3BJ91

Crystal structure of the surrogate light chain variable domain vprebj
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
VLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSTHVFGSGTQLTVLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering and characterization of a single chain surrogate light chain variable domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Immunoglobulin iota chain, Immunoglobulin lambda-like polype
total genus 29
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bj9100
1U58B 2QKIA 3PP3K 3HC3H 4YDVA 1JK8A 2HH0H 3LQZB 3ARED 1QLRA 4OLYL 2DIAA 5B4MD 1QO3A 1K4CB 4FQHB 1WQVT 4YFDB 1IGMH 1NBVH 3MV8B 3EAKA 1DJSA 3ARFC 4C83A 4ZYKA 4YO0A 1WWCA 3GJEA 3G6JA 3OZ9H 4D3CH 3P73B 1BZ9A 5FUZL 1A1OA 4JFDE 1HSAB 4EBQH 3GO1L 3ALPA 2AP2A 4Q7DA 2Y1VA 1F58L 2YUWA 4Y4FB 4URTB 2DWEB 2A9NL 4ODSL 4LCUB 3P11H 5L8JB 4MA8L 5I75C 1FDLL 5KSUB 2A9NH 1YN6B 1VGEL 3MREB 4HK0B 2DQTL 4OLUL 3WKML 5BXFA 2VDKH 3RX8A 3BEWA 3I9GL 4OCMC 4XGZB 3FT2A 4OSUH 5HHVH 4HPYH 4Y0GA 3C8KB 3KDMA 3UMTA 3SGJA 3T0DA 2FIKA 4NP4L 3SKOB 1IGIL 4X4XA 2A38A 4P9HC 4PRIB 4MXVF 1V7NH 3BVNB 3QUZA 1DBAL 2IFFL 2XZCL 4GMSH 4YNYA 1T1YA 3VFPA 1DLHA 2CPCA 3D39B 4OGXL 4TUOA 3V6BR 3GBLA 1RK1B 1A14L 1TVDA 3O6KH 4BA8A 3MCLL 5D93B 1HQ4B 4GKZB 3H9ZA 1OQXA 1PJ9A 4YQXH 2NY4C 2Y6SD 1Q9OB 2XN9D 3U0TB 3CFBA 3RZCB 5IMKB 3OZ9L 4Y2OA 1VGKB 5MEOA 4I9WD 3DRQB 5C8JB 1MCCA 3ZKQD 1OAXH 1VPOH 3CDGA 4G7YL 4POUB 5DURB 5E6IC 5AZEL 3WLWD 4ERSH 1CFBA 1WWAX 3O6FC 3GSXA 3BKCL 1JPST 2RFXA 4QWWD 1JV5A 1JNNL 1NC4D 4NSKA 4BFEA 1IGYB 3EDKA 3QJFA 1FDLH 1AFVL 1ZLVK 5E08L 1RK0B 1XF3B 5D7LE 3VFGL 1PQZB 3U1SH 3MODH 4RNRA 5DQ9A 4M1GL 4F37F 1TZGH 3VXTA 1QA9B 3U7WH 4QLRA 1ZLUK 1U92A 3GBMH 4A2LA 1T0NB 3SE3A 4A6YH 4NYLB 4QRSB 1BD2E 1YEHH 5FCUL 4KI5C 1DBAH 2IFFH 2XZCH 4PJGE 4K07A 3BP7B 3TBYA 2BVEA 1TNMA 3S4SG 2OTUA 1FZJA 4H26A 2WBWB 1OL0A 1I75A 2F8VA 2COQA 4KMTH 5FA3B 3BQUC 3ZTJH 4J12A 3BT2H 1VCAA 4IRZL 2J8UB 5E2UL 4IRJA 2V2TA 1ND0B 1VPOL 4BKLA 1DQDH 1WZMA 1CICA 3GEWB 5GRZA 4OZIF 5ALCH 4YR6A 1T1WA 3VGAB 4V1DE 4ONHA 4M1CD 2D0HA 1WAAE 2X4PA 2D31B 4K3DL 3UROR 3EGSA 4RWHA 3L3JB 3W9DA 5HYIA 4KRPD 2DI8A 4XNMA 3MLWH 2FHCA 5D70L 4G6AC 4X7SH 5EUKA 1I85C 2WP3T 5B38B 1XR9B 5IMOA 5LWYH 1ZT4B 3QUXB 3S37X 4PJIE 2GT9B 5I74C 2VISA 1ZMYA 3MLSH 5HYJE 3CZJA 4JPVH 1TLKA 1R5WB 5TE6L 4XPAL 4PP2A 3HC4H 4D0BB 3RI5K 5IJVA 3ARVA 1KPVB 4RGNB 1RZ8B 1U3JA 4ORGB 1MSPA 1S7VA 1RUQL 3ULUC 4JRYE 2VLLB 3LS4L 5TDNB 1CG9A 4FQXA 3FB5B 4U6VL 3MRPA 2YR3A 3V5HA 1OD7A 1B2WL 1KG0B 2H26B 2HFFB 4PJGF 2AEWA 2EKSB 3LPWA 3MLUH 4CUCA 2M26A 3DVGB 1RULL 5DQJA 1DQDL 5D7JB 3Q6GL 3S88L 5KW9L 2DQFA 3KLHD 4W6YB 3IFLL 3QIBD 3DJ9A 4HC1L 1A7PL 1MI5E 2YEZB 3FQWA 2GK2A 1A7PH 4KV5E 3ZDYE 3JWDC 5KSAB 5EO0B 1D5XA 2VDQL 4X7SL 3BGMB 1XR8A 1GAFL 4XP1L 3VD7A 3X12B 3WN5C 3JV0A 3CIQA 3GIVA 5E4EC 4M6MH 1ETZB 4JG0H 3MLRH 5D71L 3EYQC 3VXSD 1NGPL 2EKJA 3C5ZC 4HBCH 4XX1G 3GSVB 4M8VA 1MVUA 4KFZC 3ULUH 4OD1L 3N1MC 4R6UA 1FFNB 2K1MA 2YPKA 4LAQL 4ELME 4ALAH 5I15H 3BDYL 3IVKA 3OKYA 5IROC 3BWAA 3HN3A 4WDIA 1OAKL 1C5CH 5C07D 1FORH 5I1JL 1MEXH 3O8XB 3HLAA 4KVCH 1SVZA 2Z93A 3OHXA 4NRYA 3X3FH 5CJ8A 2E9BA 3TJEL 1VEOA 3QO0A 4JCLA 3E8UL 2R56H 1C5BL 4U7SA 3N1QC 1EFXA 4F7PA 4M93C 5FM8A 2J8UF 4N9GB 4QRPD 4KWUA 2OK0H 5H37H 3QG6A 2IJ0C 4H5SA 2W1NA 1N2RA 2HFEA 5J1TC 4IIQC 3IDUA 5GSVA 3VFUB 2YA0A 3TIEA 5BZDB 5JORA 4XVUD 1ZE3C 2VITB 3MLRL 4Y1AE 2NY2B 4ZS6D 5JTWA 3TT1L 1CR9H 4G80A 3NVQA 3O3BA 5HYJD 3B43A 2JB5H 2VERN 2XT1B 4OFDA 1QP1A 4MDIA 2UWEF 3W11D 5DEZA 1U41A 4XZUA 1UWXH 4J4PD 5ITFA 1HYSD 1NSNL 3TH2T 1MJUH 1G9NL 1HQRB 2ADGA 3VXPA 4F15C 1UM5H 1K3ZA 4FTVE 3QO1B 3MV7E 4K9EC 2FD6L 1BQSA 3RDTC 4OCYL 5FO7B 4XRCA 1XGTA 4XPFH 5D4QA 5IBLC 3K0WA 4MXVE 3L95A 3I75A 5IW1B 3P9MB 3UJTH 4GKOA 3U4AA 4DW2L 4PB0L 4H88L 1BFTA 3AS1A 3QFDA 3REWA 4EI5C 2DJSA 3DTXB 4YHIA 2ESVB 5F70A 3ILQD 3QAZB 4K3EH 4QNPF 3EDEA 2JJTA 3HKFA 4N0YL 4JFOB 2N1KA 3RWJB 3U9PL 1J86A 1I1FA 4KRPC 1UWGL 2OQJB 1DSFH 5EZLB 5T33L 3F65A 4UQ2B 2BNQB 4JO3L 4PJ8C 1Q1JH 4DN4H 1AGDA 3T4AB 1T0MA 4L3CB 4U3XA 1M7IB 2ZOLA 5L7XL 3OX8A 1QSFB 2VIRA 5F3HA 3DBXA 4ELKA 2VLRA 4KUCF 2XKSA 4BZ1L 3V8OA 5ESAA 4QF1B 4S1QH 1J0YA 2APWA 4QOKA 1ZS8A 2DQCL 3BKYH 3NZ8B 1FPTH 3QWOB 1YYLL 1WISA 1S7QB 3HMWH 2DQHH 5CFHA 3PL6C 4ODSH 1T2XA 5EOTA 3U9UB 1INDL 4KI5E 3KPRD 3CCHB 1NMAL 3DO3A 3G08B 1P4LB 4Y5YA 2YPVL 1XF5B 5I19L 3BHBA 4TSBL 1NCCL 4PJXE 1X5XA 5C6TL 2I9LB 1PSKL 4LGSB 3BPOC 1JNJA 1HHGB 3DOSA 4TSBH 5M94B 1JZ8A 5SWSA 2A6JA 5BVPH 3MLVH 4XCYB 3VXSE 4M03A 1KLGB 1W72L 3V2AR 1V7NL 4LLUA 4OCSL 1MCDA 2GY7B 2RIKA 1KEMH 1J0KA 4U1KB 4S0SD 5JNYB 4H1LB 4JZJC 5D1XA 2A77L 4YHOH 4O2CB 2KBGA 4LLWB 4S11A 5J1AB 1MJ7H 4WW2B 1FO0H 2AJZB 4AM0A 1RHFA 2QADC 5CSBA 3FQRB 4Z0XB 4PJHB 3OKLB 1U93B 3RBGA 3H3PL 4HS3A 5EU5B 2JJTC 3TBVA 1EHNA 1Z0MA 1G7QB 3D18B 3RWGA 3PJSB 3D0VB 4WUUE 1E4WH 4I3SL 1ZHBA 4LNRB 3BKJH 4L4VA 2GW5A 1KPUA 2EZ0C 5CJXC 3HZVB 5AD0A 1JHLL 3SE9H 3IJSA 5IVXA 1CFQB 3BWUC 1R3LB 4WI4A 2VXVH 2B5IC 3HE6C 3F7RA 4D9LH 1K2DA 5TH2A 3Q5TA 2GSIB 4LPXA 4XCEB 4YDJB 3U7WL 1MLCB 4HUXA 3EDJA 4WY7L 1BZQK 3E6HB 4WFFE 3N50A 3FO9A 3HFMH 4U6XA 3TYFA 4NKMA 2FX7L 2WUBL 2YC1A 5HGDA 5ELIA 4OSUL 4ODTH 5D7SH 4L9LB 2WBKA 2X89A 5K9QG 5HVGB 5EU6E 1I8MB 1QBMH 2MQ3A 1JPFB 5ILTL 2EDXA 3N06B 5BJTB 3F5WB 1QBML 1TCRA 4U6XB 3FO9B 4FXKA 4OV6F 5F9JB 5KBNC 3AS0A 4MD4B 1D6EA 3BXNA 2AK4D 4UNTA 3O6KL 4Y4KD 3O8XC 5JQ6L 1T1XB 1LDPH 1Z5LB 4KI5F 3MNVA 1WEJL 3MXWH 5I6XC 4OLVL 2NR6D 3IJSB 5IVXB 3ALWA 3GMNB 3EO9H 3HZVA 4QY8B 1RZFH 3CH1A 3HG1D 4PV9A 4M6OH 2Q8AH 1ZHLA 5JZ7D 5A16B 2NXYD 4HQQH 1I8KB 4MSWB 4NKOB 4YFEA 4ZFOA 4FQXC 4QGYA 1IE5A 3OV6A 4HS3B 2PO6C 2LE9A 3BDXA 5KSBB 1J1OH 2Y06L 4Z0XA 1AY1H 1CDUA 1EH9A 2NY3D 2VNCA 4GRLD 4HWZA 5EBLA 3RU8L 4JY4A 3TA3D 5IMMB 1HH6A 1MLBB 2AJYH 3DIFA 3LZFL 4KKLC 5D70H 3WL9B 3FT3A 2DTML 4XBPA 4DVBA 5J12C 4OT1H 4J6RH 1ZGLP 5JOPE 3VGHA 1AC0A 1YYML 1I3RB 5TE7L 4AQ1B 1S7UB 3QDHA 3UO1H 2G5BB 1LEGB 4K3GA 4M6NL 4YHKL 3CLEL 4UT7L 4XC1L 1BBDL 4L29A 5MHSE 1I85A 3WSQL 3QDGA 4JR9L 3KPMB 5L6YL 3HC4L 4K7PH 1AHWA 5DFWH 2HLAA 2VXSH 1BM3H 3U30B 4PLNC 3RQ3A 4NNPL 5HYSG 1SEQH 2EDKA 2P5WD 3K4AA 3RTQC 2A9MH 4DGVL 3RPIA 5INDA 4NZUL 4LP4A 4MXQC 2R8SL 1KTDB 3KPNB 3DV6A 3W5MA 4HUVA 4X8XA 3K7UA 2C5DC 1U0QA 1P7KB 2FZ3B 1TQBB 2QQLL 3QHFL 1CL7L 3UPAA 2EH7L 5IEKB 2Q7YB 1DBJH 1JUFA 2WZPD 2GITA 1RUAL 5C92A 2VLKB 1P1ZB 4DQOH 1DLFH 4MX7B 4XWOD 1M7DA 5BO1H 1EO7A 4PLJC 1F97A 4WU5A 4OGZA 3MGTB 3MV8D 1ONQA 4ODWA 4L1DA 1Q8MA 1TJIL 3RBSA 1GYAA 1CBVH 4JM2A 3P2TA 4Y1AB 5IWLC 1BZ7A 1NLBL 4M61A 3NCFB 3DBXB 1MCJA 4BFBD 2ZOLB 4BQ9A 1QQDA 2CJUL 1K8IA 1F42A 1AGDB 2QSCH 3T4AA 1OY3B 3GBNL 1P7QB 4OZHF 3V4VH 4MVBD 4NKDB 2BNQA 3LKPA 3MRQA 3IF1A 3RTQD 3WSQH 2D4FA 4MD5A 2OJEB 1H15B 2OQJA 2MSPA 4F7TA 4NPYA 4X6BA 1RZGB 2VQ1A 4KKBC 2DOCA 4LF3B 3W5NA 1D5ZA 2BRRL 4G6KH 2DKMA 5FOBB 1SBBA 1XIWC 1R5VA 4PJCA 2X7LB 4G6KL 1WSST 2P5EE 3W2DH 3BQUB 4YWGL 5IW1A 1YEJH 5D2NB 1UKQA 5HHXL 1EFQA 1NGYB 4OZIE 1KEGL 3QBTB 3MA7B 4P2YA 4H1LG 3MLXH 3D69A 3V5DB 3SGJC 1NFDA 2W91A 4E0RA 4NKQB 2VC2H 5GJTL 1CGSH 4K9EL 5HGGS 3I50H 3PWLA 5DUML 2NY2D 3SE3C 1MHCB 5DJ2B 1C5BH 3IETA 4NRZB 5KW9H 1HQRA 3VXPB 4RWYL 2DLHA 4YC2C 3GIZH 2V5MA 5IWLA 3B2UD 1LEKA 4O2EB 3WHE1 5BOZG 1FAIL 2QQNH 4IOSD 2RHEA 2E8YA 4ONFL 5TGBB 3B9KA 1LO5A 1T7WA 3VJ6A 3VWJA 2R15A 1A3LH 2GUOA 2CLVB 3O2DL 4ZAKC 4N0UE 3HG1A 4DKFH 4GW4A 4FNLH 4NO3A 3QUMA 2NY6C 2WIIA 3KXFE 5CEZL 4Z77A 4PY7A 2I07A 4U1SA 4B7LA 4C57C 1GIGH 5ICZA 3OKNB 3MRFA 3GMMB 4ZO7A 4GBXB 2AXFB 4N9GA 2NY1C 5GZND 5FKPA 5EORH 1KCSL 4WW1A 1EFXB 1LILA 4F7PB 3EYFA 5IHUL 2UZYB 4P2OA 5A2IH 4HFUH 3BDYH 3TBSB 1OB1A 4PJDA 4YC2B 2VUYA 3BN9C 4GO6B 1KCSH 3QI9B 1MFBH 1T66C 1V05A 1YEJL 5EORL 2C1OB 5GS3A 1S9YA 2IPTL 3GMLB 5CJOL 4PJBB 5T1LA 1I7UB 1FORL 2I5YL 3AROA 1Q0XH 3HLAB 2VLJD 3O8XA 5KSAD 3I50L 4FQJH 4OQTA 4PB0H 3UBXG 5I66B 5JR1H 5FO8B 3T3PE 4RWYH 3ZE2F 1M71B 2DLEA 4O2FA 2PTTB 1HHJA 2R56L 3K8KA 2WLZA 1J0HA 3BSZL 3PWPA 3QNXB 1HYRC 4KTEL 3SGEH 4P2CG 4OZ4A 3H9SE 1EEZA 1WCBA 1Z6JT 4UIKH 4NCC2 3RIFK 4ZSOB 4IDJH 3V6ZB 3TNMA 4ZUUA 4NQDD 3UCRA 4UIKL 5K9OB 3SBWA 2PYEA 2F58H 4NGHL 2A6KB 5A2KH 3R0NA 1WTLA 1J12A 2FB4L 5L2KA 2XRAL 4YBHA 3S3JA 3X12A 3VGBA 3D1MC 3QUXC 4BZ1H 4LRNH 2D7OA 3D25B 1NEZB 3FN3A 4Z7QF 1H0DB 3RWFA 1DCLA 4Y2DC 2YN3A 5KSAA 3IFOB 2JF1A 4OF6A 4PREB 1KENL 3P4LA 1Q94A 4OI7A 5J3HD 2CIKA 3RVVC 3CU1A 1UM5L 4P3CH 2F54D 4XC3L 1AQDB 2AXHA 4PYGA 3BPNC 5C86A 4DKAA 1X5KA 1X5IA 1KFAL 5CZKA 1YPZF 1PY4A 4G6ML 1VADB 3MGOA 4O5LH 4PJFE 4QXTA 3SDDA 2XTJB 4G6MH 3FB5A 3TVMA 5T5NF 5JO5A 1INEL 1CG9B 2FHFA 1JTOA 3CX2A 5F1IB 1NBZB 3KPLA 3FOLA 5C9KA 4TRPH 5GGRY 3BIKA 4N0YH 3OKEA 2HJLA 2BNRE 4TRPL 5IEHA 5I1IH 5CWSA 5I17A 1J0ZA 5I16B 4KTYA 3BX7C 4HLJA 4WWKD 1FG9C 1LE9A 3ESUF 5FECA 5T33H 1PKOA 2KDGA 3OKKA 5H35B 4NRZA 1BGXL 2FB4H 2AJXL 3F58H 5D1QD 3GM8A 1GGBL 4H0HB 4WTWA 3V5DA 3NCYS 2K7PA 3DV4A 4HJGA 5J12B 4XT1C 3L3JA 4R4FH 3W9DB 5FM5O 2ZNWA 3VFSB 3I6GA 5J57B 1KIQB 4LFHD 4ONHB 2EIBA 3T4YA 1CVRA 1F6AA 1B0GB 1KELH 4HV8B 5D7KE 4H0GA 3RNKA 4XNXL 1LE5B 3OPZL 5D7KD 1RSFA 4I3RH 4OD2B 4Q9RL 1LVEA 2V9TA 3DLQR 5HJ3B 3S97C 7CGTA 3O45A 5EU4A 1RZGA 2D4DA 3ZDZF 4JDTL 2R1XA 4NPYB 4WHTA 2XG5A 4R90H 5FA3A 3MROA 4Z7VE 4L8SC 1MQ8A 4Z7VF 1JNNH 1INEH 4H8WH 4I18A 2XG4A 3O2VL 2R29H 1OP3K 2VR9A 4I0PC 4ZMAT 1BIIA 3BP7A 3T4YB 3BW9B 1KB5A 4P5TB 5FV1L 1MI5B 3JWOC 1FIGH 2J5LB 3I6GB 3SO5A 1CDBA 2WLYA 5ADPH 4JM2B 5IVXF 4Y1AD 5DC9B 1TJHL 4OQ1A 4PJDF 5ID1A 1T0NA 4G43B 1X5LA 4WEBH 3VGEA 5FYLE 3MGTA 5L2JA 5H35A 4C54A 4WV1B 1KPRA 2VLKA 4YX2L 1ZLSL 3MMEB 2N7AA 1LE9B 5DO2C 1PQZA 5IEKA 4WI3A 2C7UA 1XF3A 2JKXA 4M7JH 4LFHG 1P7KA 1N4XH 4EN3A 3CFDB 2R69H 1KTDA 3KPNA 3P9LB 2J8HA 3BZFA 3QH3B 3GSXB 2B0SH 1GHFL 1U8JA 1OF2A 4NNXA 2LFGA 5L0QC 3CDGB 1SJXA 3TVMB 1M6OA 4X9IA 5B3NA 4EDWH 3QULA 3QQ9D 2ADJB 1MELA 3SDXA 3OL2A 1UA6H 3F7QA 4L29B 3JWOH 1QNZH 3UEZA 1AQDA 2OS7A 1UA6L 3V4PH 3VDAA 1TIUA 2P5EA 3QA3B 4WTZA 4WFGE 2JIXD 1WUNT 5I1AB 3LOWA 5IHBA 3BVNA 5FGBA 5I8KH 1L9MA 4P5KB 4CGTA 5DD0H 4NJ9L 2NY4D 5HPMB 1HH6B 2EDJA 5DK0A 1E4XL 3MLZL 1F00I 4HWZB 2XZZA 5EBLB 5IMMA 2EE2A 4F9LC 2A74A 4WFED 5L2KB 3QXTA 4HIJA 2HRLA 1IAKB 4ODBD 5F7EL 2R8SH 1ZHNA 1CFTA 1RHHA 4XP9L 2R2EB 5A16A 4PV9B 4QY8A 5K9OA 4LMQE 3BISA 3V6ZA 1G6RL 5I8OL 4LHUA 4ZSOA 1L9NA 1EEZB 1WCBB 3WNPA 5TF0A 4LSSH 1Z5LA 3FRPG 3QZWA 4JO4L 3NFNB 4LSVH 3UTSD 4NFCA 4A2MA 3QCVL 4H20H 4PJ7E 3GKWH 4O4YL 1JGLL 5F7KC 1BWWA 3SJVE 5I66A 3DX8B 2GJ6A 3CVHA 4GAJL 2XIDA 5MERB 32C2B 4L9LA 1T4KA 2IANA 4LCCB 1Z9OA 2P8MA 3QI9A 3TYFB 3DMMB 4TQEH 3CFIC 4GS7C 3E6HA 4PY8I 4Q6IC 5F89B 3TBSA 2ZCKH 4Y16D 4BQ8A 2VDMH 2FGWH 3EYFB 3DI2B 4XCEA 2CKBH 4YDJA 2IBBA 5LBSL 4P2QE 5TH2B 3WNLA 3QEUA 3P0VL 5HI5D 1N8ZB 1CD8A 2F54A 5KVDH 4KPHH 5FYLL 5ICZB 5MEPA 4OM1L 3I3DA 4K7PL 1INQA 3U6RB 4OI9A 5B22A 3SE4C 1T80A 2X1WL 1AR1C 3HG1B 3TBVB 2VXQL 5J13B 1DEEB 3W2DL 5EIIA 1LD9A 3MO1B 2R0ZL 2OR7A 1VENA 2FEDC 1D5BB 4LIQH 5TGBA 4XMPH 3D39E 4IEFB 5TJWK 5GJTH 4F33B 3HZKA 4KROC 3DUSB 1DLFL 3TFKC 1DL7L 5FHBL 3OAZK 4NRXA 5KJRL 2HKFL 3ULVE 1YEEH 1G9MH 3IGAA 4LLUB 3D69B 4E0RB 5GZOD 1IAOA 4LNVA 3MA7A 1T7ZA 5C0GB 5C0ND 2EYTB 1A3LL 3VDBA 1DVFC 5IR1B 4CJ0A 4XPTH 1CXIA 2HAZA 1A6VL 4L8SA 5C7XL 5CBAA 5F7NC 5CSZB 2X7LA 3KPSB 1EFXD 5I1KH 3V4VL 4J3UA 4MXQD 5E5RB 2OJZH 5EZJA 5FUOL 2I9LA 4HIXL 1G9EA 2VQ1B 1X5JA 4F7TB 1U91A 2E7HA 1CGTA 3Q48A 3V0VB 1H15A 4JM4L 4U33A 2XTJC 3NBNA 2EYSA 4RGOH 1NGQH 4FTVD 3IF1B 3EKCA 4OGYL 4NKDA 2I26N 3KPRA 2JB5L 3JWDL 1NGQL 1NANH 3MBED 4JFZL 2R0ZH 4YE4H 5CJOH 2YKLL 1I7ZB 1IZJA 4C56B 3CNKA 3NZ8A 4FQ1L 4N0CC 5HHXH 3VRJB 5DWUL 3SDYH 43CAA 4IMLB 1N6QL 4KH2A 4YBLC 1NEZG 5JHDA 4MNQD 4M43H 4ODWB 2CKBB 1F13A 4HXBH 4KY1L 1TZHB 1URLA 1AC6A 5DT1H 1J1PL 5JW4N 1YPZE 1QSFE 3S4SB 4L8BB 4S1RL 4UQ2A 4MXWL 2HVKB 5IOPB 1SVCP 3TBTA 1P1ZA 3SPVB 4XX1E 3QDMB 1JUFB 1C16A 3ZYIA 4ZUWA 5DD1L 3DVIA 1GC1H 4AH2A 1NC4B 5D7IB 5GGSB 3CD4A 3OXSA 4QHUB 4Y4HD 2HG5A 2FSEB 3DV6B 4MB4A 3IXTA 4L3EA 1BX2B 4HCRL 3QFDB 3REWB 3C5ZD 1AXTL 1OT2A 4Y5YC 3P9MA 2FYYB 2FECI 1DUYB 5C0FB 4R7NA 3IXAA 2C4XA 3IDGA 3RVTD 1CF8L 1C1EL 2DQEH 5I1DA 3ARFD 3ZKSD 1PEZA 2Z4QA 1ITCA 5EU3B 3ZMRA 2X4SA 2HP4A 2DQEL 1EAJA 1AE6L 4OFYA 3T1WA 2VWEC 1S7UA 4Y2DA 5TE4H 4LPCA 1EBAA 2GAZA 3PGCA 4ISVB 1MFBL 5ITBL 5C71A 1K6QL 3DROB 2DBJA 5DZLA 3GSQA 1QFUL 3G6DH 4I77L 4JJ5A 3STZA 2R4RL 1T2QH 3T1FB 4GBXC 3SBWC 4KKNA 1YQVL 3IJYA 5KVGH 3WXWH 3CSGA 4JY5H 3L3HA 3JZ7A 4X6EB 4WUKL 5ETUB 2DWDB 3DVNA 3S37L 2HTLC 1ZVSA 3LKSB 4Y16A 2H45A 3UBXA 3HPJA 4MD4A 1MCIA 1H3GA 2QSTA 2IBGA 5JUEL 2H6PA 3NACL 1WZLA 4Z0BL 4M7LT 3F5WA 1MNUL 3ABZA 4ZFZA 2JELH 1IGIH 4DFIA 1CD1B 4HUWA 2ADIA 3HI5L 2Z93B 4KTDL 2R4SL 4Z0BH 1Y18A 1B90A 4OGAD 1IC7H 2W65B 4X4YB 1CFNA 2JJSC 3PWPE 5EDXA 2XN9E 1NLDH 1T3FA 2BK8A 2AQ2A 2YC1B 4KKCC 1NFIA 2FJHB 4NKMB 3BT2L 3TEUA 3QUYC 3RJDA 3DETD 4ZOBA 4HUXB 4D3CL 3QIUB 1JZ2A 3MRGA 4JDZA 4L3EE 2IF7A 1K6QH 3HE7D 2XY2A 3ARBC 5DUBB 3B3IA 3H42H 1ZA3A 4U7MA 1JJUA 4GRMA 4HKZA 4JB9H 3KNBA 2NY3C 3CGTA 4BZYA 4FQPA 3UTSB 3NTCL 4LNRA 3GSNL 3JV5A 1D5MA 1YMME 4ONOA 2MOVA 3FJTA 1F4YL 2FNBA 4LQ1A 3U0PA 4Q6YA 1VGEH 2BHYA 5EU5A 4PFEA 4TSCL 4PJHA 1F3DH 5HD8C 5BS0D 2J88H 1CDYA 1RMFH 3MV7A 1CT8A 4U2ZA 3OGCA 4WW2A 4LDLB 1ZLWH 1FFRA 1MJ8L 4HPYL 3HFML 1EEYB 4MAYC 2OZ4A 3FQWB 1RU9L 1A6ZA 3RI5F 1BREA 2P5ED 5C0AA 3RWCA 5IFJB 4U1JB 1E28A 3UTTE 2YK1H 2XWTA 3OJMB 4H1LA 4NN6B 4WCYL 3D6GA 4GAYB 4OB5L 5TE6H 1ZLSH 5JNYA 3EW3B 2IAMB 1KN2H 5TDOB 3HI5H 4LSQL 1IARB 1MCKA 5KSBF 2VXUL 3X17A 4G3YH 4JVWA 4X6CA 5DJZB 2HT2D 1KN2L 5IB4B 4NCDA 4ZTPH 3SDXF 2RAMA 3T04D 5LJYH 2VLLA 1TQBC 5JW3H 4OLVH 4EN3D 3M1BA 3S9DB 5CKAA 4ORGA 2JJVA 2VO5A 3VU2A 1HHGA 1W0WA 5EO9B 3VW3L 1JPTL 2X5PA 2Z92B 4UOJA 4WI7A 4FRWA 5E9DA 2CQVA 4HC1A 4LHUG 1E6JH 1XF5A 1S9XA 3AFLA 2DQIL 3QI9D 4WGVB 1HOCB 5FYKH 3O6FA 3SKNB 3WEXB 4EEEA 1S7QA 3CFKB 4MAUH 3MODL 1NUNB 3G6AB 4Q6IB 4L8CB 3QWOA 4J6RL 4M62H 4QOKB 4NJ9H 1FIGL 1OOAA 4M02A 5TF1L 5ESAB 4BSWB 3EDDA 2X4PB 5IW6A 4U1HB 4M6NH 2OXHA 1JVKA 1M7IA 4XP9H 2VZSA 3PF2A 4F7CB 4FS0A 1S7TA 2LTQB 3DX6B 5E2WH 3SDAB 1EPFA 1ND0A 3U4EB 4BH7A 2OMBA 4NO0D 3IDYC 4HJ0C 5HHOE 4QRTB 2PO6B 3RVTC 4NQEE 5GGQH 4RIRB 4M7JL 1JYVA 4QRUB 3MUZ1 4Z7UE 3QCVH 4JFOA 3RWJA 5FDYA 4KMTL 4XTRD 3KLDA 4JFYB 4IOFD 3AGVA 3S35X 2AQ1A 1DBBL 1FZOA 5L8LB 1S7WB 1T5XA 4H26B 2ESVA 2OTUB 5I6XB 1A2YB 3NCBB 1KCVL 1EAPA 4E41A 5L9DL 3DMMD 4LLDA 1T21A 2AVGA 5GGTA 4OCXL 5IUSA 1QOKA 3MFGB 1FVDB 4ODXB 5D1XC 3OJVC 3U48A 1A1MA 1WBXB 1Q9KA 3L3GB 3ARFB 1A6WL 4PBXA 5I2IA 4KZEH 1GGYA 5F6IB 4Z7OF 5IFAH 1HINH 1N59B 1QSEA 2FHBA 4RNRB 1B0RB 3UPCA 1OGAA 5T1DH 5IB3B 2Z31C 2AEQL 1JHKH 1T83C 2VN4A 4MDIB 4PJ9A 1CR9L 1U8KA 2OSLB 5HI5C 4G80B 4HMDA 4TSAH 2J8OA 3HE6B 3ARRA 1JGVH 1NGZA 3VXME 3U83A 4JHZA 4AY0A 1XCTA 2X1XR 1RZ7L 3EOYG 5C8JA 4QHLB 4MCYA 4JHWH 4GUPB 2QQQA 3HTLX 2ZZUT 5DD6B 4M5ZH 1JZ4A 2ID5A 5IMKA 3CFBB 1FAKT 1N2RB 3RZCA 1G6RH 2AV7B 3V6OE 1IT9H 3FQNA 1MPAH 4M9OA 5I18H 4JQXC 4RGNE 1DL7H 1YN7A 4FFWC 2X10A 2PO6D 5LQBH 2HKFH 4PPTA 4I48B 3WV0A 4E5XA 3T0BA 1IBGL 2FDBP 1T1YB 4MAYA 3VFPB 2ZUYA 3BKMH 4PRIA 1RVFL 5EUOB 3QWRD 2AEPL 3RDTD 5E00A 5A3ID 1XAUA 2APBA 2NLJA 1O0VA 4I2XE 4HT1L 3C8KA 4UUJB 4UTBH 4C4KT 1JZ6A 1SJHA 5GQBA 3MLYL 2PCPA 3MOBH 3O9WC 4L4TA 2JJUA 4KGLA 3PHSA 3FQUB 3IVKB 1CQYA 2XA8L 1MCWM 1UXSA 3U0WH 1DQLH 2LVCA 2FO4B 4PJBE 4D8PB 2Y07H 1I1AB 5KSUA 1V5JA 3R8QA 4X80L 4ORZC 2BNRB 3QUXD 5ESVB 1SY6L 4KKBD 5D1ZB 2YXFA 3JWDH 1G1YA 4QT5B 1AR1D 3NIFE 5GISH 4LAQH 4PJAE 1HSAA 1N64L 1BZ9B 3MQIA 1YEIL 4IRSD 4M5ZL 4DZ8A 5DWUH 3UYRH 1BQLL 3O6LH 2VJXA 1EBPA 4OI8A 3TN0C 1VSCA 2PF6A 3BGMA 4MS8C 4CN4A 1IT9L 1AO7A 3RIAF 1FLRL 3LQZA 4UILL 3EYVB 4NDMA 4HSQA 1F5WA 5DTFB 3LKRA 5FIEA 1IAMA 3KR3H 5BS0A 1PDKA 3KLAB 4U1HA 2NW2B 4MWFA 5DQJB 5HPOA 1D9KA 3FTGB 1E27B 1S9WA 4E42A 2APFA 3DX7B 2WBJD 5BCAA 2ZKHL 5GSRB 3A6CL 4G6JL 1P2CB 1ZKAA 1H8NA 1IGTB 5IESH 4DW2H 4QYOB 3QPQC 1EJ6A 1NMBH 4CVWA 5IG7A 3AB0C 3AMLA 1FYTE 5LGKA 4AZ8A 3W9EA 3IJHA 1FH5H 4TTDC 4EOWH 1CF8H 2A6DB 1KTRL 1G9MC 4M1DL 3RL2B 1XGQB 1H5BC 1FNGB 2EEBA 1YPZB 4XXDB 1Q1JL 3JV4B 4J8RB 2GJZA 2XRAH 1F4AA 4UV4L 5JPMB 2GT9A 1MCHA 4HKJB 2BVTA 3I02B 5FYJU 1KNOB 1MAML 3MRJB 3O3DB 4PJEA 3ZDXE 5IMOB 2NXZB 2E7LC 3ULUE 2WWMC 3HRZA 3QG7H 5DMGD 4ZG1A 1MIMH 5BQ7B 4QOKD 3HB3C 5E03A 5GS1C 2DQDL 3EGSB 2SEBB 3QEQB 4O58L 3F7VB 4XAKD 1NCBH 2AJSH 1N26A 1MFCL 4AG4L 1G84A 1JHLH 4QHKJ 5FB8A 1RZJL 3DX9A 1U3ZA 3UJTL 4NO0B 4HUKB 2XWJA 1FBIH 3GMQA 1UJ3A 4IRJB 2DLIA 1J8KA 5JIPA 1FSKC 4JGUA 1RZJH 5KTEL 4PJ7F 2O5ZL 3EO1B 1GC1L 3TBWB 4P59H 4HW6A 5CKGA 2OX5A 3PQYB 5FGCB 1FZJB 4D9RD 1Z9SA 2LU3A 3QDJE 5EU6B 3RGHA 1IFHH 1CXFA 1GGCH 4QXUL 2VXTH 3CMOH 4XVSH 4JO3H 1LGVA 1MCWW 4PYHA 3HNSH 4WIQA 5H2BA 4G42A 4MJIB 3TC9A 3S96A 2XKNA 3BESR 2BVPA 3MRKA 3C08H 5AWNL 2FJGB 4RISH 4P23C 4WO4C 4X7FC 5DHYB 2W0FA 5DJCB 3VA2C 1AKJB 2Y7QA 5EULV 1MAMH 2CGRL 1F8TH 1QACA 1RJZB 1F6LL 4K7PY 2P4AB 3C09B 3ZE0E 4X4MA 4GW1B 3MJ7B 1VKXB 5ITBH 1T20B 4P9HL 4G5ZL 5GRYA 1ZGLM 2GCYA 4FFVD 1RK0A 1CD0A 4LBEA 4OFYD 4EKXA 5FYKU 3VD4A 3VCLA 2W38A 4WHYG 1MH5A 1YNKH 3MOQA 2MNUA 3S7GA 3G04A 2CUMA 1IC4H 4KJWD 2IH1B 2B2XH 1PD6A 4ZAKB 3C5ZB 5D7LA 25C8L 2YHGA 2XV6B 5FYJH 4HLZG 5AYUH 4J3XA 2IPUG 2XTJE 5T5FH 2EE9A 4Z8FL 2AXJA 2WBJA 3W0WD 3D9AH 4MLIA 5B4MC 1PVHA 5EC2B 1R0AH 1LO2H 1J88A 2Z31D 4NQEB 4D2NA 2X4TA 2NQCA 4NM4H 4P99A 1CI5A 3LRHA 1R0AL 1P4BL 3HNSL 3QUZB 4G3YL 1U6AH 3BO8B 5CUSH 4DGVH 4K94C 4JEGB 3NIGE 3KDMB 4XNUH 3FOMB 1JF1B 2Y72A 4ZPTA 4IRSA 1PGRB 2EC9T 3QFJE 4XNUL 3KS0H 3VW3H 1YEKL 2WUCH 4ZD3L 3L3KB 1NAMA 2YA1A 5DLMH 2VLKE 5ALCL 3FO2B 3SE8L 2WUCL 4XCCL 5FF6A 2DQIH 4KQ4L 4Z7WB 4OF7A 3FFCB 4APQD 3O3EB 3O3AB 4Y4FA 3LKQB 2Y06H 3QNZB 4R4NC 2Q86B 3DO7A 5FM4A 1AXSB 1B9ZA 4IRSB 4ZPTB 5LVEA 3VD5A 1RIHL 3GJEB 5TF1H 1CDHA 2J88L 4YO0B 1OTTD 2HFGH 3MV8A 4YXKL 1Q9WA 2ZWLT 5T5FL 4P23D 1P69B 1QO3B 4GFTB 1QLRB 4XMLH 3RGVD 5J3HC 3QDME 4WU7B 5DQDL 2UUDK 4PRPA 4LLMB 5EC2A 3BH9B 2D7TL 1OGTA 5D7IE 1AGBB 3GI9L 2OL3L 4LEOA 2B1HH 2R1WA 3SOBH 4Q97A 1ITBB 4HKBB 2XFXB 4OJFL 1UVQB 3T0EB 1UWEH 4YWGH 1VFBA 2EDQA 4POYA 3PGDA 2X2YA 1Q9LA 2VLJE 2IQAA 1KCVH 1H5BA 1RUKL 5TFSL 5EOCJ 1OAZL 3FRPA 4PJ7A 3QHTC 4PJ5A 2IQ9H 3WCYA 5EU7C 1JGDA 3HZYA 1DANT 4N8CL 1W2KT 3H2WA 4MMXC 3ORJA 1E4KA 1A4JB 3KYNB 4PGDB 2HRPL 3KPOB 2CUIA 5DVMA 3RU8H 5IBLD 3QUMH 4HX1A 3EFFA 3LPGA 5ANME 4DK6A 3O41A 5KVFL 1B4JL 1YC7A 4HD9A 3GJFH 5EG6C 4B41A 4J3WA 4MAUL 4X83A 1QR1B 2YWZA 1DBMH 2KQNA 3S8WA 1I8LC 2ITDB 2ZUQB 3KYMA 5DJCA 3QQNA 3WIHH 3QEQD 3WFCH 5KAQG 3DRTA 1KLFA 1GJIA 3S96B 1R3HB 3AREC 1A8JH 2YD8A 4N8VA 2VAAB 2CJUH 4CVZB 1G7MB 5JPNA 4JFEA 4JR9H 1WBYA 3MNWA 2FRGP 4Y5VB 4ZUSB 1IVLA 3D5OF 5DQDH 4DTGH 4UNVA 1RZ7H 3C60D 4UT6H 3AY4A 5EU6A 3GNMH 1V3KA 3BYYA 3K1DA 1X6NA 3PQYA 1FG2B 5JIKA 2O61A 3QQ4B 4PG9A 5BVJA 1D6VL 3JTTA 4RQQB 4X5WB 3NH7L 4H25B 3S5LG 3ULVC 4P4KA 3D85A 2YBRB 4KVCL 1UJ3B 4XCNB 1GOHA 3JTTB 2FL5A 3TYGL 1FG2A 4JPIB 1SM3H 4MQXD 5EWIH 3LB6D 5DJ6B 3PABB 2DDQH 2X89D 4FQJL 4L4VE 1KEGH 1RIUL 4RCAA 1I3GL 2G60L 1J0JA 1SYVB 4YK4B 2VC2L 3LH2H 4EXKA 2MFNA 3QEQA 2VAAA 5B21A 3EYSL 4HZLB 5KAQF 3TESA 2GEEA 2ESVE 5JHLH 1FLTX 4Y5XC 3SDXE 3C8DA 2XNAB 1E4JA 3MJ9A 4JZOA 3VFNB 2ITDA 4I0PA 4NUGH 1QR1A 5ID0B 4JDVB 1FFQA 3MOAL 1HINL 4PTTA 4KUZL 3WHE0 3O6FD 1KNOA 4GOSA 4NUGL 5IIEA 1FFOB 2NTFB 2GJZB 3K8LA 1JZ7A 1MOEA 4PGDA 1AGFB 1RJYB 1HWHB 3LQMA 1MUJB 1NGPH 3VXUD 2XZAH 4KKAD 1N0LA 1XGRA 3ARQA 5HXMA 1QFPA 2JK5B 4TVPE 3QISA 3KPRE 2IG2H 1VFBB 3CDYA 4MAYD 1K9TA 3UTTB 1IGTA 4MLSA 3GKZA 2GJJA 5GGRB 3TV3L 4LARL 4XPGH 1D9KB 2LVEA 3BH9A 3NIDE 4KQ3L 4PRPB 1TENA 1MCEA 4GSDL 3LKRB 3E6FB 4R0LB 4H88H 1QLEL 4XWGL 5JZ7C 4MJ2A 2R9HC 2J5LC 1TZIB 1ROWA 2O5YL 4P5TC 1CGXA 3OB8A 1XF1A 4BYHA 4HH9B 4FQIL 4DZ8B 3WFHA 4IIQA 2CDFB 2DD8H 3HCVA 2Q76B 1AXSA 4FQIH 4YFLI 3CXDH 1UEYA 4NZTL 5F97E 3LKQA 2NXZD 4MNHB 3UTZB 2P5WE 1YECL 1ULVA 3TH3T 1TFHA 4U0RB 2BNRA 1BVLA 5K93A 3ULVF 1A5FH 3FFCA 3CVHL 1IQDB 3G5ZB 1ZAGA 3CSBA 4NGHH 2E3VA 4D8PA 4KJYA 3MYZA 2FO4A 3KPSD 3WFZA 3L3KA 4ENED 4RMUA 3CSPA 4UV7H 3D85D 43C9B 1QKZH 3HMWL 2K9UA 1AGCB 4L4TB 4FFZL 2HA1A 3SDCA 1G9NH 1O7VA 4UUJA 4ZXBA 2NLJB 5HHNA 1GVIA 3J7HA 3L5XH 3PQYD 5L88H 1AHWC 4OBRA 2DIBA 4MAYB 4F2MB 1HHIA 1FNFA 3GDBA 4JREC 1TETH 1QLEH 4PJEF 1VACB 2DM3A 2OZ4H 3IDIB 1A64A 3FQXB 3PIQA 2ICCA 1MWAH 3C60A 4N0FA 5EU6D 5EO1A 4ZUTB 4CNIA 1YNTB 4KKLD 5KOMC 1QUNA 1T6WA 4XBGA 3BAEL 4RFNC 3IS0X 3FB6A 3ALXA 2W9EH 4WVRA 3SDDD 5FA4B 1PZ5A 5JQHC 4WWKA 2BC4A 3QDAA 5DJAB 3U9PH 4GUPA 4WGWB 3I3BA 4A6YB 4ZAKA 4OCSH 3AXLB 1XCTB 2V6HA 2VDKL 3ARGA 2NX5E 2F58L 1T0PB 1HNFA 5ISZD 3G5XB 1X5AA 1MH5B 3ZYZA 2F54E 1U8KB 4NWTL 1NCUA 2JIXB 1J8HB 3HPLA 1QFOA 1Z9MA 2HVJA 4TVSa 5HBBA 5GS0L 4YHMH 2LV4A 2GCYB 3FT4A 3UTSE 1ZT7B 1OGAB 1T20A 2JELL 1W72A 4YHML 4G7VL 3PP4H 1QSEB 4L4JA 4Y8DC 5L2KE 1AD9B 4K8RD 1KENH 5MENE 1A4KA 3H3PH 1G7LA 4FQLH 2FX9L 1ED3B 1AKJA 2Y7QB 1JPGB 4OCRH 4AEIL 2W0FB 2BY0A 3RUGB 3STLB 5FAAA 4PJHF 4ODXA 4NQDA 4PLKC 4IBLT 2D7QA 1MCPH 2AV1A 4G9FA 1EAPB 3B9DA 4GAFB 2B2XL 4XNQB 1HCFX 4UOW1 4E41B 5C0JA 4Q9QH 2Z35B 1V7ML 2NY2C 4JQIH 5IKCA 2P49B 4YGVA 2GK0B 2HJKB 3LMJH 5HYJA 1ES0B 5C08A 5KTEH 1OAQH 3P4NB 2FO1A 5BV7C 1S5HA 2X4OB 4MHHI 5E8OB 4QRTA 3QCUH 1G6VK 2B1AL 1UGNA 3VXRD 3PHOA 1S7TB 5D1QC 5T1LD 5J9PB 3LV3B 4XB8A 3GBML 1J87A 3OMZA 4JPWL 4XVSL 4NFDA 2CR3A 2ZOKB 4M7ZC 5JIHA 1H3UA 1NJ9B 1LDPL 1NJ9A 3DURA 2VOTA 5CCKL 5KS9F 4IS6B 4P9ML 3RAJH 1A6UL 5T5NG 1WJ3A 2P45B 3CFKA 1JZ3A 1I1AD 3OJDB 3H3KA 3SKNA 2F19L 3HZMA 4ZQKB 4EN3C 3BJLA 1HOCA 3UXFA 5DFTA 4U1MB 4HKJA 2WSKA 1KCRH 4P9HH 4J8RA 1A6TB 3T77A 1XGQA 1S9XB 2R69L 2ZSVA 2AJYL 4JFXA 4HGMA 3OKDB 1E4WL 5HYJB 1FL6A 4YGVB 2EE3A 4ZDHB 3BGAA 4OLXH 5FKAA 3OKMB 3W9EB 2M2DA 3RWHA 1IGFH 2UY6A 5IG7B 25C8H 1G7HB 4HHAA 5IB4A 3KWWB 3C9NA 35C8H 4X6CB 1S9VB 3QIBA 2A6IB 5GGVY 1RAMA 4Z7UB 1XH3B 3BPCB 5ADPL 5BW7A 3THMH 2VXSL 5ACZB 1SEQL 2J2ZA 1P4IL 5T3ZH 5D5MB 1JPSL 2Q20A 3GSWB 3LSOB 4H8WC 1W72B 3WN5A 5IFJA 4LCWD 1A6ZB 3FT4B 1FN4B 1ORQB 3NIGF 1Q72L 2E9JA 3QNYA 4X4ZA 3T65A 3VXRB 4TUJB 3HG1E 3BRDA 1UWEL 5F7DA 3S35L 4YH6A 2DMCA 2W9DH 3P3YA 5JQ6H 4G9DA 1KCUL 5LGHH 4QOKE 5I73C 4V2CB 4CKVX 2V2XB 2JTDA 1R5IA 5CLTA 5BV7B 1NBQA 4NUJA 3RTQA 5L2KD 1RZFL 1YEKH 5HHMB 4U6VH 1FGVH 4TUKL 1A7QH 1OAUH 2GI7A 3FN0L 5I1CH 5SWQB 5FHBH 2XQBL 3KNBB 4GW5B 2QEJA 4TPRH 4CNIB 3QEGL 4P3DB 4Y19E 4F8QA 3FCTA 3C60B 4GRLC 3TA3C 4UB0L 3TGXA 3IAGC 3FQXA 1ZOXA 4JDZB 4OLXL 5F7MC 4HC1H 1SEBA 1L0YA 5MHSD 5F6HJ 2DLFH 3N85H 3GJFB 3TIDA 3FHAA 2AABH 3MJ6A 1XGPA 1V3LA 4TQEL 3QEHB 4EIZC 3SDCB 2VLJA 2IH3A 3O8XD 4OAWB 1CD1A 1J05A 3SGKA 2E6QA 2NXZC 2RJMA 4LGPB 4IRJD 3KYKL 1DDHA 1JHKL 2H6PB 1I9JL 4I48A 5DMKB 4WHDA 1OSZB 5C0CA 2E27H 5ESQA 4KJYB 1YEGH 1DBKL 4Y16B 3EOBA 3G5ZA 2A83B 2HN7B 4OZHA 3RWIB 2PYFB 4HUMB 2DWDA 2PR4H 4FFVC 1B6DA 3ARSA 3P30L 1CGSL 4X98A 5CSGA 3ZE1F 5DVLA 3RVWC 1JYXA 2MCPL 1I3GH 4QNPE 3MYJA 4PGZA 5GGUA 3WFHB 2RGSA 4APQC 4HH9A 4NOFA 1GPOH 4AIZB 5JHLL 4JFPB 3VXMB 2CIIA 4Q9CA 1AI1L 3X13B 5CZVL 5J6HB 4S1RH 4WJ5B 1UZ8B 3G5YA 3LQAH 1FAIH 3BIBX 3WD5L 4K71C 1MREL 3I2CH 3TJEH 4PJ5E 3BKML 3QDJD 4LCCC 4XP5H 5E70A 1FFPB 1B0RA 2O26U 5DI8B 4RZCA 3UYOD 3EJZD 2H2SC 5CHNA 3IDXL 4DOHE 2P42B 2UWEA 5I1DB 5GGRA 2AKRA 2CKBL 5ICYA 1Q9KB 3L3GA 5HI3D 1A1MB 1R3JB 4UT9H 1FVDA 3RY6A 3IXAB 1CIUA 4R7NB 3P4OB 2VKXA 4G8GB 1MAJA 2VZTA 4XNZB 5MEQA 3HC3L 4L8DA 2QHLA 5C0RH 5D1ZC 2HT3D 3ZT5A 1EZVY 1FV1A 4S2SB 5GGVH 1FZOB 3SDCD 2PW1B 3K2MC 4JFYA 1T1ZA 5GHWH 5D7IA 5DEGB 1ZLUH 4OM0H 2QR0B 2PN5A 3TJHC 4LIQL 1RPQA 1T04A 1FFOA 2NTFA 4WI2A 5D72L 4GKSB 3B9AA 3SPVA 3HAEA 3SDAA 3U4EA 4BH7B 1OP5H 2WWMD 3ZE0F 2FATL 2EDNA 3NAAH 3RVVD 1RIVL 4NN5C 4L5FH 4UILH 3PWNB 4M48L 3M8OH 5GS2D 3UDWA 2X41A 5EPMA 4N9OB 3VD9A 4LCYA 4BSWA 43CAB 4L5FL 1XGYL 4BM7A 4AMKH 2DRUA 1I7ZA 3Q6FA 1D9KC 2HJFA 2Q3AA 2V7HA 1IEAA 3I9GH 4FHBD 5ACLA 1T22B 2YOCA 4KVNL 4NBXB 3V9FA 4PR5A 2VDNL 4XHJD 2VQTA 3D85B 3LVEA 5I1KL 3IS1X 1JWUB 5E9DB 3QFJD 4X5WA 4HIXH 3ULUD 1W0WB 3WXVH 3AY4C 2X40A 4Y4FC 5FUCE 2G9HA 2VR5A 4RX4D 3S36H 5CBAB 4JFQB 4AIOA 5E94B 1MCLA 5T1KA 4Y5VA 4Z95L 2HH0L 3VI4F 1JE6A 4UMGA 3RGVB 1G7MA 5JPNB 2D3VA 5B8CA 2E7CA 4HEPG 5L88L 2C3GA 3GUTB 2YKLH 1NBVL 2KZWA 2G75A 1FPTL 3KYMB 1N6QH 2ZCHL 4MA3B 4PJ8A 5D1QA 3K46A 3UC0L 3QDGD 1BQHG 3DXAE 1EXUB 2DQHL 1KT2B 4QHMB 5F6IC 1UJTA 1E28B 2WWKT 1YEFL 3MRMA 4YUEH 1T7VA 3M8OL 4Y7MA 3T2NL 3CLFH 5HI3C 4MA8H 3EOTH 3RFZC 1NANI 5H94B 1KB5H 2NY5C 4HWBA 2BY1A 1QSED 3BH8B 1YC8A 4JO2L 3MO1A 3F7YA 5ALBL 1XIWD 1UH2A 2BMKA 3TCLA 3ARPA 1OGAD 4PS4H 1CLZH 3BD3A 2HKHL 1LO4L 3FHQA 3V5KA 1Q9LB 4CADB 3PWJB 4XPHL 2RR3A 5D2LB 3OXRA 3W11C 1QFWL 1D5MB 2AJXH 5JDSA 2XZQL 1AXTH 4HJ0D 1IQWL 1U3HB 2XFXA 4XPHH 5E6YA 4GRMB 3JV6B 1CXHA 1F4WL 1HSBA 1N8ZA 1GGCL 2LTQC 4QXUH 4LSQH 1CFVL 2DI9A 5DFVD 4XVUC 4LHQB 3AREB 3C2SA 3NPZB 1A14H 4OCRL 3DMMA 2XTLA 5I76A 1NFIB 2FJHA 5DFVC 3F6IA 1T3FB 5CGTA 1CTOA 1SBSH 4JRWA 5DDHA 1U8HB 1Q9WB 3QPXH 3AC0A 3L7FB 3GO1H 4Q58C 5DRNB 1KFAH 1II4E 2BERA 2BX5A 4JHBA 4ZFZB 2EO9A 5F72S 2V5TA 5IM7A 2Q86A 4NC2B 3HA0A 2CK0H 4MYWB 2R29L 4YHZH 3OKOA 1NUFA 2X4RB 3UZQA 3NTCH 2YPLE 2ED9A 5FF6B 4LLYA 1AIFB 2BNRD 1F4YH 5A2JH 5D1ZD 2IFGA 1N0XL 3V7AE 3LN5B 4LRIA 3LD8B 4YEFA 4CW1B 4QO1A 3MRDB 3ARXA 3EOAB 1MRDH 3BJ91 1JF1A 3R1GH 4Z8FH 3VXMD 3S34H 4UDUB 1CFSB 4Z7WE 3T2QA 3STZB 1KJVA 1BGXH 4I5BB 3OR7B 5KZCD 4HF5L 5K9JL 5GJSL 4F37K 2OBGA 1DVFA 5EN2A 2XWBB 1U6AL 5I1AA 4ISVA 3PV6B 5DRWA 1UFUA 4R4FL 4ESKA 4YQXL 3FQTB 4Y2DB 1LP9A 4NQEA 4FXGB 2VXUH 3WHXA 5IQ9B 4MZ2A 2X4SB 3K81A 4BZ2L 2B0SL 4S10A 2WBJB 4AEIH 3SCMC 2IPUK 4LEXL 1KN4H 3MSPA 1UKTA 4HGWB 2BRQA 4EDWL 1YMHB 4PLOB 3C5ZA 2FYYA 2X6MA 4NNXB 4POZC 1UM4H 1KIPA 4HS6A 2NYYD 1EO8H 4TTDD 3G04B 2V7NB 4L3EB 5SV4A 4DUVA 4X9HA 5HI4C 3WJJA 4JRYB 3O2VH 5E5MB 1ZANH 1CXLA 3NIFF 1NUGA 4RAHA 4RMQA 4OUUB 3QXDB 4JAMA 4KHXL 2C7UB 4PJ9D 1ZANL 1WBZB 2AEIT 1JN6A 2HVKA 4D9QD 3KS0J 1JPSH 1AD0A 4LU5L 2ZUXA 4JJHA 2ZUUA 3T2PA 1TZHA 2F53E 1NCWH 3CLEH 4RFEA 5JHDD 1X5ZA 4AL8H 4ZS7L 2F5BL 4TNWF 3BZEA 4N8VG 2GQHA 3OAUH 2W9DL 1NCWL 1CVSC 3C87A 2FH8A 3T8XB 3TJHD 2W92A 3KAAA 5LXGH 3MBEA 2YD9A 4P9MH 3RAJL 3BW9A 3AAZA 1BIIB 4U3CA 4NZUH 4B5EA 3KJ6H 2D2OA 3ZSTA 4X7CC 2LU7A 3KPRB 4XVJL 4OFKA 4XNZC 3V52L 4Q0XL 3RVWD 5IV2B 3HMXH 5LQBL 3MROB 3NZHH 5C0CD 3O4LD 1LP9E 3LS5H 1U91B 3X3GH 5D9SB 2P8PB 5I0DA 1OM3H 4IDLA 4OD2A 1KC5H 5BW7C 1LE5A 3OBAA 5FB8B 4NN7B 1UM4L 1UB6A 2ZUQC 1B0GA 5CSZA 5AYQA 1OARL 3UTOA 3VXSA 3MZGB 1A6WH 1MHHB 1CBVL 4YHLL 3MRNB 4WFEE 4KHXH 4JM2D 3MJ8A 1MRFL 2QTEA 4ELMA 2FBOJ 2B4CH 2V2WB 1CICC 1DUZB 4NRXB 3GBNH 4X9GA 5JW5B 3OKKB 5T3ZL 2ZSWA 4FG6D 4ZS7H 1BFSA 5HHOA 3HZKB 5EUOE 1LO0H 3PQYE 3MRHB 4F33A 1WWBX 5C9JA 1UWXK 5IEHB 1FZKB 3T3PF 3ZE2E 1JGVL 2P43B 3OKEB 3G9AB 1P7HL 5E1HB 1NSNH 3BP6A 1MFDL 3L7EB 1LD9B 3MCG1 2FGZA 4MJIE 1YA5A 1DEEA 5FEBA 4EDXB 1OAKH 5CZVH 5I18L 3ARDA 3FKUS 2YPLD 3KR3L 1MEXL 1UM6L 5EOCH 4I3GA 4OCXH 3BRGC 3DHJA 3QRGL 1E27A 3FTGA 5F9WB 5DUMH 2H2PC 5F6HI 5K9KB 5IESL 2E9IA 4OCNC 4CMHC 1NUDA 1Z2KA 2VDQH 3EYVA 2A0LD 4UTBL 3VI4E 2ICWI 1T4KB 3MJ9L 2ZCKL 5MERA 3CVIH 1NBYB 4HKXA 1CLCA 1DZBA 2AEQH 4P2OC 4WWID 3VI3F 1B3JA 4XP6H 5CJBA 3P4MB 3MRCA 1PLGL 3C6LB 5L7XH 3PDDA 2PYEB 5A40E 3NFNA 3QZWB 4YE4L 4Z78B 1WK0A 1EGJL 3MV8E 1I1AA 4WUUD 3SDYL 3TN0A 4DVRH 1ZTXH 2PR4L 1RZJC 4HWEL 2WM0A 5DJYA 3HE7A 3P30H 4FTVA 5AG8A 3QUZC 4HWEH 3P4MA 3FQUA 3KPPA 5FO8A 4RRPG 2WQRA 2PCPB 2VDPH 2X1OA 1I1RA 3SGDH 1KGCD 1NDMB 4ZPVA 5DK0B 4HKXB 5KZCB 4XBEH 5KJRH 1AI1H 5E00B 3L5HA 3QRGH 5DD1H 3CXHJ 4LL9A 4CDGC 4NQDE 3E0GA 3H6JA 3IU3A 3LKOA 5FYLD 1T03H 4U6YB 5JXAL 4G6JH 4WW1B 1YN7B 3OJ2C 3CUPA 2CKNA 4WI5A 1FP5A 2DN7A 5CBEB 3SDXB 1NCNA 3I85A 4ZNEE 3QULB 2O5XL 2EEDA 1M6OB 3MZTA 2I07B 3Q5YA 5DD6A 4OLWH 4NO3B 4XB7A 2HFTA 4QHLA 5IB5A 1IL1A 2D9QB 1OF2B 1YNLL 3DSNA 5DHVA 5DRXA 1OTUD 2AW2A 3IAPA 3QH3A 2BCKB 1N6VA 2C26A 2BSRA 1LO5B 3VWJB 3BP6B 1FO0L 2CGRH 3MPCA 3OR6A 4PJ9B 2GIYA 2OTPA 4JFZH 1J5OL 1QR4A 4DVRL 2P7TB 2ZCHH 4U7KA 4I4WB 3QG7L 3IYLW 5EU7E 4GS7B 2ATPA 3OAYK 5JLZA 5JW5A 4NHCL 5E1AA 5ICXB 1MHCA 5DJ2A 1EMTH 4FXLA 3PL6A 1J8HE 4UTAL 1CGWA 5CEXA 3KJ4B 4G43A 1YJDL 4PG2C 1TTUA 1C8PA 4GXVH 4XBEL 4WHYH 4P46B 1WBXA 4LSTH 4DOHB 3M17A 3DPBA 1NGYA 2EC8A 1X9QA 3QCTH 3PDOA 4FG6C 2ZCLL 1KB5B 3L5JA 3N0PB 1UXWA 4KC3B 2HKHH 4RDQF 1A2YA 5SWZA 4AJ0A 1WAAF 3LCYA 5GGTH 5DJXA 4M3KB 5D7SL 1IQWH 3N1FC 4I18B 4JPKL 5MI0B 3VRLF 4CN1A 2PO6A 3P0GB 4PRBA 3LEYH 1FNAA 5HJ3A 4Y4HB 5E7FA 1HXMA 3RNKB 1QSFD 1TNNA 4KK8D 4LKCA 1YZZA 2PXYC 3C08L 3A67L 4LHUD 3DETC 1A02N 1CCZA 2ZJSL 1BZ7B 1FNEA 3B2UC 3MTRA 3T8XA 2Y36L 5CJQL 2Q3ZA 3DV4B 4HJGB 2BVYA 5MP6H 3H42L 4ZD3H 2F15A 5ISZB 1JYWA 4OBSA 3G6AA 1LK2B 3BUYA 4OF3A 2VB5A 4BELD 4JRXB 4RDQG 5E08H 1CGUA 3P11L 1T2QL 5IF0B 5HHME 2YRLA 3FO0H 5FECB 4I3SH 3TP4A 2AK4A 1YEFH 1WBZA 3H0TA 1P6AB 3HNTL 5EBMB 4I0KA 1TVBB 3VH8G 1VA9A 3W39A 1TZGL 3ZSSA 1HDMA 4JRYA 1RIHH 2VZVA 3WKMH 4GRLA 3TA3A 4DAGL 3FOLB 2QHRL 1BMGA 1NFDF 1I3UA 1UENA 5F1SA 4LDEB 5F21B 3O0RH 1Y0LB 4EUPH 4HS6B 3RPIB 1JMZA 1KJ2H 3HRPA 1YEHL 4O00A 4OKDA 4IJ3B 1YMHA 2J6EH 4QXTB 4X6DE 3GSRA 3TO2A 5JW4M 2HLAB 1AHWB 5JXED 4CAGA 1VHPA 1BFOA 3FFCE 3D3VD 2MQCA 5BRZA 3CPLA 5C09D 3N9GH 1BP3B 1I9RH 3QJHB 4P4RA 1CFVH 3WHXB 1LP9B 3MCLH 2XWTB 5DRWB 3VRLE 5E4IA 4L4VD 5C0AB 1PKQA 2FECL 1CZ8L 3GMPA 1EEYA 4QTIH 3FAXA 4MJ5A 4PTUB 1UQSB 2H32B 1N4XL 1H0DA 3RWFB 1KJVB 3MR9B 3WYRA 5HYFA 3DHMA 4U31A 3KJ4C 3D25A 1F6FB 4UDUA 1U3YA 5KSBA 2ICES 2Z91A 4JB9L 4QCIA 4KRPB 3QUML 4HGKC 3A6BH 1ZHLB 3CC5A 1AFVH 3VFRA 1JYNA 2APXA 4LSRL 1IC4L 3WUWB 4CVUA 4HKZB 1U2HA 2BNUA 2ZUVA 3PWPD 4LLYB 3B3IB 4JKKA 4R2GC 4LSRH 3MNVB 3NN8A 3VWJC 1IZKA 2V9QA 4IM8A 3V4PL 1DE4A 4CDHA 1D6EB 1MCOH 2XKUA 3VMOA 4C4KO 1U8MB 2H9GB 5IBTL 1M71A 2PTUA 3R1GL 1I7TB 2ATKA 4XC1H 4W4OA 4UIMA 1Y18B 1E4XH 1P4IH 4NN6C 4PJBA 5T1LB 3MUJA 2ADIB 2CRIA 2ED7A 1PAMA 4HPOL 1BVKA 1NAKL 5I76B 1IC5L 1B2WH 3LQAC 2CXGA 3AREA 4JVUA 2BY3A 4PGCA 3VE0A 1FZMA 2R0WL 3HPJB 3HMXL 3MBEC 2GHWB 4S1SH 5SV3A 1G7JA 5IBUB 4GBXA 3LKSA 5LGHL 4MS8D 1MHPH 3GMMA 5C2UB 3JV6A 4QTHB 2NPLX 3DVNB 4FQCH 1PKQE 4L4VB 4U1SB 5ETUA 5C0AD 5HGHA 4C56D 4MQ7B 3GKWL 3UTTD 3PWJA 1NCAH 3EYSH 3ULSA 2NY3B 5F93C 2BMKB 2L0DA 4MNQB 3JVGC 3VFMB 3ARBB 3TZVC 3BH8A 3VJ6B 1TJGL 1EK3A 4XPBL 5H94A 3CFEB 3GRWH 3IKCB 5GXBB 3G5VA 3GSQB 3D2UB 4LHJB 2AJUH 1NLBH 4O2CA 2DLFL 3N85L 5J6GB 5HDBE 2PXYB 5D1XB 5E8EB 2AJUL 3C6LC 4GKNB 4LGRB 3RGVC 2NX5A 4U1KA 3BOVA 5KS9E 4NQVB 4XHQA 4OCWH 1JI2A 4Y4HC 4P46D 1NFDB 4KPHL 5FYLH 2ENYA 1UCTA 2YRZA 3IB4A 1I9JH 1OAYL 4F9LA 5J56B 3GUTA 1DQJB 2F74B 5C0FA 2AERT 2YXMA 5E94A 4E41D 1EHLL 1E0OB 1JRHH 1YMMA 2G2RB 2IWGA 2G9HB 3WIFA 1BX2A 3TV3H 5KSVB 1R5VB 2HG5B 4HJJL 4J23A 5FOBA 3TYGH 4LF3A 5CZXD 4FQCL 4X6BB 1RZIA 3L3DB 4EI5A 4NZRH 3WLBB 3TBTB 5IOPA 2R0KL 4U1NB 1FE8L 3WMSA 4JLRB 1QEWA 3R4DA 2NW3B 3RZWA 4NN5B 2V7HB 3EJZC 3BEVA 1KTLB 4OV5B 2CKBA 3C6LD 4AEHH 4DKEH 5JW4R 3GRWL 1ZS8B 2HT4C 2EDBA 1DN0B 4G8EB 5GIRA 3WNMA 4QF1A 5IMLB 1QLFB 1QLFA 3QXWA 2VLME 3D3VE 1UZ6E 5EPMB 1X5GA 1VFAA 3PDGA 4XHJC 3MV01 5T1DL 4KUZH 3MRLA 2I25N 1PFCA 3BEVB 4OV5A 2FX8H 1T0MB 3CVHH 1QEWB 4WU5B 1P6FA 1KXVC 3HAEB 2EYSB 2J8UE 4OCWL 1WIPA 1OP3H 3EJJX 5CEZH 1T04B 2Q7YA 3KVQA 2QR0A 2OR9L 2I9TA 1D6VH 4M1CC 4RGOL 2R2CA 5DMGC 4HUVB 1WFOA 5FYKE 1UH4A 1E4XI 1N6UA 4JFDB 2VYRE 1YMMD 5CD5D 1FLRH 3X14B 1AO7E 1HILA 4MDJA 5INDB 4YFLF 4EJ1C 4GT7A 5MEQB 2VZOA 5I1JH 3L95B 4M7LH 1G9NC 2EYTA 4KHTH 2ZUSA 3BYTA 3EUUA 4K71B 1A6AB 1RJLB 1RIVH 3VXUE 1FE8H 4IHOA 3EYUH 1LEGA 5JR1L 5CINH 5HDBF 2G5BA 1J1PH 2ADGB 1I9IL 3DSFL 4LKXB 4KRNA 3RVXD 4GKNA 3RWEA 5DS8B 3KXFD 5DI8A 3SQOL 4PJBF 5J6GA 5IHLB 4K3JH 4AMKL 5AZ2L 4WJ5A 3UYPA 4X6FB 1D5BA 1RFDL 4PRHE 5FHAL 5GGUB 2Q87A 4NZTH 3LPFA 3MYJB 5EIIB 4MNQA 3HR5A 1S7XB 3AUVA 4UV4H 4Y16C 3AMKA 4TN9A 4X6CE 3GB7A 3X11B 1X5YA 1HIML 5EZIH 3FB8B 2HFEB 1MIML 2PYFA 5TQ2L 3RWIA 1C1EH 2A83A 2HN7A 3QG6B 3GMRB 1FNSL 2IAMD 4HFUL 1WFNA 3EOBB 2P1YA 2YSSB 1T1XA 2KPNA 1A7RH 4K3HA 4CMHB 2LAGB 1QRNB 5DO2D 4FXKB 3HNVL 4UU9A 4PLKD 1IGCL 2AI0L 5BV7L 5C6TH 1BVKB 1UC6A 5C0CE 1J05B 1CYGA 1F2QA 2FCBA 2VMFA 1JPFA 4GG6A 2NR6C 4XWGH 1JGEA 1JRHI 1Q0YH 4KDTA 4XAWH 5BRZE 3CVHB 1PZUB 4KDWA 1NMCB 4MZ3A 1RZKH 4KROB 4Z7QE 2F9BT 5HGDB 2Q6WA 5AAWA 5HDQL 3BSZH 4RFOH 2VLRE 1U8MA 2H9GA 1LK3L 4OKVB 3EOTL 3UBXI 2H3NA 1DE4B 1F45A 3SKJH 3NN8B 3S37H 1BFVH 1KEML 1RI8A 4GW5A 4JFEE 5HD8D 4Z7OE 4KXZI 5EB9A 1MIEH 3QUYA 1QFWM 4NUJB 3RTQB 4Z5RA 2MPAH 1CFTB 1RHHB 2EC9U 5IW3A 2J6EA 3UTQB 4D94A 1P5UA 4N5UA 1CLOL 2Z91B 4HIJB 3IAQA 1MFEH 2Q7NA 4R2GB 3OKLA 5CMAA 1HIMH 3L5IA 4G9DB 2R39A 2R4SH 1A47A 3D2UD 1XR8B 2DJ4A 4U1GC 1TDQA 5C0BA 1IM9A 4X4ME 2VDRH 1UQSA 2H32A 5J1AA 3QNYB 5D1XD 2O93L 2YEZA 4P3CL 4XC3H 2BOBB 1YY9C 2P5EB 4O58H 4MJ6B 2J1KA 3QJHA 4P4RB 3OPZH 4Q9RH 4RBPK 4O5LL 4NJAL 4XCFL 3PXJA 1NCCH 3U82B 4X6DF 5BS0E 5B3JE 1S9VA 2ADJA 4JFHD 4JDTH 2V5RA 4UOW0 3KWWA 3UJJH 3GSRB 3TO2B 2VDOL 3NFPB 4FQXB 4LCIL 3RKPA 1VB9A 5I1GL 4XCYA 3IDNB 2H1PH 3WE6A 1KOAA 4HG4K 4LVNB 1JWMB 5DZNA 1S7VB 3OKMA 3BZFB 3P9LA 4X6CF 5SWSB 5IJVB 4NM4L 1T7YA 4EN3B 4X99B 3RHWF 4JFFD 2BOCB 5CEZE 3ZT7A 3BHBB 1UB5B 3ARDC 3OQ3B 3G08A 2DYPA 2CO7B 4X7TB 3TWCH 3BP5A 2Y23A 4GG6E 4HWUA 1KPRB 3U9UA 1EUUA 5AWNH 3OJDA 1WEJH 1U8PB 3MXWL 5I1EH 4MQXC 5DMIH 3S3SA 4Q2ZB 5ID1B 2X4UB 3BE1H 4JY6A 4GLRI 3ULVD 4LSVL 1I8IA 4HAGA 2D31A 1ZLVH 2VIRB 4FFYL 4P2RE 1AY1L 3OX8B 4Y89A 4YR6B 4DEPB 4FFWD 4L3CA 4RMSA 4UBDC 1KN4L 2F53B 4C55A 4TPRL 4QWWC 1T89C 1EVUA 5ECJE 4UB0H 2EIZA 2B5IB 2AGJL 2V2TB 2OMNA 4QKXB 4PRBB 2R1YA 1TQCB 4WHTB 5C70A 2AGJH 1GCFA 3O45B 4KRMB 5EU4B 1ES0A 5C08B 1N5AB 5ENWA 5I1GH 2AABL 2WBJC 5IBTH 4L4TD 2QHRH 5DJXB 1OSPL 1F2XK 5IB2A 3RVUC 5FXCH 2H2SD 2Z35A 3NCEB 6FABH 1F6AB 1BAFL 4HWNA 1UXWB 4OZIA 1DQML 1KJ2L 4OZGB 2BY2A 4JZNA 4PRID 4NQDB 4DGYL 5CGYD 3VFSA 5F1NB 3U7YH 3VH8A 4ACPA 4LU5H 4XRCB 2MQ0A 1YEGL 2W9LA 1JPGA 3W0WB 5CEXB 1BOGB 1EGJA 4HWBL 4B7IA 1QHOA 1G6RB 4YDKL 2DQUH 4JGJA 4J4PA 4ONGH 1M7XA 5JLZB 5CEYB 2NXYC 4I4WA 5I16A 4JRXE 2BHZA 2F19H 2VLKD 2F5AL 5I17B 5CWSB 4QRRA 3S6CA 3ZTNL 2HJLB 3CX5K 1C12A 4LCWB 4NWUH 4V2BA 2BFVL 3QJFB 1KIRB 2PXYD 4PJAA 7FABH 4NHUA 4NSKB 3O3BB 1DBBH 3V52H 4Q0XH 1NBZA 3KPLB 2CDEA 4NCC1 1EDQA 1SYSA 5AAMA 3ARGB 5DMYA 5DUPL 2CLRB 5JORB 1TJGH 1JGLH 4XPBH 5IHZB 3TIEB 4PJ9C 3PGFH 1CDIA 2BC4B 5ADOH 1GZPA 1MFAL 3MGOB 5FA4A 3O9WD 1KJ2B 1DBML 4H5SB 3WJJC 1JNLL 1YNTA 4OGAC 1NAMH 1S7RB 3CUPB 4GQ9H 1TPXC 5C3LD 1RK1A 2VTFA 3CFCH 3QYCA 5JIIA 4LVNC 4M4RA 1DLHB 4F2MA 3FMGL 5T3ZD 3IFOA 3CFCL 5EZOH 3U7YL 3TNNA 3SKOA 1Y6NR 3IT8D 3WDIA 4TOYL 3LY6A 3ES6B 1AJ7H 2BVQB 1CE1H 1B4RA 4ELMF 1G7IA 4GRWH 4Z7VA 2A6KA 4FTVB 3RNQA 4JHWL 2IBZX 3HE7B 2EXYC 3MREA 3IU4H 4ZUUB 3VWKB 2QQLH 2CRYA 2QADD 2DJUA 5DK2A 1MPAL 4Z78A 1UADC 2JJWA 1MVUB 2R0KH 4LCUA 3PWPB 3QNXA 4QXGL 4MNHA 3KHQA 1S9KC 2WAHA 2NMSA 3QEGH 4JKMA 2PTTA 5DUPH 4O2FB 3UP1A 2V9RA 1XGYH 2PYEE 4K7PX 1RVFH 5ADOL 4PRAA 3VFTA 5DVNA 3MC0A 1FRGL 1OD9A 2GY5A 3ULUF 1OWRM 3O81A 4KVNH 5EO0A 3GMLA 3SCMA 1S9YB 1Y6MR 2NY7H 4Q9BA 5SWZD 3ZZ1A 2NY6D 5I71C 4P2OB 5J1SC 5TPWL 1QPXA 3RPKA 3DGGA 2AXFA 4EIGB 3MUHL 4P57B 4HIEA 2DQJL 2J3SA 3OKNA 2E27L 2EKSA 4TOYH 4OIBA 1ZWIA 2R2HA 3TLRA 1KG0A 2H26A 3CX5J 2WIIB 2E7BA 5L8KB 2DIJA 4EDXA 1A3RH 4M7KH 4PUBL 3E3QC 3SDAC 2OI9C 1FHGA 5F9AC 4WV1C 5FYJD 1J7VR 1C08B 1BQLH 1KPVA 4FQ1H 1SM3L 3EO0B 4FQQB 3H9YA 1MUJA 3DXAB 1R5WA 4M93B 5C9JB 5GRJL 3D87B 3CSYA 3ZKXB 2O5YH 2FATH 4NKIL 3T0WA 4YK4C 4PTTB 3JBG7 3I2CL 1MREH 1C5DB 1QSVA 1I3VA 4NC1C 5B38A 5ID0A 4HCRA 1GGIH 4XH2A 4I0PB 4JO2H 5GS2H 4AEHL 1J0IA 2XNAA 5EUKB 4XNMB 2QV2A 5AUMB 3EYOA 5D2NA 2WINB 2F8OA 4HMCA 2ZG2A 1QFWH 1J1XL 4OFIA 1T1WB 2OLDA 3PABA 3TT3L 4WFHE 3PXHA 3MLPA 4WNQA 5D2LF 4EUPA 5IK3B 4MNGE 4G8FB 4G6FB 5C0RL 1D5ZB 1W0VB 2NY6B 3QQ3A 3FONB 3STBA 3AVEA 3NCYP 3GHBL 3TO4D 4Y5VC 4CN6A 4GG6F 5GHWL 3R06B 2LAAA 4XMKL 4M7KL 2O61B 2H8PB 3VFVA 4NQXA 1P7QA 3V4UH 1K8IB 3QPXL 1SMOA 5DJ8B 5BZWB 1OAXL 1U8IA 5AZEH 4X9BA 2FLBT 3TFKD 5C0AE 3VRIA 1LMKA 4PBVC 4GRWE 4M61B 5JOEA 3SHSA 1A21A 5A2LH 4EQ3A 4KK6D 4NHCH 5GRJH 3I6KA 1W8OA 4ZXBC 4ODHL 2VH5L 4U6HB 2YD4A 5DT1L 5EIVA 1I4FA 1HHHA 4N0RA 5DQ9B 3T2NH 4MD0A 1U8NA 3ROLA 5T3ZE 4K94H 2GITB 1JN6B 4CVXA 1QD0A 5GS1A 4BJLA 1N5YH 4HX1B 2YZ8A 5HVHC 3KPOA 2FZ3A 2AJ3A 4O51B 3LKNB 1QRNE 3SEPA 1N5YL 2IALA 5HHVL 5GS0H 3S34L 1A7OH 2CMRL 4JQXA 3TT3H 5ERWA 4OB5H 2RFXB 1KIPB 4KAQH 3ZKXC 3DECA 1VFMA 4K7FA 4GG8A 2VXTL 1GZQA 1RUPL 3CMOL 3WXVL 1GXEA 3PP4L 4G7VH 1QSZA 3DRQA 1VGKA 5MEOB 1OPGH 3T0EA 3DYMA 3NFSH 3GHBH 3P40A 4HGWA 1QVOB 5IJKA 2FBJL 1IC1A 1Q9OA 5I74B 2UYLB 3DNKA 5K33A 5I8EA 3A67H 3D48R 4I3RL 4LEXH 2Y5TA 1OP9A 2CO6B 4JN2B 2D7PA 5E7BA 4DUWA 2NNAA 3CK0H 2JCCA 2IMNA 1JPTH 1I3RA 3PV6A 2C4FU 2PNDA 4WU7A 1IGCH 2AI0H 4W6XB 4XBPB 1SMAA 4DVBB 2PUQT 2DBLH 4G8GD 4OZHE 2EDTA 3DWTA 3WL9A 4KRLB 1TETL 3AM8A 4I5BA 5CILL 2FIKB 1WZ1H 4LCIH 4FP8L 4JY4B 5KVGL 2ZUTA 2DAVA 3RKDC 4NM8L 1K3IA 1RZKL 4LRIC 3FT2B 3UPRB 5I71B 3EOAA 3MRDA 4MSWA 4NKOA 4PJXA 1WV7T 2VLMD 3PHQA 5I0ZA 1YDPA 3OAZH 3CH1B 1ERNA 4HK0A 4K2UL 1M05A 1RMFL 3LEVH 4F7EB 3FAWA 2F8XC 1A7OL 2CMRH 4DFHA 3OKOB 1HH9B 2CDGB 3C8HA 3FL7A 1A6UH 1QFWI 4WCYH 1TCRB 4KI5D 4KTDH 4LVHC 2UVEA 1OW0C 1DFBL 2VDLL 3LIZL 3MV11 1MQKH 5DRNA 5E2VL 5F96H 5GGSY 1CICD 3F12B 3FOMA 5HHQB 3VG0H 5T1MA 1I8MA 5GPRA 1CU4L 5DDHB 4M5YL 1K4CA 3RP1A 2EZ0D 4OIIH 1OT1A 4K23H 5C07A 4MB3A 1JK8B 5E8PA 5L9DH 3MV9B 1KJ3H 2YD3A 3X3GL 2X4TB 2JCCB 3L1OL 1MLCA 2XXCB 1OM3L 1U58A 1A3QA 3HR6A 2DBLL 2K7QA 5D7IF 4LSPL 3Q1SH 3QZWG 3ZDXF 2UYLA 1R3LA 4S1DD 1CFQA 1WZ1L 2ERJB 3JTSB 4H8WL 4NM8H 5IFAL 3RIFF 5D2LA 3Q0HA 1FL3B 3D0VA 2H41A 1LO3L 1TPXB 3D18A 4CADA 4QRQA 2IH1A 4GG8B 1EV2E 1U93A 1FQ9C 2H2PD 2B4CL 3VWJD 4Z7UF 3RZCC 1MJ8H 1X5HA 3VG9C 4QEGA 4YXKH 1XF2B 4YLQT 5DJ0A 4OLEA 3JXAA 1NKOA 2YK1L 2XPGB 1O5DT 4WO4B 1FYTB 2OP4H 4UQ3B 1IKFL 4HS8H 1EXUA 5HHPA 4ALAL 1WITA 4GBXD 4MA3A 1I4FB 5D1QB 1CDCA 4KZDL 4Y88A 2G75B 2ORBH 1XIWB 4KZDH 1IAIL 2P8LA 4O4YH 5CD3A 5I1CL 1KLGA 1T66D 2IADA 2R0LL 3I6LE 2MKLC 4FQ2H 2FEEI 4HEME 4R0LC 3B9VA 2IMMA 2C3HA 3PGFL 1WCQA 2VL4A 1NDGB 1PG7H 2H8PA 3VFVB 4POZD 3JSSA 3KHOA 4CMMB 5F9DC 2HRPH 3MLYH 4JFFB 1QRND 3CCHA 2FGWL 2I60L 1W0VA 5IK3A 1U8LB 4UINH 1OSPH 3DX9B 4TULH 2IPKA 2YMXL 3NGBB 2NZIA 2X4QA 4WW2C 2HJFB 4G9FD 5I8KL 3Q6FB 5HYSA 4YEEA 5EA0H 1KYOJ 4X80H 1HKFA 3EYOB 3O11B 5AUMA 1BBJA 3AS2A 4ELKB 5FFLA 4P48A 4KDTC 3TM6A 4TYUA 4HULB 2JJSA 4JRXD 5DMJB 2DQUL 1BQHA 1XF4A 1KCUH 4R7DA 3ZDZE 1XZ0A 3CZFA 4WO4D 1Q38A 5JPMA 5EZLA 5I8OH 4I13B 5CLWA 1X7QB 1FNGA 5F7WC 3TO4B 1GPOL 3DXAA 4LK4A 1CS6A 4R2GD 2PW1A 1BHGA 3SJVA 2HLFD 4S2SA 4FZ8H 1FVEA 3DTXA 4YHIB 4LOUD 5EOQL 3OG6B 3LRSA 1NGXA 3LH2L 4JKLA 4P2QD 4K3EL 3IDXH 3JVGA 4V1DA 4KZEL 4F58L 3WFBH 5C7XH 1P2CA 2JCCF 5I1LB 2UWEB 5MI0C 1DQQA 4MWFB 3QT2A 2CRZA 3QDJA 1D9KD 4HBQA 4R8WL 5EUOF 3VI3E 4XZUB 3F62A 4OZFH 3G5YB 4CJ1A 2ITCA 1FVCA 1R24B 2WP3O 4P5MA 4OGYH 2MHAA 4P46C 2CIIB 4PGBA 5JOFA 1F02I 1PLGH 1AO7D 3DXAD 1QBAA 2M1KA 4WTZG 3BD5A 4ZO8A 5SWSE 3WS3A 1CDGA 4LLVB 2Z8SA 3GGWA 2DQCH 1IILE 4JQVC 1TVHA 4XWOC 5D72H 2VITA 5DD3L 1U42A 4R96B 2OR9H 4MA1C 3RWDA 5BZDA 2PW2B 3H7BA 4NT6B 3HI1B 3VFUA 5GSVB 4M43L 3GSOA 3BP4A 5CP3A 4IMKA 1KUMA 2EXWD 4RMTA 5DK2B 5T1KD 4Q74A 3FZUC 3O9WB 4P2RD 3B4NA 5I19H 1P9MC 1XFPA 1SJEB 4BSVB 2YD6A 3B2VL 4XP4H 4PJDE 2GFBA 3ECBB 2Y4SA 3QO0B 1UXSB 3TCXA 1G7IB 4M00A 4UZGA 5JMRA 3RDTB 2BVQA 3ES6A 3HC0A 4HT1H 3T0EC 4JFDD 1UYWH 2UZIL 3OHXB 4KDVA 4NRYB 2GTZA 4YIQB 4P23A 4BSJA 4HCRH 2WANA 1XGPB 2F53D 3BUTA 2GTZB 5F88B 3TNNB 5FDWB 5D96C 1T03L 3RDTA 3TVMC 3BWAB 3WUZA 12E8H 8FABA 2R23B 3ARYA 5C09E 2X4NA 3PE9A 4E5XB 1SJEA 5E6ZA 12E8L 1YECH 4Y4FD 2YPKB 2QJDA 1FFNA 1A5FL 1S7RA 1EHXA 4RISL 1AH1A 5DVOA 3MXVH 4JHAH 5FCSH 2QADB 1C7TA 3GSVA 1OTUC 3GSOB 5DURD 1G7PB 4WFFD 2C4FT 1KGCE 1ZA6A 2PW2A 1R3IL 4NC0B 4NT6A 5EZIL 5IHZA 3ZKMD 3O6LL 1R3KA 1R5IB 3GIVB 1QFUH 4I77H 1TVHB 5D8JH 3UTPD 5HSFA 2CDEB 1YYLH 1G0YR 2Z9TA 3V6FB 4NHUB 3W0WE 4PJAB 1KV3A 1KIRA 3L5XL 4RMRA 1JF6A 1C12B 4LCWA 4JM2C 4P5MB 4F7MB 1H3WM 3T65B 4QRRB 3HNVH 2ITCB 1ORQA 1RURH 3FO0L 1X6LA 4JO1H 4WUKH 3GSWA 3MV9D 5IVZB 5IGXL 1NC2A 4K94L 1HEZA 3A6CH 5D7JA 2AK4E 1G6RA 5EFIB 2OL3A 1XH3A 3W0WA 3AM8C 2D03L 1FBIL 2A6IA 5HDQH 3BPOB 4X7EC 5F1NA 3MRPB 3V5HB 3T08A 1NGXB 3SKJL 2J6EL 4KAQL 5TDNA 3VG9B 1J1XH 3B9KC 1FH5L 4OZGA 1BJ1J 5TQ0H 3UZVB 1HE7A 4OLWL 2YD1A 4DKDC 4WHCA 4EZMA 1IFHL 5D6DC 4FABL 4WRLA 2NY5L 3PP3H 1K5NB 4X7DC 4HIIA 4F80A 2ZSVB 4RIRA 2EXYD 2MPAL 3MXVL 4JHAL 1SBSL 5CJXA 4ODUB 1MFNA 4RAUA 4YDLC 2R1YB 1CZ8H 2AJVH 1XZ0B 3BI9X 1HCVA 5E6IA 1MJ7L 3ARTA 3V4UL 3HZMB 5KSAC 3O2DA 1XGUA 1WLHA 1H3PH 5IW6B 4YHZL 4KXZH 1RZKC 3HUJA 1H3PL 4GXVL 1JNHB 4YUEL 3DYOA 4HH8A 3RVXC 1XGUB 1JTPA 2X4QB 3WEXA 1U8PA 2P44B 1CICB 1V7MH 2ZCLH 1U8LA 3QAZC 2YD2A 3LMJL 5KANI 2MCG1 5GGTL 2W0PA 4ODUA 4A6YL 4R9HA 4HIIB 2HJKA 2GK0A 5EO9A 3N1PC 1NDGA 2DL2A 2C9AA 2JCCE 3QXVA 3I3EA 4L3AA 2BVOA 3TZVA 4NN7C 1JWMA 2VN7A 1MQKL 3DGCR 5ANMA 2XACC 2NY5H 2AV1B 1IC7L 2GYSA 4BZ2H 8CGTA 5ABDE 4NYLA 3SO3B 3NFSL 4LDOB 4P2OD 3RUGA 3STLA 1QSEE 2ZJSH 2E7MA 5TDOA 1DANU 2OL3B 5J4MA