3PAVA

The reduced form of cueo
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
487
structure length
466
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
publication title The reduced form of CueO
rcsb
source organism Escherichia coli
total genus 135
structure length 466
sequence length 487
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA03
3S3BB 3ZX1A 4BWUA 1NZRA 1TEGA 2VW7A 3FSWA 1OOWA 4KO9A 4PAZA 1SF3A 4HALA 1ZDQA 3NP4A 2GBAA 1J5DA 4A2HA 4E9VA 3OQRA 2XYBA 5I6PA 1BQRA 1T5KA 2YAQA 3UAEA 4GYBA 3WKPA 2GC7C 3GYRA 2PPFA 4UF7C 4KO5A 5IY5B 3S3CB 4G7SB 4KO6A 4HCFA 3H56A 3FYEB 3WKQA 2IDSA 1GS7A 1SF5A 1CURA 3NSDA 3OMNB 2RACA 1XMEB 2FQFA 3FSAA 1JXDA 3WI9A 3HB3B 2VN3A 4FAAB 2CJ3A 1ADWA 4P5RA 2YXVA 1AIZA 1X9RA 4A66A 2PCYA 1TEFA 3X2QB 5LDUA 1NDTA 2PPDA 4AZUA 1A8ZA 2MRYA 2AZAA 8PAZA 4W9ZA 3AG2B 2IH9A 4GY4A 1AZRA 4DP2X 2AFNA 2ZOOA 3AZUA 3S8GB 2VM3A 2XV3A 1V54B 3QJTB 1KDIA 1ET7A 3BVDB 3UABA 2FT6A 2XV0A 4HCIA 3C75A 5B7MA 1AS8A 3QJVB 5I5IA 2YQBA 3V9CA 2BP8A 3NT0A 3OM3B 4KOBA 2IDFA 7PAZA 4P5SA 1ASQA 2Q9OA 1CYWA 1KCWA 3N55A 1GW0A 3EF4A 4M4RB 1PCSA 1IBYA 1PZBA 5ANHA 1GY1A 2CBPA 1CYXA 1FA4A 3NJGA 4E9SA 1J5CA 2EILB 4DP4X 2FT7A 1BEXA 2DWTA 4G70B 2Y69B 1BAWA 1NPNA 3ABMB 4DP5X 2WO2B 4YSUA 2VM4A 5D4IA 1NPJA 3WNJA 2PP9A 1PLBA 1JVLA 2PPEA 1XB3A 4YVNA 4HHWA 4AKPA 2H47C 1RZQA 1BYOA 2XXGA 3FQYA 3TBCA 4RH4A 1NICA 1L9PA 2R7EB 3G5WA 1SDDB 3S3DB 3T6ZA 2CAKA 2OV0A 3OMAB 3WG7B 5B7EA 1PAZA 5TK4A 5I5JA 4F7KA 3S8FB 2XLLA 3TU6A 4JKNA 4DPCX 1NWPA 3IE9A 1L9TA 4E9QA 5E9NA 4AI7A 3NJIA 1L9OA 4MFHA 4YSPA 1M57B 2XXFA 4UAHA 1OCRB 1TKWA 1YLBB 3NYKA 1J9RA 5I6KA 2UXTA 3ABGA 3UACA 1RKRA 5F7BA 3CZUB 1NTDA 1ZIBA 3ERXA 1SNRA 2AVFA 1E67A 1ET8A 1AZUA 5AKRA 2GI0A 5AFAA 1WA2X 4G71B 1KBWA 2IDQA 3EH4B 2GIMA 3CG8A 5EHFA 2HX9A 3OMIB 1A4AA 1AG0A 1BXUA 2YAFA 4N8UA 4A2FA 1PLCA 2PPAA 1ILSA 2HZHA 3V9EA 2GC4C 1AANA 2B3IA 1SFDA 4A2GA 2JFCA 3T6XA 1HFUA 3CDZA 2DYRB 5B1AB 4YSCA 2J55A 1OE2A 4BDVB 1AZCA 2BP0B 2PP7A 1A3ZA 3PXLA 2XUWA 1KDJA 1EHKB 3QJRB 4BK5C 1JZEA 4YSTA 2QPEB 1KYAA 3UAAA 3NJHA 5A7EA 4QLWA 1WAEA 3D12B 1OCOB 2XX1A 4F2EA 2X88A 5I6MA 4E9RA 3SQRA 1PF3A 3NSCA 4DP6X 1IC0A 4YVUA 4YL4A 1OE3A 1M9WA 4AKOA 2J56A 4HZ1A 2UXFA 1L9QA 1L9RA 2YAOA 5TK2A 3TBBA 2Q5BA 1JZFA 1GS8A 1B3IA 2P80A 5B1JA 3IEAA 3QQXA 4PCYA 1OE1A 4QKTA 1JZJA 1PZAA 4YSRA 3GXUB 3ASNB 1GYCA 2XWZA 3JT2A 3KW8A 4KNTA 4KO7A 3FQ1A 1ID2A 4E9XA 4NERA 1AS7A 2FQEA 3FU7A 2VSKB 1XB8A 2E86A 3NJMA 1UATA 2H3XC 4AKQA 1CC3A 3T6WA 1PZCA 2FWLB 2VW6A 2HXAA 1X9UA 9PCYA 3AW5A 2IAAC 3PAUA 2LLNA 3UGEA 2I7OA 1KBVA 4FA7B 2HLEB 2TSBA 2FTAA 2YARA 1E30A 3FT0A 3OD3A 4DP1X 4DPBX 1AG6A 2QDVA 1ZDSA 2XU9A 2R7EA 3WNIA 4ENZA 1SDDA 1VLXA 2WSDA 3QJSB 3T71A 3FYIB 3ASOB 1MZYA 4TXVB 1ZPUA 5I26A 3AG3B 2A3TA 1NIBA 2VSMB 3FPYA 3T9WA 1BQ5A 2XV2A 4CSZA 2FT8A 1PMYA 4KOCA 4HAKA 2Y1AA 1EZLA 1MG2C 4KNUA 3H4FA 3WIAA 4GP4B 2DV6A 3X1FA 4K9JA 1A4CA 1OCZB 3X1GA 4YSEA 3QPKA 2YAPA 1BXVA 4WKXA 1URIA 1WS7A 2FJSA 1W6LA 4F2FA 5B3SB 5FC9A 4BWTA 1ILUA 3NSFA 5PCYA 2ZONA 1L9SA 2IDTA 4A67A 1JXGA 4A2EA 1BQKA 2BWDA 3DTUB 1JZGA 4DPAX 3HEIB 2YAHA 3QJQB 4HIPA 2DWSA 3EH5B 4A68A 2IWKA 1E5YA 3NSYA 1E65A 3KW7A 4M3HA 3X1BA 4YSOA 5F7AA 1TU2A 4A2DA 4BDVA 1MZZA 3PAZA 1HAUA 2IWEA 3H4HA 3NJKA 1MDAA 3CVBA 1JOIA 3X1NA 4BXVA 1NINA 2HX8A 2BP8B 1AAJA 2XVBA 1QHQA 3CVDA 1F56A 3BQVA 1AQ8A 2UXGA 3MX0B 2CUAA 2W8CA 2IH8A 1PNDA 3AY2A 1M56B 1DYZA 1ETJA 2EIJB 2CCWA 3FSZA 3DIVA 3FSVA 5I6OA 2PCFA 2OJ1A 4JHVA 1BYPA 3ABLB 3JTBA 4BXSV 3SBQA 4YSSA 2WO3B 2BHFA 1PNCA 2JXMA 4Q8BA 5I5MA 3ZDWA 1IBZA 1ASOA 2DY2A 1AACA 1AR1B 2AANA 2GB2A 3FU9A 1FWXA 2PLTA 3U25A 2DYSB 5I28A 5B1BB 1JZHA 1OV8A 1E5ZA 1FFTB 1JVOA 2ZXWB 1WA0X 2XX0A 1AZNA 4BWWA 2PP8A 3FU8A 1WS8A 1N70A 1WA1X 2HX7A 2HRHA 3IN0A 1A65A 2I85A 2HRGA 2IWFA 3EHBB 2BW4A 3N2JA 4G7RB 2CALA 3NJLA 2UX6A 1GSKA 2VMJA 4G7QB 4E9TA 4YSQA 4NAJA 1BXAA 2YAEA 3SBPA 3NJNA 2TSAA 3UADA 3CVCA 4GP8B 4HHGA 3ZBMA 4NB7A 1HAWA 2BO0A 1J9TA 2FQGA 5I6NA 2AZUA 1W8EA 2EINB 1J9QA 1JZIA 1PLAA 4KNSA 5B7FA 2OCCB 1SJMA 1I53A 4DP0X 3NJJA 2EIKB 2MTAA 4N4YB 4GP5B 3T6VA 4W1TA 4DP8X 1QLEB 2YXWA 3QJUB 2BZCA 1AS6A 1NWOA 3CDZB 1GY2A 2NRDA 3FPXA 1JXFA 2GHZA 2UX7A 3AG4B 3RYMA 4Q89A 1CUOA 3NP3A 7PCYA 1AZBA 2QPDB 6PCYA 3ABKB 2W88A 2UXVA 4YSAA 3PAVA 1MG3C 1IUZA 1V10A 1XB6A 1ZV2A 3SBRA 4CSPA 4X4KA 2IDUA 5PAZA 2VW4A 1KCBA 3PCYA 5B1JC 1SHXA 3NJFA 3ZIYA 4AX3A 1OF0A 1W6WA 1V55B 2YAMA 3DKHA 4DP7X 1R1CA 5D4JA 1ET5A 1NIFA 1IKOP 5B1KA 3TASA 1RZPA 3FU7B 4JHUA 3TA4D 4DP9X 1JERA 4YSDA 2GSMB 1QNIA 1NIDA 2EIMB 2X87A 2BP0A 3FQ2A 1J9SA 3MBWB 1RCYA 2QT6A 4G72B 4WTQA 3AG1B 3PPSA 2I7SA 4E9WA 4UANA 4ZK8A 1DZ0A 2BZ7A 4HCGA 2B08A 2FNWA 2N0MA 2J57A 1KV7A 1NIEA 3PLYA 1KGYE 4EF3A 1A4BA 1AOZA 2H5UA 2P80D 2JKWA 3L45A 2BW5A 1GR7A 2FQDA 5AZUA 2PPCA 3IBOA 2QDWA 5D4HA 1NIAA 4L0PB 2BWIA 1ZIAA 1PY0A 4E9YA 6PAZA 3EH3B 1N68A 5I6LA 3GDCA 2ZWNA 1OCCB 1SHWA 4GXFA 1ASPA 3IN2A 3FS9A 1SFHA 1GS6X 2J5WA 3X1EA
chains in the Genus database with same CATH superfamily
1QW9A 4PMEA 5DMGC 4JM2C 2XFGB 4W9EC 5I17B 3FCTB 4HK3J 3K5SA 2DQTL 3GMLA 4B6ZA 2E7BA 1EGJL 1VGKB 2E9BA 2VE6A 5T1KA 4IMLB 4Y4HB 1EAPA 2EO9A 2F54E 3ARFA 3LIZA 2C9SA 5ID1B 3GI9L 1GKEA 2DPKA 3TNNA 2AJ3A 3M7OA 4ZPTA 5KZCB 3ZL4L 1H19A 4JY6B 5DD3L 1XEUA 5EUOB 1W9XA 1OARL 3MXVH 5EF0A 1NGQL 4Y7OC 4CU8A 2Y7OA 3DROA 3JXAA 4HFWB 2NR6C 4IOIA 3NDYE 4ZO7A 1WWBX 4IOSA 5FECB 2XN9A 2ZTBA 4HSCX 1THCA 3VRLE 1F45A 3S34H 4WQOA 2YJQA 2A4ZA 4OF6A 2ZUQC 3RA7L 4TLUA 1LWJA 1NANI 3QFDA 1NA8A 2DYPD 1HKLH 4FLSA 4EIZC 1TCRA 4LHUG 4LSVL 1MW0A 3HFMH 4OJCA 1CT8A 3D39B 3DMMD 3OF6A 3OHXC 2MRYA 3GTTA 2Y24A 3X12B 3EO1A 4NAMA 1YMMB 2FE0A 1A1OB 1GZQA 2DKSA 3HBGA 4LSRL 4QD2E 5KYYA 5E6ZA 3BSZA 4NQCD 3I3DA 1NOAA 2QVTA 1EQWA 3MCLL 2XV0A 2UWEA 4LDOB 4NO2A 5LCVA 3VB9A 4MVBD 5I5IA 5BOPA 1W0YT 3EFDH 4XGZB 3UAFA 3V9CA 2DQUH 1W72H 1F8TH 5DUJA 1QRKA 5GRZA 3FNKA 4LLUA 3CFUA 1JNNL 1XVSA 3ZN6A 5K9JH 2B14A 3L3HA 2Z8RA 4A04A 1USQA 3OKDA 3DX7A 2FWOA 2JK5A 3MRBB 4XMUA 1CI5A 1AGDA 4HS6B 1SRDA 3OJ2C 4HS3A 3RU8L 1K8DB 4KKAC 4DEUA 3VWJA 1G7LA 1RI8A 2GT9B 3CHOA 2B1HL 2XCMC 4UTBH 1QA9B 3QNXB 1J88A 1NC4A 3H7BA 4M43H 3C5JB 5HJBA 1HIML 4P5TA 5I1JH 2NY0B 3MRHA 4FHKA 2BIOA 1IQWL 1CS6A 3RHWK 3VE0A 3VXRA 2EYTA 1JNLH 1DQKA 3VD1A 1HSAA 2FEEI 3DIDA 3MRIA 4ZXBD 4CVZB 4GQ9H 4WTZA 1UXMA 3DX9A 1KPUB 2ZCKL 4PB9H 2IOMA 2BCMA 4QHKJ 4R3SB 3BVUA 4RGMB 5I8CA 4I85A 1A1NB 5DJDA 4YBLB 1DQQA 3O3AB 1NAKH 3P30L 1MHEA 2GYSA 3QUXC 4JKNA 1OAUH 4G9FB 4AYFB 3AITA 3E6HA 4QHNA 4HIIA 4L29A 4Y2OB 5CZRA 4M5ZH 4XAWL 4F7MA 3FHQA 3VXMA 3D87B 4EZKA 3F6IA 1BX2B 5EF3A 5CEZH 4HQQL 4MRCA 4NS0A 4XWOC 3VB8A 4YHYB 2V7NA 2V2TA 4HDIA 2DTMH 2F7QA 4L2LA 3VGHA 5EO1A 3UG4A 3UMNA 3VXOB 3ESNA 2WLIB 4J39A 2JLPA 2ZYHA 3NABL 4G71B 4RRPM 4L1TA 3EH4B 3TJHC 1N8ZA 4OIIL 4EUPA 5AG9A 2GJZA 4Q2ZA 4L8DA 5CN2A 1P5VA 3ULUC 3OG6B 3UP1A 2E7HA 5AYUL 4YHZL 5HHXL 3PPEA 2EXYD 4NWTH 3VGFA 4RX4D 4Q9RH 3QIBD 3MREA 1MJ7L 1JWSA 1L4IA 2WW8A 4OZIB 2NPLX 4XCFH 2OM5A 3T3MF 4X99B 3UYRL 3FQXB 3CFEA 2OPCA 2W92A 4HKZB 1T1ZB 2H32B 2ATPA 2BS9A 2NDGA 2VT0A 4CUCA 2I9TA 4G42A 1G7QA 3VD9A 2LU3A 4Q9CA 3GZKA 3UBXB 4WU7B 5GRJL 3QCUL 4GPVA 4YO0A 2F53A 2VERN 2KT6A 3FHEA 3TPUB 3P3UA 1YNLH 1PF3A 4RDQF 4WEEA 1E4KC 4YL4A 5ADPH 1XDTT 2R2HA 4YL9A 4AKOA 5CBAA 1S9XB 5BNXD 2UXFA 5TK2A 1I8LC 2YD0A 1QNZL 4GQRA 2OK0H 2DQGL 4KRPD 5E6IC 4O2FB 2ZD0A 1S5HB 1WD9A 3WE6B 2Q3XA 4GG8A 4A1RA 1NKRA 4I9WD 1PSKH 4U6HA 5IBTH 4BFNA 3GBDA 4JO3H 1YCSA 1ZMYA 4XP9H 4TQHA 2WXPA 3QB7C 3QUMA 4HFUL 4ETQA 3FAXA 3IDXH 3PQYD 1NGYB 5IM7A 4FQXC 3RUGF 1DO6A 4CJ0A 9PCYA 2LLNA 1U33A 3C9NA 3GMLB 4NZDA 3CNKA 3F12A 4PV9A 4BUGA 3OLIA 2VE6B 3HG4A 1R3JA 1I8AA 2FHCA 1EAPB 5DXWA 3FONA 3N50A 3ARFB 4G8GE 3S7GA 5JOPD 5A2IH 4V1DA 1GVIA 5HD8C 3FYIB 4H1LH 4K8RH 2VRQA 3TNNB 4DGYL 2AJ3B 4KXCA 4OKDA 2W5PA 4ZPTB 2AQ1A 3EW3B 2Y7LA 1F4YH 1M6UA 1VFUA 4MYPA 3BFQG 3DYMA 1CIDA 3QUYA 2VXTL 3SJVD 1Q94A 1A7OL 4NPYA 3O9WC 5F0LB 2CA4A 4IOIB 2XN9B 4DCQA 2BFVL 3EJCA 3LS5H 4G6FD 4GP4B 3X1FA 3K1DA 1KYUA 3K6OA 1ZRUA 1DLFL 4ZDHA 5JHDD 4M6NL 3GKWH 2MJWA 2AVGA 3OTTA 4J6RL 3SDDD 1TCRB 1HQRA 1HHIA 3CVIL 1MFMA 3EJQA 5HVGB 1CT8B 1V5JA 3VG0L 3E7JA 4JQVC 5TE6H 3ZK0A 1MJUL 2AJYH 3OKEA 3EO1B 2EDWA 4YX2L 4AGMA 1GZQB 5IW1A 3F00A 4Q0XH 3V4UH 5F93C 5KYYB 1OD9A 2YLHA 4XN2A 1A22B 5LGHH 5GS0D 1EEYA 1RZJL 5D4QA 1YA5A 2CZNA 4WVRA 4Z7UA 3QAZC 4LGSB 2UWEB 3UROR 3V0WH 4NO2B 2UUDK 4JB9H 1LDPL 2VITA 3ROOA 2VLKD 1OCWH 4I18A 2JSFA 4FFWC 2R59A 4PJXA 3E8VA 1OAKL 2J7LA 3BPNC 2F19L 2VO8A 4RRPG 3CVDA 3MNMA 3QISA 3L3HB 3LKOA 2FWSA 4N24A 4WJKB 4OGAD 1CYGA 3OKDB 3S35H 3DX7B 2FWOB 2IH8A 4JREB 2JK5B 4OZIF 3HIZA 2A4CA 4HWNA 2D7NA 2VDQH 2A7BA 4QAWA 2FB4L 2AJVL 5M95B 5JO5B 4J3OH 3HBZA 4HS3B 3TZVC 3NH7H 4PP1D 4YZWA 1CD9B 1CLYL 1FNLA 4JFOA 2P44B 1IB5A 3VWJB 3FFCE 1G7LB 5GZOD 1KEGH 3TNMA 3B9EA 3KJ4C 2JNZA 5L2KE 1NC4B 3H7BB 2HT4C 2ZYRA 4XOEA 4P5TB 5KSAD 1A7PH 3MRHB 1ASOA 3VE0B 5C6TL 4FQLH 2EYTB 4MMXB 1HSAB 3JYBA 4WU5A 1KT2A 5ICZA 1CU4L 1X5JA 1HE7A 4Y4KD 1JZHA 1MHPL 3DX9B 3UG5A 5AWNL 4NP9A 4A7UA 5MP6L 3KS0J 4TTDC 3OQ3B 2ZXWB 5D71H 2CBQA 2EZ0C 4HWEH 3GXFA 2AMGA 5I8CB 4XXCA 4Z6AT 1KYOK 5DJDB 4ODHL 1DQQB 3GSOA 4YFLF 1MHEB 5E9DB 4CSTA 3IJSA 5GGSY 1ZWIA 2JMRA 5GGRY 4ZD3H 2V3DA 2IFGA 3WXWL 3MUJA 3E6HB 1RURL 4QHNB 4HIIB 4R0LA 3W0WD 4U6VL 3AB0C 4Z18A 3VD7A 1KZQA 4F7MB 5IJDC 3VXMB 4WHYH 3L3JA 4L9LB 1NCCL 1ZXQA 3VSVA 5IMLA 2YKKA 4C56D 4OW6A 2WNGA 1DUZA 3SPGA 2V7NB 2WTRA 4M62L 4QXTA 4HDIB 3ZBMA 5JOFA 2FBRA 1EGJH 2V2TB 5EO1B 1GGBL 5I71C 1PG7L 4XCEB 1GKOA 3HNVL 4JO2L 3ZUCA 4UNTA 4KY2A 3RIFK 2PYFA 4EUPB 1N8ZB 4WNJA 2GJZB 3KNBA 4Q2ZB 4L8DB 4X8GA 4N4YB 3O8XA 4ZFQA 2ALWA 3KPSA 2CDGB 1P5VB 5KTEL 4ODSH 5CN3A 3KBEA 4HBCH 3G5VA 1LM8V 1U8LA 1PEZA 4JO1H 1DEEA 3ULVF 4TSBH 2WVTA 3O6FD 4HEPA 4TM9A 3MREB 4M4PA 1JWSB 3STBA 2WK2A 1UCTA 2HTKD 1CL7L 1QBML 1J8HE 3CFEB 4NN5B 1VFOA 2I9TB 1CUOA 3G08A 4G42B 1G7QB 3NP3A 4JM4L 2A0LD 2QPDB 1SXNA 4YO0B 2F68X 2F53B 1G7HA 2IH3A 3M1CA 4B9ZA 2MPAH 4WI0A 5IREA 1NCGA 2XOTA 3W3BA 3QDGA 3VFMA 2R2HB 3QUZA 5CBAB 32C2A 4YDJA 4X4ME 4W9IC 4Y1SA 3MLRL 3ZYJA 3LN9A 2UWEF 4U2ZA 2GJ6A 3HMXA 3VSTA 4L3CA 4GG8B 4HWUA 5TE4H 3BDBA 4U6HB 2X53A 3RPIA 4PH8A 2ZNWA 4CBPA 1XQ4A 1CFVL 2IFFL 2CKNA 4E42A 1RZPA 4D7PA 5SWZD 4DP9X 1F4WL 3M8OH 2GSMB 3QUMB 2BVOB 4ETQB 1F3JA 2EIMB 4OAWB 5IM7B 2X87A 4FGMA 3AXHA 2Z6FA 4CSSA 1JAEA 4IKKA 1C5CL 4WTQA 2AEOA 4QTFA 2HAZA 4IS6A 5C6WH 5M94B 1YN7A 4UANA 4OJYA 4MXQD 4PV9B 3TH4T 1R3JB 2EH8H 4JRXA 4HMEA 5E2JA 1OOAA 3EJRA 3F01A 4V1DB 4N5UA 2CPUA 1JV2B 1O7SA 1URZA 1ZE3C 4X80H 1XF2A 3CDFA 1FH2A 2VL4A 4OZFA 3QW9A 3QUYB 3O11B 1JMZA 4PGZA 1Q94B 1AXSA 3ASWA 2CJSA 4KKLC 1P5UA 1J5OH 2YUVA 3MOBL 1PEWA 4OSUH 4DCQB 1USZA 3L7FB 4FZEL 1C7SA 5KYNA 3ARDA 4ZDHB 1UD4A 4BWUA 5TQ2H 4J3SA 4Z7NB 1Z9SA 3U83A 2Y36L 4JRLA 5FDWA 3UTOA 5KVEL 1CGYA 1HQRB 1Y6NR 3BEVA 1HHIB 2BSTA 4HJ0D 2R4SH 3IMRA 5EV7A 5DZVA 3WNMA 4PQXA 3OKEB 5E1AA 3FFOA 3Q2VA 4P07A 4XOCA 5IW1B 1XEDA 3TVMD 4UINH 2YQ2A 3T0EA 4K94L 3D39E 5E2UH 4DERA 1I9IL 1Q72H 1EEYB 3QYMA 3EYSH 3HZKB 1YNTF 3NEOA 3S5LA 1XGYH 4XPHL 3C5ZC 4HU8A 3GS4A 2F8XC 1T1WA 2VITB 3A6CL 3BH8A 4N0YH 3ROOB 4I18B 3SDCD 2H2PD 1F58L 3UTPD 5JPNC 3UJJH 1WBXA 4PJXB 1TTBA 2NYYD 3QJHA 3HKZA 2YZ1A 4NENA 1JS4A 1EDYA 1E6OL 5TF0A 5TTRA 5AW3B 4R4FL 5B8CA 4P5KA 1EMTH 1QYGH 4APQC 4XNMA 3GHBH 2LV4A 5HDBB 4ENEC 4MMYA 5D5MA 2NX5D 3G5ZA 1IAII 4EIGB 4JFOB 3MRCA 2X41A 12E8L 1AZRA 3F7PC 3AAZA 5E2TH 1W72A 4TLTA 2D03L 4HWBA 2YD7A 3TNMB 4E2OA 1T1XB 3VXPB 4LSQL 3EG9A 3EOYG 3BP4A 3PS6A 4ZZKA 4AYID 4HCIA 3S3PA 3C75A 4MJIE 4RMQA 4WU5B 3CK0H 3ZO9A 1KT2B 1KCUH 3B5HA 5ICZB 1LDSA 1QFUH 3AXLA 4XVTL 1TQBC 3E0GA 3N1PC 4XO5A 3MRLA 5GSRA 1DQIA 3I9AA 2IDFA 3PWNA 3SKJH 3CFCH 1M3JA 2OCFD 1OM9A 2APVA 1Q90A 2Q9OA 4ABWA 3IJSB 1IC4L 1PCSA 4TRPH 1ZWIB 3ZDZF 1CLOH 1GY1A 4A7GF 2JF1A 4PP2A 3BVWA 1TZAA 1P6AB 2ED8A 1NKGA 3MRJA 5LN8A 4R0LB 3AREC 1JZ2A 4F1SA 4YHML 2XSKA 4TLKA 3E3QC 3L3JB 4K5LA 5IMLB 2DMKA 4Y8DC 3TURA 4HH9A 2WTRB 4QXTB 5JOFB 4W9HC 1J0YA 5TDNA 2D2OA 1DBML 4R7VA 5BV7B 3FH7A 4O9HH 2FX9H 3EJYC 2PPEA 1XB3A 1R9FA 1E8ZA 4JPWL 4FQCH 5I2IA 3C6LD 1RZQA 1LO2H 3DK2A 3KNBB 4KVNL 4XVOA 4E68A 3O8XB 1NICA 3KPSB 5MERA 4KKCC 2N3JA 2C3WA 5SWSE 3G5VB 4F7KA 1M7DA 1U8LB 5GGTH 4DPCX 1DEEB 3VI3E 4AI7A 4YQXH 5F0MB 4Z7NF 4HUXA 1KTBA 1K4CA 1A7NL 3MA7A 4PRHA 3VU1A 5DYFA 2MCG1 4Z7AA 4P2QA 1GGUA 4MZ3A 2NMSA 3ABGA 4BFBD 4N9OB 4A6YB 1DLHA 1G7HB 4PI2A 1CDCA 3DJTA 4WI0B 4YIQA 5FA4A 3UO1L 3VTAA 3T65A 1OAYL 2AEQL 1DCLA 4B96A 3MV9D 1S9YB 3VFMB 5IWLC 2OMTA 1FNEA 2I5YH 3L1EA 5FO7A 4YX2H 1UM4L 3QUZB 4JFXA 4WEUD 5CCKL 32C2B 3QO1A 4S10A 3SHSA 4MXWL 2HFEA 4PJ8D 5LNEA 1JMXA 3EYQD 3OMIB 2EUXA 4R97C 4KITB 4FOMA 2GJ6B 4L3CB 3EJPA 4MZIA 3ZKSD 1Q1JH 4Y1AE 3IAGC 3RPIB 3OC5A 2HZHA 4PJXF 3BZ4A 4FQJL 1KWKA 3S36L 2J21A 2QGDA 4YDIH 4AL8H 4HXAL 5BUPA 5ABAA 4E42B 5EOCL 4IGBD 2IBZY 2AXFA 5E24E 1V7MH 4QWWC 1F3JB 3MXWH 4FMVA 2KDGA 1H6FA 2E4FA 1X5MA 2BMKA 4FULA 5DMIH 3PXLA 3JVFC 1KZYA 3FO0L 4BK5C 2HN7A 1BAFL 3GHEL 2D4DA 3LN5A 4IS6B 5HDBF 1YN7B 4OLZH 4QLWA 3BRFA 2H1PL 3B4NA 1Z32X 4LVEA 3SBWC 2D0GA 4Z7QF 3NFSL 1OP5K 4UCFA 1FO0L 4WFED 3BDYH 3CPLA 1O5DT 2XG5A 2F1AA 1I1RA 3C8HA 4NI3A 1XF2B 5C0CA 1B3IA 5JIKA 3BKJL 2F1EA 1HDMA 2VISA 3ASNB 4PBVC 1AXSB 3PL6C 1P5UB 1JZ8A 5C0EA 5ALBL 2VN4A 2EIDA 1BZ9A 1QI4A 4XMPH 3RGHA 1E5CA 3SDYH 1UATA 3NIDB 3ARDB 4KV5E 1TO5A 4MB4A 1TZHA 5I9QB 5EDSA 3QZMA 4NN6C 5KYXA 5FDWB 3QDMD 4OZGE 3MJ6A 3IMVA 5K1JA 5HTSA 3IETA 3BEVB 1RLWA 3C87A 3FRPG 2BSTB 2K78A 5JQ6L 1XCQB 1MNNA 2QDVA 2Z34A 1JDAA 5E1AB 3U0WL 5GZND 2NQCA 5KVEE 2OSYA 3GEWB 3UH8A 4E41A 1SMAA 1R19A 5TF1H 3T0EB 3PP4L 2MHAA 1CDJA 4TXVB 3HKFA 2ERJC 1I31A 1QSZA 1NCNA 2AP2A 2XQYG 4DN3L 2WXKA 3S5LB 1NANH 2P47B 3CSPA 3AS2A 1T1WB 3BH8B 2SODB 4HX1A 5C3TA 1WBXB 3K2IA 3B9VA 2YK1H 2WLKA 2CCVA 3QJHB 3RY6A 4KI5E 2X10A 4P2AA 4NENB 3RAJL 3C5XA 4F58H 1E9OA 1L9SA 3KPRD 3Q8AA 5B8CB 5T1LD 2DYPA 2MKWA 2WUCH 1PGRB 2A5UA 2K3TA 5DO2C 2CMRH 3QJOA 4X5WA 1MFDH 4XP1L 4MMYB 5D5MB 3G5ZB 2BIHA 4BUQA 3DMMA 3S4SG 4JFFE 3O2VH 4URTB 1F18A 3BGAA 3MRCB 2Y06L 4KK9C 4CKVX 1MF2L 4Y5XC 2P43B 1W72B 2R9HD 5CO1A 2X05A 3MTRA 5F7AA 1QSVA 4LLQA 2FHFA 1VZIA 2VDNL 3EG9B 3BP4B 3Q2WA 3ZRCC 4YXKL 5DD5H 1C1EH 2DM2A 2F61A 4AZ8A 3RTQC 2OA9A 2UY7A 4PR5A 1CBVH 1KIRA 3AXLB 2XKNA 4K7FA 2WKOF 3IT8D 3D2TA 1E4WH 3KYOA 4XVJH 3VXRE 1O75A 1Q0XL 3MRLB 2X9YA 5GSRB 3PWNB 1U8NA 1QHQA 1JGLL 1QPKA 1Q0YH 5SWQA 1HNFA 4NZUH 3U9UB 3A4DA 1T2XA 1UEYA 2RTTA 4WUUD 4FABL 2A77H 1MH5A 3ZO0A 4M5YH 5I1DA 2OJZH 1R5IA 2APFA 2CCWA 3IDGA 4D8OA 2QKIC 2OL3L 4PP2B 3TBVA 5F6IC 2NTFA 1MQKL 2P28B 3MRJB 5EC1A 4X9GA 4JFEE 4M1GL 1V05A 4EE2A 5D72L 1VDGA 5KN5A 3SBQA 4N2CA 5I1IH 1MRDH 4JZJA 4PJAE 3G6DL 4NX0A 2QSTA 5TDNB 3OAUL 5BV7L 3CZEA 3NSXA 1AR1B 3FN0L 1JHLL 4RIRA 1R34A 4IRZL 4BBWA 1CICD 4Y2DD 1G9NH 2FEJA 2PLTA 3U25A 4N9GA 2AKRA 5I28A 1A5FH 3IM1A 5ESQB 4ZXBA 2ZE0A 3N40P 4ODVL 2CKBA 2O6DA 2ZX7A 1UWEL 4NQSA 1C9SA 3D30A 4IBWA 3K8KA 1M7DB 4NFDA 3NIDF 1MHHA 4UM9D 3RVUD 5HHOE 4Z0BH 2VGLM 1AKJA 4HUXB 3PWPB 5AW5B 1K4CB 1HHJA 4PY7A 1FZOA 1H15B 3SDAD 2WXNA 2XBZA 4OGYH 3CE1A 4PRHB 4XBEH 5I73B 3OKNA 4P2QB 2BHYA 3DPDA 3M1BA 1Z0NA 2Y5QA 1DBKH 1DLHB 1MREH 1VEMA 5F7HA 4RGNE 3TN0B 1M2VA 2I9LB 4YIQB 5FA4B 4HVBA 1RIUL 3T65B 1I1AA 3IFOA 3TFKD 2OMTB 1G7MA 3LDBB 1FNEB 1EO5A 5FO7B 2F74A 4JFXB 1R3IL 1RK1A 2F53E 2NDFA 3ECWA 4I3GA 1KF9B 3QO1B 4MXVE 4RMUA 4TTGA 1IAIL 4KVCL 3HS9A 1NMBL 2NW2A 3SCMD 5HI5C 3O6KL 4K9EL 5EA0L 3EHBD 4C4KO 5GS1A 1ETA1 3BZ4B 4XPTL 5G4NA 2FSDA 1R5WA 4KFZC 3P9MA 4AM0A 1SXZA 2AXFB 3B9DA 3C08H 4HPOL 1M3IA 2BMKB 4RX4A 3HZYA 1P7BA 1YG9A 2ADFH 2YWZA 3BKCL 3MJGX 2HN7B 5D7EA 2ZAHA 3LN5B 5LBVA 1KFAL 1BEYH 1P84J 1AVAA 3EAKA 3RWEA 4QTHB 2FVNA 1ZLWK 2A74C 3PAVA 4UOW0 3W9EB 4YWGH 3L13A 2FAUA 4PTTB 4ZW8A 3QDJD 3ZR6A 3PCYA 2XZQL 3CFTA 3QS2A 5C0CB 1IGTA 5D7JB 4MS6A 4R5VA 5GJSL 1HDMB 1WFJA 2VISB 3BPOC 2Q0ZX 1IQDB 2YXMA 1BWWA 3G9VA 1IT9H 3HNSH 3HE7C 5FFGA 2ZT9C 3RQ3A 1BZ9B 4TNWK 1Q0EA 2AK4D 4GW1A 4Y2LA 4ZMLA 1NIDA 1J0HA 4ILDA 3GMOA 1TZHB 1FE8L 1ESOA 3MNWA 4H1LB 5KYXB 2YQ3A 5I19H 3PQYA 2EAEA 5J9PA 3MLUL 2B16A 3VAEA 3CFNA 3FCBA 3IETB 5J3HD 4PJHE 4TULH 4ES9A 1SM3H 2BZ7A 1JI2A 1H8SA 4WI4A 4PGDA 1YQ2A 3KM2A 3E38A 5D1XD 2IXQA 4E41B 1N7MH 2JQZA 4I4WA 2Z3FA 2EXWC 2MHAB 5GQBA 3LHPH 3NMEA 5KVGH 3N1MC 5CXPA 1OZTG 2FL5A 3EH3B 4QXUL 4NQVA 2GJJA 2B5IC 3CIQA 3MLVL 4HX1B 3HZMA 4YNYA 3SJVA 4JS7A 4Z7UE 4FXGC 1M1SA 1A7RH 2C4FU 3U7YH 4RETB 1OQOA 1EEZA 3TF7C 4DQOH 1QSFE 2NY2D 4KUZL 1TNMA 2HVBA 4L5FH 4FFVC 2QHLA 4FKHA 4O2EA 4YUEH 3G5YB 2DYPB 4YGVA 5C07E 5JHDA 5KW9L 5DDHA 3SDDA 4X5WB 3HNTH 2HCZX 1HK6A 1QO3A 4GKNA 4QTIL 3L3IB 1DFXA 4P59L 5HY9A 4MJJA 2C9UA 4NWUH 4N2GA 2KDYA 3HE6A 2WWNA 3DLQR 3MYZA 3P2TA 4HWBL 4MA7L 4ONHA 4UT6H 3F04A 4GQZA 3GSQB 4LLQB 3VGGA 4GAAA 4TL4A 3IAQA 4JFDD 3S97C 4XTRC 3LH2L 4IOFD 5BZXA 4AZ8B 2UY7B 1OAYH 4PR5B 1GYVA 3SD5A 1KIRB 3BT2H 2ICEA 1UENA 1FNFA 1XMEB 4K7FB 4ODTL 5DMGD 2VLKA 2E76C 1WPCA 3KYOB 4JM2D 2QL1A 1BF2A 35C8H 3DJ9A 4P5RA 5SWQB 2VWEE 1MCQA 3FJTA 5KG9A 1QWNA 2PCYA 3RG1C 1RAMA 2RIKA 1MH5B 2VMCA 1KLUB 3POHA 3X2QB 5I1DB 1QZNA 3F58H 3FMGL 1R5IB 1V7NL 3IDGB 1S3KL 1E9QB 3TBVB 1MAKA 2NTFB 4LE8A 5EC1B 1L9MA 3P0VL 4PJBB 1ZEAH 4X98A 4WO4D 2BFGA 5LXGL 4J8QA 1WFTA 4HYTB 2XV3A 4DNLA 4AV5A 1LQSR 4JZJB 3IFNL 4YHIA 1XFPA 4OCXH 5GZOA 4OZHA 1X5GA 3IFLH 2NR6D 4AQ1A 5BO1H 2FT6A 4PVMA 3THML 4HJEA 4G3YH 3ZMRA 4RIRB 3NAAL 1JD9A 3RWCA 5KSAA 3C60C 4L1HA 4N9GB 1BQHB 4M9OA 2AKRB 4KQ0A 3FK3A 3MJ7A 3SGEH 4ZXBB 4H25A 3FU6A 4Y4KA 5BMFH 2ATAA 1Q9LA 3BKJH 4MJHA 4NQSB 4P23C 1FN4A 5I74C 1JSYA 1MAML 1GRWA 4L0ZA 1X5ZA 2HJFA 1MHHB 2FUQA 2D9CA 5ANHA 2QVMA 3ZE2B 1AKJB 1I85C 3MGTA 3Q6FA 3CVHA 2PO6C 4LPYA 2Z31C 5L6YH 1HHJB 4PY7B 1FZOB 5J13C 4NZ8A 4WI2A 3UC0L 1TQCC 2EILB 3W39A 1QATA 1YPZE 3LS4H 3OG4B 3M1BB 3W0WA 4A37A 4FG0A 4ZMNA 1ADQH 2VDMH 5FKAA 2X1WL 3TP4A 3WFCL 4HBQA 4PSRA 3B7SA 3IDYC 3LMJH 1I1AB 1NCDL 3KGSA 4C56A 2YD1A 3IFOB 5GGTA 1G7MB 2F74B 1AQKH 2HFGL 2X3CA 2CHWA 4Y9FA 2X6AA 2NW2B 3QDGE 2YOCA 4DW2H 2VXQA 2DI8A 5DZNA 3OMAB 2CDEA 4NZFA 4AXWA 3LQAH 1OSPL 4KZDL 1QVOA 1R5WB 2H41A 3P9MB 2GJ6E 3GPSA 4KKAD 4AM0B 3H2PA 4XAKE 4BKSC 4G6MH 3O6FA 5E1QA 3HZYB 4YDZA 2V9QA 1OTUD 5D8JL 5IVZA 3RWEB 3WFEL 4FLRA 4L4JA 1KN4H 5IQ7H 2ZXQA 3OHMB 2LE9A 2J6EA 1GMIA 4ZUSB 1WO2A 3KAAA 1FZMA 1G9EA 1NEUA 2HX9A 4JRXE 3WY3A 2YMXL 3CDGA 1P4BL 1IGTB 4GSXA 1KGJA 2YSSB 3FUHA 3HAEA 3QUXD 4MRBA 5EO9A 3O3DA 4DVRL 4MNQD 2CDFA 1ILSA 3L3OA 3L4UA 4KRPB 5AQ0A 4XNZB 4J3OF 1SFDA 2XA8H 1CE6A 1KCSH 2VLRD 5GRVK 4YSCA 1DVXA 1EPFA 2WXHA 4GW1B 1OAJA 5LQBH 4LHUD 4UOW1 4KTDH 4RISH 4K2UH 5AG8A 1VB9A 3LNHA 3GMOB 5L0QB 2ZXGA 3MNWB 5ILTL 3L2NA 5SWZA 2O4EA 3EH2A 1KDJA 2WCSA 2Y9RT 4JKMA 3PQYB 1JZEA 1WSST 2FJHA 5IJKA 1RULH 2CJUL 4G7YH 1IGCH 2F0CA 3P3TA 2DI9A 4LCUA 2R69A 4PJBF 1P6WA 1TETH 3TJHD 4PGDB 4LSUH 5J4MA 4NPKA 2B4CL 1X9LA 5G5DA 3KJ6L 4I4WB 3RPBA 4M1GH 3ULUD 4OQ1A 2Q5BA 1MXDA 2UZIL 5I15L 4FXTA 5JA8B 3JV6A 3MGOA 1IRAY 1TLMA 5CHNA 1KXTA 3GXUB 2FL5B 3PFUA 3Q48A 3U36A 4NQVB 3ORJA 2IEPA 4H44C 3HZMB 4YNYB 3SJVB 3EZJB 5SX5H 5AAWA 4MQSB 1Z7JA 5CAYB 3SYPA 3V8CA 1TITA 2HVKA 2FEDC 3MBWA 4G6FB 1EEZB 5K9QG 1I1CA 3STLB 3FCUB 1L3WA 3B2UC 3F5WB 3NBNA 2FX7L 2QFPA 4O2EB 4YGVB 5JHDB 2VMFA 2FSEA 5DDHB 3SDDB 5IJBC 4XX5A 1QO3B 4GKNB 3NQKA 3UIYA 5HY9B 5IK3A 1JRHI 1VZGA 4RAHA 5E6ID 3HE6B 5I26A 3CV5A 3W11C 2PUQT 3F7YA 4ONHB 4EIBA 3TVMA 3T9WA 3QPQC 4XC1L 4RCAA 4JJOA 5B38G 2DWDB 1PMYA 1OPGH 3ZKQD 4MQTB 4RVBA 1NGPL 2R8SL 5E8EA 3EDEA 3PHQA 2VRKA 4JG1L 4FQXD 2ICEB 2PWGA 5GGQL 4EVNA 4K9JA 2BIPA 2VLKB 4OLVH 2GSIA 2XPGA 3SDCA 1BXVA 5EZLA 2IJ0C 1Q1PA 5KG9B 3ZL2A 4OV5A 2X0UA 1BIHA 3HG1D 4A2EA 1E6JL 1HL5A 3KCPA 4KUCD 3RBGA 3LNFA 5HD8D 1I7TA 2ZWSA 5EZJA 4HJJH 5HGDA 4PWFA 5IQMA 4LSTH 2E75C 4TUKH 4X98B 5E00B 4ZS7L 2NX5A 3NSJA 1GGCH 1GTFA 2H2SC 1FLRH 4YHIB 1CD1B 1TU2A 1NBVH 4LSSH 3U4AA 4DQAA 2HMIC 1BIIA 2CGRH 3O9WD 1YY8A 4AQ1B 3IKCA 4K3EH 1HXMA 3H4HA 4PW4A 5HDQL 4FP8H 4M56A 5DK3A 1BMZA 4Z3HA 1JOIA 5T1DL 4O51A 5KSAB 3O45A 2J8UE 2GEEA 4RDQG 4C55A 4OCWL 1JPGA 3VFGL 2V17H 5LNGA 1H3PH 2CUMA 2CKBL 4H25B 4PV1C 4UNIA 2E5EA 4Y4KB 1Q9LB 1AQ8A 4AGOA 3MZTA 5GJSH 1FN4B 2HSIA 2HJFB 1DYZA 4F93B 1BD2D 2XYCA 5EORL 3MGTB 1F4AA 3Q6FB 3CVHB 5DCCA 4NJ9L 1YY9C 1MWAL 5F7EH 4JHVA 4W9JC 4LVOC 3W39B 2BNRD 4I2XA 4HJ1A 1WZKA 1IAOA 1IC7L 3MAWA 4OGZA 2W95A 5DHYA 3W0WB 2ZJSL 3JZ7A 5E56A 5FKAB 4LHQB 3QRFM 1MCOL 3ZHKA 1XBDA 4FFWD 5E5MA 4C56B 1MVUB 3MRGA 2G75A 5EU7E 3JTTB 4UT7H 5CKGA 5LWYL 1XH0A 4WNQA 1SDAB 3OR7A 5B1BB 3VTTA 1JYXA 2CO1A 2DW5A 3SPJA 1KWGA 4B3VA 2MTPA 2EDRA 3L9EA 4A39A 1FCCA 2J1WA 1ACCA 4XMWA 4EEEA 3C6LA 3UC2A 3ATFA 2CDEB 3ZSSA 4DGVH 1RUKH 1S7TA 2YUWA 4AXWB 3O2WH 2NY7H 5LB1A 1QVOB 2VC2H 2R4RH 2CRMA 3TZVD 5C0FA 4FKEA 2DQCL 3NJLA 3BP6A 3WEAA 3BE1H 3OJDA 1ZHKA 3O6FB 3T3ME 4XPFH 4Q6IA 1S5IH 2CBTA 2F8OA 2HT4D 2OMWA 2TSAA 3VI4B 1KXQE 4EMZA 1KTRL 1MIMH 3AGVA 4GW5A 3EOAB 2OSXA 1NBCA 4Q6YA 2VYRE 1YAIA 2EINB 1MXGA 1PLAA 2QFRA 3L2MA 4KNSA 1QABA 1I53A 5DMJB 4TTDD 5F3FA 1FZMB 1XR9B 2EZ0D 4OR1A 3MV9A 2H8PA 1X6NA 1MNUL 1ML0A 3CDGB 4KKRA 3L3GA 3T6VA 1BP3B 1NH6A 5JHAA 3B3BA 3HAEB 4NQEE 5EO9B 5ENWA 4AE1A 3GSXA 4PJ8A 3GBEA 2CDFB 1KB5H 1A4KA 4BZ2H 2E3VA 2QQLH 3LEYL 3QJUB 4HZLA 5T3XH 4KX9A 2IG2H 4OI9A 1CE6B 3GLEA 2KKQA 5A6LA 5I1AA 1XH3B 1JL8A 1SMDA 4Y4FC 1DBAL 1SN2A 5DVKA 3X3FL 4EI6A 2DD8L 2NLJA 5SWZB 4IGBA 4Q89A 5EOCH 4ZFGH 4AM0Q 1GGIH 1CQKA 5FYJD 3BUIA 2FJHB 3EO9H 2XXCB 1S46A 3KEHA 4LCUB 4ZAKC 3HN5A 1V7NH 1MG3C 4XMKH 4ZFGL 1UYWH 5G5DB 5DD0H 3LHAA 3UBXG 4HOZA 3X11A 1EEQA 1KN2H 2APWA 1OGTB 3JV6B 2KLSA 3L1OL 3MGOB 5CHNB 1KXTB 3SPCA 4ZFFA 1YUKB 4ZOBA 1UJ3C 2XWEA 4BQ6A 3U36B 3V0JA 3A4EA 1VIWA 2OQJA 5CP7A 2YD8A 4JRFA 3O6LH 4PJEA 4KGLA 1ZVNA 2OS7A 1T3FA 2WXRA 4OV6F 2HVKB 3MBWB 3ULUH 2EH7H 1A3LH 4KKQA 4DKFH 1U6AH 1KCVL 4X9FA 3JBG7 2Z4QA 3D9AL 2DJUA 4L2YA 4QY8B 2P42B 3IJ8A 3QE5A 3BWZA 3T3PE 4AUYA 2FSEB 3QDMA 2N0MA 4IIQC 3IS0X 4NFBA 4Y5YC 2P80D 5IK3B 2BW5A 4LCVA 7TAAA 4YAQB 3T0XA 5ETUA 4DPRA 3F7YB 1FHGA 5GZNA 3TVMB 5GS0L 1K9TA 5HYEA 2WD0A 1NDMA 1U30A 5FHBL 3TL5A 1PY0A 3VFTA 3CLEL 3VD0A 3RIAF 3CZGA 3PHQB 4OM1L 4GXFA 2X12A 1BLIA 3VD3A 4EVNB 2Y7MA 1PZ2A 4NQCE 2GSIB 3SDCB 2ZQKA 1F42A 4QJ4B 1DEDA 1UT1A 4UT6A 2B2XL 3VXSD 4OV5B 4KO9A 2OI9C 3LNEA 3WTYA 2QHRL 3KCPB 4AC4A 3WTWA 4GG6A 1I7TB 1NFIA 3OBAA 3KPRA 4PJ6A 4F8TA 5EZJB 3B7UX 5HGDB 1QFWH 5T1LA 2G2PA 3VI4F 1KYFA 5L7XL 4F7TB 1MJJA 2NX5B 5JXEA 4EI0A 4GRWE 2CWRA 3CIAA 2X3BA 4PWKA 4BH7A 5JLZA 4XOAA 1DJSA 1CPUA 1TU2B 2EIBA 5F1SA 3C09B 4JO5A 1BIIB 2VABA 3S3CB 1YY8B 3IKCB 1HXMB 2R1WA 3H56A 3N9GL 1AGBA 4O51B 3O45B 4D0BA 2NY3C 2G5UA 3VFPA 4S2SA 2CUHA 1JPGB 4IMKA 5IIEB 3WEBA 1QBLL 2YMXH 1YQVH 3BYTA 4Y88A 5G4OA 3ZKNC 4OH2A 1RFDL 3B9AA 2XQ0A 4B0MB 4B27A 4GUCA 3LNDA 2QGCA 5ICXA 5SV4A 3CVHL 4WUUA 4PWIA 1TJGL 4XH2A 4AUJA 1ZS2A 4X4ZA 4TV3A 4I2XB 5IUCA 4ZS6C 3ZE2E 1IAOB 1MI5D 3HRZC 5DHYB 1Z5YD 1EJ6A 3B8SA 4D3CH 4KKZA 1WTLA 2C9QA 3C5ZD 1ET7A 2DBLL 3T08A 4NN7C 3VFNB 5E5MB 5B7MA 3MRGB 2G75B 5J1AA 5DD1L 2BHUA 2J4WH 4WNQB 2XICA 1NCWH 4JL1A 3OR7B 2BP8A 5HSFA 5E1HB 1NEPA 1CICA 4Y2DA 3QQ4A 4AV0A 1JCKA 1JRHL 2VXQL 1CGUA 3H8NA 4NUJA 4DSYA 3C6LB 4YC2B 5AOLA 5DFAA 1IMHC 1S7TB 1AR2A 4APQD 5I8EA 3T1FA 4J12A 3PXHA 4ABUA 4AVIA 4ENED 1PLGL 5JR1L 1M6OA 3PE9A 2CBPA 1ZD6A 3BP6B 1MIEH 4UM9A 5AOIA 3OJDB 2XY2A 1ZHKB 1N2RA 2OMZA 4Q6IB 4QNPE 3AACA 1NGWA 2OMWB 1BJ1H 3SDAA 3K46A 3UDWC 1RZFL 3DHPA 4GKOA 1NPNA 4HXBH 4UV7L 3UBGA 3ULVC 3BW9A 4GW5B 2BRQA 4NZRH 4PJGB 3I02B 4J4PD 2J6EL 4UV4H 3S8WA 2JJSC 3IDNA 3PYCA 1AD9B 1CTMA 3OC8A 3R18A 4NO5A 2DEXX 1U8OA 3QJFA 1INDH 2H47C 1BYOA 1UWGH 4PBDA 3MV9B 2H8PB 3VI3F 1TVDA 2HG0A 3V95A 3PU7A 1GGTA 2FNBA 2OW6A 3H7LA 3V4PH 5ENWB 2GKIA 2OCJA 1DSFH 3GSXB 4PJ8B 3U7WH 1A4KB 1EUTA 1JZ5A 3R0MA 3SCMA 3V79C 2KS0A 4WO0A 5JIMA 1ES0A 4EUPG 4DGWC 4E9QA 5I1AB 2R8SH 3PWLA 3SYQA 3ARED 2VXUH 2Z1PA 4MFHA 1IGMH 4WI7A 4EI6B 2NLJB 3K5RA 1AQMA 4FG4A 4IGBB 3IRCA 1YLBB 3NYKA 1A14H 2X38A 4I9WE 1AIFA 4NRXA 4LVHB 3ZOAA 3VFSA 2R69L 3EJYD 3TYFA 3BD4A 3PQYE 1ET8A 3VRIA 2D7PA 1YJDC 5FA3A 4DKAA 1LVEA 2GIMA 3T4AC 5B39G 4X8CA 2XWDA 4AMWA 5JNYA 5EHFA 3VNYA 3X11B 5D1QE 5C08D 3D5OF 3QDJA 3ARSA 4A2FA 1AO7D 2F5AL 5EZIH 4ZFFB 3RX7A 5JOPE 3GBML 2G4EA 2OQJB 3MR9A 2JFCA 4Y9GA 5CP7B 5HDQH 5T3ZD 4W70A 3DDGA 1KELH 1N0XL 2WGNB 1AC6A 3NCEB 4PJEB 4BDVB 5J5EA 2QQKH 4MMXC 5EC2A 1YUHA 3AQZA 2WNXA 1T3FB 2PP7A 5EWIH 1E3ZA 1FH5H 2AK4A 1P4UA 4TNFA 1KIUA 4I7ZC 2YRPA 1UWYA 5AKTA 1FAKT 5DD6A 3FZUC 4Q4IA 1E27A 5DU7A 1FNSL 2Z4QB 5AW8B 3FUFA 4KHTH 3US9A 2GIXA 5KUMA 3QDMB 4XP6L 4W4OC 4LSPL 4ELMA 1WFNA 2IIJA 5C7XL 4HZ1A 5K39A 2XWBA 1ZTMA 2BIMA 3K2KA 5ETUB 1RIVH 3DV6A 5D1XA 3QHZH 3N1QC 4AVHA 5E5LA 1PZAA 1NDMB 4YSRA 2JWYA 2LR4A 2ZJSH 4NOBA 3VFTB 5L4FA 4L9LC 4PJ7A 4OZGF 3U9PH 4YJZL 1CZ8H 5DRZA 2EDLA 2WOYA 5E4EB 4AKQA 4ONGH 2IAMC 3RE0A 3B2PA 4ZW3A 2VCOA 3V5KA 2AJSH 2EKJA 1HINH 3FT2A 4W9GC 2JJUA 2GUYA 2VLKE 1KBGL 5IW6A 4K7PX 2XU9A 4GG6B 1ZDSA 1NFIB 2J1YA 2OMXA 1WT5A 4X5QA 2KLTA 3MRKA 4LL9A 5T1LB 3UZEA 5DMKB 2OYKA 1QR1A 1TQTA 4EDWL 1GZPB 1BZEA 1MJJB 1JZDC 4PJGF 4FL4B 3FU0A 1IVLA 1S6NA 2Q20A 4M6OL 2W0LA 4MNHA 4HC1H 4BH7B 3IU4L 5JLZB 4C58B 1BQ5A 3BCFA 3PL6D 2VABB 2PN5A 3P77A 4M02A 4TSCH 1YEDA 1TVBA 3BKML 2R1WB 3IDMA 4W4NA 1TQVA 2DMBA 4DZ8A 1AGBB 1EZLA 2X4SA 4F33A 1I3VA 4D0BB 2K6WA 2YGQA 2FJFB 4KRNA 4OZHE 3WIAA 4DUWA 3VFPB 1RPUA 1P7QA 2Y7QA 1AGCA 4S2SB 3H9ZA 1AXTH 3BWUF 4ODWA 2J5LB 3RI5F 2FJSA 3QWQB 5FC9A 4BWTA 3JWOC 1ILUA 2CLRB 4JM2A 1UCBL 2BNUA 5I8KH 1ZSHA 1UA6H 1NEZG 5ICXB 4HIXH 2IPUG 2WVSA 2XETA 2VUYA 4YMPA 4WUUB 3KLAA 1E5BA 1GYAA 4XH2B 3TEZA 5FK9A 2XWTA 2DIEA 1I4FB 2XJLA 5EN3A 1VEOA 2VH5H 1SHSA 3HR5A 1GC1C 4WO4A 1YECH 3RX8A 1MY5A 1UG9A 1ZTXH 4HT1H 5IT2L 4FFTA 1EHLH 2XZCL 1UURA 3PG2A 1TIUA 5J1AB 4YPGA 2NR6A 3W0WE 4FQ2L 3CH1A 4YE0A 4OJDH 3BCDA 2BP8B 1P84K 1DR9A 1CICB 4Y2DB 2HTLC 3QQ4B 3ISWA 4H4NA 4JGJA 4NUJB 2JI1A 4XPAL 2UXGA 2EDFA 3TO4C 2JCCE 5HHPA 3GFUA 5I8EB 3T1FB 1CFTA 5ADOH 4AWJC 2C9AA 5E23A 3TGXA 2FO1A 4BFRA 2COQA 5I23A 4MQ7A 1M6OB 2VDMB 3OHXA 1WIPA 4UM9B 4Y16C 4KK9D 4P0DA 3T0DA 3BAEH 5BZZA 1R3KA 4LMQI 1N2RB 2OMZB 3UO8B 2GG1A 3L3KA 5EIQA 1D5ZA 3WNKA 1T89C 1MFAH 1WEJH 2BHFA 1KCVH 2AEIT 4IKLA 2AI0L 2A73B 3BW9B 2F15A 1RJZA 1QSED 2X09A 4HJGA 4XCCL 1J87A 5DUPH 1JFHA 4YHOH 4NO5B 1DVTA 1U8OB 3MLYH 2R56L 3QJFB 4WSJA 1PD6A 4H8WC 2QQNH 2I60L 1BFVH 2R0LL 4FFZH 5H2BA 3S2AA 1KJ2H 1DQMH 1AZNA 1MCKA 3KYKH 4DKTA 4RAVA 2GITA 3IMUA 4OGXL 1ES0B 3EHBB 1E8WA 3EZ8A 2BJML 3PWLB 5F8QC 4CN1A 5BVJA 5HHQA 2GI7A 4LDEB 4YBHA 4DN4L 2CHDA 3UJTL 1RSFA 5FCUH 5CCJA 2YAEA 3CAFA 1YEKL 1E40A 4NRXB 1AIFB 4JNXA 2EDDA 2ORBH 3WSQH 4FTVD 1A66A 4MXVF 1SBBA 1MPAL 3VFSB 3TCLA 2JKXA 4AH2A 5AL0A 1T7VA 2VR4A 3WD5L 3TF4A 5I6NA 1GXEA 4HS8H 2YFNA 3TYFB 3V0IA 3F7KA 4BZ2A 5C0AE 5BPPA 5FA3B 5L8KB 4GI9A 2MTAA 4WCYL 1Z2KA 5JNYB 3H9YA 1KCKA 4BK8A 4CW1A 2OMUA 3NACH 3QDJB 4B5ZA 4L8SC 5A43C 1TYRA 4G6KH 3OPZH 5JIDA 2MOVA 5H35B 4IK6A 5EG6C 1HOEA 3EKCA 5C0NC 4NKIL 1C8PA 3MR9B 1AS6A 3QUXA 1Z6JT 4MNQA 2YLKA 4Y19E 1ANUA 4L1DA 1YUHB 2VLRA 2GHZA 1VESA 2K8MA 3Q1SL 1FGNL 1KIUB 2KUTA 4HMDA 4LHUA 5DD6B 2XRAH 5KJ7E 1E27B 4C83A 4AEIH 2P49B 1RFDH 1GGYA 4JN1L 3UTSE 4P05A 3JWDH 1PZ5A 5T3ZH 3WFBL 1FI8C 4W9KC 4GS7C 2K3HA 4ELMB 4LCWD 3W5MA 2XWBB 3H0TA 1HWGB 3H9SD 4P9HL 4XE0A 1SHXA 5HI5D 3DV6B 5D1XB 3TT1H 5IB1A 3UYOD 3LD8C 5KVFH 5C09E 1MFUA 4M7ZC 5D7KE 1HHGA 2ZKMX 4YDKH 2HG5A 4RMWA 4U7SA 5DRZB 2X4RA 3GMNA 5CR8A 2NY6C 5AW9B 4CU6A 4PJHF 2VDLL 3BPLB 3ISRA 4PG9A 5EUKA 1LK3L 3BWAA 4FYRA 2ZWLT 2YGPA 3V5KB 1J8SA 3DVNA 2ALAA 3AG1B 2OR9L 1JRHH 4KJPC 4Y9CA 2HLAA 3APNA 1J0KA 1TPXC 1K4DB 2NY2B 3UTPE 1MWOA 2EKSA 3PXJA 4BIKA 5IW6B 5EF2A 1QHPA 1I3RA 3OR6A 4EF3A 3MRKB 3D51A 1B4JH 2D4FA 1E4KA 3NRFA 1QR1B 5JHMA 2WUBL 5DJXA 3FQWA 4JCWA 5AZUA 5HYIA 1I8LA 4WK4B 4MNHB 4DKEL 4RISL 2B1AL 5E6IA 2HJKA 3FB6A 3GHPA 2FATH 4MMZC 5DVLA 3P77B 4POZC 3CZKA 4QR7A 43C9A 2OZ4L 2AC0A 1YEDB 3HE7D 1TVBB 3IDMB 4LVNC 4DZ8B 1OWRM 2A6KA 1TMQA 3GDCA 2X4SB 2VKXA 1XTMA 2EYSA 3FHAA 3MOAH 1FAIL 2VDOH 5INCA 1U93A 1P7QB 1AGCB 1ZGLA 4U49A 2DQ6A 4ODWB 4UAOB 4FQXA 4WJG3 1WFIA 3S5LG 2ETWA 2WZ6A 3FN3A 4JM2B 1VHPA 5F89A 4UUJB 4WHCA 4GFTB 3D07A 1TZGL 2V2XA 4H0LC 3KLAB 3HG1A 3HVNA 2XYBA 5FK9B 1EJOL 3BLPX 2UYLA 4KY1L 4QRPE 3GK8H 5E99L 1JPTH 1OTSC 3CFDA 2C34A 3HI5H 4UF7C 4KO5A 2BSSA 4JPKH 2ILLA 3S6CA 3PREA 4MA8L 3O9WA 4YPGB 1JPEA 3Q3GA 1CURA 3CH1B 3S88L 2C9RA 1ZHLA 4JQIH 2Y5EA 1Y7VA 3MNZA 2ZUQB 4KFMA 4NZTH 4KTEH 2F18A 4WFHE 4FFVD 4ZMVA 5KOMC 1WF5A 4ZTEA 5BRZD 4OFKA 5HHPB 1X9RA 3EBAA 1CFTB 1NDTA 3LRKA 4OCYH 1PTZA 4UOZA 1HE8A 4MQ7B 5A2AA 3OHXB 3Q9QA 2R39A 4JQVA 4NRYA 3HBPA 5EPMA 4ACPA 1R3KB 3L3KB 4TVPL 1D5ZB 3KCWA 3WMPA 2XWXA 4MKMA 1PKOA 1BW8A 1XF5A 3ATBA 3GXMA 2K0RA 3KH4A 4XTRD 3RBSA 2BNRA 1RJZB 3BVDB 1S2EA 3N0PB 2IQ9L 4HJGB 5E0FA 3ATEA 1UXWA 4KKPA 3QT2A 4IKIA 1T0NA 5FYKH 2VC2B 5DZ9A 2VLJE 3KYMB 5DURD 5H2BB 4GSRA 1DQVA 1RUQH 2G3NA 1CWVA 2WINA 2EDMA 2DQDH 3A0OA 5EOQH 1U9KA 3ZYIA 3QYCA 4PLNC 3MA9L 2J1KA 1EK3A 1LEGA 2QSCL 3N55A 4WDIA 4RAVB 4N1EA 3STZA 4V2BA 2CO6A 2YPVH 1G0DA 3FAWA 2Y22A 4BHUI 1ONQA 5EOCJ 5BVJB 5A6IA 5HHQB 4NQTA 3NJGA 1S4IA 5DZJA 3TZVA 2W80C 4BA0A 4E9SA 3AU0A 3QGVA 3AFLA 5DRNA 5IFAH 5EU5A 3L5XH 3DURA 2FUTA 5FGBC 1BAWA 3F7VA 2PW2B 3K74B 3TCLB 3V4PA 4PRPD 4AH2B 4DTGH 4OUOA 3O4OB 3C60D 3ARQA 3WNNA 4AMXA 1CFMA 2DKMA 4HKJA 4U4BA 5IESH 3U1SL 3D3VA 1IBDA 4KXZI 4PVBA 5HBBA 1C5BH 2RQEA 4EDWH 1P53A 3FBQA 1T83C 5KBPA 3BIKA 4CW1B 2OMUB 4TOYL 4PJIA 1SJEA 3H6AA 5DWUL 3ARTA 1RZGA 1N9PA 3P54A 3WG7B 2VDPL 2RGSA 4K23L 1UT9A 3FTVA 1PX3A 5F9JA 2FJUB 2PO6D 2Z31D 3QUXB 3IPBA 4MNQB 4FJ6A 2ICES 3J8F7 4HUVA 1I9JL 3FKUS 4YE4L 1MFBL 1FIEA 5CGMA 1Y07A 2VLRB 4X5PA 5CJXC 4CRPA 4JZOA 1TKWA 4LHUB 2E6PA 4XNXL 5JXAH 3LZOA 1DVQA 1LO0H 2VAAB 4FQIL 2UXTA 4C83B 5L9DH 1WH0A 3DSFH 5IHZA 3RVWD 4QXGH 3CZUB 2XHNA 3TONA 3AC0A 2VM9A 4ZT1A 1PZ5B 3TO2A 3OXRA 3U2SA 3RDJA 4NAQA 3ZYOA 1O6TA 3H0TB 1JGIA 3QDME 5AW2B 3ARUA 3T77A 2A9DA 5D70H 4QHUB 5IB1B 3MLTA 1AY1L 1D6VL 1PLCA 5HPMA 1XF4A 1HHGB 3QRGL 4XNDA 2HG5B 5KBKA 4PWHA 1RUMH 2JVUA 1BG9A 3I9GL 4A2GA 1LLAA 2X4RB 3GMNB 3V10A 4B9JA 2VXSH 4RRPA 2F9BT 4PG9B 4CC4C 5DVOA 5EUKB 1OM3H 3BWAB 5BUAA 3E9TA 4AEHL 5DS8A 1UQSA 5CIPH 4IBTA 2HLAB 2C7UB 1LEKA 1Q9KB 2MQGA 4XXDA 2EKSB 2UVFA 4FC3E 5I6MA 1I3RB 3OR6B 4LRNL 3IFPA 3FTUA 5D96C 4H1LG 5GSVA 4N8CL 3RIAK 5HHMB 1JBJA 4LLVA 5DJXB 3FQWB 4GG6E 1RPQA 3QUGA 3KPRE 4CU7A 4XNAA 4F8NA 2P80A 1I82A 1MCNA 2VDKH 4G7VL 4KPHL 3QCTH 2HJKB 3FB6B 1JZJA 5DJ0A 1UACL 43C9B 1FSKC 2JLLA 1EZVX 43CAA 4CGTA 5J1SC 2A6KB 4KO7A 1Q8MA 4ZRGA 2EYSB 4FXKC 4TSAL 1LO4L 3BXNA 3VTMA 5INCB 1U93B 1VFBA 3KPNB 4ZUUA 2JV6A 3OKYA 2MCMA 2BSED 2XQBH 1SEQH 2KZBA 2HA1A 4IDLA 5HYJB 2HLEB 5F89B 4HC1A 1XSKA 1CFQA 1WP6A 3LAFA 3VXSA 4LEOA 3UIZA 2V2XB 2WSDA 5DJ8A 3HG1B 2MWCA 3T71A 4BRVA 4UT9A 1JZ7A 3RWFA 5H37H 1I7RA 2UYLB 1H9DA 1WGOA 4HF5L 5ISZD 4GLRI 1JF6A 3GRBA 4WUUE 2DH2A 3AT0A 3CFDB 3KPOA 3PIQA 5I30H 3IXTA 1UHVA 2BSSB 3L3DA 3QXVA 1QI3A 3O9WB 2O5YL 4MLSA 2E8ZA 1Z5HA 1ETB1 1MG2C 3CHRA 3Q3GB 3H4FA 3WAJA 3VXUD 3MNVA 5JQIB 3DSNA 2FEDD 1ZHLB 5DEJA 1OCZB 3MNZB 3MV8D 3MJWA 3BLBA 3B2UD 4RZCA 4JDZA 1MY7A 4GRLD 3OL2A 3Q8BA 1KGCD 4XXWC 5D7JC 1BQKA 1L9NA 3RGVC 1NSNH 4DPAX 1TZIB 4J3OG 2Q76A 5EZPA 3GM0A 1BJ1J 7CGTA 4WUKH 4NRYB 3W11D 4HPYH 2FDBP 2J8UF 3X1BA 1KB3A 1XF5B 1H5BC 3B83A 3MUGA 1DCEA 2BNRB 3GC3A 5F72S 2LU4A 2A6JA 2ISDA 1MI5A 3QAZB 5DT1H 1YHPA 5H4ZA 4ODUA 4TVPE 4JY5L 2O61A 5AAMC 3C5ZA 4PYGA 1IC1A 1T0NB 2P46B 3L81A 1DP0A 1LHZA 4GNKB 4JG0L 1H3WM 5C6PB 1NBYA 5JPNA 3LZFH 4ZW6A 3RLSA 3BPNB 2ESVE 1R47A 2Y6SC 3BD3A 2WINB 3N91A 4HJUA 1DJWA 4DEPC 3EJUA 3BIAX 1DJZA 4HSAC 1U8PA 3SPHA 5I18L 3S9DB 4B95C 4ZPVB 4O5LL 3STZB 4HAGA 4WDIB 5E70A 2E4TA 4PJCA 5DO8A 1BQHG 1BLNA 3U2IA 1OGAA 2CO6B 2EIJB 2X28A 3KYAA 3QZNA 1ONQB 3GMMA 4NJAL 4O02H 1J0IA 4TVSa 3RWJA 4APQA 3U4EA 3OZKA 3TZVB 1NUDA 4ALAH 1F41A 2H2SD 1BYPA 3H9HA 5DRNB 2HMID 2CK0H 1GJUA 4YSSA 2O72A 1DL7H 5EU5B 3DURB 2NUPA 4FFZA 1SOSA 3F7VB 4BCXA 1GJIA 3KJ4B 1RPKA 1WICA 3COOA 4G5AA 3V4PB 3D4CA 1UB5A 1AACA 1JXKA 2DY2A 4Z1PA 1BVZA 2J72A 4NNYA 4JFQA 1QD0A 3N41F 3D3VB 4J4PA 2DYSB 3CQFA 5H4YA 2H45A 3FF8A 5CLWA 2X89D 3BIKB 2OR8A 4PJIB 1SJEB 1PKQA 2ARWA 3HC4L 4LEEA 1RZGB 4BQ9A 3FQTA 5J56B 3NCMA 1LE9A 2MNWA 2YFOA 1L0YA 2HX7A 2IGFL 4DKDC 4H8UA 4M4RA 5F9JB 4GW4A 1E4JA 1NCBH 1AJ7H 1YY9D 2R51A 5FUZL 2AQNA 3EJSA 4HUVB 1FAIH 5AL8A 5ICYA 3HLKA 4JVWA 4ORGA 1AE6H 3D18A 4JZOB 1BZQK 1TKWB 1NKOA 3AB0B 2HRPH 3AREA 4HUNB 5I8OL 3CVCA 1ULVA 2FBJH 2W81C 2Z8VC 5IHZB 2YWYA 4KDTC 2AK4E 5K1NA 2E27L 3QK0A 3TO2B 4D0CA 2I24N 3OXRB 5I71B 5IJVA 1SJMA 3U2SB 5JIHA 2YOAA 2CGZA 4QF1A 3FUMA 1SY6H 2NSQA 3G6JA 4HUMB 1OQXA 3I6KA 1MQ8A 4M7LH 1GMEA 3T77B 5IGXL 1PZUB 3FOMA 1FIGL 3MLTB 4RMSA 5HPMB 1MCHA 1XF4B 3TT3H 1SLUA 1KGIA 5C08A 4XPBL 5LDSA 1AO7A 1F02I 4PBXA 3N42B 5C0RH 2VR8A 4LMQE 3ABZA 1ACYL 4L0YA 1AQDA 3GRWA 5E6SB 3T0VA 1PX4A 1OHZA 4PJ7E 1UQSB 2R29H 4OLXL 5C9JA 4CGUB 1LEKB 2BNQD 4H2AA 4XXDB 1P9MC 1UGKA 1T0PB 3IFPB 1UD3A 3MRPA 2Q6WB 4KZCA 1EXHA 1IUZA 4POUB 3ZDXE 5CM1A 1ZLEA 3SBRA 1A7QL 5IWLA 4LLVB 3OLGA 5HI3C 1BOGA 3RNKA 4Z3FA 1IV8A 3L1FA 4J1UA 5DJ0B 1HH6B 2ZOKA 5F3BA 3DKHA 1M42A 3BEWA 4JGMA 3LKPA 5IHUL 1UB6A 3L9RA 5B1KA 3HC2A 4N5EC 2DQJL 2L7QA 3EDKA 4XVSL 4Y4FD 4YZFE 3ZMNA 3BXNB 1FVEA 4ZMYA 1MRCL 1VFBB 4NCC1 4ZUUB 1NFDF 3T3PF 1AI1H 1NUFA 5GGUA 1U21A 3CX2A 2PR4H 1A02N 2NZ9C 4JFDE 3V4VH 4P4KC 4S0HA 5LBSL 4BK5A 3GBNL 4ZAKD 3W9DA 2A83A 2VR6A 1CFQB 4UZSA 4OT1L 3VXSB 4LEOB 1SYVA 1KGYE 2FH8A 4MX7B 3SBWA 3ULSA 2MNJB 1OAXL 5JPMC 1FGVL 3RWFB 1I7RB 4LQFL 2PCXA 2QDWA 3KPOB 1HHHB 3PIQB 2H7WA 1KFGA 1VFMA 3IXTB 4LARL 4MD0A 4E9YA 4F7EB 3L3DB 5JDJA 3PL6A 4LEXL 4LZKA 2W1NA 1LK2A 2ZUVA 3V7AG 3U1SH 3MNVB 2G30A 5L88L 3DSNB 1GS6X 2TRYA 4Y1TA 3ZX1A 2Y1ZA 4X9HA 4RZCB 4UB0H 4JDZB 5DWUH 5DHDA 4NNPH 2HKHH 3DWTA 2NY1C 4GRWF 2F58L 4U3XA 3VXNB 3NP4A 4U1JA 3C6SA 2DLFL 2IV8A 2Q76B 4DOHB 1YYCA 3Q7JA 3U79A 4D9QD 3FF7A 2AGJL 3GXIA 3VGEA 3IMSA 3ZE0E 4CL7A 4NP4H 4GYBA 2WHVA 4JQIA 3D7PA 4AQEB 3MUGB 1FUNA 4KQ4L 5CWSA 5ESVA 1KCRH 4KO6A 1MI5B 2EO7A 2E0PA 1T03H 4L3EE 4R6UA 5FUOH 4ODUB 2O61B 1OL0A 3C5ZB 1UGNA 1SF5A 2A6DB 2MOGA 1NBYB 3IK2A 5JPNB 4KJQC 3II1A 5DVMA 5IROC 3CMGA 2UY6A 3PGCA 2P24A 1U8PB 3PGFL 2Z7YA 1ZT4A 4HAFA 4EZMA 3N42F 3NIFB 3MRFA 4PJCB 3SKMA 2PPDA 1BLNB 3ZZ1A 4EXPX 1OGAB 4F2ME 5C0BA 4KHXH 3WTSA 2AHIA 3GMMB 4F57H 3RWJB 3P4OA 4H7VA 4APQB 3D2UB 1A6WH 4QRRE 3U4EB 3N40F 2DQFA 5IEKA 4MA1C 4BQ8A 3H9HB 2AFNA 2WXIA 3AZUA 1N6VA 4Y5XA 2NUPB 3MROA 2V3FA 4FZ8L 1DBJH 1KJ2B 1PCXA 5DC9B 1FZJA 1UB5B 3V6FA 5DZAA 2NY3D 5FYLD 4JFQB 1CG9A 1U3NA 3K81A 4UOJA 5FLUA 2H9GA 1QSEA 3RTQA 3V0FA 1UUNA 1WAPA 3SPIA 1OW0C 1R6VA 1HXYB 5AB1A 1TQBB 2BSCA 3C8DA 5JW3L 3ZKND 1UADC 3VXTA 1PKQB 3FQTB 2M8XA 1LE9B 4AV4A 1UACH 4Z7OE 2YRBA 2FGWH 1G9MH 2NZIA 4JRYE 4M4RB 2C9PA 4I77H 4GW4B 1YEHL 2OSWA 5CLTA 2EEBA 3EGXA 2N7BA 5KBNC 5ICYB 2QKIA 1JWUA 1S9VA 4ZS6D 4IDJH 4ORGB 4WGWB 3SE9H 3D18B 3QZPA 2W38A 1ZLDA 1I8KA 3FRPA 1K5WA 5F9OH 5AW0B 2CD0A 1VENA 3QIUC 4A7SA 3IXAA 1N26A 2C9VA 4ZUTA 2CXKA 3ABMB 3CN3A 4P9MH 4X50A 4DP5X 4X6BA 5FYJL 4FQHA 4FTVA 4O00A 1D5MA 1NPJA 3QPXH 4BE5A 4KAQH 4G8EA 4JHBA 2DI7A 3O0RH 4ONFL 1NAMH 4D0CB 5IJVB 4X2UA 2YMTA 1IGYB 4S1SL 4XX1G 1KULA 4LP5A 4QF1B 4ZI8A 4UWQB 3ARBC 3G6JB 1IKNC 2AK1L 3E2HC 2V8MA 3WMSA 1KBKA 2YN5A 2ZXCA 3G5WA 1SDDB 4OCLC 5ALCH 2CIIA 3WV0A 4MQXC 4ODXA 5BVPH 4N87A 2EVIA 5GRXG 5E8NA 3P69A 5C08B 1C5DA 1AO7B 1EJFA 1L9TA 3QC5X 4MJ4A 4ANUA 3BN9C 3E8UH 4H0HB 3MTXA 4IOSD 1AQDB 4YSPA 1M57B 4GKSA 2WQ8A 3WKNA 2BVEA 1HC1A 1QTPA 3ULVD 1J9RA 4IKNA 1JTPA 3MNDA 1OVZA 3T1WA 5C9JB 3AUWB 5KVDH 4OQTH 1KV3A 1Z3GL 5AD0B 5DZOA 4PRIA 1T2QL 3HC3L 3R1GL 2EEXA 4RQQA 5IMMA 2IF7A 3O3EA 4NQDA 5J57B 3MRPB 3L7EA 2DQHL 3D50A 2IDQA 1F4XH 2HFFA 2VMEA 1J86A 5C3IA 3RNKB 1BOGB 4KQ3H 3FTWA 4JDTL 4LCWA 1XGUA 4OM0H 1ZVYA 2YAFA 2JB5L 4N8UA 4J1UB 3V8OA 5FM4A 2ZOKB 4R97B 3CXDL 3H9SA 5F3BB 3FH8A 3BEWB 4Z7WB 5CIPA 1A6VL 3LKPB 4I3SH 1UB6B 1AANA 5TGBA 1W0WA 1WUZA 2L7EA 4FG2A 5AZ2H 3M1OA 4S0SD 4U1MA 3VD4A 1D7DA 1CO1A 2BS71 3O4LB 2PWEA 5GGUB 4PHZA 5AVSB 4BGDA 3AY4C 3WJMA 4PJCF 4YHNB 1EO7A 5I18H 3K8MA 2E9IA 3W9DB 2A83B 1AGFA 2VUOA 4QHMA 4X7SL 2X88A 1SYVB 2ICWI 4XNYL 4G11A 1IFRA 5D1ZI 4LEBA 3NSCA 2W0KA 2A74A 1IC0A 2VLMD 3EOTL 3PABA 4JEGB 4UT9L 4MCZA 1HXKA 3ULSB 4BFOA 3BRGC 3CMOL 1ZOXA 3WIIL 2VDOB 1GS8A 2YN3A 3QEGL 1RK0A 4UIKL 3OPUA 5IW3A 2XWZA 1UZ6E 5EU3A 3UZVA 2F5BL 2X1OA 4P5TD 3VW3L 3PL6B 3M07A 4PGEA 1I3GL 1LK2B 1RZJC 3BO8A 3UZQB 3WHXA 3WUWA 1BBDH 3HE7A 4P3CH 5CJQH 3A3YB 5E4AA 4ATTA 1ZSDA 2Z9TA 3FZUD 4K07A 5H37A 4NN6B 1R4XA 1ID5I 2DMCA 3MCYA 2I7OA 3C6EA 3IGFA 2FTAA 2YARA 5DHVH 3OD3A 4U1JB 5DLMH 3C6SB 4DPBX 1TYJA 4EAEA 5I1CL 5E9DD 3A5VA 2R1YA 1F3RB 3P4MA 2QADC 3QQNA 3QRLA 2ZSWA 1DJGA 2YMOA 5CSZA 2ZXAA 4N2LA 3Q6GH 3AXIA 3LOWA 2XTJE 1ZY9A 3D33A 3GI8L 2A3TA 2W0PA 2X4TA 2XWJB 3AT9A 2ERJB 1F3DJ 4K5OA 5CWSB 1RUPL 1BD2E 1CLZH 1HZHL 1KGWA 2MOQA 1GZHC 5GRUL 1GHFH 3PRZA 5SX4H 3G6JF 3EDFA 3PUCA 1WRFA 3ELQA 1N10A 2IAMD 3DA0A 2OR7A 3T0AA 3FCSB 5I76B 4FXGA 1A4CA 5DJCA 2UY6B 3PGCB 2NYKA 2P24B 4HKBA 4NEHB 3LRLA 1WZ1L 3A4FA 3ALPA 3S48A 1GSMA 3MRFB 5IHLB 5MEOA 2X2YA 4PS4L 3SKMB 3O3UN 3DTUB 5BRZA 2BZDA 5C0BB 4K3DH 3IU3A 4NGHH 3P4OB 5JW4N 2XACC 4AGLA 4R7NA 1MFCH 2VAJA 1GPOL 2ZUYA 4XP4L 5IEKB 1VERA 1CXKA 1F90H 1CLCA 4Y5XB 3MROB 5JZ7C 2FZ3A 3HRPA 1F4HA 3OGOE 1HAUA 1J1OH 2F6AA 1FZJB 4NUPA 1KY6A 3F6LA 3V6FB 2DJMA 5BS0D 2Z93B 1HJBC 1Z9LA 1JHKH 3GMPA 2H9GB 1ECYA 1QSEB 1NINA 3RTQB 4D2NA 2Y7NA 4WFFD 1AAJA 4WHTA 5C9KA 4Z7WF 4PJ5E 4OY9A 2YIHA 3SDXA 3VXTB 3O81A 4K3JL 3QQ9C 4R26L 4ABQA 4NQXA 4R2GC 4JY4A 2D0HA 1YEJL 3H3PL 4LFHG 3I6GA 1FFOA 5I6OA 5CD5C 2OX5A 2QKIB 1JWUB 1S9VB 1WAAE 4LF3A 5F6IB 3ISYA 5F96L 5EBWB 4HGWA 1YEEL 4KXZH 3FRPB 4XPGH 1QFHA 4GXVH 2NXZC 2JXMA 4TNGA 4ZUTB 1K6QL 2Q3AA 4X6BB 4JHAL 4FQHB 5AVWB 4KKNA 3H42H 4G8EB 4A6YH 2RAMA 2GVYA 5C0DA 4PRPA 4L1LA 5C0JA 1A9VA 3C60A 2HTLD 2XA3A 4AITA 2RJMA 4L9DA 3TO4D 2X7LA 3NCJL 3ZW3A 1KBBA 2CIIB 3TYGL 1RIHL 4AQZA 2ZCHH 2G4GA 4ODXB 4U1LA 4LCCC 1C5DB 3UPCA 4Y16D 3N2JA 1FORH 1KTCA 3GRWL 5TDPA 3BESR 1I85A 5GJTH 1F86A 4GKSB 2PO6A 2Z31A 2KZ1B 4NAJA 4XB8A 4Q7DA 4Z7IA 1SY6A 4I88A 4F91B 4OLWH 1KC5H 4HHGA 3GSNL 4GBXC 4XBMA 1HAWA 4PRIB 2FYVA 4NIKB 3L6FA 4P5MA 4RQQB 3U4BH 3O3EB 5IMMB 4NQDB 1O9VA 3L7EB 15C8L 5ECGA 2B9BA 5DR5L 2HFFB 3EOBB 4D9RD 5IVXE 2YGOA 2ZWKA 3A6BH 1WHPA 5GRYA 5KS9B 3NIGB 1XGUB 1G6RH 4LCIL 3S37H 2V5MA 2W60A 1U91A 4FNPA 3VX1A 1G9NC 1XZWA 5AEAA 3PJSB 2CBOA 5CIPB 5DQDL 5TGBB 1W0WB 1S7QA 1GYWA 4W6WB 2ZAIA 4U1MB 3E9UA 4X8JA 4U1HA 5DLLA 1E2VA 3WJMB 1XAKA 2ZUTA 4NM8L 2Y2TA 5K93A 1RVFH 4U3SA 5I0ZA 4CVWA 2VDKB 4WI8A 4TQEL 1EDHA 4QHMB 4YSAA 3QR2A 1N4XL 2A74B 3PABB 4OB5L 5DJAA 1M71A 3ECUA 4U1SA 3P0YH 2LW3A 3PWVB 4X4KA 2YPLE 3VXSE 2WLJA 4PG2C 5EF1A 1RK0B 2Z7UA 1W6WA 1FQ9C 3ZE1F 5D2NE 5CZVH 5C0ND 5DJZA 5F7UA 5GHWL 1RUAL 4N8VB 5EU3B 3UZVB 3BPOB 4RGOL 1XWVA 2LQRA 4J2XA 4U6XB 5DZLA 1BA9A 2XTLA 4PGEB 2YXFA 3BO8B 3WHXB 4OTXL 2IPTH 3HE7B 2CBMA 3WUWB 4ZTOL 1ZSDB 3KPQA 2QT6A 2WXFA 5I66B 2Z64C 2AS5M 1B4LA 3J27A 4GIPD 3LZRA 2BSEA 4Z95L 3NZHH 3DXAE 4AIZA 1SJXA 1HH9A 2P1YA 3JV0A 3BWUC 4YOKA 3P4MB 4HJIA 4LAJH 1QLEL 3T8VA 5ITBL 2ZSWB 2XG4A 5CSZB 1EFXB 3A4AA 1JP5A 5D55A 1CFBA 5K33A 1V3LA 2X4TB 1E5AA 2E7LC 4P2RD 5ISZA 2R0ZH 3V5HA 2NY6D 5LVEA 3IJYA 3O2DA 4UZUA 2B5IB 1J1PH 2LOEA 4JPVH 5IMKA 3IN2A 4YLBA 4FXGB 5DJCB 3WLBA 2NQ3A 3X1EA 1U8CA 4KJPD 4PVNA 2NTSP 3Q2NA 3VXUA 1XH1A 3I50H 4HKBB 4AG4H 1PZDA 3EYUH 3EO0A 1BJMA 2ENYA 3MV8A 4I0KA 1AZVA 5MEOB 1PS3A 3HHMA 1QKZL 5BRZB 3FQRA 4GRLA 3IU3B 4A55A 1D9KB 1BZDA 1XL6A 4R7NB 1BQRA 3RNQA 3QXAA 4I48B 4BQBA 4DIXA 4JG9A 1R5VA 2PW1A 1QUPA 1D7BA 3MLSL 2FIKA 4NYLA 4POZD 1QW8A 2P8MA 2J71A 2FZ3B 1E4XI 1KLGA 3B9KC 5IY5B 5M7QA 1MEXH 4G7SB 1U95A 3GMPB 3HS0B 5E1GA 3NCBB 5KS9F 3NIGF 4IBUA 3CZFA 3HUJE 4BZ1H 4TS6A 3FUNA 5D6CA 4LK4A 2ENQA 1FC2D 4TQ8A 3FSAA 4WHTB 5JW4Q 1CF8L 3I6LD 4YHKH 3PAYA 1NGXA 2NXYC 3SDXB 5DURB 2P8PA 2YSTA 1FF5A 4NQXB 4M7KL 1TEFA 2WYZA 3NFNB 4P2YA 4JY4B 4FA8A 1A8ZA 2DWEA 1ZJAA 3I6GB 1TTFA 1ZKAA 1FFOB 2OX5B 1CD0A 4LF3B 5B3JE 1D5RA 4X42A 4RAUA 4HGWB 1OTSD 2VM3A 4JFZH 1V54B 4BD4A 4UIMA 4R7LA 5BW7C 2JXMB 1N6QH 3UABA 1MCPH 4RGNC 3CXFA 3I2CH 3QFJE 1FL3A 1DQLL 1T20B 4MDJB 4Z3IA 4ZUWB 2ZOLA 4LCYA 5C0DB 4HIQA 4PRPB 4X4XA 5C0JB 3MRRB 2NYZA 2G0KA 4JGNA 3C60B 1IE4A 1T0MA 2R2EA 4QCIB 3OM3B 4CVXA 1TENA 2X7LB 2RD0A 5JIIA 2CNYA 5E8DL 4KGJA 1JYWA 1ASQA 3QBTB 1BFOA 5AOJA 4X6DE 2X89A 4JZNA 4U1LB 4Z8FL 4P23B 5I74B 3EF4A 1TJHH 1DQDH 1IBYA 3L48A 4GUOA 3S35X 2ZPKH 1SYSA 2FR4A 4F5CA 1UTDA 5E4IA 1H9VA 3GIZL 2G9KA 2PO6B 2Z31B 1U92A 5J13B 4ZG1A 3VNZA 2IBBA 1TQCB 2DWYA 1CFNA 3DRQA 3LQMA 2Y69B 1T5XA 1MUJB 2FWUA 2QMKA 3L6FB 4P5MB 3W1ZA 5IBUG 1WIUA 1EHNA 2DM7A 3WY1A 4UDUA 1A1MA