3BJ91

Crystal structure of the surrogate light chain variable domain vprebj
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
VLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSTHVFGSGTQLTVLSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering and characterization of a single chain surrogate light chain variable domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Immunoglobulin iota chain, Immunoglobulin lambda-like polype
total genus 29
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2007-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bj9100
3P4MA 5TFSH 1DVFB 5C0EA 3VXRB 3IAPA 2H1PH 4YGAB 3MBEA 1NUFA 5ADOH 5DS8A 4ZXBD 1HE7A 2PCPB 1I9IL 4M5YH 3FZUC 3TCXA 4MHHG 1T2JA 5EIIA 3OKKB 5EWIL 1NGYB 1MFBH 1MQKH 3SDAA 1B0WA 1MJJA 5JHDB 32C2A 5DF0A 3X3GL 5C07E 3LKOA 2PO6C 1EAPA 2AEPH 5HHVL 2HWZH 2X1WL 4QHNB 4LSUH 3JTTB 1YEHH 1CWVA 5DS8B 2OTUA 3SO3C 5D2NC 1AO7D 2B5IC 4M7KL 5FECB 1AQKL 3CFBB 2HTKD 1CK0H 1JZ2A 4AIXA 2ICEB 5I1IH 1ZTXL 1AC6A 1MFAH 2PW2B 3DMMC 4GO6B 4Y4KC 2EKSA 3KPPB 4TUJA 5IESL 3KAAA 2UWEF 5IQ7H 1A4KB 4QF1A 4LHUD 2X4OB 3PWUB 4HT1L 4X9BA 1R0AH 4IOIA 3KPRB 1IGYA 4LSRL 1PY4A 3PABB 5EO1B 2XZQL 2DWEA 2J5LC 3WSQL 5FO9A 5GGSA 4YHKL 1FL6A 4BSJA 4O2FA 4AH2A 2Z9TA 4NRXA 1DN0A 2YPLB 4OLYL 5J56B 25C8L 1NCCL 2PF6A 1A5FL 1DSFL 2ZUUA 4RMRA 1OCWH 3EDKA 1ED3A 3QEHA 4X6DA 4WUKL 2EIZB 1QRND 1OM3L 4P2CG 4EUPA 2FO4B 1UADC 2NNAA 5FKPB 5DVKA 4C58B 1BECA 3K81A 1IAMA 4NZTH 5GJSL 1HSAB 2Z8SA 4U1MA 3HMWH 1TQBB 4GG6F 3MLYL 2NMSA 4JO2L 4ORGA 5CJOH 1DQDH 6FABH 5ICXB 3FOLB 4LU5H 4LKXA 1JHLL 1PD6A 1FNAA 1OAYH 3HG1A 3V9FA 2MWCA 2DIBA 2GKIA 2KPNA 1ORSA 1U0QA 2GJ6E 3KPSD 3UTQA 4PRPD 3FFCD 5T1LB 4JRYB 1NBVH 5E08H 4RBPK 4D8PB 2J1KA 4OCLC 4QRPE 2AKRA 4G9FE 4QXGL 5JMOC 3LIZH 4GKNB 2YZ8A 3QIWA 4WWID 5CINH 5DJYB 5EUKB 1PGRB 1EEZA 2G2RB 4K55A 1VFOA 3S4SB 1CGVA 5D7IF 3SE9L 4V1DA 3V5DB 5C7XL 5KAQG 1QD0A 3HNTH 3DX9A 3ZKMD 5F6HI 2HVKB 4YHLL 4J3TA 2OCFD 1QFWI 2GSGB 4YIQB 3Q5TA 1JFQL 2R23B 3DV6B 3GSNA 1QRNE 1CXEA 4GMTH 5KSBA 2Z31C 4XMLH 1BQLH 5H2BA 1ZT7A 3U46A 2PUQT 2ENYA 3TH4T 4U1GC 3IDYB 1F4YH 1KYOK 2BMKA 2VZTA 5IGXH 1XF5A 4J1UB 4XPAH 3T8XB 2NY6C 2AK4E 5DC9B 9CGTA 2NTFB 2A9NH 4PS4L 4R8WH 1D3CA 4P2OB 3UJJH 2IANB 1CICC 4FQLL 2W38A 5FYJD 4U6YB 1RZ8A 5KS9B 3OKDA 4YPGA 5I71B 1IILE 5I18H 4J3OC 4X6EB 4HS6B 4ELME 2W0FB 1DQLH 3HZYB 1X5JA 3D1MC 4IOFD 3QO1B 3LS4L 4YZFF 1BHGA 4XCNB 3VFPA 1I1YB 3GUTB 4XH2B 4AYFA 4DVRL 5D7IE 4BFEA 4M43L 2YMXH 2YUWA 3H9SE 3MLRH 2B20A 2CXKA 4JN2A 4XBGB 5FA4A 1PKQB 2R0LL 1JYWA 2XZAL 3RVVC 1K6QL 3UTTB 1PKQA 3RU8H 1T2QL 1JWSB 4XCEB 3BHBB 4OV6F 1HI6A 1IGMH 5EBMB 5LCVH 4HUVB 1MQ8A 3NBNA 5C07A 2W60B 4XI5C 1YNKL 4PREA 3W5MA 1YNLL 1EV2E 4XCNA 5B39A 5BS0B 4P5TB 1EFQA 4QRRA 1UJ3B 4YDKL 5IVNA 3MRHB 1IZJA 1DUYA 2BVUA 4WHTB 4KJWC 5FCUH 1BEYL 3QWQB 4OSUH 4G8FB 1P4LB 4XNZB 4QHKI 2H26B 4A2LA 1ULVA 4ZPVA 3NH7H 2VJXA 3TYGH 1NSNL 4L9LC 4LARL 1CD0A 4XBEL 1MIEL 5KVEH 4LIQE 1XCTB 2IBGA 1HQ4A 3QULA 1XF5B 2Q86B 2C3VA 2D4DA 1KXQE 2BCKA 3BWAB 5FYLD 5HPOA 1YEIL 5CGMA 3IJSB 3RX5A 1T03L 1MJ8H 4F15C 2NY7H 4Q9CA 5M7QA 4MXQC 3QDMD 3HNSL 3SGDI 2DICA 4QRUB 4NQUA 3N1MC 2I07B 3UTQB 4A6YH 3MRMA 5EOQH 1R3KB 3U0PB 5F9AC 4WI4A 4MJ4A 2Y07H 4IMLB 4NT6A 1OP5K 3SJVD 4MA7L 3KJ6H 4Q97A 4NQVA 4XWOC 5E2WL 5IVOA 5E2UL 3QUXB 1DQJB 1HYSD 3OZ9L 1MRCH 3WNMA 3BT2L 4IDLA 3CFCL 3PP4H 2MKWA 1IFHH 4PRPA 1SJHB 1XZ0B 5DQ9A 3H9YA 3CFDA 1KB5A 5GRXG 2JKXA 5A3ID 1XAUA 2Q20A 4WO4C 5T1LA 1F97A 4U1GB 4L8DA 1A1NB 3TN0A 2H41A 3C8KB 3QIUB 3P4NA 1P7QA 1S7QB 4M62L 5T1KA 4JFEA 4PJGE 3SKMB 4M1DL 5T1KD 1FAKT 1T1XB 4RMVA 2R2EA 2X6MA 2XWBB 5DJ0B 3VGFA 1L7TH 5BW7C 4CGTA 5E8NB 3QHZH 4S0SD 4Z77B 4LLVA 1HK6A 3PJSA 5HYJD 32C2B 3W11C 5HHOD 4DKFH 1NCUA 4Y89A 1ZEAL 1S5IH 8FABA 3VE0A 4OZGE 3OKNA 4NDMB 3DGCR 2FGZA 2R1WA 5D1XB 1V7NH 2VQTA 2O5YL 4X80L 1A4KA 1NL0H 5HJ3B 1BFOB 3QNYA 5F7YC 2AV1A 5CD3B 4ZUWA 5I8OL 2CIKB 3LKSA 3OQ3B 4ZTOH 3ALXA 1BLNB 3DYOA 4KDTA 2QL1A 4MCZA 4N90D 3IDMA 3PV6A 4Z7VA 5CWSB 2PNDA 1DQMH 1F6AB 1CGSH 1R5IB 3QDAA 4N0CD 5EU4A 4IOIB 1EMTH 5T3ZD 5GGTH 3WKML 1G6RA 5HGDA 5EU6B 5B3JF 5L0QB 4R96A 1YYML 3GMMA 1HXMB 4KI1A 5C0CB 4M6NL 1FFOA 2KQNA 1VEPA 2OL3B 1SMAA 2Y7QB 2JB5L 4KK5D 2BNRB 3QUZC 5I16A 2ATKB 5EN2A 3MYJB 4MJIA 2IC2A 4DKEL 2XFXB 5EU3A 1FJ1B 3T2NH 3O6FB 3B9AA 1KJVB 1YY8B 3Q6GH 3K1KC 5IB3A 1F6LL 3BP7A 5I66A 4YK4B 1INEH 5EB9A 3KYMB 3MV7E 4CNIA 2PR4L 2RCSL 1P4BL 2VDQL 2I25N 1LDPH 5KVFL 5KW9L 3OAYK 5EZJA 5BXFB 1EHXA 3INUH 3WO4C 1JNHB 1Q1JL 1X5IA 3GMNB 4XP4L 5AG8A 3WIFB 2AJYL 2ZUYA 4XBPB 1U41A 2XTJC 3BZFB 4P5KA 4R2GC 5HHPB 2IFFH 2BY0A 5KANI 2BVPA 1KNOB 4IRSC 1KTLA 4BH8B 5B38G 3Q2CA 4H0GA 3TESA 1IAKA 5D2LB 3EYVB 4PGBA 5FYKU 1TZGH 4OFYA 1XMWA 5JPMB 2CO6B 1Y6MR 4UT6H 3SKJH 1L0YA 4XAWH 5DR5L 4PJ7B 1F11B 4LLUA 1FZOB 3RJQB 1WWBX 5CCKL 1DBBH 1QFUH 4HH9A 4HWEL 4Q0XH 3TNNB 4YO0A 3SDYH 1IM3A 3G5ZB 2Y5TB 1X5LA 1IGCH 3P4OA 4UDTB 4HWBL 1CD1B 1WBZB 3B2UC 3QIBC 5A2FA 4Z7WB 3GM0A 1KEGH 3EO9H 2X9WA 3RHWF 4Y16A 5C0IB 3BPOC 1RIVH 3MV8E 1P1ZA 3HPLB 4JVPA 3ZSSA 3A0OA 4ODHH 4I3RH 1BZQK 4K23H 5A1AA 2DQHH 4TSAH 1UKQA 2P5WA 3OKYA 3NABH 1A0QH 1S7SB 3I3BA 1K4CB 4LHQB 3FFDB 1CIUA 1P84K 5IW6A 1FE8L 2VZOA 1YN7A 4LLDB 4AT6A 4I3SL 4Z6AT 1QOKA 3NPZB 3PDOB 1TIUA 2H32B 1I9EA 4KXZI 4F9LC 2DYPB 5F7EL 2AGJH 3GSVB 5MERA 5D7LD 4WDIB 1G7LA 2I60H 3TGXA 3J8F7 2X44D 3RUGB 4F37K 2CKNA 5KSAC 3KHQA 3TT1H 1DBJH 5C0JA 1NCWL 4Y4HB 1UACL 4LF3B 1U91B 3WN5C 5HHOB 3BISA 1TVHA 4FQIH 4PRHD 5E8PA 2AEIT 3EYVA 4S1SL 4XP9L 5D72H 3T3PF 2FR4A 3NTCL 4OCXH 1EVTC 5C09B 5I8KH 3SN6N 1F3DJ 1YMMA 4X4ZA 3KLAB 4OF5A 3C60C 4LP5A 1JGVL 3QCVL 1G7JA 3G6JA 4FFVD 4M1GH 5CZKA 5CUSH 1UC6A 3HE6A 3QFJA 1NGPH 3MOQA 1FH5H 3B9EA 5E4IA 1U3HA 3SCMA 4N0FB 4LIQH 5IB1A 1OGAE 4M8QB 2JLLA 1FORH 5ID1B 3QUYA 4X7SH 3SDDC 4LSVL 1WTGT 1IT9H 3GNML 2WBJC 3NCYS 2QHLA 2R1YA 3U30B 5DD1L 5CZVL 1MRFL 3NMEA 2QSCL 1RI8A 2HP4A 4PP2B 4DQOH 1D5IH 3SJVB 3UBXG 3MYJA 2BNQA 4MJIB 1X3DA 4H0IA 4GRWB 4ACPA 5GS0H 2XWJA 4OLVL 5HYQB 2A6IB 2ENSA 3S88L 1WBZA 3P0YL 4WGWB 3IDUA 5I19H 2DLTA 2DI9A 4J6RH 3KPMB 4X6CB 4PRIE 4O02L 1CLZH 4FQHA 4LCCB 1A6VH 4UI2A 4FTVD 1F11A 2C7UA 1MHEB 3NCJL 1S7VA 3T0BA 1T0NA 4LRNL 5I1AB 3ZE0F 1QTYT 2EEDA 3TV3H 4XP6L 1XGRB 1NBYB 1A2YB 2YC1A 4O51A 4WCYH 4CVUA 1L7IH 1RUQH 3MJ9H 2Z31D 3VD7A 4OV5B 1JPFB 4XBPA 5ACZA 3DECA 4OGYL 1J1OH 2X4QB 5F9WC 2R1WB 5D1XA 4RAUB 1LO5B 2JCCE 4ZFGL 5FYJL 5BXFA 5EZOH 3G04B 3VGAB 4X4YA 1HNFA 2Z35B 4Z7UF 1AD9B 4PJ8B 2C1PB 4AY0A 3O8XA 3FO0L 2LTQB 3Q3GB 1RIHH 5CSBA 2KKQA 4EI5C 5L6YL 3MV9A 2XWBA 1B0GA 3X12A 4ZUVA 4P4KC 4NWTH 4DFHA 4RGNC 1CF8H 4EQ2A 1U2CA 1JNLH 1MJ7H 2ATKA 5CKGA 2VO5A 5EN2B 5ELIA 1BOGA 4JKKA 2CUMA 3WHXA 1ADQA 3QFJD 3RWDB 2RQ8A 4LLYA 3VFNA 2H45A 1QEWA 3CMGA 2F8OA 5FOJA 2WIIA 5I75B 4K8RH 4HZLA 3WFCH 4JG1L 4P4KD 2AP2A 3VXMD 1DQJA 4WFFE 4ENEC 3BZ4B 5JW5B 1JV5A 5IOPA 1PLGH 2C3HA 1UA6L 3WFDH 4G7YL 3V4PL 4PJFB 3GSXA 3DO7A 3B9KB 3CFKB 3MRLA 3GGWB 4JO4H 3C9NA 4HXAL 3IS0X 4JFEB 5T1KB 3UDWA 1BFOA 1P7QB 1S7QA 1AE6L 1EGJL 3QEQB 2CRYA 1JHKL 4LGRB 1ZSDA 4NO0A 3RKPA 4RCAA 1FRGH 2HYMA 2BOBB 5AEAA 3C08L 3MUY1 4KJQD 1MFNA 5T3XD 4IDJL 3UC0H 3ZLQC 1NCNA 3MMEB 4R3SB 4Y1AD 3BN9C 1T1WB 3KYOA 3NIDE 3PJSB 4OUOA 4OM1H 3MRLB 5L2JB 4JQXC 3L5XL 5IR1A 4K94C 1MAMH 3MRDB 1CU4H 1FIGH 4PB9H 5CEZH 3QUXD 4PJFA 4NQVB 4Y5VB 1CICD 5LG1A 1IBGH 1ZHBA 3F58L 4KGJA 4CW1B 3ELAT 1TTGA 1MNUL 3P0GB 5DFWH 3V6BR 2DQUH 3MRHA 4HZLB 3BIKA 2NY5H 1C16B 4S1QH 5GZNC 4YE4H 5B39B 5IK3B 1KELL 1XGYL 1KN2L 4I0KA 1X44A 1F6FB 2MQ0A 3IDGA 1T0MB 5FF6A 4PRPB 2NXYD 3QUMB 4D3CH 3L3GB 4HQQL 2DQJH 3ZL4L 4MDJB 1NFIA 5B8CC 3VRJB 1JYXA 3C87A 4GXUN 1N0LA 3SQOH 4XB8A 4NZJA 1XIWD 4X7FC 1GC1H 5IVZA 4UZGA 2HFGH 2NZ9D 4QCIA 3KPNA 3SOBL 3TO2A 1R3KA 1J0JA 5F1KC 1LP9F 3UMTA 3BVNB 3FCTA 4XVUC 1NMAL 1F13A 1JMZA 4L4VA 4GOSA 2ZUXA 4PBWD 1RK1A 3QQNA 5IMKB 3VFPB 2QQLL 3D69B 5AAWA 3WFHB 1GZPA 1MVUB 2NW2B 5JO5B 3AXLB 4GAYA 4Y1AE 4K9EH 5JR1L 1NQBA 4ONHA 4QOKD 4CADA 4XCFH 3ARTA 4XNYL 1ORQA 4P5TD 3S35X 3IDJB 3OKDB 1FVEB 4NKIL 3VCLA 3B8SA 2G75B 4MQXC 2H32H 3VRLE 3VW3H 1F00I 1K8DA 4UDUA 4R0LA 1NLBL 2VERN 5HHXH 4KRMB 3VI3E 5JXAH 1LNUA 3H6JA 5AWNH 2Z31A 3LD8C 1CDYA 4FXGA 5DVMA 1K85A 4LQFL 2CDEA 2BNRE 4OZ4A 1QBML 1T5WA 4QRQB 3RNQB 5J11B 2RHEA 2R23A 4JDVA 2H8PB 3DX8B 5HVGB 3DRQA 1HHIA 1RMFL 4LDLB 3OR6B 3U9UA 5JDJA 4P5MA 3PQYD 2F53A 4HUXB 4RQQA 3TPUB 3TO4A 5DLMH 3ZYZA 2HKHH 1YDPA 3H9ZA 3IFPB 4JGUA 2HTLC 2EXYC 2ZSVB 3BKMH 3HC0B 1ZK9A 3C5SA 3RVWD 4DN3L 2WM0A 4P2OD 4E41A 2AQ1A 1KFAH 3HMXH 1MJUL 4E41D 4XB7A 2W9EH 5JA9A 3QPXL 5K9OA 2BY1A 5FM4A 4NO2B 4P2QE 3VXNB 5F7NC 3S4SG 2WUBL 4WEBH 1XGTB 4TRPL 1ORSB 4YUEH 2WNGA 4LPTA 4MGXA 4PP1D 4ZXBB 4WFHD 3EFDH 5C92A 4LKXB 4OZIF 1CVRA 4NQSB 4K2UH 1NDGA 3DMMD 1LEKB 4G9DB 4ORGB 3R06B 1X9QA 1A7OL 4PRNB 3NZ8B 4NM4H 1VADA 2FB4H 3C6LA 3G6DL 3DX9B 2C3WA 1EUTA 4NNYA 3FT2B 2V2TA 2HT4D 2DQFA 1WC7A 1A7QL 4KRNA 2BHZA 5DD5L 4ETYA 5I1JL 4Z8FH 4PJBF 2O5ZH 3IJHB 4GSDL 4GRLC 5IBLC 3MRCB 4OCRH 1N5YL 1KB5L 4LVOC 3F12B 2Z4QB 3LCYA 4JRYD 4IJ3C 3BDXA 3TF7C 3H7BA 2EDXA 1T1YB 3HZVB 1NUGA 5DK2B 4M1CD 4NHCL 1R24A 2X4UB 4KU1A 5C6PB 1YEGL 4I48A 4ONFL 3BQUB 4HHAA 2J4WH 5AUMB 4LSPH 1FZJA 4HCRH 4MQSB 1EVUA 3U1SH 1J87A 4GKNA 1F8TH 4OLUH 4U6XA 4LP4A 1UEYA 3BGFC 3H3BC 4I4WA 2ADGB 1PG7X 3WO3B 4WNQA 3C60D 1Q0XH 4XTRC 4MDIA 4OJFL 1UWXK 3MNVA 3V52H 5FYLH 4ZDHA 4NNXA 3TFKD 5ENWA 3M1BA 2NY1C 5CP3H 3U9PL 3G5VA 2YD5A 1TCRA 2YPLD 5JW4R 1JZ3A 1D6VL 1ZVYA 3W39B 1EAPB 1I8LC 3UXFA 4HIEA 3S6CA 5E4EC 4M1CC 4S2SA 1U8KA 1HINL 4IIQC 5D1ZC 3KPRD 2I27N 4LFHG 3VMOA 4QRSB 1KCRH 4QOKA 4Y5XC 5SX5K 2C4FU 3C5ZD 5IP4A 5EZIH 1DE4A 3TCLA 1M7DA 5TF1H 1T1ZB 5INDB 5SWZD 5GRUL 2FGWL 1P9MA 2PTTA 2XWTB 1A7NH 2AK1L 3BYYA 4Y4FD 3O81A 3UJIL 1BIIB 3REWB 3I6KA 1ACYL 3MGOB 1FLTX 1MWAA 2IQAA 4J4PC 4R4BA 1N3NB 4Y16C 3MV8A 3E6HB 3L3OB 1NMCC 5DWUL 5ICYB 2PW1B 3QI9C 2VL5B 3VXPA 1QBLH 5D70H 2YSSA 2BY2A 4U1NB 3MRPB 4QRPD 1KLUB 3OHXA 4M7LH 5IHUH 3EOTH 3SDXF 1UB6B 1L0XA 5IV2A 4M7JL 3SBWA 4XGZA 5LBSH 2W0LA 5EUOB 1DVFD 1E4XI 1EXUB 4U33A 3L5HA 3IXTA 3BUYB 1DQTA 1WWAX 4KQ3L 4U7MA 1N64H 5I73C 5ICYA 3OB0H 5CBAA 4NUGL 1I7UB 1T04B 2DLGA 1FSKB 3VDAA 2A77L 4NNXB 1INQB 1K5NA 4ZO8A 1LO3H 2IQAB 2EDTA 4G6KH 1OAUL 5HDLA 1CLCA 3MC0A 3QUMH 4DGYH 4X5LA 3B5GA 4PD4J 4ZG1A 1R5IA 5MI0B 1ZT1A 3FO9A 3MRNB 1GAFL 3P77A 1VACB 3GSWA 5ITBL 4FFWC 4S1DD 2MFNA 3HLAB 3MA7A 1NCDL 1VESA 2OXGA 3MREA 4WTXA 1B2WH 1NAMH 3VXRA 2R4SL 4WU5A 3WYRA 5MHSD 1MIML 3L6FB 4U05A 1P84J 3HC0A 3PL6C 4RX4A 3PNWB 5EORH 4ZFZB 4CN1A 1IZKA 3GKWH 3ZT6A 5L8LB 5J6GB 4OD3H 3P9WB 1PEZA 3BN3B 5HGAB 4ALAL 4U1LA 3CU1A 3VDBA 1OF2B 1SVCP 1VGKB 2FEDD 2IG2H 4OUUA 5I6XC 2JIXA 1UWGH 1N4XH 4F58L 5FHAL 2VISA 3CVHH 3HUJA 4EOWH 4BUGA 3QPQC 4HIEB 2YD4A 4BZ2H 1MI5A 4LASH 3MLTA 4PLJC 4U0QB 5C0BB 3QJFA 2FD6H 2CLVB 2VYRE 4JHWH 4ZQKB 1XGQA 1WT5A 1JGEB 2EKJA 2HFTA 3Q1SL 3OJDB 4P9HL 4GUPB 2CMRH 2P44B 2V2TB 3BXNA 1QSFA 2K9UA 1KJ3H 3VXUE 1VADB 2UY6A 3DV4A 3RPIA 4OFIA 4PJIA 1KB5B 5DFVD 5E5MA 4Q6IC 5SWSE 4PJXB 1NGWA 2GTWA 3SDXE 1KEMH 1CQYA 3ZKNC 4NGHH 4LGPB 1T3FB 4UT7L 3QEUA 5SX4H 3PWLB 2AEPL 3EDEA 1XF3A 5HI4D 4HIXL 5DJ8B 2XG5A 1IC5L 1QZ1A 5ID0A 4YR6A 3EOBA 5CZXC 1YEHL 5EFIA 5D2LF 3DUSA 1JL8A 2VE6B 3T2QA 5C6TH 1KCLA 1QFPA 1I4FB 1CK0L 3WMSA 1U8PB 2P5ED 4U1HB 4YHML 2NR6D 4PJCB 3IAGC 3HC4L 5F1SA 1MFAL 1FNEB 3F6LA 3QXDA 1L9NA 2A74A 2B4CH 4P5MB 4O2EB 1OTUD 4OLXH 2C3VB 1CGWA 2H6PB 2FYYB 5DJAB 1LEIB 2ADIA 2Y1VA 5CZXD 3ARGB 4HT1H 5L2KE 1DFBL 3H9HB 1HHGB 2HJFB 4PJDB 4MSWA 3SKUD 2BRRL 5HSFA 1R0AL 2O26U 1FVCA 3UPAA 4OLZH 4O9HH 3GIVB 2OJEA 3GZKA 3WBDA 1Q72H 4UUJA 1MF2H 1A6TA 3LRSB 5HDBE 1P4LA 4M6MH 4U0RB 5ANME 1BPVA 4TUKH 2HAZA 4GRWE 5KSAA 4ZMAT 1NCCH 3M17A 3RX8A 3KYAA 1CR9L 1FN4B 2VABA 4ZS7H 4GRMB 4MLIA 5I15H 5C07B 3BH8B 2XN9B 4FQCH 4JY5L 2E7MA 1X5KA 4GQPH 3GMRB 3KXFD 1A47A 2JELH 1B6UA 2ZSVA 3HAEA 2WBKA 5C8JB 3ULVD 2C3GA 1PG7H 3U36A 4XPHL 5CEYA 2V7NA 3BP6A 4JN2B 4XBGA 3HE6C 5C08A 3QEQE 3X14A 3FMGL 1AD0A 2VDOH 5ECJE 4TYUA 1R3IL 2H2PD 1HHIB 4N8VA 1RU9L 3KPNB 5F9DC 4MS8D 1YPZA 3FTGB 4XP5H 5AD0B 3UTSB 4PTUA 5D5MB 5K33A 1XCQA 4HUUA 1NCAH 1S3KH 1QBBA 1G9NC 3BZ4A 2DS4A 4GAGL 3MRRB 2E7BA 3DSFH 5DD3L 1AH1A 4D94A 4WWKB 1P5VA 5DMIL 4UOW0 2QR0A 3DUUA 1BVZA 3H9SA 2QQQA 1T22A 3RWHB 3K3QA 4OKDA 5KZCB 3LHPH 1XT5A 2CLRA 3VRIB 1J0YA 2AJUL 3HCVA 2G75A 5DYOA 4I77L 2GW5A 2F8XC 2MHAB 4ZUUB 3UTSE 2PYEA 4LAJH 3O45B 4GAJL 3L9RB 4Y5VA 3IU4H 5C9KA 1UYWH 3RWEB 5CBEB 5CMAA 4I2XA 2P42B 3WHE1 5E6IC 1E6JL 3QEGL 5DUML 3T1FB 2CK2A 3C2SA 3UZQA 5GQBA 4OCYH 1IGJB 3MMEA 4KDTC 4IRZL 3M8OH 4JM2A 5IFAL 4W4NA 3OKEA 2YPVH 1MAJA 1T20B 5I1DB 4DVBB 4RMTA 4GS7C 5IVZB 1QNZH 1WZMA 4OIIH 1JTOA 1W8NA 15C8H 4Y2DA 3VDCA 1FCCA 3GI9L 1ZVHA 3MACL 1ZHKB 4RMUA 3S4SA 3MJ8B 3SE8L 5EOTA 5L8KB 1OQOA 1KIRA 5J9PA 5ANMB 3VJ6B 4JRWA 5HDQH 3SDCC 2YD7A 1O7SA 1OGTB 2W1NA 3FN0H 3IDGB 4AL8H 3EFFB 3V6OC 1DQLL 3KDMA 3S97C 4MA8H 4AIZB 3O2DH 3ZYIA 2ZNWA 4JRYA 4ZAKC 5JQ6L 4LPYA 4DN4H 4PJEE 1KF9B 4ZFFB 4P4KA 3GHBL 3F7PC 4NQCD 1X4YA 4F8QA 4TTGA 4DVRH 3DX7B 1K8IB 4FXKB 5J4MA 2VDML 3EIFA 3UTSD 1ODAA 5MEPB 3P9LB 2BC4A 1ZGLA 3SHSA 1CBVL 1IRAY 1UH3A 2BNQB 4R3SA 2JCCA 4PY7A 1H3XA 1MCEA 5B3NA 3U36B 4RAVB 1OP3H 1SEBA 2CK0H 4ZUVB 1LMKA 5L2KA 1YNLH 4J3WA 2E9IA 2X4NB 1I9JH 2P24B 3H42H 5F96H 5CJ8A 5TPWH 4YDKH 1QVOA 4G43B 1GOGA 5IG7B 2VLLA 3E2HB 1O7VA 5D7JC 5SWSB 5C0GB 2ARWA 1JGDA 4L8SC 2H3NB 3JV5A 5IIEB 1NEZA 2NY3B 1CLYH 3FB5A 1KTDB 3X11A 5J3HC 3WNKA 3BOVA 2NY4C 2QQNH 4ODUA 1NBYA 2QV2A 2X4OA 5KSUA 1TTFA 3KS0H 5SV4A 3WUZA 1HKLL 2WIIB 3WLWC 1BVKA 4P4RB 1E28B 3NACL 1JPTL 1YMME 3A67L 2K7QA 5C0AE 3BO8A 4MLSA 3H3PL 4PJHA 4LLQA 1BZ7A 3RZCB 4Z7UE 3I50H 3GK8H 5EOQL 2QKIA 3PGDB 3GBLA 2W65B 3BGMA 5TH2B 1F3JA 2DTMH 3OPZL 4WI2A 4KUCD 1WZ1H 2FBJH 1FHGA 3ARWA 3DYMA 1J0ZA 5HI3C 3ZZ1A 4RISH 2XPGA 5FM5O 5E2UH 3RWIA 5JHDA 2Y06H 2A83A 4NRZB 4JFFE 4K3EH 3RX7A 3SGKA 3ZTJG 3FB7A 1IAII 1T0PB 1IFHL 3D39A 3PWPE 1V5JA 1LO5A 2XYCA 2NY1B 1YUHA 5GRWA 1C12A 4CU8A 4P57B 4EDWH 4JZNB 2GTWB 2AAVA 1JBJA 4NQCA 2VDPL 1QO3A 5IM7B 3QXAB 3DXAA 3MLWL 1DVFC 5F3BA 2YC1B 1A2YA 2APVA 3P2TA 2IJ0C 4LSQL 3SGDH 3QDJB 4F33A 1BAFL 4M1DH 1UT9A 1S5HA 4YHPA 1FNSL 4Y4KA 1SJXA 1ZLVK 3ILPB 2AEQH 4LCCA 4XVJL 3QT2A 1U8NA 1TENA 1YEJL 3MLTB 5I1GL 4QRTB 2FRGP 1ETZA 2EIDA 4WI5A 1S5IL 1NFDF 4XTRD 1S7RA 2ZOLA 1A64A 3ZT5A 1D9KD 1HHGA 3V0VA 1G6RL 2Y5TA 5JIKA 2YN5A 3ZTNL 3T3ME 3W0WE 2A6IA 3HI6L 4HWUA 5HYQA 4JQIH 3C60A 1GIGH 4R0LC 3TBWB 5I8OH 3G9AB 3L3KB 4YHNB 1YZZA 2VIRB 2VZVA 3JWOH 4XPBL 1IGIH 4YQXL 5D7SL 1IM9B 2R4RH 4YHNA 5FOBB 1NC4B 4N0CC 5B39G 2YEZB 4YHYB 2ID5A 3MNWB 4C56A 2ADJA 3QUYB 4KI5C 4U49A 5BV7L 2H32A 3HLAA 3MA7B 4K94H 3P4LA 4MB3A 1HDMA 1U3HB 3GMNA 1WSST 4NFCA 1OAQL 2AQ2A 2DDQH 2F74A 1A7PH 1EEYB 4R90L 3MJ6A 4HFWA 3QJHA 3QQ4B 4J23A 3VMNA 3HE7C 1CLOH 3K8MA 2I9TA 2XOTA 3QUZB 2ARJA 2DKSA 1U2HA 4XNUL 5IUSA 1UCBL 3I2CH 4HPOL 1U58B 2P43B 4PRIB 1UB6A 1NAKL 2L7UA 1QO3B 4LHUA 3O6FC 3ALWA 3BIAX 5J06A 1EEYA 1BX2A 3ESVF 3JSSA 1P7KB 3QIWC 2GK0A 4L3EA 4YDVA 1T4KA 1U3HD 1RJLA 2R2CA 3GSUB 3FQTB 1X4ZA 5JOEA 3INUL 2EH7H 4X5WB 5I9QC 5T33L 1AKJB 1G0YR 1SYVB 2XKUA 4LSTL 3C6LC 5D7LA 1NAMB 4HJJH 1E4XL 4M9PA 3MV11 3TBSA 1DUZB 1CD8A 3OR7B 5J7CC 4JPWL 1LILA 3SDDB 1QPXA 4LL9A 5J6GA 2WV3A 5E2JA 3I02B 4QYOB 1URLA 4LLQB 1PJ9A 2WBJB 5C2UB 1QRNA 3TIDA 2IPUK 3VD5A 3L6FA 4XAWL 2FJFB 2IBZX 3W5NA 1Q9OA 3GSQB 3GMPB 1D9KB 3WIHL 1AI1H 4WUUE 2E6QA 3SBWC 1DBBL 1QFUL 1BVKB 3GHEL 1EJ6A 4LCUB 3EYUH 4PJAE 1Q9KA 2IGFL 3NN8B 5GGTA 2ORBL 4XMKH 1JNNL 2R69L 1CICA 3VI3F 5JOPD 5IIEA 3TBYA 5E7FA 2D7OA 3EO9L 3U4AA 1BWMA 3WL9A 2F5AL 1FJ1A 2HT3D 3OG6B 5DUPH 5JZ7D 3SKNB 4ODHL 1IEAA 1UH2A 1U8HA 5D6DC 1WFUA 4OBSA 4WVRA 2X40A 5C0FA 4WU7B 3VXMA 5I30L 1U8QB 3VFGH 1HYRC 4HSQA 2V9QA 2HG5B 1BM3H 2PN5A 4HCRA 4JRXD 4F7MA 2Q6WA 2VUYA 4X98A 3RIFK 5H94A 1KJMB 2ZOKA 2NXZD 1X5GA 3I6LD 3L3HB 3UX9B 4KZDL 1TETH 4U2ZA 1MWAB 3U7WL 4YJZL 1DBKH 2BNUB 1QHPA 3UDWC 5F1NB 3RA7L 5ALCL 4BQ8A 3VXUB 3U0TA 3G9VA 4M4RA 4TTDD 1PVHA 4RSVA 1AHWB 1W0WA 5DHVH 4Z95H 3BKYH 1BZ9A 2VC2L 1RHHA 3BPNC 3JV4A 4PB0H 2VXQH 5D7KE 4KVCH 1NMBL 4CNIB 4OZIE 1WISA 1KCUH 3V4VL 3CMOL 3WDIA 1OTSC 3MRCA 1NCWH 4FTVE 2LVEA 4X4XA 3C8HA 2BCKB 4FQIL 1TJHL 2VLKD 5EZLA 4EI5D 2GJ6B 3NAAH 3QUKB 3NCYP 2DQFB 7FABL 2NY3D 3L3JA 4L9LA 3NTCH 4OZHE 4OM0L 3TZVD 3NPSC 5I8KL 1EEQA 4NKDA 4LPUA 4ZPVB 4QEGA 3W39A 4QHLB 3HC3H 5FGCE 5L7XL 2JE8A 3WXWH 5CSZA 2FZ3A 4X9GA 4F7TA 5AZEL 1S9XB 5CUSL 5F7WC 1IJ9A 4R96B 5J1AA 3DMMB 2F54D 3SPVB 3LKRA 3BN9D 3KWWA 4Y5YB 1S9VA 2YK1H 1KGCD 4OZGA 3AY4A 3RBGA 5I8EA 5FYKE 3L9RA 4LSSL 2FHCA 3WFZA 4ODVH 2NZ9C 7CGTA 1A1OA 1K2DB 4L8BB 2MQ3A 4XCCH 2XA8H 4E41B 4FABL 5KTEL 3IDIB 1GGIH 1MFCL 3ZKQD 3REVB 4JFOA 4WTWA 1OB1B 5IMLB 1C08A 3O6ML 3AS2A 1FGNL 1AO7A 1RZJC 1K8IA 4FXKA 2FL5B 5D7KD 1RUKH 1T89A 2CKBH 3U0PA 3MRFB 1TXKA 3GB7B 1A6ZA 2XXMB 4PJAA 1G9NL 1A3RH 1K9TA 1R5WB 2X70B 2Z4QA 3VXME 1HQRA 4RGOL 3HFML 1T5WB 3O3UN 3L5WA 1LO4L 4M48H 3STZB 5C9JB 3NCMA 3VJ6A 4PJDE 1UXWB 4D9LL 3GSNH 1TQBC 4PJ9D 3QQ9C 1G1CA 5EO0B 4PGCA 3GJFB 3ZDXF 2VMFA 5IW1B 3WFEL 2A1WL 3K7UA 3BAEH 4XCYA 3QFDA 2ZG3A 3U7YH 1KLFA 2XQYG 3HN3A 5GS1C 4WI7A 5E5UB 5E6ID 2QHRL 1QLRA 5D96B 3MLVH 4BQBA 1FBIL 5KAQF 4MA3A 5E2TH 1KT2A 5FDWA 5IBUG 4HWZB 2P46B 3DGGA 1JPSH 4M00A 1G1YA 4BSVA 2NW2A 3O3DA 3WFHA 4DW2H 5KSBB 4P3CH 1RIHL 5L6YH 5CILL 1SM3L 2IBBA 3T0EC 2NLJA 5EO9B 2BERA 4MYWB 5ADPL 3VGBA 3L3IA 1ES0B 3EO0A 4HUVA 4Q9QH 2VXVH 2CLRB 3VRIA 1RUAL 4YWGH 2F58L 2VXSH 5D1XC 3WV0A 4S1RH 5IB2A 2HJFA 2OM5A 3H9HA 3LKNA 4PJEB 1XIWB 2IFGA 4K3JH 2VL4A 5DVNA 1A3LH 1F90L 4K7PH 3LMJH 2FX8L 4IHOB 4O4YL 4YBLB 4OZGF 1ZT4B 2EEBA 5C0BE 2FSEA 3EZ8A 2HJLA 4G7YH 1LK2A 5HTSA 3NIDF 2DMKA 5ID0B 5F8RC 4UNVA 3KYNB 3SDCD 4MJ5B 1EK3A 3BEWA 4MWFA 2UV3A 2HN7A 4G8GE 2ZCLL 3QEUB 4KH2A 5AAMA 3HAEB 5C8JA 5L2JA 1QQDB 4PJXF 4JO1H 2XKNB 1TJIH 4PJXA 1KJ2B 4Y4FC 2ED7A 4JDTL 4UQ2A 4WENB 3D3VB 1MUJA 1Y18A 2XKNA 3WO4B 2F15A 1FPTH 4XCEA 4ZYKB 2B1AL 3FQNA 3HNVL 2ADFL 3L5XH 3BKCL 4G6AC 4WI8A 5IMKA 2GTZB 3RNKB 2LFGA 2A2QT 3ZTJH 4DCQA 4ELMF 1K3IA 4QHLA 2BFVH 1BD2A 1MNUH 3GUTA 1BF2A 3B9KD 3NGBC 3ARGD 3C2AL 2ESVD 1UM5L 4S1QL 5H37G 4YBHA 3SE4A 2EDNA 3V4UH 4CN4A 5IVXA 3W9EB 4OCWH 4GXVL 4UB0H 3DXAD 4QTHB 5CHNB 5EIVA 1DANU 2FL5A 3ALPA 3KPRE 1FFNB 1QSVA 1TZIB 2AKRB 2LU3A 3LQZA 1VPOH 2DQJL 1D5ZA 3S98A 3ZL4H 1OAZL 3MLXL 3LZFH 5MENA 4P2OA 3FB6A 2WZPD 1DJSA 2HFEB 1T83C 3IDIA 2A38A 1QR1B 2Z93B 1FC1A 5E0QA 3SOBH 1NLDL 3WD5H 1RJYA 3MRNA 4G7VL 5K59E 3O3AA 1AO7E 2XZCH 4KK8C 5DXWA 2Y5EA 5IR1B 3Q3GA 3L5JA 1LO2L 4RFNC 1FV1B 3MXVL 5B8CA 4PJ8D 5M95B 4F2MA 1FYTE 5L9DH 4F7MB 4D0CA 4Z5RB 3P9MB 4M7ZC 2AQ3A 4HXBH 1MRDH 3MFFB 4JCLA 2JJSC 2BOBA 5JHDE 3VH8G 1TPXC 4KDWA 3NA9H 3BXNB 3PIQA 5KG9B 4OV5A 3VW3L 1NANH 2DKUA 4PGCB 3G6AA 3ES6B 1GOHA 1UVQB 4MXWH 5C1MB 3QPQD 1V7ML 4LVHC 1EHNA 3THMH 4APQC 2EH8H 1JZ4A 4RWHA 2DD8L 3VFWA 4ZS6D 5C9JA 3MZGB 2VL5A 3CFKA 2DQEH 2VQ1A 3DBXA 3QI9A 2E27L 4NOFA 2C7UB 4CU7A 5E8DL 3G5YB 3D39D 1IGYB 3CFEA 2NY0C 2A6KB 2BSSB 4OCMC 4OB5H 4PJCE 1AP2B 3WN5B 1G9MH 2VLJD 4QF1B 2AJVH 1RMFH 3TJHD 3VXUA 1E27A 4HPYH 1X5HA 2JJTA 1WK0A 1C08B 2AJSH 5DC4B 1ACZA 4D0BA 4GW5A 1A9EB 3C8DA 3O4LD 4FQ1L 1FGVL 3VGDA 1MCDA 1HSAA 4WU5B 1T1ZA 2HKFL 1RQ5A 5DRNA 2FATH 3SCMC 3LKPA 3RGVB 3S37L 1GGBL 4XMPL 2Q6WB 4Y16D 4ZAKA 4LQ1A 1D5XB 4C59B 5KVGH 1A9BA 3VFRB 1JUFB 1BGXH 1MLBA 3VFVA 3BZEB 3GO1H 5MP6L 3MV9B 1AIFA 1JYVA 2JB6A 3ULVF 2J8OA 4TRPH 1U8OA 1TITA 4Z0BH 5JORB 4PRPE 4UOW1 4G6ML 4JFDB 5FA3B 1NGYA 3MRKA 1YEKL 5C0RH 4NN7B 3MOBH 3MBXL 2YUZA 3SKOB 1HIML 4OI8A 3D18B 3MBED 3UYRH 1NBZB 4O5LL 2DLFH 3HRZA 2FR4B 5I1EL 3D2UA 4E42A 3NGBB 2JIXD 3FQUB 4LPVA 4Q9RH 5DVOA 5F7DA 3VWKC 4WW1A 5HHOA 4MD4B 4GSDH 4ZFOL 1N3NA 1KXTB 5MEQB 3BRFA 2JF1A 5GISH 4ZOEA 4CUCA 5KJRL 2D0HA 1BZ9B 1IAOB 1JWUB 1QLFB 4H20L 1G7QA 3T65A 3B9DA 4J4PA 1AFVL 3O41A 2YHGA 3QCTL 5KSAD 1CL7L 2NY3C 3LDBC 2OR8A 4G6JH 4WEUD 5D7LB 5DO2C 5IF0B 4LSPL 5GRJH 4O58H 3QO0B 1QP1A 3C5ZB 4DZ8B 4POYA 3HE7A 4YK4C 4ODWB 5I1CH 3QG7L 1F8TL 3AU1B 4J3XA 3RQ3A 3HE6D 2EECA 1XFPA 1ZS8B 2VLJA 3WNLA 3V6FB 1PW3A 3P4MB 4P23A 3WEXA 1R3LB 3BE1H 4GXUM 5AYUL 3P3YA 4QRTA 2BVOA 2N4IA 4OF7A 1MFEH 3EYFB 1KUMA 3E8UL 1DEEA 5IMMB 5FYLE 1C5BL 1R6VA 3CJJA 4Z7WA 3EYFA 1HH9A 2F74B 1U6AH 1G7HA 2E5EA 1S7WB 4F33B 1OSPL 2ED8A 3V8OA 1Z3GL 3CVHA 3O6LL 2Y23A 4IIQB 4RGNB 3V6FA 4LPXA 1YNTA 3B2UD 2AERT 4G8IA 4WJ5B 4YO0B 3MNWA 5CP7B 1D6EA 5EZIL 4HFUH 5TF1L 4Q2ZB 3QIBB 1RK0B 3KXFE 3RUGA 2ZKHH 4KY1L 4QXUH 1MCNA 4DZ8A 3OB0K 5KN5B 2X1OA 4N0YL 4MB4A 2XPGB 1KPUA 3SCMD 4YXLH 4X7CC 2EDJA 2WP3T 5EPMA 2OR7A 3BRGC 2ITDA 3RNQA 1RV6X 2OSLA 1BBDH 3T65B 4OGXH 4NHUA 5K9JL 2DQCH 2D9CA 4JQXA 2PKDA 1NEZG 3VXSB 4G9FD 4XPFH 3PWPA 5F7LB 1Q38A 3MRBB 1VFBA 1RULL 3WE6B 1GPOL 2APFA 1FNLA 3FT2A 4NP4L 2F9BT 1XGUA 2H1PL 3KS0J 2R8SH 4M7JH 3C09C 3U2SB 1S9WA 1P1ZB 1KTDA 4KQ3H 4WTZA 4YDJA 2GFBB 4NUGH 5IQ9B 1RJZB 2YS4A 5I73B 3X3FL 4LRIA 3TNMA 3VFTB 4FTVA 1QBAA 5TQ0H 5LVEA 3QUML 1QSED 1PYWB 1M71A 4DGIH 4GQ9L 4NZRL 4N90E 4R97C 4F8TA 4C83A 3TNNA 2QADD 5ESVB 1HHJB 3BZEA 3C5SB 3FL7A 2OQJB 5CWSA 5FOBA 4TVPD 5I1IL 5FUOH 4LOUD 5GS0D 4R9HA 4TSCL 3RGVA 1KV3A 1Q9LA 2FEDC 4Z0XA 2Q8AH 4OD3L 1VFMA 3IXAA 4JFEE 4HIJB 1NFDA 3P11H 5C0DB 1RZGB 1OAKH 2VXUL 1FG9C 3EYQD 3IETA 4OT1L 3B8YA 3FOMA 2FLBT 4R4NC 1CZ8L 4MAUL 1FIEA 4Z7WF 3MRIB 4KMTL 4TSBH 3HZMA 1Y6KR 2PTUA 4EOWL 5D1XD 2B7DT 4UAOC 2UZXB 1W72B 1TQCB 1WCBB 1F58L 2GUOA 5IHZA 3LH2H 5CD5D 1CDBA 4NQCE 3D0LB 3MRDA 5E6YA 5I66B 3T0DA 3BP7B 3PHOB 3ARXA 5FM5M 1A6WH 3MV7D 4U3XA 2ICES 2PYED 2ZUQC 5DJXB 1JIBA 2X5PA 3ZKXB 4WUKH 3CSBA 1CVSC 1RY7B 3JWOC 1B4JL 1I3RB 5AZ2H 4S10A 4I18B 1SEBB 4UT9H 3QRFM 4XVUD 3QIUC 4L3EE 4NGHL 2APBA 2Q1EA 2DRUA 3ULVE 1ADQH 3T1FA 3JV6B 1H3GA 4WY7L 2Q87A 3P30L 3MODH 4XXDB 2XV6B 4GRWF 4BM7A 4MZ3A 1OY3B 2YRZA 3BH9A 4GFTB 5DZOA 5L8JB 4HS8H 3QH3B 3CH1B 3CU7A 3AAZA 3BW9B 2HTLD 3T2PA 4D0DA 3FB6B 5LAXA 4Z7WE 4EIZC 1UKTA 5CINL 1JZ7A 4P3WA 3GRWA 2Z8RA 1KPVA 3STLB 2QR0B 3H9SB 4TULH 2GT9A 4YXHL 1OLZA 1S8DA 1NBQA 1T7WA 1U8JA 5T1MA 3IFNL 4GKZB 1DFBH 3MUJA 4F3FA 1A6UL 1J8KA 3ARGC 4N8CH 3CH1A 4PIRF 4ZNCD 4JR9H 1EIBA 1Q72L 4B50A 5C0CE 3UTSA 3ILQC 2PYEE 5AD0A 3X12B 4GT7A 4Z77A 1Z9MA 4L1DA 3I3DA 1MHCA 3BSZL 4AEHH 4XMLL 4OI7A 1I7ZB 3F6IA 1T1XA 3QDGA 4ZUTB 3OAZH 4LEXH 1ZGLM 5TE4H 1MCHA 3OG4B 3G04A 4S0TD 2YWZA 4R6UA 4XPAL 3U4BH 4FQXB 1FAIH 2XA3A 4YXKH 5DJZB 3ZE0E 4V2BA 3PWPD 1AGCA 1GSMA 1YJDC 4PS4H 4QWWC 4UQ2B 3VGGA 5D7LE 2PYEB 1NFDB 3R1GL 2MHAA 4ZUUA 5C0DA 3S35H 1FLRH 3D85D 5E70A 3O9WD 1XGRA 3O4OB 4M93B 5DQDL 1K4DA 1PG7W 3QUXA 5ACLA 3SGKC 5GPRA 5JHLH 3FMGH 2VDOL 4P48A 2FJHA 4KHXH 1PSKL 4ISVB 5B21A 4NBXB 4PGJA 2Y72A 1JV5B 3WS3B 3L95B 1DLFL 1H8NA 4Z76B 4HEME 1RUPH 4HZAA 4PJ5A 5DD3H 3HAEG 3HRPA 5TE7H 2R1XB 1J1XL 3RKDC 5DMIH 3TNMB 3OXSA 2V17L 4NWUL 3VI4E 1EO7A 1T66D 3OAUL 3MZTA 3CDGB 5EOTB 1IQDA 4BZ1H 1HQ4B 2EC9U 2EDYA 3ILQD 1IGML 5IHLB 5CJXA 2OR9H 1FNFA 2FDBP 1R3HB 5F3HB 3QCUH 2QADB 1CFVH 2ZUQB 2XACC 3H2WA 5ESVA 3EW3B 2LVCA 3DUSB 1ND0A 1YEEH 4Y5XA 4WHYG 4L8SA 3BX7C 4X4YB 1MCWM 5I2IB 1GZQA 1QG3A 2F53D 3M17B 2ITCB 1RJZA 3M8OL 4C4KO 2YOCA 2DI7A 2WP3O 3RWEA 2AI0L 1TNMA 3R0MA 4JPIB 4PRAA 3VFOA 1A6TB 3LRSA 2WIMA 3AB0C 4LARH 4O51B 2UZIL 1BWWA 1MIEH 3V95A 4JPKL 4MAYD 5KVDH 4KTEH 3K2UH 3MCG1 2D7TL 3BIBX 5I0ZA 5DD6B 5GHWH 5GJTL 1TVHB 1XR9B 2HFFA 4OLEA 4NQEB 1OPGL 4OF3A 1UKSA 1W2KT 3RVXC 4MZ2A 5HGBA 4JFXB 3F62A 4P2OC 3QQ3A 1QYGH 1F4XL 4JM2C 1JI1A 1YPZF 3CLEL 3UO1L 1MH5A 2YKLH 5FO8B 4A6YL 2IQ9H 5GS2D 1HQRB 5LGHL 1RZKH 1IMHC 1PEWA 4WHYH 2EE6A 3MRQA 5B3JE 1UZ6F 2AV7B 3HMXA 4LNRB 5E2WH 3CXHJ 4OZFH 1VGKA 2R0WH 3OL2A 4R7DB 3M07A 3TA3B 3OZ9H 4L4TE 4WO4D 5A3IC 3SDCA 5BV7B 3BT2H 1GL4B 2SEBB 1S9YA 5IMLA 2P8MB 3V6OA 2EZ0C 4XVTL 1NMCB 2APTA 4ZFOB 4OFPA 1EBAA 1T80A 5CP7A 3WEXB 4IRJB 2X1PA 4JLRB 4EI6B 3CVIH 5ESQB 1S7SA 4MNGA 1M05A 5T5FL 1LD9A 1A1MB 5CJQH 5DRWA 5IB5A 5FHBL 4X6DB 1F4HA 4W4OC 4LKCB 2ZJSH 1ZA6A 3EOAA 4IOSD 1G7HB 3KYKH 4IM8A 1HH9B 5FAAA 4QXTA 4QY8A 3MO1A 5EU5A 1IC4L 4NZUH 2MTPA 2CLVA 4O2FB 4AH2B 2XNAA 3RWCB 3MV7B 3TJHC 3VXRE 4Y4FA 5IBUB 2J88L 3MJGX 3ZDXE 2DQIH 1V7NL 2BHYA 3W2DH 2R2HA 5CAYB 3DHJA 4Y4HA 4WUUB 3QXUA 3N9GL 1JPTH 4ESKA 5JUEH 1MHPH 5GGRA 4X7EC 5D7JA 4N9OB 2PW1A 1YC8A 4MD4A 4ODWA 4KI5F 2NY5C 5D2LA 4L4VE 2G5BB 4F7CB 5FV1L 5JOFA 1KTKE 5I1LB 1S7WA 4AQ1B 4H88L 4JHBA 5F88B 3RRQA 5IW3A 3RVUC 3ULVL 3D18A 4PJXE 5HHQA 2C26A 4OF8A 3ZDYF 5KVMC 4W6WB 4ODTH 4WFGD 4MNQD 5JORA 3L3DB 3HI1B 3KR3L 5T1DL 4JO3L 4MXVE 4HJ0D 4PUBH 5TF0A 1AXTL 4WW1B 1AXIB 5TGBB 5CIPH 1RJCA 2CLZB 3O6FA 3VXOB 3EYSL 4KK6C 5DMYA 1Z9SA 2AJ3A 3U82B 4FNLH 1MCOH 3MBEB 2HT3C 1WIUA 3RI5K 2F19H 1JMXA 2YPKB 5LXGH 3GIZL 4XRCA 3MOAL 4AENA 3GM8A 1BQHA 3PDDA 4M6OH 3OX8B 5E9DD 3VXRD 3RDTA 1DN0B 1WBYB 6CGTA 1I7RB 2PR4H 5F9WB 4L29B 1P4BH 1FFOB 1LDPL 4G3YL 4ZO7A 4LGSB 5BJTB 2AEWA 1E27B 4X5XA 4ZD3L 4RGMC 2VISB 1M4KA 3HUJB 4PRBA 2FJGA 2M2DA 2YXFA 2D31A 3VXSD 1KENH 1U8IB 4LCIL 3S34L 4LLUB 3TZVC 5C6WH 3BP5A 4UILL 4G5ZL 5FKAB 5FYKD 3BDYL 1DL7H 4XPBH 4FG6D 1FNGA 4YQXH 1DBAL 3PDGA 2CDGA 3NFPB 3BD4A 3WKNA 3S36H 5KSBE 5AUMA 4HLZH 1JPGB 5TDNB 2R0KH 3LN4A 1HEZA 3B43A 4LAQH 3PWNB 5HY9B 5E4EB 2AJZB 4G8GB 1T1YA 3HZVA 2BVTA 3ARBB 4NDMA 4KZEH 1UM6L 1T7ZA 3QXTA 3TLRA 4TTDC 4S2SB 3OKOA 1OAQH 4FP8H 2JJTC 5DD0L 4PJGF 4DUXA 3VA6A 3PP3K 1AGFA 2DQTH 4JCMA 3OKOB 3BUYA 3GMLA 2DLIA 1WBYA 1CGXA 1QLEL 4JG0L 4K71B 5D2NA 4RWYL 4GG8B 1A21A 4XNUH 3AREB 4NNYB 4MDIB 1KLUA 3I3EA 5DMKA 4P2YA 5I1AA 2VLME 4BFGA 3DX6B 2EIEA 3FB8A 4NJAH 4X0KB 4F2MB 3QNXA 3VXSE 3JZ7A 2VH5H 4F9PA 3PXJA 4I3SH 3TBTB 3X3GH 3MGOA 1Z0NA 2FHFA 3V5KA 2GCYA 4AIOA 1QACA 4HD9A 3WFBH 1P2CA 3BEVB 5T3ZH 3G5YA 1RZFH 3ISWA 1AQDA 5CGYC 4FMKA 4QOKE 4Y5VC 3RL2A 2FEEL 2Z93A 1AQKH 3RIAF 4U31A 1ZV5A 1CXKA 5E6IA 5INDA 3TCLB 1UGNA 3QFJE 4QY8B 2H2SD 4IRSB 1Q8MA 1ZTXH 1FFNA 4ZYKA 3GSOA 3GHEH 4PLNC 5IESH 4XP9H 1XCTA 4CVZB 1I1AB 5ICZB 8CGTA 1QSZA 2ORBH 1V3MA 3FO1B 3UZVB 2ZOLB 1JPST 4NO3A 1OAXH 1BD2B 3UBXA 2CDEB 4ZTPH 1E4WL 3PHQA 1I8IA 4NO5B 4HUWA 4OZHB 1LE9A 1HILB 3IDNB 3LKQB 4KQ4L 1RJYB 2F54A 4PG2C 4XAKD 2EXWD 5GGSY 1TVBB 4TVPL 1F45A 4P9MH 5DZNA 4JFPB 2WLZA 3TN0B 2VZ3A 3TVMA 1MI5E 1CT8B 2V5TA 4I4WB 4JFDD 3KPSA 4KI5E 1OM3H 1KGCE 4PJ5E 3RWFA 1KJ2A 4NC2B 1N2RB 4MCYB 2VZUA 4CJ1A 1MCPH 3MV9D 1WFOA 2NW3A 4HX1B 3HR6A 4OZFB 1TETL 3SDCB 4V1DD 1G7PB 1I8MB 2XIDA 4LU5L 3O4LB 5BMFL 2PXYB 1VA9A 3KPLB 3OJVC 4KPHH 4Z95L 2XICA 4R4ND 3NA4A 4OCSH 4XI5D 1CLZL 4KUCF 1RIUH 3MUZ1 2VITB 4KVCL 1FYHB 1S7XB 1IEBB 1LEGA 1NBVL 1KBGL 2OP4H 2YA2A 2YUXA 4Q74A 2DL2A 5E08L 2E6JA 4HWZA 4UV4L 3CPLB 1OGAA 1QKZH 5HHMD 3U6RB 5IB5B 3LIZL 5LJYH 2H2PC 2VUOA 1KXVC 1SY6H 1TJHH 3PWVB 3QQ9D 3NAAL 1JGUL 2Z0BA 5C7XH 3DVFA 5DTFB 4LEOA 3QXVA 2EDBA 1FVEA 4OGYH 1OL0A 4JRYE 1U8MB 1AJ7H 2VDKH 1IC7H 1XGPA 4RNRA 4JFHD 5F8QC 5D93B 2BMKB 4HG4K 4Y19B 5AZEH 4WHTA 3LV3A 2AV7A 4LNRA 1ZLUH 3D9AH 4YEEA 1XGTA 2BJML 5MEOA 4GMSH 4L8SB 1EJOH 4GG6B 5GGRY 1CS6A 1T83A 4LVNB 3AC0A 3DSNA 2X4RA 2IAMC 3AS3A 3G6JF 4FQ2H 2FEEI 1JNLL 3QQ3B 4WW2F 4FZ8L 3WHE0 2Q8BH 5TE6L 4PBXA 3VG0H 3LY6A 2JCCB 5HPMA 4PJEA 1GRWA 5FEBA 3TO4B 4Z7VF 1U8LB 1FGNH 1UZ6E 3QDGE 1CDIA 1MFDL 3V0AC 4MCYA 1WAAA 1IQWH 3L5WB 1T0MA 3PXHA 5FF6B 2CKBL 3ARZA 2YRPA 4XC3L 3AY4C 1JI2A 1X5YA 4HS3A 4XNXH 3MA9H 1G84A 4XP1L 4NSKB 1G9NH 4YFDB 4Y5YA 1FFQA 2EYRB 3AM8C 4BH7B 4MAYC 3GMQB 4HKZA 4M43H 2DQGL 4APQA 5E8EB 1S9XA 2H9GB 1GGTA 5EC1B 2APXA 1QLRB 2VLJE 4PYGA 4LCCC 4KJQC 5ANMA 2ATPA 1N0XL 2FWOA 2NY2C 3WFEH 4R7NB 5ITFB 5F44A 5SWZE 1JHKH 4L8CB 3T0EE 3A6CL 1X4XA 3C08H 4WEMB 3GJFA 3DRTA 4BK4A 4IDJH 4ZS6C 4EUPB 5DRZB 1CFBA 3UC0L 1VB9A 1T20A 5I1DA 1FBIH 1N5AA 5IBTL 4WIQA 2OX5A 5D96C 5E2TL 5KOMC 4OM1L 2J8UA 2X9XA 2AABL 1E0OB 4PJ8A 1C1EL 1GGCL 3F7VB 1CU4L 1F2XK 1FIGL 4PB9L 5CEZL 5FFLA 1HKFA 1BQUA 5H35B 4I2XB 1J5OH 3B9KA 3O3EB 3F65A 5DUBA 4HKXA 3T0EB 3W0WA 4EXKA 1E6OH 2D9QB 2LABA 4YWGL 3MLZH 1U36A 2CJUH 4F3FB 1N59B 3O0RH 4AG4L 3TBTA 1Q9WB 2DBLH 2XKSA 5DZLA 2A6DB 5H94B 4KAQL 4L3CB 1ZKAA 5C09E 1JTTA 3ZDZE 1Q94A 5IK3A 3G08B 3ZT7A 2PW2A 4U0RC 4WWKA 3HNSH 1NGZA 2DI8A 3EJYD 1A4JA 1F4WH 1HXYB 4JHAH 4GG8A 2X42A 2EZ0D 2C4XA 5D2NB 1SBSL 5F7FA 1V8HA 3TPKA 1QR4A 4MA7H 4Y8DC 5HD8C 3KJ6L 3FO2B 2NXZB 2ZCLH 4HUMB 1D7FA 2V7NB 2GI7A 5JR1H 4OBRA 1SEQH 4Y4KD 4X98B 2WBWB 3L7FA 1P53A 3PP4L 4PP2A 1VKXB 3ZYJA 4E0RA 4N9GB 4NC1C 4X83A 4MMZC 3X13A 4TPRL 5B4MD 3MRIA 1EX0A 2RIKA 2L4OA 1ED3B 1QFWL 3WNNA 5I1KL 4AJ0A 1U8HB 3GSQA 3UTZA 1IEAB 2BX5A 1IAIL 3IXAB 3BKCH 3BMWA 1FDLL 3RVVD 3T4AA 3C6LD 3JV4B 3OF6D 2CRIA 2IMNA 3QH3A 4EJ1C 4CVXB 5EO1A 1PKOA 1AR1C 1QBMH 1YMMB 3KPQA 1X5AA 3HZMB 2YD8A 5TDOA 3ZHKA 3V4UL 3FOMB 4EVNB 3V8CA 2VAAB 4X80H 4P49A 4XNMB 2Y4SA 1NL0L 2HKHL 1P7KA 3QUXC 4Z0XB 4RRPA 2UWEE 1WVZA 3LEXA 4PRIA 2Z92B 4UIMA 4M02A 3TJEH 3FQXB 5I0DA 3V0WL 1G7LB 2DL9A 3WD5L 3GSVA 2I9TB 4JFFB 1AKJD 3MLPA 2WUBH 4WEBL 1RZ7L 1S78D 5FGBA 3WE6A 1CGSL 5T5NG 3FQWB 1E4KC 4X5WA 3OKLB 2Q3ZA 2ICWB 3SDAB 1ERNA 2MCPL 2EDRA 1HH6A 1RFDL 3CH8A 2HMIC 4DK3A 4FFWD 4S1DC 1A7RH 4M6NH 5F9JB 3PG2A 2XTLA 2E3VA 3LN4B 1VFAA 5BVPH 4X9FA 3EAKA 3WIIL 4NN5C 5HI3D 1RZIA 3NA9L 4HIJA 2BSED 2P5WB 3L5IA 4Q58C 1FG2B 3PWJA 4IS6A 4AMKL 4UIMB 1J8HB 1T0NB 3I02A 4QYOA 5DD5H 1T66C 2EH8L 1MHEA 2XRAL 3TWCH 3TZVB 3U0WH 3S36X 1QPPA 2HLFD 4KV5F 2OQJA 1P5UA 3FONA 2E27H 3IVKA 1OTSD 1KB5H 3RL1A 3SDAD 5ADOL 1ZHLA 3MNZA 5KVFH 5KW9H 5F71A 1H15B 4OB5L 2A73A 4KXZH 2NY0B 5ISZB 5IFJA 5EPMB 1IM3B 1OLLA 3EJJX 1EFXD 1X7QA 2XNAB 1QSEE 4XNQA 1YC7A 4C56B 1U8NB 2J4WL 4Y2OA 1LP9E 1EFXA 1NC4D 5F97E 5DMGC 1IM9D 2AJSL 3VD3A 3T04D 5MHSE 4HKBB 3RHWK 3DARA 5HHVH 5D2NE 1J0KA 5DEFA 4JHZA 1B3JA 1YJDH 4NQDD 1ZA6B 3EOAB 5DFTA 5BZWA 4X6FB 4PJFF 2NX5E 3CFJB 2HJKA 4G8IB 5TGBA 5DMJB 4N0UE 5MP6H 1Y0LB 4PJBA 1EHLH 4Q0XL 1BQHG 4PBVC 4OJFH 3F7QA 5F9JA 4P57A 1G6VK 1N6QH 1JNHA 3IU3A 1R3JA 2V5MA 2OL3H 2PO6A 3CFIC 3DURB 2C1OA 5IQ7L 4JKPH 2Q3AA 2A83B 3B3IA 2ZZUT 3OJ2C 5JZ7C 2P1YA 4L1HA 2KBGA 3B5HA 5CBAB 1CTNA 1MCRA 1MY5A 4R7DA 4F9LA 2CGRH 4P2RD 1XR8B 3B2VH 5HHOE 2IADA 3WSQH 3T77B 5EU3B 5HVFB 3BGMB 2IALA 1AXSA 1H15A 2YZ1A 1G7QB 4HIHB 4XHJD 1NJ9B 3ECBA 2NY1D 2WANA 1NGQH 4E5XB 4D9RD 1UM4L 5IT2H 1SJEA 1IKFH 4DAGH 4UIKL 3R0NA 4XPTH 3FHQA 4OFKA 2A6DA 3E6HA 2GJJA 3L3OA 5ERWB 5B38A 4QGYA 5FO7A 3P40A 5DJDA 4R4BB 1JP5A 3U83A 4L4TB 1ETZB 3MLUH 3B6SA 1OQXA 2VXTL 5GJSH 2ZCHL 2WBJD 5F72S 3X11B 4NQDE 4JAMB 4CKVX 3B83A 5IEHA 2IAMD 2DAVA 4JO2H 3W0WB 4QHUA 1S5HB 4H8WH 4W70A 5CJOL 3DROB 1YN7B 4LLDA 1XH3A 1CDGA 3MRKB 2IPUG 5F9OH 4O2CB 2XWTA 3V6OE 1R3LA 3QG7H 1QBLL 1TVDA 3FFDA 4MNGB 5CD3A 1D5MB 4QKXB 3L1OL 4HK3N 1JN6B 3QIWD 5HGGS 4JQVC 3TT1L 5ACMA 2V7HA 2DIAA 1KLGB 4JZNA 2J3SA 3VFRA 3AGVA 4N9GA 2FNBA 5D72L 2RR3A 3QB7C 1R3HA 4PY7B 4M5ZL 1L6ZA 4P46B 4OCXL 3IDXH 4F9PC 3L7EA 1I3GH 2GJZB 1NCBL 2QQKL 3NCCB 5C0ND 3UPRA 1H0DA 3SE9H 5GS0C 4JDZA 3E8UH 1RZKC 2UYLB 3RDTD 2B1HL 2F5BL 4PGZA 3HNTL 2A77H 3CX5K 2R1XA 1WWCA 3GMMB 4V2CB 1WTLA 3TT3H 4YHLH 2Q7YB 1QFOA 2C3XA 5IKCB 1BREA 2EYSA 1AIFB 1NCDH 4WNQB 5J11C 4X7SL 4LSVH 4Z7VB 1BQLL 1RUMH 1OT1A 1ZOXA 1F4YL 1M6OA 5DD6A 1MPAL 2ZKHL 3KLSA 4QXUL 1N59A 4JFFD 4I5BA 3LKSB 3OSKA 5D1QD 3EUUA 3GMOA 3BPLB 2A9NL 5FGSA 1LP9B 5GSRA 5HBBA 1HSBB 2IG2L 3W11D 1TZHB 4FQLH 4LMQI 1AGEB 4L5FL 4NFBA 3MV01 4RGNE 1PAMA 1AP2A 2A9MH 3DVGA 3RWJB 3QDHA 2FD6L 1CTOA 1HZHL 1U9KA 2B4CC 4Y1AA 2D7NA 1QFWM 1L9MA 1A6VL 3LS4H 1ND0B 5D1QC 3HR5B 3C6SA 1P6FA 4L3AA 1MOEA 1YMMD 5GGQH 4HWNA 2E9JA 2EYTA 4JZOB 4ZAKB 2X4TA 4XP6H 4K3DL 4QNPF 4WCYL 1ZMYA 3QIUA 4ZOCA 2BNRA 5I9QB 3LQAL 4LVNC 1EO8H 3C6LB 5FYKL 3P9MA 3OXSB 2GT9B 1UFUA 5EA0H 4QTIH 1XZ0A 1KIQB 3HI5L 5TDOB 4PJ5B 5C2BL 4NQXA 1J05A 3VGEA 2EDHA 2BNQE 4Z76A 3KXFA 3RUGE 3U48A 5EU4B 3N1GC 2NR6C 3VXTB 4DKAA 2F53E 5GGVL 2R29L 4CVXA 1YPZB 3FTGA 2YWYA 4MXQD 3O45A 2PXYA 4YC2C 2XI9A 4OSUL 1KIRB 3KLDA 5EBMA 3MJ7B 5K93A 5J9PB 4LBEB 4NUJA 1CFQB 5J12B 4ENED 1KIPA 3P0VL 5HPMB 1SVZA 2FX7H 3E2HC 3PIQB 3NZHH 1RD6A 3W9EA 5H8DA 1J1PH 4KK8D 3VU2A 2XQBL 3S5LG 1YEDA 2V9TA 4ZSOB 1N7MH 1FO0H 4R26H 5D8JH 1XCQB 1MF2L 5DJXA 1MJ8L 2NY7L 4X7TA 4JB9H 2W91A 4DCQB 4NQEE 1AD0B 1HWGB 4WV1C 3AROA 4TUKL 5J1TC 2KL6A 1TQCC 2GTZA 3RNKA 5E8EA 4HBCL 4B7LA 4MNHB 2VWEE 2AXFA 2IAMA 1HNGA 4QT5A 5FB8A 1I7TA 5I15L 1B4RA 1X6NA 1UJ3A 3EDJA 5C71A 1EGJH 5F6IB 4FQCL 4JY5H 4GW1A 1MUJB 3PWVA 5AG9A 4ZSOA 3K80A 1ZWIA 2NCMA 3IRZA 3O9WA 5IJVA 3BRDA 2EDOA 3KLHC 3QWRD 3TN0D 2HH0L 3UROR 5IVXB 1ZANH 3RIAK 1KACB 2X4PA 4Z7QF 3AAZB 1GZPB 1OD9A 4WY7H 4XZUA 4ODBD 4JANB 3D69A 1BVLA 1Q0YL 1WITA 2WW8A 4UUJB 1NCAL 3BPLC 4GG6A 5E1HB 3DSFL 4UU9A 1L7TL 1VCAA 2E8ZA 3QHZL 5CEYB 2WINA 1NPUA 2YA0A 5DSCA 3RVWC 3TM6A 4O2EA 2X9YA 1WWWX 4PJDF 2CUIA 1BP3B 2KZ1B 4HMCA 2K3TA 3RWFB 3IFNH 1H3PL 3ME0A 4JM2D 1CT8A 3RP1A 3RTQA 4LNVA 2NTFA 3RTQD 4YHYC 4L4VD 4N8PA 3VFSB 5IW1A 4H1LH 4GLRH 3PUCA 2COQA 4NRYA 1YQ2A 4JRXE 3LSOB 2Q76A 2EYRA 4NHUB 4OCYL 2HJLB 1T3FA 4HJGB 3F5WA 2CH8A 1BMGA 3IS1X 4JKMA 4X7TB 3EJYC 4MA1B 5F93C 3BZDA 5GRZA 5CJ5A 4AEEA 3DVGB 3RWJA 1EMTL 4F80A 3ARGA 2UWEA 1MEXL 3BPCA 4G42B 1RZGA 4XNYH 4IHOA 4FQXC 15C8L 2DN7A 3R1GH 3RAJL 1J7VR 5E7BA 3CC5A 3PWNA 4Y19D 5HY9A 3SE8H 4UBDD 3O3BA 4PJCA 1YECL 4A2MA 3PL6B 2NW3B 3GGWA 5JHLL 1I85C 5AWNL 1PSKH 2WLYA 1QA9B 2CKBB 3V5HA 4BELD 3VD9A 5JQ6H 3BP5B 1DLFH 5T3XL 4WFFD 2ED9A 1XF3B 1R5WA 1H8SA 2X70A 4OZGB 2WUCL 3WIHA 5JW5A 4RFOH 5DMGD 5K59F 5KS9E 3NCFB 4AQOA 2VDMH 2VDQH 4HGWA 5IJKA 3FOLA 1I7UA 4A6YB 3ZYOA 3GJFH 4U6YA 4POUB 2CRZA 2GHWB 4X0KA 2BVOB 1EXUA 4NIKB 4PY8J 4PJGB 4FQJH 2F54E 5DRXB 1IGTB 4LK4A 2CK0L 1INDL 3CFBA 3T8XA 5FECA 5E99L 1CFVL 3CZJA 1IGFL 4Y2DD 1MCWW 5TDPA 2OK0L 2B2XL 1VSCA 1OGAB 2W9EL 3AM8A 1NGXA 2UVEA 1XF4B 5IB4A 1INQA 1K5NB 4TQEL 1T5XB 3QDMA 4JJ5A 3CX2A 4U6VL 4JE4B 5GGUA 3EFDL 2AI0H 2P49B 1XH3B 4PRHE 1C5CH 4PD4K 2AJZA 4G8GA 1A7OH 1ZA3B 2DWEB 2UZIH 5IV2B 2D7PA 3K2UL 3LEVH 5BRZE 2GCYB 4MQ7A 4U3HA 1B0RB 3HS0A 5EZLB 4YPJA 3QR2A 3DVNA 1EEZB 3QSKB 1X5ZA 2C9AA 1BD2D 4K23L 4TSAL 2VLMD 1QYGL 4I8DA 4GJTB 1JGLH 4HLJA 1G7MB 4HDIB 1VACA 1OD7A 2F8VA 4NN6B 1WFTA 4HKJA 1N5YH 1SYSA 1UXSB 5FGBC 1EBPA 1U8KB 2FBJL 4AEIH 2FHBA 4XPGL 4IRSD 5IMMA 4Y4FB 4W6YB 1G7IA 4PJBE 1YEGH 2EDFA 3JWDH 3J7HA 4K3EL 1PQZA 4JVWA 2P5EA 2R56H 3TBYB 4NO3B 4HCRL 4NC0B 1MJJB 3BKJH 3CX5J 4QXWA 4OZHF 2VR4A 1IKNC 4QXTB 1CXIA 3I6GA 3EHBD 2EIZA 4WUUD 2Y6SD 3OKMB 2YSSB 1F2QA 1Q9KB 2CLZA 4QRRE 3I6GB 2P47B 2XY1A 3CCHA 2CXGA 3LKPB 3ZKMC 5F7MC 3KYKL 1ZVSA 3DLQR 1IGTA 4NNPL 2OYPA 4DWHA 4EXPX 4KHTH 5C08E 3ZE2E 1UWEL 1W0WB 1WAAF 3U9PH 4KKNA 2EDKA 1YEJH 4HKBA 3DI2B 1BJMA 2ZPKH 1H8OA 2MCG1 2DLHA 2J88H 3H7BB 5E00A 4XAKE 4J3VA 5FUZL 2ARJQ 5GGUB 2G5BA 3NN8A 3W2DL 3ULSB 1JF1B 4BKLA 4DZBB 1NGPL 2DWDA 1FH5L 2BSTA 3S7GA 5JUEL 4P23D 1FL5A 4IRJD 4RIRA 2ZCKL 1QA9A 2CKBA 3V5HB 3CGTA 1X5FA 3FQUA 3ULUF 4UAOB 3HRZB 4E5XA 3ARBD 1BQHB 4AENB 3I6LE 4KVNH 1LK3L 2E9BA 5TDPB 4MQ7B 4G8GD 4UTAL 4NN7C 3IRPX 2GQHA 1A7NL 2AK1H 4Z7NF 5DD1H 3P73A 1MRFH 2X4UA 4RA3A 3UJIH 4JJHA 4ERSH 5LWYL 3RZCC 3ZE1F 2XZZA 1DLHA 1TPXB 1VFAB 1A7PL 2BY3A 4P46C 1JVKA 5T1DH 1JHTB 3ET9F 3LSOA 5KBNC 3VD4A 5F7UA 3U4EA 2PCPA 5BZDA 2WWKT 1F4AA 3BP4A 3ZDZF 5J0BA 1P4IH 5KSBF 1KB9J 2W59A 3UEZA 5BZWB 4OFDA 5LXGL 3GIZH 2B8OT 3H0TB 3IF1B 3QG6A 4J3UA 1I9IH 3HTLX 2J6EL 1NFDE 3C5ZC 5CHNA 3MJ9L 2F53B 4HUXA 1ZLSL 4QRPB 1NAMA 1LO3L 3MSPA 4G6KL 4HF5H 1E4XH 3N1FC 4GW4A 3LOWA 4LSUL 1KENL 3FQTA 1C8PA 1UZ8B 1WFNA 4JZJB 3WS3A 3JUZA 1B2WL 4NRYB 1QSFE 4BK5A 1BX2B 2R4SH 3RDTC 3G6AB 4B53A 5EU5B 4RDQF 5JPMA 3FQNB 2X89A 4R0LB 2BVEA 3PWJB 4IS6B 3I9GH 5KS9F 4NYLB 2R0KL 3GEWB 1BFVL 4I0PC 1LD9B 4UINL 4ALAH 3VG9C 3OR6A 4UOJA 2LE9A 2EE3A 3BZFA 2QJDA 4P5KB 4YBLC 3X17A 1JK8B 3MROB 3V0VB 4JLRA 1JNNH 3WIFA 2R69H 3O11A 4OZ4B 2MPAL 3JV0A 3JVGA 4F58H 1I7TB 2XZQH 5CKAA 3O8XC 5HHNB 1CDUA 2AXFB 4BZ2L 4EI5A 2ICWA 4LASL 1I8KB 5C0AA 4C55A 2YPLE 4UU9B 3GI8L 4YHZH 3RWIB 3DXAE 2F5AH 3KYMA 4OCNC 4H25A 3NFNA 3O2WL 3V4PH 3D39E 3TFKC 1ROWA 3VCLB 5I30H 4GKSB 4DOHB 4NJAL 3QXAA 1YEFH 4JFDE 4HXAH 3PHSA 3C60B 4GAYB 1CE1H 1CN4A 2VH5L 4NZTL 3EZJB 3DRQB 3SY0B 4MD5B 1FRGL 2VAAA 4UT7H 1Q9WA 3IFOA 1H5BA 1ITBB 3RA7H 4HIXH 1RZFL 3RWCA 5DK3A 3T0VA 3TYFB 1ZHBB 4CW1A 4PRAB 1DP0A 5ABDE 5TH2A 4BFBD 2QKIB 3BQUD 1KOAA 1KN4L 5C0GA 1W0VB 4KTYA 4LKCA 3CMOH 2NXYB 5GZOC 5E5RB 3L3GA 1WF5A 3QUMA 2DQUL 4OAWB 5ALBH 4OLXL 3MGTB 1ORQB 5EOCL 5SX5H 5E94A 4YE4L 4LVOB 1CQKA 5D5ME 2YRLA 2GITB 3ZMRA 4D3CL 3CXHK 4O9HL 4NRZA 3K2MC 5F6IC 1E4WH 5F70A 5CLWA 5LGJA 3KYNA 3AMLA 3MJ7A 3P9LA 4FQPA 1JGDB 4UV7L 5E8NA 4GRWH 4MAYB 1RZJH 4GMTL 1GC1L 3ZKND 3BJ91 5EC1A 5JPNA 3IJYB 4Y1AB 1C5DA 2YBRB 1W72A 3WJLA 4JQVA 4KMQA 1SY6A 5BS0E 1A4JB 4ZS7L 4LCWE 3VRJA 3LEYH 2QQLH 3CXDH 1Z5LB 3S3JA 4XCCL 4FABH 4J3SA 1LP9A 4KJWD 2NPLX 5GSRB 1QSEA 1MFCH 2JELL 4P4RA 3S3PA 2FIRT 3C9NB 3S5LB 4LCWB 4PG2A 1CFQA 3ARFD 3I85A 1CXHA 3N50A 3QHFL 2ICWI 3S5LA 4NKIH 4PV8B 1RUKL 3MR9A 2V2XA 3RWGB 3TVMC 2GY5A 3DJ9A 1Z5LA 4XP5L 4OI9A 3C6SB 3HR5A 4P4KB 1MELA 2BDNH 4OTXL 3MTRA 4RGOH 4ZFFA 2R0ZL 4Y5XB 1TCMA 4D9LH 4KKBC 3D85A 1LWRA 2XTJE 5BV7C 1GGUA 3RU8L 1JGUH 1T2QH 3RPKA 2AJUH 4I77H 1I1RA 1RPQA 5DLML 4GAJH 4XVSH 4WW2C 3UP1A 1U8JB 4OKVA 3OWEA 3MRGA 1S7TB 4LCWD 3D85B 2OMNA 1D5MA 1S7VB 2GUOB 5IHZB 3B9KC 5D93C 4HKZB 4MJ6B 3PWPB 3QEGH 2ZUWA 3KG5A 5DUMH 5LAXB 2BJMH 4WI6A 3WUWA 1SM3H 5KANG 4FQXD 1ZHNB 3D3VE 2WAHA 4OGAD 3UJTH 2YD9A 1JPFA 5DT1H 2VXVL 1DBML 1KTRL 3SQBA 4XXDA 2FECI 4S1RL 2Q8BL 4XBEH 3HCVB 4I5BB 4U6TA 3TBVB 3MUGA 3GI9H 3WHXB 3BP6B 1F3DH 3IKCB 3S96A 3UTTA 4DUWA 4XWGL 3RY4A 5BO1L 1J88A 4U1JB 4ELMA 4MVBC 1Z6JT 4G9FB 2AJXH 4YFLI 3RTQC 4I18A 4PJEF 4XC3H 4U6HB 4X7DC 2VAJA 2EXYD 1N2RA 2V7HB 1KCSH 3ARFC 3CSGA 5IKCA 5MI0C 1A7QH 4XH2A 5GZND 1OP3K 3H9SD 1FVDA 1MCBA 4ZUTA 5MEOB 3SKNA 3IJYA 4RMQA 2DQGH 3MXWH 3QZWB 1B90A 1JRHH 4JFPA 3KGRA 3D0LA 2DTSA 5IEHB 2GFBA 4YDJB 1WCBA 4NBZB 4YPGB 1I8KA 4I0CC 4H26B 3SJVA 3IDNA 3LKQA 5IMOB 4BQCA 2GITA 3A6CH 5I1HL 4KJPC 4JDTH 5HGHA 1U93A 4P23B 4R4FL 3BH8A 5B4MC 1FPTL 5GIRA 1I1AA 3SY0A 4JFZL 12E8H 3O2DA 3H42L 1YMHB 5GGVY 5JW3L 4D0DB 5ILTH 4WV1A 4YHOH 1Z9LA 1C1EH 1MWAL 1WCQA 5ETUA 3ZO0A 5DEFB 3LQMA 1NJ9A 4HIHA 3QEQD 4QHUB 5DHVA 4JFED 1U8PA 4HJ0C 4HLZG 4RGMB 2DKMA 2GSGA 4N8VB 3O2VL 2YUVA 2HLFC 4QLRA 5C09A 3FKUS 4H25B 3MLZL 1A7BA 2QQNL 5FO7B 5ERWA 1BJ1H 1KJMA 4OCWL 5B38B 3O9WC 1FL3A 5HYJA 1P2CB 3BEVA 3BPNB 2ADIB 1HKLH 1RK0A 1ZHLB 4EIGB 4O00A 2WWMC 4WU7A 4OQTH 3NACH 3VXMB 3O11B 4Y8AA 1XEDA 4UTBL 4D9RE 5E5MB 3H3PH 2HJKB 1I9RL 2DYPD 3QUZA 3VWJA 3GK8L 2R2BB 4K71C 5HYSG 2DYPA 2ZG1A 3PV7A 3VWJD 2LV4A 5KSAB 1DQML 3EOBB 3SGEH 3H7LA 43CAB 2G5RA 3N85H 1DEEB 5GGTL 3NCBB 3ZHLA 1G0XA 3GMLB 3MXVH 2IH1A 2Y06L 5F7HA 1M1SA 4KRPD 5L9DL 3QA3A 5IFJB 2GAZB 4UDTA 4KTDL 4PG9A 1MRDL 1LO0H 4TPRH 2JIXB 4OLWL 2NNAB 5FKPA 1QFWH 3RPIB 2VLKA 1KB9K 3VFVB 1W72L 4MXWL 2IMMA 2Z91A 4M8VA 1FNEA 4X6CF 3DI3B 3T2NL 1FDLH 2AXGA 4IRSA 1JPGA 2D03L 1BAFH 5EH1A 3OJDA 4ZFZA 3PNWA 1JGEA 5IFHL 2DQEL 2HVJB 4DTGH 1FNSH 1F3RB 4OGZA 5LBSL 1II4E 1CYGA 1X5XA 1HCVA 4LPCA 4JREB 1J11A 3BP4B 3PGFL 4PG9B 3FT4A 1G9ML 3CVHB 1Q1JH 1N64L 5SV3A 1MFBL 1MQKL 3QA3B 4FTVB 1IAOA 1JWUA 3E3QE 2MJWA 5DURB 3VFUB 1N26A 2HT2D 5JLZA 3ILPA 4DGYL 4MXVF 5JTWA 43CAA 4FQ1H 1KCVL 5F7DB 2VQ1B 3DBXB 3FN9A 2EKSB 2FO1A 2GYSA 2FATL 1I7RA 1TZGL 2NYYD 3HB3C 5D7SH 2R4RL 3TJEL 3CLFL 5A2LH 3UTZB 3K74B 4OF6A 3WNOA 5A2IH 1BGXL 5CIPA 2FCBA 2PTVA 3QJHB 2VLJB 5EORL 1OARL 1RVFH 3GKWL 4NOBA 2PO6D 1JHTA 1IGCL 3K8LA 5IJKC 1VKXA 4L4JA 4PJIF 3D0VB 2V9RA 2MCPH 1GOFA 1HXMA 1RFDH 3ULSA 4RGND 5C0RL 1T04A 3FQWA 4D9QD 3MOBL 2CIIA 1U8OB 3VMPA 3G5ZA 3GJEB 4R90H 1HHHA 3A6OA 3QXWA 3O6FD 4N1EA 4AEFA 5EBWA 3EOYG 5D7IA 3WIIH 4YHKH 1A9BB 1CLOL 4PJHF 4I0PD 4F7EB 3BGFB 3P73B 4P2RE 2DQHL 1HEZB 3QDJE 2EDLA 3LB6C 4JHWL 4KK9C 4OLYH 3EO1A 4Q9RL 1IAKB 2FX9L 1E4KA 1A0QL 4P9HH 3LB6D 1MLCA 3LS5H 2JK5A 5JOFB 2XRAH 4KWUA 3U0WL 1TJGL 4PJAF 5C0CD 1OCWL 2OL3A 1JJUA 4RIRB 1KJ3L 2AV1B 1FE8H 3ESUF 2O61B 4YX2H 1S7RB 4H20H 2DBJA 4ZPTB 3GBNH 4FFZL 4KJYA 3WN5A 4N0UB 3I6KB 2BSSA 2JTDA 2O5XL 1MCCA 4P3DB 1PFCA 1XF2B 5F7EH 4X5XB 43C9B 1RHFA 3ARYA 4Z7QE 5J57B 1DQDL 3RY5A 4JPWH 2AK4B 5DC0A 4JFDA 5F7KC 2XFXA 5DDHA 4JJ5B 2XXCB 5DK0A 5D6DA 5I76A 2P8PA 2IPTL 5I16B 5HJ3A 3C8KA 3VXOA 1UQSB 1NGZB 2IF7A 3HC4H 3PE9A 3X13B 5ISZE 3MFFA 4XX1E 4D9QE 1EHLL 3EYUL 4QXGH 2ESVB 4J2XA 3VE0B 2EIBA 5ESQA 3QNZA 2OL3L 5DQ9B 4Z7NE 3C5ZA 3S96B 5HVHB 1ZGLB 5IWLA 3UTOA 4Y7MA 5HGDB 4LLVB 2H2SC 4ORZC 3MUGB 1BIHA 4YGVA 1WV7T 2BRRH 1A14H 1C5BH 1S9YB 5DHXB 1F6AA 2PETA 2CGRL 1BF8A 1U6AL 1IKNA 3Q0HA 3CD4A 4IMLA 3GMQA 1NFKA 3QIUD 1ITCA 2ICCA 5DUPL 3P4NB 5DA4A 4LIQL 5H35A 1BLNA 4K7PX 1YQVH 5TQ2L 1FC2D 4I9WE 4BZYA 1G7MA 1IT9L 2D7QA 1DANT 4P99A 2AXHA 3OGCB 3TIEA 1XF4A 3FT3B 3K4ZA 4IBLT 1SJHA 3I75B 1N5AB 1D5IL 4N0RA 3O4OC 3VWKB 1FZJB 2OZ4H 1A22B 3AFLA 5GS0L 5CD5C 4K7FB 3MLUL 3U7WH 3MFGB 4RAHA 1UJ3C 3QRGH 3S88H 3DHMA 1PG7L 3P0YH 4NT6B 2H3NA 4XPHH 3BGAA 5GZOD 3NZ8A 2X4RB 4XXCC 4Z7OE 5I19L 4Z5RA 4H8WL 4J6RL 4U7KA 5D1QA 2UWEB 1SMOA 3JTSA 3MCKB 5F1OB 2VC2H 4QHMA 5J13B 5B8CB 2Q7NA 2DQCL 3QDMB 4KROC 5ENWB 1R3IH 2QLVB 3JXAA 2VXQL 4ZDHB 5IB4B 2OS7A 5C3LD 5HYEA 3LPWA 2X41A 3NCJH 1RULH 3O3AB 3L1OH 3HPJA 1EHAA 1Y18B