3BJ91

Crystal structure of the surrogate light chain variable domain vprebj
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
b'VLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSTHVFGSGTQLTVLSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin iota chain, Immunoglobulin lambda-like polype
publication title Engineering and characterization of a single chain surrogate light chain variable domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bj9100
3PDGA 4ZQKB 3SBWC 3MNZB 4ONHA 3TF7C 4RA0C 4WUUD 4HLZG 1OM3L 2AEQL 1JVKA 5SX5H 3LN4A 4JHWH 4HS6B 1NKRA 5ID0B 1MPAH 4PG2C 2A6KA 1RJYB 2OJEB 4Y4HB 4XXCA 2R0KH 3DTXB 4JG0L 1E6JH 3EJJX 1AD0A 5LG1A 3IKCA 4TSBH 3QULA 3RA7L 1BGXL 4DZ8A 1IQDA 5JW4R 4CMMA 4MA7L 4BUGA 4ZUUA 4RRPG 3KYOB 4IRJC 4QWWD 4GMTH 3ETBF 5C08B 4A2LA 2Y25A 3UPRB 1Y0LB 5D1QA 1KPUB 4YXKH 1I7ZA 4GW4A 3TFKC 2X2YA 2YSSB 3SOBL 3BEVA 4IOIB 3F58L 3VH8B 4BKLA 3OTTA 5C3LD 5JOPE 1AGDA 4WO4B 2WINA 3GHBL 5KBNC 1TZIA 4H1LH 2NY3C 1M7XA 1YNTA 2R4RL 5HY9B 3M8OL 2N4IA 2EDRA 2CLVB 1YJDL 4Z5RA 1JGDA 2NY6D 4BZ1L 4JKMA 1MRCH 2E9JA 2Q8BL 3BKCH 1H3WM 1WEJH 3DO3A 3TWCH 4RWYH 1LWRA 3QPXL 3H7BA 3IETA 4JN1L 3MZTA 5D7LA 4KHXH 4ZFFB 4JM2F 3BW9A 1RZGB 4M8VA 5D2NA 1GPOH 3K2UH 1UB5B 1V3JA 2EIBA 4PJ7B 4MCZB 1CK0H 3TESA 3EOTL 4OZFG 3P11L 4FABH 3KLHC 4KAQL 4ZXBB 3U82B 4MXQD 1MIEH 1AGEA 3QUZD 1T7WA 5EUOA 2PYEB 1UM4H 5E6IB 1S9VA 2HJKB 1BIHA 4NZRL 1M05B 1I8MA 4G3YL 4RZCA 2LU7A 1FL6A 3HFML 4MNHB 2D9CA 3UPAA 4XVUC 2EKJA 2WIMA 2FIKB 2ZUXA 4I0PA 2PF6A 4U6TA 1U6AL 1RZKL 3QUXD 5CP7A 5CP3A 2KBGA 4ZSOA 1H0DB 1V05A 5DRXA 5SX4H 4LHJB 5DMKA 3RZCD 2NXZB 3RGVA 4M48H 1X5YA 3IDMB 4QRPA 4WV1B 1MCDA 3LEXA 5DRZB 2HLAA 4YHNB 3H9SB 1X3DA 5E7FA 3QDJB 1RMFL 4JPVL 5KSAC 3QO1A 4N8PA 4HUUB 3QJHB 2ICEA 3DSFH 3FB8B 2YBRB 3TV3H 3G04A 3OHXB 5ACLA 4YHYB 3ULVC 4WFFD 2OZ4A 5IROC 4HDIA 5F9JB 1NLDH 4LLMA 2FDBP 3HS0B 3KPQB 4PTTA 2D2OA 4X0KA 4JY6A 1OP5H 1T3FB 5KANI 4MDIA 1DBAH 4IRZH 3VXMB 4RX4A 2F74B 3KVQA 4QHMB 5I15H 3KPMA 2VR5A 4O58L 4O9HL 3GM0A 5TGBB 1NGQH 3KXFB 4GS7C 1VACB 2VB5A 3L9RA 3QDMA 4LEOB 4MAYB 5D8JH 4RIRA 5FYJH 3IDGB 4AEFA 5F9DC 5EFIA 5J9PA 2X4NA 2GFBB 1BBDL 4IDJL 2VXVL 5ICZA 3GHEH 1AKJA 4EOWL 2B0SH 4DGVH 3STZB 2X89D 4HZAA 1A2YB 4ZS6D 4PJBB 4F2MA 4PJIF 1ZHBB 2VERN 4NFDA 3TH4T 5LAXB 1C16B 4HCRL 5TPWL 2Z31D 5IMLB 1TXKA 4KJWC 4DFHA 3BP6A 1A3LL 5I30H 4CDGC 5H35A 2OSLB 5IW6A 1NL0H 4BQBA 5CEZH 4TSAL 2CJUL 4QOKA 4NFBA 1MLBA 4FQIH 3LPWA 2BFVH 1IAKB 5FYLH 4TULH 4OCWH 1U8PB 3QUMA 3BMVA 1X7QA 4HLJA 4S1SH 2IBZY 4YAQA 3O3EA 4XVJL 1JWMB 1H3VA 3VJ6B 4WUUB 5ALBL 5HI4C 3RWIA 3VI4F 1AGFB 5JDJA 2CDGA 2CLZB 2VJXA 4JFYA 5JHDA 3MODH 3BVNB 2DICA 4NN6C 4ZO9A 3CFCH 4NWTH 2AEPH 3QNXB 2O26U 1N2RB 4S1DC 5F72S 3Q6GL 4ENED 2BHUA 1N3NB 5FK9A 4JCMA 3MRKA 3VXRD 4NZUL 4FXKA 1SQ2N 1MI5A 4P46C 4G8EA 3HUJF 2ICES 3FL7A 3O2DL 5A2JH 3S35L 1S7VB 3VFPA 3ARPA 4PJ5E 5GRZA 3STLA 4Y0GA 5GGVY 3U9PL 3QEGL 2VXTH 4K3DH 5MEPA 2XIDA 1S7XB 3LV3B 3G6JE 3LOWA 2Z92B 3MRLB 5JXAL 3OR7B 3E3QE 3KNBB 4EBQL 4F58L 4LBEA 5KANG 2BVOA 3G9VA 4OD2A 1A14L 1FV1A 4WY7L 1HDMA 3FT2A 3GRWA 5IJVA 2NY6B 2K7QA 4J3WA 2Y36H 4KMTL 5E94A 3G6DH 1EZVY 2BNQA 5MI0B 1NGWA 5GGSA 3VDCA 3S97C 4LVOB 3WIIH 3SPVA 1RHHA 4ZDHB 3S4SA 5DTFB 4HKJA 4U3HA 2BY2A 1A9BB 1PX4A 5DC4B 2Y5EA 3MOAL 4P4RA 3ZDXE 5IB3B 1JYXA 2R29H 3WUZA 4ZOCA 3QXUA 1Q72L 2E8YA 4CNIB 5BXFA 1TQCC 3HZYA 4UDTB 4NO0A 4GQPH 4XHJD 1JZ3A 3VI3F 3IDXL 1JZ8A 4JDVA 4JRXD 1HZHH 1E6OL 3L5XH 2E27L 5FM4A 4M3JA 4M5ZL 3QUZB 1KIPB 2ITDB 3PIQA 4PRDB 3L3HA 3ZYOA 3WKNA 4RMTA 3E6FA 4KKBC 3OAZH 1A7RL 1JCKA 5IVNA 1DN2A 5DHVH 1ZA6A 5BVJB 2BNUB 1EXUB 1FBIL 3WDJA 3WNNA 1QR1A 1RK1B 1CIDA 3QUXB 4P9MH 4PGCB 5FECA 4F7MB 3TCLA 1G6RH 3VG0L 3I02B 1L6ZA 4DKEH 1KLFA 1CXKA 3RZCB 4I2XE 2AXGB 2DQGL 3QAZB 1T4KB 2ADJA 4FQQA 5KSBB 1AHWB 4X6FB 5E08L 3CLEL 3QCTH 5C0CD 2D0GA 1EEQA 1I7RB 3RY6C 3BKJL 1CXEA 3E6HA 1NFDE 1AJ7L 4O51A 4R97B 1U58A 4OIIH 1XT5A 4OLVL 5GRWA 3HNSL 5E1HB 4ZXBC 4XC3H 4MJ5A 5I1KH 3W39A 1LO5A 3I9GL 4X5XB 1YPZF 1DL7L 1CL7H 3QHTC 4NQDA 4P49A 4PBXA 4TNVF 5CUSL 3CVHH 5HHQB 1Q9WA 3TPUB 4PD4K 5IB4B 4ALAL 4LSSH 5FYKL 4K8RH 1TTUA 5I2IA 4GKNB 4JLRB 3ZL4L 2Q7YA 3FB5B 5FV1L 1A3RL 2IPUG 5CD5C 3RWGB 5E2VL 1KIUA 1I7UA 1B4JH 2EXYC 4AEHL 2VZ3A 3ARBD 4F8QA 1LVEA 1A4KA 4LLUB 1B6UA 3OG4B 1AIFB 1FAIH 1JPSH 1KB9K 3LVEA 3MGOB 1A0QH 5JNYB 2UZYB 4JHWL 3X17A 1WUNT 4WEMB 1MPAL 3JBG7 3WHE0 4PJEE 2BOBB 4YXLH 2R0KL 3HNTH 4OIAA 1G7PA 1MY5A 5BRZA 3B6SB 2B7DT 1JNHB 2Z31B 4TNVK 5J1AB 3O0RL 4R7NB 5HVHB 4U1SA 5IVZB 3RI5K 5J6GB 5E24E 4GMTL 3F12A 1X5FA 4NQCD 2I9LA 4X9BA 1G7HB 2CIKB 1A1MA 2H45A 5EWIH 2CR3A 4YK4B 5ISZD 3MRHB 4EIZC 3QDAA 1HYSD 4UQ2B 3PQYD 4X4ME 2SEBB 2VH5L 5ESQA 3G08B 3QYCA 2XZZA 2X9WA 3LY6A 1VSCA 5FA3B 2EH8H 4K7FA 3W9DA 1ZHNB 1XF3A 4CADA 3CFDB 2B4CL 3NACH 3BAEH 4Q9QH 3SCMC 4KGLA 4CUCA 2VITA 3HMWH 4Y1AD 3L3GA 3O2WH 5FUZH 2J8HA 1HXYA 3IFOA 2DM4A 2ZNWA 5L2JA 2VMFA 1KNOA 3QQ3A 3EYFB 5C0BA 3U7YH 4HH9B 4HXAL 3SGJA 1WEJL 4RWYL 3VXRB 3LD8B 2OXHA 3QNYB 4GMSH 4OZIF 4P5MB 1X5JA 5EO9A 5HVWA 3MRCA 4KHXL 2ADFH 2VO5A 3RAJH 4IIQC 2AS5M 1NLBH 4KQ3L 4PYHA 1W8OA 1I9RH 1GPOL 3K2UL 3CDCA 5IJKA 1NCBL 2YA0A 4KXZH 5C07A 1CK0L 1UXWA 1FNGA 2KPNA 5C0IB 5JORA 2X1OA 3NMEA 2V2WA 4WFEE 4FABL 2EDJA 4CU8A 4M7JH 1MIEL 4HIHB 3QFJE 4WW2B 1UM4L 1ZGLA 4MJID 1TVHB 4G6MH 3H3PH 5I8OH 5DD6A 1F11B 1CVRA 2FR4B 4V1DD 1EUUA 5C8JB 1D9KD 3IDUA 1DLHA 4O2EB 1OGTA 3B9DA 1PYWA 5ESAA 4HWNA 3KYMA 3A67H 3KPPB 3SO3C 1KBGH 1QVOB 2HAZA 4J3SA 4XGZA 4DUVA 3KPOB 2FO4B 4O2CA 4P57B 3DUSB 3NFPA 1KPVB 2OK0L 5KS9F 4JRXB 1SYSA 2FJGB 4Y4FC 3DO7A 3C60D 4QO1A 4XPFH 1P84K 3TV3L 3HZMA 4MWFA 1CTNA 4I4WA 2A83A 5LCVL 1LO4H 5D5MF 2WUCL 1TZHB 3TBYB 5BV7H 1HKFA 2I07A 3MLPA 1UWXH 3MJ6A 4NZJA 5H2BA 2X1PA 1T0NB 3MLXH 1DBAL 5BJTA 5DD0H 2CMRH 3SJVE 3ULUH 1GGCH 1XGTA 5ALCL 3GIVB 5I15L 5IESH 1ZVSB 2X4OB 2ZNXA 1QTYT 2Y23A 2YPKB 3DVNA 1NGQL 3MV9D 3PG2A 5IOPA 5CSZA 4TOYH 4Q9CA 5MI0C 3R1GH 3RKPA 1S7TB 2V2TA 1J8HA 1ZOXA 5FCSH 5KSUA 3P77B 2EE9A 3UZEA 5E8DL 4PB0H 3HE7C 5C0CB 5MP6H 3B2UC 4X80L 4ZUVB 1ZWIB 2QHLA 1BD2E 3GHEL 4G8GD 5D4QA 1YN7B 3SKOB 5TDNA 2IALB 4K3JH 5I73B 4JKPH 4RAHA 4IEFB 4GG6F 4OF0A 1DQQA 1T5WB 2YHGA 1UVQA 4L3CB 1MCNA 3T3MF 3TP4A 3NVQA 1XR9B 4G7YH 1G7IA 4ZFGH 4HMCA 2GTWB 5HGDA 2JCCB 1UADC 2BNRE 3U4BH 1LE5A 2VABB 2UUDK 2F8OA 4XPAL 1FFNA 4FQIL 1FLRH 2IF7A 4ZAKC 2DJUA 5B38B 3ARBB 4XNUH 4Q0XH 1DBBH 1KLUB 4LCYA 4S1SL 1I8LA 1ITBB 2ADIB 3G5YA 2B4CC 4X9FA 2XQBH 2BVEA 5JW4Q 4RA3A 4FNLH 5GRVL 1CD9B 4APQD 2VQ1A 3QIWC 3MODL 2D7MA 3PDOA 5DWUH 2VZSA 2OL3H 1BFVH 2AEPL 5EBWA 2IBBA 3S5LG 2NX5D 1KT2B 2BSRB 3L95A 4DUWA 4QYOB 5JQ6L 2E9WA 3WS6C 1MFEH 2IQAB 2A74A 5GZND 3ARUA 1KXVC 1SJVA 3C9NB 4LIQE 4IS6A 4TUOB 4N0YL 4P2QE 3GSVA 4NUJA 2VLKA 1FNEA 3KLDA 4NNPH 4OUUB 4I9WD 1AQKH 5ISZB 2BMKB 1HHIB 3VMOA 3PQYB 3X11A 2HRLA 1EO5A 4WW1B 5C9JB 5K9KA 1PGRB 2VXTL 5IW3A 3ULVF 5EBMB 1EA9C 2IADA 4WWKD 2GAZB 3FFCA 4HUVB 4UINH 2LFGA 2XNAB 4X6DA 3PGDB 4NCC1 3OKDB 2OR8A 3UTZA 4H0HB 4LLDA 1A1OA 4Y1AB 1BLNB 4L4TD 4TVPL 1NBVH 3D39E 2Y36L 2J2ZA 2RCSL 3G6DL 2FIRT 3IJYA 1TVBB 4M7KL 1JPFB 4U1MA 4G6AD 3B83A 1YQVH 4KK8D 4PJ9D 1JGLH 1FO0A 4H8WL 4X6BB 2R29L 2EH7H 2CXKA 1YUHB 2VKXA 3V5KB 2OLDA 3BQUA 4MDJA 5K33A 2FLBT 4YK4C 5DDHA 3SDXB 1HZHL 3L5XL 2HKHH 3P9LB 3MRMB 2JJTA 2YPVH 32C2B 4LMQI 3UYRH 3VRLF 1I9IH 4MJIB 3T09A 5JHLL 5FM8A 1RIVH 2FO1A 2ZUVA 3ECBB 4HZLB 4PRPE 4M7LH 4ZPTA 4V1DB 2BSED 4HWZB 4FFWD 2JB5H 4CJ0A 4M1DH 4NO2B 1D9KB 4I18A 2NY7H 5I8CA 2PKDA 1CD8A 1FVDA 3O41A 4P9ML 4XBEL 5J0BA 2MQ3A 4MD5A 4DKEL 4AMKH 1WWCA 5I75C 4OM1H 1QFUH 1LP9E 3OKEA 3LD8C 5GRUL 1NBYB 1UEMA 4YR6B 4ISVB 3DXAE 1FL5B 2P24B 1T7VA 1U91B 1VFOA 3BZEB 4D94A 3HPLA 3C5ZA 3C60B 4H20L 2KKQA 3VD5A 2H9GA 3MLSL 4OIIL 3QIUA 4WUKH 1KUMA 1QACA 3ABZA 3G5ZA 3RWEA 4LSTH 5I1KL 3JWDC 3B9KD 3QH3B 4WW2C 1FJ1B 2NY5L 1Y18B 1CL7L 5DJCB 3CVHL 5DUPH 3LEVH 1U8NB 3NIGE 4K8RL 1J10A 3MV9B 1HE7A 2PR4H 3VFMA 1RUQL 4D0BB 2R0LH 2IQ9L 4XH2A 1RUPH 2G9HA 3BH8A 3UTSE 1UCBH 4MNGB 1IGCL 1Q9OB 5EOCH 1KN2L 4X8JB 3HC3H 2XG5A 1YNLH 4P3CL 5CLTA 4JFDE 3ES6A 1FAIL 1FVCA 1JPSL 3LS4H 4D8PA 4EUPB 1GGBH 4PLKD 4G8GB 5C09A 4KRPC 1INDL 1T89C 4U1LA 2DM7A 3BIKA 3ORJA 2CQVA 4LPCA 4S2SB 1IGYB 4N68A 1X5KA 4JQVA 1CLZH 4NBXB 4YXLL 1UFUA 4KQ4H 1DQDH 2AV7B 1GRWA 3UTTD 2UY7A 5CGMA 2Z4QB 3C09B 4PRHD 4NKIH 3GMQB 5IFHH 4YDVA 4G5ZH 4L9DA 4DGYL 2GK0A 2VLJB 2DIJA 5EWIL 4OZHE 3UAJC 3TJEH 2IFFL 2DQHH 1P4IH 3ARGD 4Y88A 1ADQH 1OGAA 1KV3A 3KYKH 5LKNA 3PWLB 4RFEA 1NGYB 4HG4K 5FEBA 2EH8L 3BZ4A 2PTTB 4HWBH 4RQQB 1PFCA 4APQB 1EBPA 2VUYA 3GFUA 1AGCB 4UQ3A 2C1PB 5MERB 3MLZH 4TRPL 2GTZB 2XZAH 4G9FD 5FUZL 4HAGA 2NX5B 3P4MB 4POUB 4WI4A 4NSKB 4ORZC 3EOAA 4WJ5B 5I8KH 1RULH 5DQ9B 3FN0H 4GMSL 5K59F 4H8WC 5SWSA 1DE4A 1JPST 1QYGH 2ADFL 2D9QB 3MGTA 2CSPA 1NLBL 3BEWB 3GSQB 3VFRA 4M03A 4R4FH 1BZ7B 1I9RL 4G6JL 3M1BA 4NT6A 1JNNH 3QUKA 3FT3A 1S7UA 4RGOH 3NPZB 4WWKB 3ARBC 1CE1L 4M7JL 2K7PA 2AJVL 3RDTC 1G9NC 2OR9H 5EC1B 1KTDA 3KWWB 5E8EA 3H3PL 5I8OL 3SE9L 2EYSA 1T04A 4L4TB 5EO1A 4NKMB 5JW4N 5MHSE 4YGVB 5IEHB 4DWHA 3L3KB 4MJ6A 1KTLA 1MJUH 2AGJH 5CZVH 5IHLB 5TDOA 1BZ9A 2FJFB 5C0RH 3A67L 3WFHB 4PJ9B 4P4KA 1OAXL 3SKMA 5E00B 1WWAX 1JL8A 1S8DB 1YMHB 4BFGA 3EYOA 4K9EL 4DVBB 2V9TA 5L9DH 4MB4A 4PLJC 1C1EH 4HS3A 1BQHA 1J05B 2AJSH 4WI9A 1F45A 5HGHA 3WE6A 1EV2E 5KOVC 1VPOH 4U6HB 2UZIL 3DVFA 3TNMB 1EFQA 1EAPA 4XPFL 4I3GA 1HQ4A 3IFLH 2GEEA 1S5HA 3IS0X 3Q5YA 1HIML 1FFOB 2IBGA 4BH7B 4XCCH 1QA9B 4JRYD 4PGDA 5BV7L 3V6OA 1FYTA 2LV4A 2XFXB 5E9DA 1XGQB 4FHBD 4KTDL 4OGYH 3QI9C 1FNLA 1C7TA 4NPYA 5DURD 3MLXL 3OKLB 3DETC 5DD0L 3ILPA 3ZE2F 2CMRL 3NCFB 4HGWB 2DQFA 1IAIM 4TOYL 1AI1H 3R1GL 3EFFB 3I85A 4HXBL 4DN4H 3D6GA 5FO9B 6FABL 1MLCB 5D6CA 3TN0D 1DJSA 3F6IA 5D7LD 1IMHC 4FQPA 2DQDH 4JFFE 3QHFL 4JJ5B 4OJFH 4MQXC 5E4IA 4DCQB 3WV0A 4HMEA 4JZNB 4F9PA 3G5XB 2XKNA 4JO3L 3ROOB 3LKNB 4K3HA 1EHLH 2Q6WA 1DQJA 1QBAA 4K3JL 4L8BA 3KPRE 4JKPL 3B9KB 3L3JA 2AJZB 3LN5B 4Z7UF 4PJAF 3SGEH 3FO0H 1SM3H 4G7YL 4NO3B 5F71A 3AXLB 4ZFGL 1MFBL 2X4UB 3VXQA 5BQ7B 1D5XA 3U4BL 3IXAA 4PS4H 1PG7L 3P9MB 5ICYA 3BUTA 3BRFA 4JDZB 1XCQA 4FQHA 3BIAX 3NABH 1FLRL 2DQUH 3VFVA 5DMGD 1HOCA 1IEAB 1RUAL 4XNUL 4Q0XL 2OP4H 4WDIB 4X99B 1I9EA 2GJ6A 2XQBL 3MXVH 5AD0B 3QIBA 1T80A 4X4YB 1X4XA 3V8CA 1R3LB 4KK5D 3C60C 2IPUK 5DWUL 5FYJE 1BFVL 1N59A 3D85A 3QEHA 4WU7A 3T0WA 4JZJB 3RKDD 1YYLH 1FZOB 5IFJB 3D2UA 3MJ9H 4JFHE 1VADB 2FX9H 3FOLB 3UTTB 3HC4L 4NFCA 2FECI 5I1DB 5D96B 1MFEL 3B5TA 4U1IB 3WJLC 2XPGB 3DIFB 1S7QB 2IC2A 1OW0A 1I1FA 1HINL 4XWGH 4HC1H 1KEGL 2X4QB 4RX4D 4MCYB 4H88L 4NNPL 5IQ7L 5FFLA 5BOPA 2R23B 2V6HA 1VFAA 5FDYA 5KG9A 1QQDA 3ARGB 2EO9A 4NJ9H 4OFYA 1EGJA 1GIGH 3HI6H 3HUJE 4ZOBA 1A6UH 4JFXA 4YHLL 4Y7MA 2HP4A 1KB5H 4UINL 5CEZE 3GSWA 4JJHA 4X6CF 3CAFA 3F7YA 1JPGB 5FYLE 3U48A 4QLRA 5D2LB 4D9QE 5INCA 4G9FB 1N8ZA 5I8EB 1NBVL 1TJIH 4IBLT 4RFOH 5DQJA 3LQZB 3CZFB 1S9YB 1NCAH 3GSOA 1ZE3C 2OXGA 3MA9H 4P59H 5HHPB 1I1CA 5KVFH 5CJOL 3L7EB 4K9EC 4LCWE 5AG9A 2C7UB 5IT2H 1S7WB 3WS3A 3VFTA 2YKLL 4KDWA 2V17L 3V9FA 1KJ2B 1ZLVH 1DSFH 4U7MA 3O3BA 3BPLB 2DD8H 5CMAA 1I1AC 5EBGA 3UYRL 3WO3B 1F6AB 4L4VE 3PABA 1I9IL 4ETQA 1GGYA 4YDKL 1WK0A 15C8L 5ANMA 3DV4B 1J88A 1JI2A 2QKIA 4RCAA 4LGRB 4D0DA 5I6XC 1UZ8A 3LN4B 3P0VH 1BAFH 3CXHK 4M7LL 4MA3A 3Q6FB 4M1DL 2NY7L 2A1WH 2F8XC 4HBQA 1KCLA 2HN7A 4NUGH 3TPKA 3QULB 1IQDB 1QFUL 1WBYA 4G8FA 1FZKA 5GZNC 5FUCE 3EJZC 4Y8AA 2DI8A 4X9GA 4QCIA 2EC9U 3T4YB 5JO5A 2PN5A 1N0LA 3VGGA 2A0LD 2FCBA 4N0RA 1I7ZB 4GW4B 2HJLB 5T33H 3PWUA 5TQ2H 4HKZB 5DUBA 2ZCLH 5IEKA 4FOMA 2R0WL 3H9ZA 4WWKC 5DRNA 4JRYB 1ZSDB 4LSTL 4PV8A 1TZIB 2X41A 1MH5A 1FPTH 1QSFA 2J5LB 4JO4L 5DURB 3P30H 3V6BR 3MRBB 4XHQA 3B3IA 1S7SA 2Q3ZA 4GOSA 4AT6A 1JGDB 4XVTH 5FGCB 1OTTD 4UU9B 3S3JA 5ABDE 1J1XH 5EU5A 4Y4KC 3ME0A 5F7FA 1YPZE 3JV4B 4MXVE 1RUPL 1MHHA 5EU6E 2E9IA 1HK6A 3TN0B 5D7LB 1CDUA 3BW9B 2ITCA 3PDDA 1G6VK 5D2NB 3OV6A 4M7LT 3NBNA 4M5YL 3LS4L 3K1KC 5T1KD 4D0CA 4LCIH 2X42A 1GGBL 2H8PA 3ALXA 3HRZA 1A6ZA 2F19L 1NCCH 2JK5A 4TPRH 4TTDC 2W92A 4Q9BA 1B0WA 3OB0H 4MZ2A 5TH2B 4S1QL 4DN3H 1P69B 1S9VB 4KQ4L 2G5BA 3ZTJH 4IJ3B 1FL6B 1JV5B 3EYVA 1SJHB 3RTQC 3CSYA 4NKIL 1AXSA 5TJWK 5IFHL 4G5ZL 3VRJA 2D4FA 1KIQB 3EDJA 4UNTA 2BVPB 4XNMB 4MVBD 4BELD 1U8OA 2Y7QA 1C8PA 4PGEA 2O5XL 5DRXB 3K3QA 1RK0A 5I1AA 4PJ5A 4EN3C 2DQHL 1Z2KA 1P4IL 4WHYG 1ONQA 3EO1B 1ADQL 4GRLC 3KYKL 1OTSD 1S78D 2BRQA 4PRNA 1F6FB 1JRHI 3G6JA 4ODTH 2VIRB 3CH1A 2FB4L 4HJ0D 1IILE 3LEXB 1EEYA 3WEXB 4HWBL 1JF1A 2COQA 3P0GB 2MTPA 4U6XB 4G42A 3MLZL 3MREB 5CINH 2R1YB 1PD6A 4MQTB 2XZAL 3BIBX 2HJFA 4UNVA 2I60H 2X44D 2H2PC 2VLME 3QEQD 4NKDA 4QRTB 5I8KL 1MCIA 1VB9A 2AJUH 3FN0L 7FABH 4JY6B 5EIQA 1AC6A 1A9EA 1QYGL 1ZXQA 1LEGA 5I1GH 1TETL 3DURA 3BGFC 3C6LA 1REIA 3O3DB 4R4FL 4YZFF 1ZMYA 1U8JA 1IC5H 4OZGB 4MX7B 1MCOL 1JNNL 5F7UA 3NH7H 2DN7A 4R7DA 4FQXC 3GMPB 5E1AA 3O11A 1LO2L 4RGOL 2BXZA 3ZKMD 2Z8RA 5KVEH 5HI5C 4DKDC 4X7EC 2CRIA 3QG6B 3P4OA 4MMZC 5EFIB 4WI3A 3RBSA 1N64H 1U36A 1RFDL 4PLKC 1IGML 5J11B 4NQVB 2Y07L 2Z8VC 4NJAH 5AZ2L 1NAMA 4LHUG 4R0LC 1MJUL 1SJEA 2AGJL 1PX3A 4ZODA 4Y89A 4LF3A 3HAEA 5D96C 2R56H 5J56B 4HJJH 4NOBA 1OSPH 5KN5B 5E8OB 3QFJD 1KG0B 5H35B 1RHFA 2E7LA 3A6BL 4LK4A 4Y16A 3GMMB 4OF5A 4YIQA 1WGOA 1VPOL 2PUQT 3TYGH 4GG6A 1NFDA 1X7QB 3HE6A 3IFLL 4XTRD 3D0VB 3KGRA 5GS0D 1SBSH 1OOAA 1UJ3A 5KS9E 1E4KC 3BPCB 4Z78A 3U46A 1FZJB 4OGYL 5HYJD 4U1GB 1CFVH 4NYLA 3PV6B 5HHOE 4OGXH 5JHDB 3HCVB 3PXHA 1MHCA 1PY9A 3I3BA 3FQTB 3QXAB 5D5ME 3O8XD 3FONA 4IRSA 4PJXB 4ZD3L 4W81A 4YDIH 5F7NC 1AI1L 3Q2CA 2OZ4L 1D5ZA 1QFWH 4DN4L 2RFXA 1CR9H 3MRKB 5IBUB 4PY8J 4FXKB 2Q86B 4WI7A 1SMAA 4GG8A 2DQDL 4B0MM 5GRVK 1MELA 2VLLB 5HPOA 4OJFL 3K81A 3LKSB 3ZHKA 3VFPB 3O6KH 3STLB 5TFSH 5AYUL 3SJVD 2MWCA 3ARFA 5JDSB 1YEKH 4JN2B 3S36H 5SWZE 4GRWB 1EHLL 1LEIB 4KVNH 4ODUB 1YEJH 4PJEA 3GZKA 1S9WB 4Y5VC 3D3VE 2UWEE 2ARJB 3REWA 4LBEB 1OP9A 3FO0L 1XF5B 12E8H 1SM3L 3IU3A 1QLRA 4PIRF 3RZWA 4U6YA 3HLAA 1IEBA 5E94B 2Z8WC 5HTSA 4PS4L 2FX7H 3OKOA 3GSNA 1NGWB 3FAXA 4XXCC 5GGSB 4PJDE 5C71A 4LPWA 3UTQA 1BD2D 2DQUL 2F53E 4N0UA 4OCNC 4HKJB 3MJ7A 1HI6B 2CDEB 3S8WA 4J8RA 2OP4L 3ULUE 5JXEA 4X4MA 4UILL 2EKSA 5T1KB 2H3NA 4WTWA 5JPMA 3LRHA 3MXVL 3MLWH 4NO0B 5D1QC 3EUUA 4QRUA 3ZDYE 1N6VA 3O9WA 3O3AB 4LLVB 4FS0A 1A6TB 5B3NA 1QFOA 1MJJB 4HWUA 1H9VA 3QUML 4JHZA 2ESVD 4HIJA 2UYLA 1WBXA 3RVVD 4KV5F 3MJ9L 2CK2A 2WBJD 43C9A 2R8SL 2BVYA 2DLEA 2BP3A 4PD4J 4ELMF 2ARJQ 5CBAB 1YECH 4JQIH 5DJYA 5INDB 5FF6B 4XWGL 1IJ9A 5IV2A 3Q1SH 1CIUA 4LLWA 2F58H 4TNWF 2P44B 3TLRA 3NAAH 3O6FD 4M6OH 3WSQH 3PHQA 1CGTA 3VFNA 5SWQA 2EZ0C 2A77H 5GGUA 3HI6L 2IH1A 4FG6C 1KB5L 3DHMA 3V52H 3IRZA 6CGTA 5D2NC 1ZAGA 3WL9B 2O61A 1U93A 3SDYH 1I1YA 4OFDA 3UTPE 4Z7VF 5F7YC 5A2LH 3UBXB 4N1HB 1WZKA 2P5WE 3QEQB 4MJ5B 5AYQA 3W39B 1T22A 1BQLH 1BQUA 3OX8B 4FP8H 4KKLD 5AUMA 2WWMC 4H25A 1JWUB 5CIPA 1V7NL 4IJ3C 4ELKA 4FZEL 4P9HH 3CCHB 4YBLB 3HI5H 3X14A 4I0PC 2W60A 3GRWL 4KKNA 4TNWK 1BM3H 2GSIA 4WTXA 4O5LL 1YMME 1MY7A 1L6XA 5ICXA 1N7ML 2W9EH 1WC7A 5IK3A 4Y2DD 3V6FA 1MCQA 4Z77B 1A4KB 5BVPH 4XMPH 3RGVC 1N4XH 5H37G 3QWOB 3G6AA 3RUGB 3QO0B 1MWAH 1XAUA 1JE6A 4ODWA 2X1WL 3MRFA 3P0VL 2V9QA 4MQ7A 5C6WH 4KK5C 5EUKA 4KI5C 3VRLE 3MNVA 5C70A 1PZUB 2A1WL 3IGAA 5F8RC 3RKDC 5IP4A 4NUGL 2FX8H 1KIRB 2X7LB 4W70A 1OLZA 4E41E 1ZTXL 3E2HC 5DRWA 3QFJB 4Y5YA 3S36X 3KLAB 3U6RA 4YWGH 1F8TH 3QEUA 5FA4A 4Y19E 1L0XA 3WBDA 3DX7A 4EUPH 1RI8A 5T33L 3UBXI 5TDPA 3WLBB 1UWGH 2ZCLL 2R4SH 1MAML 1YC7A 2IAMA 5IBUG 4MGXA 4YPGB 1X5ZA 2HKFH 5HPMA 1U3HD 5A2FA 3ARWA 5HYJB 4CADB 1FPTL 4OFPA 1BF2A 3IB4A 3I6KA 3MUJA 3O8XB 4ZFZA 2V9RA 1Z9SA 3ZE0F 4F57H 3FFDB 4UOW0 5LGHH 2NR6C 3IFOB 2BNRA 4MA1C 5DR5H 5ID1A 2HT3D 3JV6A 1NCDL 4PJFB 5LQBH 3MRDA 5IHZB 1JGUL 4ODVL 3OGCA 3BN9D 1B3JA 3W0WE 1VERA 3ZYIA 3KPNB 3RWJA 3MV8E 4PREB 2DLGA 3VCLB 2VQTA 3UDWC 2IPTL 4CU7A 1NCCL 2PYFB 3DX6A 3ZDZF 3S4SG 4TPRL 1AGBB 3NCJL 4DN3L 4NN5C 1ZHLA 4XNYH 2X9XA 3EBAA 3ET9F 4OZ4A 3EDEA 5DD6B 3R4DA 3IRPX 4JFDD 4M61B 5EPMB 1RZJC 5GGVH 3MLRH 5IIEA 4BSVA 1OGTB 1BD2B 2J6EA 3H0TB 4XCNB 4HUMB 4OKVB 3BESR 4LDLB 4O2CB 5C08E 1J12A 5EA0H 4ODTL 2YMXH 4QXTB 1GZPA 5I74B 4PJGF 3RNKA 3QDGE 3C5ZD 1CYGA 4AM0B 2WP3T 4U4BA 1T83A 3HZMB 4I4WB 3MRNB 2ESVB 3D39A 4KK9C 2QSCH 3FT4B 5ILTH 4HGMA 4A2MA 2WBJB 2I07B 1V3MA 2GK2A 2QLVB 7FABL 1RAMA 5BJTB 1F3JB 3TIDB 3RIFF 1XGPA 5I1GL 1A6WL 1XGTB 2ZSWA 3NA9L 3OQ3B 1W0WA 2VN7A 5L8LB 4C56A 3O6FB 1N0XL 3NH7L 2V2TB 1QSED 4QHUB 5C0AD 2HFFA 1UWXK 3PWVB 1QBMH 4L29A 4PJ7E 3HR6A 3CIQA 2DLFH 4AH2B 1DQMH 1WWBX 1XGRB 3NFSH 4PRPA 5C09D 5D7KD 3F7QA 1VFBA 1G1YA 1WV7T 1ZKAA 3DHJA 4S0TD 2PYEE 3I75B 5L8KB 2DIAA 3KR3H 4GW1B 1BJ1J 4JM2D 3KAAA 4NCDA 3GJFA 1WIPA 3OGOE 1LP9A 1I7TB 4HJJL 1G7IB 3T65B 5HJ3A 1OSPL 1FZMB 3RIFK 1KCVL 3EJYC 4FXGB 1Q0YH 3SGDI 2OQJA 1K4CB 3GMRA 5DS8B 2P8LA 2DTMH 2CGRL 1V7ML 2ERJB 4JGMA 4F7CA 3L3OA 5MHSD 1U8HA 2J8UB 1WIUA 3TYGL 4RAVA 2W65B 4LCYB 2W0FA 5CBEB 1F3DH 1OGAD 1SBSL 1G7MB 4OF8A 3Q0HA 1NANH 4HJ0C 3H9SE 1BOGB 3WUWA 2WLZA 1JPTH 1CFVL 4U33A 2VQ1B 4WTZA 5D1XD 1H15B 4L3EA 4X7CC 3IXTA 3FJTA 1ZLUH 3WXWH 4Y5XB 4G9DB 3SY0B 4N8VG 1DUYB 1I3UA 3GSUA 4LLQB 1RZ8A 1QFWL 3RL1B 1CR9L 4EVNA 2BVTA 3UTSA 3VXME 5F7DA 4M8QA 1MFNA 2NW3A 2P8MB 2CLRB 3BXNB 2P5ED 4ETYA 5CGTA 1FNEB 3KXFE 3MLYH 1K85A 1A7BA 1J7VR 1F2QA 2CIIB 3OJDA 3P9WB 5TFSL 3X11B 5J1SC 4N5UA 1QFHA 1YEKL 5IMKA 5EU3B 1R5VA 1LDPL 3CFKA 3S36L 3VD3A 1EHAA 2DKMA 4KVNL 1NJ9B 1U3HB 3FKUS 4RMSA 4KMQA 5T3ZH 4HGKC 1OAQL 2EDBA 4XP6H 12E8L 4KTYA 1O0VA 4DTGL 3VWKA 1GCFA 4JFFD 1NEZA 1UM6L 1HQRA 3KPSA 4BQ6A 4KKAD 1H3UA 3QHZH 2FX7L 4NQEA 4X4XB 4BSWA 3HPJB 2HVKB 4OZHA 1JFQH 1IGJA 3C5SA 4X6CA 4H5SB 1EZVX 1FO0B 3HB3D 3VWJA 3IDIA 2AJXL 4YEFA 2EDWA 3CUPA 2XRAL 1WF5A 1S9XB 5GGRY 3KS0H 4OUOA 3MLWL 4WU5A 5CEXA 1W0VA 3L6FB 1UM5H 3QZWB 5F1NB 1M71A 1AH1A 8CGTA 1NH6A 4BA8A 3MV7D 2Q20A 5D7IF 2IWGA 4WUUE 4TUJA 4Z7WF 1J0YA 3ARVA 1FYTD 4LKCB 1HHJA 4RWHA 1YECL 5E9DD 5GJTH 4JFDB 3WD5H 3MCKB 3LHPH 1L7TH 3FZUD 4QTHB 4TQEH 3HI1A 4U0RB 5JMOC 5FHBL 4I18B 5E4EB 5EZJB 3QCUL 3FQRB 3WFDL 1JF5A 3Q1SL 1ZK9A 4UUJA 4Z7OF 3TO2A 1Q94A 1LHZA 4MD5B 1QEWB 1X44A 1KJ2H 3NAAL 3OKEB 3SGJC 3QQ9C 4HAFA 3BE1H 2MMXA 1BWWA 5C6PB 3ZMRA 2MPAH 3UXFA 5HYQA 1F4XH 1OAKH 2XACC 1AXTH 3SDYL 4OF3A 5IJKC 3HPLB 3QCVH 3C5ZB 2CKBH 1NDGB 5JUEH 4OM0L 4YH6A 1I3RA 2HLFC 1UZ6F 3DMMD 1G7QB 4L9LB 1OSZB 1EEZA 2AI0H 2PO6D 3N50A 1LO3H 1BQLL 4KPHL 4M7ZC 4FP8L 4H1LA 2NY4D 3AAZB 3SEPA 4H26A 4JVPA 3U4EA 3MRRA 1F58H 5GQBA 3X13B 1WICA 1H8SA 1CLCA 3GBNH 3HI5L 3W11C 3NCMA 1BM3L 1NGPL 2F5BL 4QXUH 5DYOA 2BHZA 1QSEB 4OLYL 5C0AB 5DEFA 2W9EL 5LGJA 1NCNA 4HG4J 3RU8H 4KUZL 5EC2B 3WIHH 4FFYL 3ES6B 5IHUH 3RWHB 1BBJB 4OSUH 5DJAA 1FVCB 1YEEH 1MWAL 3JV5A 3BGMA 5I74C 3U4AA 5C09B 4EQ2A 4U1LB 3IDYB 1DBMH 4I5BA 3MRQB 4LLYB 5CJQH 5ESVA 4J4PA 2APXA 4BH8A 3ZYJA 3D0LA 3OAYH 2NLJB 2WBJC 3D2UD 4RNRB 4U1JA 3SE8H 5H94B 2A6JA 3BSZH 3MUY1 5GRJL 2PW2B 1CFBA 5D7JD 3RVTC 4OGAD 4ZTPH 3DOSA 4YWGL 1F8TL 1T7XA 1A5FL 4XCYB 4KTEL 2NPLX 3MACL 3BP5B 1E4XI 3NIFF 5CZKA 1OGAB 2R4SL 3BDYH 4HD9A 2XTJD 1PKQB 3T0BA 4OV5A 1LD9A 2HKFL 3KPRA 1JUFA 1I8IA 4EI5D 2H41A 5GHWH 3GSXA 5D1XB 3PE9A 3CFJA 4UQ3B 4OAWA 4C54A 3GGWB 4WFFE 2OX5A 4F57L 1BWMA 5LGHL 4HV8B 4XNQB 3WIFB 5T1LA 4MSWB 3MCLH 2LABA 4RBPH 1JTPA 2A38A 2JJWA 1FHGA 1PVHA 1HH6A 5TE7H 5T3XL 1DE4B 2AV1A 3T3PF 1NSNH 3WHXB 3QG7H 2P5EB 3O4LA 4Q7DA 4YEEA 4P5TA 4HKBB 4HFUL 2HVJB 2V2XA 3M1BB 4NT6B 4QY8A 4GQ9L 3V5DA 3I2CH 4YUEH 4IM8A 2DQTH 5EZIH 4XB8A 1OY3B 3RJDA 1UKTA 3OJVC 3BKYH 1I8LC 2AQ3A 4LGSB 2H2SC 5EUOF 4OCSH 5EU6D 1CF8L 1OB1B 1KJ3L 1RUMH 1NUGA 2LTQB 4QRQA 2NZIA 4P23A 4MD4A 4ZO6A 4NP4H 3PJSA 1K4DB 4MJ6B 3PL6D 4XP1L 3QRGH 2Y5TB 1L0YA 4P2YA 1T0MB 2B39A 4M6NL 3OMZA 2GCYB 4PJ8A 1C5BH 2EEAA 4GLRH 3SKMB 1SEBA 1AC0A 4P99A 4RGND 3NGBB 5IB5A 4XRCB 1CU4L 4R96B 3ARYA 1TCMA 4KRNA 2O5ZH 2BDNH 3WNLA 4QHNB 3D69A 5HDQH 3VXPA 4KI5F 4EZMA 3FB7B 4PJIB 2I9TB 4LASH 4O4YL 2NXYD 1EAPB 3V6ZA 5I1LB 3MV7B 2C3VA 1FVEA 2R2HA 4JQXA 5EU4A 1HH9A 1A6VH 5ILTL 3O3UN 4LPXA 4NRXB 3E1F1 3GBMH 1FYTB 3TO4A 1XMWA 2XWTB 1X5GA 3JWOC 5E9DB 5F1OB 5BZDA 5F96L 1K2DA 1QSFD 1BEYL 3AB0C 5HGAA 3ILPB 3V0WH 5D70H 4LCWA 1F4WH 1J8KA 5GSVA 4KKCD 3K8MA 2APWA 1HSAB 3ZE1E 4F37F 4LARH 3AS3A 3VXRE 2XZCH 5ETUA 2OTWA 1WZ1L 3MV01 1RIHH 3CX2A 4AIOA 4L8CB 5F9OL 1DVFA 3DRQA 3LKRA 2GITA 1IQWH 4YHIA 4YZFE 1QBML 3IFPA 4L4VA 3WYRA 5GIRA 4YHKL 2J88H 2DLFL 4GKSB 3BQUC 1DQML 1JP5A 2XKSA 1FORH 4U1KA 3L7FB 2LU3A 2FL5B 1MJ8H 3DMMB 1XH3A 2Q6WB 1NC2D 2PO6B 3RPIB 3SDAD 2I25N 2JJTC 2EDXA 1TPXB 2PXYA 2NY4B 3KR3L 4OD3L 3BKMH 5SV4A 3PWJB 5HSFA 3HUJB 1RUKH 1W0YT 2H1PH 2WLYA 5C0EA 4XP9L 4Z18A 1FC1A 4QTIL 5B4MD 1NMBH 4M93B 4W6WB 4M1CD 1CD1A 1Q0YL 1YYMH 3SHSA 4I18C 1C08A 5CJ8A 3TA3D 1HCVA 4F37K 4ZG1A 5F7LB 3TJHC 5ICYB 1R5IB 4GKZB 1MAKA 1G9MH 4GRWH 2YUVA 4XMKL 3MUGA 5CJ5A 2XQYK 3QT2A 3K7UA 4CVUA 3QWQB 1A1NA 5KJRH 4JRXE 3X3GH 3Q5TA 1E28A 2QSQA 2Z93B 3C5ZC 1IL1B 4DOHB 5I9QC 3D85B 3WXWL 1A4JA 3MMEA 5DHYA 1MQ8A 3QEHB 1VKXA 4HUWA 4JRWA 5M95B 3D2UB 2AJYH 1UB6A 3ZLQC 3WN5A 5FO7A 5DHVA 2VXSH 1KCKA 1MFCH 4XPGL 3OXSA 1UYWH 5D7JB 3A6OA 2DIBA 1IM3A 2DDQL 3BH9A 5HYFA 1DBKH 1LEKA 4L5FH 4J7RA 4HUKB 1G6RA 5C0DA 5HHOD 3FRUB 3M17A 3RWDA 3VXNB 4NGHH 4K2UH 4QNPE 2XTJB 1K8DB 2RQ8A 4NO5B 4OB5H 4MYWB 5C0CE 3EAKA 3O45B 1QBLH 4IRJD 4PY8I 1SEQH 2B5IB 4EI5B 5T3ZL 3K4DA 1OHQA 5FCUH 3LKPA 4YFLI 5A1AA 3BRGC 4E5XB 1IT9H 1XIWA 3DYOA 5F44A 3ZSSA 4XXDA 1I8KA 4G6KL 1BP3B 2YA1A 4NNYB 1WIOA 5GS1B 1GC1H 2XN9D 1OTUC 4JQVC 5DQJB 4UIMB 2ATPB 5I19H 3AUVA 4ZS7H 4RAUA 1JFQL 3U7AA 3ARQA 1SBBA 5SWZD 3CVHA 4UIKH 4LEXL 4OCXL 2JCCE 3EYUH 4R4BA 3WKML 1JZ6A 3CC5B 2C3XA 3WS3B 2IEPA 4I13B 4R4NC 1T66C 3P0YH 5HHVH 3H7LA 2EIZB 1UM5L 3VFGL 4UOJA 4NN7C 4CVWA 5KTEH 1TMCB 1WTLA 5EOTA 1YPZB 3F5WA 1ZEAH 5EU6B 3QR2A 2JB6B 4U31A 3MV11 3TYFA 2R2BA 4PP2B 3EDKA 5ANMB 5F93C 3C8KB 1U3ZA 2BXYA 2LVCA 5GJTL 3WD5L 1P2CB 1BQHG 1L7TL 4TQEL 1T1YB 3PL6B 2Z35A 3I6GB 5I1EH 3U0TB 3L5JA 2DWDA 3KLHD 2R1WA 4NRYB 5DJ6A 1KJ2L 4CVZB 1EX0A 1FFPA 3VXTB 4RGNB 1JMXA 3BE1L 5ITFB 1NUDA 1UACH 3SDDA 1M7DA 4IHOA 4I48A 2ARWA 4FTVA 3GO1H 5E99H 4K23H 3BPNC 4LSVH 5J3HC 5CILH 2MPAL 4Q6IB 4ZUSB 5ISZE 4WEBH 4YHMH 4X5WA 4XVUD 1KJVA 2VDML 1P7KB 5TE6L 5DC9B 3NCBB 4PRAA 1OAKL 1AP2A 1AXTL 5DO2C 3MBEA 2H26A 1MUJA 2CKBL 5IEKB 1WAAE 4KUCF 5JUEL 5EG6C 2VXQH 5B22A 4AG4L 4JFZL 4JO1H 1EGJL 3BP4A 4PV8B 1OT1A 1LO3L 2C4FU 5IKCB 4QGYA 3TBVB 4Z7VE 1QSFB 2ZPKH 4MS8C 4Y1AE 4GXVH 3W5MA 2ICCA 2CR6A 3GBNL 4K94H 4AT6B 4I8DA 5CS7A 1G7JA 3MC0A 5D9SB 5F88B 3TT3L 2EC9T 4LSQL 5EU5B 3UTPD 1XF4A 2VC2L 3ULVD 1D6EA 2IPKA 1MJ7H 1DQTA 2QHRH 4GUPA 4JO2H 2DF3A 2ENSA 5GS0H 4D3CL 2ZG1A 3RU8L 1FC2D 2ITCB 3WIHL 5B8CB 3TZVD 4MZ3A 5IHUL 5HYSB 2YN5A 1N5AA 1X5XA 3CVIH 3HC0B 2UV3A 4NDMA 1HILA 1J1OH 2DJ4A 5DD3H 3SDXE 1QSVA 3X12A 3SKNA 1IC4L 1WWWX 2D31A 3ZSTA 3QXWA 1NC2B 5CJQL 3SDAB 4OZIB 4MJIE 4A6YB 1HN1A 2QQQA 1NDMB 4M43H 2AAVA 1II4E 2FATL 1HHKA 4ZNEA 3V6OC 2WWKT 4KHTH 4V1DE 1F4AA 4XC1H 4NZDA 3C5JA 4L4JA 1S3KL 2JJSA 1XF1A 4N0FA 3TA3B 1TTGA 1AQDB 2Y7QB 3C2AH 4QF1A 3CLFH 4XBPB 3MRGA 3PGFL 4Z0BH 3ZHDA 3MLVH 1T7ZA 3IJSA 3OB0K 4LRIA 3BDYL 1YN6A 4PRNB 4FA8A 1PQZB 2VKWA 1K6QH 3L3IB 3H6JA 2VXUL 4G80B 4KJWD 4J3TA 3D3VA 5DMYA 3CPLA 1JF1B 2E6PA 3B2VH 1FIEA 1PJ9A 3D9AL 4DQOH 4F9PC 1CICD 2GW5A 4ZTOH 4G43A 2HJFB 3HR5A 3EZ8A 5I17A 1M7IA 1CDJA 3MCLL 5LJYH 5FO8A 2HMID 4LKXA 4PJDA 4NKOA 3T0EA 5J7CC 5TE7L 2F53A 3BPOB 4CMHB 1OLLA 5KS9B 1D5IH 3MLUH 1BVLB 5HI4D 3MV9E 3QG7L 1LEGB 4MHHI 5IF0A 1JHTA 2CDFB 2BCKA 2UY6A 2XOTA 1UJTA 5HHOB 1U8JB 4NC1C 4JZOB 5CWSA 3UTOA 4YUEL 1HXMA 2ADGA 1IAOA 4MNGE 3LQAC 4PB9L 1CFSA 2ZP0T 2DQTL 2WV3A 3KHOA 3K74B 3O11B 3L1OH 5EZIL 4AY0A 2G75B 2ZJSH 4IRJB 1KXQE 3BKYL 2N7AA 4OCSL 3DX9B 4P46D 2X4RB 3EKCA 4N90D 4G8GE 2Z91B 2FSEB 3INUH 3QIBC 3QSKB 1YEDA 1X6LA 3W0WD 3DJ9A 2XN9B 4NP4L 3VFUB 1DEEB 3QRGL 1LE9A 4KROC 4JREB 3J8F7 1AR2A 5DMIH 5SV3A 4DKFL 5T5NG 3V4VL 2HT2C 3TEUA 3RFZC 2W9DL 3MROA 3HAEB 2FHBA 1WZMA 4OBRA 5GGRB 4LGPB 3MTRA 2VLJE 3PWNA 2O5ZL 2CRZA 1UT9A 4LIQH 3WFCH 3CDFA 3FQNB 4JR9H 4CU6A 4YIQB 5F7HA 2HFEA 4LASL 4GG6B 5C0GB 5IROA 3T2OA 2FBOJ 4ZUTB 3FQWB 4X98B 4YO0A 4U3CA 3LMJH 2P5WA 2Y9RT 3GBML 1U8LB 1E27A 4LSRH 3MJ8A 1ES0B 2HTKC 2ORBH 3VXOB 4M00A 1P7HL 2NX5E 2OL3A 1F4WL 3H9HB 3FONB 1ZLSL 1OQXA 1ZGLP 2QADC 5E70A 2XZCL 3QDGD 1B2WH 2E9BA 2RFXB 2N56A 1YMMA 1RIHL 3MRPA 3MBXH 1F00I 5IMMA 4ODSH 2AXFA 4I9WE 4LRNH 3SDCA 2WP3O 1GGTA 4XP4L 2HWZH 5F6HI 4JPKH 1ZVYA 1KF9B 5IQ9A 2LAGB 1IGTA 1MJ8L 2BERA 4E42A 4NM8H 2MHAA 4NQXA 5I1JL 4LOUD 3BKML 2IMNA 2D0FA 3FRPA 1RUKL 2H1PL 4L4TE 2HYMA 4U1HA 5AAWA 5EULV 4MHHG 1D5BA 4OIBA 3GUTA 3G5VA 1IEBB 2OMNA 3PL6C 4Z95H 4FFVC 3GSNB 4U7KA 4GBXA 1CN4A 4X7TA 1FYHB 5HHXH 4N0UB 2VWEC 1G9ML 2DMBA 1Q9LA 3MRIB 5JR1H 1EDQA 3TZVB 3QUYA 2BOCB 2GSGA 4NNXB 3VXUD 2A6IA 5I1CL 2H3NB 3QJFA 2L7UA 3BWAA 5FDWA 4NHUA 3GK8L 3RWCB 4OZFB 5CD5D 1WT5A 2VOTA 1MCPH 1P4BL 3OKKB 5DVOA 4GS7B 5CEYA 2EXYD 2IMMA 2KH2B 4Z0XB 2WM0A 5CHNA 4AENA 1ORQA 1S7RA 2DI9A 2AJYL 43C9B 3ROLA 1J0KA 3H42H 2VXSL 3OJ2C 1YEHH 2V5RA 1KCUH 5MEND 4F7EA 2XZQH 3DBXA 1XZ0A 4P3DA 4L5FL 4R26H 5CAYB 2VDLH 5GSRA 1ZLWH 2NY2C 3MV8A 1R24A 3WFBH 1OL0A 1WLHA 1QHOA 2VDQL 2OYPA 5SWQB 3BD4A 5GGUB 4OB5L 2IH1B 5IVXF 2FH6A 4NOFA 3MNZA 2O61B 4X6DF 1EO8H 2QR0B 5FCUL 2YD6A 5JW3L 5ELIA 4M62H 3ESVF 1CICB 1T2JA 2OTPA 3H9YA 2Z9TA 3LZFL 2FHFA 4U2YA 3GI8L 4L1HA 2OM5A 1RJYA 1L7IH 1GC1L 2OJEA 4Y4HA 5IB2A 3UJJL 1FE8H 1T22B 5I19L 1NUFA 4LP4A 1E4JA 4WI8A 5AUMB 1K5NB 2F54D 3DPBA 3KYOA 5DJXB 4Z76A 1OARL 2ICWJ 3EYUL 1DLFH 4ZYKB 3U9UB 1KLGB 4NN6B 3X14B 1U8MB 4WHCA 3SCMD 2YUXA 1CBVL 3UPRA 4GSDL 1KPUA 2ZCKH 3P0YL 5HHVL 1G1CA 4IOIA 3VH8A 3UO1H 3AGVA 1YNKH 3O2VH 3V6FB 4Q9RL 4WO4A 1LNUA 3HAEG 4P46B 1BF8A 3G6AB 4WCYL 1CQKA 1U8IA 4LFHG 4ODWB 2RR3A 3W0WB 3MRFB 4Z9KB 4UNUA 5HY9A 1H8NA 5TE4L 2CLVA 3FMGL 2B1HH 5EUKB 3UJTH 4P5KB 4ZNCD 5KVGL 4L3ED 4JGUA 1GHFL 4LHUA 3MLTB 4CJ1A 1PZ5B 3UTTE 5EN2B 1KENH 4K55A 2QQLH 5F7EL 4DEPB 4UT7H 1EFXD 4YHZL 5DRWB 4XMLH 2KQMA 4ZFFA 3BPOC 4CMHC 1KXTB 5C0ND 1RZGA 3NTCH 1AO7A 4K23L 2HA1A 2VL5B 1NBQA 3F7VB 4LSVL 4PRBB 4YHML 1GYAA 3RY6A 3BZFA 1UB5A 4PJ7A 3P3YA 3DX7B 3SQBA 2DQCH 4Z6AT 2C5DC 5TDPB 5DJDB 4ZXBA 1ADQA 2VXQL 2VDRH 4JY5L 5L2KA 1BQSA 1P6AB 3MFGB 2PYEA 4JPIB 1IC7H 5DJ8B 5E6IA 4I3SL 2HJKA 4HT1L 4QHKI 4HWBA 1M05A 2AKRA 2EDKA 1TQCB 5D2LE 1I1RA 2VSDA 4G9FE 4MNHA 1FIGH 3VWKD 2NNAB 4HK3N 4K94L 4E0RA 1T6WA 2FIKA 3DYPA 3RVWD 4Y4FD 4EQ3A 3IF1B 3AFLA 2HG5B 3QDGB 3IU4L 1H0DA 4TUKH 4QHLB 4JREC 1MJ7L 3JV6B 2W0KA 1H8OA 4JO2L 4MLSA 3VDAA 4F33A 4ZFOL 2B2XH 3IDMA 4WV1A 4HIXH 4U2ZA 1MVUA 2C1OA 3CVIL 4XNZB 5DRZA 2E7LC 1IM9A 4YHNA 1J1OL 3H9SA 5DD3L 4FMFA 3QDJA 4IMKA 1QSZA 4Y16C 1VGEH 3FB8A 4M1GH 2YBRA 1Q0XH 3HE6C 4FFZH 4QRSB 2Q8AL 4M43L 1QOKA 1A7QH 4GW5B 5F9JA 1FFQA 1QHPA 1ZHLB 5E2WL 5FB8B 1UJ3C 3HS0A 1ORSA 3KPQA 3HE7D 3B2UD 1T3FA 4KJYB 3MNWB 4XC1L 3VXMA 3ZKND 1FLTX 5HYEA 2F74A 4QHMA 3RHWK 5TGBA 4U6VL 1VHPA 2A2QT 3ZZ1A 4BSVB 3KXFA 5FHAL 3NCYP 4PJHF 3T1WA 2J12B 2PCPB 1HEZB 4LEOA 4MAYA 1E4WH 1QKZH 3VXUB 3IDGA 4OI8A 3IFNH 4P2OD 1K6QL 4I0CC 5DA4A 1T20B 3MO1B 1GZPB 2GFBA 4EKXA 1R0AH 5T1DH 3CSPA 3EZJB 3L5WB 3RNKB 5E2UH 4PRID 3HG1D 4YX2H 3STZA 3ARFC 4AK1A 3JUZA 4JRYE 4ZAKD 1DQLH 1KGCD 5CJXC 1A2YA 1CE6B 5JTWA 4PJBA 4WGVB 4PR5B 3ZT5A 3F6LA 2FYYB 5GJSL 1C16A 5IMLA 5EIIB 5MENB 5FGCE 3MLUL 3FO9A 5K93A 2ZSWB 4AIXA 3QIWD 4BFBD 2VRAA 4LSUH 2O93L 5ENWB 1R3HB 3BZDA 4UT9L 1XF2B 4C56B 1DANU 5DUML 1GXEA 1DBJH 4DKAA 2BSTA 1KC5L 4OCRH 5EZLB 5D7LE 4F8TA 5JOFA 1U8PA 2BVQB 3L1OL 3W2DH 2JJUA 1Z3GH 2XWBA 2CRMA 5D2NE 2ZJSL 3U1SH 5JXEC 4L29B 4MNQD 5EDXA 3TZVC 3FHQA 1JWMA 2WIIB 2MKWA 1M6OB 4HWEH 4WUUA 5F9WC 4D9RD 2YPLA 3TM6A 1AGFA 5DK3A 4Z7QE 4JFED 5I1HH 2YD2A 2NTFB 3BVNA 5IGXL 2I5YL 3O9WC 2JIXD 1AFVL 1VFBB 4C58B 2HTLC 4BUHA 3QNXA 5EUOE 2MCPL 3N85L 4FQJH 5JW5A 5DMIL 1T1ZB 4UV7L 2F54B 1CLYH 1N3NA 3I84A 2R69H 4HK0B 5E2TL 4C57C 5DSCB 1F90H 2P1YA 2DS4A 1ZGLM 4P2RD 1L9NA 3SCMB 2D03H 4MA8L 1A6PA 4YHPB 4LIQL 5F1KC 4JHAH 1NGXA 3V7AE 3JTTA 1U8HB 4JR9L 4PG9B 4JPWL 2J6EL 2V5SA 4Z7UB 3QWRD 2W38A 3LV3A 1S7XA 4PJAB 2Z92A 3OR7A 4QXGH 1TDQA 3LMJL 3KNBA 3T4AB 4IIQB 2HH0L 4LNRA 2EDOA 2ZOKB 2G60H 2CD0A 4LSRL 3WUWB 5T1MB 1ULVA 4MLIA 3ULSB 1P7QD 1XR8B 4FQ1L 1LO0H 4J3VA 1U95A 4QRRD 4TVSa 3TVMA 2JLLA 4HPYL 2FWOB 3LEYH 4L3EB 1CICC 3VW3H 5JPNB 1CCZA 5I1IH 4PPTA 2BSSA 3MJ9A 2HMIC 4X7SH 4C83B 1B2WL 4ZDHA 1EFXB 3T77B 3D48R 5DTFA 3NA4A 4EVNB 3S7GA 3B9VA 4BFIB 3MBXL 1OPGH 5F89B 1A9BA 4LP5A 4M8QB 3ZT7A 3NIDE 4ODSL 4HC1A 3LSOB 3O4LD 3C87A 1YJDC 3UX9B 4CNIA 4OZGE 2EO1A 2HWZL 1CFNB 4UDTA 1OD7A 4U49A 1X6NA 2LE9A 1SY6H 1ZLUK 4UBDC 1HHHA 3GNML 3U7WL 3SO3B 3FTGB 5IMKB 4M6AA 5DGRA 1L9MA 3QUZA 4NM8L 1C5CL 1KIPA 2ITDA 4PRDA 5I76B 3RL2B 1KB5A 3CK0L 1XGUB 3OPZH 4PGZA 2D7TL 3PXJA 5AWNL 3VWKB 5BVJA 1NCTA 2BNUA 4YFLF 4YXHH 1EXUA 1HQRB 5DLMH 4Y4FB 2RHEA 4DW2L 3QUXA 4Z95L 5EORH 2VZUA 1MIMH 5ADOL 1JJUA 3QISA 4W68A 3C5SB 3HZVB 4GRMB 3RZCA 5HHXL 2AXGA 3C8HA 4F7TB 2YD5A 4X6CB 4K7PH 4DEPC 1L4IA 5BS0D 1T4KA 1QPXA 2WNGA 3AM8A 2E7CA 2QQNL 3IDIB 5KSBA 2W9LA 1AHWA 4X6FA 4Y5YC 2LQRA 4AEIL 2ZUYA 4I0KA 2I27N 4OCMC 4LU5H 1RZKC 1I7RA 2APFA 2R0ZH 4WU5B 3PNWB 5CEXB 3P4NB 1V3KA 2VZOA 1INQB 4JM4H 1MCPL 1M71B 4OQTH 1JWSA 1ZHKB 1CT8B 2DKUA 2IAMC 3WXVL 2ED7A 2GT9B 1H3PH 3HE7B 4X5XA 1FQ9C 3H42L 1HHJB 5JHDE 5HHQA 1HHGA 1KCUL 3TPUA 5IB4A 4PJXE 4DGIH 1QLFB 2R9HD 4GKNA 1NC4A 4JLRA 3VFSB 4KRPD 3FB5A 3F8UB 4R26L 3VFOA 2OJZH 3RWGA 1N5YH 5DK0B 2D4DA 2EIDA 1TITA 3MZGB 2VNCA 4UTAH 4GFTB 4EDXB 2IGFH 4P2OB 4LLUA 3LDBC 4RMWA 1AIFA 4FQCH 5HYQB 4YQXH 2WQRA 1CTOA 5HD8C 1EO8L 3MGOA 2E5EA 4XNZC 4M62L 1KN4H 4PRIB 4DVRL 3HG1B 5JNYA 1TJHH 4JEGB 4HW6A 4GH7B 2X89A 3UAJD 4GRWE 4ZAKB 3IAPA 3QXTA 5F7KC 1SMOA 5EOCJ 4W6XB 4LCUB 5CKAA 4GAGH 4KZDL 1FE8L 1KELH 4LOUC 2DRUA 3B6SA 1JNHA 1FN4B 1INEH 1ZT1A 2Z31A 2J7LA 2VN4A 1OF2B 2VISA 3FCTB 4K3EL 4R7NA 4J6RL 5IVZA 5J6GA 3VDBA 4N8CH 3QIWB 4TVPD 2DMCA 1G7HA 3ARDA 4JFPB 4N5ED 1R3IH 2CIKA 3GDBA 4KH2A 3MRHA 1J0IA 3X3FH 5DYOB 1T7YA 2HFGH 3D5OF 3C8DA 4JANB 4UQ2A 2NY1D 1JGEB 2SEBA 2XYCA 2D0HA 3G08A 4MNQB 5T5NF 1QRND 3AROA 5DJAB 5FA3A 5HDOA 3RI5F 1RVFH 1ZHNA 3FB6A 3CFDA 3BT2H 3R06B 4JFEB 2P8PB 4M3KB 1CXIA 3UZQA 3VE0A 2JIXB 1QLEH 2AEWA 4JG1H 3UJTL 3HNVL 4YNYB 3OKMB 5ESVB 3WFEL 1JI1A 1T83C 2XA8H 2GQHA 4LSDA 4HH9A 5LVEA 2LVEA 3TGXA 2QQLL 3QNYA 4P5MA 4UT7L 3RDTD 4P2RB 4XMLL 3WUWG 1J5OH 3DROB 4WTZG 4EXKA 2I24N 1VDGA 3KDMA 2OCFD 4HKXB 1E6JL 2G2RA 2B1AH 4DAGH 2W1NA 4TSBL 2YEZA 5A2IH 4A6YH 2VDRL 4KY1H 4OV5B 1LD9B 3ZHLA 1NUNB 3QNZB 1TVHA 1P7QB 4QRRB 2ZZUT 1A02N 1F11A 3CFJB 1OWRM 4PLJD 1WCBB 4K7PX 2FR4A 4YXKL 2GY7B 2MQ0A 3QEQE 5C8JA 3N1FC 25C8H 1BECA 1CGVA 3S5LB 4N8VA 1MHEB 4TUKL 2IG2H 1EHNA 1SHMA 4P57A 1Q1JH 3DUSA 4WEUD 3O4LB 3QI9D 3DETD 1NEZG 5D1ZA 3WHE1 3HTLX 2FLRT 4CVXB 4UTBH 5DI8B 1MRCL 3BKCL 1VGEL 5I75B 4NWUH 4M1GL 1QPPA 2EICA 3TWCL 2ZOLB 4FFZL 4RBPK 3S96B 3PP3K 3TH2T 3RUGE 1TZHA 3TBYA 1UGNA 1P4LA 1NFIA 3VG9B 3GBLA 2NZ9D 5GS2D 1T0NA 5HGBB 5B39G 4MQXD 1ND0B 4ZOAA 1CDBA 3N9GH 3PJSB 3GIVA 1IAIH 3HN3A 1MCLA 1ZVSA 2X4OA 3ARXA 2EECA 4G7VH 5SX4I 3BUYB 3V4UH 4S1RH 2ZKHH 4P48A 5HXMA 5BS0B 1FH5H 1LK2B 1SEBB 4HJGB 1FRGH 1LK3H 1KYOJ 1QKZL 1DDHB 5C0NC 5C0CA 3SDDD 3G6JF 2Q76A 4FTVD 4OI7A 1ZWIA 2D3VA 2WANA 3D69B 1I9JH 2W0LA 3MBED 5E2UL 3K4AA 4XPBH 4YX2L 2Y4SA 1FVEB 1YN7A 3SKOA 1DQLL 2IALA 3NFNB 1J1PH 2O5YH 35C8H 5HYJE 2D7OA 4M48L 4UI2A 5A3IC 1T5WA 4R2GD 5BZDB 3QXDB 3VWKC 4KRPB 2JCCA 3ZDXF 3RVWC 3MYJA 5JLZB 5C0BE 3DSFL 3TBSB 1SYVB 4WNQB 4PJFE 5GGTH 3SGKA 4FRWA 5B38A 1BMGA 3GB7B 1NLDL 2HRPH 4H1LG 1Z3GL 3CD4A 2APTA 1P1ZB 2GITB 3LKRB 3ARSA 2XWJB 5DJZB 2AK4D 3IFPB 3VWJC 5IB1B 4ONGH 1GGIH 4IRZL 2VDNH 4RGMC 2C3HA 5F8QC 3U30B 1JGVH 3SKUD 4HLZH 4AYFA 2ILLA 1JTTA 4W4NA 5HBBA 4U1KB 4F15B 5C92A 2Q7NA 4U1NB 3OF6A 4YBQC 2BSRA 5FV2A 5D8JL 5KAQG 5FYJL 3LKOB 1CLYL 1FGVH 3B9AA 2IQAA 1NCUA 4HF5H 3C9NA 3ZKNC 3PGCA 4TUOA 1I4FB 4NQCA 1MQKH 1CD1B 2A73B 2D03L 4OUUA 2B0SL 5ISZA 4DGVL 2BMKA 5DVNA 3MRJB 1HHIA 4L8DB 2X4SB 4AZ8A 1FNSH 2FJHB 4JHAL 1XGYH 1IC1A 2J8OA 4CN4A 2NY1B 3PQYA 1BX2B 1KTKE 4WW1A 1OT2A 5C9JA 1TENA 2APVA 1NFDF 4OBSA 2FBJH 1QRNB 5EBMA 1WAAA 1EBAA 2GAZA 4P2OC 2YC1B 2P7TB 2XNAA 2G60L 3PGDA 5C0JA 4KZEH 1KCSH 1PLGH 3P73A 5E03A 5I30L 3NZ8B 5CD3B 2GIYA 1NL0L 4HIEB 4Y1AA 3VRIB 5CEZL 1JYVA 1BLNA 3LEYL 2VLJD 2ESVE 2BFVL 3D87B 3DX8B 5FYLL 2VAAB 1A4JB 3MMEB 4TULL 3QP3A 4OCWL 3HMXH 4AL8H 1JYWA 4F80A 3ULVH 1I1AD 3QBTB 1TVBA 4X7SL 1JPFA 2P49B 4AJ0A 3RDTB 3DV6B 2AK1H 2Y06H 4TSCH 5A2KH 4X6BA 3BH9B 1GOGA 1LEKB 1YDPB 1YUHA 3V5KA 5C0DB 3CFEB 1P53A 3CFCL 4NWTL 4F3FB 1SY6L 2NQCA 4UB0H 3RWDB 1RV6X 3SDXA 3MFFA 4UV4H 5DHXB 3MRMA 4POZD 32C2A 4ELMB 3ZYZA 5GISH 1TJGH 4PJEF 5E5MB 5B3JF 4KJQC 4O02H 3EJZD 4PJCA 4PY7B 2VLRD 3T2NH 2IAND 3ECBA 1GAFH 1M4KA 1UC6A 2AEQH 4HZLA 1XIWB 4V1DA 4JAMA 3HHRB 4HWZA 2R15A 2DOCA 2F8VA 4YXHL 1PY4A 4NO2A 1D9KA 5HVFB 3BWUC 5DLML 3VXSD 5J13B 2F15A 1UQSA 4J4PC 5I71C 4K3DL 4JY4B 1BGXH 3RA7H 5IVXA 1TQBB 2DTSA 3CVHB 2CRYA 3QI9B 1NBYA 4ISVA 4PLNC 4Z7VB 2DYPA 4IMLB 1FL5A 3HZKB 4H0GA 4KDTA 4LU5L 1U91A 2J8UE 5C0FA 1YC8A 4UDUB 3SOBH 1RY7B 4Y4KD 1ZS8A 4JM4L 3P2TA 2WBWB 3WIIL 4OQTL 4HIIA 4OCYH 3QFDB 4DK3A 2CK0H 1TIUA 4WHTB 1OAYH 3U0PB 3TYFB 3MX0A 1MWAA 1FJ1A 2CUHA 2R4RH 5DJCA 2NW2B 5DK2B 5E0QA 1U8NA 1ED3B 3I6LD 2Z35B 4Y2OA 2QL1A 3MV9A 2R1WB 2OJZL 1N5YL 5DJ6B 4D0BA 4QT5B 4TTDD 4S11A 5LXGH 3LRSB 3RIAF 4UTAL 4JN1H 3QA3A 2IGFL 1V3LA 3DGGB 4XBGA 4X8JA 3SDDB 1M7DB 3K1DA 4FTVB 1CXLA 3RWFB 3LH2H 1WBZB 5F6IC 4FQCL 1BFOB 1KJVB 4YQXL 3I3EA 5AAMA 4N9GB 3RTQD 1G7LA 1R5WB 3MBEB 2UVEA 4EUPA 1KN4L 5E5RB 5IMOB 3C6SB 1G6RL 1TJHL 1MUJB 3P11H 1DUZB 5L0QC 4TN9A 4KAQH 1NPUA 5FOBB 4S2SA 1IGYA 3FFCE 5EB9A 3G9AB 4EN3D 5EU7C 3GSRB 4GRLD 3V0VB 1CL7I 1KELL 3OR6B 2OTUA 4NZRH 4R2GB 1T0PB 3QCTL 3FOMB 3HFMH 3VG9C 1HSBB 2Z4QA 4N8CL 4JFOB 4P23C 5HI3C 3KJ4B 2X9YA 3GMQA 1U6AH 4W4OA 1G7JB 1RZKH 1F97A 1R3IL 4AIZB 2WUBH 1D6EB 2IPKB 3N06B 3QQ4A 4XC3L 2H2PD 4GBXD 2HFGL 2ENYA 3PWPD 1F2XK 3RIAK 4PJ8C 2KZWA 4LSPH 4JFQB 2AK4B 4XCEB 4LQFH 2EC8A 1W2KT 3DI2B 3PWLA 1NGYA 3QUYD 1N5AB 4XP5H 4D9LH 2PTTA 1RVFL 4LSSL 4NDMB 4RQQA 3BT2L 4APQA 1RMFH 1T5XB 1XCTA 2C1PA 5MERA 1B90A 4NRZB 2NX5A 3P4MA 4FQXD 1B4JL 4RFNC 2XA8L 4JQXC 2V7NB 5GGSY 4NSKA 5HI5D 4WJ5A 5DQ9A 1HHKB 3PHOB 3TO4C 3UPCA 2MFNA 3S9DB 4PGBB 3FO2B 1J5OL 4N0FB 1A0QL 2R9HC 1A6AB 4O9HH 1OP3K 1BZ7A 4RMRA 2KL6A 5GRXG 2EE6A 1ETZA 4P0DA 2M1KA 3UEZA 4X9IA 3IJSB 4X6EA 3HNTL 3BOVA 5DD5H 4OLWH 4A6YL 1DVFC 2KZ1B 1YY8B 1BBDH 3GM8A 4IDJH 3KWWA 3U30C 1UH3A 4Q58C 4L4TA 2VXVH 4NKMA 2QSTA 4EOWH 4YGVA 5IEHA 4PJHA 3A6CH 4G43B 3HR5B 4F15C 4DUXA 25C8L 1I1AB 2WQ8A 1M7IB 2FJFA 5FO8B 2PXYC 1MCBA 4LKXB 2IG2L 4NKOB 3WFHA 4PJ9A 3T0EB 4ZPVA 4HCRH 5E00A 1S8DA 4BJLA 4PJGB 2A6DA 1JZ4A 5I6XB 5K9OB 1W72B 1JHTB 3CJJA 5FUCC 4KXZI 1A3LH 3BDXA 3NACL 3BAEL 4Q9QL 2ZUUA 4F7PB 4OFKA 2ZUTA 4N5EC 3HA0A 1J05A 3HMWL 3O2WL 4UTBL 2ADGB 1IAOB 1QSEE 2H32B 4J2XA 5C0AE 2AERT 1VFMA 4U6HA 4NWUL 2NY1C 3DRTB 3TNMA 3U7YL 3W82A 4XAWH 2W91A 5I0DA 1FFOA 4MMXC 4BH7A 1QA9A 2VLRB 3NCEB 4GAYB 2EDYA 3RAJL 2IANB 3WO4C 1U8KB 1XGQA 5C09E 3NOIA 5D7KE 1C5DB 3OKLA 3VXSB 3KYNB 1YEFH 2MSPA 4LHUD 3IYLW 1D5MA 3ISWA 4G7VL 2EYRB 3LN9A 3V4UL 3TNNB 2DL9A 3V5HB 3WN5C 5C86A 3U0WH 4NZUH 1FH5L 1MLCA 4NBYB 1FRGL 3MQIA 2YWYA 1T1WB 3D18A 1LK3L 2E7BA 4G6ML 4OQ1A 5T5FH 1AO7D 2L4OA 4JJ5A 3O2DH 3AVEA 5HHNB 3S35H 4DCQA 1CWVA 5F3HB 4IOFD 3IDJB 5IW1B 2FZ3B 4Y4KB 4JZNA 4PV9B 1OGAE 3G5XA 4J3XA 3ROOA 3LKNA 1F6LL 1PKQE 1KBGL 4MD0B 4YO0B 1J1PL 2O5YL 2ZUWA 3V0AC 3B9KA 2AJZA 3LN5A 1E27B 1QO3B 3O4OB 4HEME 3BO8B 4WY7H 4HBCH 8FABA 4NO3A 1XIWC 3AXLA 4ZUWA 5D1QD 2X4UA 5AG8A 5BQ7A 1OWWA 5J13C 1WFNA 1LO4L 4GXUN 3AMKA 1TQBC 2NY5C 5FAAA 2HRPL 1JZ7A 2P5EE 1RIUH 3MOAH 1TZGH 5AZEH 3K8LA 4WDIA 4X99A 1G0XA 4K8RC 3RTQB 1GGIL 2B8OT 2VDNL 1H3TA 5AD0A 3ULUL 1GGCL 3H2WA 5IESL 3T2QA 1IM9D 3IDXH 1R3LA 1E6OH 2E27H 3GMOB 1JK8B 1IGTB 1JF6A 4M5ZH 4EN3B 5IR1B 3K0WA 5J12B 2X70A 5L6YH 4JZJA 4GRLB 1FZOA 3U2SB 5IFJA 2EZ0D 4KJPC 2ZSVB 3V8OA 5BW7A 1BFTA 1VADA 3FOLA 3UTTA 5CFHA 1VGKB 1FGVL 4FG6D 1A7RH 5I1DA 4PB0L 1U9KA 5MP6L 4U1IA 2XPGA 2NZ9C 4HF5L 4K3GA 1S7QA 1LP9F 2NYYC 4PRHA 5B21A 1FBIH 2ZUSA 4UT6H 1MQKL 1EO7A 2B20A 2DWEB 1A7PH 4MCYA 5E56A 3VG0H 3DSNA 1URLA 4GBXB 4DZBA 1FNSL 3PWPB 1UKQA 4HFWB 4WFHD 2VUOA 4GO6B 3ARGA 3V2AR 5A16B 3RBGA 3QUYB 2WWMD 3SDDC 2UZXB 3BGFB 1JPGA 4KZEL 3BWAB 5FDWB 1KACB 4NHUB 2CPCA 4I0PD 4PJIE 3MBEC 5D2LA 3MV7E 3ILQC 5I8EA 4FQXB 4OLVH 1KPRB 3HNSH 3NIGF 5DJ0B 5CHNB 3GJEB 1FYTE 3V6OE 3CZFA 4AENB 1ORQB 1S7RB 2VE6B 1DBBL 1S9YA 2XKUA 5E9DE 2BY1A 5IG7B 3RGVD 3VA2C 1K8IB 5KSVB 4R2GC 5CUSH 3GJFK 4YE4H 4QRPD 3L7EA 4FNLL 4CAGA 4F7EB 3DBXB 2C7UA 1XZ0B 1S7WA 2GUOB 4EEEA 3KJ4C 1P6FA 4KI5D 4R0LB 2OL3L 5GSRB 5E2VH 4UB0L 1KJ2A 3CU7A 5EBLB 5D7IB 2BC4B 2DQIH 3VI4E 4Z7WB 1DN0B 3KPLB 1BVKB 5MEOA 2AP2A 5E7BA 1NMAH 1T21A 1F6AA 5E8PB 5GISL 4X8XA 5D7SH 4HUXB 1I85A 3DV4A 3T2NL 1GAFL 4XWOC 2YPLD 5BZWB 2EDDA 1AQKL 3DNKA 2CKBA 4XAKD 3ZT6A 3Q6FA 1KJMB 3STBA 1ZLWK 1ZA3B 5IB2B 3Q3GA 1CG9B 3QDMD 3S35X 4OZHF 5FGBA 2ZG3A 1RZIB 5I66B 4FQLH 5FXCH 4Z76B 3O0RH 1U42A 3T4YA 4NC1E 2JJSC 2AJ3A 4UZGA 4L8SA 4RDQG 1AKJD 4YDJB 2HJLA 2NR6D 1GZQB 1T1XA 4HKZA 2VH5H 1RJLB 4OCYL 1LNUB 2GJ6E 4LRIC 3WIHA 1YQVL 2Y6SC 4JRYA 1ZSDA 2CK0L 5L8JB 1JGLL 3UZVB 1OAYL 5C2BH 5M7QA 2B4CH 5FOJA 1U8IB 2EH7L 5F3BA 4DJMA 3AU1B 4DOHE 3TVMD 3MRBA 1NBZB 3OKYA 1MCCA 5ACZB 4QOKD 4UU9A 4LHUB 3DUUB 2GJZB 5F1IA 2RBLA 5J6HA 2X5PA 2HKHL 3JV4A 4HXAH 2YPVL 4Y5VB 5BV7C 3VA6A 5LXGL 3TN0A 1RIVL 3T0EC 3VI3E 4ONHB 1T6VN 1AO7B 3LH2L 3BJ91 4KQ3H 2IH3A 3ULUC 3AY4A 2JB5L 3BZFB 5JHDD 1NCBH 5IWLA 1H5BA 2A6KB 2XTJE 1AD0B 4AMKL 3IKCB 4OM1L 4DZ8B 1NMCC 4CMMB 4POZC 1F4YH 4ZUUB 5D6DA 5BCAA 5L2KB 4WVRA 5TH2A 5A40E 4CN6A 1EJ6A 2XA3A 1MI5D 2AKRB 4B53A 4XCFH 1JV5A 5SX5K 3QQNA 5D1QB 1SJHA 4PYGA 4E0RB 3BEVB 4XNMA 1KIQA 4BKLB 2BVPA 3O6MH 4WUKL 2YXMA 2WUBL 1AGDB 4KK9D 4ZMAT 2WINB 2VAJA 1P9MA 5F70A 3EO1A 3FRPG 3GKZA 4LSPL 4F33B 4J1UA 1YNTB 5KAQF 1UXSA 4LQFL 2VIRA 5DUPL 3LEVL 2OK0H 1MVUB 4XP5L 4D9LL 1CGSH 2C1OB 1VCAA 3WEXA 4Z5RB 1IM9B 2HT4D 5HDBF 2PR4L 4U6XA 5JA8B 3MREA 2BNQD 2GI7A 2R0LL 2R1YA 5DZLA 1J0JA 5LCVH 3B43A 4LCCA 1UCBL 3H7BB 2WUCH 3IETB 5EOCL 4QRTA 5ANME 3HC3L 1YNLL 1ORSB 3O4OC 2KDGA 2YUWA 1HCFX 5ALCH 1BJ8A 4NO0D 1RZ7H 3O3DA 1NC4D 2VWEE 4OZGA 4MX7A 1MRFH 5JA9A 1AGEB 1CLZL 3GMPA 5EUOB 4RGNE 1JNLH 2MJWA 3AS0A 1DQDL 1HNFA 3GKWH 5DD5L 1I8MB 4OLWL 3QG6A 4RZCB 5E8DH 4X80H 3W81A 3SDCC 4I0PB 2RJMA 3EJYD 1FNFA 1EPFA 3S88H 4NQVA 4BSJA 5CP7B 4ZSOB 3TJEL 3A6CL 1ACYH 1MVFA 1ZT4A 1EUTA 5DMKB 2LU4A 4CW1A 5J12C 5JIKA 1BHGA 3RGVB 1TCRA 5C6TH 1QSFE 3C08H 3JWDH 4QRPB 3BGAA 5CJBA 2HLAB 5KN5A 5E8OA 3FO9B 4BK5A 3JZ7A 1KG0A 3HRPA 3QO1B 2ICEB 3ARDD 3G04B 4RMUA 4KUCD 4XPAH 3UDWA 3LPGA 2BSTB 3GMMA 4GBXC 4HDIB 1ROWA 5JOFB 1JZ5A 1RULL 4K71C 5EOQH 2X10A 4LLMB 1VEOA 3D0VA 4XAWL 2XWBB 4PTTB 3E2HB 4X0KB 4MDIB 4W6YB 3QUYC 4NQDD 3BPCA 1UA6H 1FZJA 4R9HA 2YPLB 4YDLB 1F02I 2C9AA 3KPMB 1F42A 3PV6A 3HCVA 3FQTA 1WT5C 4ERSH 4OZIE 3QXAA 1YEFL 3VD7A 1J0HA 4PJXA 5FGSA 3VH8G 3MA7A 2V5MA 3L9RB 3QDMB 5JW5B 4JB9H 1F3DJ 1Y6KR 5HHMD 4RIRB 5JQ6H 1B88A 1DANT 5DFTA 1CFTA 3U0WL 5J9PB 1OP5K 2HFTA 2X4NB 2OR9L 2Q86A 3B4NA 2OI9C 3CMGA 4N0YH 5I16A 5T5FL 5ICZB 2VLLA 1AKJB 1MHPH 2X6MA 3LKSA 1NGXB 3JTTB 4MA1B 5CZVL 3CX5J 3VGAC 5C9KA 4F2MB 5JDSA 5C0RL 4JN2A 3EO9H 1LEIA 4ODUA 5BRZD 4I2XA 3RVXD 1S9WA 4LNRB 3QXVA 2ARJA 2MKLC 4ORGA 3BP6B 1XF5A 1ZV5A 5L9DL 3TVMB 1U95B 5IW6B 1C1EL 4HBCL 5JIIA 4TVPH 4QOKB 2AJSL 1MLBB 4ONFH 43CAA 3WJJA 3TBTA 2R2CA 5FUOH 1FAKT 2RCSH 3QUMB 2K3TA 4Y4HC 2BSSB 4M7KH 4YAQB 1PW3A 3O3EB 4JCLA 4NN5B 4XCCL 1HI6A 2CDEA 4NQTA 1RIUL 1CDHA 3BI9X 4H8WH 3RWIB 1TZGL 5AZEL 5LWYH 2CDGB 4JFYB 5T1KA 3WNKA 2EDLA 5D1ZD 1HHHB 3O3AA 1PAMA 4LLVA 5C0BD 5FK9B 1A6TA 5L6YL 1HWGB 1MJJA 3QQ9D 4JKLA 3L3DA 3SE3A 3REVA 1G0DA 2I26N 4WO4C 1KB5B 3SGEI 5JHLH 1T2QH 2PTUA 1MI5B 4G8EB 2YD4A 1G9NH 3VD4A 5CBAA 1NFKA 3KS0J 3IJHA 5INDA 1EAJA 1RJZA 2XN9E 5FF6A 3OKNA 4UT6L 5C07D 4EIGB 4XBEH 1A7PL 3NN8A 2K9UA 2A9NH 3EW3B 5MEPB 2HLFD 5FIEA 3VFWA 5GRUH 1M1SA 2BVOB 1EMTH 4OD2B 1FV1B 4XX1E 2KUTA 3FT2B 1HDMB 1X5HA 2EDHA 5IJVB 3WL9A 4HEPG 4XVSH 5LGKA 3VMPA 1WCQA 4IOFC 3W11D 4WIQA 4H20H 4GG6E 2BNQB 3MGAA 3MLSH 3SPVB 3NABL 3T3ME 1JWSB 3UBXA 1RHHB 3SE4A 1BJMA 3S4SB 3QEQA 1JIBA 1FL3A 5CLWA 4P4RB 3OX8A 5DVLA 3OL2A 5E6IC 2NY5H 4MXVF 4MJ4A 1WITA 4YE4L 1JWUA 5BXFB 3HZYB 5IVOA 2M8XA 1HHGB 3CCHA 1NC4B 1Z9MA 4JDVB 3VFOB 2YD1A 2JTDA 1RUQH 1V8HA 2CH8A 3CH8A 2VYRE 2IQ9H 1HYRC 2R2EA 3PIQB 3L3HB 1YYLL 3T8XA 2DQIL 3E6FB 1IGCH 2DBLH 2FX9L 1KN2H 2L7JA 1NMAL 2NXZC 4Z77A 4P3CH 1ZA6B 3RVTD 3QWOA 5D7SL 4WV1C 3RUGA 3OJMB 3QO0A 1QR1B 2YRZA 5GS2H 4HC1L 5FECB 4FQ2H 3TCLB 5DZOA 1INDH 4IMKC 2XV6B 3TCXA 5B3JE 1CDCA 4NJ9L 1J8HD 4YHYC 1GIGL 2CKNA 3WDHA 1DEDA 3OF6D 5BOZG 2ADJB 3PP4H 4FQQB 1KIRA 2X7LA 2WSKA 3OAZK 1A6UL 1ZT1B 4FQLL 2VISB 3QFJA 3KLAA 1J9CT 3E6HB 4DGYH 3ULVE 3ARDB 2FGWH 4O51B 1IVLA 1U58B 5EO0A 1TJIL