EUTA 2DI8A 3MDJA 2YA2A 3BPOB 3CZFB 5ETUB 4GI8A 3ZKMD 1A6AA 4XP1L 5F9OH 2BDNH 2R8SL 3Q06A 5GGUA 3U30B 2OCJA 3FBQA 4XP4L 3FB5A 5SWZD 3BH8A 2CO2A 3L3OA 4KO7A 3HE6C 4PS4L 2Q1EA 2WYHA 2WLIA 1C8PA 3GB7A 3KYOA 4LDLB 1R9FA 4MA7L 2WNGA 3WFDH 5KVMC 5LJYH 2N3JA 2C9RA 4MNHA 4Y88A 1OV8A 4OJEH 3ZKXC 4NQCB 1KCUL 5KANG 1KMGA 3QW9A 4FQIH 3EYVB 5JQ6H 1LE9B 4NO5A 1QTSA 2AK4D 1KLUB 4TMPA 4YDLB 4QRSA 4EN2A 3NIDE 2KLSA 1SHSA 4A1RA 2Y7OA 3SE3A 2X70B 1R4XA 2BRQA 4FZ8H 4NUGH 5T33H 3N9GL 1E2WA 2O6CA 5ILTL 3HJ0A 3QZWG 2G75B 3ZKSD 3V4VA 5L9DL 3TT3H 4JKPL 5JPMA 1XH0A 1LEIB 3GS0A 4PJ5E 3RKDC 3UO1H 4NRZB 4YHOL 1FFPA 2VDQL 1TQVA 4LKXA 4PV9B 1DN0B 4X80H 3MNZA 4ZUVA 4YXHL 1JZ5A 2ZONA 3JV4B 4HJJH 2LU5A 1AS6A 1XQ4A 2H6UA 3CK0H 3IXAA 4KPHH 2VXTH 2EIMB 3L54A 5MP6L 1XCTA 3TYGL 4Y2LA 3GLDA 4AGOA 2YN5A 3T6VA 1A47A 2NUTB 5I6MA 1ZGLB 4GQ9L 3U7YH 1MCDA 2JSFA 2X44D 3AY4C 2YUZA 2H8PB 3HC2A 1FAKT 1AQKH 2YWYA 4HSQA 4NN6B 4H8VA 2BS71 4YVUA 5JUEH 3ASNB 4FNTA 3SDYH 1ED3B 2HUHA 1K2DA 3JT0A 3SSGA 4F7MA 1RQ5A 2VC2H 4JRYE 2BDNL 4I9XA 2ITDB 3Q7JA 1IJNA 1HHKA 3QZOA 4YHPA 5C0RH 2P8MB 2BSSB 3LNEA 3GXTA 4JFWA 4UOW1 1SBSL 2DQCH 4NYLA 4MNHB 3ULVL 3QO0A 4LHUD 3QR2A 2QJDA 1FSKB 3N41F 3PJSA 3N50A 5B7FA 4GW5B 1JZEA 3GSNH 2FO8A 1Z9NA 2AEPL 4OCNC 4PJGA 1XGQB 1AOHA 1MVUA 5CEZH 1SPDA 5MI0C 3KGSA 1V3JA 2DQFA 1CD8A 2GABA 4N1EA 1UOWA 4OGAD 4I0PD 5EEVA 2E4TA 5HPMA 3VXNB 4XMPL 4ODUB 4PWHA 3JYCA 4AJVA 1W91A 2SEBB 4JL2A 3UTTE 1IGYA 4O4YL 5IQ7H 1JXGA 4HPHA 4WWOA 4LLYA 3NSCA 1IFRA 4XGZB 3EJRA 2HKAA 4QAMB 2X4NA 2E47A 3C6SA 1IEBA 3NQKA 4KO5A 3RVTC 2IBZY 4JFOB 5LN4A 3EOBB 2DV6A 2XXGA 4N2LA 1JPEA 2Y36L 4UV7H 2CIIA 3E6FB 4HJSA 3FOMB 1WBYB 3QJSB 5EOQL 4KZCA 1CZ8L 4I0CC 2NCEA 2XFXB 5DYOB 1OT4A 4QO1A 4G43A 1TG8A 3ARFA 5D1ZD 3DPBB 3LH2L 3X12B 3BPCB 2X4SB 2IANE 2H3NA 4XPFH 2QKSA 2R7EA 4PJCF 5KUKA 3NJVA 2H1PL 4JZNB 4B5EA 4YBLC 1DJZA 2HJKB 2PYEA 3UTTA 4RDQG 1PVHA 2VDML 3GJFA 5SX4I 1CFNB 1D5XA 2XLLA 4HU8A 3MRFA 1JXFA 1DQQB 5B39A 2JWYA 3FSAA 4MA1C 5E8PB 2Z4QB 1NCCL 1C7TA 4KMQA 1F41A 2AK1L 2VMEA 3SDAC 4N86A 1TDQA 4XBEH 2V3EA 4HK3N 1EXUA 5EO9B 2NXZD 1CLCA 2A6IB 3LVTA 3DV6B 1TJGL 1ZPLA 3RHWF 3IGFA 2IH9A 4FDWA 1R5WA 3VQ1C 2OL3H 3CH1B 4D9RE 1HL8A 1T7XA 3NCBB 4L5FE 5T1LA 2BO0A 4JDZB 3VYNA 5DF0A 2ZUTA 3IF1B 1YDPA 1CE6A 4F9LC 4KXBA 1D6EA 1OGTB 2F1BA 5EC1A 2IF7A 3QYCA 4J5VA 5IHUL 1S7UB 2Q5BA 3GS7A 1Y1UA 2DJUA 2FZ3A 3MI6A 4NKOA 4MNGB 5DWPA 1NTDA 4TLSA 2OSWA 3OC8A 3CU1A 3VXUD 1FC1A 4HS6A 4B7LA 5FECB 3CG8A 4OZ4B 4QTIL 3I75B 4XNMB 3IDGB 3LHAA 5EEYA 1X4YA 3L1EA 2R51A 3QUKB 4JFZL 5J9PA 1FV1B 2E9BA 3TA3A 1RK0B 1QYGH 3GMLA 5A3IC 5DI8B 1PCSA 4MNQE 3CPLA 5I0VA 3VXMD 1HU8A 2PXYD 5A2IH 4RFOH 5KYXB 3WTUA 1ETZB 4LBAA 4Y4HC 4TPRL 3V5HB 2UXVA 3O6FC 3M07A 4N6QA 3UAAA 2WVVB 2VZVA 2DYSB 1MNUH 4M8QA 4UQ3A 2E6PA 4XPAL 3MUJA 3LH2H 4ZOAA 5DRWB 3WEBA 2BS9A 1F4WL 3TBTB 5JIIA 3DOSA 3W0WE 1X5XA 1UD3A 4ZFQA 5KSUA 1AYOA 3RIFF 3WHE1 3VTTA 5CJQL 4JFDD 2IH1A 2FGWL 2XBDA 5HHMD 3U9PH 2VDNH 3QJFA 3GO1L 1UZ8A 4G9DB 1TQBC 3PGDB 3FTXA 4FLHA 2QSTA 4IIZA 4B9ZA 2DQUL 2W94A 4NI3A 4A6YL 9PCYA 1LP9A 1YLBB 2X4SA 3EG9A 4MJ4A 2X1XR 3FRPB 1UM4L 1QHQA 2WCPA 4PAZA 4HQQH 4J3BA 2XUWA 5I66B 4IRSD 1CBJA 1U8HA 3OKMB 4K3DH 1U95A 5C86A 3TNNA 1D5ZB 5DQDL 2FB4H 2ZCZA 3IGKA 2WUBH 4I77L 4UIKL 2GITB 3NRQA 2VITA 4ODXB 3N1QC 1B2YA 5EA0L 3WJJA 4XCFL 4DAGL 3BP5B 3VXOA 4QXVA 1HX0A 5FC9A 1LEIA 3UPAA 5EUOE 4R2GB 3NK4A 4DN4L 2EIKB 3WHXA 3LEYL 3BVDB 1IL1B 1Q9LB 4JHBA 3NH7L 5TDNB 4MB5A 3DMMA 4UV4L 4DSYA 4FQJH 1MW2A 3TA3D 1FORL 3FRUB 1HN1A 4WV1A 4GP4B 4HBQA 3L16A 3FQ1A 1KENL 3QIBC 1QFWH 2GHZA 3QIUB 1GGUA 4GAGL 3UBXA 2ZJSL 2ZKWA 3ESOA 4GKSA 1I3VA 2FX7L 5EWIL 3SE9L 3ETTA 1MFDL 4P46B 3W39B 1UJ3A 4GB9A 1EGJL 1T21A 2DKMA 1QEWB 4XBPB 1UKTA 2JV6A 2HRGA 5FO9B 3SE4A 3KPQA 5CLXA 5D70H 5I15L 3T3PE 5JMOC 4EAEA 1C9SA 3GHBL 4RZKA 3BISA 3BQUB 3VXME 3MRHA 3MTRA 5DD1H 2Y72A 5ITBL 4NC1E 2ATPA 2B1HH 1NAKH 1UGKA 1I1FA 3VFPB 5F7EH 1KBWA 2YSSB 2DQDL 3BUBA 5I1AB 3QIUA 1OB0A 3BD3A 4GQRA 2HVJB 5GGVH 3ROOB 5AOMA 3SZ6A 3V9EA 2JCCE 2ZWLT 3QGVA 3N43B 2YD6A 3LNIA 2YPLA 1T4KB 4DTGH 1TZIB 3SD2A 5LGHL 4HC1L 4YDJA 5KSAC 1NA8A 2QMJA 1SY6H 1ZANL 1QRNB 1AR1C 3F12A 3TIEA 3QJHA 4OD2B 2A9AA 5DK3A 2NYKA 1VERA 2AQNA 1A21A 1KGCD 3P30L 3SO5A 4M8RA 1R33A 3WJLC 1T0NB 2F5BL 5CZXD 4PJFE 4DVRL 3V6OC 3OQRA 1XSKA 2HVKA 1UH3A 1I8IA 5AYTA 2XX0A 4ALAL 4FXKC 4XI5D 4PGZA 1U8OA 2AP2A 3FT2A 4LVHB 4NWTH 4AJ0A 5C1MB 1TSRA 2FWLB 1OGPA 4KXZI 5EULV 1SYVA 1MCEA 3ARFD 4F80A 3DUSA 4CN1A 2VQUA 4NUJB 1QW9A 4ZMZA 3GSXA 1GZHA 4AH2A 3OHXB 4NQEB 5AWNL 2X9XA 4HJ0D 5DRXB 5IGXH 2A83A 4RMVA 1FP5A 2AKRB 2OR7A 1ONQB 2TRHA 5GGVL 3MU3A 3V0IA 5JZ7D 4OZFA 3FQTB 3MLTB 2HPOA 5K59E 4NKDA 5I6NA 4LOUD 1P7QA 3B9KD 4AK2A 2VLRB 3P0VH 3SYAA 1FE8H 4TNWF 1S7QB 3R18A 3RUGA 2DW5A 3Q6FA 3NABH 2EH7L 4IRZA 8FABB 1OM3L 2VN3A 3IEAA 4MWFB 1ZRUA 1SUHA 2Y5TA 1Y07A 5FK9B 4DKFL 2OTWA 5D1ZI 1KCSH 5E7FA 1PAMA 2XXMB 1J9TA 4N1HB 1RPKA 4QXUL 2PTTA 3T3MF 4WWID 2Y06L 4DGYL 4XRCA 5E70A 6PAZA 1AQDB 3BZEA 4PJEE 2VQTA 4PGEB 4HGKC 1LMIA 2YK1L 4PLOB 4AT6A 1KN4H 3GI9L 5I8KH 3J07A 3BWZA 4JO1L 3ZTNL 4DKDC 1OLZA 5E00A 4OIBA 1NCWL 5I6PA 1NFDB 3WYRA 3OPZH 3QJRB 3PNRB 1II4E 1VZIA 3OLGA 3BH4A 2GY5A 4X9IA 1CFNA 2FQFA 5I6OA 4FQXB 3RGVD 4L5FL 3HNVH 4U6HA 4OF8A 3ZMEA 2Q3XA 5FYJD 3FSVA 1GCFA 3F05A 2PCYA 3BW9B 2DQHH 4CVWA 4BZYA 1GVIA 5DRNB 2R1XA 5EU4B 5IBUG 4AW4A 4B9FA 4DNLA 5F1NB 3CFDB 2UXGA 1KPVB 3AM8A 4AT6B 5JZ7C 5CR1A 2KZWA 5K1NA 1Q72H 3H4FA 1OE3A 4PBDA 1JHTB 1BM7A 1KV3A 4S0SD 3UJTL 2W38A 2XTJE 4QI3A 1EXHA 1U8LA 2DRUA 3WDHA 3EOTL 1JD9A 3GXPA 4PI0A 1KT2A 4M4RB 3OM3B 3ETBJ 3O9WA 4UT6H 2HN7B 4BQCA 4S2SA 5EIQA 4DP6X 4K3JH 2EICA 2CM6A 2V3DA 2XWEA 4NBZB 4HSAC 1FA4A 1BZ9A 1S7SA 3KXFA 3U36A 3K72B 5F3BA 1S9WA 4KQ4L 2WVTA 1E4XL 1C1EL 5ABAA 2EE6A 4M48H 4F8OA 4LLYB 3UAJA 4IDJL 1ECZA 1RZJL 1AZBA 3CSBA 4HKXA 3SQBA 4P3CL 3GMRA 4PB0H 5DRXA 1J48A 2ATKB 2WXPA 1CL7H 4UCFA 4QHNA 2Z31A 2OXGB 2PW1A 4YZWA 2P47B 3U2JA 5I18H 1A4JA 2XN0A 4HH8A 4EI5B 2B59A 5JHLL 1P9MA 3D69A 1MW1A 1V7NH 1OSZB 3FBKA 4K9EL 4N0UE 4TVSa 4M6NH 4CC4C 1UD5A 1BOYA 2NW3B 4YK4C 1N59B 2JCCF 2VDKB 3AQXA 3PWLA 4LCIH 1UENA 1TVBB 1EHLL 4CADB 1U3HB 4MVBD 4XO5A 5LAPA 2ZD0A 2HVBA 4K8RH 1FLRH 2KQNA 4TTGA 4X6DE 2BSTB 2LE9A 3O0RH 2IBBA 2XN9A 4LGSB 4EMZA 1E3ZA 3BEVA 2YXVA 3BGMB 3EFFA 2CUMA 4X98A 5IB5A 3I84A 4NIKB 4X9FA 5T3XH 5TD4A 4CBPA 1F3JB 1W0WA 3KPNB 3TOPA 3PRZA 5CCGE 3JUZA 1M6OB 1SVCP 1LO4H 1G9HA 4YX2H 2E7DA 3INUL 2NW3A 1CJYA 2NY4B 1OZTG 1MG2C 2H26A 4N0FB 5IOPA 1DQMH 4JPVH 4YJZL 1RZ8A 4XVTL 2YJLA 3KCPA 3TZVA 1NGZB 2R59A 3TGXA 1SUJA 3MNWA 2ITEA 3OR6B 1OCOB 4S11A 1X5LA 2J72A 1URLA 3HOGA 4HJGB 3SDAD 1A2YA 3MRBB 4DKTA 2Q20A 1NJ9B 4XP4H 5F44A 1DSFH 2CGRL 3AB0C 5E2TL 5L7XH 4LCUB 3CX5J 5LBSH 3V5DB 4DGUA 5ICZB 4JMNA 5DJ6A 2EEBA 2YZ1A 4AUUA 2NTSP 3FONA 5AW9B 1EHNA 3D07A 3K72A 3NZSA 1JHKL 4MXVF 1HEZA 5E5UB 1U6AL 1L0QA 2MJWA 2FSDA 2IXQB 2AQ3A 3S34L 3ULSA 4GMSL 4N22A 4YXHH 2DBLL 5E6SB 5K9KA 4PREA 1M7IB 1NCAH 4YLCA 5C7XL 4IEFB 2G75A 1YEKL 3LIZA 1BG1A 1H5BC 4Z3EA 3DTXA 2HFFB 1JNLL 2WXKA 2CCLA 1XH2A 4Q9QH 4B5ZA 5LB1A 1RJLA 4FXKB 5CP7A 2E76C 1FFRA 2B5IC 1PF3A 4LEBA 3SY0B 1L9OA 1FG2B 4M6NL 4UQ9A 4B53A 4DP7X 2BOLA 4HYTB 1IZKA 3HG2A 4XC3L 5TQ0H 1HH6A 3BGAA 5IB4B 4XPGH 2HYMA 3NQIA 3GEFA 1OAYH 4XVUD 1FLRL 3H3PL 4GP8B 3L4CA 2J55A 3PFQA 4W9EC 4XPHL 4WSGA 5AKVA 2ZXCA 2MCPL 2VQ4A 3T0EA 4BEIA 1HHJA 1IVLA 2B0SL 1XR8B 3Q2CA 1FZJA 1L0YA 1XEUA 4KHTL 4KKLD 3DYOA 3H53A 1T20A 3JYBA 2WQAA 4GO8A 3QT2A 1Z1WA 4M02A 4TF4A 3WIFB 4LLUA 4XB8A 5CD5D 5KWYC 4LARH 2IVFC 1AQDA 3P11L 2CPUA 5C0ND 1ZLSL 4MDRA 1S8DB 5DTFA 2H0FA 4MQTB 5H94A 4MMYB 5BVPH 3KL3A 3P02A 4X7CC 1KJVB 5E2WH 3VMOA 5CJBA 1YPZE 4G42A 5F0MB 3ZE1F 1ND0B 1EGJA 2D7TL 2E27L 5FOJA 3TBSB 4NPYA 4X6CE 2Z91A 5GGSY 1UCBH 4YVNA 4U1JA 3NGBB 5IKCA 4KQ3H 4G8GB 1SJEA 3KBEA 4JFED 2HLFD 3D3VA 3BVNB 5AW8B 1G9ML 3II3A 4UI2A 2FJFA 5HJDA 1S7QA 4H8UA 4G9FB 3T1WA 5D2NC 5H35A 2JJVA 5I5MA 4RGNB 4AZ8B 5DC0A 3WL9A 4MMXC 5C0JB 4HZLB 3LIUA 4M93C 2IFFL 2ILLA 4TQEL 1N0LB 3MCLL 4O9HH 3VFTB 3HC4L 3CZSA 4XN2A 1F56A 3TTSA 1C12A 2C3VB 4Z7AA 4Y5XC 3RIFK 1A7QH 4R7NA 5DHXB 5G4NA 2V7HA 3GUFA 5L8KB 3BDXA 1RZPA 3SPVA 4PG9A 5IMMB 3T0EC 2QZ5A 2NX5E 5CJ8A 4KDTC 4MA8H 4FTVD 4O2CA 1TTFA 3CZNA 5GS0C 3L4UA 2A74B 4JDZA 1FDLH 1AZRA 3BP7B 1K8DA 1MOEA 1GGTA 3IJYB 3HE7A 4PWEA 3U36B 1F8TH 1GJUA 1AKJD 3O3BB 3KL0A 4ACTA 4WHYH 3H9YA 4U0QB 4WEUD 4UZSA 5DJCA 1CICC 3FK3A 4N2OA 5EO9A 4P06A 4FNPA 1E2ZA 4KBPA 1ITCA 1CTOA 4DZ8B 1P5UB 5D1XE 4Z3JA 3ULVH 3ESVF 5GQBA 3JZYA 3OKDA 1DJYA 1Q9KB 3P4OA 1A9EB 4P5TD 3MREA 1CG9B 4B9CA 2DEWX 4GRMA 1AE6L 1G6RH 1U8PB 2WJ5A 2JTYA 1I1AA 2QTEA 2GY7B 4HXAH 4YHKH 3MRIB 2F7RA 2HJKA 2PYEB 3EJZD 4YPJA 3RFZA 1T4WA 1NUNB 3QNXA 5TGBB 5T3XD 3O4OB 3OC5A 4GUPB 3L3HA 5IVOA 3TEXA 3LZPA 4XPFL 4J3OD 4HKBA 5BRZB 1OVZA 3S5ZA 1N67A 1IX2A 1AIFB 5F70A 1IQWL 1KTLB 3T0ED 4YDMA 4BHUA 1E27A 4L4TE 2DQTH 2JQMA 1D9KB 2ZAHA 2YD2A 4L29B 1J0YA 2CNZA 5J6GA 4HFWB 1H0DA 1UWGL 2H1XA 2Y7MA 3MCKA 4JM2F 4LCYA 4LL9A 2ZZUT 3F7YA 1F97A 1ZVSB 4A2MA 4FQCH 1E4KA 2IGFH 5DJZA 3QDMD 3OG6B 4M8UA 1QQDA 4DWHA 5CU5A 5D72H 3C6SB 2KDGA 3ARZA 4N6RA 5CEZE 3CN2A 2FX8H 4XGZA 2C34A 2K70A 3RLSA 2FO1A 3HKFA 3BGFB 2EIZA 4JJOA 1FHGA 4MJID 4JFPB 2BHYA 3JTTA 3VRIA 4C4UA 3S2AA 2CRYA 3SOTA 2J6EL 3AAZA 1RUAH 4I85A 2G2PA 3L5XL 4RMSA 3Q8BA 4OFQA 1KYOJ 1X5FA 2WWNA 5C0EA 3O4LD 4ZO7A 2V5MA 3CVIL 3WFCH 4EI6A 2G3NA 2BP0B 2AQ2A 2DMBA 3C5SA 1CGTA 2EIEA 2DLEA 1SN2A 3L3DA 1NFKA 4KK8D 5AYUH 2WJ7A 2F15A 4PY8J 4Z0BH 4ODHL 3CDGB 5I2IB 1CFBA 4XX5A 3N2JA 2F53E 4OZIB 4OM0H 3QXAA 2J8OA 4K0OA 5F7FA 3SPHA 2BSSA 3FT3A 4K94L 4RFNC 3FB6A 2XG5A 4XO4A 2WXQA 4BFNA 1GR7A 1UM6H 3PY9A 1QW8A 2QPDB 4P0DA 5T1KB 2ATAA 3RWIA 4OF3A 3FW6A 1HCYA 3P4MA 3IU4H 2UWEA 1JAEA 1A4KB 1N6VA 3Q3GA 1ZSDB 1KCVL 5E4EC 4LCCC 4UV4H 2CD0A 4BSWA 2I60H 5IBTL 3HS0B 3RZCA 3QUKA 4UDTB 1YN7B 4IKJA 3MV7D 1J8HD 1FYTB 1YEDB 3LN4B 3WD5L 2XTJD 3HZKA 3MYZA 1SQ2N 4LAJH 3FZUD 4AKQA 2WSPA 5FM4A 1JJUA 1G6VK 4U3HA 1N5YL 2CM5A 1UD2A 4M1CD 3QJOA 1MUJA 2FJGB 3BXNB 3OKEB 5EF2A 2AANA 4UTAL 1ZLUK 4Y1AA 2FX8L 2CKBH 4U6VH 3SKNA 1OO2A 3R7QA 4DZBB 2OBGA 1XZWA 1ODUA 1B9ZA 1ZVSA 3BEWB 4HMCA 4PPTA 4P5RA 3QIWB 1DVSA 1NKRA 3DK2A 1EZVY 3T2OA 2WZ6A 1GYWA 2X3CA 5FKPB 4PJGE 3KPRE 4RQQB 4XPBH 3ZKMC 5JW4R 4WFED 3ZYZA 3H9HA 2B4CC 5HDBF 2QVTA 3PWPE 1E5CA 2VXQH 4G80B 4KITB 4LHUB 4OLVL 3ZPDA 5K9OA 4U33A 1NEPA 1NSNL 5BMFL 1AIFA 1BGXL 5IIEA 1ID2A 4NHCH 2CJUL 3R1GH 1TQCC 3WMQA 3N85L 1YQVL 4ZFOB 3RUGF 4NP4H 1T03H 1TZAA 3MOAH 1KXVA 4AIXA 1M05B 3D85D 4HJUA 3JWNE 3Q8FA 1G84A 2WAQA 1PZCA 4NN6C 1ZVNA 4LE8A 5ETUA 5IFAH 3PNWB 2PPFA 1OP5H 2OCFD 2R9HD 4N9OB 1C08A 4KVCL 3HVNA 4G7QB 1UA7A 4QYAA 5HTSA 4Y4KB 4QF1A 4DZ8A 4K2UL 1ZSHA 1WF5A 4IRZL 4P99A 2GCYB 3T2QA 1KCVH 3ENEA 4YGAB 1XMWA 2GVYA 3KHQA 2YPVA 3UGUA 4KKNA 4HJEA 3QQNA 2ZUUA 3QFJA 3F7VB 3LH9A 3S9DB 3ETSA 3JTSB 1INEH 3RA7H 5F2FA 2YARA 4H1LG 3AFLA 4KUZL 1XL4A 1XBDA 4OZGB 5KN5B 2VXUH 3SKMB 2ZYSA 1WA2X 3ML9A 2Z7YA 4HETA 5DQDH 4MQ7A 4OB5H 5C08B 4ETQB 3E0GA 4HIHA 5JDSA 3HE7D 3SB3A 1X7QB 4BH8B 3DX9B 2UZPA 2XWBA 3VD5A 2LT9A 5FO7A 1FV1A 4JVPA 2Z1KA 5AFAA 4LPVA 4BE5A 4GUOA 2WHVA 4M7KH 1A7OH 3TBWA 1H3XA 2EEDA 1TJGH 4QPEA 2WLHA 2GPZA 3U6RB 1RZJC 3VD2A 1WA1X 2EDHA 4LLMB 4NZTL 4A7QA 3S4SB 1AVAA 1MFCL 4NM8L 2P9RA 2Q3ZA 4FNLH 5L4MA 3EO1B 2OMBA 5I76A 2V33A 3RGVC 3WDJA 4OD3H 4BZ1H 1ODAA 4MYPA 4PJXB 3FFDB 3QUML 4YAQB 2AABL 1R5IA 4LPCA 1TPXC 2ZPKH 4R4BB 1UJ3C 4MS8C 3V5KA 2UWEB 3GBDA 5IB3A 1A22B 4H40A 3VWKA 3T4YB 2ITCA 3QUZC 4AKOA 2JKWA 3W2DH 2HCZX 1FFQA 2Z65C 2XDHA 4RZCB 2A4CA 3DJZA 4AEEA 5EIIA 5DO2D 4XAWL 3O4LE 3LV3A 2O26U 1OB1B 4S1SL 3S37X 4APQB 4KZEL 4NYLB 3ECBA 5FUZH 5C8JA 3BWSA 1F11A 3OKNA 4JDVA 3AXLB 1G0DA 3LNHA 5SV3A 1HHKB 3EGDB 3T4AA 5T5NF 4WWPA 5AVZB 2AHIA 1RJYB 4PBVC 5LGJA 5AL8A 3N04A 4OUUB 3IRZA 3RG1C 3WGVB 1QR1A 5F7DB 4Y2OB 4HVBA 3SKUD 5C9JB 1T20B 2W9EL 3V52L 2EVJA 4WO4B 4PV8A 4AMKH 2YQBA 3MXWH 2AEQH 3O45A 3PU7A 2KPWA 5DHVB 5ESAA 1HHGB 4OBSA 4XXDB 4TNEA 3D39A 3SPIA 3DSNB 4G2AA 2CBTA 3HTLX 2YSTA 4MZIA 1HYRC 3FRPG 4WQOA 4E9RA 3GZPA 4WW2C 4OU3A 1R3LA 3LDBC 2EEXA 4L37B 1ZT1B 3VFWB 2R0LH 5BVJB 1CXEA 3IDYB 2L4OA 3UOAB 5DJAA 1JUFA 4LLAA 1VZGA 1K72A 4PJDA 3HMXH 2WBJC 1OCRB 3UZVB 5F96L 4PTUA 4W9GC 4BJLA 4KRNA 4UT6L 1GZQB 5KS9F 5HD8C 4XWOD 4KZEH 4JM4H 3AG2B 1XV8A 4NZTH 1CDGA 1JGUH 3KVPA 3MYJB 4JO1H 3ZTNH 1AJ7L 4PJEA 3QCUL 2IQ9H 2F7OA 4QIRA 5DO2C 2Y7SA 2DTML 2OV0A 4KGLA 4AQEA 5I1DB 4RRPA 1MAMH 5ECGA 3DWTA 1S4IA 1HAUA 1OAXL 3W37A 3A4AA 2W9EH 3LRGA 3V52H 4IOIA 4DP5X 2APBA 4KXCA 4PJIE 1XGZA 4JFQA 4LCUA 2RR3A 3M88A 4PJDF 3RJDA 1O7VA 3WO3B 2NTFB 4J2QA 3BWAA 4I13B 2YIHA 3WKQA 3II1A 2Y06H 2Z0BA 4DGYH 3SPCA 4ETYA 4YR6B 4K5MA 1KDJA 3BAIA 2DY2A 5IJDC 4KQ0A 4Z7IA 3PWVA 3FPYA 2JI2A 4OZHA 1ES0A 4L0ZA 2HA1A 4NI6A 3P2BA 5HGAA 2D0HA 1JGIA 3QULA 1GIGL 1DJXA 1U8CB 3L8QA 5C7XH 1T1WA 1G1YA 1K5NB 4PV1C 1UJTA 1QACA 3TN0C 4KHXH 1YMME 2Y2WA 4LSSH 1IE5A 1MCRA 4AE1A 5C92A 2W1NA 1IGMH 3DROB 3WJLA 1WWAX 2C4FT 4Q14A 4EJ1C 4UYPA 4YUEH 4FEMA 1UT2A 5I1CH 1R3IH 1RZJH 2H7WA 2J88L 3L3OC 3ZVVA 1XGRB 2M26A 2OX5A 3FTZA 4PCYA 1BWWA 3MUUA 3ORJA 1BFSA 4NQDD 3HI5L 4JAMB 4XP1H 2ERJC 1BG9A 4LLDB 3IRCA 1DQJB 1FFNB 4G8IA 3QUYA 5F96H 1Z0NA 3B7UX 3NCCB 2R69A 4PRHE 2VGLM 1A1OA 2D3NA 5F6IB 4K3JL 4JBSA 3GSUA 5I1KL 1IAII 1U8LB 5ECJE 1KG0A 5E9DA 2VDQH 4CVXB 2HFEB 4M4RA 1T0MB 4F2MA 4GG6F 5I19L 3S5LA 4UQ2B 2B0SH 5T1MA 3P11H 4PJ8C 1MAML 1XF5A 5H35B 4HAKA 1DBKH 5LWYL 1WFMA 3KZ8A 1KWGA 4Y5VC 5E0QA 1WAAE 1WBZB 2BNUB 2HTLD 4H7VA 1FNSL 2EYTA 5EZLA 5H4YA 1GGIH 1QR1B 3S5YA 4KHXL 2DEXX 2XPYA 2R1WB 3MO1A 4EO5A 1PY0A 2LFEA 2XXFA 4FZ8L 3WCYA 3T08A 3INUH 4NO5B 4NRYB 1AXIB 5GPRA 1EHAA 3VUAA 1TR7A 5D4IA 2Y2TA 5J5EA 1KLGB 3QB7C 1O7DE 2XVKA 1WCBA 1EJOH 3VXTB 4D94A 4XPGL 2GJPA 1M7DA 4YXLL 5EMYA 5HGGS 2ADGB 3UO1L 3G04A 3BVTA 2WQSA 1KYUA 2GT9B 4LVOB 5JORB 4DGIH 2RACA 1DSFL 2CGRH 5L7XL 3RX8A 2RCSL 5E1HB 5TE7L 3KH4A 1MHPL 3LAFA 5EV7A 2FEJA 2XFGB 3G5VB 2QR0A 2BK8A 5MHSE 5J11B 2FJHB 5FYKL 5I0WA 4Q2ZA 1T6VN 3TONA 1DVYA 4FL4B 4RSYA 1NBZB 3LKOA 3SDXF 3QDJB 4JE0A 1UACH 4V1DE 5EZOL 4AC2A 1UH4A 5DK2A 4MZ3A 1E6JL 2XZZA 2YD3A 3DETD 3ZR5A 4QY8B 3Q8AA 1D2PA 4I3RH 5FW7A 1RZIA 2J88H 2J2ZA 1E4XI 2XTJC 4U1HB 2YRBA 3EHBC 3H3KA 5JUEL 3MV8D 5DDHB 1W15A 4GT7A 4IU3A 4LLMA 1FL5A 4C59B 3AGVA 4GYBA 2Q2EB 1DJHA 2MWCA 2WNKA 3MRDA 1ZVYA 2Y5EA 1NC4D 2KLTA 3UYPA 4FKKA 1QBAA 4GIPD 4OLYH 2IAMD 3RWEA 4JQXC 3D33A 2OSLA 4LLVB 2EDMA 5F0PB 3F3HA 3H3PH 1IC7H 3ZDYF 3QPQC 1YZZA 1NBCA 1AZUA 2Z8WC 1FAIH 5AVYB 3WXVL 3A6CH 1COBA 1I7UB 5FAAA 5I75C 1G7QB 1FFOA 3M86A 1BQHG 1LXMA 2HRPL 5I8EB 3K81A 3L13A 3V4PB 1ZA6A 5IR1B 2BS8A 4CC4A 2DQGH 4D7PA 5FYKH 3QDGB 4AUJA 4AENB 2I25N 3N0AA 4G6JH 5HHNB 3UJJL 3F7VA 2KMWA 4G82A 2WQRA 1PU0A 4FL4C 3WO4B 2N1KA 3D51A 4OCLC 2VMFA 2R0WH 1OPGH 3PHOB 5GGSA 3GSWB 1KSRA 1PY4A 3JV6A 4NWUL 3MQIA 4P9HL 5JHMA 4LQFL 3RWDA 1C5CH 2Z3FA 4KJQD 3RBSA 2F53D 3EYUL 4BFBD 4OF0A 3HB3D 2LAGB 2VH5L 4UYQA 1Z9SB 2WBWB 4X7DC 5K9QG 3TBYA 3GGWA 3TIDA 1EAJA 5A7BA 3DK0A 3IFOB 1TZ8A 4GLRI 4KAQH 2VUOA 5E03A 4CUCA 2ESVE 4BK4A 1NCCH 5I8CA 2DLHA 5JO5A 5C07E 3VFRB 3SODB 2OL3A 3JVFC 3QWNA 4FZEH 1G6RL 3AT0A 4QTHA 2UWEF 2FH8A 3ZXAC 3QZPA 2OTPA 1E5AA 4K9EC 5CIPH 4BGLA 3H54A 4KPHL 4PJXF 1HIMH 4Z23A 1QI4A 1W0YT 3D48R 4R97B 5I1AA 1A4JB 4EI5A 1FZKA 3GM0A 3QNYA 4POZC 2VB5A 4P57A 4LSPL 3VXQB 1ZT1A 1IQWH 1RUAL 2ATPB 4CC0A 5IF0B 5AB1A 4FNRA 1OW0A 1UD6A 3JUYA 3BEWA 2OZNA 4NWUH 3VRJA 3BI9X 4J3OF 2WINA 4QRTA 1WD9A 4RSVA 4YWGL 3NZUA 3MRRB 4ORGB 3QZLA 1WTLA 5ITFA 1A6VL 3DX7B 4HHAA 3DDGA 1KB5L 1U58B 3QRBA 4PJ9C 5D7IA 3F6JA 4G11A 4M1GL 5ERWA 1T21B 1GOGA 5TE6L 1VGEH 1IBGL 5BO1H 4F5CA 4PW3A 3IMSA 5E1AA 4FLOA 1VZHA 2FL5A 2H3XC 3X3GH 1P2CB 3MBXL 1X7TA 2CAKA 2K9UA 2IDQA 4PTTA 4KJPC 5BW7A 4IDLA 2K8QA 3CZJA 3KJ4C 1CXLA 1N64H 1YEIH 1KB5A 1PNCA 4Z5RA 3S0PA 3RVUD 5HHMB 4LSQH 4PLKD 4MASA 3K7UA 1SHXA 4JR9L 1OSEA 1JPFA 4WY7H 1BYPA 2KL6A 2OPCA 2XRAH 5J13C 5B1CA 2VLKD 4E2OA 2LU3A 1TYRA 3H1ZA 4N4YB 3SPGA 1PFCA 3D5OF 1CQKA 5FA4A 1YMMB 3DETC 4XXWC 1IAIH 4XO3A 1T1XA 1YUKB 2DWDA 4YAQA 3LKRB 3ZYIA 3KPMA 3PDGA 4APQD 5KVDE 4H0LC 1HE7A 4Z7UE 1GZHC 4LMQI 2WLLA 2A4EA 3ARUA 5I74B 1L7IH 4N1CA 4ZSOE 4ZX5A 2BSRA 2NPLX 3ZJAA 1JZ8A 2FIKA 4AI7A 4YHKL 1I8LC 1X6NA 3TVMC 1G9MC 5DC2A 4YXKH 4ZFOA 1AZZC 3MJ7A 2V4LA 3KAAA 2CLVB 2OKMA 3WNNA 3CFCH 4KHTH 3HR5B 4QOKE 2MTAA 4OM1L 3TA3B 4L0PB 4LBEA 5JW4Q 1H15B 2X40A 4FTVA 2ZUXA 3L5XH 3OTTA 3LJ3A 5HHOE 2VRAA 2UZIL 1N2RB 1DCLA 3PWPD 1KYFA 1AO7D 3FU8A 1IGJA 4NQUA 3BPLC 5EU3A 2Q8AH 2F2HA 2VLRA 1F3DH 5ES4B 5DA4A 3I3EA 1YEGH 4V2BA 4HDIA 3L5JA 3P9MA 4WK0B 3C08L 3FTSA 3VGBA 2X9WA 1GY1A 1RHFA 1ZT4A 4LOEA 3RUGE 4I48B 4Q6YA 4LF3B 3GMOB 1IM3B 1X3DA 5C2UB 4GSRA 4QF1B 2J8UB 3TO4B 5DHYA 5IVXB 3HRPA 1D2OA 2VL4A 3D85B 4KDTA 1C8QA 1UM6L 5D9SA 3WV0A 2VDRH 3QHFH 4M7LT 3DX1A 4OM1H 3HFML 3PHQB 5GGRA 3MRFB 4UOJA 1ETB1 5CN1A 4X6BB 4WI0B 2YJQA 4E9TA 3P3RA 3RY5A 4C8XA 3CJJA 4X7SH 3V4VH 3VW3L 4B7IA 2C9SA 1QRND 4KVNH 2IG2H 5MERB 5D2LF 3LN5B 1QLFA 4ENED 4BFFA 1UXLA 4R5TA 5JMRA 4PWJA 5D7IE 4RESB 1ZLWH 3D85A 5CGMA 3NZ8B 5D6DC 2VQ1B 2KUTA 4F7CB 3C08H 5JXEA 1PIGA 3ARDB 4KDWA 4F8TA 2N59A 2JK5B 3I50H 4PP2B 4TUKL 3IMTA 4WEBH 2BY2A 2BY0A 3S48A 3MRHB 1MQ8A 2J8HA 4N25A 1FWXA 4W6YB 2NY6D 4ORZC 4Z7QF 3HRZC 5I71C 2G3ZA 3FQNA 3N6YA 2W60B 2E7HA 3QG6A 4GXVH 4Y1AB 2YR3A 3KLAB 3ZYJA 2W07B 3GK8H 3U4KA 1BZ8A 4PTTB 4P4RB 1MW3A 3H9SD 4DO4A 1WPCA 5IVXE 4UTCA 2DMHA 3VRIB 4BWUA 1TSHA 35C8L 4L48A 4JG9A 5DUML 4OFYA 1NBYB 4Y9GA 2NY7H 2X4TA 4IYKA 4J1UB 5IUCA 1MDTA 3LPPA 2VNCA 1U92B 4N6RB 5KW9L 3C6LD 1A4BA 2Q76B 1HQRB 1KPUA 1LD9A 1ROWA 3PJLA 2QELA 4RBPK 3KYNB 4XVJL 5FYKE 3VFVA 4AQ8A 2FJGA 3OKEA 4PJFF 4GG6B 2X1WL 4KNUA 2VXVL 4PGCB 3FYIB 4I0PA 5E9DE 3GGWB 1EH9A 3N1FC 4FULA 2B9BA 4ATTA 1SDDB 4XPBL 4I3SL 5IM7A 5KBLA 5GRUL 1SXAA 1DVTA 3MGOB 1E27B 1I8AA 1HNGA 1QKZL 1XB3A 2A38A 2VAAA 1HWGB 2VN7A 2DKSA 4P2RA 5FGBC 3WY2A 2XYCA 4R7VA 3FU7A 4HIJA 2CBPA 1PZ3A 5AW5B 1JZ2A 5EU7E 4NZRH 2ALAA 1A7RL 2CZNA 2Z0UA 5DEGB 5BV7L 3WTVA 4MXQD 1YQVH 4N8VG 4FA8A 3MXWL 4UT7L 5T1KA 2DM7A 1IT9H 5D7JC 3BSGA 2C9UA 4A38A 5C6TL 3VD0A 3QZWA 2YBRA 1XSJA 3U2SB 2WO2B 1CT8A 3F7PC 2COVD 4JM2B 3MJ6A 4TSCH 3FUKA 3F65A 3MRCA 3FO0H 3QIWC 1ETA1 4FRWA 1MY5A 1WZMA 1XCQB 3Q1SH 3VD9A 4JEGB 4HHWA 2IFGA 1JYWA 1IQDA 2P8LA 2GYSA 4W9LC 1WIUA 3EXLA 1NCWH 5HJBA 1Q9WA 4JKNA 5ERWB 3ZDWA 2C8NA 4HWUA 3EGSB 3PFUA 1DCEA 1KPRB 1KYAA 4JJ5A 4NQED 2YWZA 2KH2B 4G5AA 3MOQA 4PVNA 2EILB 1V7MH 3UAJD 1XF4B 3ZOAA 3OGOE 2QSCL 3UABA 2DMKA 4PREB 2HLEB 1AGDA 1KCBA 3WENA 3PWUB 1TKWB 3TJHD 2YEZB 2H0PA 4OD3L 1H0DB 2Z1PA 5KBPA 2ADJB 1HZKA 5B8CC 2OMZB 4GG8B 4P23A 3VGDA 1D6EB 1MN4A 2VKXA 2VR7A 4UTBH 3ZL1A 1CFMA 3CHPA 4Y2NA 4X6CB 4BE6A 5JPMB 1DBML 3H8NA 2HFGL 4W9DC 4PUBH 5F7LB 3FO9A 1MVFA 5F6IC 3QDMA 3VD7A 2ZE0A 2O6DA 4M7LH 4M7KL 3OKOB 2X4OA 2WTRA 4JHWH 4E9XA 1AGBA 1QHOA 3KPSA 4Q58C 1WS8A 1T66C 4LVNB 3TFKC 3BRFA 1IBYA 4PP1D 4FG6D 1GW6A 3L3OB 1M7DB 2EECA 3MREB 3JZ7A 3L1OL 5DJ2B 1GGYA 5CMAB 4K55A 3G9VA 3G6AA 1ZIBA 1S7RB 1FVEA 4BZ1L 4MMZA 4X6DA 1ZK9A 4DF9A 3MRJA 3D4YA 3LKRA 5FKAA 4ENEC 2ZG1A 1VCAA 4WI3A 3QZMA 1DL7H 1USQA 5DFAA 1MVYA 1X9LA 5D2NA 1HQ4A 3QBTB 1TJXA 3PHOA 4MAYB 3KVDD 3QNXB 1NLBL 3TT1L 4TSAH 3OB0K 2VDLL 4N3TA 1EWHA 4UILH 1E9QA 4KY1H 1MWAA 4GEJA 3FUFA 2Z6FA 3BLKA 4QO1B 2MNUA 5DZ9A 1AHWB 2WB1A 5HHVL 1NGPH 2QL1A 4ZTEA 4LESA 4ZUUA 2LVCA 5CZVL 2J1XA 3WFBL 3US1A 1IBDA 2OMXB 2J1KA 3P4LA 3UBXG 3ARBD 1DZBA 3MLRH 3PHAA 3W11C 1J8HE 5FFGA 4HEPG 1X5MA 2R29L 1JWUB 4URTB 1OZUA 1O6SB 4RGND 5FCUH 2YD4A 2NLJA 4HXBL 4X4ME 1ZLVK 1MFEL 3QQ9C 1E8ZA 5TJWK 2FDBP 2QQNL 3B9KC 4NRXB 3DI2B 1X7SA 4QHMB 4BDVB 1V8HA 3CCHA 1B0RA 4M48L 5AVXB 5A40E 4WW1A 4TKWA 5KSVA 1D9KC 2CGYA 5FO2A 4LFHD 1KIPA 4XCEA 4PRBB 1BVLA 4O51A 3KDMA 2EQDA 4ZYKB 4ELMF 3QQ4A 1H6FA 1HEHC 1YN6A 1I9RH 3TJEL 3ZKQD 1TCMA 4O5LH 3DO7A 1S5IL 3WTYA 3MJWA 4YBQC 2W0FB 4U6YB 4P5MA 1XIWB 5FCSH 4PRNB 3I2CL 4UDUA 4WWKD 3FONB 4Y4FD 3N42F 3VU1A 3F85A 5EFIA 2J21A 3SCMA 4YXLH 5DWUH 1U6AH 3GI8L 3M46A 5HYIA 3GZQA 4N20A 5EBLB 2H0EA 2WNXA 3BIAX 4RDBA 5EOTB 2RCSH 5BW7C 5I73C 3HG1D 2B8OT 1JWMB 2QLVB 4PJ8A 2FEDD 4Y4HB 5T3ZE 4R6UA 1WT5A 3FCBA 2HSIA 2WXOA 5DEJA 4J3XA 4GBXD 3OGCB 3RPBA 1FL3B 4GRLB 3ULAB 5PAZA 4CAGA 4I7ZC 4APXA 4PJ9A 1N12A 3MLUL 3R7RA 2OMUA 3BWUF 4HIQA 1VB9A 4C55A 4IDJH 3VXPA 1S5HB 3Q43A 5D71L 4FCAA 4OCXH 4OKVB 4OT1L 2ROXA 4U1IA 3UTSE 3ABZA 1T83A 1XL6A 3EYSH 3U0TA 3QPXL 3IDJA 4XPHH 3SGEI 3BWAB 5JW3H 3LRSB 3FO1B 3U4EB 5JA8B 5CD3A 2H4EA 1BD2A 3G6DL 5IP4A 1MXDA 4O02H 2V2WB 3FUMA 3REWA 1A1OB 4WSKA 4KK9D 3H56A 5D1QB 4PB9L 4YSTA 3DHJA 3ABLB 4IBQA 2PCPB 2V0AA 2ZXAA 4AE0A 3VTAA 3LEXB 2Z7ZA 2ZXEB 1NPJA 1UUNA 1T6WA 1JTPA 2A0LD 1CFVL 3GXNA 4H1LH 3U0PA 3DURB 4MS6A 1WV7T 4FQ1H 1NL0L 4ZMAT 5D2LA 2O5XH 1GGIL 5DLLA 3IDJB 4MKTA 3H4HA 3X1EA 4MMXB 1ZHBA 3GSOB 4ZW8A 5FR3A 3EYUH 1S5IH 4PJ5A 5DXWA 3IKCB 5LGKA 1DLFL 2CJTA 5DJXB 4PJDB 2DQCL 2HT4D 4UAHA 4XVTH 5CJXA 1WZAA 2Z31C 4G7SB 1M3IA 2ZG3A 3K91A 4P2QB 5CJOH 1BPVA 2YS4A 1YMHB 4FQ2H 2XNAA 3L4WA 3GEWB 4Q74A 2XG4B 1PG7X 2GC7C 2ZUQB 2XPGA 4HLZH 4WVRA 4GXFA 4PJ9D 2ZT9C 4J8QA 3QXVA 5JW3L 4P05A 3SOBL 4H5SB 1P4UA 4IBVA 2QQKL 1AGFA 2O72A 3DGCR 2I07A 4RISL 5FV1L 1M7XA 5IMOA 4G8EA 4G7VL 1QLEB 4YR6A 3CFKA 3WMPA 4AEIH 1EO5A 4I9WE 4K9JA 1Z0MA 2VOTA 2V2TA 3LVEA 4RFEA 4EQ2A 2H26B 4N0FA 1WVZA 3LNGA 5GJTL 5T1JA 1NC2B 2WXGA 3HB3C 1VFMA 2WMPA 5DD3L 3Q01A 4PRNA 4Y0GA 4Y4KC 3ROOA 1HIML 4PGJA 1WTGT 3VYPA 1IKNC 1QABA 3WKML 2WC7A 1DEEA 1H5BB 5AW4B 1MPAL 4ZYKA 1BQKA 2UY6A 2IIJA 2XCMC 3EJZC 1U8JB 3LMJH 2UZYB 4M61B 1FPTL 2YRZA 3MACH 4IJTA 2UZXA 1NFIA 2C1OA 4LGPB 4DUWA 8PAZA 1QSFA 3S98A 1LP9F 2I9LB 5EPMB 3CTTA 4GRWF 4FQCL 4ESKA 1YECH 5JHAA 1Z9PA 4ECNA 4A37A 1MCLA 4CW1B 3QJQB 5IB1B 3T1FB 2Q6WB 4HS8L 3KDPB 3TEWA 3QRLA 1NAMA 2FLRT 2VISB 2Z31D 1LO5B 2D73A 5C08A 1SEQL 2GSIA 5INDB 3MA9H 1RI8A 2Q7YB 3QZNA 2D03L 5D7LB 4ZUUB 2XBTA 3SQBB 1A3RH 43C9A 1ILSA 3DSNA 4JQIA 5EIVA 1KBPA 2NR6C 1MRFH 3MV8B 4X4XB 4N2CA 4MCNA 4P3DB 1UADC 3UTQA 4DPRA 4F8LA 2OS7A 1ONQA 4M3HA 4HUMB 4YUEL 4LHJB 3FU5A 5CLYA 1A9BA 3J27A 4HIXH 2G9HA 4F9PA 3CZGA 1A3QA 5IWLA 3O9WD 2N56A 4NKIH 4NUJA 2QV4A 5D93B 1BBJA 4LRNL 3TNNB 4P5TC 3D9AH 2Y3AA 3KH3A 3A6CL 3LKSA 4X9BA 5FS5A 5DZAA 2YAPA 1VGEL 4AQ8C 9CGTA 1KUMA 3ATBA 3H7BB 4M7ZB 3PAUA 3WOVA 2LOEA 2BWIA 3KW7A 4UINH 1E9QB 1YPZB 4BKLA 3NAAH 4MB4A 2HT3C 4NNYB 3O8XB 4XMZA 4TOYL 1HXMB 1MCHA 3SE3C 3OLDA 4LCCB 4WIQA 4ZTPL 1BZ7A 5L2JB 3UTPE 1PZDA 3QQ3A 4GW4B 2PTTB 5IJVA 3ISWA 4PJBB 5ADOL 3LTVA 3U79A 4H2CA 4FQQA 4IHOB 3OX8B 3T3PB 2OTWB 3TBTA 4Y4KD 3BZDA 3LPWA 5KANI 3C75A 4BZ2A 2YOCA 4FYQA 2VC2L 5DURB 1RAMA 1OK0A 2AJVL 3MRKB 5E94B 4KKQA 1NFDA 4F7PB 1M05A 5JDJA 2FGZA 4TULH 1CGSL 1NGYA 1O9ZA 2YOAA 1YYLH 4ODHH 1DQTA 2WTRB 2X4OB 4HAFA 3VXSD 5HI3D 5HI4C 5L0QC 2HJFB 3CUPB 1YHPA 1QSZA 2VLME 3KPSB 4P04A 2ZAGA 4JDEA 5D6CB 1T83C 2ORBH 2WLMA 3PGCA 3B4NA 3TN0A 4YDZA 3UEQA 4G83A 3I75A 3MLXL 1R47A 2NY1C 3CFEA 4NEHB 4PS4H 5FYJH 5IW6B 4G1MB 4YSCA 4BV1A 2WKGA 2XV6B 4NQEA 3VI4A 2AS5M 3H9SB 3QH3B 4ODVL 3MBXH 1BMGA 3S6CA 1BQHB 1EO7A 4XCFH 5I17A 2YEZA 2WGXA 3LQZA 7PCYA 3T6QC 1QFUL 1U8QB 2FQDA 1F4AA 4XPAH 4XN8A 3V4PL 2BRRL 3P3YA 2CHZA 4ELDA 2ZKHL 1BQLH 4H1LB 3IPFA 1I85C 4R8WL 5C0NC 5HYQB 3OAUL 5TDNA 2Y1AA 1OGAE 3DRQA 4TN9A 3WJMA 3ZDZB 1A02N 1YC8A 4JJ5B 1INQA 4X4KA 1NIFA 5FYLE 5TE4L 4TLUA 1L3WA 5T33L 1XSOA 3O45B 2Y1YA 1R24A 2EDEA 3WEXA 5C2BL 2ZSVB 4KRPB 1V3MA 5DVOA 4DN3H 5C9JA 3BAYA 1WWWX 1EAPB 3CGTA 3HLAB 4D0BB 4EDWH 1UWGH 2IG2L 4X7TA 1FJ1B 4FABL 3JWOH 3QIBA 1OHZA 2APVA 4P3WA 1ZV5A 4RWYH 4GAYA 1ZT7A 3WUZA 4X0NA 3TYFA 2UY7B 1QLRA 3BSZA 5KYUB 4XP6L 3UEZA 1JDAA 3CDGA 3PXJA 5LCVL 3L9BA 2YFNA 5F7EL 4JZNA 2VDRL 1KIRB 3QHFL 5C71A 1GC1C 4P5TB 4JZJA 1BVZA 4PLJC 4GIOA 3VFVB 4HUUB 1YC7A 1MJJB 3COOA 3FNKA 1PD1A 3UZEA 3MUY1 3T8VA 4HD9A 4HH9B 4LRIA 4WGWB 4HWBH 5T3XE 2WIIA 2UZIH 3FQ4A 5IM7B 5BXFB 3IBEA 3QIUD 3EDKA 3CV5A 3RL2B 3CFQA 3MLVL 5C09B 1ZS8B 1QUNA 1FH2A 2ZJSH 1NFDE 3GHBH 4UB0H 4FFYA 5KYXA 1XD0A 1PLCA 3F00A 3AT9A 3PLYA 1NCIA 4K7PH 4Z0XA 1RURL 4FS0A 1LEGA 3AC0A 3DX7A 4HHAB 1KBKA 4UT9H 4RWYL 3UC2A 3PWPB 4J27A 1R3KA 1WAEA 3HE6D 3ZDYE 2UXTA 2AQSA 4G8GE 3QAZC 4ZMTA 2PN5A 1NQBA 5GGRY 2OJZL 4QJ4B 4XXWA 5F7MC 3WIHA 3GBEA 1NDTA 1UH2A 4P2OB 5FM5M 1S7VB 1HH9A 4KNSA 4S1QL 4BM7A 1FH5H 3GTVA 3IJEB 1TMCB 3QUZA 3D39D 2XZAH 2PO6A 1GYAA 4QJ5B 1LQSR 5K9QI 2W8CA 3P4MB 4PJHE 2IOIA 3V4UH 1NANH 2YGVA 3R1GL 4X5XB 4AVKA 4E9SA 4ZMQA 1HL4A 1H3UA 2XQBH 3GXUB 2G2RB 3FU6A 4YL4A 2JK5A 5IBLD 5BRZD 3M17A 2JB5H 3CH8A 4PJ7A 4Y5VA 2NNCA 1T5XA 4IOFC 5A16B 4WTZA 4DT2A 1UHVA 4XODA 5CEYA 3VMPA 6PCYA 4D0DB 4PJ7F 2ARWA 4LAQH 3LN5A 3GRGA 1RFDL 1E50A 3AG1B 2YLKA 3BJ91 2WKLA 2WXNA 1ZDSA 4YBQD 3P77A 1WHOA 2PLTA 3OSKA 1CZ8H 1BD2E 4IJ3C 3WGUB 1JZ6A 3M8OL 5AALA 2R39A 3GSWA 5CJQH 1FNFA 1MHCA 5BQ7B 1VIWA 2IH1B 1JK8B 1YSOA 1U8PA 3KWTA 2JB6B 4U7SA 4JUTA 1AKJA 4EI6B 3UBGA 3EYOA 5IHZB 5HVWA 2EXYC 4X6BA 1JTOA 1KYDA 4DVBB 1ZVHA 3I3BA 3QIBB 4BH7A 2XZAL 1A14L 2G5BB 3K1KC 4CSSA 4OAWA 4CC1A 1P1ZA 5D8JH 4J6IA 4FXLA 1GL4B 1SHMA 2EXSA 2CHWA 4JB9H 5F0JB 1NCBL 3T3ME 3BH9A 2MPAH 4BK5C 1KN4L 2KS0A 3KS0J 3HNSL 1I1YA 1S7TA 2EUZA 1X44A 1QSEB 3BKYH 1J1PL 3DIDA 4P2CG 3KWWB 4KTEL 4WI7A 5SWSB 5ICXB 1JNHB 2YAFA 4PYHA 2KERA 1GY2A 4XNXL 4MAYC 5HDWA 5CIPA 1NGWB 2YPKA 2PP9A 2I7OA 4AQ1B 2VKWA 4FNQA 1E9OA 3HNVL 4G8GA 1JWSA 4IS6A 1S3KH 2F58L 2H0JA 4Q6IA 4Z7WE 5AW1B 1A25A 3AACA 3CZEA 4LQ1A 1AMXA 1PX4A 2E9WA 5IQOA 4OGYL 1CLOH 5CGYC 4ZS7L 1L6XA 4BFKA 5AAPA 2WW8A 4M6MH 3PYCA 4PJBA 1MG3C 4E36A 4GRLC 4PVLA 1LWHA 5I0DA 1J0IA 3VO0A 4H13C 2I69A 4A7SA 4F7TA 3TFKD 2HFGH 4OLXH 1NCJA 3T6WA 1EZUA 3TLRA 5L2KE 1MIMH 15C8H 2VLKA 3HE7C 4YHZL 3PGFH 4JKKA 2ZKYA 3MRKA 4MHHI 5AEAA 3DPBA 2CIKB 2IPUK 1B6UA 4UNUA 4NWTL 5AL0A 3UC0H 4BIKA 2DL9A 1A7NH 4IGBB 5C3LD 1EJ8A 4JQXA 4GSDL 3R4DA 3Q9QA 3ERXA 3F62A 3EF7A 3QXTA 5I30L 2EE2A 4AGLA 4NKMA 2CBMA 3BX7C 1UWEH 2A6JB 2QSVA 3SKOB 4R97C 3UG3A 2HRHA 4MXQC 4XZUB 1PCXA 3EXJA 1ADWA 1EEZB 1FIGL 3GNML 3S36X 4BZ1A 1GZPA 1UQSA 2R56H 4X6FB 3VW3H 1ADQL 4NN5B 5D8JL 1S7VA 2AQQA 3ZE1E 5CZKA 4I2XA 1JF1B 4CSZA 4YGVB 1NOAA 5BZWB 1OD7A 5C0IB 2F5AH 4LRIC 5BOJA 3MUHL 3VXQA 2CIIB 5I1GH 3TA4D 4Y4FB 1LO5A 1MNNA 5HHOA 1OY3B 3S36H 2PABA 1TPXB 4PRDB 3VXRE 4HIEA 4PGDA 1KGJA 5KJRH 3MRRA 1ADQA 3G9AB 5T3XL 4A2DA 4TUOA 1LO0L 1AJ7H 2ARJB 5CSGA 3B2XA 4E9LA 1RZGB 3SDCA 4D8OA 4WCYL 4DQOL 1DBJH 3RI5F 4BQBA 1W0VB 3O6KL 1HSAB 3SBRA 1SJEB 2ZUYA 5LWYH 2BVOB 1EK3A 2C1PB 2QKIA 1J8HA 3QXWA 4F92B 5J57B 3GSQA 4L29A 4MS8D 1IKFH 1N10A 5LBGA 4FKHA 1BVOA 4LASL 1KENH 2LGNA 4CU7A 4OD1L 3QG7H 4HS3B 4WZ9A 2ZYIA 3E9TA 3HI1A 1KXQA 2R27A 2CO6B 1I85A 4RFEB 4U7MA 4H4NA 4PHZA 5DS8B 5T1KD 3CLEH 5BUAA 3S37L 2H8PA 1H8OA 1D3CA 1UKQA 3B7RL 2BC4A 3K46A 3VGGA 3MNVA 2JKXA 1FO0B 2XN9B 2H9GA 5DURD 5TPWH 5DZVA 1KGWA 2NSQA 4LVNC 5BZXA 2J5LB 1SOXA 4W6XB 2Y6SC 5CILH 1CVSC 4Q0XH 2J56A 2BH0A 4A7VA 2P5EB 5E5RB 4JGMA 1IAKB 4J12A 1RK1B 1TUPA 2XNAB 1OF0A 1EDYA 1JZ3A 2G2NA 3N1MC 1MW0A 4YSOA 2F53B 4BGDA 4WCYH 3HZYA 4OZIE 1B2WH 4K94C 4X4MA 2AV1B 5D1XA 2ENSA 4UF7C 5TF1L 1TJIL 4I2XB 4A6YA 3Q8CA 4JFFE 3CVDA 4YL9A 5I1CL 3L5WA 3DRTA 3S88H 2YUVA 2JLLA 1V5JA 3MA7A 4KK5D 1S78C 1U0QA 4KGJA 4X7EC 2NMSA 4XO8A 5KSVB 3NACH 3NJJA 4R0LC 5LGYA 1K6QL 5DD6A 3NSFA 4NRXA 3NFPA 3DUUB 3Q8EA 2C4FU 1CK0L 1NBQA 3P30H 2QDWA 1J18A 4G3YH 4OFYD 4PIRF 5CSZA 5JR1L 4HIEB 4PGDB 4D9RD 3LS4L 5AUMB 4A2FA 4R96A 2ZP9A 3J8F7 1HWWA 4ZXBD 2EUWA 4MJIA 4IKLA 3H9SA 3QH3A 3TT3L 2R0ZH 2UUDK 1PY9A 2BP3A 2FHCA 3GMPA 3NPZB 2CO7A 4ANXA 1CXHA 1G7JB 1BEYH 4U1SA 5DK0B 4XE5B 4PJIA 5D6CA 3WUWG 5CILL 1PZ5B 2PWEA 1TTCA 3TH4T 4BSVB 4CDHA 1E4XH 1C1EH 2GK0A 1QNZL 4MHHG 2D3VA 3U4BH 2R2EA 3MR9A 5DR5H 2MEJB 4I9WD 1MCBA 4IBYA 5IGXL 12E8H 3C5ZB 4OF6A 4E41A 1MREL 3QI9B 4LIQL 4FMVA 3RB5A 5KYYB 1XZ0B 1ZA3B 2PCXA 4UMSA 4AVIA 5JIHA 1LK2A 4F9PC 3FSZA 3QG7L 4PJFA 4U1LA 3E3QC 2G0LA 1AZCA 3FQUA 3OB0H 3FN3A 5E2WL 4PWGA 3X1GA 2V2XA 4MNQD 2QGBA 4Q4IA 5H94B 4X9GA 1XGYH 3IMVA 1VADA 2NZ9D 1I9EA 1WAPA 3TH2T 1HI6A 4Y4HD 4LSTH 4OKVA 4Z18A 2H2PD 1MIEH 4DGIL 1FNGB 3TVMD 2G4GA 2W0KA 4PJAA 5E2TH 1P53A 1AR2A 4EIUA 1EO8L 3U7AA 3KLHC 3EDEA 4RISH 2ERJB 1EDHA 5DVPA 4PRAB 1JMZA 5A43C 2OM5A 2XX1A 2OCCB 4LSVH 5CR8A 3VH8G 5IT2L 3TV8A 2FD6H 1BECA 4KDVA 4LP5A 3K6DA 5FGCB 3F5WA 1XAUA 3FF7A 4XNUH 1DN2A 1P5VA 1PS3A 3EFOB 4ELKB 1AQHA 5EZJB 2XETA 3DX6A 5MENE 2JIXB 4F8QA 5B22A 1A7QL 1NEZG 3O9WC 4FQ1L 3ZL2A 5DU7A 5A2AA 3KE0A 4ZZFA 1FNSH 3WMSA 3GRBA 1RIVL 1WBZA 2BNUA 3JBG7 3WY3A 1DEDA 2APWA 4ZUWB 1ZMYA 4WW1B 4OZFB 3D08A 1MRFL 3BN9C 2IDTA 3ZQXA 2VLRD 3UFIA 3V6FA 5AW7B 4N68A 4BYHA 1FZOB 4MYWB 5D96C 4OGXL 3T0AA 3OHXA 3G5YA 2NY2C 1NCGA 1E4JA 1JHLL 5I74C 1EFQA 1I7TA 1BVLB 1W8EA 3BDBA 3P77B 1DQVA 2IV8A 4Z7VB 2ZOUA 2D8KA 1QNZH 5EUOA 2EVFA 3HE6B 4UUJB 1A3LH 1TTRA 3UMNA 4N26A 1E90A 2IAND 2ENYA 3AUVA 3MLWH 3EYOB 4H8WH 3QFJB 1CD1B 3L7FA 5IHZA 5KSBE 2AZAA 4X7FC 4HP5A 4PCKA 5GRJH 4HXAL 2EINB 3N43F 2VDPL 1KB9K 4F7EB 3MBWB 4W9CC 4Y1AE 1DVFB 4H88L 2H2SC 2PUQT 1WH0A 4JANB 2BZDA 3EO0A 4N2KA 2K6ZA 5C0DA 1S7XA 3T0EE 4PJCE 4HK3J 2VAAB 2C7FA 3OV6A 3TJEH 3MTXA 1KC5L 2H1LM 1AI1L 2DAVA 1MLBA 3BPOC 3G7TA 4QWWD 5JIQA 3HC0B 3UBXI 4DGVH 2YSSA 5D72L 5E00B 4OLYL 5FM8A 1PX3A 2OMVA 3SN6N 5HPOA 2BZ7A 1YEWA 2G2RA 2G3MA 3RVTD 1XMEB 1HDMA 3QO1A 2G3XA 2NZ9C 3CD4A 2IOOA 4U3SB 5H37A 1UFUA 4CADA 5FYJL 4J8RA 5GS3A 4XVUC 2X4UB 1V10A 1PYWB 4E9WA 3MX0B 2AJYL 1QFHA 1ZLEA 2DLTA 4HFUH 4X50A 4WO4C 1J1OH 3APCA 4EQ3A 1X9QA 4AQEB 5DZOA 2UYLB 3REVA 2N4IA 4N0UA 3SDCB 3V6BR 1V55B 4G8FB 5AYUL 5C0GB 5D2LB 1UVQA 4LK4A 4WUUE 3ARED 1OGAA 1X5KA 2FBOJ 2VSDA 1S3RA 5HVGB 3MRLB 2DS4A 1U91A 2O5ZL 1OKEA 2ZWYA 1TO5A 3KBPA 3DVGA 4DO5A 2NT0A 5LCVA 2VDOL 1I3GH 3T6XA 3B1UA 2P5WE 4EDWL 1R3LB 2A9MH 2CUAA 2EH8H 4XTRC 5FW6A 2YXWA 5L4IA 3VVVA 3ZTJG 5F7BA 5KSAA 4O02L 4OM0L 2R4RL 5B4MC 5ID0B 2Y9RT 1U8NA 4YSRA 3D39B 1EEYB 2IAMC 2VDKL 4ZMNA 5KTEH 2IGLA 2EDQA 4AG4H 1DJSA 4U0RB 1KN2L 1H6EA 5GJSH 3B5HA 4DP8X 5ANMB 3ZSSA 1BQLL 4IK6A 1MFAH 4W81A 5D7EA 1NAMH 3VE0B 3IDXH 3A3YB 3FSWA 3ML8A 5PCYA 4N8CH 2FR4B 1Z3GL 1KTBA 2YGPA 3FQ2A 4X6EB 3DTUB 1BAFH 5GZNA 2BJMH 5BZZA 3CIAA 1SF3A 4X8XA 3AJ7A 2L04A 5B3SB 3EDJA 2UY7A 2J6EA 5EBGA 2ZYHA 4DK3A 1E43A 2P5ED 5JNYB 4XC3H 3NPSC 5TQ0L 3MUGB 4KU1A 3N06B 2E74C 2Y1ZA 3KWUA 5EUOF 4BUHA 5L8LB 2IO5A 2FE0A 2V37A 2XN9D 3UBFA 2D31B 2PO6D 2ICEB 3TX4A 2R1YB 3QEQA 5DJDA 3ROLA 4K7PX 1HKLL 5TH2A 4UTAH 1QO3B 2BOBB 5C0AA 5HVFB 1FYTE 5IFAL 4WUUB 1JVOA 1E0OB 3P73B 2FQGA 4PJXA 3B9EA 2XV2A 3Q5YA 5FHBH 1NH6A 1AD9A 2AJYH 2ZX7A 3VI4E 5IJCC 1IARB 2XA3A 1B3JA 3QFDA 4IJ3B 1EQWA 4LNRB 4U1GB 5SWZE 3N0PB 1N9PA 2H6PA 5T3ZH 3NH7H 4M43L 1ZLSH 4EZJA 1BQHA 3WNIA 1G6RB 1IFGA 4PJCA 1TEGA 3QORD 4V2CB 4H8WC 2FWOA 3ARRA 1QRKA 3RGBA 5DS2A 3DGGB 2QADB 1KCWA 3MLTA 4JO3H 4ZT1A 4JKLA 4WUUA 3KXFD 3IDGA 1JNNL 3N85H 4QOKB 4BXSV 2AVGA 5DJDB 3ROLB 2P5WD 4R3SA 3EH4B 2OMVB 1WEJL 4HFWA 5F1OB 4ETQA 3O3AB 5IB2A 2NDGA 4OTXL 4KZDL 3ARGB 4IOSD 1CF8L 1KACB 3L9RA 1TU2A 3MPCA 1MXGA 3ILQC 5IEKA 5LNDA 4RGOL 1N7MH 3VFUA 1JTTA 5IK3A 2H45A 3UYRH 4XAKE 3KJ6H 2X0UA 4XNZC 1C5BH 2CMRL 2OMWB 3GHEH 4FYSA 3UTSB 3LPFA 1A3RL 4Y2DC 4ZO9A 3VSUA 1XAKA 4PJ7B 4Y5VB 3UL4A 3RFZB 4RMQA 4X6CF 2PYED 4H25A 1OOWA 3MV7B 2GUYA 2WD0A 4WNQA 2EADA 4O4YH 5KSUB 5BS0D 4P9ML 3HG1E 1D7DA 2QPSA 4IRJC 1ULVA 3AXIA 4W9IC 1FVDB 1SOQA 2WBJA 2ZF8A 4G1EB 5C9KA 4NKIL 4NENA 5CKAA 5L6YL 5IEKB 5CXPA 5D5MF 3ARSA 4NJ9L 4GT0A 3PAVA 4C56E 2IWKA 4KI1A 2GTWA 4EN3A 2VXVH 4Z7VF 4F9LA 1I8KA 1IM9A 4AMWA 5F7KC 4AYDC 4JGNA 1O9VA 4X4YA 4RBPH 5B38B 3QXDA 2R7EB 1N5AB 1M53A 3RWJA 4D0CA 4NXKA 2B9AA 3WLBA 1D5MA 1DUZA 1P7KA 3IFNH 1ZJAA 1BJ8A 1SDAB 1AC6A 2E3VA 3RNQA 2R1YA 2H6OA 3EW3B 2ADYA 3DV4A 4ZOCA 5KG9A 2OJEA 4LOVA 5KS9B 1MFCH 1AAJA 1ZHNA 5C07B 1GKOA 3NP3A 3TN0D 4PP1C 3W81A 1G7MA 5E4OA 4NQDA 4WHDA 2VLJA 3QZBA 4LOUC 1JK9A 1I1AC 1MQKH 1SZNA 3B8YA 1WZ1H 5G4MA 2HKHL 3D52A 2EEAA 1ZS2A 2CKBL 4PN6A 4EN3D 1KB3A 3D30A 4G6FD 1HINL 1Q9WB 4B9KC 4PJCB 5E24E 1RERA 4MXVE 3SY6A 2CDEA 2WBJD 5AAMA 3RVVD 3OJDB 1ID5I 5T5FL 4OGZA 3X14A 1NPNA 4HCRH 4W9ZA 5AW2B 4L3EB 3S4SG 3BSHA 4LCWA 3RDTA 1LL1A 1KZYA 1F86A 2CKBA 1OM9A 4DTGL 1S8DA 4MXWL 2E9GA 5GGVY 3DVNB 2A6KA 4HV8B 3VWJA 4XCCL