3PXJA

Tandem ig repeats of dlar
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
199
structure length
199
Chain Sequence
b'AAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase Lar
publication title The Immunoglobulin-like Domains 1 and 2 of the Protein Tyrosine Phosphatase LAR Adopt an Unusual Horseshoe-like Conformation.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 35
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pxjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pxjA02
1K4CA 2HFGL 1LGVA 2W60A 3EYFB 4I77H 2E7LA 1OSZB 4LFHD 1EFQA 1NSNH 2Q1EA 4O02H 1U91A 2Z92B 3GIVA 1DBAH 4GFTB 3ARBD 4HEME 5E2JA 1UM6L 2YPLD 2QR0A 2FSEB 1QPXA 1S7RB 4LCCB 43C9B 1EK3A 4ZDHA 3JWDC 5I1IH 5HHOE 4L4TE 3KPTA 3DX9B 3WIIH 5ISZA 1UYWH 3QFJE 3IDNB 1CG9B 1C16B 1JI1A 3MLSL 2J8UE 3LH2H 3NABL 3W0WB 2B20A 2CIKB 1I85C 2W60B 2FGWH 2GI7A 1NEZG 2CIIB 3F65A 4YHOH 3ZTJH 1A22B 2ZSWA 1E27A 2DQHH 2AXFA 1U91B 3DMMC 3VXSE 3GIVB 1N64L 2ICEA 3KG5A 5MI0B 2J8UF 1YEGL 3S36X 1ZVHA 3VCLB 4KZDL 1GZPA 1CFQA 1QD0A 4PY8I 1MCSA 1RU9H 4OLZL 1IGJB 4JRXA 4P2QB 2EDYA 3CIQA 5K93A 4YDLB 2OMBA 4NC2B 5CEZH 4YFLF 4YWGH 1VSCA 2UWEB 3EYSH 3HHRB 1S7TA 1ZWIA 4JO4H 5C07D 3QEGH 2JB5L 3VFOA 3WSQL 4OFIA 5JHLH 4OM1H 3V4PH 4M7KH 1GAFH 3MYJA 2W65B 4HCRH 4YZFE 5IMKA 1F45A 4AZ8A 1FO0L 4J3VA 4GQ9L 7FABH 5FDWA 1WWAX 3DI2B 4RBPH 1QHOA 1QACA 4X8JB 4OFPA 4BA8A 3JTTA 4NBXB 1OW0A 5KSAB 3DURB 3L3JB 3HI6H 4MJ5A 1KXQE 3TNMA 1JPFB 3P0VH 4HIEB 5T1KB 5HPMA 2R29L 1OL0A 1AFVH 1UCBH 3OB0H 4LIQE 3HR6A 3PHQA 3S35X 1ZWIB 3EDFA 5DJ8B 1H5BB 1IC5H 3I2CH 4OI7A 1IGCL 4F57L 5I1DA 4Y2DD 3PDGA 5I74C 4PJ8D 1EHAA 2DMKA 4K23L 4J8RB 5SWSD 4PJEB 4YAQB 3CZFA 1NCDL 5FDWB 3GIZL 5HHMD 2WNGA 3MV9B 4PTTB 2F19L 2VAJA 1E6JH 4MJ5B 5D2LF 5C0IB 3VXPA 4N8CL 1DL7H 4I3SL 2PYEA 5HPMB 5ESVA 4WHYH 1ULVA 4EVNA 1WC7A 4EKXA 3P9LA 2FJFA 1MNUL 5I1DB 4EXPX 1JF1A 1EX0A 1NMCB 4JCLA 3ZKMD 4IIQA 4JB9H 1BVLB 2HKFH 2PO6A 4HS3A 4R9HA 3LEYH 2VR5A 1XGQB 4JAMA 2BOCB 4YH6A 1XGRA 3MBXH 3L95A 4X7DC 2J4WH 1Q8MA 3TCLB 1BQHG 1T4KA 3TYGH 5TQ0H 1G7QB 1F97A 4ONFH 1H9VA 3QUML 1QFUH 4QTIH 2W59A 2W92A 4LVNB 3LKQA 1KYOK 4QEGA 4MQTB 4JQXC 4NQEE 5DUBB 5T3ZL 3U4AA 3RGHA 3ROOB 2VL4A 5GJSL 4FQ1L 3V0VB 4JJ5B 5ESQA 1QR1A 2EDWA 3LEVL 3HS0A 2IPTH 4DN3L 3CX5K 1G7MB 4IIQB 5F9DC 5GIRB 4AJ0A 3RTQA 4HS3B 4U1NB 5GGUB 1F58L 4YHNA 4X7FC 3NZHL 4JLRA 1WT5A 3O8XD 5JR1L 3OKEA 4UIMA 2ICWI 1MCOH 1QKZH 5KVFL 2WP3T 1UJ3C 1QO3B 1C7TA 4UMGA 3ESVF 3I75B 2X42A 3PV6B 4HWBA 2A9NL 3BMVA 5L9DL 4Q97A 2FO4A 3VG9B 3BPCA 3PWNA 3MROA 1F90L 1BD2E 2J88L 5FM5O 4Q6YA 2C4XA 4N8VG 3HS0B 1YEJH 5MEPB 4JO2L 3D85B 4HPOH 5HHOA 4L4TA 4QOKE 3FKUS 3QFJA 1WFNA 4NKDB 4LIQL 1IRAY 4YHKL 5J56B 5CBAA 2J8UA 4MZ3A 5DJYB 4X6BA 5D5MB 1D5MB 5DR5L 2M26A 3P9WB 1RZJL 1G9NH 3QWQB 2MQ3A 3DSFL 4Y4FB 4OFKA 5BJTA 4N1EA 3V8CA 4J23A 3VXSA 3BPCB 4CGTA 4IRSA 4QRQA 3VFWA 3FQRA 4HLJA 5C2UB 3RWGA 4EN3A 4DKFH 2E9BA 5IF0A 4Z7NF 2HLAB 4HC1H 1RUAL 3QDGE 1I9RL 1N7MH 4I3RL 1JV5A 3SO5A 3UP1A 3MRRA 5HHOB 2F74A 4U1SA 3CFDB 4JHWH 2CSPA 1OP3H 2OP4L 5IHUH 5EC1B 5DK0B 4HUVA 4DGVL 1MQKH 4X6BB 1JIBA 3B2VH 4PR5A 5I1LB 3MO1B 3K3QA 3UBXI 2R4RH 2PW2A 4KROD 4L9LC 4UDTA 5DT1L 1PKQE 1XZ0B 1ZGLA 2L7UA 3PGDA 1L9MA 4FQXA 2HA1A 1FSKB 4YNYB 3FQRB 4XNYL 3UTTD 3RX8A 1L4IA 3W81A 4EN3B 3LHPL 1VGKA 3OQ3B 3NPSB 4JCMA 1MLBA 1R3JA 3KXFD 1KCRH 2W38A 1LVEA 3O6FA 3Q0HA 4NGHL 4DCQA 3P4OA 2GYSA 4WU5B 2F74B 5DRZB 3ZZ1A 5DYOB 1JGVL 4NNYA 4OD1L 4P4KC 5BS0B 4IOFC 2H8PA 4RGND 4AIZA 3JV6B 4RAVA 2VLME 2PXYC 1W0VA 3ULVD 5MP6L 4WUKL 4PR5B 1Q9WA 1NBZA 2OR7A 2ZZUT 3KLAA 5C0FA 4XMLH 2XKSA 4AENA 1LE5A 1ZGLB 3X3GL 3WNPA 1XF5A 1A5FL 4P5TA 1UC6A 4XAWH 3E6FA 1BJ1H 3UROR 4MVBC 1DLFH 2BVTA 2HFEB 4JQVA 1IAOA 3V9FA 4Y4KC 5BV7B 2HFTA 4HKJA 3P4MB 1MLBB 4HWEH 2P49B 3SE9L 4YXKL 3RNKA 4M6AA 3AAZB 3P4OB 5DHVB 1HEZA 1MPAH 4CU6A 3BIAX 3LQZB 4JY5H 5FUOH 4N5EC 3QAZB 4RAVB 4LASL 3CZJA 1FL3A 3EJJX 4LFHG 3MLWL 4NRXB 4XCFL 1H3UA 3WUWG 1QSEE 1CLYL 3OR6A 3MRPB 1J5OL 1Q0XH 2DM4A 3KLAB 2DL9A 3S98A 3UJTH 5D7SL 5EWIL 3BSZL 3I9GH 3WIHH 3NMEA 4XMPH 5IVOA 4XTRC 1DDHA 3HN3A 2EO9A 5J1SC 3PABA 4LP5A 5CCKL 4HG4J 5CD5C 2HH0L 1SVZA 2YWZA 1T04A 1AGFA 1K3IA 3I6GA 3T8XA 3RNKB 3K8LA 1HEZB 2WBJC 3QULA 1VPOH 3MLUL 1UT9A 2YXMA 1T3FB 4NQEA 5DEGB 5IB1A 2ESVE 3T0WA 1EAPB 4TSCH 1FL3B 1TVDA 5GGRA 3BQUC 4WTZG 5ISZD 2EDLA 3OR6B 5E8DL 1C08A 2DLHA 5IEHB 1EA9C 2Q8AH 5I8CA 5J1AA 4HKXB 2BMKB 2EC8A 1Y6KR 3MRQB 1DDHB 1JUFA 4LHUA 4WO4D 5EIIB 4ZD3H 1ZLWK 2EEDA 3T08A 3TBYB 1G9NC 1AGFB 1CLZH 4HK0A 3IETB 1ETZA 5IWLA 3TA3D 2KKQA 3TH2T 3MRJA 5E1AA 3FB6A 4JRXD 1M4KA 5E5MB 2X70B 4YXLL 2X4TB 1L6ZA 3CFJA 3KLSA 2AABL 1BD2A 5I75C 2YD8A 4IM8A 3H7BA 4M3KB 3MX0A 2LAGB 4WI5A 1T83A 4I1NB 4JFQB 5I8CB 2OXGA 3SQOH 5FOBB 5J1AB 2R1WA 4UT7L 1YEIH 1I7ZB 4N0FB 1VEMA 4QOKA 1IC4H 4YIQB 1MEXL 1JUFB 5JPNA 3UTSB 5HGDA 1C5CH 3ZKQD 2CKBH 2VUYA 1CE1L 1B88A 3F62A 3QFDB 5T33H 2X1PA 1IKFL 4M03A 1RIHH 3AREC 3CMOL 3N06B 3DETD 1CICA 3QQ4B 3QQ3A 4MB5A 2MCPH 3NAAL 4JM4L 1AIFB 1BD2B 2NW2B 3MSPA 5FKPA 1JGDA 1NLDH 3HLAA 3QDGA 2FX8L 1OTTD 1AR1D 2R1WB 3SCMD 3M1BB 2CDFA 3V4VH 5INCA 4PFEA 2F5BH 2BJML 3PIQA 2EDDA 3IXTA 5GS3A 1CGSH 1T7YA 5H2BB 5I18H 4NQXB 3BP7B 1DUZB 3V6BR 3FOMA 4FP8L 1TPXC 1WWWX 1KBGH 3AROA 1PKQA 1NFDB 5I1HL 1YYLH 1JGEB 3ARUA 4LPUA 3QQ3B 3ZYIA 2PYED 2ZG2A 1NAMH 4LCWD 5JZ7C 4LU5L 1IAIH 4UUJA 1NC4D 1H3TA 3GHBL 3QJHA 5IT2H 2CDFB 4UQ3B 3ARGB 3BZ4A 1HHIA 3GJEA 5H37H 1H3PH 2MKWA 1FNGA 4MD0A 4TQEH 1M05A 4UV7H 1DTUA 2EDRA 5SV4A 1YDPA 3IXTB 2PO6D 3WDHA 5JNYA 2Y5EA 3KYOA 3GSQA 4YBLC 2DQUL 5EO1B 1NMBL 3EOTH 4NYLB 2P8LB 2CXKA 4EEEA 4Y0GA 1P4BL 4FQHA 5KVEH 1PAMA 1FDLH 1HN1A 2VNCA 3KPRE 3KPLA 4KJYB 2HJLB 3HC0A 4GAJL 2C3HA 3F6IA 1IZKA 4JKMA 4GOSA 1YEFH 4PRDA 4TSAH 4UUJB 1I4FA 4GW5B 4MNQB 4PREA 4YBHA 3QJHB 5TE7H 1OF2B 1FNSL 4JY4A 4LEXL 3BZ4B 3LY6A 4LEOA 3U9PH 3BJ91 15C8L 2E7MA 1M05B 4RMQA 3UO1L 5IBUB 3RTQD 4RMUA 3WD5H 5E2VL 3REVB 1UKTA 1QSEA 3PWUB 4MA8H 1BIHA 2V2WA 3DX7B 2VDMH 2BRRL 3MA7A 1HYRC 1I3VA 2RFXA 2XWJA 3VH8A 4FFZH 4RIRA 4M48L 5IB5A 1EH9A 2H26A 3HC0B 1NANI 5JW4N 1MHCA 4LKXB 3DGCR 5ECJE 4ZO9A 1KG0A 5DC9B 1K9TA 4PRDB 4D0DA 2B1HH 1FJ1B 1EEYA 4PREB 5CJQL 1OGAE 4OGYH 5E0QA 2DLIA 3BIBX 1AD9A 5MEOA 4LEOB 4ETQB 1ZEAH 4RISL 1HOCA 3QHZL 2ESVA 2XWTB 4HXBL 3RVXD 1BJMA 4L4TD 5KG9B 4WIQA 1GSMA 2XTJE 2APVA 3QFJD 2QSQA 4S1QH 3QPXL 2AV1A 5MERA 3KYAA 1LMKA 5ALCL 3N1GC 4HWZB 3O45A 2XWJB 3VH8B 4RIRB 2H26B 1A6AB 1W72H 1KG0B 4L1DA 5F93C 1KJ2A 4XNQA 3VXSD 3FMGH 3OAYK 5T3ZD 2AK4D 4IRSD 3NCEB 1X9QA 4YHPA 5EZJB 1I8KA 1JK8B 1YEHH 4NO3B 4Z7VE 5FA3B 5JA8B 1QRNE 1MCWM 2I60H 3CPLA 1HOCB 2F8VA 1UM5H 3HR5B 3QUYA 3C2SA 3L1OL 2ESVB 1A1NB 4TVPE 2DRUA 2AV1B 5MERB 3ZO0A 4JZNA 3G5VB 4XCCL 2YBRB 4O00A 4F7TA 2KZ1B 5IVXE 4U1HB 4Z7VF 2G9HA 3BWAA 1A7NH 2FGZA 3QUXB 4TULL 4M4RA 1BGXL 3IJYA 2NXZB 3V8OA 4EUPB 5TDPB 1QYGL 1NDMA 2FX7L 1KJ2B 4FQXD 5I1CH 4XNQB 3C6LD 3QBTB 3I85A 3H8NA 4X5XA 1GGYA 5IVXF 5FIEA 5IGXL 4YHPB 4XNUH 5AAMA 4LQFH 3HNSL 4QHUA 5D1QC 5DD0H 3TV3L 3CPLB 4NSKB 4MX7B 3QUYB 4J3XA 5JIHA 3O6FD 4ZTOL 5CLWA 1G9EA 3RPKA 3AY4A 4L3CA 3FZUD 3GSNH 4U1LB 2WP3O 1MRFL 1TNNA 5CMAA 4DAGL 4Y16B 4F7TB 1O5DT 2C1PB 1QRKA 3VXNB 2YPKB 3C8KB 3BWAB 4KKBD 5GS0L 1N5YL 2D7TH 4XP1L 2CO6B 4NQCE 3AU1A 5AZ2L 4E5XA 3VI3E 5D7JB 1J88A 3WLBB 3QDJB 4MNGB 4RZCB 1MRDH 4P5TD 3L3GA 3MBEC 4N0UE 1NCWL 2NY4B 4ONOA 4E41E 2NXYB 4QHUB 4YXHL 5KTEH 5MENE 4MJ6A 4U1JA 5EORL 4G3YH 4LGRB 5LBSH 4R26L 1CDUA 1S7WA 5AWNL 4PYGA 3WHXB 1EHNA 1QFWI 3SY0A 1LEGB 4RMTA 1GVIA 1TTFA 4GKZA 5IMMA 1X5JA 5CKAA 3NGBC 4OI8A 3KJ4C 4YDIH 4NIKB 1GC1H 5FO8A 3MRDB 3CK0H 5A1AA 3S5LA 4XP4H 1NCCH 5E08L 2GJZB 1L6XA 4PRHB 3DHMA 3L7FA 3MRFA 1CU4L 4U1JB 5IB4A 5ITBH 1NCBL 3MUGA 1S7SA 3F7YA 3ZDXE 2YD6A 3KPRA 5AUMA 1EGJL 3ARWA 4BFBD 1CDGA 3SKMA 2O5ZH 3L6FA 5CS7A 3RWHB 3SY0B 4YX2L 4NQED 4QT5A 5JTWA 2LE9A 4GKZB 3RA7L 1VERA 5A16A 4JFXA 4P2CG 2D0FA 4PRIB 1TVHA 3C60C 5FO8B 3R06A 2B1AH 5EBWB 3LKOA 3TN0C 2VTFA 4K3DL 1S5HB 3L3OA 1R24B 5DMGC 3EYQC 4NPYA 4PJXE 1UM4H 1TTUA 4LHUD 1U8QB 4OBRA 1AXTH 3MUGB 4YHLH 3VWJB 1BZQK 1XCTA 3IRZA 5DS8B 3SKMB 3L6FB 4ZOBA 3C8DA 4PJXF 4XBPB 4ZUTA 1NLBH 1ND0A 3V5KA 1MCCA 3OXRB 3WCYA 1RV6X 4LLQA 1FFNB 1CF8L 1KPRA 4LK4A 1OGAA 5FYKE 3RGVD 4JFXB 4UU9A 2EE6A 2HP4A 3AM8A 4RA3A 4NUGL 1IQWL 3W2DH 3R06B 1JPGA 2QL1A 3UAJD 2QADB 4H5SA 2WWMD 3UJIH 1BLNB 4U1GB 1GGCH 2R1YA 4HJGA 1U8PA 4QOKD 4R0LB 1JPTL 2WWKT 4KUZL 5T1DH 4KK6D 2XRAH 4R3SA 5LWYL 2DLFL 1FL5B 4LVHB 4HIHA 1Q9LB 43CAB 4M6NL 4OJFH 5AAWA 3A6CL 1ZHNA 4TTDC 3EJZD 3RI5F 1CTNA 1P84J 4LSQH 3WFBL 3ULUF 1QSFB 1CT8B 1Q0YH 2NMSA 1T7XA 4ZUTB 2DQCH 1CICD 1ND0B 4OQTA 3QCVL 1HHGB 2X89A 1JZ4A 2ZJSL 1OGAB 2E8YA 2DI9A 3ZE1F 3O2WH 4YEEA 1CGVA 4H1LG 4QRRB 1VESA 1H5BC 1QRNA 4Z7VA 3IGAA 3FHAA 1JPGB 3SE3C 4KMQA 1DZBA 3QDGD 1MCIA 1HSBA 4H5SB 4IMKC 2EXYC 4J1UA 4JGUA 1OAZH 4HJGB 2OZ4A 1OPGH 2XTJB 3BKJH 1SJHB 3B43A 4JFHE 5TDNA 5IVXA 1JE6A 4HIHB 1AXSA 2MHAA 4JFPA 3IFNH 1ZHNB 2EXWD 2VDLH 3MODL 4ODVH 5E1HB 1X5IA 4CJ0A 2WBKA 1IFHH 4NCC1 4GBXB 4CDHA 5FF6B 5CSGA 3ULSA 5HY9A 4MA1C 4WNQB 5HYSG 2EZ0D 3IGAB 1DBKH 4KQ4L 4WW2F 1HSBB 4ZOAA 4IRZH 4JR9H 4ZG1A 5K59F 1FIGL 2ZNWA 2GSGB 4KRPB 5J3HD 1A1MA 4TUOA 3RDTC 3ABZA 3FN0H 2VLMD 2O61B 2V2XB 1AXSB 2J6EA 3CUPA 4FQIH 2WUCL 4JFOA 4XBEH 3AGVA 1GC1C 4JFPB 1HILA 3LB6D 5E70A 4NQCA 2Q3AA 1U3HC 1Z9SA 2DI7A 5KANI 1IAKA 1D6EA 2GSIB 3RL2B 3NA9H 4MJ4A 4N0UA 4NKOA 4E41A 1OD7A 2B4CL 3TPKA 5TQ2H 5MENA 4JJHA 1S9WB 4XVJL 1W2KT 5SWQA 1FIEA 2F53B 1TMCB 2OTUB 3RNQB 2HJFB 5HHVL 1A1MB 2ADGB 5IOPB 4M62L 4AIOA 5IFHH 1EJOH 4Q0XL 1ZTXL 3CUPB 1ZSDA 2GKIA 4I18B 1JGLH 4XMKL 1QSED 4ZTPL 2OTWA 4RQQB 1HILB 5EPMB 4WTXA 2VH5H 3HNTL 4JE4B 3DX6A 4N0YL 5B4MC 1OAUL 3S36H 4K7FB 1QA9A 3IAGC 1AHWA 3BH8B 3O2VL 1RUKL 3SE4A 2DQDH 1CBVL 3WJLC 3C08L 2AEQH 2NYYD 3ULUL 3PP3K 1ORQA 4KJWC 3OPZH 4HAFA 5MENB 3VG9C 1JFQL 2XA8H 2GY5A 4NCDA 2P46B 5D1XB 1E6OH 2CR6A 3BE1L 4GMTL 4ZFOB 1RUQH 3N1FC 4XWOC 4PB9H 1NGPL 3CVHB 5CJXA 2AW2A 2AXGA 3FT3A 1ZSDB 5CFHA 4OCSH 2IFFL 5GGTA 5JPMA 4X99B 4OD2A 1PY4A 3DX6B 1N3NA 4KI5C 4HJ0D 1AHWB 4PJ5B 1KIQA 4M9OA 1S7UB 4I9WD 5F7UA 3DUSA 5T1MA 2AKRA 3WDJA 4PJXA 5IHZA 1NSNL 5LGHH 1YY8A 1EIBA 5HJ3A 3D2UA 3NN8A 3CDGA 4QF1B 5JO5A 3PXJA 2DJ4A 3S35H 5F9JA 3NACL 3H6JA 3E3QE 3KPSE 4NFDA 3H9SB 3KS0J 4GG8B 1LD9A 5H94A 2QQQA 1R0AL 4Y4HD 4PLJD 2ZOKA 1TZHB 2BHUA 3RWCA 1ACYL 3VG0H 5I1IL 4PV8B 3SKJH 3U2SA 5JPMB 2Y5TA 3AS3A 2QJDA 4OD2B 3WIIL 2AV7B 4M8VA 4WV1A 3T3PF 1DEEA 1N3NB 3MOBL 3QRFM 3TZVD 3HAEB 4OLVL 3U36A 3QPQD 1Q1JL 4BH8B 3SKUD 2GTZB 5SX4H 3EYUH 2FGWL 3DUSB 2GFBB 4LCIH 5T1MB 2AKRB 5IHZB 4U1KA 4YHOL 1A6TA 3F5WA 1IQDA 1YY8B 3CFBB 3GRWH 4GRWH 4HQQH 4JHAL 3VXUE 4CU7A 4CVUA 5EU4B 4XHQA 4NHUA 3CDGB 5J12C 1KJVA 4Q7DA 4Z7OE 5DUMH 4XPAH 2FZ3A 2HAZA 1KPVB 2BRQA 2RBLA 2YN5A 5IJVA 4UZGA 4G9DA 5H94B 1LD9B 2JB6A 3NFNA 5F88B 3LPGA 4I0PA 3RWCB 3QNZA 5HDQH 3ARYA 4M5ZL 4Z7OF 3E2HC 3TJEL 5CEZL 3P9MA 1KEGH 4RGMC 4WV1B 4YWGL 4LSSH 2AEIT 3EYSL 2EDTA 3HC3L 2IALB 4JO4L 3O6KL 3NIGE 4QRPE 1W0WA 2H3NB 1JMXA 1S7QA 1MCKA 4JHZA 4MB4A 5E6ZA 1MCRA 1A6TB 4OM1L 3GBNH 3HRZA 2C26A 3UTZA 1GAFL 2QQNH 1V3JA 5C0JA 2BZDA 4ZFZA 4LSPH 2A74B 3U0WL 2IMNA 2FZ3B 7FABL 4JDTL 4NWUH 4WW2A 2CUHA 5IJVB 1YEKH 3LPFA 4G9DB 5DD1H 1JNJA 5HDLA 4RFNB 3MXWH 3QA3B 2ICWA 4YPGA 5T3XE 2J5LB 4OCNC 4OZ4A 3HI6L 3DTXA 3QNZB 3P0VL 5DMKA 5FYJL 5DRWA 3WO3B 1K8IA 3UC0H 4MD5A 1KCVH 1AFVL 5M94B 1FNHA 3U4BL 4OTXH 2B5IB 3BP4B 4OUUA 2HMIC 2MWCA 3I2CL 4HDIA 1W0WB 1U8HA 1MSPA 1YNKH 3F58L 1HQ4B 5F89B 1FVCA 2W0FA 4JDZB 1IC7H 2Y06H 3ZKXB 4J3TA 5ACMA 4MQ7A 4PRPB 2VZ1A 1ZGLM 4RAUA 2G75B 2XY1A 1CXIA 1LQSR 3IJHB 4KC3B 3PHOA 1CIUA 5CP7A 5LCVH 2V9TA 1TZGH 3KPRD 2ICWB 1MQ8A 4YPGB 1E6JL 2A1WH 4KV5F 4YPJA 1MHHB 1U8JA 1Z5LB 2YD3A 1P4LA 3DTXB 4M43H 3GJFK 5D7KE 4D8PB 3SDAC 3IFPA 2BVEA 2V9QA 5DRWB 3LV3A 4MMXC 1XGTA 2AJZB 3VW3L 3BT2H 4XCNA 5EO0B 3L5HA 1MCHA 3HC4L 5FCUL 4HDIB 2Q6WA 5HXMA 4NO2B 4EOWH 4WDIB 1MFCH 1FVCB 4LHUG 5CJ5A 3FN9A 2IFGA 5IBLC 4Y19D 1G7IA 4MQ7B 4JB9L 3HFML 2XZCL 4MNHB 1KB5A 3W11D 3SGKA 4ZUWB 3K8KA 3KJ6L 3LEYL 1AKJA 5CP7B 5SX5K 3SDYH 5AG8A 4LOUD 3UDWC 1HZHH 1P4LB 3QJFB 2J4WL 4Y8AA 4G80A 4QXUL 4YLQT 5TQ0L 3UBXA 1QFUL 1C1EH 2DM2A 2NZIA 3DARA 2Q6WB 4BSJA 2Z93A 4OIAA 1G6VK 1NBYA 2YOCA 4K9EH 4MCYB 4JDVA 4ZQKA 4DKEL 1CDJA 2YHGA 1G7IB 1KLUB 2O93L 2B0SH 3O3BA 4K7PY 1OAQL 5F6IB 1AKJB 1S3KL 1S8DA 4R4BA 2F58L 2QKIA 5DO2C 1MCOL 5JIPA 1MH5A 5L2JA 6FABH 2QHRL 4G7YH 2Y6SC 4G80B 5IMOA 3HE7C 1AQKL 1CZ8L 5TE6H 1CDHA 4NKIH 2X89D 2EYSA 5E8PA 4K2UH 2Z93B 5D93B 3VFRA 4X6CF 3KPSA 5F7KC 3VXQA 3UJJH 1QRND 2K3TA 4ZQKB 4HIJA 1ZMYA 3BW9A 4XH2B 4ODWA 4FXKA 4XVTH 1IM9A 4TVPD 1P9MC 4HPOL 4A6YH 4PGCA 1N5AA 5DJXA 5EOTB 2GJ6E 3O3BB 1I8IB 1F6FB 4Y5YB 2X2YA 2AJ3B 4RFEA 1GGBL 1S8DB 1J0ZA 4R4BB 4CJ1A 2R0WH 4O2CB 4UAOC 4TSBH 4DKAA 1S9KC 2FWOA 3WDIA 4IBLT 3P77A 4W70A 1N4XL 4M7JL 5J9PB 3VXUA 1G9ML 2G5BA 5CP3A 2AJUL 3VFRB 1WIUA 4OBSA 1TDQA 4K71B 4R90H 3VXQB 4GRLA 4HJJH 5I8EB 2ENYA 1P2CB 3BW9B 4WWKC 5T1LD 4GMSH 5I19H 1XT5A 1FL6A 3O4LD 4ODWB 4BZYA 4FXKB 1INQA 4ORGA 3U9UA 1KN4H 4PGCB 1N5AB 1JTOA 4HK3J 4P99A 1KLGA 1AR2A 4KDTA 4ODUB 4R7DA 5HHPA 2X05A 5IP4A 1AGEA 1O7SA 5JHDB 3D9AH 4QRPA 4LMQI 5KSUA 4NQCD 2N1KA 3EFFB 4PGZA 2VZUA 4XI5C 1U93A 4S2SB 2IPUK 3P77B 1BEYL 2R1XA 2R4RL 2G5BB 1FO0B 3MGOA 3RUGB 1MCDA 3EFDH 5GRUH 4E41D 1NMAH 4HBCL 1R6VA 4GW4A 5DQDH 4YEFA 4YHMH 2OL3H 1S5IH 3HNVL 4CVXA 1HWHB 3GEWB 4HFWA 2CJUL 1INQB 4ORGB 3CNKA 2NTFA 3IXAA 4NNPL 5B22A 3VH8G 2ZUTA 3NCBB 2NCMA 2W9DL 3BP5B 3CFCL 1I3RB 3PWPE 4R7DB 4C58B 5IUSA 1AGEB 3KNBB 4LLMA 1K4DA 2XWBA 1JVKA 5I1KH 2HTLC 4UBDD 2JKXA 2ADIA 2CH8A 4F58L 4UI2A 3O6ML 3QNYB 4GRMA 4LDLB 1ZLSH 3TFKD 1UWXK 1T1YB 2D7NA 4GW4B 4JN2A 5LG1A 5SWZE 4EI5A 4O58L 3TP4A 1NFIB 5BO1L 1K3ZA 3B9VA 2X4OB 3IF1B 3RWFA 4XP9H 5A2KH 3T0EE 4HWEL 2NTFB 1A3QA 2K1MA 5FGRA 3RWEB 2HTKC 4BK4A 1OQXA 4JFFE 5FEBA 1MUJA 3ARRA 4K9EC 4P57A 3IFOA 4PY7A 1IKNC 2G60H 1Q9OB 3BGFB 3QIWC 4KGLA 4HKBA 1Q0XL 5BW7C 3UJTL 4GRMB 1OP3K 1XGYH 1IGYA 3I9GL 4ZNEE 3MLRH 4MWFB 1MVUB 4DJMA 3GMRA 1YMME 2ITDA 3FQTA 5EOCL 4EI5B 1F4YL 3D2UD 5F7WC 3SQBA 1UA6L 2V5SA 4M93B 4HUUA 5E2UL 5IKCA 3VGAB 2N56A 3QUMB 4PGBB 1VPOL 4R7NB 5FYJU 2R2HB 3CVIH 2OLDA 1MUJB 3MOQA 1EBAA 3BO8A 5HHXH 4P57B 1IGTA 4PY7B 5FYKD 4MA3A 1JNNH 5DF0A 1I7TB 4JPIA 1CL7H 3RZCC 4QXWA 5DXWA 1IGYB 4YO0A 4BZ2L 35C8H 1DEDA 3N1PC 3GMRB 2ITDB 2A6KA 1K6QH 1CK0L 4ZD3L 3VGDA 4B5EA 3NFPA 4B0MM 3MREA 3GNMH 3NA4A 4KHXH 3OKYA 4DK3A 4I0PD 3RVVD 1IGTB 3MV01 2CGRH 5I1JH 3VD4A 2VKWA 5GSRA 5FYLE 1K85A 3Q1SL 4PJAE 2EICA 1TETL 1HNFA 2I9LA 3JTSA 4A2LA 4OKVB 3THMH 4RX4D 1CVRA 1MHEA 3SQOL 4HF5L 1X5GA 4YO0B 3QH3A 4YK4B 1EAJA 1YEIL 2GJ6A 4JFHD 1PZ5A 1IC4L 2A6KB 4MA7H 5J13B 4NDMA 5DQJA 1C5CL 2NY4C 1FN4A 2BVPB 3DXAE 2X9XA 4RFOH 1JPST 5TFSH 1KV3A 4ZUUB 3MREB 4JFDE 3VFTB 4BZ1L 3DRTA 3T2QA 4U05A 1R5WB 4FG6D 1YPZB 1I1RA 3G5ZA 2NY0D 5K9OA 2XKNA 3M17A 2YUWA 3PQYE 3G5XA 2LFGA 5C9JA 5IW6B 3DBXA 1PFCA 1TJGH 3IDGA 3I6LE 3S5LG 2I9LB 3LRSA 4POZD 4AEHH 3FQXA 1OP5K 1MHEB 3I84A 2OX5A 4HIIB 2EYTA 1XF3A 1T21A 2EDQA 1P7HL 3DRTB 2NR6C 5ILTH 3MNVB 5EBMA 5FUCC 1KBGL 4QLRA 2KUTA 4M8QA 1YYLL 1MREL 1U95B 4D2NA 1XGUA 2I9TA 3LRHA 3M17B 2ERJC 4PLKD 3G5XB 3QEHB 4PUBH 3DBXB 2H2SD 3GM8A 5IR1A 3IDGB 3LRSB 4NWTH 1I3GL 1XMWA 4X9FA 1RZFL 5C0DA 4Z0BL 1OCWL 5BQ7A 1F4XH 4OFYA 1JI2A 3GI8H 4FFWD 5FHAH 5J8OA 1H3PL 3PWPA 4UV7L 1FFPB 3WL9B 2EDKA 3BUYA 3IS1X 1YECH 1SJEB 4L8DA 2R2EA 2V7HB 4Z7UF 1A7OL 5EBMB 5FM8A 3VWJC 1KFAH 1O0VA 4OLXH 4M8QB 1BQLH 1KIPA 2XPGA 1FDLL 3C09C 2WLYA 4LRIA 1JGUH 1ZGLP 4KWUA 5FYJD 1RZ8A 1MFAH 5HSFA 3VFPB 3VD5A 3TM6A 5IR1B 5K9KB 1NAKH 5SWZA 4NJAH 5T5FL 4OZFA 3U0PB 3EBAA 4TSAL 1RK1B 3BRFA 1OAKL 3T0EA 3RU8H 2JTDA 3SEPA 1T89A 3IFLH 4DVRH 5C8JB 2NY1B 1LWRA 2QADC 4JFFA 5D6DA 3ZL4L 2YUVA 3PWPB 1EZVX 4ZPVA 3OHXA 5CILH 1OAYL 1G6RA 2Y72A 3BUYB 3BMWA 5EOQL 3H0TA 3E6HA 2R2EB 5FYLL 4FFYL 2DD8L 5TDOA 2VDML 4LDOB 4K3HA 1J8HD 4FFZL 3BIKA 2NY6B 2ZPKH 4AM0B 3VFNB 2XQYK 4ZNEA 1CFNA 2X4SA 1YN6A 3IKCA 3QCUH 1KLFA 1YMMA 5SWZB 2X4RA 4OZFB 4FQ2L 1JP5A 5EO9A 3SBWC 1ZLVH 2B1HL 4NO0B 5IBTH 1P1ZA 5DFTA 3SGDI 1HI6A 3KPSD 2XZAH 2ITCA 1TXKA 3FB5A 2ZUUA 4U6YB 1IEBB 4HD9A 1IM9D 4X7EC 5F7HA 2EEBA 5EIVA 3E6HB 5GGVY 3ZDZF 5LKNA 5F1IA 4JO3H 2P4AB 3MRBA 5TDOB 5I1EL 1H3GA 2R8SH 1I8LA 3L9RB 3MRLB 3BYTA 3ES6B 1A6VH 1CFNB 5F9WB 1YN6B 4Z7QE 1U58B 4PJ8C 4QKXB 4WEBH 1YMMB 3VXUD 2X4RB 5EO9B 2WZPD 1P1ZB 4HZLA 2FIKA 3V7AE 1N8ZA 1N0LA 4GRLD 4NBYB 1YEHL 4EDWL 3BZEA 4Z7QF 5GGRY 5ITFA 4L4VE 1HH6A 5IQ9A 3B9KA 4P2OB 3JV0A 2XIDA 1UB5A 3FO9A 2A6JA 1EERB 3CGTA 1RFDH 3O0RH 2MQCA 4PJAA 4DEPB 1HCVA 3MRBB 3T65A 4QRPD 1BECA 2AJVL 4KHTL 4P9HH 2X10A 3ULVH 4LSRH 1QFOA 3QISA 1KIUA 3GSXA 2H9GA 3ZKMC 4WU7A 1RURH 1J9CT 4G8EB 3ARFD 1RUPH 3DXAA 1ZA3B 4Q9QH 1N8ZB 3DVFA 2N7AA 4JFDA 1F6LL 4XP6H 5ACZA 3S3JA 1FGNL 3FFCE 5FO9A 2BERA 3ZHLA 2CRMA 1FZJB 1UB5B 3HMXA 3PQYA 3WXWH 2VOTA 3GSNL 1OHQA 4PJAB 2P43B 3HPJA 2UUDK 4MXVF 4HGMA 4UINH 4MAYA 1A47A 2D7TL 8FABA 5GHWL 4NP4H 3DJ9A 3JXAA 1NBVH 2Z8VC 1MRDL 3PWLB 1RJLA 4JFDB 1EEQA 1A6UH 3O8XC 1YQVH 4R96A 5ACZB 1DQDH 1U0QA 3ARDA 4JVWA 3F7VA 1WZLA 2IGFH 1BIIA 4G3YL 2K7QA 5D7KD 1NC2B 4O51A 4X7CC 3LVEA 1PKOA 4PD4J 2KPNA 4EBQL 1A6ZB 1ADQA 2JJWA 3R0NA 2DB8A 2X4QA 5JW3L 1UFUA 1FV1B 4MAYB 4HPYH 4TVSa 4QHLA 1EVTC 2NY3D 4M1CD 1A64A 3MGTB 1CDBA 2E3VA 2P47B 1J05A 3EYOB 4NZUL 3F7VB 1CE6A 5CJBA 3VWKA 5ITBL 1BIIB 4F3FB 4H26B 5FGSA 4C56B 3BPOC 2O5ZL 1PDKA 4YHZH 2AVGA 1H3VA 1MHPH 5B38G 1D9KA 5DJ2A 2FRGP 3IDIA 2W07A 4QO1A 2CMRL 5EFIB 2XT1B 2ICES 4QHLB 2DQTH 3T2OA 3D39D 3UCRA 2W0KA 2VDRH 2B1AL 5IFAH 2XNAA 1QVOB 4QYOA 4NFCA 4X0KB 2VN4A 1DVFB 2L4OA 3RWIB 4F9LA 4BK5A 4ENED 4YQXL 3FQUA 2VZTA 3OKOA 4YHLL 1QLFA 1UB6A 5HYQB 1N0XH 1CD9B 1NQBA 4KROC 2XQBL 1AE6H 1OGTA 3T0BA 5I0ZA 3QO0A 4R8WH 1IAII 5IIEB 4P3DA 4G43B 1NLBL 3IDIB 3DWTA 1F4WL 5F1KC 4LHJB 4Y5XC 5DLML 4NM8H 5EUOB 1WV7T 5HVWA 1B0GB 2C7UA 2DYPD 3KPNA 5HPOA 3W2DL 4CW1B 2XNAB 3TVMA 4MDJA 4XGZB 5J6GB 4L8BB 2GJ6D 2VLJD 2OCFD 3CU7A 4RGNC 4ZPTB 4OLYH 2XRAL 4WEMB 1HCFX 1KTLB 4P23B 1TQBB 2EDXA 4P9HC 3ULVC 4L5FL 1DN0B 4H1LH 3LKSA 5DVOA 1N64H 1OY3B 1S78D 5L0QC 1OGTB 4LSQL 3RL1A 4OLZH 4JPKL 1Q0YL 3OKMA 4P3DB 1VFBA 1J1XL 3RHWK 2F15A 1SEBA 2BVYA 2QSCL 2E6JA 5JQ6H 4PJ7B 3WNLA 1ZANL 1DANU 1FG2A 4M9PA 2OK0H 2B5IC 5D4QA 5AG9A 3O2WL 4D0CB 2C7UB 1C7SA 2VWEC 3KPNB 3MLXL 4M4PA 4I3GA 4L4VA 5F3BB 3W9EB 1P7QB 4LARL 1OAZL 1WLHA 3F12A 1OPGL 4ERSL 4U6VL 5LGJB 3LKRA 5C08B 3RAJH 1T5XA 4AT6A 2FO1A 1JRHH 1BP3B 5E56A 5C0ND 5BXFB 4CVWA 2A83A 3SGJA 3O9WA 3IFNL 4GQ9H 1QBBA 2BY3A 1REIA 2BVQA 3RL1B 2X4NA 1FC1A 1U2HA 2GHWB 5J11B 5HBBA 5C9KA 4FFVD 2DJUA 2JF1A 3B83A 3TIEB 3RP1A 3T1FA 2R29H 4I2XB 4G8FB 1TITA 2BNQE 2PETA 3MRKA 4L4VB 2DF3A 4S1DD 3FFCA 2E7CA 3FO1A 5I9QB 4JR9L 5C2BH 5DVLA 1IGCH 5CEXA 4BM7A 1WCBA 3OGOE 1GHFH 1QLEL 1F13A 3LKRB 1T5XB 4AT6B 4NKQB 4K23H 2XI9A 2GAZA 4XBEL 3UBXG 4JM2F 5DJ0A 1CGXA 2N7BA 2ADJA 2IAMA 3DUHA 3U7AA 3G08B 4PJDE 2F19H 5GS1B 3NA9L 3DGGB 5B8CB 1FVDA 5DQ9B 3PWJB 3WO4B 5L8KB 4I3SH 4DZBB 4WO4C 5TQ2L 4HWBH 3EO1A 3P4NA 3T0ED 1UG9A 3FFCB 3KGRA 1HKFA 1PG7H 3HPLA 4PJDF 3TA3C 3V6FA 5CEXB 3BKCL 1CFTA 5HDBE 1MNUH 4JFFD 1M7IB 3SKNB 4OI9A 1B9ZA 1PY9A 2AQ2A 2R2BA 3BX7C 1GGUA 3UZEA 5A40E 5HDBF 1OLLA 3SO3B 4GAYA 2ZSVA 4G7VL 5HHNA 1FVDB 4G6AD 4LMQE 2YA0A 4R2GD 2BCKA 3WN5A 3U83A 2AEQL 3PL6A 3HUJB 1KB9K 2ZUQC 3B9DA 5EC2A 5GRVL 3DUUA 4XBGB 5D93C 1J86A 3OKDA 3HPLB 3LN5A 5T3ZH 1E6OL 1RUQL 3MRGB 3DETC 4PB9L 1UEYA 2DDQH 2NX5D 1DQJB 4L8SB 4OCSL 4Y5YC 1F58H 3NZHH 4PBXA 1KCLA 5JR1H 1I1YA 1OTTC 1AR1C 3FRUA 3SCMC 4KXZI 3FT4B 2I24N 3RIAF 5KVFH 2Q76B 3PL6B 1MWAA 2KH2B 1ZT4A 5EC2B 4QHMA 4TRPH 2A9NH 3MZTA 5L9DH 4PJBE 1WBZA 3A0OA 3B9EA 2IPUG 3MJ8B 2CLVA 3INUL 1F90H 4Q9BA 4FTVD 4PJGB 2J88H 1PYWB 4Z0XA 2DMCA 1QZ1A 1RZ7H 1P53A 2F54E 3B9KD 3JWOH 1BOYA 4JO2H 5FYLD 4ZNCD 3VG0L 2Z0BA 3SKJL 5IB3A 4LIQH 4M3JA 1I1YB 2VLRE 4YHKH 3FRUB 2VITA 3VFSB 1KPUA 5D1ZA 1A7PH 3EYUL 4LSUL 4OB5H 1I85A 3D0VB 3DSFH 3GRWL 4HQQL 2PO6C 2P24A 3DXAD 3SDCD 1CTOA 2YRPA 3F6LA 4JRWA 5DUML 4XPAL 3DMMA 4GW1A 1XEDA 3LZFL 1U8KB 4CNIB 5GRVK 2EYRB 4KK8D 1I9RH 1WIPA 3PQYD 5F1OB 4OZIF 3I6LD 3NCCB 1KEGL 3Q3GA 1FYTB 1UH4A 2OP4H 3N50A 4DGVH 2VITB 3VXMD 2DM7A 4NHCL 5D7IF 4UILH 3ROLA 5ADOL 1Z2KA 2RQ8A 3GBNL 5DT1H 2OM5A 5C0AE 1FAIL 2XICA 1AC0A 5CD3A 2QQNL 4NBZB 3UTPE 4LSPL 5KS9F 3I50L 5E6ID 4UQ2B 3DMMB 3UYOD 2LAAA 3ARDD 3MCLL 4NWUL 4YDKH 4B50A 1YEKL 3LHPH 2WQ8A 1VENA 5ALBH 4CUCA 1BJ8A 5E9DE 3U46B 4NGHH 5C71A 3QHFL 4H0GA 4NQDE 5AYQA 4OD1H 3Q3GB 1SYSA 2BNQA 5K9QI 2ZCKL 1G0DA 4PRNA 1Y0LA 4WHTB 2A38A 4WUKH 5MP6H 3GB7B 1YNKL 3WS3A 2Q20A 4X4XA 2I26N 1DCLA 4EQ2A 4IJ3C 1IC7L 4X9IA 3RVXC 3LPWA 3X3GH 5IFJB 2NW3A 1JNHA 1A5FH 4TUJA 4LVOB 5ENWA 1HHKB 5CSZB 5EBGA 5EN2B 4HUXA 3VWKD 4M93C 2ZUYA 2BK8A 4PJDA 4W4NA 1BF2A 1TZGL 4YGVB 2Z91B 2A1WL 3EOBB 4M43L 1PX4A 4PP2A 5KVGL 4LPVA 1D9KD 1T66D 1CIDA 2XFXA 2BNQB 3BT2L 2IQ9L 3BXNB 4IRSC 3WE6B 3EIFA 3IJSA 5DTFA 4OZHF 4S10A 4XCFH 9CGTA 1BAFL 1MFCL 5FECA 5J4MA 2BC4B 4X4XB 1K2DA 1P5VA 1J5OH 1JN6A 3DVGA 3KPPA 5GJTL 1LNUA 4PJ9A 4V1DB 1QP1A 3ZMRA 5D7SH 5I74B 5EWIH 3BSZH 4TUJB 3LSOA 4AY0A 3SJVB 1IE5A 4MZ2A 3VFGL 5CGYD 2EDJA 3QIBA 3SDYL 3PWVB 4F15C 5MEQA 5CCKH 5DD5L 3IU3B 4KJQD 3ARQA 3QIUA 5INDB 3PGCA 1CGYA 1NDGA 3MLUH 3QXTA 4FQXC 4U6XA 3C6LC 2APTA 2IMMA 2KBGA 4L3EB 5DTFB 2CLRA 2CQVA 4PJFE 3JWOC 5FECB 1E4XI 1CDYA 3KPPB 3O6FC 4XVSL 1LNUB 3TVMD 4L4JA 3C5SB 3GMMA 3FZUC 1JHLL 3QRGH 4NO5B 3KHQA 2UY6A 3HZVB 5J13C 3RX7A 1QFPA 4PJFF 4P49A 3B8YA 2WSKA 3BPLB 3ZT6A 4DUVA 5MEQB 4PGJA 1F2XK 3RIAK 3L3HB 1M1SA 3D69B 1KIRA 4G7YL 1H8NA 1JYWA 1NDGB 4U6XB 4P5TC 1LE9A 1UJ3A 3OAZK 5CIPA 2VXUH 3NCJL 5TE6L 4JQVC 4PJBA 1IL1A 4NKIL 3MRNB 4YXLH 1YN7A 4QNPF 5GQBA 2AABH 3VGFA 3UJJL 2YSSB 3GMPA 5E5RB 2CUIA 2ID5A 5CWSA 3D3VE 3V6ZB 3GMMB 4FXGA 2XG4A 3KLHD 3EKCA 4A6YL 3CFEB 4UT7H 1NGZB 4X6DF 4HEPG 1MEXH 3MJ7A 1R3IL 4LGSB 3VE0B 4DGIH 1Y18A 1CXLA 2VLRA 5C0EA 3O9WD 5KN5A 2R0WL 1CE1H 5HI4D 5J89A 4TSBL 4FABH 1LEKB 2IADA 1QEWB 3WLWC 5DURD 5BOPA 5AEAA 1QBLL 1IKFH 2QEJA 3WS6A 1KJMA 4KK5C 4LLAA 3L3DA 3CMOH 4PJBB 4WFEE 1LO0H 4R90L 5ESAA 3GMPB 3V5DA 2JLLA 1C5DA 4FXGB 2FX8H 3AMLA 2Q8BL 3REWA 4F7EA 3MJ9L 2XN9E 1V5JA 5J6HB 2VLRB 5DHYB 1DBJH 5C0EB 1EHXA 3MC0A 3D9AL 4H25A 3ZTNL 5KN5B 2IAMD 4CMHB 4NC1E 4OZFG 2C1OB 5E8OA 5KSBB 5C0AA 1AXIB 5I1HH 5EU3B 3P2TA 4L9LA 1H15A 3N85L 5GRUL 4HGWB 4XNXH 2UZYB 4YHIB 2XQYG 4HH9A 4GKNA 3V5DB 5IWLC 4FQPA 1TJIL 1C5DB 1ODAA 4BSVA 5E9DA 5FGBA 5DJZA 5LJYH 3K1DA 3FONB 4P5MB 4NQDA 5TGBA 2YEZA 3DNKA 4Q2ZB 3EJYD 4P4KA 2V17L 1ED3B 3GUTA 3M8OH 1MF2L 2Z4QB 1F02I 3RGVC 3O4OC 3LKPA 2CUMA 2PXYA 3BEVB 3DX8B 2DQUH 2XXCB 5DJAB 5TH2A 4P3WA 2X9YA 2WWMC 3CSBA 1GZQB 3OAYH 5C0AB 3BH9A 1ZLSL 1JMZA 4L9LB 1S7XB 5E2WH 1X7QB 4GAJH 1A7QH 4F9PC 4HH9B 4GKNB 1VHPA 4HXAL 4XP9L 5E9DB 1XR8B 3EJZC 1OLZA 3G6JF 4J3UA 4MSWA 3ZDYE 1CN4A 1MI5D 1SYVB 2KQNA 1NGQL 4G9FE 4K3JL 1S9XA 4O2FA 2BX5A 4I5BA 3MJ9A 5TGBB 2YEZB 15C8H 2PTUA 1OB1A 3OKLB 5IESL 5E2VH 3LKPB 2PXYB 2P5EE 2G60L 3C5JB 4K8RD 5DC0A 3T09A 5TH2B 3X11A 3ZDYF 3SKOA 2UYLA 1T20B 4QRSA 3CSPA 4M48H 3BH9B 3H9HA 1XGYL 3MRIB 3MLRL 1I8MA 4HV8A 1V05A 2AK1L 2P8PB 2LTQC 1C12A 4Y4KB 3GMNA 3TIDA 2EXWC 1JWUA 3V79C 1F11A 5HDOA 2YK1L 3NZ8B 1S9XB 4I5BB 1A2YA 1LEIA 2ILLA 3CVIL 5ANME 2P8MB 1OB1B 4QRTA 1QQDB 1RVFH 1U8OB 4PJFA 1JNNL 3QPXH 4KKAD 4NZJA 3BQUA 4WI8A 4WENB 4Q6IC 5ALCH 2FR4A 2BVOA 5ID0A 1CQKA 1HH9A 2VQTA 4QRSB 1G7PA 3NTCH 3H9HB 3TT3L 5J3HC 5D1ZD 1I8MB 35C8L 3WFHA 3U7WL 2FLRT 1YNTA 5KVDL 1C12B 2G2RA 1IVLA 5L2KB 3S8WA 3QNXA 3UYRH 2HLFD 4ZXBD 3LB6C 1JWUB 1F8TH 1F11B 2A6IA 1LEIB 2WBJB 3TO4A 1T1XB 2YD1A 1F3JA 1JJUA 3WFDL 3MLYL 5IMLB 2AXHA 2Y7QA 1T2XA 3BQUB 1TCRA 5ID0B 1QFWM 4HC1A 3D3VA 1G7PB 1MVFA 3THML 1E28B 2M2DA 4D9RD 1BZ9B 1ZA6A 4L29A 4TULH 3C87A 5EU6E 2DWEB 4TUKL 3WIFB 2YC1A 1QYGH 2G2RB 3AXLA 2FX7H 2OQJA 3EW3B 3QNXB 5JMOC 4S1SH 3MRCA 4M7LH 4RFOL 5TFSL 1H0DB 2A6IB 2FATL 3D18B 25C8L 4GLRI 3BWUC 1YEEL 2NYYC 3AREA 1TZIA 3VXRB 4HKZA 4DAGH 3EAKA 2PR4H 3QWOB 3IT8D 1TJGL 4JM2D 4ODHH 3D3VB 3IS0X 4IRJB 5D2NE 4F7CA 4AEHL 1MAJA 1OSPL 1OARH 5BCAA 2A2QT 1ZA6B 4L29B 3HI1B 4DFIA 2IJ0C 2PTTA 4XP1H 2H41A 3WXVL 2XN9A 2YC1B 2NY2B 5IG7B 1GYAA 2APFA 2OQJB 3UTQB 1P7KB 2AQ1A 2PCPA 3MRCB 1M6OB 1NCWH 1X6NA 4YGAB 3T1WA 1NCTA 4HJ0C 1AGCA 3B6SB 5EORH 4LBEB 4RMVA 4R26H 4GG6B 3AREB 5AD0A 1ORSA 5AWNH 1TZIB 5ADPH 4L3AA 4NUJB 4BELD 3QDME 3IVKA 2FLBT 4NWTL 4P2YA 2AJYL 4F7CB 5C0CD 4U6HA 1A0QH 3OG4B 2VO5A 2PTTB 5ICXA 2V5RA 3TBWA 1FVEA 3GI8L 4Y4HC 5FHAL 2N4IA 4PJ9D 1QG3A 2GW5A 1MJJA 3GSOA 4DUWA 3BN9D 3UPRA 5BRZB 4BUHA 4XB8A 2PCPB 1YECL 2MCG1 5CJ8A 5E08H 5KANG 2X4PA 2VC2L 3QUKA 3QIBD 3TZVC 3ZE2E 1MCPH 2GUOA 2E5EA 1CU4H 3VFUA 2D9CA 1BQLL 1TPXB 3RWDB 1CVSC 3QIUD 1EGJH 3H2WA 3WIHA 3EGSA 4AYFA 4ZFGH 4I4WA 3WNOA 3QUZD 2VAAA 2P5WE 5E8NB 2OSLA 3B4NA 1A9EA 2EDNA 3OAUL 4OIIL 4X6CB 2V7NB 2VE6A 4YX2H 4MCZA 3ZE2F 2VLKE 4Y1AD 2IBBA 4U6HB 4XPBH 4ZSOB 3SDXB 5A2IH 3RU8L 1ZK9A 4G9FA 3X12B 3DV4A 4OGXL 1XIWD 5CZKA 3UPRB 4K3EH 5CILL 1UACL 4K3DH 3TBSB 3W0WE 2OZ4H 4TVPH 4AMKL 2P5EA 4J2XA 4YBLB 1HXMA 2LU7A 3K80A 3VFUB 3V7AG 2Q3ZA 3ISWA 4P46A 4GXVH 3T2NL 1ZT1A 5L6YH 3U79A 1FNFA 4M6ML 1CWVA 3UZQA 3HE6A 2VAAB 4WFHE 4APQA 1ZVSA 32C2A 1OTUD 4P2QE 3K2UH 3TGXA 3S4SA 3HB3D 4LCYB 4XXCA 5B39B 3MOAH 4RSVA 2XZAL 4JZJA 3DV4B 4POUB 2F54D 4NUGH 2UWEE 5ANMA 3MRHA 5AZEL 4LAQH 4WI3A 1AP2A 4XXDA 2P5EB 2I5YL 1NBQA 1D5IH 1FQ9C 4JPWL 4WUUB 5LWYH 2DLFH 1ZVYA 2J6EH 4M6NH 3OKNA 2UWEF 1D7FA 1IEAA 1ZT1B 4ZFFA 2R9HD 1F3RB 4WEBL 2Z9TA 5J11C 3O81A 3WFBH 3LKNB 1DSFH 4LLUA 2R0LL 5HVHC 2UZIL 1JBJA 1I1AA 3Q6FB 4ZUSB 4V2CB 5D7LB 2Z35B 5D9SA 4AL8L 4ONGL 5DA4A 5GGSB 2BSSB 1EUUA 2DLEA 2QQKL 5A2LH 2CD0A 5IK3B 3TCXA 5KSVA 4ELKA 3O0RL 3C5ZA 5GS0C 1RHFA 5L8LB 4PJEE 2CR3A 1DE4A 4MD4B 4CVZB 2A6DB 4P9HL 4HLZG 4KGJA 5EU6A 4Q74A 3MODH 4HZAA 5GS1C 3MV9E 2BOBB 4KKNA 3UTPD 2CKBB 4WW1A 1MOEA 4H0HB 1XH3A 3QZWB 5I66A 2YD2A 4PJEF 4ZAKA 1FZOA 5FB8A 4LOUC 5D1QA 3X13B 3GSUB 3IRPX 4CRPA 3V5HA 1FIGH 1ZLVK 3WXWL 4NQDD 1KC5L 1NAMA 4BQCA 1JHKL 3HA0A 1CL7I 3QI9A 4P4KD 5D2NA 5C70A 1EFXA 1SQ2N 1T1ZA 2SEBB 2WUCH 3AM8C 1DE4B 3O2DL 1KYOJ 4M6OL 3HCVB 5GGTH 4XCYB 1OAXL 5F8QC 3O3DA 2Y4SA 4OF3A 1NCUA 2EKSA 4WW1B 4LLVB 2FH8A 3CX5J 4JVPA 3BZFA 1XH3B 4ISVA 2B4CH 1YQVL 5I1AA 4OKDA 1DQDL 5FB8B 3MCG1 4FQQB 12E8H 3KYMA 3D5OF 5D1QB 4XVJH 5EZIH 3V5HB 3NIDE 4YC2C 3C8HA 3CH1B 4MYWB 1NAMB 5HHVH 4Z78A 3QDMA 5HYJD 4KPHL 3UZVB 4Q0XH 1ZTXH 2JIXB 3FQNB 3T0XA 4HX1B 4PRAB 1EFXB 3B3IA 3JUZA 4XMKH 5I73B 1BQUA 4HPYL 3DROB 3HNTH 3NIDF 5F7EH 3WNKA 2HFFB 4N0YH 2GK0B 1OAUH 2DM3A 3O3DB 3V2AR 2NTSP 1RUKH 4ZOCA 2IQAB 1CBVH 1LDPL 3MBEB 3C08H 4ISVB 3ULUH 1BX2B 1OSZA 1CFVH 1WIOA 3E0GA 3QEQB 2X9WA 4N1CA 5FUZL 1JFQH 5CGTA 3EHBD 4ZUVB 2FX9L 4HMEA 1T7ZA 3ZKSD 4Z78B 2P5WA 3QDMB 1MHPL 4OV6F 1NGPH 1VA9A 3HG1B 4X5LA 43C9A 2VLKA 1JYXA 1I7UB 4NZRH 2ZCHL 3O2DA 4Z7WB 3B5HA 3PDOB 2COQA 4OGZA 3IDNA 1AY1L 1CG9A 3KJ4B 2IBZY 4X8XA 1C16A 5DMIH 3P30L 3LOWA 4KI5E 3W0WA 2CIKA 5D5ME 3QXVA 1A4JA 2CIIA 3EDDA 3GDBA 1Q9KB 2ZOLB 1OVZA 4NOFA 1N0XL 4DWHA 1W72A 3NACH 3VCLA 1AE6L 2P5WB 1EPFA 4R8WL 3TO4D 1R0AH 1IGJA 2VLKB 4JFZL 4P2QA 1ACYH 3TNNA 1BFTA 4NM8L 2UVFA 5E00B 4BQBA 3TH3T 4F8QA 4NQTA 4U7KA 2UWEA 3MOBH 4OLVH 2PF6A 5F8RC 3C60B 1Q1JH 3TN0B 4Z8FH 3S6CA 5TJWK 1G7JB 1A4JB 2Z31D 3B2UD 4OLYL 3SDDD 4C83B 1WGOA 3LDBC 4JHAH 3GO1H 1SM3H 3GJFH 4YR6B 2W65A 3VXMB 4UBDC 1FP5A 1FH5L 1CD1A 1W72B 2X7LA 1MY5A 4G6FD 3RWJB 3EZJB 3V6OE 1X5HA 4X8JA 3TFKC 1J18A 4HMCA 3QWRA 4PBWD 5KSAA 3DURA 3L3JA 4PLOB 4WFED 2ZNXA 5JQ6L 1JPFA 3TNNB 4JFED 4YE4L 4M5ZH 2R4SL 3TJEH 4HIEA 5T1KA 2OK0L 5BS0E 1I9JH 3HC3H 5DJ8A 3O6KH 1H5BA 2DTML 1AJ7L 4IMKA 2C3VB 2XN9D 5SX5H 3KPOB 4Z76A 3RAJL 2X44D 3G9VA 1JRHL 1WZMA 4LVOC 1KN2H 3NIFE 3VGGA 4J8RA 1KEMH 4PJEA 3U0WH 4YAQA 1KB5H 1CD1B 4U1IB 2X7LB 2EDBA 2EIDA 4Z18A 4JDTH 4M5YL 2CK0H 3MV9A 4PTTA 3VRJA 3JV4B 2B4CC 1KTKE 4P59H 5C0IA 1CGWA 3S88H 5C0BB 5FYJH 4YZFF 3U7YL 3D6GA 3U4BH 5BOZG 5JZ7D 4AH2A 5C2BL 1FBIL 3GSNB 4M1GH 5ICZB 1TVBB 3MCKA 3F58H 4JG0L 4Z76B 1GHFL 4XNMB 4LKCA 1IM3B 5AYUL 1BVLA 1UVQA 1LO3H 3PHSA 3SGEH 1XGQA 4ZO8A 5F7DA 2BOCA 1ZHKA 1JWSB 1L7TL 3VRJB 3ULUC 4LL9A 3TCLA 3BDBA 4G8GB 1G7QA 4MA1B 3DPBA 4QHKJ 2FJHB 4E0RA 5JXEC 3VW3H 4HWBL 1YQ2A 3WMSA 4AH2B 5DUBA 3HC4H 3S37H 5FCUH 1PG7L 2X1QA 4G9FD 1JZ8A 3MCKB 3ROOA 1ES0A 3V0VA 4JJ5A 1T5WB 3X3FH 4I0PC 3RVVC 3T77B 4LKCB 3RDTB 3SN6N 1G7MA 5GIRA 3HFMH 2XZCH 3ZTJG 1UVQB 3G9AB 4U1NA 2LV4A 1UZ8B 2IAND 5GGUA 3MLTB 3KJ6H 3BPLC 5J7CC 1DLHB 5F7DB 1ZHKB 1U3HB 4P46D 3OL2A 5KZCB 3ZSSA 3FB8A 1EJ6A 3HE6D 2DS4A 4PIRF 1QO3A 2F9BT 4QXUH 4E0RB 3I75A 4APQD 5LAXA 3PV6A 1SBBA 4WW2C 4FG6C 3P40A 5GRJH 1ES0B 4O9HL 2E6PA 2NY0C 3GSRA 4DKEH 2JJSC 1U8NA 4XAKE 2DDQL 5MEPA 1SJXA 3D85A 4EIZC 4Y5VC 2F8OA 2HWZL 2YRLA 5IVZA 4ZS7L 1L7IL 1OAQH 1MFBH 2BXYA 4NKDA 3ELAT 1WSST 5EZOL 3UTSE 1S3KH 1GOHA 2F58H 1JZ7A 3FB8B 5C09E 1A6PA 5DJYA 5D5MA 1D5MA 2QHRH 4EQ3A 1AO7D 4GRWE 1AQKH 1A7RL 1CZ8H 5LAXB 4TRPL 4Y4FA 4JO1H 5ID1A 3OV6A 1I1AD 3BFOA 4XRCB 4BQ6A 1T1WB 5BVPL 3GSRB 1RZ7L 2QBWA 5JORA 1U8NB 1IGIL 1X5FA 4PLKC 2DBLL 2HLAA 3JWOL 5HI3D 5I2IA 1TCMA 2H2SC 4DTGL 5IVZB 3C5ZD 3CFDA 4NCC2 4GKSB 5EC1A 1UWXH 1GGBH 3DIFB 5DK0A 4Z95H 2HN7B 4CMHC 2CRIA 4FFWC 5EU6D 1A7PL 4OB5L 5I1LA 2ATPB 3BKYH 3KAAA 3MO1A 3U4EB 2JK5B 1N4XH 4M7JH 5CJOH 4YFEA 1G9MH 1NFDE 1XZ0A 5IVNA 4EJ1C 5ID1B 2AJUH 4ZAKD 3V6OA 4LGPB 4YNYA 4P3CH 1BBDL 3TF7C 4Y7MA 5DC4B 5JORB 2NNAA 4BFGA 4D9LH 3OKKA 4J6RL 5I2IB 1NFDF 4CN1A 1EO5A 4PYHA 4ODXB 4WU5A 3JWNC 5DRZA 2ARJQ 5DYOA 3QI9D 5BS0A 2B2XH 4J3SA 3JV6A 5DEFA 3L5JA 4UILL 2CLZB 3V95A 1BEYH 4CBPA 5GGVL 5F72S 1OQOA 3RBSA 3TT1L 4DW2L 1KT2B 4HBCH 4UV4L 5J12B 2HFEA 4WI4A 3FO0L 4YDKL 3HNVH 2NNAB 3OKKB 5ALBL 4PLNC 1T80A 2CJUH 3P4MA 4MNQE 2ATKB 5DHVA 3AAZA 4NNPH 3LQZA 4X9BA 2WINB 3U6RA 2W9DH 3P0GB 3CFCH 1YMHB 3E2HB 2PKDA 4RGMB 3E3QC 5DEFB 4NRXA 3ZT7A 4F58H 3MRPA 3O6MH 3TO2A 3H42L 1I1FB 2DIJA 2EH8L 2VDOL 1INDL 2H45A 3OMZA 4O58H 4JQIL 5BO1H 1KJ3L 4X80H 1F4HA 1RK0A 4TYUA 5CINH 3L3KB 1U36A 5BZDB 5EBLB 3U6RB 1J7VR 3KYNB 1PX3A 2E27L 1T3FA 2PTVA 4J4PA 3RRQA 1B0RB 3A67H 3M07A 5DEGA 4GRLC 1EAPA 5GGQL 2WW8A 4UOJA 2X4UB 4OFDA 2D0GA 2J8HA 3TO2B 4ELMB 5IEHA 2DJSA 3W0WD 4HKXA 1WTLA 2BMKA 3CU1A 4CMMA 5DJ6B 4KDTC 3QT2A 4MMZC 3MRQA 3EYQD 5EOCH 1F4YH 4PBVC 4U0QB 1UA6H 4G6KL 5JW5B 5EIIA 3R8QA 1RK0B 3VMNA 1T6WA 4OLWL 5E2UH 3TBYA 2FNBA 2X1XR 3IETA 4P4RB 2FEDD 5F9AC 3ARFC 3SDAB 4OD3L 1OP5H 3VXOB 5E5MA 4MJIB 2ZWLT 2X70A 2X4TA 2R15A 3VU2A 1ZHLA 1SEQH 1XFPA 5A43C 1IT9L 3QB7C 4JFQA 3QRGL 5FOBA 2HKHL 3H9YA 4CMMB 4BZ2H 3RKDD 1UWGH 1I7ZA 4N0FA 3BKMH 4GXUM 3L7EB 4TOYH 4YIQA 1CK0H 3UTSA 5I15H 5C09A 1CFBA 2FEEL 3FFDA 4U33A 1G9MC 3QFDA 3AS0A 1VFMA 5DFVD 2VXUL 3QWRD 1CXKA 5KSAD 2FD6H 1J8KA 3QQ4A 1C8PA 1ZHLB 5T1KD 1XF1A 1AIFA 2NW2A 3Q1SH 3UPAA 4MDIB 1NEZB 4IRJC 4JRYE 1TETH 2CKNA 5DRNA 4HS8L 2I07A 3MUZ1 4HBQA 4HF5H 4HUMB 4JKWA 2NY2C 3M1BA 3BDXA 1JTTA 1P9MA 1R3HB 3S3SA 4PJIB 3QDJE 1DBML 4MNGE 4DGIL 2H32H 3VD7A 2HVKB 5H2BA 5C09B 4NQXA 3BP7A 3FFDB 1DUZA 4BZ1H 4FABL 1H3XA 4WGVB 2DAVA 2NY3C 1HXYB 5D8JH 4GRWB 4M1CC 3PV7A 3MV9D 1KELH 3QQ9D 3TWCH 1NFDA 3VFVB 3HE7B 1JGEA 4YFLI 2IEPA 4CADB 1JL8A 3MMEB 1LO0L 4P2RB 5HYIA 4OZGB 1MCNA 4MXQD 3SHSA 1O7VA 3U82B 1TENA 5DRNB 3TESA 4K3GA 4H8WH 2I07B 3V4UL 3KVQA 2E8ZA 4GS7C 1X5YA 3CAFA 4UQ3A 3WBDA 3ARGA 2GJJA 1DBJL 3A6OA 1G6RH 1DBBL 2A9ML 5EO1A 3V52L 4PRHE 4NYLA 4UAOB 2P8LA 5GS2D 3ZKND 4I8DA 1MREH 2ORBH 5FUCE 4KJYA 2LVEA 2HJLA 2CDEA 4F2MB 4XZUB 2DLGA 4XNXL 2VDKH 3H3BC 4C4KT 1I3GH 5F7FA 2AEPL 5E6YA 2VQUA 1RZFH 4WWKB 5H8DA 4Z0BH 4GW5A 1OCWH 4MNQA 3RPIB 3GMOA 1N2RA 1OF2A 5IJKC 2YPLE 1B4JL 3NCMA 4PRIE 4XC1L 1YNLL 4PJCB 1PEWA 2H1PH 5C6TH 3M8OL 4QXTB 3BD3A 3F7QA 3L5XH 3DRQA 3G04B 3REVA 1HE7A 3PWUA 1A7OH 3DX7A 3S4SG 5FCSH 2Y1VA 4JPVH 5B4MD 3WHE0 1Z9LA 3PGFH 2C9AA 5E2WL 2CDEB 1A7QL 4LKXA 2NLJB 1RZIA 5T5FH 1T03H 3ARSA 1KJ2L 3LD8C 4ESKA 1OAKH 1JHTA 1FJ1A 5EZLB 1Z3GL 3GMOB 1N2RB 1SY6A 1TQCB 4ETQA 1A9BB 3ZL4H 5H35A 3D85D 4GKOA 1OAYH 4RDQG 4X4ZA 5EOQH 3DO7B 1FRGH 2XWTA 1WK0A 3DRQB 3ALXA 5FYLH 1IKNA 4FFYH 2DD8H 4PRBA 1BQHB 3QSKB 4WEUD 4X9HA 4HWZA 1J1PL 4MB3A 2OJZL 1WZ1H 4U0RC 5KW9L 1A6AA 1BZ7B 5C0NC 4Y4FD 1RZIB 4FQ2H 1QSFE 2YUZA 2HT4D 1JHTB 1BBJB 3W82A 1PBYA 5EZJA 4N0CD 1JK8A 4NO3A 2UUDH 2WUBH 4QRRE 4FFVC 5FA3A 3UPCA 5H35B 4QHKI 4OZIB 3HR5A 2DICA 2VDNL 3MV7B 1A1NA 5HHOD 4KAQH 3GZKA 1RVFL 3FO2B 4DVBA 1OWRM 1T7VA 3G5VA 2YBRA 4PRBB 2W0PA 4S1DC 5I1EH 3QIWB 4ONHB 4U1HA 3NTCL 3PNWB 3MJ6A 3QUXA 3BDYH 3RZCA 2GEEA 1K5NA 4LNVA 2MMXA 4EUPA 5LXGH 5TDPA 4N8VB 5DJDA 3UYRL 4C55A 1BVKB 3MA9L 1F8TL 1FE8H 4YHYC 4X9GA 1I1CA 4EN3D 1GPOH 4RWHA 4EDWH 5HHME 4NSKA 3ETBF 4MX7A 4AG4H 3I6KB 5F70A 2WANA 1X5KA 3NH7L 3NBNA 4U1LA 5BS0D 4Y16A 4DVBB 4H8WC 4JRYA 3MV8B 4RNRA 1T89C 2C1PA 3VXNA 2YPKA 4A6YB 3C8KA 4OF7A 3ARVA 3RZCB 5D6DC 2AJVH 4IS6B 4KHTH 1S7VB 3GI9L 3EOAB 5IB2B 2M8XA 3V7MA 1K5NB 1N26A 3AB0B 5DD3H 5D7JA 3WLBA 3QDJA 4MNGA 4RZCA 5DJDB 1GIGH 2HG5B 2VDQL 4S1SL 3W39A 2EKJA 3LAFA 3GSWB 4M7LL 3ZSTA 4KQ3H 1KTDA 5E8EB 4CN4A 3UX9B 2F5AH 4G6AC 1FGNH 4KKLC 2F53E 2BVUA 2OL3A 5FK9B 3WHXA 2PR4L 5ERWA 1WTGT 4HIXH 4JRYB 1RMFH 3HKFA 4M61A 4PPTA 5IEKB 4RNRB 1LEGA 4ODHL 1NL0H 5I73C 2HMID 1RJZA 1OARL 4XPHL 3U30C 4F33B 4D0BA 1QHPA 5GHWH 3CXHK 4H20H 1LK3L 2HVJB 3MRDA 4OSUH 5I6XC 1JTPA 1UH3A 2YXFA 2YZ1A 4CKVX 3W39B 4EIGB 5C0RL 3GKWH 1KTDB 1I8LC 2GJZA 3ECBB 5IQ7L 3HMWH 4PRHA 3UTOA 2DQFA 5J1TC 3K4DA 2NPLX 3VI3F 4HGKC 2OL3B 3DYPA 5ADPL 4EBQH 5ERWB 2OJEB 4OV5B 4M61B 5JW3H 3RWHA 4J4PD 5FFLA 1IAIM 1A0QL 1RJZB 5C6WH 1LP9E 1KENH 4D0BB 1Q94A 3GBMH 2YPLA 3ME0A 3B9KC 4PRIA 4IMLB 5EBWA 3O3AB 1TNMA 4PJ5E 1JYVA 3MTRA 1S5HA 4XP5L 2BNRB 5LQBL 1CFSB 1FCCA 1R24A 1B4RA 2DQFB 1MCPL 4NZUH 1U8QA 1LILA 2GT9B 4NQVB 3VWJA 3QXDB 4HT1H 2Q7YB 5DS8A 3WUWB 2ERJB 4ZFGL 1CGUA 3U1SH 5JQHC 3H9SE 4K7PX 3SDCC 1JZ6A 4PJHE 4XBPA 4OQTL 5E95B 3OXRA 5DK3A 1FFNA 2CMRH 4XPBL 3ZDXF 3ARBB 1Q94B 2LU4A 2YPLB 2EE2A 4KK8C 1J0HA 5CUSL 4K3EL 2VDPL 1BLNA 3FTGB 4PB0L 2OZ4L 4TVPL 2P44B 4R0LA 3VRIB 3UTSD 1FNLA 4YQXH 1FL5A 1Q9LA 3OWEA 43CAA 2XV6B 3CCHB 1CLOL 4LRNH 5FKAB 4GXVL 3C09B 1UEMA 5L6YL 2GQHA 2XQBH 2Y6SD 2YA2A 2J8OA 1UQSB 3A6BL 1QSFA 1CT8A 5E6IC 3K2UL 1HHGA 1ZLUH 1F4WH 3SBWA 2X41A 1BD2D 5DLMH 1F5WA 3MOAL 1R3LA 1XCQB 4QXGH 4M7ZC 3E8UL 3UTTE 5DVMA 4QRRA 3V0WL 3PG2A 2Q87A 4OF0A 3I02B 4LAQL 4N9OB 3K4ZA 4GAFB 2VSCA 4JFEB 4U2YA 2IC2A 2JCCB 4QHNA 1SJHA 1D5IL 1UXWB 2GCYA 4KKCD 3K74B 2J6EL 4L5FH 1R5IB 4WI9A 5C07B 2EE3A 2V2TB 3ULVE 2D03L 3OJDA 4BH7B 4BKLA 1DSFL 4PJ8A 4JPKH 3MLZH 3T3ME 1J1XH 1WISA 2CK2A 2QSCH 4GBXA 5FF6A 1ZANH 4WNQA 1B3JA 2IH3A 1R3LB 2RIKA 2QHLA 3MLXH 3TLRA 4HLZH 2APXA 3FJTA 4NN5B 4LARH 1LO4L 2W9LA 3T3MF 2GSGA 1D9KC 4ERSH 1T66C 3ARGD 3KYKL 4QHNB 4U6VH 3OF6A 3CC5A 3TBTB 2BHYA 2GCYB 1ZXQA 2O61A 3RZWA 2V2XA 3CVHL 4PRPE 3BPNC 5EU7C 2H2PD 5DZLA 3OJDB 4Y2DB 4BKLB 4PJ8B 3OJMB 2GSIA 4KUCF 3RL2A 5M7QA 5DD6A 5SWSB 4F9LC 4KRMB 5CGYC 5FV2A 2IH3B 4KVCH 4X4YB 1KNOB 2DQJL 5HHMB 2E6QA 5I16B 4KJQC 1S9WA 2VISA 1VKXB 4MHHI 3L5IA 4MNQD 5HI5D 1K8DB 2F53A 2OTUA 4UT6L 3RNQA 2HJFA 4KRNA 1QLEH 2ADGA 5IOPA 3MFFB 3CC5B 2YPVH 1MFEH 4I18A 4P5KB 4RQQA 5EPMA 5GGTL 1PSKH 4K8RH 4NT6B 4KFZC 3TVMC 4BUGA 4Z5RB 1AD0B 4K7FA 5D96C 3BH8A 4KTEL 5DD6B 3OR7A 1MWAH 4F80A 4NJ9L 4OF5A 3S97C 12E8L 2VISB 1MCBA 2Z8WC 3EDKA 3ZHKA 5EZIL 3IDMB 4HUWA 5FA4A 3C9NB 4WVRA 5ETUB 1V7MH 3BKCH 4S0SD 5D1XA 2IWGA 5K9QG 5C0GB 5KVMC 4ZFOA 2HTKD 1EEZB 3CVHA 1QNZH 1A6WH 1LP9A 1U92A 2DQIL 5FYKL 3BAEH 4X99A 1FORL 5F7EL 3LN9A 5DZOA 3KLHC 2LU3A 4PJ5A 4UTAL 4G7VH 4X5WB 3H3KA 1UXSB 3OR7B 1S7UA 3FN3A 1CFVL 3MRMB 4KJPD 3O8XB 3J7HA 3O9WC 4Q9RL 5HI4C 4HUWB 4QF1A 5FA4B 1G7LA 1WFTA 1FLTX 2EIEA 2HT3D 3H9SA 1RQ5A 4GG8A 4PJHA 1PGRB 2EH7L 1FCGA 3QDHA 2ESVD 4NZRL 1KACB 2OR8A 1MIMH 1TZHA 4U3HA 1LP9B 4D3CL 1U92B 4PV8A 1GXEA 2AV7A 2O5XL 4NRYB 1YYMH 3P3YA 5DMIL 3HAEA 3MUHL 2MQ0A 3QUXD 4BH8A 3C6SA 2AI0L 2GTZA 2NXZD 2GFBA 3B9AA 4X6EA 4WHCA 3QP3A 3WKMH 3CFBA 4UTBH 4FNLH 1YC8A 5EU4A 4Z77B 5HGHB 3INUH 1G7LB 4FZ8L 5GXBB 3L5WA 1KPVA 3ILQD 3BPOB 4X4ME 1QLRB 4OFVA 4PJHB 5F88A 3RJQB 3T4YA 3QUYD 5CBEB 1INEL 3BHBB 2AXJA 3IYLW 2XZQL 4V2BA 2OI9B 4Y16D 3AC0A 1I75A 4Y5XA 4LCWE 3UTTA 1PG7X 1FNEB 2JJUA 2IALA 5JHDE 3S7GA 3C6SB 2H3NA 4Z8FL 4LSUH 4ZYKB 3EJYC 4X6EB 5D7JD 5F6HJ 3QDJD 4YUEL 4U6TA 1V7NL 3GO1L 1SM3L 1WEJH 2ED9A 3RUGE 2NY4D 2VMFA 3MV11 3ARZA 2A74A 2NXYD 3RI5K 3L5WB 3GHEH 3LZFH 1DN2A 1MAKA 1WICA 4KROB 4PV9B 3T4YB 3WN5C 3QA3A 1S9VB 5KBNC 1H3WM 2EIBA 4MGXA 1LK2A 3MGAA 4I48B 4W81A 3RUGF 2P48B 4DN4H 4Y5XB 3UTTB 3VXTB 1I9JL 1DR9A 3TH4T 3BP4A 3KXFB 3J8F7 4NHCH 4OAWB 5F89A 1HQ4A 5ADOH 4JGJA 2BSTB 1KCUH 4RGNB 4JDZA 1FAIH 1XR9B 3TYFA 1KN2L 3KWWA 3KDMA 1HKLL 4PRPA 1KEML 2G75A 3I50H 1KB5L 3IJHA 3NIGF 4PRHD 4EDXB 3MCLH 3CSYB 4HULB 2WLZA 2VXQH 1MAML 3AFLA 5BVJB 5L0QB 2CK0L 1MHHA 4P59L 1BVZA 1Z5LA 4LQ1A 3S88L 4D8PA 1LK2B 3F7PC 3FRPA 4LPYA 3QHFH 2AERT 1RIUL 2AJZA 3DYMA 4Z9KB 5EO0A 1Q72H 1ZHBB 2ZCKH 3QXAB 2PYFB 1WBXB 4NRZB 4M1GL 5D6CB 4NO2A 5L8JB 4WDIA 1IGFH 4PRID 5EH1A 4R4ND 3PP4H 3TYFB 3KWWB 3KDMB 4KKAC 4MNHA 4LSTL 5JUEH 1LO3L 1QTYT 3OAZH 2WIIB 4ZUWA 3OBAA 2ZCLL 4EZMA 3RVUC 1K4CB 4UIKL 3VWJD 4NNXA 5D1ZC 5T5NF 3QJFA 4ZS6D 5KVGH 2HLFC 4ZXBC 5CIPH 2IQ9H 4WO4A 4AEFA 5IW3A 5T3ZE 3S37L 2AK4E 1HQRA 4GXUN 1BAFH 3F8UB 1EMTL 5A3ID 4MCYA 3TA3A 1NGXA 4M1DH 3X3FL 1HK6A 3VMPA 2QR0B 4AQOA 2QADD 5GJTH 1BJ1J 4ZDHB 1KLUA 1SVCP 2ARJA 1EHLH 5CSBA 1JWMA 1P5UA 5ISZB 1D5ZA 3VFGH 4OCXL 5EG6C 2C3XA 4OGAD 4NNXB 5DD5H 4AIXA 4XVUD 5DJCA 5FM4A 2ZSWB 3NCFB 4XPGH 1QSFD 1E27B 5I1GH 4PG2C 2AXFB 4WO4B 2DMBA 4JVUA 3DHJA 2ICEB 1HQRB 1OGAD 3MZGB 2D7OA 5GRJL 1GZPB 1CFQB 3TA3B 1NGXB 4QRRD 2R0KH 4KK9C 4FZEH 5GZND 4XVSH 1UZ6E 4JRXB 4MAUL 4XH2A 5F7MC 2XG5A 3TJHD 1JHLH 2ARJB 2XTJD 1JWMB 5EOCJ 4JM2C 5EOTA 1D5ZB 1I8IA 1MFBL 1S7TB 4Y5YA 5F9OL 2AJ3A 3MLPA 1UZ6F 4O2CA 3VFOB 3SCMA 5DJCB 5D2LE 3P11L 5J9PA 3MYJB 2H6PA 1YPZE 3NCJH 1VADA 4H1LA 4JO1L 4FQLL 1ROWA 5IMKB 4GBXD 4U4BA 2ZUQB 5GSVA 2K7PA 3FAXA 3TEUA 1BWWA 5I8EA 2R39A 3WJJA 3JTTB 1P2CA 4X4MA 5BMFL 1J0JA 3TNMB 5T3XL 1YPZF 1TJHL 4KRPD 2AQ3A 5E99L 3OF6D 2AS5M 5FYKU 4LCWA 3PHQB 4PTUA 1R3IH 1PW3A 4ODUA 5JHDA 4Z95L 1NC4A 1A3RL 3SCMB 3EFFA 4PJ9C 4UB0H 4QWWC 3BKYL 3BN9C 1QBLH 4S2SA 5HYSA 2H6PB 1M71A 1VADB 5CJOL 4H1LB 4U49A 1FO0A 3CZFB 3RUGA 5GSVB 3QIBC 2HRLA 2BFVH 2L0DA 4P3CL 4WFFE 5IBUG 3QIUC 1E4WH 4D9LL 2NZ9C 3VXPB 2F53D 4WCYL 3QUZC 2IH1A 2Q8BH 2PYEB 1EEUA 2O26U 5ESVB 3MJ9H 4KVNL 4LCWB 3BP5A 4PTUB 3WHE1 2B2XL 1I3RA 4EVNB 1WC7B 3P9LB 2FJFB 1NC4B 3KNBA 5EDXA 3ZTNH 1DJSA 1XIWC 1JF1B 4NQUA 1SBSL 5HYSB 3KS0H 1KULA 1M71B 3QNYA 1IEHA 3N85H 4H88H 1OTSC 2PO6B 1T1YA 1QUNA 1MCEA 2WWKO 4JAMB 5MEND 5F96L 1XGRB 4X6FA 3L95B 1NFIA 2RHEA 2J2ZA 4X83A 1TJIH 2X4OA 3IF1A 1CI5A 4G6ML 5D1XD 1TLKA 2IH1B 1T4KB 1VEPA 1TQCC 1H8OA 3RWEA 5I8OL 1J0YA 3LKQB 4Q9CA 1OTUC 3HB3C 2V17H 2YD7A 1MF2H 5ELIA 5ESQB 1QR1B 1Q9OA 2BSED 4PGEA 4PJ5D 3LIZH 2R0ZL 4KH2A 3RTQB 3VRLE 3STLA 3BEWA 4MWFA 4YHNB 3EOYG 3Q2CA 1MVUA 5TE4H 4JLRB 5HVFB 3OKEB 4X6FB 4U2ZA 4UIMB 4XX1E 4HXAH 2R9HC 4LSDA 4X80L 2APBA 3WS6C 4MLIA 5CINL 4K3JH 1NGQH 4ZMAT 4Z7NE 3H9SD 3VRLF 3QUMA 4PGBA 4R7NA 3NFSH 2AJSH 2VR4A 2B8OT 2R2HA 3QG6A 4RCAA 2VSDA 1PJ9A 2FO4B 3PWNB 3A67L 3MROB 8CGTA 2AK4A 5IESH 4EUPG 2ZUWA 4WTWA 6CGTA 1PD6A 1I7TA 4PGEB 3K8MA 1NGYA 4CN6A 1J0KA 4IJ3B 4L4TB 3STLB 3BEWB 2BXZA 3QFJB 5FDYA 4QCIA 2AK1H 5CBAB 2J8UB 2IG2H 5DDHA 2VKXA 4UNVA 2LABA 4NN6B 2YK1H 4KY1L 3QG6B 5BJTB 5M95B 4KMTL 3VXSB 3W5NA 3C6LA 1WBYA 2AK4B 4IRSB 4QRQB 3GGWA 3VFWB 2EDOA 1GOGA 4BSWA 4W4OA 1V3LA 4HK3N 3RWGB 5FGBC 5IF0B 3X17A 4TNWF 1NGYB 3OXSA 1SEQL 3DVIA 4OKVA 5FO7A 3TT3H 5FGCE 1JV5B 3SGDH 2CXGA 3MRRB 4U1SB 1F00I 3AB0C 2GK2A 3SGEI 1UWGL 1D5BA 3U7WH 3BKML 1RUMH 5ICYA 1PG7W 4QCIB 4X7SL 5KVDH 5DHXB 4TOYL 4HUVB 2X1OA 1WJ3A 2BVPA 2VUOA 5DDHB 1FAKT 1L0YA 5DUPL 5I15L 4F15B 1B0WA 4ZUUA 3VFTA 2C4FU 3O3EA 2PW2B 1R5WA 4UDTB 5D2LA 2WAHA 2FH6A 1MCQA 1YPZA 3PGDB 4FQXB 4U3XA 3C6LB 2FD6L 3CH8A 1WBYB 1CDIA 3GGWB 5LVEA 4BSWB 3WFDH 3MLYH 4OCWH 1FPTL 5IW6A 4TNVF 1DP0A 5I71C 1VGKB 2A0LD 3OXSB 3WFEL 4OF6A 4XNZC 1R3JB 3N9GL 2ZG3A 5FO7B 2FBJH 3O6FB 3IB4A 4DCQB 1FYHB 1WFOA 4NNYB 4TUKH 3K2MC 4KUCD 1D5BB 5F7NC 2H8PB 5ICYB 4AIZB 1LO2H 3S34H 1N6UA 1W0VB 4PRPD 4PJAF 1IARB 1WWBX 4HIIA 3EDEA 1Q9WB 1NBZB 2FATH 2G5RA 3O3EB 4LSVL 3BGAA 5C0FB 3LCYA 5D2LB 4Z6AT 5D8JL 3MNVA 25C8H 3K46A 4AENB 1LE5B 1KELL 4PP1D 1IBGH 3TWCL 1XF5B 4P5TB 3E6FB 1U95A 3FT2A 1E4KA 1YEEH 4Q58C 1IAOB 3QEHA 4Y2OA 3EHBC 4HKJB 3BUTA 1OOAA 1OSPH 4H8WL 1C5BH 1S9YA 4B41A 3CXDH 1G0XA 3WXVH 2ZKHH 5GRXG 1FFPA 3WL9A 1G6RL 1P4IH 1SJEA 1OT2A 2EIZA 2V7HA 5EB9A 5F6HI 3Q5YA 2ORBL 3FT2B 5C7XH 5BZWA 4C56E 2O5YL 4I9WE 4DK6A 3VFPA 5TPWH 1HWGB 1OT1A 5K9KA 2VDKL 3PABB 5E4EB 3U0PA 2OMNA 2AJYH 4GH7B 1RK1A 1T04B 1UH2A 3ARBC 3I6GB 3T8XB 1YA5A 3QULB 5TF1L 1S9YB 3TO4C 2P7TA 2J1KA 5C8JA 3I3BA 4NQEB 2H1PL 5C6TL 5IB1B