3PAVA

The reduced form of cueo
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
487
structure length
466
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title The reduced form of CueO
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 135
structure length 466
sequence length 487
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pavA03
1J9SA 1CYXA 1SHXA 1NIAA 4AX3A 1OE2A 4HCIA 1BXUA 1X9UA 1OCOB 1URIA 2PPFA 4YSPA 2TSAA 4DP7X 3AW5A 1A4BA 3IEAA 2BP0A 2BWDA 1FFTB 4A67A 2GBAA 2YAPA 4NB7A 3IN0A 1J5DA 1JVOA 1L9OA 1NWPA 4ENZA 1AZNA 4Q8BA 2HRGA 2VSMB 4WKXA 1XMEB 3ERXA 2PPCA 1L9QA 2QT6A 1ASOA 1GY1A 2FQDA 4BXSV 4DP9X 3DKHA 3OMIB 4QKTA 2VW6A 2R7EA 4F2EA 1OCCB 2YQBA 3QJUB 4UANA 5I5MA 5LDUA 2FNWA 1A4CA 2HX9A 5B1JC 4AZUA 1JOIA 2CCWA 2XYBA 4A2DA 2YXWA 1WA2X 1AZCA 2DYSB 4TXVB 4KNTA 4A68A 4DPCX 1IKOP 1KCWA 3RYMA 4E9YA 1AACA 1SHWA 3ABLB 3H4HA 1A4AA 4A2GA 1E5YA 4YSCA 1EHKB 1PNCA 1V10A 3ABGA 2YAMA 3EH3B 2HX7A 2HX8A 1ETJA 3QJRB 4HAKA 3T6XA 4YL4A 4A2HA 1GS8A 4HALA 4YSSA 4BDVA 2UXVA 2CUAA 1KCBA 1KBWA 2GC7C 2IWEA 3SBRA 2CJ3A 2BP8B 2H3XC 4FA7B 2J5WA 1AOZA 1ET5A 3NJJA 2Q9OA 2RACA 2YXVA 4BWUA 3X1FA 3EH5B 2FT6A 3MBWB 4P5SA 5TK2A 1GSKA 2FWLB 1JZHA 1NPNA 2BW5A 2UX6A 1WA1X 3FU7A 3CDZB 4JHUA 1BYOA 3PCYA 1NZRA 4AKPA 2A3TA 4E9XA 2VM4A 2VM3A 1KDJA 2PLTA 2DV6A 1TKWA 1QHQA 5A7EA 3PAVA 4G7SB 4HCGA 2GIMA 1X9RA 1FWXA 1E5ZA 3NP4A 2WSDA 2W8CA 1AS7A 4ZK8A 5I28A 5IY5B 3PXLA 1GS7A 3FYIB 3AG4B 4EF3A 3T6VA 1MZZA 1TEGA 2XX0A 3UGEA 2QPEB 4DP0X 2CALA 2UXFA 1AR1B 1ID2A 5AZUA 5FC9A 3NJGA 4K9JA 1XB8A 2BZ7A 1SNRA 4KO5A 1AZRA 3BVDB 3IE9A 2YARA 3NJNA 3CVBA 1BQRA 1NIBA 2OCCB 3TA4D 2FTAA 1PF3A 1JERA 5D4HA 4CSZA 1FA4A 2QPDB 4HIPA 2J56A 3DTUB 4YSTA 1CURA 5PCYA 2Q5BA 3AY2A 3FT0A 4DP6X 7PAZA 2HXAA 1MDAA 5F7BA 2VMJA 1YLBB 3OM3B 1EZLA 1JXDA 1ASPA 4A2EA 2EINB 3TU6A 2XUWA 4GP5B 1ET7A 1KDIA 4BWWA 1J5CA 3WI9A 1OOWA 3EF4A 3OMNB 3MX0B 1E67A 3NT0A 2IDTA 3FSWA 1QLEB 1PZBA 4YSAA 3EHBB 5I6LA 1MG2C 3C75A 3QJTB 3GYRA 5ANHA 1ZDSA 2YAEA 2CAKA 1BXVA 3ABKB 5B7FA 2XXFA 4RH4A 3OD3A 3CZUB 4BK5C 1AIZA 1PNDA 3NP3A 4E9VA 4G71B 4GP4B 4HHWA 5AFAA 2BHFA 1A8ZA 3AG2B 1XB6A 3X2QB 1W6LA 1V54B 2QDVA 1V55B 1AQ8A 3NSYA 1ASQA 1E30A 5I6KA 1W6WA 1NIFA 2QDWA 1M9WA 1PZAA 2PCFA 2UX7A 3D12B 2FJSA 5E9NA 3SBPA 3N2JA 3QJQB 2AVFA 2DWSA 2UXTA 3IN2A 3NYKA 1MZYA 1DYZA 4G7QB 3X1NA 1A65A 4BXVA 1JZFA 1PLAA 4GXFA 4AKQA 1NDTA 5B7EA 1AG6A 3QQXA 1HAWA 5B3SB 3QJSB 4CSPA 1KV7A 4PCYA 1BQ5A 4E9SA 9PCYA 3S3BB 3T6WA 3BQVA 1KYAA 2XV0A 4AKOA 4M4RB 4UF7C 2VN3A 2FQFA 2EIMB 2I7OA 1NTDA 1AG0A 1ZIAA 2XXGA 5I6OA 2ZONA 4DP5X 5I6MA 4YVUA 3H56A 1JVLA 2VSKB 4DP8X 4KO7A 3NJLA 1GW0A 1RZQA 1PLCA 2B3IA 4KOBA 2CBPA 2DWTA 1ZV2A 1RKRA 3HB3B 3UADA 1JXGA 1SDDB 3QPKA 3NSCA 5B1AB 4E9TA 4YSUA 2HRHA 1WA0X 1SF5A 4HHGA 4HCFA 1OCZB 2BP8A 2MRYA 3PAZA 3KW8A 1AAJA 3H4FA 1SFDA 1ZIBA 1N70A 4AI7A 2ZXWB 3OMAB 1F56A 4E9WA 1PY0A 1XB3A 3S3DB 1AS6A 1OE1A 1NPJA 2X88A 4NAJA 1ZPUA 3JT2A 2EIKB 2ZOOA 3CDZA 2X87A 1L9RA 5F7AA 3S8GB 2AZAA 3WKPA 1T5KA 1BYPA 1JZEA 3FS9A 1I53A 4E9RA 1QNIA 4WTQA 1M57B 4YSQA 2WO2B 4KO6A 3ZX1A 1NIDA 3UAEA 1ZDQA 1UATA 1TEFA 5I26A 3X1BA 3FQYA 5AKRA 2GI0A 4QLWA 4W1TA 4N4YB 3G5WA 1CUOA 1CC3A 1AZUA 4KOCA 2XWZA 3ASOB 4GYBA 2W88A 2HLEB 5I5JA 1OCRB 2N0MA 2J57A 1AANA 2PCYA 1J9RA 2IWFA 1WS7A 3NJIA 1J9QA 2I85A 3AZUA 2JXMA 1BAWA 1DZ0A 1TU2A 2XLLA 2FT7A 1MG3C 1SJMA 5TK4A 3SBQA 2VW7A 2BP0B 2NRDA 3OQRA 1ADWA 1BXAA 1NIEA 4YSOA 2IH8A 3V9CA 1PZCA 4N8UA 3S8FB 1IBYA 1L9TA 1PLBA 4A66A 3NJHA 2YAFA 1RZPA 4W9ZA 3WNJA 4YSEA 2BWIA 4HZ1A 1HAUA 2XV3A 2AFNA 3NSDA 4G72B 3U25A 3FPYA 2R7EB 3L45A 4G7RB 4MFHA 4F2FA 2YAOA 3FU8A 1RCYA 3FSAA 2E86A 3QJVB 4Q89A 4X4KA 2Y69B 5I6NA 4M3HA 3ZDWA 1L9PA 1IUZA 2FQEA 2I7SA 1OE3A 3SQRA 1JZGA 3T9WA 1AS8A 2P80A 1OV8A 3V9EA 4KO9A 1VLXA 5B1BB 5I5IA 4FAAB 3AG3B 2IDUA 4NERA 1N68A 3FYEB 2AZUA 4DP1X 1PMYA 3CG8A 4DPAX 7PCYA 2GB2A 4YSDA 2GHZA 4BDVB 2GC4C 3KW7A 3FU9A 2PP8A 1M56B 3UAAA 1BQKA 2H5UA 1SF3A 2ZWNA 3ASNB 1JXFA 2XVBA 1CYWA 1GY2A 1JZJA 5D4JA 2FQGA 2YAHA 3TASA 1AZBA 2J55A 4GY4A 4DPBX 3WG7B 1J9TA 3T6ZA 3FU7B 2JFCA 3FSVA 1R1CA 4PAZA 2BW4A 2EIJB 8PAZA 4JHVA 1WAEA 4DP4X 1KBVA 1IC0A 3AG1B 3FPXA 3N55A 2UXGA 3DIVA 6PAZA 3EH4B 3FQ1A 3NJMA 4L0PB 1NICA 1HFUA 1NINA 2OV0A 3FQ2A 3GXUB 2TSBA 5EHFA 3PLYA 3HEIB 3JTBA 1PAZA 5B1JA 2AANA 3TBBA 1IBZA 1ILUA 2IDQA 3PPSA 2H47C 3ZBMA 4E9QA 5D4IA 3ZIYA 1L9SA 4YSRA 3ABMB 1W8EA 2IDSA 2IAAC 5B7MA 1GR7A 1BEXA 2JKWA 2FT8A 3WNIA 3FSZA 1SDDA 2YAQA 3GDCA 2PPEA 6PCYA 2DYRB 4YVNA 3WIAA 4BWTA 2PP9A 4UAHA 2Y1AA 2HZHA 5B1KA 4KNUA 2VW4A 4F7KA 1SFHA 2PPAA 1KGYE 2PPDA 3CVCA 4GP8B 4G70B 3T71A 3WKQA 2P80D 1PCSA 3IBOA 1GS6X 2XX1A 3NJFA 3NSFA 4KNSA 3NJKA 2PP7A 2BO0A 2IDFA 4P5RA 2OJ1A 2IWKA 1NWOA 1A3ZA 4JKNA 2MTAA 1ET8A 4DP2X 2WO3B 2GSMB 2XU9A 2IH9A 3CVDA 3X1EA 3X1GA 2BZCA 5I6PA 3TBCA 1JZIA 1WS8A 2B08A 1ILSA 2EILB 2LLNA 4A2FA 1E65A 1OF0A 2XV2A 1B3IA 3PAUA 3S3CB 3UABA 2DY2A 3UACA 5PAZA 1GYCA
chains in the Genus database with same CATH superfamily
2NY5C 5IEHB 4UDUB 4CC4A 3BW9A 1LDPH 1QRNB 1QFPA 4OUUA 1MCRA 4MNQB 3GMRA 3TFKC 1BXUA 3KNBB 3O3UN 3PIQA 1H9VA 2MNJB 3AITA 4WFHE 2I25N 3ME0B 2YXFA 2QHRH 5SWSD 5J3HD 1JVOA 4WO0A 2YUXA 3QEHB 3WMPA 3MODH 1E50A 1UXWA 1I9IL 4B3VA 5BOZG 2EEDA 4RAVB 1HILB 5GISH 1R47A 2CXGA 1BQLL 3AB0C 3V5DA 2PTUA 2UVEA 3ERXA 4NXKA 4Y4FB 1SEQH 1JPGA 5AB1A 3SKJL 1A4KA 3M1BA 4J3OD 3DKHA 3KPTA 4GO9A 2H41A 3QUKB 1Q9KA 3QIBB 5H94A 5KVEE 3GNMH 1I8LC 3QJUB 4UZSA 3A6BL 2HX9A 1N64L 4U7KA 1XSIA 1BBDH 4AQEA 2XQBL 3RFRA 1LE9A 2EEXA 2X4SA 1UCBH 5DEFB 5INCA 1AZCA 4DQOL 4QF1A 1WGVA 4MGXA 1BFVH 2Z65C 2AJYH 3KDMA 5F2FA 3T2QA 3CFTA 4NKMA 3LQMA 4FQXC 1BZDA 3DHPA 3FUIA 3FN0H 4M5SA 3V7AG 4DKAA 4WEEA 4ZBJA 5C09A 4HF5H 8FABB 3CZSA 2Y6TE 2RFXA 4Y5XA 1MAMH 1UZ8B 4ABVA 5HYJD 5L7XH 1KCBA 4NO5A 2Z31A 4MZRA 4TV3A 1XF3A 3HFML 4X8JB 3LTVA 2LTQB 2OSWA 3CUPA 2BSDA 1FZKB 4UQCA 4TVUA 1P1ZA 3NPSC 4M4RA 2YN3A 4G42A 2C9VA 2P8MB 3CVHL 3MBWB 4X5PA 2O93L 5GGTH 3SPIA 3UTOA 4FHJA 1A0QH 4OB5H 3BFOA 4XZ4A 1BW8A 2BW5A 1V27A 3VWJC 2Q6WA 1RY7B 4PJIB 3TPKA 4KQ3L 4M1GH 4A55A 1NOLA 2CRZA 4N2OA 1EX0A 2VUKA 2VXSH 4X4XA 2PLTA 3DX3A 1OCWL 4GSXA 4G8AC 4H0IA 1TKWA 4S1QL 5EBGA 2EO1A 1Q72L 4PGCB 4GAJH 4N2MA 3QPQC 4U1HB 5KSUA 5HDRA 4EQ2A 5GJTL 4DK3A 1MFDL 5SX5H 5AKSA 5DEGB 4OZHA 4NQCB 1XWVA 2P46B 4JUSA 3UPAA 4MWFA 2OW6A 4KZDL 4AIZB 4R7NB 3QIWB 4HOZA 3E7JA 4QO1A 2KMWA 5HHOB 5IESH 3TF7C 3SZKC 3OXRB 3NABH 4QRTB 4Z78B 5T33H 2D03L 3CFCH 3MKGA 5DSCB 1U8QA 5IHZB 3FF7A 5KSBF 2QPEB 3QWOA 4YHIA 4JFHD 1TZIA 4NC1E 1A4JA 1IB5A 1EWHA 4YBHA 4ODUB 5DFTA 1UM4H 1GKOA 5D70L 1BAFL 1D9KD 3VFGH 1EHLH 1J87A 1KCUH 4JHWH 2V3DA 1IBFA 4WCYH 4ZTPL 3BKCL 3QA3B 3BMWA 4P59H 5BS0A 4R7VA 2VR5A 5IQ7H 5DZ9A 3ARDD 4G3YL 1U58A 3LPPA 4B53A 2HXAA 1GTFA 4XO5A 2BC4B 3BISA 1UD8A 2X70A 1F18A 2Z34A 1S4IA 4PJFE 4PU2A 1ASPA 3SDCA 4AK1A 3FT2A 4ONFH 4BUGA 1VPOL 3THMH 3EYUL 1TQTA 2EDEA 1M1XA 3TA3D 3H9SE 1OOWA 4KRPB 3ULUF 3MX0B 3O81A 1CDBA 1PZBA 3V79C 4NZUH 1IGIH 3QJTB 3MRNB 4MA7H 4E41B 4ZZFA 4IQHA 5I2IB 3DV4B 3NZ8A 5I8KH 3SKMB 4KKPA 3OD3A 4ZW6A 3MO1A 4QHMB 1N9PA 5HD8C 4CSTA 3M17B 3PWVA 4TPRL 5TE7L 2BY2A 2IAMD 4HHWA 1D7CA 3IDJB 1XBDA 2VL5A 2P5WD 4TLKA 1XB6A 2C1OA 3VMPA 3TBWB 4K2UL 3INUL 3I75B 4HQQL 4MJ6A 5CIPH 3EGSB 4ODTL 4G6KH 3OVUB 1C5DA 4FYSA 5T1JA 1MRCL 3MV7A 4O4YL 1OGAA 5ABDE 1RP8A 1ZTXE 1Q8MA 2BSRA 4W4OA 1G7LB 5DJ2A 4Z3IA 3HLKA 1JZ3A 5EA0L 2DOCA 1AR2A 2H26A 1DYZA 3X1NA 2R8SH 4U6YA 3L3OB 5SX4H 3DJZA 1JTPA 5B7EA 2X3BA 1MXGA 5HHNB 3T3PB 3V8CA 2P24A 1QWNA 4QYAA 1G6VK 5ERWA 3ZHKA 5JLZA 3WTYA 2VDML 5J6HB 5F7EL 1MIEL 4KK6D 1HSAA 1XGPB 1IILE 3IWUA 5AG9A 3I3DA 2OBGA 2W95A 4YIQB 3GGWB 3LNGA 2VN3A 2I7OA 3MBXH 4YK4C 4WY7H 1KPRB 5F7KC 5F9OH 5F1IB 3EJPA 2QBWA 5KVGE 3H56A 4G8FA 4DP8X 2YGNA 2OMUB 4OH2A 4ZO8A 3O4OB 3SGEH 4IK6A 4F7TB 2HT2D 2NY5H 2DI7A 1IE4A 4N2FA 5FUCC 2EXWC 2VDPB 5DFVD 4KKLC 2AEPH 2A77H 4L0ZA 3UTSE 2PO6B 4FULA 4EKXA 2B0SH 3IF1A 3NSCA 5GGSB 1FL5B 3FFDA 2JCCA 1CFVL 2O6PA 1O9VA 4NDMB 2YA1A 1T5XB 3M8OL 1A7RL 4Z7UA 4CUCA 1VDGA 4ZFOB 1XIWB 2YGOA 4L8BA 6TAAA 3B8SA 3KLSA 5D5ME 4MXWH 4WK4B 1AR1C 2CPCA 1NEZG 2P49B 1IGJB 4P4KB 2X44D 1XVSA 2G4GA 1X44A 2JMRA 2YPVL 3WLWD 5CFAA 3I85A 1AO7E 1BMZA 5ICYA 4XP5H 3T0EC 3EYFB 4L2LA 3LQAL 2ZXEB 3T09A 4QHLA 3OPZL 5IG7A 2HKFH 2B3RA 2FGZA 3REWA 4BA8A 3DTXA 4U1NB 3VW3L 1KMGA 1JPTL 4X8CA 2BINA 1I8IB 1QNIA 5ANME 4PRBB 3PDDA 4GXUM 1X5IA 5BOJA 4M7LT 4P2QE 2YEQA 3LS4H 2APTA 4BZ1A 1ZDQA 3LZFL 2IMNA 1ZHKA 3BFQG 1V7NL 1J0IA 1IM9A 2WTRB 4WWKD 3HG4A 4W1TA 4YHZH 3EZ8A 3PL6C 1AZUA 5AVSB 2VDPH 4M7LH 4U6HA 5I1KH 1AIFA 1MWAB 1KLFB 1T1YA 3L1FA 3KBHE 2FX8H 1MREL 2ZP9A 3BW9B 4OUUB 4ZNEA 5CILL 2VQ1A 4V1DA 3GMRB 4PMEA 2LLGA 3PIQB 4MD0A 1DQJA 2CJTA 3EHBC 3MMEA 5CP7A 2FT7A 3SBQA 3V4VA 3B9VA 1SPDA 3NGBC 3P73A 4UQ9A 1FZJA 2X4RA 4ZG1A 5I75C 2YBGA 3S8FB 3QCUL 2ESVE 1H0DA 5IMKA 1UXWB 1PLBA 1WIUA 1XHHA 1XZ0A 3U7YL 2YAFA 4JY4A 1UURA 3EIFA 3WSQL 1M6OA 3V5DB 1WEJL 1NCIA 3UBFA 1DDTA 1LDSA 4UT6H 1JPGB 2O5ZL 3X3GH 3NSDA 2PETA 1A4KB 2VH5L 3M1BB 2R2EA 4EI5D 4N24A 2ITCA 3VXME 1Q9KB 4Y19D 5DHVA 5H94B 1U33A 5E1QA 3VACA 2GITA 3TLRA 3CH1A 1U2CA 3SE3A 4YH6A 4AQEB 4P23D 5TFSL 1LE9B 2X4SB 5INCB 4Q9RH 2WYZA 4WWID 5IW6A 1CE6A 1OE3A 1W9XA 2FQEA 4QF1B 1MWAH 3FFOA 4KO9A 3KDMB 4NKMB 5DZAA 1EZUA 3BQUD 1P7BA 1PFCA 1U8HA 5C09B 3MZGB 2F58L 4CILA 4TQEL 1F58H 2RFXB 4Y5XB 4L18A 1D9KA 4F33A 2PR9A 4IHBA 3FU9A 3V0VA 4NO5B 2Z31B 5MERA 2P47B 1XF3B 2V9QA 2EH8H 4CVZA 1BQKA 3ZT7A 2XKSA 3CUPB 3JT0A 4JRXA 1BGXL 1I31A 4XCNA 4XCYA 5CCKH 1P1ZB 1J5IA 2ZCHL 4J3OC 3ML8A 1EAJA 3ARWA 3ARDA 1GY2A 2X6AA 2SODB 3HE7D 4G42B 4A7TA 5IQOA 3HMWL 1MJ7L 3LZOA 5JW3L 2OTPA 1TJHH 4ODXA 2Q6WB 3FSVA 1Z32X 1SVBA 2ZCKH 1A6UH 3HI1A 3VQLA 5T3XL 3H3PL 4X4XB 3W1ZA 1BZ8A 1S7UA 3BWUF 1TKWB 3AG1B 3OZ9H 3NIDE 4OR1A 2UXGA 4ODHH 3SHSA 5IOKA 5KSUB 4YAQA 1T7XA 1XR8A 1L0YA 1ETZA 4NM8L 3T2NL 5EHFA 1S6NA 3RVVD 2LU4A 4OZHB 1TT6A 4MWFB 4HXAH 1G87A 1I9EA 3GKWL 3INOA 3SB3A 2GTQA 2VXUL 2RD0A 1BA9A 4QO1B 3ZIYA 4HBCL 1BWWA 4B9ZA 5LN8A 3ZVVA 3GMMA 2ETWA 1U8QB 5CJXC 1KGIA 2IAMA 5B7MA 3QWOB 4JO3L 1RXLA 4YHIB 3VXQA 3OAUH 3KEHA 1TZIB 1QFWH 3O9WA 3JWOL 1A4JB 3D8MA 3WTXA 3UTTE 3E8UL 3V95A 2JB5L 1SLVA 3FJTA 1G9MC 4NC2B 4PG2C 2Z0UA 3MACL 2BM3A 4Z7OE 5CCJA 3VB8A 4GLRH 1HESA 2K7QA 5BS0B 4XP9H 2DD8H 1O5PA 5I16A 2FEEI 2MQ0A 4LBAA 5DD1L 3HG3A 4FQQA 2XWXA 1KXVC 1U58B 4N2LA 2ED7A 1ZT7A 4PWJA 2J7LA 3GZPA 5SWQA 1NCDH 1OW0C 2X70B 2VTFA 4ZMOA 5KANG 4HLZH 3SDCB 3BJLA 3FT2B 1JNNL 3OMZA 5FV2A 2X4PA 2ITDA 2VISA 2GHWB 2DMGA 3FBKA 5AOLA 5E4OA 1M1XB 2DQHL 2A9AA 4PLKD 4FI7A 4ANXA 3TBCA 5IFHL 1JTTA 1ILSA 3RNQA 4KJPD 1RJLA 1R3KA 4WUKL 5CGYD 2XQYK 1B4RA 3MHZA 5PAZA 3NZ8B 3HUJE 2GJ6D 1QSFD 3MO1B 2V6HA 4PP1D 1AFVL 4KY1H 3BIBX 5LQBL 2YUZA 3PWVB 3K0WA 4OCXL 3QWRD 3DUHA 2CK0H 5GRUL 3RVUD 3PE9A 2VL5B 3VFNA 4GI9A 1F8TH 2C1OB 1BD2E 3ARDC 3GIZH 4Q2ZA 3RZCC 3ZL4L 2ZUQB 3ATEA 1NDGA 1SOKA 2QVFB 3ML9A 2JJTA 3NQKA 4MJ6B 4UUJA 1O5DT 4Z5RA 1DJHA 4F8LA 1OT4A 4KDVA 4OGZA 4ZX4A 1C5DB 1NWPA 2F5BL 3MV7B 4C4KO 1VCAA 4IBZA 1OGAB 4LEEA 2MEJB 3C2AH 1GHFH 5L2KD 4LKXA 3NUKA 2CA3A 2BSRB 2OR8A 4OLWL 3IGUA 3IMTA 1GZHC 5DJ2B 3KG5A 3MA9H 5EZOH 3TA3C 2H26B 2FQDA 3VNZA 4BXSV 4U6YB 5C0JA 1IEHA 1MNUH 5LDUA 5L8LB 2P24B 2HRPL 1EDYA 1Q94A 1N19A 3GI8L 5ERWB 5JLZB 1EGJA 3EKCA 4JPKH 1HSAB 1Y07A 3NCCB 1ZVSA 2DQCH 4MCZA 4PJ8D 4JZJA 3RBGA 4YS4A 4IRJD 2VAJA 3L08A 1YPZA 3CVIL 2BDNL 2HVJA 5CZVL 1IKOP 4JO5A 1L4IA 4WEBL 3WYRA 3GLEA 1T6WA 2XRAH 5F3BA 3ARXA 5D71L 4G8FB 1EAQA 5D2LA 5AVYB 3ZTNL 3BDBA 1DSFL 1I3VA 2X40A 1T0MA 4HYTB 1JSYA 4N2GA 3QJRB 2IGFL 4D7BA 1MQKH 1QVOA 5GRJH 5TE4L 3IF1B 1NAKH 5IHUL 3FFDB 2FEDC 1EFQA 1ML0A 2GC7C 5LAXA 2JCCB 5KVEL 4FA7B 4OLVH 3ROOA 2N7AA 3BT0A 4BUQA 4KKQA 1ESOA 4Z7UB 2NXZD 4L8BB 1EO8L 4PB9H 5ITBL 2EYTA 4PJBA 2A38A 4M5YH 3EBHA 3RFZC 4PCTA 4EI5A 2CR6A 4KK6C 1BYOA 5ICYB 4OW6A 4FYRA 3JWNC 4Z3GA 5IG7B 4QHLB 5FIEA 2B16A 4KY2A 3REWB 4WO4C 3DTXB 1CLOL 1GIGH 2QEJA 2FRGP 2GSGA 4HIHA 1FQ9C 2ZUWA 5F9AC 1RIUH 4RAHA 2EDOA 4ESKA 2AABL 4GMSH 4HPYH 5AVTB 2NY6C 2HT2C 5ISZA 3RL1A 5E2WL 2NZIA 1ZHKB 2WSDA 4WJG3 5DFVC 4CAGA 1IM9B 1DO5A 3BQUA 1FAKT 4CL7A 5CMAA 3HNTL 2ERJC 5DMKA 2EDXA 4U2ZA 4PHZA 2R83A 4U6HB 5GGUA 1AIFB 3JV6A 2EDWA 2O5NA 1T1YB 3MLRH 4H8WL 2LT9A 2XX0A 5D9SA 4WFGD 2XYCA 3ELQA 2CWRA 1MCLA 2VQ1B 4PJFF 4V1DB 5FC9A 2AJXH 4OM1L 5KOVC 4UYPA 1XB8A 3R0MA 1XDTT 1GYVA 1DQJB 3MMEB 3EAKA 4MD0B 4NP9A 4S1DD 5CP7B 1G1KA 3HE7A 5IROC 3V4VB 3ECUA 4HKBA 3WLWC 2X3CA 1R0AH 3P73B 1JD7A 1FZJB 5E4AA 2X4RB 4J3OH 4PEEA 1NGPH 4XPFL 5E4IA 5F7YC 1XR9A 1QQDA 2BCKA 4K23L 4OT1H 1H0DB 5I1CL 5IMKB 1MOEA 1XZ0B 3WE6A 1CURA 5PCYA 3I9GH 4JY4B 4RMRA 2AMUA 1M6OB 4ODSL 3MLSL 3CC1A 3FC8A 4OCSL 1KCKA 2R2EB 1IFRA 2WAQA 2VMJA 3HG1E 4UCFA 2ITCB 4Y9BA 5DHVB 1BV8A 2GITB 4WWKC 5CNHA 1ADQH 3CH1B 3A4EA 3VXNA 4GP5B 5JA8B 1H8NA 5LLIC 3W5NA 3EJJX 2XBZA 1J5CA 3GLZA 5D7IE 3TCXA 5IW6B 3NFNA 2CDEA 1CE6B 2VR9A 4NFBA 3ETSA 2A2QT 2V8LA 4JPVL 2IO5A 3RJDA 3APMA 3ARBD 3V7MA 1TJIH 2A7BA 2F6AA 2XVLA 1EBPA 1U8HB 3BP5A 1PY9A 1N0LA 3V4UL 1JGEA 3Q1SH 5H8DA 1TJGL 1XCTA 1WSST 2LQRA 1XF5A 3V4VH 4OCYL 1RVFH 4G80A 1D9KB 2R29L 4F33B 3QCTH 3MOQA 5AFAA 2FDBP 2QQQA 3V0VB 5MERB 3HB3D 4ZUVA 2F0CA 4CVZB 1Y6KR 2XG5A 2LAAA 4JRXB 4XCYB 4XCNB 5AW7B 3IT8D 3V0WL 3T0DA 3ARDB 3TJPA 1U3HC 3TXAA 5FYJD 2F08A 5BRZE 3E0GA 4POZD 1NCUA 4LGRB 2A6IA 1BG9A 3UG4A 3VA2C 5DHVH 4ODXB 5HHPA 4WI3A 3MV8D 4P23C 1JZ7A 2AVFA 3NYKA 3NSXA 3SGJA 3HI1B 2UUDK 4UIKL 1PGRB 4S1SL 4NJ9L 4PJCF 1N3NA 1S7UB 3HI5L 3D2TA 5D4QA 1PIGA 1SJEA 5EC2A 1KXQA 4LVNC 1TVDA 2WXMA 4P9ML 4EDXA 2WK2A 4H0GA 4YAQB 4MB4A 3LMJH 5DZJA 1XR8B 3TV8A 1ETZB 4IK7A 1SZNA 3MLVH 4HGWA 4L3EE 3UDWC 2ZKHH 3Q6GH 4RNRA 2OJZL 2JKJA 5D5MF 1AG0A 5I6OA 4F9PC 2JJSA 3RVWD 2GJ6A 2CRMA 1QSFA 1PX8A 4KMLB 2KT6A 3GMMB 4HC1L 3V0AC 3QWRA 1PLCA 1YQVH 1ZTXL 2IAMB 4J4PA 3EGXA 3VI3A 4DGYL 3VXQB 1IGFH 1ITCA 2OL3L 1N6VA 3KCPA 3O9WB 4KHXH 4UILL 5J11C 4LHUD 1C7SA 4LLUA 4NLAA 1SJHA 3MJ6A 3WJLA 2E7BA 1SFDA 1UM6L 2I60H 5L2KA 4XNXH 2NLJA 1HHGA 2XQYG 4OFVA 5DVOA 4FNQA 3SJVA 3WKML 4DZBA 5I16B 2ZOTA 1ROWA 4NAJA 3SBWA 4FQQB 4KV5E 1UACH 1FBIL 2H1PH 3PNRB 4G5ZH 1ZT7B 3DLQR 4J3WA 4NLHA 5FV1L 4AJVA 3RVVC 1DVTA 4M7JH 3HW7A 3JTTA 5KVGL 5IB3A 5SWQB 2NCMA 1T5KA 3MOBH 2W9DH 3QIUD 3RIFK 5J89A 4NUJA 4JDTL 1NJ9A 4RMTA 4XP4L 1FGVH 4IRJA 3OAWA 5EC1A 3FT9A 4DKFL 2X4PB 2ITDB 2VISB 1EXUA 1GRWA 2KDYA 4G5AA 5IJCC 4LBEA 3EXLA 3UAEA 4FA6A 3HI6H 2YD6A 4HPOH 5LCVA 4BZ2L 5AKRA 3RNQB 1Z3GH 3O4LA 2V5RA 2ZX8A 1RJLB 1B2WH 1R3KB 1CGYA 5LGHL 3MUY1 3P02A 3A21A 3F64A 1DHKA 2KLTA 2KZ1B 2FO1A 1OT1A 4JG1L 4RSVA 1I8MA 4ENED 5F71A 2WGNB 4L3AA 1KTLA 3KGTA 2XWDA 1EVUA 3NJIA 5DZLA 2I85A 2PR4L 3AZUA 2NCEA 4JFZL 3RX9A 3PWLA 3VFNB 1GPOL 1OEZW 1QHPA 1HXMA 4Q2ZB 3HE6C 4NGHL 3CSPA 1W72H 1NDGB 1S9KC 1JCVA 4UUJB 4Z5RB 1AD0A 4YDKH 3O2VL 4L5FH 1U8OA 4PJEE 3LKQA 2W81C 1M2OA 1TOXA 3NJHA 4IRZH 4LKXB 1KBKA 2N0KA 3TBTA 2DMKA 2WKLA 1YECH 1KC5L 1HT6A 2WTPA 1ORQA 5DMIL 3ZJAA 3JWNH 1ZK5A 2DIEA 3VXRD 5EBWA 4RWYH 3ZDXB 5C0JB 2Y7MA 5DUMH 4YHMH 4KRMB 4KJPC 1Q94B 3IXTA 3US9A 3ZTEA 3GXTA 3S37L 4XN4A 1ZVSB 4MCZB 1OAXH 4JZJB 3WD5L 1WTLA 1YPZB 1A9BA 2HVJB 2X6BA 3KE0A 1B6UA 2UWEF 4JY6A 1PSKL 2KUTA 4AVHA 3RVUC 3GF8A 3U0PA 5F3BB 1CTMA 4P04A 5KUMA 4AYID 2HMID 5BVPH 1XL4A 2OXGA 3ZSTA 5D2LB 1ETA1 5DK3A 1T0MB 2C3GA 5E03A 5KG9A 7PCYA 4L9LA 3K8LA 3B9KD 1TTBA 1WHPA 4YHNA 5FFGA 5LAPA 2YA0A 1QVOB 2OZ4H 3NIDF 5DVNA 3BUYA 2QQNH 4WV1C 5C07D 5LNGA 2VMCA 5LAXB 4K73A 3OG6B 3RWFA 4OD3H 2PF6A 3ROOB 3C60A 4E2OA 2VDLB 4PRPE 3ASNB 4NRXA 4C83A 2KPWA 2FNBA 2EYTB 2W9LA 4PJBB 4M7KL 2BVYA 3LHPH 4P99A 4EI5B 4AMKL 1AE6H 4Y19B 4QD2E 4PJ8C 5FHBH 3ZLQC 2DEWX 1XSOA 2BW4A 2EIJB 3D7PA 4JG5A 4V2BA 5F0LB 2G3NA 4DP4X 2GSGB 2ZWSA 4HIHB 2EADA 3O6FC 1O0VA 2XTJD 3NDZE 4UB0H 3RL1B 5ISZB 4Z7OF 5IBTL 3C08H 4M9OA 1XH0A 3BQUB 1ILUA 2G2NA 5CMAB 5DMKB 4P2RE 4MLSA 2C9XA 2BY0A 4XAKD 4C57C 1G9EA 4IKIA 4NIYE 4PQXA 5AOMA 5GGUB 3JV6B 3G7TA 3TJEH 3EYSH 5IIEA 1RERA 3BVXA 3IB4A 3ROLA 5D9SB 2NXZC 1ECYA 4M6AA 1WAAE 2ZUYA 5LNDA 4QT5A 3BE1L 2VDLH 4U1LA 5E1GA 4MJJA 2YAQA 3HE7B 5LWYL 3TV3H 4HKBB 3ETBJ 4HU2A 4DJMA 4J3TA 2IPTH 4HUWA 3H1ZA 1MCIA 1XR9B 1QQDB 2BCKB 5MHSD 5FOJA 1VEOA 3MV8A 3WE6B 5F3FA 2VXQL 1JYWA 3IDXH 3WKQA 4FS0A 3HUJF 3P2BA 4XXCA 3CK0L 1H8SA 5E8DL 1JWMA 2OYKA 3D3VE 2CGRH 3VTMA 2BO0A 4CKQA 5KW9H 4U7MA 2VZUA 1EJOL 2GY7B 2OJ1A 4W68A 3UO1L 5GZNA 1W8NA 3VXNB 5FWQA 2WO3B 2GSMB 2YGVA 3ARPA 4I1RA 4PRIE 5FOBA 5C0IA 2WXLA 5ALCL 1Q0EA 1SQ2N 5BXFA 2BZCA 3ATAA 5I6PA 2AI0H 3MRKA 3NFNB 1WS8A 2CDEB 1NM4A 4JO4L 2XXCB 5C3LD 4Q6IC 2P52A 2YIHA 2Q8BH 4CNIA 1L7TL 4PJ9D 3A23A 1IKFL 3PJLA 4S1DC 5JMOC 4LHUA 3BP5B 4C58B 1N0LB 1JGEB 3U1QA 1XCTB 1XF5B 3P1VA 4G80B 3MAWA 2R39A 2QPFA 4MRBA 1BVKA 3D4YA 3OZKA 4ZUVB 4K5MA 3LN5A 3LS5H 2HUHA 1KBGH 2XG5B 4U3XA 3JWDL 1MH5A 1N6UA 3BUQA 3LPOA 4ETYA 5EWIH 2DKSA 5DURD 5H4YA 3WFEH 3V0HA 3EOBA 1LL1A 1T83A 2Z7UA 3FCTA 2A6IB 5E9DD 1L0PA 2F53D 4NZTL 3DXAD 1NLDL 4XMLL 5HHPB 3QIUA 2PWDA 1U91A 3MV9E 4ADIA 3MDJA 4QRPE 1NCAH 2Y5TA 2CH8A 1TVHA 1N3NB 1KCVL 3NEEA 1F6LL 1SJEB 5EC2B 3G5YA 1F00I 5CLYA 5K69A 3RA7H 5DYFA 4EDXB 1IGYA 1JOIA 4U3CA 3ARBC 1TR7A 3HHRB 4QAMB 4L4JA 3GHBL 2YWZA 1JHLL 4HGWB 4JRYD 4A6YA 5T3ZD 4A68A 1PG7W 1PTZA 4RNRB 2DEYX 4RISH 3KWUA 4N90D 2JKTM 2GJ6B 1QSFB 2DLHA 2XZAH 4OV5A 3L54A 4M5ZH 5JHLA 4NKIH 5E5LA 3EGXB 3VI3B 5AWNL 4F15C 2LFEA 4PCKA 2FB4H 3KCPB 1DFBL 3T6XA 2R27A 4Y8AA 4LLUB 1GS8A 1SJHB 3CZNA 4POZC 3RJQB 1DUZA 2PYEE 1AGBA 1PJ9A 4KJQD 2H3XC 1WF5A 1TENA 4HEPA 5L2KB 3K2UL 1X5LA 1DQMH 2NLJB 1HHGB 3RG1C 3CZKA 3SJVB 4XXCC 4DZBB 1GSKA 1WBYA 3GJFA 5TGBA 1BWMA 3D39E 1U8NA 2UX6A 2APBA 2AXJA 2BVEA 2LE9A 3VXRA 1CDUA 1AH1A 1JE6A 1ERNA 1SBSH 2FCBA 3ENEA 1MAJA 4Q0XL 5TDNA 4KTDL 3BHBA 3JTTB 4X7EC 2AJUH 5IB3B 2DIAA 3II2A 3T2PA 2OP4H 4PJ8B 4HMDA 4PJXE 4NUJB 1PYWA 1NJ9B 5H4ZA 1HC1A 3PAVA 4FG2A 4IRJB 4NCC1 4RGMB 5EC1B 1X5XA 4HH8A 3VGBA 3I74A 5K1VA 1EXUB 1DLFH 4LBEB 4MQTB 5D1QA 3O4LB 1G94A 4UTAA 5IY5B 3IMVA 4LOEA 4G6AD 3WS6A 4FTVE 3N6YA 4X7CC 3K81A 4FXGA 2VWEC 4OGXH 3CFEA 3HKZA 2E7LC 3V0FA 1IC4L 4DP0X 1I8MB 5LB1A 1ID2A 5E2UL 1S3KL 4U49A 3N43F 1KTLB 4IDJL 1RZJL 1R5VA 4IJTA 3L5IA 2PTTA 3PWLB 1AZRA 1HXMB 1XEDA 3ALPA 4J23A 4XNBA 1LEGA 2Q3ZA 2YD2A 4NO2A 1NIBA 3VXSD 5D7IF 3E9UA 1AD0B 4NM4H 1JERA 1U8OB 4CSZA 4HAGA 3LKQB 2QZQA 4HIPA 2O30A 2VLMD 3WFCH 2A6KA 3LHAA 3TBTB 3LRHA 5MI0B 3P2TA 4N0UA 1JBJA 3ZZ1A 1ORQB 4BFGA 2OMWA 5DDHA 2NNFA 3J7HA 4PFEA 5EBWB 3Q8CA 5CN1A 3IXTB 1CD8A 1NSNL 5LCVH 4MCMA 3T77A 1KDIA 1QKZH 1OP5H 3IS0X 2QFRA 4ICXA 5I18L 4C56A 3OGOE 1A9BB 4JY6B 3BPLC 4Y2NA 5B3JE 5I6LA 1J1PH 4M1DL 4ECNA 2D7TH 3OL2A 4V11A 3U0PB 3BIAX 2OXGB 1N5YL 2R4SH 4B0MB 5IQMA 5KG9B 1W91A 2R0KH 4L9LB 5D7LA 2A74A 4DKTA 2BXYA 4N3TA 4YHNB 3QUYD 4GP4B 3BUYB 5AVVB 5C0BA 1A8ZA 5F0JB 3RWFB 2J25A 3C60B 3VMNA 5GZOD 1E3ZA 2ZP0T 5LN4A 2XWEA 1IAKA 3MV01 4OBSA 3RVTD 1ITBB 4JVUA 3AY4A 4LLWA 3PJSA 5HI3D 2HJFA 4NRXB 5IHLB 3TESA 2AC0A 4C83B 3WXVL 1ZKAA 2D4FA 4GAAA 2YJQA 4KH2A 4K94H 2EXTA 3VGAB 1M1SA 1BQUA 2F7RA 1UM5L 4PI0A 1WFNA 2PW1A 2PWGA 3UZEA 4G7QB 4BXVA 1R33A 3U7WH 2W9EL 4FXKA 4JGUA 2G60H 5AZ2L 1ZMYA 3G04A 4FP8H 1HAWA 2HMIC 2VR4A 1QSEE 2GBVA 1NCOA 5F6IC 2HVBA 3ARTA 5EV7A 1AXTL 4PJ9A 3B9KC 2J88L 3MLZL 1CB4A 4OZIA 3F7RA 1H3VA 3DV6A 4KZ0A 5I6MA 2I69A 4PJ5E 3LEXA 4XC1H 3NRQA 4LT7A 1GW0A 3FO9A 5IIEB 4HV8B 1VZGA 3ROLB 1KB9J 2CBPA 2AXWA 3HB3B 4QT5B 2GSIA 3UTZA 5KUKA 4U1LB 3HRZA 4QPEA 3WTVA 2AJSL 3Q2LA 3J07A 5HSFA 4RZCA 3W0WE 2BP8A 2W0KA 1E90A 2DQTH 3DVIA 4HUWB 3JSSA 4JFFA 1GGYA 3SOBL 3DXAA 4UV7H 1WZMA 2EE9A 2WN3A 3MV8B 3S3DB 4DO5A 4U6XA 3H3KA 4I3SL 2BZDA 2NYYD 2XTJC 3QVAA 2B1HL 2YEZA 4KKAD 3D09A 4UV4L 3RWEA 5JO5A 3D69A 3QEQE 1JWMB 3WKYA 4BV1A 4EBQL 2XTSA 3V0IA 1R3IH 2X10A 3WKPA 1XAUA 2BVTA 2Y23A 2WUBH 2Y36H 4ZJ9A 4E9RA 3IBEA 2PCPA 3N40P 4FQ2L 4QLRA 2H45A 1NCCH 4APQD 5C0IB 1KGCD 4DEUA 5FOBB 3QFDA 4Y16D 3NFSL 1ZANH 3ZX1A 3IDUA 5BXFB 4HEME 3BAYA 3MRKB 4PJHE 3UERA 3X1BA 3FQYA 3F58L 2E9WA 4PJEF 4Q9QL 1A8JH 3GXNA 1KYUA 4AEFA 4CNIB 1T1XA 1P7QD 4YX2H 3ASOB 4BQBA 2O1AA 4LHUB 1I85A 5CUSL 3OJ2C 4X6CA 2IG2L 1CD0A 3BKJL 3LV3A 4BE5A 3V8OA 1BF8A 4O58L 4QJ5B 4G82A 5FYJH 2VITA 3HC3L 1TFPA 4QWWD 4ZUSA 1BVKB 4K7PL 5IUCA 3LN5B 1OO2A 3RX8A 2G0LA 2VW7A 3LKRA 1UOWA 1P5UA 4HJTA 1MH5B 2E6PA 5EBLA 15C8H 3DBSA 3QBTB 1VFOA 2J12B 1MCWM 5K1JA 3T3MF 3EOBB 3VU2A 1KB3A 3FCTB 4BFOA 2NTFA 5CBEA 4XXDA 3RLSA 5E6UB 4GFTB 1MCJA 3QIUB 1I8KA 1U91B 5ALBH 2H0PA 2W07A 3U25A 3B2VL 3BKMH 2Y5TB 3WNNA 1TVHB 3HN5A 1P84K 3G5YB 3PDGA 1AI1H 3OLGA 2E27L 2OCFD 5AVRB 3IAQA 1FNAA 5EZIH 4PJ9C 2EIDA 1IGYB 2FLBT 4O2EA 5C7ZA 3IVKA 1YJDL 2C9PA 4GEJA 4A6YB 5I0DA 2JLPA 3KM2A 3V9EA 1DBJL 5IVNA 1C5CL 4OLXL 5E00A 4OV5B 2DQGL 3AG3B 1GA2A 2IDUA 3ARZA 3MJ7A 4PJ7E 2J1KA 4JY5L 3N91A 5I0ZA 4Y4KC 3RVXC 3PREA 4TQHA 2H0JA 4WJ5A 3IPFA 1CD9B 5J13C 3FTXA 1BFOA 1LHZA 1T4WA 3KW7A 1DUZB 1AGBB 3CLFL 2DWXA 4KVCH 2D0HA 3UMTA 4JO1L 5I1GH 3QHFL 4RGND 3WLBA 2ZWNA 5I8OH 2VSCA 5CAYB 3VA6A 5D4JA 1WBYB 2VMEA 3GJFB 5TGBB 1RUPH 1CCZA 3PFQA 1U8NB 3WJJA 4XO8A 3VXRB 3MJ9A 3WY2A 4ANWA 5TDNB 1J1XH 4GW4A 3T04D 3BHBB 1WAAF 3NH7L 3P40A 4M8QA 4OJFH 4J8RA 3QYMA 4B60A 1PYWB 1KTBA 4A6YH 3CFJA 3LIZH 3NJMA 5IVZA 5K9KA 1KIPA 1QA9A 4A7VA 3NZHH 1DBBL 1ZRUA 4G8GA 4EXPX 3QZPA 4JFDD 1PAZA 1FYTD 4KPHH 1F3JA 3FSOA 5D1QB 5CCHE 1KCSH 2V5YA 2VZVA 2PKDA 4G8EA 4OF7A 3WY1A 1L9SA 1DVZA 4FXGB 4KJQC 4BH7A 3CFEB 4XCCH 3VD7A 3KMDA 3QUYA 3B7RL 4B9PA 5D1XE 4DKEL 2APSA 2GKIA 1KFAL 5I23A 4RMVA 1R5VB 3BZ5A 3SPJA 5GZOA 4KQ0A 5IGXH 2PTTB 1AC6A 4KK8D 2J6EA 4LEOA 3TH2T 3V0JA 4NP4H 1JYNA 4D0DA 2Q10A 1LEGB 5AD0A 4NO2B 1KENL 4X5WA 4RIRA 3IU4H 1KEMH 1SFHA 4YXLH 3BH9A 3L4XA 1VEPA 1A6WH 1CDJA 4AQAA 2Y4SA 4GP8B 1E6JH 1U4FA 2A6KB 5C7XH 1NCBL 2P80D 2YPLE 3FTWA 4N0UB 3GD1C 4PD4K 1GS6X 3HS9A 3GSNA 4R97B 1UD4A 2OMWB 2K6WA 5DDHB 2VXVL 2XTJB 3SE9H 3RKDC 5C6TL 3VD9A 5AW6B 1ZHNA 1XD1A 1ZVYA 4U6VL 4XOAA 4I2XE 2XWJA 2H6OA 4G6AC 2YKLH 3T77B 4PBWD 2ZKXA 2CHXA 4UTAH 3U4KA 4P3CL 3QXAA 3CXDH 4C56B 4ZO6A 1B88A 4IMKC 2FH8A 3BI9X 1GGCL 2Q76A 3BPNC 3LZLA 1G4MA 3UABA 4U05A 4NN5C 1X5AA 2J43A 4HHAA 1HTYA 5D7LB 1CYXA 4NI3A 2A74B 1O7SA 1N4XH 2ZUUA 4JPSA 4HCIA 3RU8L 2BY1A 1T7YA 1YYMH 5C0BB 2IOIA 2Y07L 2AAAA 4JQIH 2DWEA 4N9GA 4D8PA 2XA3A 4LO9A 3FCGA 1H5BA 1IAKB 3PPEA 4LLWB 3PJSB 2HJFB 4OTXH 4KDTA 4ZPVA 5DJ8A 3PU7A 1L9OA 4KX9A 1DJZA 4Q8BA 4ACPA 4K3EL 4MDJA 5BUGA 3IRCA 3UJIL 1GL4B 3AUWB 4I85A 4YJZL 4OSUH 3O3EA 1I8AA 3T6QC 2PW1B 3NTCH 3OF6D 1QBMH 1H3GA 1JNLH 2LU3A 4B27A 4APQA 1OAUH 4FXKB 5JW4N 3G04B 4P3WA 3MLWL 4PRHD 4Y16A 1CLVA 5FM5O 4NC0B 1CICD 5E2VL 3QS2A 1VEMA 2F5AH 1FO0L 2WXGA 4PJ9B 4OZIB 4DPCX 12E8L 1U8KA 3QUYC 2WSKA 4FNLL 4HUXA 3IKKA 1AACA 3KJ6H 4LU5H 4N28A 3DV6B 5DVKA 3CMOH 3HS0A 3LEXB 4TMPA 1MDTA 1JS4A 3FO9B 2LU7A 2F54E 3L9BA 5HI3C 5DQDL 2GSIB 3UTZB 3KGRA 3NAAH 3HRZB 3L95A 4P8QA 5IV2A 4Z8FH 3GHEL 2BP8B 4EZLA 1LE5A 5DURB 2Q9OA 4HK3N 4JFFB 2FT6A 5FS5A 3DXAB 5M94B 5KTEH 3KPLA 4U6XB 5JQIB 2OMYA 3GBLA 2VO8A 1HE7A 4IEFA 2X1XR 2YEZB 1E28A 3RWEB 1A7BA 2VKXA 3D69B 5JO5B 3IETA 2NOYA 3MRJA 3D4ZA 3SDYH 2BPBA 4XODA 2R1WA 1RPKA 2PCPB 3K6IA 2QGCA 5C9JA 4ZD3L 3GBNL 3QFDB 3F83A 5I1IH 2IC2A 3LH9A 2IJ0C 1GVIA 2VZ3A 4M1CC 1ACZA 5I74B 1KJMA 2W8CA 3FFCD 3CSGA 4F92B 4EVNA 1T1XB 1TQVA 3FTSA 3MCYA 3DECA 1UJTA 2CKBH 4X6CB 3CWGA 2UXFA 2WIIA 3LV3B 2XN9E 1I1AC 5E4EC 1UTDA 4FOMA 5AVZB 2NZ1A 2VITB 5CN3A 4DGUA 4ZUSB 1F4XH 3D4GA 2VDNB 2NYYC 4XVTL 3KPOA 4IOSA 1KY6A 4YOKA 3LKRB 3F7VA 1P5UB 3RHWK 1QSVA 5BW7A 3MA7A 5EBLB 2JJUA 2XQ0A 2E9BA 4FXTA 5F1KC 5B3JF 1IC7H 1KZYA 3V10A 5D2NE 3ZKXC 4J2QA 1MWOA 5GXBB 4APQC 2NTFB 1N0XL 2OMZA 4FEIA 4LRNL 4XXDB 5DT1L 4Z7VA 5CBEB 2ZTBA 1R17A 3Q5YA 1I8KB 3OKNA 4N6RA 2W07B 3A6OA 3ULUD 3L48A 1AGEA 4C47A 1PDKA 5T3ZH 3RUGE 3FDWA 2KS0A 4QHKI 4R90H 4OFDA 2EINB 5A2LH 1V3LA 2JV6A 4WWOA 4O2EB 5K1NA 4AYBA 2G5UA 3IVKB 1D5RA 3N1PC 4DEPC 2WLNA 4AEIL 2CM5A 3DSFL 2IDTA 3WEMA 2YQGA 3U6XA 1FAIH 1HOEA 5E00B 1HYRC 4KUZH 4QWWC 2LV4A 3K6DA 3L1EA 3MJ7B 1ZVHA 3QDJE 4U1MA 2F61A 3NCMA 2VDNH 4WJ5B 1PG7H 4KK9D 1BFOB 1C5BL 2K6YA 3UCQA 4LVOC 3UOAB 4ZMVA 5LNEA 4K0OA 3WFHA 3NIFB 3V4PH 4FFYA 4ZT1A 1AD9A 2NUTA 3WLBB 3EFOA 3NRPA 4G8IA 1NMBL 1Q0XL 4BYHA 1WPCA 5GGQH 5ADPL 1C1EH 3MGAA 3DGCR 5D93B 3K2IA 2YQ3A 2GCYA 2PCFA 2UX7A 4UT7H 2J2ZA 4HJJL 2WVUA 4GW4B 3GPSA 3GEFA 2AJ3A 4M8QB 1NCJA 1RI8A 4J8RB 4QRBA 1KY7A 1YG9A 4H0HB 4H26A 2MPVA 3EDEA 4HWZA 5DHDA 3CFJB 1KV7A 5IVZB 5K9KB 3LH2H 1YY8A 1KIPB 1QA9B 4UZGA 2WKGA 1T89A 4G8GB 3TEXA 3LEYL 2XV0A 2DTMH 1F3JB 2AK4E 4KQ4H 3CLEL 4KVPA 3C8HA 2OR9L 4OF0A 1AJ7L 5AAPA 2AK1H 5HDBE 4BH7B 2AEOA 4PREA 2D4DA 3CN0A 1MI5D 3Q8FA 3QUYB 3MNWA 3D30A 3DX9A 3GSOA 1SY6L 4PS4L 2GFBA 2F18A 3SPVA 1E4JA 1EHNA 3UADA 1H8OA 5BW7C 4YLCA 4LEOB 5FHAL 5AVUB 4D0DB 1G1OA 1OCZB 4YBQD 3HAEG 4HWNA 5AD0B 3KL5A 4A39A 1ZLVH 4X5WB 5AB0A 2ZCLH 4PJHF 4RIRB 1FFRA 2E7CA 3LXCA 4P5KA 2FAUA 1BJMA 3BH9B 2G75A 4RFEA 1EXHA 4JGJA 1RFDH 2GIYA 4AQAB 5C97A 5CBAA 1SDAB 3VNYA 1AMYA 5K93A 4Z7QE 4HPHA 4PRHA 3GSNB 5FX3A 4FABH 3G5VA 2HKHL 1CICA 1UENA 2V0AA 3HC4L 3VX0A 1ZHNB 4G7YH 2RTTA 3IDNA 2XWJB 3OHMB 4HOMA 3A0OA 4FQCH 3ARFD 1LXMA 3V2AR 4ZSOA 2HT4D 3QXAB 1EHAA 4PJDE 2MPAL 5JXAH 2DMCA 2GI0A 4P2YA 4GFXA 3QUML 1VESA 2WLZA 2QELA 2Q76B 3FQ4A 3F84A 1S5IL 1UWEH 2VERA 4B9KC 1G84A 4KK8C 3FQTA 4HHAB 4HCRL 3KPMA 3V6OE 4PY8J 1X6NA 4HJSA 1AHWA 5CP3A 5KVMC 2RAMA 2J6EH 3LH8A 2DBLH 4KJWC 5F0MB 4DAGH 3KVDD 2W80C 2DWEB 1ZEAL 4N9GB 1SJMA 2C34A 4D8PB 1HSBA 5I30H 4RAUA 3KPSE 1H5BB 3S35H 1GXEA 3QFJE 4ZPVB 5DJ8B 3EXJA 5FGSA 4P46C 1L9TA 3GSNH 4M00A 4MDJB 2GJRA 2P9RA 5JIKA 4PJ7F 4A7QA 1W16A 3O3EB 3PFUA 3AMLA 3E3QC 2MTPA 5IB1A 5CCGE 2R69H 4APQB 4XH2A 1J10A 4G7RB 3L2NA 4GG6A 4ACTA 4B95C 1S8DA 2PUQT 2YAOA 3S48A 2L4OA 4Y16B 3ZKMD 3L16A 5KSBA 3CH8A 1OY3B 1S7QA 3AXHA 3I6LE 2KKQA 1HHKA 5EORL 3LDBB 5F9WB 4A2MA 3OLIA 2FE0A 3RIAK 3RPIA 3UYPA 2ZCZA 2GUYA 3ZDWA 1O6TA 2FZ3A 3K8MA 1NKOA 1JCKA 1JZGA 1U8KB 3DO7A 4HUXB 4CC0A 1NCGA 4UI2A 4F8TA 3G6DL 3S88H 5DFAA 3ARRA 3HS0B 1N68A 4NUMA 5J57B 1OP4A 4KX7A 2HG0A 3D18A 3K3QA 5B39G 2VLKE 1VA9A 3EDKA 4OY9A 2GB2A 4YSDA 4FFTA 4M6NL 3L95B 5DUBA 2GI7A 4X7TA 5IV2B 3LRSA 4WW1A 1LE5B 1N6QH 2J1ZA 4QOKE 1GAFH 4JCWA 5FGCE 2WQUA 2MCPL 1FGNH 3P3YA 4XPGH 3KL3A 1K8DA 4UT9H 4DOHB 2Q7NA 3KPLB 5EEWA 1IRAY 4RFNC 3DO4A 2OMYB 4WZ9A 3TIDA 5KANI 4K3JL 3DJSA 1JGUL 3C6EA 4PRDA 4IEFB 4F9LA 1MY5A 1E28B 2XIIA 3IETB 3MRJB 4NIKB 1PKQA 4KK5D 1SLWA 1BPVA 4NS0A 4R8WL 3VSVA 2KH2B 1QYGH 3L8QA 4AW7A 5L6YL 3FPXA 1CLCA 3DIVA 2R1WB 4B50A 3BMVA 2EZ0C 5EF0A 3UG5A 3EDJA 1NICA 5C9JB 5H35A 2VRKA 2MFNA 4IW4C 1T6BX 2Y7NA 1JGVH 1U8PA 4AQ8C 3BP7A 3OKEA 1KJMB 3D9AL 4BE6A 1X4YA 3ALXA 4EVNB 2FX7H 3PPSA 4YEEA 5EIIG 3MLYL 4B3EA 3AFLA 2ZXCA 1WZ1H 3NQIA 2QADD 2VIRA 1FC2D 2DICA 5ESQA 3ABMB 3QAZC 2YPVA 3BPOB 4MA8L 4HXBH 2WIIB 3DOHA 1MW2A 4G59C 4OZFG 1UA3A 4IHOA 4HJ0D 4RGNB 4NPYA 3ARGC 1JN6A 1BJ8A 2ZSWA 2YMTA 3O8XD 2EE3A 3IMBA 3KPOB 1UZGA 3KHQA 3F7VB 1G7JA 1KJ2L 3GBML 5DWUL 3MA7B 3QNYA 5JHMA 1CYGA 3OB0K 5K9QG 4P9HH 3VSUA 2ODHA 1KGYE 3AXLA 5AALA 4LSSH 4FI6A 2ADJA 4JUTA 3U0WL 4QXVA 2OMZB 4Z7VB 5DUJA 1C16A 5E8OA 1YEHL 4G2AA 2NR6C 4X4ZA 3OKNB 3CXFA 4N6RB 4WDIA 1JPSL 1NEZA 2W38A 1AGEB 1PDKB 3KLAA 5DJXA 2EKSA 4AZ8A 1J5OH 4AC2A 4ZW7A 3VDAA 1X5GA 2W60A 2WWNA 1XGYH 4NKQB 3I50L 1S7SA 1IU1A 3VG0H 4PWEA 4YFDB 1R9FA 4XX5A 2ARWA 3WNMA 4BSVA 3QP3A 2YRLA 3ATBA 5DC0A 5TD4A 1I8UA 1A6PA 3B83A 5DZNA 1U3YA 5JOFA 3OKLA 5KSAD 5IBLD 1V7ML 4BHUI 1MI5A 2MIZA 4X9YA 4GSDH 4URKA 1OARH 2AJVH 2FJGA 2RHEA 1CR9H 1JUFA 3AWEA 4U1MB 2DL9A 3VAEA 3DX4A 1J9SA 3BRDA 5EU6D 2EEFA 1T2QL 4FNSA 5A7BA 2GUOA 3PG2A 2ENPA 1CTNA 5LBVA 1BM3L 2XXMB 3WFHB 1JI2A 2KHAA 3AW5A 3E2HC 4XBEH 1AD9B 2NUTB 3GZKA 3IEAA 1IM3D 3EFOB 4G8IB 4LLQA 3D05A 4UMSA 1TYJA 3IGFA 5D1ZC 1XCXA 4WKXA 3MOAH 1CZ8H 2GCYB 2PCFB 2ILLA 4F2MA 2J2ZB 4OGYH 4P0DA 1ASOA 2EDJA 4NZRH 2AJ3B 5E08H 3ARFA 2C1PA 4OVVA 1IKNC 1J0KA 1HCZA 2X42A 3DYPA 1T03L 4H26B 4HWZB 5LBGA 1A4CA 4LCUA 5BO0D 1EV2E 1YY8B 4BSJA 4FQLH 5CKGA 4A2DA 3QZOA 5DZOA 4QTIH 1GSMA 3DRQA 5G4MA 1OOAA 4ELME 4I9WE 4KK9C 1BQLH 4ZUUA 4S1RH 2CO6A 1A4AA 1TSRA 3SKJH 3APCA 2NDGA 4MHHG 3IDYC 4PREB 4LPVA 5HHME 1YEDA 3MNWB 3BAKA 5I1EL 5JXED 1QSZA 4TVPE 3DX9B 2PMZA 3GSOB 5DGRA 3A6BH 2GFBB 4FFYH 1N64H 3SPVB 2CJUH 1LWJA 3SE8H 3K7UA 2WZAA 1FIEA 2XQBH 3FMGL 2QV4A 2AW2A 4B9CA 5C86A 5FUOL 2CJ3A 1WFUA 1PLGH 1CE1L 5DEJA 4DGIL 2OKMA 4LL4A 1DQDL 3CSYA 1U6AL 4LKCA 4XAWH 3VFPA 5BQ7A 2QMJA 3P11L 1IGTA 4P5KB 4RFEB 2XETA 3S7GA 2G75B 2PN5A 3RB5A 3P9LA 5E5UB 5CBAB 3QCVL 5A40E 5D6DC 4MMXA 1PBYA 1J11A 2FYVA 2R51A 1OQXA 4JRLA 2VDRH 2YOCA 1WGOA 4ANVA 1A7OH 4PRHB 5C71A 1R5IA 3GMOA 3MNVA 4K7PX 2HT3C 3G5VB 1CICB 2EH7L 1SXCA 4JR9L 3UBXG 2NNAA 4HIJA 1B4JL 1LNUA 4GRWB 1P9MA 1VRSA 2IPKA 3IDNB 4DSYA 2WGXA 1FFQA 4LVHC 3LJ3A 3SCMC 4TNWK 2ICWI 1RZFL 2GIMA 2VR6A 3FT4A 4LQFL 1DJSA 4FQHA 4ZSOB 1G0XA 1UWGL 2NSQA 1B0IA 5CJ8A 5F44A 4RBPK 3ZKND 3B9DA 2WPGA 5LJYH 2EUVA 2GY5A 3ISWA 2WINA 3CZEA 4MVBD 3VQMA 3RGHA 4IRSD 3A24A 4GUPA 1NL0L 4Q97A 3MZTA 3FQTB 4EF3A 4TUJA 4UQBA 3KPMB 5GSRA 3B2DC 3ISRA 2J44A 1AHWB 2D31B 1Q72H 3K2MC 3RUGF 3ZQ9A 1CXFA 1OM9A 2R0ZL 3R1GH 1NQBA 5CZKA 1OAYH 5GJTH 2XY2A 5JQ6H 2JKXA 3WFBH 4AGMA 4UINL 1NC4A 3HNSH 3PQYE 1LO2H 3NJNA 1HSBB 1WWWX 4RAUB 2NY7L 3JVGA 1KB5L 5ECGA 1EH9A 1UA6L 1T7VA 2QL1A 1Y18A 1DZBA 2LR4A 1JFQL 4EDWL 1CF8L 2K8MA 2I26N 1HYSD 1YEIH 4X9BA 2FBOJ 5IB1B 4JKMA 3UGXA 4XH2B 2XKNA 2FATH 3SZ6A 2MKLC 4GG6B 3V5HA 1S8DB 4A2EA 3ZYOA 4GUOA 5KSBB 1YPZF 1XMWA 3CQFA 1S7QB 5IHHA 4WHYG 1HHKB 5DJAA 1DQLL 5DD5H 2ZXBA 5E0FA 1COBA 4O5LH 1DR9A 4ZAKD 3RPIB 3VFTA 2C9RA 3UYPB 4RFOL 3RTLA 2XWBA 2FZ3B 3LZNA 4M7ZC 2WWMD 3C12A 3DO7B 3NACH 5CP3H 1Z3RA 2JJWA 4Z1PA 3HN8A 3L3IA 3D18B 4HT1L 3C2SA 5JNYA 1A9VA 3SKNA 3O8XA 3GTNA 5D7JC 5T5FL 4XVUD 4AL8C 2BOLA 4ZX5A 3QR1A 2WUCH 5DUBB 2YUWA 3ULSA 1E7VA 3DTDA 4X7TB 5B4MD 3LRSB 5EZPA 1L7IH 4WW1B 2VDMB 2N3JA 2W5PA 1RU9H 1V54B 1CVSC 1ZT1A 3CN1A 4NKOA 2A9NL 2K78A 4JKLA 4PJBF 4E9LA 3GMLA 1MN4A 3TZVC 1H3PL 1UOKA 1BLNA 3UTSD 1K8DB 2X0UA 2DMBA 4LCVA 5HDBF 3TIDB 1K85A 3WDJA 4DVRL 3B2UD 1YNKL 4PRDB 4EUPA 2OX5A 4TPRH 1PKQB 4A37A 4K8RD 3HBQA 2YRZA 3AREC 4JM0A 4G11A 4AKQA 2KDGA 4Y5VC 1E9OA 3INUH 3SGKC 5H35B 2F1BA 2D3LA 9PCYA 1AO7D 4K3GA 4TTDC 1INDH 3SGDI 1B6DA 3TT1L 4EI0A 1U8PB 2BK8A 3U82B 3VH8G 5JIDA 1QOKA 3BP7B 4ZMTA 3OKEB 2ITEA 1LO4L 4GXVH 3PYCA 1F45A 5EU6A 1T2JA 4MJIE 4XMTA 1RJYA 4O2CA 5EULV 3ARQA 4Z7QF 2VIRB 5ESQB 2Q8AL 5JIQA 1RZQA 3U1SH 4N1CA 4PW3A 1PZ5A 4IHOB 4GG8A 1A25A 5C0ND 1BAGA 1OSEA 5AKTA 4AW4A 4NPYB 1U8JA 1JN6B 1LLAA 3CZLA 5DD3H 2ZSWB 5FXCH 1FIGH 4BHUA 4HCFA 2MRYA 2OSYA 3BXNA 3IGLA 1G7JB 1AAJA 4PJDF 2ZYSA 3QNYB 4FLOA 3CXHJ 3ULUH 1JGIA 1W0WA 3IAPA 3AXLB 3S34H 3UYRL 3CSFA 3BP6A 3C6LD 2X88A 2ADJB 3DO3A 5E8OB 3H2WA 1C16B 1KXHA 3C8KA 3CDZA 5CO1A 4YXHL 4WDIB 1NEZB 2DDQH 1YUKB 2C9QA 5DJXB 3KLAB 1HKFA 2EKSB 4W6YB 4TL4A 4XO3A 4AZ8B 3NK4A 2ESVD 1OWRM 1AGFA 1SQMA 1RQ5A 4Z7AA 2W60B 5LDSA 1S7SB 1A7RH 1OAQL 3VO0A 3ETBF 1YUHA 2QADC 2Q1EA 5CLTA 3EO1A 4BSVB 5E2TL 3UPCA 4OCLC 1E7UA 5JOFB 5J12B 3OKLB 3DPBA 5IT2H 1MI5B 3B7TA 5JXEA 4QGYA 3RQ3A 1CUOA 2E76C 4AOFA 3BRFA 4X7DC 3LQAH 2FJGB 2B14A 3B8YA 5E6ID 1JUFB 4TUKL 3WE1A 4DN3H 3VW3H 5A6IA 1JPTH 1J9RA 3BZDA 5KBMA 2GUOB 2IWFA 1QBLL 3KBPA 3MXWL 1QTYT 1CGSL 2A9BA 3L9EA 4OD1H 5CR1A 3KBFA 1DBMH 2AQ1A 3JBG7 3O0LA 3ZT6A 4PI2A 1V7NH 2AV7A 4MKMA 5FFOA 3FQNA 2OMTA 4LLQB 3PAYA 4W9CC 4YSOA 1AQDA 2IH8A 2BP3A 2NX5D 1RUKL 3V0EA 2APFA 4F5CA 1DO6A 3U48A 3Q2NA 3SY0A 4Q9CA 1RZIA 1MREH 5IF0A 4FGMA 1T5WA 1QI5A 4F2MB 2ZQKA 3WGUB 1ZOXA 4NBYB 3ARFB 2C1PB 1K3IA 3AT8A 2WP3T 4GPVA 4TNWF 5IBLC 3X17A 5KSAC 2JELL 1KB9K 4LCUB 2R29A 4G7VL 2UZIL 5F9JA 3SYPA 5I6NA 2J71A 2AHIA 1T0NA 3PUUA 3NZUA 2RJMA 4PJFA 2FO8A 3DRQB 3CTTA 4IRSA 1I9JL 4LLYA 5F7MC 3U7YH 1MNNA 3FO2A 2I7SA 3ABZA 1JZ4A 3WSQH 1N7ML 4ZUUB 5KZCD 2CO6B 4HWBL 3H9SA 5CLXA 5EU5A 4AH2A 1CFMA 4EN3A 5I73C 3N04A 3SO5A 1IFGA 3QZNA 1V3JA 1YEDB 2ROYA 5HHVL 3FTUA 4H20L 4NN7B 4RMBA 2DI8A 2ICWA 4YHLH 3T3PE 4DPAX 4P5MA 3VYOA 4HP5A 1BREA 4QRRE 4LSVH 4RRPG 3S36L 1A7NL 4PHXA 2JH2A 2F8IA 4X42A 1VB9A 3WIHL 1MFEH 2HB0A 3CSYB 3A4AA 3ZSSA 4LKCB 3RILA 3VFPB 5BQ7B 3VDBA 1IGTB 1KTDA 3LD8B 1CIDA 2QV2A 1JZDC 3P9LB 3TTYA 4PWKA 2BIQA 4MMXB 1ETB1 4FI8A 2F58H 1AMXA 3T4YA 4J2XA 1R5IB 3GMOB 3MNVB 5C1MB 4F37K 4F80A 2VUYA 2NNAB 1G6RL 4HIJB 1LNUB 2JVUA 4F7MA 5IMLA 3AU1A 1I9RH 3UZVA 1IC0A 2IPKB 4HH9A 4N9OB 4YFLF 1KGJA 5I76A 3FT4B 4QXWA 2OV0A 4FQHB 3QAQA 4GXUN 2Z1KA 3A4DA 1PFOA 3HEIB 5JW3H 3C09B 2WINB 2NNCA 3QHZL 4U7SA 1JDDA 1K2DA 3ZBMA 4OFIA 4GUPB 3NCJH 1INEH 1A7QL 3CX2A 3KYKH 4XNZC 5D1XC 4MASA 3B7UX 4TUJB 4M8RA 2V7HA 5GSRB 4MB3A 1W8EA 2B2XL 1ODUA 4NNPL 4FCAA 4X5LA 4OFYA 3NDYE 4LP4A 2CQVA 3QWQB 3O3BA 4U0RB 5IMMA 1NC4B 5F88A 4YVNA 3SQOL 4DEWA 2VXTL 3UTSA 3KLHC 1YY9D 1Y1DA 4YE4H 1Y18B 1AGCA 3GJFK 4RSYA 1KIQA 2JIXD 2K9UA 5BZZA 4ZQTA 1KUMA 1ZLEA 1OPGH 2E5EA 4I8DA 4WWPA 2V2XA 4FQIH 4MX7A 1MRFH 2XQYA 1BD2D 1L6PA 5D5MA 1T0PB 1RZ7L 1WFMA 1SJVA 2R9HC 4J12A 2L7EA 3E8UH 2XKNB 4I13B 3V5HB 1AO7A 2VZSA 4Z7NE 3QSKB 1JHKL 1TQBC 3MACH 4HUUA 4IRSC 3CIQA 2WVSA 4DP2X 5KEZA 5DJAB 2CDFA 2XU9A 1HEHC 3VFTB 3ILEA 2P8PA 2QKSA 1FORH 3BD3A 5ANMA 2XWBB 4ZX3A 2BHUA 2QADB 1IBBA 1FSKC 2HPOA 4MD4A 4P2QA 4Z0BH 1E65A 5HVGB 3REVA 1OF0A 3BRGC 3GI9L 4I0PC 1PL3A 2ZT9C 4Q7DA 3QI9C 1MCNA 3L3IB 1U3JA 5MP6H 5JNYB 3SKNB 3EDFA 3X3FL 1JNNH 3O8XB 4PVNA 3EJZD 3R4RA 1A5FL 1A1NA 5CM1A 3ULSB 1RURH 4YSPA 1HYSC 4D8OA 2DQHH 3CJJA 1ZT1B 4NKOB 1HIMH 4DUWA 4HUMB 3GMLB 4PLJC 3C6LA 4OLUL 3R19A 5AOKA 4ELMF 4U3SA 1TCRA 3WIIL 1BLNB 2FIRT 4R4ND 3G6AA 3AQXA 1EDQA 2J8OA 2ZPKH 4EUPB 1FFNA 2ESVA 2OX5B 5LQBH 4ZAKC 4R83A 5CS7A 4U1JA 1QLFA 1IZKA 2QGDA 3CN4A 3QQ4A 5IEKA 3UJJH 2WWMC 3CV5A 2ZIDA 4IGBC 2I32A 25C8L 1MW3A 1E9OB 2VLJE 4AZUA 3ELAT 4X0NA 4YZFE 3PWNA 3VXMA 1ZA3A 2Q3XA 1NGQH 2EDFA 3FHQA 3BGFC 1EAPA 3BH8A 3ESNA 3QT2A 4M3JA 1G0YR 4XVUC 1BECA 1G0DA 1H15A 5EU6B 1EQWA 2WIMA 4U1GC 3CFUA 4FMVA 1RJYB 2I9LA 4O2CB 4B41A 5B4MC 4H88H 3QDGE 4AYMC 3MCLL 1QWUA 4OZGE 2HX7A 2HX8A 4DQAA 3SE4A 2F74A 1ETJA 5GSVA 3RWJA 5FECA 1PZ5B 1W0YT 4GG8B 3WY3A 5D6CA 3QRGH 5F7HA 1Z9NA 1U8JB 2V33A 3R7RA 3IYLW 2MQCA 4B97A 2ZJSL 3B2UC 4QGTA 3RY6A 1KNOA 3BXNB 4GQQA 3ZE1F 5CZVH 4Y4HC 4BWUA 3X1FA 3FQWA 4FMKA 4K8RC 5GS0D 3KBEA 1W0WB 2RA1A 1X5JA 2EIZA 1KF9B 1LILA 4XMKH 3BP6B 1DSFH 4E36A 3II3A 1WWCA 3C8KB 3CDZB 1B0RA 5CF3A 3KXFE 5TE4H 5HJGA 5BMFL 3HNVH 4X0KA 4LSPH 1WLHA 1KSRA 1N8ZA 5FUCE 1BIHA 1AGFB 2DV6A 4TVPL 5T1LD 3RX5A 4AE0A 1UKSA 1IIIA 4PUBH 1YUHB 1EO8H 1FWXA 1NAMA 3EO1B 1TMCB 3U4AA 3NP4A 1TEYA 2J1YA 5C92A 3DPBB 1YEGL 4H8VA 4XPTL 5C0NC 3A67L 2ICES 3ZT5A 1WV7T 5AYQA 3M1CA 2Z6FA 2NZ9D 1D6VL 5AAWC 3UTPD 1CLOH 3RL2A 4ALAC 4DCQA 3IFLL 2WVTA 5DD6A 3EJYD 2J5LB 4F57L 5EUOE 3T0EE 5F7LB 4WHDA 4XNAA 5EN3A 1YYLH 4KO5A 1LDPL 3PUCA 5E2WH 2X09A 1VZIA 5E6SB 3SIKA 2HFGL 1MCOL 2AV7B 4Z3JA 3UTTA 3FQNB 2OMTB 3O3DA 3TA4D 3HNTH 5EDSA 4UM9D 1PF3A 1UUSA 4J28A 4XVSH 1AQDB 1MFBH 3BESR 3B37A 1F4HA 5AOJA 3HG2A 4YDLC 1XEUA 2ALAA 4H8WH 3SY0B 1RZIB 2ICWJ 1BMGA 4AEHH 3LEVL 2EC8A 4F37F 3Q01A 3BT2H 1L0QA 5C0AE 1KWKA 5IF0B 1T5WB 4WI6A 3FUFA 3MODL 4HDIA 3V52H 4XNMA 1KACB 5GISL 4CN6A 5I71C 1H19A 4IBVA 2WANA 4XPAH 4QY8A 1SEQL 2DM4A 3D33A 5BRQA 5DRNA 5F9JB 3B2MA 3MXVL 1CDGA 5E6IC 2H2PD 1T0NB 1ET7A 3PJNA 4MJ4A 4PJFB 3GNML 5A2IH 1TQBB 3NEXA 4FCHA 4IRSB 1E4XL 4LLYB 3LAFA 1BBDL 3FO2B 4TRPL 4QYOA 3MLSH 3H9SB 5EU5B 4AH2B 3SE4C 3HMXA 4EN3B 4Y1AE 2J20A 4NFCA 4Z3TA 2CAKA 1BXVA 5JOPE 2XXFA 1BFVL 3B2XA 1FG9C 5IVXF 3GKZA 2AJYL 4KFZC 2ICWB 3E1ZA 3NP3A 4N5ED 2QVTA 4P5MB 2QPSA 2QVIA 3RY6C 2JKSA 3MJWA 3FN0L 3HUJA 3BOVA 5FO9A 5TQ2H 2O6CA 3ECVA 4HF5L 5EU7C 2YSSA 3TOPA 1W6LA 2G0KA 1X5MA 2JIXA 5AAMA 1MAML 3EW3B 1FVCA 1V55B 1X3DA 3T08A 3VM7A 5I1AA 1AQ8A 5L7XL 1BEYH 4PTTA 4TLUA 3V5KA 1ASQA 1KTDB 1CLZH 2BNQE 4JPVH 1BD2A 1DN2A 1UG9A 5DLML 4TUOA 5AENA 4WK0B 5I6KA 2LGNA 1RAMA 2YHGA 2D9CA 1JYXA 2DIBA 1ZLWK 2ZNXA 4JCMA 4YNYA 4CDHA 1GZPA 3D12B 3SBPA 3T4YB 2X4TA 2UXTA 4NQXA 4OCYH 5GGTL 1A0QL 2JE8A 1PLAA 3BUIA 4F7MB 5SWSE 5IMLB 3AU1B 3UZVB 4HEPG 3O6MH 4GMTH 4HH9B 3F00A 3GSRA 3WHE0 5I76B 3K8KA 4BK5A 1KV3A 2VERN 2VXSL 5FPIA 2ZE0A 3GFUA 3H2QA 3BQVA 3D06A 4NYLA 4LDCA 2VABA 4GAJL 3C5XA 3POCA 5CJOH 5D7KD 4OF8A 2FQFA 2XXGA 1NTDA 1ZIAA 3NOIA 1RZKC 1K2DB 3AQYA 4LCCC 1YC8A 3BWSA 2DH2A 4MMZA 5E7BA 4KO7A 4P05A 2V7HB 4DO4A 5I1HH 3B1UA 1TYEB 2EC9T 3F5WA 4P9MH 1PU0A 5IESL 4QTFA 1ICTA 4JM2C 4UQEA 3NABL 5T33L 4YGVA 4U33A 3O3BB 3UC2A 5IMMB 5F88B 1NUFA 3BD5A 3QFGA 5GGVL 3ZHLA 3UTSB 2G5RA 1UWXK 2HWZH 4IIQA 4OUOA 3ILQD 4ISVA 3W82A 1AGCB 2GPZA 4E9WA 1KIQB 1XZWA 5BV7C 1YC7A 3CZGA 1UYWH 3VFGL 1EHLL 2V2XB 3ZDYF 3FXIC 1KCUL 4MX7B 2ZG1A 4JHWL 4FDWA 3APFA 5HYJE 2F19H 4LIQE 5D5MB 2C3HA 2EIKB 1MW0A 5EPMA 2OW7A 5C6WH 4XWOD 5DHYA 4C54A 2IGTA 1AO7B 4HOWA 4JRFA 3G6JE 4HUUB 1QRND 4HA1A 5KS9E 1CS6A 3QARA 4MNQD 1X5ZA 3L4YA 2CDFB 4NQEE 3C8DA 4H25A 4G6FB 4X80H 3TN0A 3N50A 2P8PB 3OAYH 5ANMB 4ONFL 5DF0A 3TJHD 3N9GL 3THML 4MD4B 4P2QB 5F96H 3REVB 4ABQA 4L05A 1CC3A 3DYMA 4F8PA 4PIBA 4KH9A 3S5ZA 4NZUL 1BOYA 3CBJB 1OCRB 1IGIL 3ZHDA 4EJ1C 4ZMNA 4MA7L 1WS7A 3DGGA 3UP1A 1A1NB 5I8KL 2XPGA 1NKGA 4R0LA 1VFAA 3QIBD 5JPNC 1UT1A 1MG3C 4TL5A 4WFEE 4BEIA 2VR3A 1ODAA 4DHLA 5D7SH 3C6LB 32C2A 1BXAA 4K8RH 4U3SB 1TCRB 5F70A 2D7MA 4D3CH 4EOWH 3KVQA 3G6AB 3KPRE 4XMPH 3TONA 3PGCA 3K5RA 3L5JA 4G6KL 5EN2A 1FFNB 2ESVB 1CO1A 1QI4A 4U1JB 4I3RH 3NCYP 1QLFB 3QQ4B 4JFZH 5IEKB 1QFUL 2W91A 4AM0A 3OKMA 1QR1A 2R8SL 2WYIA 3HG1A 4HUNB 5HJ3A 2GW5A 2JTYA 3QXTA 3VXMB 1AXSA 3PWNB 1ZA3B 3O2VH 4AJYV 3CHXA 4LCWE 4HFUL 4UM8A 3NIGE 1EAPB 3BH8B 5JZ7D 1N10A 2WV3A 3EJZC 4JFSA 1H15B 1KC5H 2WJ5A 5D7IA 2I9LB 2IFFH 4UTBH 3SGDH 5GGSY 3MBXL 3PWJA 4ALAH 1VZHA 4QAWA 1PMYA 1KGWA 4ILDA 1AP2A 1Q38A 2F74B 5GSVB 3RWJB 5FECB 5F9OL 1A2YA 3AS1A 3WTWA 5D6CB 4IJ3B 4R4NC 3S37H 2NY5L 4P2RD 4TULH 2GC4C 4UM9A 4L3FA 4G1MA 5GRVL 5CLZA 1JFHA 1KNOB 1XXFC 2A77L 2AEPL 2BJMH 4ZO7A 3WD5H 4EI6A 1BQSA 3AT0A 1PSKH 2B0SL 2WBJD 3PHSA 3FQWB 1ZE3C 4Z95H 2EIZB 2FX9L 2FQGA 3U1PA 1X5FA 3SDXF 3WN5A 4FZEL 4GKLA 2PXYA 4DNLA 1J9TA 2FH6A 3ULVF 3H9YA 2P5WE 3HBGA 4DESA 1KJVA 3QIWD 1B0RB 4MXWL 3RAJH 1KBPA 4X0KB 1N8ZB 4LCYA 1SXZA 2QKIC 3JYCA 4XP5L 4L48A 4F1SA 2ZYIA 2HKFL 1NAMB 3DX2A 5GPRA 3NIDB 3OV6A 4CVWA 1IO4C 2MOGA 3LX9A 1CFQA 4M7KH 3LZQA 4PJGE 3KPNA 1IBZA 3FHEA 4L5FE 1E5BA 1IAII 4Z7IA 4U0QB 2H47C 3LS4L 1YHPA 1C9SA 4WHTA 3VGGA 4PRID 3OWEA 4FKEA 4DCQB 3RL2B 3VD5A 4PGBA 4YHZL 2V2TA 2EO9A 5DD6B 3AM8C 2VDPL 5GS0C 3JWNE 5JR1H 5FGBC 5I1KL 4Z7NF 3FSZA 3ZGHA 3B5GA 3V55A 2DYRB 3KGUA 4UAHA 3UTTB 4U3HA 3O3DB 1IL1A 2YO3A 3Q8BA 4KRPD 1PS3A 4Z7OB 4FLQA 2DKUA 2E9GA 3IFNH 3WEXA 3NSFA 3BE1H 4HDIB 2XVKA 4XNMB 5DHMC 2A6JA 4CA4A 1XF2A 2CUMA 3EOYG 3AQZA 1PY4A 4N2DA 1NAMH 4UT6L 1EDHA 1TZOA 1OSZA 4QY8B 3RZWA 3X3GL 1IVLA 5DRNB 5C0DA 4GS7B 5L0QB 3BAXA 3MV9D 1BJ1J 3RWDA 4MS6A 1Q1PA 1V8HA 1WWBX 4QYOB 1RZKH 2ZWKA 2EDRA 4YHYC 2GT9A 5HGBA 1CWVA 1QEWA 3MNZA 1BFSA 1TZGH 4JM4H 4Q6YA 2B20A 3ZW3A 1IBGH 4X98A 2DY2A 5IWLC 4LSTL 2X0WA 1MWAL 3DBXA 3ZDXE 1MPAL 3N1QC 2W92A 5EZLA 2YD1A 5L88H 1NUNB 2AQNA 1NIAA 1ZV9A 1UCTA 3CC5A 3HUJB 5FO9B 5ALCH 4AY0A 3OAZK 4FFWD 4KI5C 4NUPA 1IC5H 2TSAA 1NMAH 1ZJAA 2YSSB 4YZFF 4X5XA 3MUGA 1F58L 2EO7A 2JIXB 3VE0A 1FVCB 2E7DA 5I1AB 2MOVA 4PTTB 3V5KB 1XD0A 1KFGA 1R75A 2VJXA 1D5IL 1BD2B 2O5XL 3IN0A 1IKFH 2EH8L 2ATPA 4HZLA 4QTHA 4TUOB 1TIUA 4E68A 4XHJD 3ES6A 1RJZA 3WEBA 5BV7H 3V6ZA 5CCKL 2A99A 3TX4A 4YNYB 1GZPB 3DVGA 4KROD 2H2PC 4PBVC 4OZGF 4PJEA 3W3BA 2X4TB 1F11A 1QACA 1NC2A 4NQXB 3ORJA 5I19H 4GO8A 1GTNA 1PZ3A 1CXKA 3VG9C 2HJKA 1TJHL 4F2EA 2IQ9L 4GAGH 4GEIA 4XNUH 4PWHA 2Y22A 3D39D 3GSRB 2ZCKL 2X05A 3V6FA 4NOBA 2PO6D 2CCWA 2XYBA 4J6RH 4JE4B 4NYLB 3FRPG 1G9NC 2YXWA 5LBSL 4D9RD 2VABB 3HMXH 3QQNA 1LEIA 1Z9PA 3D25A 4N5EC 4ODHL 1GOHA 2E4TA 2JF1A 2WXRA 3Q9PA 4NZTH 3F12A 1NLDH 2C3WA 3MUJA 4FJZA 4XMLH 4Y19E 5EOCH 1XIWD 1J0JA 4URTB 2VAAA 2F9BT 2UUDH 4MMZB 4UMGA 7TAAA 1O7DE 4HXAL 1KCVH 2WCPA 4LL1A 5DA0B 5HDWA 3F5WB 3J8F7 4ZFGH 2F7IA 4YHKH 1ZPLA 4YGVB 4OVUA 2UXVA 4G6JH 4FTVD 5KVFH 2Z3FA 2OI9B 3G9VA 3OAUL 4HJEA 1QFWL 4FNTA 2NY3D 4ZFQA 4HS8H 4IIQB 3S3JA 1IC1A 1D3CA 3QE5A 4ISVB 3HVNA 3GSVA 2R1XA 4ZXBC 3UEQA 3U30C 2WJ7A 4AT6A 3RDTC 3PF2A 5FR3A 5EPMB 4JHUA 4XP9L 2DD8L 3PCYA 1SM3H 2B77A 3WO3B 5EUOF 4ZPTA 3WFZA 5DHYB 2WNKA 4H13C 4RGOH 3VD1A 2PCXA 1UQSA 3JYBA 2X6VA 1BVNP 4NHCH 4TQIA 4JK0D 1D6EA 4H25B 3TN0B 4OLYH 5D7HA 4Y7MA 1T20A 3K6NA 2N1TE 1WBXA 5EF3A 2YFNA 5I28A 1MCEA 2MSPA 4OLEA 1GS7A 2VZTA 4WSJA 1Z5LA 5IB2A 1Z9LA 1FFOA 3KH3A 2J8HA 1ACCA 5DGQA 1TEGA 4P2RA 3NJVA 1T3FA 4ODVH 3DGGB 4D9QD 3FO0H 5HGHA 3STLA 2XPGB 4G9FE 4XO4A 1B9KA 2WBJA 4R0LB 2NXYB 5HDLA 2K9FB 1VFAB 1WAAA 1O75A 2IOMA 2J73A 3CVBA 3ZRSA 3FONA 32C2B 1ZE3H 4XWOC 3L2LA 1F8TL 4YSTA 3UBHA 3PGCB 3TVMD 1PW3A 2R2BA 3F62A 3S2AA 3SKUD 5E2UH 5