3PXJA

Tandem ig repeats of dlar
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
199
structure length
199
Chain Sequence
AAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase Lar
publication title The Immunoglobulin-like Domains 1 and 2 of the Protein Tyrosine Phosphatase LAR Adopt an Unusual Horseshoe-like Conformation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 35
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pxjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pxjA02
2AJ3A 2OXGA 4PIRF 4TUOB 4FFVD 4D0BB 4LK4A 2UWEF 2V5RA 1QFWM 2CGRH 3IKCB 5E94B 3GMMB 1UEYA 3TPKA 1I1AA 4N5UA 3DVIA 2F53B 4ZFGH 2X09A 1F4XH 1GGCH 4ZXBB 2A6KA 2PO6B 4M03A 1DUZA 4KHTL 3I9GL 3PWPB 4OZGA 5AUMA 4BZYA 3B5TA 1XF4A 3KHOA 3KDMA 2D7TH 1RZ8A 4IRSC 4C58B 4QY8B 5J06A 1BWWA 4L8SB 2CKBB 2XKUA 4LKCA 1MRCL 2Q86B 4H1LB 4AEFA 4FQCH 3UAJC 1AXIB 3D2UA 5D7KD 3DURA 5KSBE 3H9SA 3BN3B 5EU4B 1JWMA 3S9DB 5DRWB 4FQQA 3SE8L 4K71B 4NZUH 5D9SB 1R3IL 2P5EE 3O2WL 1OTUC 3QQ9C 4LQFL 4P2QB 3EO9H 2WP3T 2VABB 1CBVL 2M8XA 1EUTA 3NZ8A 3QHFL 2D31B 5D5MF 3W39A 1SEQL 4LSUL 5D7JD 4PGDB 4PLOB 2V9QA 5CZXC 2RFXB 1SY6H 3STZB 1N64L 1F8TL 1S8DA 3HNSH 4QRTA 5I8OL 4S1RL 4N90D 1WICA 4ZFOL 4DN4H 1YN7B 1ACYL 1MHPH 2E8ZA 1N0XL 3QXTA 4HIIA 3QDJA 1ODAA 1KN2L 1KPRA 3GJFK 1HQRB 3E6FB 2NNAB 1MVUA 2IPKA 2Y72A 4KAQL 4L3ED 4TVSa 1E28B 1MI5B 5A1AA 4RA3A 2WWMC 4TNVK 2C4FT 5DD0L 3TVMA 2Q8BL 4YDKH 5KZCD 2XTJE 1CT8A 2GUOB 3B3IA 3LD8B 4OFKA 1H0DA 4OIAA 3FQUA 3BGFB 4TQEL 3CD4A 3UP1A 1MY5A 4LDEB 4G7VL 4QXUL 5D2NB 1E4XL 3GO1H 4XVJH 3U48A 4XVUD 5J11B 1U58A 2AXHA 4OKVA 3KXFE 4TNVF 5I1CH 3UMTA 4IRJA 4GG6F 3F5WB 2BVPA 4KK8D 2IFGA 4R97B 5EO9B 1L0XA 2A9ML 5I2IA 1ZSDB 2EYSB 2FBJL 1T1WA 1HKFA 5FO8B 1VKXA 1IAIH 1BF2A 5F3HB 2BNRA 3MXWL 4X6DB 5D5MA 1DQDH 1I4FB 4YK4B 1O0VA 2MHAB 4LARL 5HHOD 5MP6L 1R0AL 1A6VL 1P5UA 2AV1B 2L0DA 3B9AA 2PYEA 5J1SC 1XGRB 2P1YA 3K4AA 4PYHA 3T3ME 3SQOH 3FT3A 5EN2B 3X3GL 4JO1H 3QXAA 2ESVB 4XCCH 1VFAB 3MV9B 1JWUA 3MV01 3RX5A 4DGYL 4PJDF 4GBXA 2KPNA 2OZ4H 1BECA 4Z7VE 4Y5VB 2VLLA 4MAYD 5FGBC 3BP7A 2ICWI 4RWHA 5FK9A 4HQQH 3WYRA 3DECA 4FFWC 1FO0A 2DDQL 4WTWA 1LE9B 3OKLA 2I07A 2VUYA 43CAB 1AKJA 3ZE2F 4O5LH 4JKPL 2ZCLL 5TE6L 4LSVL 2BFVH 5HGDA 4QNPE 1KG0A 4WWKB 2YS4A 1DZBA 1CDBA 3K46A 3ULVF 1D5IL 2R0LL 3ZKMC 4NHCH 3C6LA 3ES6B 2HLFC 1U8PB 3U1SL 4GG6A 2CO7B 2B2XL 5IEKB 3QUYD 1G7IA 1NGQH 1P4IH 3AB0C 3DHMA 1P4LA 3FHQA 2BY3A 2WZPD 4NN6C 4OLWH 2C4FU 3RX8A 3VXSD 5JO5B 1CFVL 4NYLB 3VRLF 3GGWB 4D3CH 5E4EC 5BJTB 2O5ZL 4WEMB 5IESL 4QCIB 2FL5A 1Y6NR 4JRYD 5CLTA 3A6OA 3DBXB 3DUUB 3HI1B 2Y5TA 3SEPA 3GFUA 2NY4B 4K8RD 4WV1C 2VIRA 3SDAC 3QG6B 3IXTA 4PJDA 3EDEA 5ESAA 4RBPH 3AMLA 4YXLL 1EDQA 3QISA 2AW2A 5K9JL 2LAGB 1UQSA 3WXVH 4UT7L 2JCCF 5EOQL 2H8PB 3ARDC 1WEJL 3V4UH 1P4BL 3QDMA 5E8OA 4LEXH 1S9YB 3EYQD 3D39D 2EDRA 3KJ6H 1DN0B 1T66C 4PP1C 3KYNB 2HTKC 3BEWB 4NO0D 1CD1A 4XI5C 3C60C 1TPXC 4F57H 3OF6D 4DGIH 4I4WB 2NY6C 2OXHA 1BJ1J 4JN2B 3SY0A 4YGVB 4D9LL 3K4ZA 3MRGA 2KZWA 5I1AA 1NFIA 3HE7C 3B8SA 2OQJA 1MCPH 1EFXD 1JTTA 5MENE 1L6ZA 1GAFL 3LS5H 2O93L 3S96A 1HHHB 2J4WL 1OM3H 1QYGH 3ULUD 3HAEG 1HYRC 3BKMH 3IDXL 3RRQA 4NO3A 3O9WC 1D5ZA 1D9KB 1NCWL 2RB8A 3HZVA 3JV6A 5HHMB 1IGIH 3VRJA 5D71L 4JAMB 3QIBD 3O6FB 5T5NF 3QNZB 5JNYA 4PJBE 4XAWH 4LP5A 2NXZD 2MQ3A 3ZDXF 3X12B 2Z8WC 5EZLB 5C09E 3RGVD 5CZVL 1FVCB 2EXYD 3CJJA 4HAGA 1QFUH 1WZKA 2JCCA 3SKNA 1UM6H 1FYTE 5DUML 4RMSA 3CMOH 1U8IB 2GJ6E 2Y07H 4HEME 4L8DA 1VA9A 2R2BA 3T4YB 1U8QA 3HB3C 3X14B 3RKDC 4HK3J 4LCCB 2FEDC 2AERT 5C9KA 3RUGE 1P6AB 2K3TA 1M71A 1CXKA 4NQXB 4EZMA 1D5XA 3FB5B 5EU5A 3ARPA 4QHUB 2EE6A 4H8WL 4I2XB 1TZHA 1AD9A 5IHLB 4XB8A 4G9DB 3FN0H 5DUBA 5ALCL 2DD8H 1KCSH 3P3YA 4Y16D 4JPVL 1NQBA 1LP9B 2H41A 2OSLA 3CXHK 3ARYA 2D9QB 1FE8H 2QR0A 3F12B 5FUOL 5D7JB 1IM3B 4MLIA 1I8LA 1VPOL 4PGEB 5HDQH 1S7QA 1A9EA 3KYMB 3KYOB 2ZUSA 5AYQA 4P48A 2DJ4A 4NQDE 1I8IB 1S5IL 5D7LD 1FO0H 3WJLC 3P9WB 4L3EB 4WHCA 4GQ9L 1FAKT 1AIFA 1F90H 3T0BA 3TYGL 2UZIL 4NQCD 3QXDB 4WNQB 3SDCC 2E9JA 3AM8A 2DJSA 4WUUD 1JK8A 3L3IA 3OKYA 5D1ZB 4RAUA 3FB8B 1UT9A 1PG7L 3TIDA 5DJZB 4N0YL 2DQTL 5C0JA 3T1WA 5MEOB 1G1CA 3SDDD 2Z91B 4ZDHB 4NWUH 3V6ZA 43C9B 5DGQA 1GZPA 4PB9H 1T2JA 1C12A 1CDYA 1XF3B 2ZOLB 3HRZA 3LB6C 3WHXA 5CD3B 3MRBA 1JUFA 5F9OH 1CICD 3CLEH 2Y25A 4IMKA 4I5BB 4PJFB 1I1FA 2E7LC 2VLKD 3MBED 3MV8D 4HJGB 1P2CB 4MD5B 4H26B 4PRID 4GMTL 3FO2B 2YPLD 3IDNA 4G3YH 2BSTA 3PQYD 5CIPA 2JF1A 4PGJA 5FHBL 2EDYA 2PXYB 3GB7B 2V7HA 5CP3A 2DKUA 1MFBL 4F37K 2AJXL 4FRWA 1T6WA 5AAMA 4CNIB 4AIZA 1DEEB 1RZIA 4EDXA 1DSFH 3NCCB 4GMSH 4Q6IC 2A74A 1RZFH 1X5AA 3HG1B 3NCMA 4PRBA 4U31A 2A1WH 2AJYL 3KNBB 2VDNL 3ULVH 5FM5M 2GEEA 3BAEH 3EYVA 2Z31A 1PFCA 1R5IB 1HINL 5JA8B 3BPLC 4HIEB 3BRGC 3QNYA 4UTAL 1M6OA 2DQIL 3FONB 1RIVH 3GMOB 4LEOA 3TV3L 4PLNC 3MR9A 1OD9A 3IJYB 4LVNB 3O3BB 4PJCE 4F7TB 5ENWA 2A6IA 3DVNA 3V8OA 5IT2H 5AZEL 4YHPB 3QR2A 4CVUA 1FNSL 4P9MH 5EIVA 5F93C 1LO0L 3ARUA 2R8SH 2V17H 1MCSA 3TA3D 5FO7A 4HG4K 4PY7A 1RUQL 3B9KB 4JFDE 4M7ZC 5DQJA 1MF2H 1G7HA 2VDML 4JGUA 3FRUA 4JRYB 2ZUXA 4LGSB 3T0XA 3NTCL 2XIDA 5E8NA 1CD8A 1K5NA 3VI3F 4GKZB 1QBML 5L88L 3JWDH 1WAAA 2ICEB 1W8OA 2BZDA 3MOBH 3U30C 5JOEA 2HAZA 4OCRL 4JB9L 2R4SH 1ZVSB 2B39A 1Z3GH 1MCOL 4OIIL 4MMZC 3RVVD 1URLA 1WC7A 4YEEA 1E4WH 3N9GH 3HZYB 4KUCD 4LLWA 5DURD 2IADB 5E70A 2IAMD 1RUMH 5IFAH 1RUPL 1GOGA 4MSWB 1V3JA 4NO0B 3BSZH 4PG2A 4NCC1 4PJAE 2OJZL 3UTTD 3S88L 1CLOL 2B1AH 3B9DA 3SGEH 5DHVB 3MJ7B 3PDOB 3PABA 4WDIA 3JV0A 4NZRL 4B5EA 35C8H 5IJVA 1EFXB 2DAVA 5C0FB 3B2VH 3E2HB 4HS6A 2WBJA 2EYTB 2HWZH 2DBJA 4FFYH 5KSUB 3ZTNH 1BAFH 1F02I 2R56H 2YMXL 2R39A 1EK3A 2XWBA 2EE9A 2Y6SC 4LVEA 4FQ2L 5BZDB 3QIBB 2CDGB 4OZGE 2W1NA 4M3JA 3CSYA 4HUMB 1IL1A 1C08B 4WRLA 3MJ6A 1F4YL 4NKMB 2I9TA 1AGEB 4NOBA 1INQA 4NRXB 1A6UH 1MRDL 1OGAE 2KBGA 4XGZB 5C0DA 1KTDB 5IHUH 4HUVA 3H9SE 4JKMA 3QFJD 2OTPA 4JY5H 4U4BA 4FQXA 2VKXA 3U4EB 4P5TA 3NFNB 1MELA 1DQLL 4EI5A 5LXGL 2W38A 1FSKB 3BISA 2WBKA 3QUYC 4FZ8H 3VXUD 5F7DA 4QTHB 1FZJB 1LD9B 2I26N 4JFHD 2EKSB 1U8HA 3ZMRA 4BFIB 4R7DB 4DN3H 4KJWC 5TH2B 3JWOH 3FMGL 2MOVA 5IHZB 4PJHB 2XICA 5L2KA 1D6VH 5C07A 1DQTA 2X4OB 1JVKA 5KG9B 3OAUH 4Y16B 2GITB 1UM5H 3SJVE 1T2QL 2DQEL 4B50A 4IRZL 2XN9A 4HMDA 3BPCB 3EYUH 1A9BA 1N2RA 1MJJB 4RIRB 4NIKB 4PJ9A 3T0DA 3EYQC 2LTQC 3C5ZA 4OUOA 3PP4H 4JFOA 1AGFA 5CIPH 1MEXL 5DT1H 3LPFA 1DVFB 1JGLL 5CP3H 2YUZA 3LS4L 1T0PB 1W8NA 5E95B 2GK2A 4RMQA 1YYML 3V6OA 2ICWJ 4LCUA 4UZGA 4Y2DC 3C09B 5D7LB 2ARJA 3GEWB 1OQXA 1SJXA 3GSRA 2VN7A 4I77H 1JZ3A 4LSPH 4TTDD 5ISZD 4P59L 3F7QA 1I9JH 4QRPB 3KS0J 4YHZH 5F9JA 3MNVA 1YEGH 3V4VL 5IP4A 1HILA 4Y4FB 4ODWA 2OL3H 1UEMA 2NZIA 2QL1A 4CMHC 2PYEE 3HI6L 4XCNB 4PD4J 4MVBC 2NXZC 3S97C 1BIIA 5GS0H 1QFWL 1NBVH 1O7VA 2B5IC 1AXTL 2WWKT 2APWA 4KQ3L 4MXQD 5H37H 1KPUA 5AD0B 1PLGH 3IDGB 4V2CB 3RGVC 3SDDB 2EXYC 3MACL 1IQWH 2ZZUT 3IVKA 1D6EA 1MCKA 2DB8A 1ES0B 3ARED 4X99A 1F00I 3SO5A 1CICB 1K4DB 1CLYH 1KCKA 1OGTB 2DQCL 1LO4L 4LF3A 5C0RH 3KGRA 4X4YA 1DQJB 2PUQT 2FDBP 1EZVX 2VLKB 3MBEB 3MV8B 4NO2B 2O5XL 4JJ5B 5HVFB 2FIKB 3CLFH 5EDXA 4PRIB 5BS0A 3LN4A 4TUKL 1CE6A 2BMKA 4ZFOB 5HYJA 1ZT7A 5GJTH 4NC2B 4K3JH 1EO8H 4G6JH 3O3DB 5D93C 5CEZE 3LHPL 4LPTA 4J3TA 4FXKA 2OTWB 1MJ7H 1JCKA 3M8OH 5IB3A 3LN9A 1G1YA 3HR5A 5AWNH 1QACA 3IFNL 5I75C 3LMJL 2NX5D 1YECH 4U3HA 1Q94B 5IMMB 4RGOH 1VADA 2GSGA 3VFSB 4HKXB 1N8ZA 4HWBH 1KCRL 4RNRB 3DX9B 1MQKL 2AJSH 2CK2A 4X8XA 4NQSB 5T1KD 5KVDL 4H25A 1OPGH 1OP3H 1KJVA 3MUHL 3NPSC 1RUKL 4HK0B 1G6RB 4JPWL 5I1GL 5TQ0L 1A14H 3MX0A 2IPUG 4M61A 2ZJSL 1EHLH 4H0HB 4LCWA 3D6GA 5IF0A 1TVHA 4KZDH 3TA3B 2VZ1A 5ETUA 3MFFB 2XY1A 3QDME 3NMEA 4LPWA 3NAAL 3I50H 4M8QA 4X6FA 3BD5A 5C0BD 1T1ZB 4M48H 4D0CA 3DV4B 4RRPA 5I1JL 3NIGE 1ZV5A 1AP2A 1R24A 3ZYJA 4D94A 4GXVH 1GGUA 4P3CH 3AY4C 1IGTA 1JHLH 4M93B 1S7SA 3ULVE 1EJOH 3BVNB 1CR9H 5EU7E 1NCBH 5F7MC 5F1IA 3X13A 4U6VL 5JW3H 3VJ6A 4TVPE 3ZHLA 5GGVY 5DURB 3E0GA 3LZFH 3GSNL 4NWTH 3DVFA 4MYWB 3AS1A 5BW7A 1QSFB 2X2YA 3CH1B 3UTTB 3CX5K 4DOHB 5I19H 1JRHL 4XXDB 4X4XB 4NO5B 3TYFB 5SX5H 5KSAA 1NGPL 4N1CA 1CGXA 3WFBL 5IROA 4I3SH 5FKPA 2WSKA 5J9PB 5CJQL 1RSFA 4TOYL 3RWEB 4X80L 1HK6A 3H42L 4Z76B 4P5KB 2R69H 4R96A 4V1DE 4HMCA 3ULSA 2X4QA 4QRSA 2PETA 4C56D 3NIDF 5IB1B 5E03A 2JCCE 4IOFD 4M5ZL 1QBAA 2P47B 1QLRA 4W81A 1CD9B 4PGCB 3VCLA 2V2TB 3V52L 3MLTA 2KDGA 3HCVA 2JK5A 2XV6B 3UXFA 4XWOD 1CYGA 3OG6B 2VDOL 4BH8B 4F8QA 3G5ZB 3BH9A 3BIKB 5I8KL 4YAQB 1CK0H 3OBAA 3WKMH 3G6JB 1C7TA 3DHJA 2VXSL 1BD2B 3SKMA 4R8WL 3LY6A 3QFJB 2XWTB 4ZPTA 3HI5L 5A40E 4M8VA 4Q9RH 2Q87A 2QSCL 1YN6B 3TBYA 4HS3B 4XP6L 3WJJC 4XH2A 3IXAA 4ZTPL 3MA9L 3SKUD 2C4XA 1XR8A 2YC1A 4DFIA 5HY9B 3VXUB 3MRMA 2OCFD 1B0RB 1T4KA 5DVMA 3O3AA 4G6KH 5DI8B 5ITFA 4R0LC 1I7RB 2YKLH 4WO4A 2OX5A 1ONQA 5B38A 5JQHC 1A3QA 4RQQA 2HMID 2VDKH 3WNKA 1T0MB 3OPZH 1FZKB 1SYVA 5E5UB 3QWRA 2R0KH 1JF1B 4XB7A 1FL6A 4KRPD 5GIRB 2R1XB 1VGKB 4NBZB 4LVOC 1Z0MA 1RZJC 3AUVA 4N1HB 3BYYA 1FZOA 5K9QG 5D70H 4NRZA 2IAMC 4OZHF 1N26A 3MPCA 2P44B 1BZ9A 1A1OA 1UVQB 4QF1B 4OF3A 1AE6H 4RWYL 1WT5C 5HHVH 2HRPL 1N4XH 3DPBA 1EUUA 5KVMC 1CIUA 4GLRH 1SBSH 1A6ZB 4F9PC 3MJ9A 4FQJH 3PGCB 2DLEA 3RQ3A 2AK4D 3O8XC 1E6OL 3DNKA 2H2SC 3O4LD 3KPLA 1RQ5A 3VXQA 5E6IC 3S35L 1P7KB 5I1LA 2FR4B 4MA1C 1PDKA 4U1IA 2R2HB 4PB0L 3MLVH 4OCLC 2R0ZL 3AXLB 3NN8A 4XXCC 3WIIH 5DFTA 3GM0A 5C8JA 4PJ5A 1LWRA 1A3LL 1UM4L 2Y7QA 2BRRH 2FIRT 3IU3B 3I6KB 2ATPA 3RY6C 3TN0A 3V6BR 1MLBB 3TZVC 3D3VD 3H7LA 3EJYD 1H5BB 4IBLT 2OR9L 4BSVB 3WIHL 3TLRA 4JFQA 1WFOA 4DJMA 2VZTA 5DHYB 4JG0H 3AREB 5T3XD 3MGOB 3NACH 4OZHA 1MHHB 5DJDB 1XGPA 4YDJB 2R23B 1WK0A 2O61B 2BX5A 5TPWH 2W0FB 4FS0A 3RPIA 3TO4A 1DBJH 2E3VA 4XRCA 1G0YR 5IVOA 4ZAKA 1MJ8H 3CFBB 4QHNA 2X4PB 1JGVL 3WFHB 3M17B 2BCKB 4YPGA 1OCWH 1U8NA 4M1GH 3FKUS 4RFEA 3QB7C 4CN6A 2ZG2A 4OM1L 1QRNA 4WI7A 5DSCB 4YBHA 5SX4H 3WDJA 4JCLA 3EJZC 3SO3B 1BQLH 2NX5B 4MA7H 2IC2A 2P24B 2FSEA 4AENB 5IVXB 2R1YB 3OKEA 2CUHA 3G04A 1EGJL 5E08L 2UVFA 4R90L 2BSSB 4ZUTA 3P30L 3PWVA 4X5XB 1NCCL 4X98B 1KTLB 5T1KB 1X5YA 4M3KB 3L7FA 5FB8B 1ZHNA 1U9KA 1WAAE 2IG2H 5C08A 3L3OA 5T1DH 3AU1B 4PV8A 1UB6A 5ICZB 4PJ8C 4QHMA 2ZCHH 3KXFD 4HH8A 1MPAH 1ZGLM 4OSUL 3PNWA 4EIZC 1PEWA 1T80A 2AJVL 1AJ7L 3HNTL 5HHNA 5DJYA 4DUVA 5ITBH 2DWDA 1S9VA 5EBLA 3FFDB 5KS9B 5E9DA 3LEXB 3G5YB 5IJKA 4JREC 5FXCH 2QKIA 4XC3H 1PX3A 2C3VB 5JW5A 3I85A 4R4FL 5H94B 2NW3B 3MLSL 3VFGH 4K7PL 3I84A 2GFBA 1LHZA 4LMQI 5LWYH 4MXQC 1CDCA 5I1HL 1AY1H 3QPQD 3CFCL 1UWXH 1YNLH 1ZLWH 1GC1L 5FDWA 4W4OA 1TTGA 1WBYA 3DMMC 4P9HH 1UH4A 5IFHH 1GPOL 2VL5B 1KXQE 3KPQB 4EEEA 2XRAH 3OB8A 5D1QC 3MCKA 2ZUQC 3RFZC 4TUJB 4RGMB 4HC1A 3HLAB 4NUGL 1HNFA 4P49A 4JGJA 4G42A 3T77A 1KIRB 2NY3D 2Q3AA 1NMAH 5EIIA 1WFUA 5HHXH 4HV8A 2DQGH 3PXJA 4WEBL 3RU8H 2K9UA 1LO3H 4HKJB 4TUOA 1FJ1B 4D0BA 4TSCH 1PGRB 3IKCA 5E94A 3FQXB 1WIOA 3GMMA 1LVEA 3CC5B 5EA0L 1GIGH 5C0AD 5MHSD 2F53A 4WFHE 3RVWD 4ZXBA 3MJ9H 4YHLH 3MLYH 5F70A 5EU6B 1ZHKB 3PWPA 2DM4A 4LHUD 2JJUA 2K1MA 4KI5C 5L2KE 3X3FL 1E4KA 4LSTH 4I48B 4XVSH 2ENSA 4L8SA 2CKBA 3QUKB 5C07E 2GK0A 1C5DB 2Q86A 2JELL 4H1LA 3MRDB 4AL8L 2AEQH 5GZND 1RMFL 3QIUB 5EU4A 1UXSB 3W11D 5DRWA 4MXWL 4DGVL 4RMRA 1CFSB 3MRNB 3RVTD 2F5BH 3DIFB 4AYFA 5D9SA 2ZCKL 4CW1B 3L7EB 1A7PL 4P2QA 4WHYG 3RAJL 1U2HA 2VABA 2LVEA 5EBWB 4LCIH 1F4HA 4JO2L 3TBTB 2D31A 4X6DF 5TF1L 5K33A 4PGDA 5JXED 4PLJC 4KKCD 5HBBA 2HFGH 3SE9H 3RP1A 3STZA 4FQPA 3V6OE 4LHQB 1YEIH 2Q1EA 5SWZB 3WNPA 3SOBL 4KRPB 3S6CA 4FA8A 1WQVT 3MSPA 4RSVA 5ANMA 2XOTA 1CQKA 2X7LB 4OLZH 2XZCL 1HQRA 4HBCL 3E6FA 2NNAA 4HKBB 1FV1B 1CL7H 4YUEL 2ZKHH 1Y18B 1MI5A 1JHKH 3VH8B 1XGTB 3HKFA 5FV1L 1HH6B 4NJ9L 1T0NB 1P53A 4KPHH 1W72L 3VFUB 2VISB 2GUOA 3FHAA 3BRDA 1FZMB 3O4LB 1Z0NA 5D2NA 4ZO9A 4Z0BL 4NM4L 3RWHB 1TJHH 1ZEAL 2APFA 1DANT 3U6RB 2AJUH 4IOFC 5F9AC 3F5WA 1ZSDA 1SMAA 1TIUA 2EYSA 1G7LB 5FO8A 1EVUA 5GGSB 5F3HA 4IMLA 1I4FA 6FABH 1F3DJ 5L2JB 2MHAA 3OR6B 3O4OB 2F19L 5BMFH 3D3VB 5BS0E 5AG8A 1RHHB 4UIMB 2AV1A 2QQLL 1XGRA 3VFMB 1JMZA 1FGNH 4CVZB 5EN2A 1DBML 3C60B 1T3FB 2ESVA 1VFAA 3MV9A 4R2GD 3PGFH 1I9IH 3FT4B 3S34H 3IFLL 4J7RA 4XCEB 4BZ2H 4Y5VA 3QDAA 4AMKL 4LOUD 1ZLVK 8FABB 3QBTB 3SDYL 4RFNB 3MREB 3TBWB 1CXIA 1Y6KR 5LGHL 1YYLH 5BVPH 4LSRH 1LE9A 3VI4E 1M7DB 4C54A 43CAA 1H8NA 2IPTH 3SGJA 2OP4H 1BEYL 4HF5L 4H5SB 5FHAH 4MB5A 5JHDD 2V2WB 4WWKA 1I3GH 1YNTB 3U7YL 3ES6A 5DMIH 2XZQH 3DETD 1WTLA 1U8PA 4ZTOL 4HC1H 2L4OA 2FH8A 1FAIL 5IEKA 1NMCB 3OR7B 2E6JA 3HC4H 1DBBL 2IANB 1YPZF 3FO0H 1JPST 4NDMB 3BH8B 3DTXB 5JO5A 4NYLA 3GGWA 2H1PL 3P4MB 5BJTA 4QCIA 5D96B 5E7BA 1PZ5B 1WZLA 4K23H 3FB6B 4ONOA 5D7SL 1MAML 1RIUL 3DBXA 3C08H 3UPRB 1CLCA 3DUUA 3HI1A 1DANU 3QG6A 2KQNA 4HXBL 5KN5B 1VGEH 3ILPB 1MAJA 3MODH 2H8PA 3LPWA 4NFBA 3P0YL 1EMTH 4MNHB 3BGMB 2CKBH 1S9YA 1VEPA 1CVSC 4R3SB 5A3ID 5J0BA 3SBWA 4EQ2A 1DN0A 4H1LH 4WU5B 3KYNA 3BEWA 4OCNC 4AIXA 4LU5H 4EBQL 4F7CB 2HVKB 4GRWB 4I4WA 4AM0B 1H3PH 3V79C 4EN3B 2A9NH 3GRWL 4JN2A 4UQ2A 4YGVA 2Y06H 4PUBH 5E2UL 1Q0YL 4ZD3L 2QQQA 3SKOB 5KVFL 1HHHA 4P4RB 1NEZB 4XPFL 5J3HD 1T03H 1D9KA 1LP9F 3U2SB 1OAYH 3K7UA 3TBVB 2VZOA 3MUGB 1DLFL 1NAKH 2YA0A 4JAMA 3IDYB 3O6FA 5J1AB 5GJSH 4JM4H 3QNZA 4Z77B 2VLJD 4CUCA 2YHGA 1RK1B 4ORZC 1QKZL 4LSSH 3X12A 5EZLA 2JJSA 4R7NB 5FYKL 1L7TL 3ZDYF 1FVCA 3TWCL 4JDVB 4LPCA 4BQBA 2J8UB 1UCBL 1JV5B 3HZKB 2J5LC 3UJTH 2AXFB 3W81A 3CFJB 4LPXA 3T4YA 2UUDK 5CILH 3X14A 4KKBD 1FCGA 2VZVA 4LCCA 4YDLC 5KJRH 5ALBL 5TE7L 2XTJC 3WFEL 3ZHKA 1XIWC 1A7NH 4DKFL 4KDTC 4NQXA 3BPOC 2A6JB 3FB5A 4PREB 1TQCB 4QHUA 1X5GA 5I1IH 3GSNB 4G9DA 1S7VB 2GSIB 1G9ML 1IGML 5HI5D 2RIKA 1R3JB 1LP9A 2X89D 4R4BB 1MWAL 2VDLL 4XP9L 3ESVF 3F12A 1IKNC 5D7JA 3CU7A 1F11B 1U3HC 1IM3A 4PJFF 5B39B 4NKIH 5J8OA 1NL0L 4KKLC 1UA6L 4PGEA 4JRXD 3GUTB 2D7OA 5L0QC 3KYMA 4RGNE 4DKEL 3KYOA 4KQ4H 4QKXB 4U6YB 2NY2D 3PL6D 2HP4A 1I8IA 3BPLB 4M9PA 3UPAA 4I0PD 1KCLA 3I2CH 3VXMD 1X5FA 1Q72H 5L7XL 4PJ5E 4L3EA 4M62H 4YFLI 4BM7A 2IGFH 5GZOD 5F6IC 4Q9CA 3QPXL 4G8GD 3QXDA 4L4TB 4WNQA 5JW4Q 1GGIL 4W6YB 3V4PL 2A2QT 4LRIA 5D1ZA 4KROB 5DWUL 1XF1A 2F15A 3QEHB 1PBYA 1JWSB 5DJZA 3HUJB 3NVQA 1IZKA 1HH9B 3RA7L 3EHBD 5MEOA 4NUJB 2UZXB 2Z91A 4ZDHA 5MERB 43C9A 4OBRA 4Y4KD 4AQ1B 4OZHE 1BBDL 2ZOLA 1XF3A 3MMEB 3L5WB 1ZAGA 5DQDL 3WFZA 4I5BA 4J3VA 4PJFA 4QOKB 4OCYL 1QFOA 5DA4A 4HJGA 2HT3D 1P2CA 4MD5A 1MFEH 2D4DA 4H26A 4XNMB 3FO2A 3KPSB 4UINH 4B7IA 2MPAL 4ZUUB 3QRGL 1CN4A 5GZNC 1QRNE 2PXYA 3GB7A 4M6NL 4OLVH 3FO9B 3BDYH 3QDJD 4XP4L 5IBTL 3MLWH 3RVTC 1A7RL 4CNIA 2BHZA 1C1EL 1DEEA 4HEPG 3CFDB 5MI0B 3MROB 5ADOL 1AD0B 3HG1A 3KNBA 4LPVA 3TVMD 2VSDA 3U0WL 1R5IA 3NA4A 3TPUB 4HIEA 4KKCC 4JPIB 1YMMD 3NFSL 3QHZL 5C08E 3UJIH 3GMOA 4X7FC 5GISL 4WJ5B 3QSKB 3IJYA 5D72H 3O3BA 4NHUB 4F7TA 4YXHL 3ULUF 4UUJA 1XT5A 4IRJD 1NLBH 4Z78B 1H8SA 4YHPA 2FNBA 5E1AB 5HI4D 1Q0XH 1KCUH 2BNRD 5GGRA 2DTML 5E9DE 3VXSA 3B9KA 1RHFA 3U9UB 3FN9A 4H0GA 5F1NB 2WBWB 5GHWH 3TP4A 4JRYA 1DQQB 3WO3B 4GKZA 1B6UA 3L3DA 3GMNB 2V7NB 2JB5H 2ICEA 3PHSA 2DM7A 5F6HI 2EC9U 2FX8H 1VACB 3VGHA 1ZVSA 1WBZB 4X5WB 4ONGL 3CDCA 4WUKL 4KZEL 2W0LA 5JIIA 2DQFB 3HZYA 1QBLH 2IADA 4KHXH 1CS6A 3D39A 5E99L 3SCMC 1QHPA 3MRIB 4MSWA 3MGTB 3U0TB 4NO0A 2X1PA 3OF6A 2CDFB 4K9EC 1AKJD 5DHVA 3MJ7A 3PDOA 4PJHF 5FYLD 4OI7A 5DD1H 3JBG7 1S7RB 1GGYA 3LKSB 4QEGA 1EFXA 3NCJL 2VZSA 4OGAC 3KYKH 5C0FA 4KK9D 3ETBF 4U1KB 3C6LD 1MOEA 2EYTA 3AGVA 3D5OF 5KSUA 5E2JA 3KLAB 4HIHB 4LOUC 2F53E 5I74C 2F8XC 3VG0H 5KTEH 1MFCL 5ACMA 5BZDA 5JOPD 3QIBA 2CDGA 3CFEB 5C70A 2VLJB 3IS1X 4XAKE 3QO0B 1I7TB 1C08A 4GRMB 4JFPB 4NKMA 5I1DB 3WV0A 1AGEA 4YWGL 4NRXA 4J3XA 4ODVL 4LNRB 4OD1H 4ZOEA 4XGZA 1KTDA 4KH2A 2EDFA 4CMHB 1VCAA 4GKNB 3U4EA 1ZA6A 3NFNA 4G5ZL 2B7DT 5DVOA 2VXTH 3MLUH 1TJIH 3BI9X 4P2QE 4DW2H 1F6AB 3DO3A 3L6FB 1DJSA 4O4YH 2WUCH 4DAGH 1TZIB 4S10A 1FZJA 1LD9A 1BQHB 2EKSA 3X11B 3OMZA 4R7DA 5TH2A 5HYSB 5IHZA 4PJHA 4EDWL 3ZYZA 3AAZB 1NSNH 4I3RL 1PKOA 3PDGA 3NA9L 2VE6B 4XMLH 3ULVD 2DQHL 1ACZA 2W9LA 4YX2H 2PW1B 3ZKQD 2X4OA 5ANME 2I60H 3WCYA 3QI9D 5BV7L 5KG9A 1ZHBB 4P23C 4Y16A 2GITA 4M7LH 3FO1B 4XHJD 1PY4A 1YEEH 3BPCA 2YD5A 3SHSA 4YHYC 3QWQB 4O58L 3TO2B 1MJJA 3FFCE 4KJQC 4RIRA 5DJAB 1MI5E 1EEYB 1JPSL 2XTLA 5IGXH 4OUUB 5J57B 2ZPKL 4WW2B 4JRXB 4YZFE 1CQYA 3U7WH 4OI9A 4EUPB 5CFHA 1DVFA 3BQUB 2NY2B 5D2NE 4QWWC 3WNLA 1NUNB 5FYKD 1JNHB 2BOCB 3KPRE 4I0PB 5D7LA 3VXMB 1LO5B 1MFDH 2L7JA 3ROOB 5HYQB 3FAXA 1HHIB 2YEZB 5J3HC 4QRPA 4PG9B 1JPTH 3IRPX 1KENL 4U0RB 5LQBH 1XAUA 4OZFB 1F58H 3KPPB 4NQCA 3NABH 4G8GB 4Y4FA 3OJVC 4F3FA 5D7IE 3TIEB 4AH2B 1QG3A 4XCNA 2NW2B 4BH7B 4P4KD 1Q9KB 2ESVE 3MV9E 5AD0A 3IDGA 3FCTB 1NFDB 3SDDA 2LFGA 3L1OH 1HKLL 3KPOB 4Y4KB 1ES0A 3LQMA 3O6ML 4BK5A 1JZ7A 4CN4A 5J1TC 2EICA 1CICA 1K4DA 2AABL 1OGTA 1RJZB 3RZCD 1DQJA 1OLLA 2NZ9C 2VLKA 3MBEA 3MV8A 4K8RH 3UEZA 4FZEH 4NO2A 4OLYH 4JJ5A 1WWAX 2FIKA 4PRIA 2P49B 4P2RD 3ORJA 4KRMB 5SWQB 4ZFOA 3PQYA 3T0ED 3ISWA 2AEPH 3T2NH 3LPGA 1RULH 3O3DA 3WEXA 1J05B 4UB0H 1JL8A 2UWEB 3H6JA 2OTWA 3HZMB 1SEBB 4DVBB 1JNNL 1BFVL 3HE6D 1FGVH 1OVZA 3DRQB 2AVGA 2NY0D 4AIOA 4EXPX 3QUZD 5DHVH 4HLZG 2F9BT 3IFOB 3C8DA 1Q94A 5IMMA 1RZ7L 3MBXL 1OP9A 3PIQB 4YPJA 3VFSA 4O02H 4HKXA 3QFDB 4RNRA 4X5LA 1E27A 3DX9A 4KMQA 2FD6H 1YMMB 4NQSA 3ULUH 1BIHA 4PLKC 4OD3L 7FABH 4HK0A 2N7BA 1G6RA 2ZNXA 1BFTA 2VDQH 3IYLW 2XZAH 1CFNA 4PRHB 2PR4L 1J87A 4LRNH 2R0WL 3G08B 5GS1B 2P8LB 3N50A 5F7HA 3TA3A 1F97A 1I1AC 3GIZH 2GTZB 1G7PB 2DRUA 5C0EB 3WNNA 1T1ZA 1O7SA 3DV4A 4PV9B 1Y0LB 1TNMA 3G6JF 3WXWL 5DK2B 1RURL 4L3CB 4X7DC 4JM2B 3V0WH 2EDJA 4N8PA 3BVNA 3MV7D 2EEAA 5IUSA 2EE3A 1V3KA 4XC1L 4XVTH 4CU7A 4F15C 3Q0HA 2QQKH 4M5YH 5HHME 2YN3A 5KVGH 2PCPB 3QXWA 5GQBA 2DQDL 3BKYH 1QSFA 3FOMB 4OCSL 3CH1A 1RZKL 5FKAB 5IOPB 2BJML 3AC0A 3UTTA 1NMBH 1YEHL 1KACB 1I1RA 1A7QL 4N0RA 4YHMH 3WN5B 3GJFB 3RJDA 2Z31D 1JFQL 4J6RL 4XXDA 4X4XA 4NO5A 3TYFA 4UOW0 3O0RL 3LN5B 3TEUA 2HT3C 3P73B 3EOTH 3CSBA 1IC5H 3H3KA 4LLUB 5J9PA 4YC2B 1IGJA 3RWEA 1C5BH 4Z76A 1BQSA 1NGXB 4P5KA 5CINL 1KJMA 1IAOB 1X5XA 3BYTA 5IB1A 3TJHD 5E7FA 3MRQB 2F58L 3EFDH 4PGCA 2V2TA 4KUZH 1NUGA 1OAUH 3DUSB 5F7WC 1FH5L 3B5GA 1G84A 4KJYB 2MKLC 1Q8MA 1J0JA 3P2TA 4MA1B 3BIKA 4YAQA 1HSAB 3TVMC 3G6JA 4U1HB 1I8MB 5E00B 2EIEA 1BD2A 5IKCB 4HT1L 1SJEB 5D7KE 2D2OA 3QFJA 2XWTA 1UZ6F 3ZYIA 3U4BL 4JFZL 3PUCA 3RWCB 4KHTH 3I9GH 2ADJB 1YN6A 4HS3A 2HJLB 2P42B 4O51B 4YE4L 3CDGB 4IRJC 4K7PY 2GCYB 1K6QL 5HY9A 3VXUA 1MRCH 3CNKA 4WHDA 5HI4C 4A6YL 1B0RA 3CX2A 4CL7A 2FEEI 1ZTXH 1R3IH 1KTRL 3O2WH 1T0MA 3QA3B 4N90E 4LQFH 1YEFL 4N5EC 1FZKA 4JLRB 3QHFH 3QI9B 1SEQH 2WNGA 5F8RC 1JF1A 3H3BC 5KOVC 2B0SL 1EEQA 2R1XA 1G0DA 4GBXC 4K9EL 5JPMB 3S5LB 1N64H 1FNEB 4L3EE 3UBXB 2ITDB 1F8TH 5TE4H 3HNVL 3SGEI 5I8OH 5GRUL 2CUIA 2XFXB 3IKKA 2Q6WB 1ACYH 1UVQA 4QF1A 4JFFD 1N0XH 4EI6B 3MLZH 1XGUB 4DZ8B 1KN2H 2VDRL 2J1KA 1MCQA 1A6ZA 3CH8A 4RDQF 4M4RA 3PGCA 4HZAA 5ACZB 1YEKH 4KAQH 4J3OC 4N8VB 1T2XA 4GSDH 3ROLB 5DD5L 3C2SA 3C6LC 3L9RB 2FHFA 5DD0H 4EI5D 5GS3A 1P7KA 2FR4A 1QRKA 5ISZA 4JQIH 2R2HA 4TQEH 3AXLA 1X6NA 5IVXF 1E4XH 4Z6AT 4WFGD 5HHOE 1G6RH 4L5FH 3O45B 3RVXC 3IU3A 1BGXL 3I6KA 2DICA 1MLBA 5HVHB 4NOFA 5IBUB 4FQCL 4P4KB 4GAJL 3UO1L 2FBJH 4KRNA 1H5BA 2FJFB 4C83B 1FDLL 4BSVA 5ILTL 4FNLL 1PX4A 1RIHL 2DM3A 5MP6H 4MZ2A 3VD5A 3AREA 3NOIA 1A6VH 1MWAB 4GW4B 4U1GB 5B3JE 1R0AH 3MGOA 2XN9D 2ENYA 3EO9L 4PJ7E 2WQRA 2N56A 5INCB 3RZCB 1Q1JL 3X3GH 1KJ2L 1MHHA 4PJ9D 5DJDA 1CDGA 4YDJA 2O61A 2R23A 1Q38A 4DGYH 2W0FA 3OJ2C 3VGEA 4YBQD 4U1LB 2P7TB 2BVEA 3MZTA 4P2RB 1V3MA 1ADQL 5C0ND 3T0EB 3CFBA 1T1XA 1ETZB 1GL4B 2X4PA 3M17A 2BCKA 3WFHA 1UWGH 3MUJA 1A0QL 4DN4L 2EO1A 3ULVC 2C3GA 2DDQH 4KGJA 1OP5K 5EU7C 1WWCA 4HDIB 5DSCA 3WKNA 1CDUA 3HE6B 1N0LA 3OSKA 4JKPH 2ZCLH 2NX5A 3QUZB 5LCVL 4LSVH 5GSRB 1PSKL 2P24A 1M05B 4AENA 5IVXA 2R1YA 3VXSE 1D5IH 2R0LH 4NN7C 2BSSA 4X5XA 3WO4C 4X98A 4D8PA 1KTLA 5T1KA 4PBWD 3R8QA 3U1SH 4LGRB 1CGSH 3RWJB 4JRYE 3U83A 5JXAH 2B2XH 5FB8A 3RVUC 3GO1L 4Q0XH 1AHWB 4XVJL 4U7SA 4MCZB 5CWSB 5K9QI 1KEGH 5IB2B 1L6XA 3AU1A 4UNUA 2Q3ZA 3ET9F 5ICZA 1NGYB 1CFVH 4FQIL 5CEXB 2FGWL 1T5XB 3D18B 3JWDC 4HK3N 4PBVC 3PHQB 3TFKD 5IESH 2O5ZH 4X9BA 5I17B 1ZXQA 3D39E 3FFDA 4GXUM 5KS9A 3LQAC 2OTUB 5C0BA 1VERA 5T3ZL 3I6LD 3LEXA 3G5YA 4ZUSB 4YXLH 5KOMC 2CQVA 5K9JH 2C3VA 4UT7H 4L29B 1TETL 3SQOL 5HYJD 3BPNB 3MV7B 5H94A 1YQVH 4L8BB 2NW3A 1P4BH 1JYWA 2XA8L 1GCFA 4OV6F 2B4CL 3ULUE 4MB3A 2HFEB 3UDWA 1RFDH 2GW5A 2CH8A 4KV5F 3IF1B 4G6AD 1A6WL 1HQ4B 4NZDA 2VL5A 5JQ6L 4KXZH 1RJLB 3KPQA 1MRFL 3BW9B 5KANI 3P4OB 4PJXF 2HT4D 1GAFH 4O5LL 4TUJA 1I8LC 5DTFB 3HLAA 3L3HA 2UY7A 3IDXH 2F8OA 5LBSH 4Q74A 4JQXA 2OL3B 4I1NB 3BRFA 2AAVA 5FOJA 5D71H 4AG4L 4U3CA 2A0LC 4C56A 3IS0X 3S36L 4HKJA 4LCWD 4PRPD 4P46D 3QG7L 1P4IL 1EXUA 3FQXA 5CZKA 3CC5A 2NY0C 4KK5D 3DX8B 1L9MA 1PVHA 5DC0A 5EU6A 5CZVH 1ZHKA 4D3CL 1T7YA 3N1QC 5D6DA 2YXFA 3AM8C 2JIXD 5J13B 4I48A 1H3WM 5DUMH 4G9FD 1S7UB 1XGYL 3QUKA 4ZS7L 1BJ1H 1C5DA 3BMWA 4C59B 1NCDL 4Z7UB 5IMKB 4ZFZA 3QIUA 1UXSA 3WXVL 2XI9A 3D1MC 4EXKA 1CFSA 1Q9LB 2EDLA 3MRNA 3DIFA 4JY4B 4QO1A 5JW4R 3L3GB 3SE4A 1XCTB 4CW1A 5FUZL 3L7EA 3STLB 1Z5LB 2F8VA 3DX7A 5EBWA 4IMKC 3MYZA 4DCQB 3TBTA 5CJOL 4F57L 5ALCH 3RTQD 5GRWA 3MGAA 5KSAD 1A21A 4FQLH 1L0QA 4MJID 3I6GB 1BVZA 4DFHA 2E9WA 4XBEL 1UCTA 1QPPA 4TN9A 5D7LE 1FHGA 2VR5A 4Y2OA 3K1KC 3DYMA 1VPOH 1IGFH 1QNZL 1UH2A 2X7LA 3OKDB 1ZLUK 4AEHL 4QRRB 5DJCB 2VR9A 4Z95L 3AS0A 4HKBA 1FV1A 1TCRB 4JFFB 4NQCE 1Y18A 1S5IH 1U8JB 4QT5B 3VH8A 1XGTA 3ZT6A 4HWNA 1HH6A 3T1FB 1L4IA 4B7LA 3BEVB 3IDMB 1T0NA 4NP4L 4U33A 3VFUA 2VISA 3MZGB 4JR9H 2WP3O 1FZMA 3BN9C 3O4LA 4ELMB 2I27N 4GQ9H 4ZMAT 3TYGH 2F54D 3RWHA 2UZIH 1A1MB 1RV6X 3QNXB 3HMXA 3PWUB 5GS0C 4OCXL 4KMTL 4XNYL 4KJPC 3W0WD 2VMFA 3RGHA 1TTFA 1PG7H 4LLDB 1G7LA 4XNUL 1J0IA 5GGSA 4N0YH 2VLKE 3MV8E 5HPOA 2FHBA 2DQTH 3D25B 4WO4D 5L2JA 1ZGLB 4Q58C 1PAMA 4ONHB 3ZZ1A 4LASH 3D3VA 4PRIE 1RHHA 4UIMA 4X6CB 2YPLE 3S4SB 4KKAC 3PQYE 3VFMA 3QULB 1ZS8B 4WTZA 4NNPL 3HPJB 3MRPB 4XTRD 4CVZA 5BV7B 1JYXA 3FN0L 1T3FA 2DD8L 1KCSL 1JF6A 1U3JA 3FT4A 2CRMA 4M6OL 3WIFB 2ATKB 8FABA 1Y6MR 5JW4N 2LAAA 5FF6A 4IOSD 4HS8H 1M7DA 5DMJB 4PG2C 2QSTA 3BMVA 5GSVB 4B0MM 1MFBH 2AJXH 2EKJA 4YDIL 3W82A 2VB5A 4GRWF 3T3PF 2FJGB 1QBBA 4H5SA 4XCFL 2V2WA 1OL0A 1QSVA 1J7VR 5D8JH 2WBJC 1FG2B 2AQ2A 1R5VB 1ZKAA 2VDNH 1YNTA 4F33B 4I18B 2ED7A 1HINH 1L7IH 1MCRA 4Z7QF 1FIGL 4UTAH 4UI2A 5I30L 1JYNA 2HT2D 1U6AL 2X9YA 3TV3H 3OR7A 1PG7X 3S37X 4GLRI 1INEH 1ZE3C 2IANA 5CEZL 4NDMA 2APXA 3BH8A 3DTXA 3VGBA 1NKOA 5AZEH 3ZSTA 4LLVB 1BJ8A 3P4MA 1FNSH 1X9QA 1LO0H 3FQWB 5EC1B 1LDPH 1PZ5A 3FB6A 4KWUA 3UPRA 3NCFB 1RUQH 4FQXC 4NBYB 3CDYA 2YXMA 4P5TC 3C9NB 3G6AB 1FC1A 1LK3L 2VDMH 4NWUL 5EUKB 5KN5A 2RQ8A 4MDJB 3NTCH 3ILPA 1JPFA 1I7UB 1QR4A 5F9OL 4MCYB 3OGCB 2J8UF 2NR6D 4MNHA 3D48R 5T1LB 3BGMA 3UTTE 4OCRH 4DOHE 4JB9H 4R3SA 4Q9BA 4GS7C 4OIIH 1B0GB 1MCOH 3V5KB 3PP3H 4OLEA 4LSQL 1M1SA 4WU5A 3U82B 1DEDA 2JLLA 2HH0H 4JGMA 4ZAKD 4F7CA 3VDAA 2HVKA 5EUOB 4AM0A 4YHNB 3AFLA 4EN3A 5E8DL 2CRYA 1V5JA 3VFOB 4UU9B 2IBGA 3HFMH 1RUPH 3VFPA 1LEIA 1YY8B 3RWFB 4E41D 1QLEL 3SKOA 2OJZH 3RHWK 3S88H 5E2VL 1CG9A 5DUPL 3Q6GL 5L0QB 1CLOH 2V5SA 3MRLB 5CEYB 4P4RA 4OLXL 1NEZA 1UB5B 4NZRH 4LBEB 2YD1A 2X4UB 2ICCA 4LP4A 3U2SA 1QR1B 4PJ9C 3A67L 3C5ZC 4EJ1C 3BAEL 3RHWF 3TBVA 3MUGA 4WI6A 5J1AA 3B83A 3GSWB 4Z77A 5JUEL 3QCTL 1S9KC 1RK1A 4JFXB 4QYOB 1RJYB 5C0NC 4TVPL 3QFJE 2YMXH 4BKLB 5SX4I 3QAZC 5K9KB 3V6OC 4FQ2H 2N7AA 3QUMB 4YHOL 4R7NA 5CP7B 1F4YH 3QUXC 4P9ML 2I5YL 1IGYB 3P0VH 2V17L 3VXUE 1MRDH 1R6VA 4JDVA 4J23A 4JFHE 2J8UA 1JV5A 3HZKA 2AXFA 5T3ZD 3CFJA 5JDJA 5HHPB 2NY1C 3ZE0E 1VFBB 1DQLH 2JIXB 5LXGH 2DMKA 3CIQA 4G9FB 3C2AL 4MJ5B 1SMOA 4P2YA 3MOBL 2XWJB 1HE7A 3K3QA 2A6JA 4PJEB 4PREA 3LQAL 3H3PL 5DK0B 4FFZL 3DGGB 4UNTA 3GSNA 3FMGH 1A4KB 1S7VA 1A4JB 2GSIA 2AS5M 1P84J 3CZJA 2X4RB 3ARVA 5I9QC 1R3JA 3BHBB 4AEEA 5IFAL 4R4BA 1ZVYA 3QCVL 2LU7A 3K8MA 2AK1L 1F11A 4LQ1A 2B1AL 3RTQB 3T09A 5JXEA 7CGTA 4RDQG 2P5WD 5B39A 5FGSA 5CKGA 1T2QH 2DQEH 4MJIB 1S9XB 5C3TA 4IRZH 5T3XH 1F2XK 3BD4A 4U6YA 4FFYL 5C71A 4X4MA 3ZTNL 1LQSR 3OB0H 2W0PA 2DQUL 5ISZE 2NTFA 1IEHA 4XMKL 2CLZB 1JGLH 4JG1H 1UJ3B 2NY5L 1ZLUH 5DMKA 4XZUB 1KLGB 4MA8L 1WF5A 4OCWH 1AO7D 4ZXBD 2PO6D 3QIWD 4IJ3C 4Y19D 3J7HA 3PWPD 2HT4C 5DD3L 5J12B 3VXTB 4L4TA 5HI3C 5IHUL 3MQIA 2GT9B 4MAUL 2Y9RT 3V4VH 2F54B 3Q2CA 3GI8L 3QEHA 1JWSA 3HUJA 1P9MA 5ADPL 3JWNC 1HH9A 5I71C 3QDGD 2LU3A 2VQTA 3HI6H 4A6YB 4NUJA 3W0WB 5MERA 1A7OL 4HGWB 4CBPA 5IIEB 1QFWH 2MCPL 4OTXL 1AXTH 3QEUB 1P1ZB 3L5WA 4DN3L 4XPBL 3NBNA 3MACH 4QOKA 1D6VL 5CSGA 1VFOA 3ARFD 3W9EB 2A38A 1FYTB 1NEUA 5ID0B 1RK0B 3OJMB 2DLTA 3GSXB 4XNMA 1MFAL 3EZ8A 5I1KL 2DQCH 4APQC 3KPSA 1LO4H 3VA2C 3D0LB 4JCMA 4ZUUA 3P0GB 1UM5L 5B8CB 3VXRD 5CGYC 4CN1A 2C3XA 2O5XH 3FO9A 3OKKB 3EYUL 2NX5E 1E4JA 4TUKH 4XBPB 4I13B 1TNNA 2E5EA 4GRWH 5BW7C 3CFDA 3KS0H 1U8LB 3MROA 2G60L 1RUAL 1AD0A 3LHPH 4IM8A 3BUYB 4F7PA 4Z8FL 4TSAH 4H88H 5J7CC 4FHBD 1S78C 5KSAC 4N8CH 3IFNH 3HAEB 3TPUA 4JPIA 5IROC 1ZOXA 2YZ1A 5DO2D 5C0GB 2WM0A 4WJ5A 1KCRH 4UT6L 4I77L 4NHUA 1BWMA 3IDUA 4LSPL 4M43H 4U49A 1F4WL 4HH9B 1CL7I 5KVDH 4G6FD 4Z78A 3OX8B 4K3EL 4U7KA 1YEGL 5E1AA 2ORBL 4HUWB 5EZJB 1OTTC 4JPWH 5TQ0H 5I1GH 4NQDB 2CIIB 5KS9E 5C0BE 2GIYA 1GSMA 1T89A 3CUPB 3IAQA 2P8PB 5H8DA 3LKNB 2ZJSH 3U9UA 3UZVB 5F1NA 5GS0L 3RIAK 3K2MC 1DQQA 3WIHA 3GMNA 2V7NA 1PLGL 3NAAH 3DJ9A 1JZ8A 2X10A 4Y5XB 1IQWL 3MV9D 3P4NB 1VACA 1QLFB 2EYRB 3CVHB 1WBZA 4X5WA 4N0CD 3RIAF 3RNQA 3FOLB 4LLMB 2W9EL 1WV7T 2DQFA 4NQTA 4RAVB 4HWEL 3MRIA 4RISH 1TFHA 3MGTA 4GRLD 1F2QA 3U0TA 3CLFL 4WO4C 1PKQB 2CDFA 1EAJA 4P9HC 5CBEB 1UADC 4JDTL 4MNQD 3GJEB 2YWZA 3GSNH 5GJTL 5GGVL 5B3NA 1EO8L 2QSQA 4KTEH 4OF0A 3LKSA 4E41B 4IDJL 1MJ7L 4C56E 1LMKA 4U1KA 4G6ML 1U91B 1JRHH 5JA9A 3DSNA 4Q9QL 3KLAA 1ULVA 4HIHA 1NGPH 1EGJA 4D2NA 3WFBH 3JSSA 4KK6D 2E7BA 4X8JB 3ARGD 3HPLA 4RGOL 4TOYH 25C8H 3HRPA 4JANB 1G7QB 1ZA3A 4U0QB 3T8XB 3A6BL 3SQBA 3RL2B 3CFEA 3PXHA 2VLJA 3QO0A 3TJEL 1I7TA 4GRMA 4JFPA 4WW2F 2Y4SA 4M5ZH 5I1DA 1NBZB 4X7EC 2NXYD 2Z92B 4RGNC 4WW1B 5L6YL 1YJDC 2C3HA 2VDOH 4BQCA 4GKNA 1J9CT 5I8KH 4F58L 3MJ8B 4KV5E 1G9NL 2HTLD 4I3GA 4M6ML 4KZDL 1HI6B 4CU6A 3VDBA 2VXSH 4R8WH 2P45B 1TQBB 2VH5L 2NMSA 2WANA 3T4AB 2HT2C 1F6AA 3L6FA 5AAWA 3HI5H 3VD9A 4MQSB 3CPLB 3O2VL 1TZIA 2YPKA 5IQ7L 2QSCH 1GOHA 2MQCA 4XP6H 3X11A 4WTZG 3TN0C 5DLML 3LQZB 2DL9A 4HCRL 1CTOA 4GXVL 4ZTPH 3MA9H 4NJAL 2BSRB 4P2OD 3BJ91 5HYSA 5FO9B 2NY7L 3EOYG 2ADFH 3AAZA 1EJOL 2HFTA 4M7JL 2APVA 1NC2B 2XQYK 2VE6A 4NN5C 4HHAB 2PW1A 3F7VB 5CSBA 1ZHBA 3FO1A 3O2DL 1KOAA 1D9KD 4S1QH 3TO2A 4B41A 3BUTA 2MTPA 1YY9D 2AJZB 4XNZB 2P5WB 5DJAA 1E6JH 4LVHC 1EEYA 1UYWL 3O6FD 4Z5RB 4OUUA 3TO4C 4DEPB 4WW2A 4JRXA 4D9RD 4I3SL 2RGSA 4ZAKC 4BFGA 4EUPA 1W0VB 3N1GC 2AK4E 1I3RB 3BQUA 3O4LE 2FB4H 5BZWB 4PJAB 5DEZA 1JNHA 2BOCA 4I0PA 5KAQG 3VXMA 1LO5A 4RWYH 3ROOA 5HYQA 3MYJB 2HRPH 5CUSL 2CLRB 1HHIA 2YEZA 2RBLA 3O41B 1AO7B 4PG9A 4CRPA 3QIWB 4Y19B 5CD5C 3R1GL 2DI8A 5E56A 4OZFA 2R9HD 3KPPA 4G8GA 5SWSD 3S35H 1A7BA 3D3VE 2BRQA 3TF7C 5E6ZA 3TIEA 5E2WH 3NH7L 4AH2A 4PB0H 4LLYB 2NW2A 2C1OB 2R0ZH 4UDTB 4HKZB 2DMBA 4BH7A 1A3LH 3KPNB 1Q9KA 1PJ9A 3TCLB 3QDGB 5T3XE 2FWOB 3FCTA 1NFDA 4L9LB 3O6LH 1WLHA 4WI9A 4HWZB 1OGAB 4U6XB 3KPOA 1SQ2N 2AEIT 2FYYB 4Y4KA 3RZWA 3VG9C 1FLTX 3D2UB 4KY1L 1XH3A 2OR9H 5JIKA 4FQHB 4FQQB 2YKLL 1RJZA 4L1DA 3WIHH 3ARFB 3DXAD 4PJIB 5IJKC 3ZYOA 2VDKL 5HGBA 2EDQA 2R15A 4LCYB 3VWJD 5D6CB 4HUUB 3EIFA 3OPZL 3D9AL 3LDBB 3NZ8B 5SWQA 5EOTB 4PRAB 3V5DB 1J10A 2R2CA 4JM2F 1JIBA 3VXRB 1PD6A 4KFZC 1Z6JT 1J05A 4UAOB 1MQ8A 2UWEA 2VR4A 1CFQB 3HZMA 4WTXA 1SEBA 4DVBA 3UJJL 5D70L 1JGVH 2VXQL 2YD2A 4W4OC 1K2DB 3DRQA 1A6AB 2NLJB 4XX1G 2WWKO 4QHKJ 3IFOA 1KEML 3PIQA 3QFDA 1N4XL 3SJVB 3S35X 1I1CA 1N6QL 1YMMA 5FM5O 15C8L 4AY0A 4LIQH 1FLRL 1T1YB 4RAHA 5D1ZD 1EGJH 4HLJA 3BKJL 5E08H 1HHKB 3P30H 1JGDB 1NCCH 5A2JH 4PRHA 1CT8B 4G6FB 5MEPB 1I7ZB 2DQJL 3PHOB 1OOAA 3G08A 4ZNEE 3VA6A 5GS1A 4LHUG 2P8LA 3RBGA 5IBLD 3H9HB 4ZXBC 3BKCL 3NIFF 1G7PA 2HKFH 5FGCE 4ODXA 5C0EA 1TJGL 2XG4A 4MDIB 2DJUA 2V2XB 1AJ7H 1A6PA 1Y0LA 1E4KC 3HNTH 5T5FH 4NQUA 3UPCA 2H9GB 4POZC 4ISVB 3RY4A 4L8SC 5DK2A 4Y7MA 1OT1A 5FYJD 1ZLSL 4L3CA 5FCUL 12E8L 4JM2A 1A3RL 1TVDA 4JG0L 4JZJB 5ESQB 5EWIH 1F3RB 2KKQA 3OZ9L 2PXYD 1WZ1L 3HC0A 3HHRB 1LGVA 4K71C 2P4AB 2O26U 3NACL 2VC2L 1UJTA 3V7MA 4R4FH 3MLSH 4K7PH 4M1CD 1A1NA 2PCPA 3ZO0A 3FOMA 4GRLB 5TPWL 3HG1D 5FKAA 5IOPA 5TDPB 5I1HH 4XX1E 3WN5A 4MNQB 3CFCH 3GJFA 3SKJL 2HYMA 1GC1H 2H32B 2YD9A 3LN5A 1IQDB 4GQPH 3CFKA 4PR5B 4ERSL 2VITB 4Z7OF 1C8PA 2D3VA 1HZHL 3P73A 1GPOH 4QHLB 3DRTB 4D0DB 1ZWIB 2IJ0C 1NGXA 2FECI 2IQ9L 2ERJC 3MXVL 1FFRA 1SJHB 1IAOA 5F1OB 5C0AE 4BJLA 5MHSE 3ARGB 4Y88A 3MRQA 3ZKXB 2J8UE 1XF2B 4RFOL 4EUPH 4OM0L 2IQAB 3DUSA 4X6EB 2D4FA 4KJYA 1F13A 3B9KD 1SHMA 3OKMB 4GG8B 4WCYL 1HSAA 1I9RL 4S0SD 5IW1B 2NXYB 4U1HA 1T7VA 5E00A 1I8MA 5EA0H 5IKCA 3BGFC 3WS6A 1SJEA 5I18L 1RD6A 1KN4H 5D2NC 2ZCHL 3RY6A 3RWCA 1ZVHA 4XP1L 2ADJA 2HJLA 3MLXL 4O51A 5ICYB 3CDGA 3PE9A 4HPYH 4OZFH 2GCYA 1EVTC 4K7PX 1K85A 2JELH 3G6DH 1INDL 1HEZB 1IC4L 4MHHG 3PV6B 4MD0B 4P2OB 4DGVH 5FAAA 4OGYL 3GRWA 3QYCA 3ZE1E 1MNUL 1KTKE 3W9DB 2ZCKH 5LWYL 3QA3A 3SGKA 1A7PH 3RAJH 3VFNA 1DP0A 4JLRA 4X4ME 2E9IA 3H9YA 4JO2H 5TF1H 3QI9A 4POUB 5FA4B 1EEUA 5JPMA 3S5LA 5DR5H 1EX0A 2OQJB 4U6TA 1OF2B 4XP5L 4YO0B 3VD7A 1YPZB 3CCHB 3UBXA 2ITDA 3SOBH 2BP3A 5FOBB 4OLUH 3JVGA 1BVKB 3FRPA 2XFXA 2Q6WA 4EI6A 1U95A 4ENEC 1XGUA 4DZ8A 2XZCH 5HHXL 3SGJC 3JTSB 2EEDA 2IALB 4HBCH 3SPVB 4CDGC 1EERB 4WWKC 2WINB 5ACZA 3HUJE 1OSZB 1XR9B 1DLHB 4N8VA 4OT1L 3ROLA 3L9RA 4NJ9H 2HA1A 1W72H 1FPTL 3LRSB 3RNKB 2BXYA 4F80A 4NQED 2QHRL 1IBGH 3MJ9L 4YHLL 3LH2L 4ONFL 5A2KH 4V1DB 1YJDL 2KL6A 2OLDA 4Z0BH 5SWSB 3VFWB 1N7MH 3O45A 1ZEAH 2YRZA 3FQRB 3HR6A 3T08A 3GI9L 4P4KA 2R2BB 3B8YA 5AZ2H 2FJFA 4C83A 2VLRD 5HTSA 3MRCB 2NY4C 5DJ6B 2F19H 1M71B 1D5BB 3B9VA 1MWAA 4GW4A 1X7QB 3GBML 3WFCL 4LCIL 3QEQD 4MQ7B 2PTVA 5INCA 3RZCA 1D5MA 1CE1L 1DBMH 3DXAB 3SBWC 3VWJB 3OAYK 4U1LA 2P7TA 2Y5EA 2GAZB 2AQ1A 1DVFD 2W9DL 4P2RA 3IFLH 5JHDE 4AMKH 4E42B 3T0EA 1ETZA 3SDYH 4K2UL 1X5KA 5LGHH 2FCBA 2H3NB 3WNMA 5K59E 1CVRA 5F9WB 2QADB 1OLZA 4HDIA 3ARWA 4XHQA 3VGAB 3HE6A 2HFFB 1BEYH 3GJFH 3QUZA 4QRPD 5FYLH 1D9KC 5GSRA 5BXFB 1IM9B 1M05A 4MS8D 5FEBA 4NM8L 1S7WB 3U7YH 4Y4FD 3O6FC 1S7XB 1F3DH 5DRXB 1D3CA 3RWJA 3MCG1 4ZTOH 3A6CH 3U46B 1YEJH 4LDOB 1HCFX 1FAIH 1AHWA 2DBLL 3DSFL 2Z8SA 4MCZA 3S37L 1MCWW 5CWSA 5D4QA 5IB2A 2KH2B 2JJSC 3S3SA 3UTSB 4FFVC 1NGYA 3BDXA 5CEXA 5M94B 2H1PH 3PHQA 5IB5A 4GAGL 4Y1AD 1OAXL 1TMCB 4EIGB 4UDUB 3M1BB 5I17A 1EHAA 2IF7A 3MNZB 5DVNA 5D7SH 1MAMH 1RIUH 3EYOB 1QO3B 5CJBA 4ODHL 3UTZB 2G9HB 4CVXB 2X4SB 3ARZA 3CK0H 2EZ0D 3NPZB 2R9HC 4HXBH 3L5XH 5FA3B 4ZUSA 3CZFA 4LCCC 3F7YB 5EB9A 1AGCB 1CFBA 1NDGB 1KBGL 1FGNL 4L29A 1AGBB 3ARBB 4F7MA 3RWIB 3JV5A 3MV7A 4L8BA 4Z7UF 3EBAA 1KIUA 4QRUB 2HFEA 4LIQE 5JR1L 4EBQH 1TITA 3VU2A 5TDOB 2UY6A 4Y8AA 4TTGA 3IF1A 3ZSSA 5C2UB 3GRWH 4Z7WF 5BVPL 1HQ4A 3RDTD 5E2UH 1RJLA 2YUXA 2ID5A 5EG6C 4EUPG 4ZD3H 3BW9A 1CDJA 3CVIH 5D7JC 3TT3H 4F37F 5DRZB 2VLJE 3P4OA 5KVFH 5DTFA 4V2BA 4YH6A 5FHAL 4XPFH 2WUBL 2VAAB 2OL3A 5ESVA 5DMIL 4M7LT 3ZDZE 4HC1L 3PJSB 4OZFG 2XG5A 1QKZH 1CGVA 4XNXL 2V5YA 3SDXF 1FG9C 3DX8A 1J1XL 3JUYA 5ENWB 4R26L 5FYKH 5A2FA 1L7TH 3FN3A 4M7KH 3TWCH 2C7UB 5EZOL 3Q1SL 4NFDA 3VGDA 2DS4A 4AT6B 5IWLA 1UCBH 1S7UA 4XVUC 4LRIC 5D1ZC 1CU4L 4ELMF 4Z7UA 1ZK9A 1FVDB 3TT1L 2WW8A 4KK8C 5ALBH 1Q9LA 5TE7H 3WFEH 4JY4A 1GGBL 3L3GA 1FIEA 4DKFH 3INUH 2AQ3A 4UIKL 2CKBL 3PV7A 1KLFA 1XCTA 1QSFD 1DFBL 3STLA 3FTGB 1Z5LA 5EZIL 3RIFK 2EXWD 3O6KL 1WC7B 2I9LB 4DCQA 1U3YA 3BGAA 4JRXE 3DVGA 1H3PL 1G9MH 1IGMH 4GAFB 4FQ1H 3B9EA 2EH8H 4Z0XB 4HWBA 4X6CF 3I6GA 4JPKH 4ALAL 1IEBB 1MWAH 2VDLH 1DBKH 4XP9H 3LKOB 5T1MB 5H35B 3BE1L 4YXKL 2IWGA 2GJJA 3VXME 1YEDB 2PXYC 1NL0H 2Z4QB 3MUY1 1UA6H 3O3EB 4MAYC 3UTQB 3PWLB 3I75B 3OKDA 3EYFB 4R4ND 1OAYL 3QEGH 4JDZB 5DJCA 4DKEH 5CLWA 4TULL 3EDFA 4CJ0A 1TCRA 4JFFA 4G8GE 2CJUL 4NKDB 5F7YC 4QT5A 1GHFL 4JVWA 1AR1D 2ZUTA 3T1FA 3BEVA 3IDMA 2XWBB 1BD2D 3V5HB 2W59A 5L7XH 2VXUL 2AKRB 3GHBH 2DYPB 5E8EB 2EDDA 5D1XD 5A2LH 4ELMA 3VWKD 1IL1B 4LVNC 1ZANL 1NFDE 1WBXB 3QPXH 2EH7L 3PWJB 1A1MA 4NQEB 3QNXA 3PWUA 1GGIH 4GO6B 5GRVK 3V4PH 1AXSB 4G7YL 4LLDA 1AI1L 3B6SB 3B9KC 3D25A 1ZGLA 1C5CL 2FH6A 4ONHA 4X6CA 3S4SA 1VFUA 1BBDH 3QULA 1ZS8A 2VLRB 4K8RC 3HPJA 3MRPA 4XCYB 3V0AC 4LNVA 4UBDD 5DQDH 2UWEE 2J8OA 3QDJE 3W5NA 1GZQA 4FXGB 1T22B 2UZYB 1AC6A 5DS8B 3L3KB 3QEQB 4JKWA 1UXWA 2IMNA 4DKDC 3WIFA 5DJXB 1GXEA 2ATKA 5IMOB 4L4VD 5F7EL 3U0PB 3QRGH 5K93A 2OI9B 3KLSA 4M6NH 1MSPA 5GSVA 3OAZK 1YMME 4QXTA 5IBTH 4XP4H 3J8F7 2D7MA 9CGTA 5IHBA 3WL9B 4DK6A 1C1EH 4KQ4L 1JTOA 4YBLB 5EUOF 2FJGA 5F71A 4GKSB 4X83A 3HMWL 3EZJB 5ADOH 1NAML 2JTDA 2Z0BA 2LVCA 2F5AL 3WHE1 2Q76B 3E2HC 3I2CL 1FG2A 5HYIA 3ULUC 1R5VA 5M95B 3WLWD 4F33A 4I18A 3U0WH 3GIVB 3LV3B 1MLCB 1QTYT 1Z2KA 4JZNB 3RJQB 2MNUA 3MOQA 3NFSH 3QHZH 2BNRE 4JKKA 5D5ME 3EFFB 5ICXB 2P8MB 4MQXD 5GISH 5EOCJ 3QIBC 3QUXB 3K8KA 1MY7A 1DR9A 1KCVH 1NANH 4LLVA 3FQWA 1KB9K 5EC1A 4HFUH 2NY1B 1MCCA 5JMRA 1MREH 2DTMH 4ODWB 3GBLA 1T21B 2D7PA 3C9NA 3G6AA 1E4XI 2QQNH 1H3XA 4NZJA 5EUKA 4Y1AB 1J0HA 1FSKC 2Z35B 4OIBA 4YQXH 1WIUA 4QNPF 2Q8AL 1I7UA 3N06B 5CBAB 1KPUB 1FFQA 5HGHB 1Z9SA 4MCYA 2ZUUA 3OGCA 5J6GB 4HFWB 5T1LA 4HSQA 5L8KB 4OI8A 4WI3A 1B0GA 2PNDA 5FYLE 3V5KA 4I9WD 4TNWK 5I9QB 4ONGH 1MIEL 4JO4H 4WUKH 5EUOA 2BHYA 2CK0L 3GKZA 4YHNA 1FBIH 1VSCA 2WLZA 3VFOA 3BWAB 4UU9A 5E99H 4PJEF 3H8NA 1YY8A 4GG6E 3RWFA 5EOCL 4TNWF 5SV4A 5HGAB 4Y16C 4ZOAA 5HDOA 2NPLX 3MRLA 5CEYA 1MIML 3RDTB 1UB5A 4QRQB 3U79A 2CMRL 1IGCL 5JOPE 5EFIB 4EOWL 1QR1A 1KC5L 5I6XC 3GSWA 1DVFC 4N8VG 4JFXA 1RJYA 4IJ3B 4IDLA 3R06B 1N8ZB 4BKLA 1WTGT 5BO1H 1MFCH 5K9KA 4EVNB 4S11A 2FBOJ 4PJDE 1YMHB 2D0FA 3QUMA 1J1OL 3C09C 4PRPA 4H20L 4P46A 5E5MB 5CP7A 4OFIA 4Y4HB 1IGYA 3I3BA 4ODVH 2QBWA 3UAJD 5LGKA 3NCBB 2MFNA 5F8QC 5CHNA 5I71B 1F3JB 4S1DD 5IBUG 1J8HD 4N68A 3ZE2E 5HHPA 5DYOB 4KVNH 4J3SA 4G5ZH 1VFBA 4Y4FC 1WFNA 2JIXA 1JNLL 3BIAX 4TSBL 3QQ9D 2VKWA 4YGAB 4Z7OE 5CCKL 2OJEB 4G9FA 4DK3A 2JB5L 2X4TB 3M45A 3D85D 2XWJA 1OB1A 4PJEA 1BOGB 4M6AA 5CZXD 1BVLB 4HIXL 5DK0A 1J0YA 3DGGA 3SDDC 1KIPB 1A4KA 4EDWH 1A4JA 4ZOCA 5T5NG 4APQB 1QBLL 1OAZL 2X4RA 2QSVA 4L1HA 3BHBA 2VLMD 1CICC 3NA9H 4U6HB 3X13B 3VRLE 3LSOB 2EZ0C 3RTQA 3MBEC 3RBSA 1XCQB 5BV7H 3VRIB 1NGWB 3KR3L 4MJIA 1J8KA 1S9XA 2ADIB 3KYKL 5FYKE 4YHIB 4FTVD 4NFCA 2WWMD 2ITCB 5E1HB 1B88A 4G43A 2DLFL 4KXZI 4BSJA 2ZPKH 4WEUD 1LDSA 2CLZA 1LEKB 1UJ3A 4BELD 1ITBB 5DHXB 4XZUA 1KLGA 4IIQB 3QDHA 3D0VB 3ZKSD 3LKQB 5EU6D 3VXTA 1B4RA 4ZYKA 2Q7YB 5D1XB 2GT9A 3VWKB 4C4KT 1KENH 1SBBA 3IDJB 1KFAL 2F54A 3ELAT 3KJ4C 5GGQL 2E7HA 1D7FA 3QIUD 4UT9H 4MZ3A 1MCBA 4JEGB 2VXTL 3MLUL 4F8TA 1UWEL 5CS7A 3DV6B 4A6YA 3W0WA 4O4YL 2HKHH 3TA3C 4HGWA 4JQVA 1X4ZA 2FO4B 2UV3A 4M1DL 5IIEA 3S7GA 4U1SB 1QEWA 3QEUA 3LRGA 5DGRA 1WWWX 5DRNB 4DTGH 3I02B 4P2RE 2IBZY 2N1KA 3W9EA 3ZDXE 1FYTA 1RVFH 5E2TL 3T0EE 5ID0A 1BHGA 4FFWD 3C5JB 1RK0A 3QWOB 3GSXA 2A83B 4M93C 5SWZD 3U9PL 2I60L 2X4NB 3EYSL 3PDDA 3D0LA 5B8CA 3RVVC 3DARA 1CGTA 3OKKA 1KGCD 1SYVB 4L4VB 5BVJB 3ZKMD 1RY7B 4XBPA 3OWEA 4OBSA 2HLFD 1U8LA 4LL9A 3BUYA 3KYAA 5DEFB 1JNNH 4GW5B 3BP4B 1BFVH 2X1QA 2XA3A 2ARJQ 3HAEA 4MX7B 1GVIA 1QQDB 3N0PB 1RZ7H 2X1OA 2Y36H 3MBXH 5C0GA 4PBXA 1EFQA 4Y0GA 5H37G 4HIJB 4HH9A 3N85L 1C16B 2FZ3B 3OX8A 1B4JH 4OD3H 1NCNA 3KPLB 5EZJA 4NQDA 3SN6N 2CIIA 3SDAD 1F58L 3NGBC 1OARL 2P8PA 2A6DB 2R0WH 1AGDB 3UYOD 5LKNA 1F45A 3QUMH 1IAKB 4PJ5B 5KANG 1UFUA 1ROWA 3MV7E 2R4RL 1RU9L 1T66D 4PP1D 2HTKD 4WWID 1JI2A 2A77H 3C60D 4TRPL 4Y5XA 1CLZL 5ID1B 5DF0A 3P4NA 3ECBB 1X44A 5JORB 1QLFA 2EYRA 3CVHA 4OGXL 2X41A 3FOLA 4LLMA 2X40A 1RURH 2PTUA 3LKRB 2OS7A 3AROA 3GSVB 2J12B 4PJCF 1BFOB 1ADQA 3O9WD 1PKQA 5B22A 4XC1H 1U42A 5I73B 5CBEA 4N0UB 1CFTB 3GJEA 2AEPL 1HN1A 2DQDH 3DI2B 1RZKH 4E41A 2BJMH 1JZ4A 4UBDC 4XRCB 3JTTB 1A7QH 4ZSOB 1LEGB 1FVEA 1U91A 2LV4A 1JFQH 3LOWA 5AG9A 3BP6B 1U8NB 1FNAA 3O0RH 4N9GA 1ZGLP 5I66B 1B90A 4X8JA 3MUZ1 4F9LA 2ZP0T 1JHTB 3N1MC 3A0OA 2IAND 2YK1L 1G7QA 3K8LA 3LKPB 4JANA 5CINH 3T8XA 1KIQA 3RL2A 3ULUL 5LVEA 3MRHB 3HTLX 3G04B 2F58H 1NBZA 2XZAL 2Z92A 4HPOH 1BLNB 2B1HL 2BVOB 2VO5A 3HB3D 4WW1A 1FH5H 4Z7UE 3GSQB 1CZ8L 3RKDD 4IRSB 4PJAF 3KHQA 2FEDD 2C1PB 4YNYB 2B8OT 2X70B 3WLWC 1W0WB 3MJ8A 4DKAA 4TTDC 1HI6A 3L3OB 1YQ2A 3W2DL 3R4DA 1MCHA 4HT1H 5BRZD 2PYFB 3T4AA 4QGYA 1I9EA 1OTSD 3F62A 4QHMB 3VW3L 1FCCA 4MQXC 1J8HB 3U4BH 3CPLA 4JFZH 3V8CA 3S4SG 5ERWB 4YE4H 2XT1B 3LQZA 3F58L 4OB5L 2DWDB 1SM3L 2BSRA 2E27H 2G5BB 5FO9A 1K6QH 4ZNCD 3D85B 3V0WL 4EN3D 1H5BC 4A6YH 5C3LD 2MQ0A 1NC2A 3TBSA 4JHWL 1ORSA 3F7VA 5IFJB 4XVTL 3AREC 2GFBB 5KVGL 1V7ML 3BESR 2DI7A 3BKYL 1T04B 4YDVB 4JY6B 5EORL 1YEFH 4JFFE 1EAPB 1JF5A 2AJZA 5IK3A 2P5WA 1IARB 1IEAB 1DTUA 3VI3E 3BIBX 3CXDL 4Z5RA 2B0SH 2Y1VA 4PJIF 1WBYB 1FNGB 4K9EH 4XMPL 4JZOB 4FTVB 1P7HL 3FQTB 1I3RA 2NQCA 3MCKB 5A16B 4A2LA 3WFDL 3MCLL 5GRUH 1FORL 4PJAA 5IM7B 1NBQA 2BC4B 5IG7B 4K94C 3MYJA 3EFDL 1AFVL 2VDRH 4KUZL 5F9DC 3LCYA 2EDWA 3FT2B 3SO3C 4YIQB 1I75A 1LNUB 4WFGE 3O41A 1AO7A 3SE3A 2PO6A 3QIWA 4Y19A 3HAEH 2AV7B 2WK2A 5IVZB 2A73B 5DD5H 2J6EL 4HGKC 1I8KB 4FP8H 1KJ3L 3MRJB 4QY8A 3E8UH 1GRWA 3MRRB 4FABL 4X6CE 4JFED 4JHAL 1JI1A 3LB6D 4YFEA 4LLYA 1YUHB 2C1OA 4UDTA 4HKZA 2HVJB 2VRAA 2GY5A 1BJMA 1DL7L 3KPNA 3TCLA 1BGXH 3QDGA 5FCSH 2FWOA 4PS4H 3QH3B 2XN9E 4L9LA 3MNWB 4HWZA 2IH3B 2GK0B 5C6WH 1OGAA 3VE0B 4U6XA 4DVRL 2FYYA 2AI0H 4GAJH 3UO1H 4UV4L 4Y89A 4PJXB 3WUZA 1FDLH 4AJ0A 4FQHA 2J3SA 5E8PB 5F88B 5ILTH 4S1DC 4FNLH 4FXLA 1RIHH 3ARFA 1J18A 4PJIA 1ZTXL 2RFXA 1NCAL 4LCYA 3RX7A 5D6CA 4HUUA 3CVHH 5EOTA 2YWYA 1Q1JH 4PRAA 3GBNL 1KJ2H 3V5DA 4XPHH 1YN7A 3VXRA 3EO0B 3LIZH 1KUMA 3UDWC 1IKFH 3T2OA 1CFQA 3CAFA 1T7ZA 2RJMA 3ZTJH 4ZO6A 1ADQH 5TE4L 1K2DA 1A6AA 1TVBB 1A0QH 2ERJB 2NLJA 3H0TB 1E28A 5TQ2L 4BSWB 5ANMB 3MLZL 3NFPB 3SJVA 3RPKA 1C7SA 4RGMC 3AB0B 1U8KB 4L4TD 4KI1A 5LCVH 1K9TA 1PSKH 4NN6B 2BK8A 3FFCB 1YEKL 4JQXC 5GGTL 1ZT1B 1T1YA 3QZWB 4GSDL 4KROD 1HHKA 3LEVL 5E4EB 1JGDA 3GSOB 1OAKH 4JQIL 1I7ZA 5I1EL 5MEPA 2CLVB 3PHOA 5DA0B 5EO9A 4ODTL 4WV1B 4RRPG 3SDAB 4XWOC 2XPGB 1G6RL 4L5FL 3KPRB 1JZ6A 3I6LE 4X6DA 3H9HA 2YD7A 5KVEL 2YPVL 3BP5B 3ARDB 4FQIH 4QOKD 2FGWH 5D6DC 4ODSL 4MDIA 5HYJE 5JIPA 2V2XA 2K7QA 2JB6B 5EUOE 4XPAH 2H9GA 1MCEA 4ISVA 5I15L 4IMLB 3KPSD 1TPXB 5F96L 4JZJA 5ESQA 2NY6B 5T3ZH 2EEBA 3QIUC 5D7IB 1QFWI 2YUWA 3HE7B 3X17A 3MLPA 4N9OB 3MJGX 1TETH 4WHTB 3SE4C 4P3DB 4HUKB 1HOCB 1NPUA 1BZQK 2XA8H 4D9QD 4GRLA 2B4CH 4XPGH 3RWDB 4DUWA 2VDPL 3O9WB 4O2CB 3U7AA 1SVCP 5TDPA 2DKSA 1DBAH 3F65A 4MNQA 2HMIC 1RZJL 5HDBF 1UWGL 2Y6SD 2H32A 1NAMB 1IQDA 4S2SB 3IU4L 4PR5A 2VITA 2XQBL 1A6WH 5JQ6H 4QHLA 3DRTA 3DI3B 4D0DA 1MRFH 1ZWIA 3HC3L 4KRPC 4OAWB 4LCWE 1VHPA 4PRPE 1SJHA 3NIGF 1NUFA 4CU8A 5HJ3B 2BNQD 2KZ1B 3ARGA 2IBBA 3OHXB 4PRNB 1XF2A 2C3WA 1PY9A 2IQAA 4LLAA 4X6EA 4AG4H 1AQDB 1CGSL 1BM3L 5GRXG 3S3JA 5JXAL 3OKMA 3S36H 1X5LA 4GG8A 3QG7H 4G9FE 4J4PA 4Q0XL 3VXNB 5IW1A 1JBJA 3R0MA 1FNLA 2VXVL 3ZL4H 1KEGL 1F6LL 4OCMC 3UC0L 2E7MA 4PJEE 2FHCA 4KJWD 2P43B 3K4DA 3IGAB 2GKIA 3T0WA 3JZ7A 5ICYA 1JGEB 5BRZB 2ICWB 5KW9L 5B38G 2IPUK 1XGYH 4ZS7H 1NCDH 2ZWLT 1HEZA 1KXTB 1EBAA 3PV6A 5HDLA 4MD0A 3O4OC 3FB7B 4P2OA 4MJIE 5B21A 4JHBA 3EJYC 2B20A 3OXSB 1YQVL 3IFPB 1HWGB 3W9DA 2Z8RA 1OT2A 5FUZH 1QSED 1RFDL 5CJOH 5FA4A 3WS3B 1HCVA 4DQOL 1CD0A 4UQ2B 4RCAA 1MJUL 4Y2DD 1OF2A 1B0WA 3B4NA 4YO0A 4RFNC 1YPZA 3CCHA 4XBEH 5FECB 1PQZB 2X05A 3CU1A 5FOBA 1BVKA 4OFDA 2EDOA 3S36X 1SYSB 5EULV 3WD5L 1T83A 3QO1B 4TPRH 5LBSL 1QNZH 4AEHH 1AR2A 4Z95H 3JTSA 4X7TB 1JRHI 2IFFL 2IALA 3L5IA 3SPVA 1YZZA 2F54E 4P2CG 3SDCB 4NT6B 2WINA 1OSZA 1XR9A 1DLHA 5DEGB 4MVBD 5IV2B 3W0WE 4NP4H 3LRSA 3RNKA 1U8IA 1P84K 2BOBB 5EH1A 4CGTA 1NMCC 5I0DA 1IVLA 4V1DA 4KU1A 1HDMB 5SWSA 3VFWA 32C2B 4C55A 1K8DB 4JFEB 3FQRA 1ERNA 4OCXH 4BQ8A 4KMTH 1QP1A 4OQTL 4XNYH 3NCYS 4OF6A 5D96C 1NKRA 1EHXA 1K3IA 4XNUH 4I2XA 3BXNB 5HSFA 1EEZB 3NIDE 3MLRL 3MRCA 5DJ6A 1D5BA 2J88L 1X7QA 3C5SB 1SJVA 1QFPA 3ZTJG 1EJ6A 4NNPH 1OTSC 3IAPA 1P5VA 4PGBB 4MQ7A 4OFYD 1HHJB 4OZIB 3DXAA 2QJDA 1H8OA 1YNKH 4F7EB 3VWJA 1XGQB 3GK8L 3MFGB 1CWVA 4FQLL 4Q6IB 2ZUWA 4HUXB 4JN1L 3S98A 2LU4A 2GAZA 4M6OH 4BK4A 3BQUD 4E42A 4EN3C 2X9WA 4K7FB 1CGWA 5I16B 4ZFFB 4ELKB 3GMQB 1MCFA 4ZQKB 1N5YL 2H3NA 3QPQC 1IGFL 4MHHI 1WUNT 4YDIH 1AQKL 2HFFA 3VD3A 3GMPB 5BXFA 4XCFH 1IM9A 2CKNA 2OK0L 2H32H 3OV6A 3TNNB 5TFSL 4WI2A 1S7WA 1IAIM 3BZFB 1K4CB 4UV7H 3IDYC 1S7XA 5DRXA 4K94L 1OWRM 4JR9L 3GZKA 3GKWL 1U0QA 1UKSA 2NY3C 1FIGH 1IILE 3DGCR 3U46A 5I30H 3FB8A 1U6AH 1BREA 4M7ZB 4OJFH 3DUHA 4U2ZA 1HIML 3GHEL 5KZCB 4G8FB 2EC9T 5C0CD 5CEZH 3UTSA 5K9OB 3I3EA 4URTB 4M9OA 3U30B 3PG2A 3RVWC 5CD3A 4UDUA 3M1BA 3HS0B 4UILL 1TZGH 1BX2B 3MNZA 3QXVA 5E4IA 3EYOA 1QO3A 3UTZA 2X6MA 2G9HA 3ZHDA 4CVXA 4ODBD 2X4SA 1LK3H 1PKQE 4LASL 4GW1B 5FUCC 5FA3A 4AEIL 2MSPA 3F7YA 1AGCA 1A64A 4IHOB 1NDGA 1R3HB 4QXWA 1AGBA 4JO3L 2CPCA 3ARBA 3RWIA 5HHOB 4E41E 1I1YB 1OW0A 1TQCC 2I25N 2YD4A 4QRUA 3W11C 4JVUA 4LSQH 5T33H 1A8JH