3PXJA

Tandem ig repeats of dlar
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
199
structure length
199
Chain Sequence
AAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase Lar
publication title The Immunoglobulin-like Domains 1 and 2 of the Protein Tyrosine Phosphatase LAR Adopt an Unusual Horseshoe-like Conformation.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 35
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pxjA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3pxjA02
3RY6C 3NCMA 4UNUA 4K07A 2XN9A 4Y16C 4JM2A 3CSYA 4M8QA 4ZO6A 3SDCC 1MH5A 3P0YL 5CBEA 4BZYA 4GRMB 4HF5H 2DQFA 3JWOC 4NQUA 2ITCA 1J9CT 4X4ZA 1NUNB 3VXUE 3W0WB 5D2LA 3P9LB 4M5YH 5HD8C 4XWOD 1JTPA 4WFFE 3HC4L 5INCA 4NYLA 3TJEH 4UTAL 2ILLA 3SOBL 2X09A 3QDJE 4JN1H 1BVLA 1S78D 3SBWA 1N5YH 1QRNB 4UQ2A 3DX9A 4KHXH 4OCXH 5C0ND 2IH3B 4EOWL 2SEBB 4KROC 2X4OB 1LGVA 1BOGA 3GSUA 3DV6B 2V7NA 1IM3B 1KIPB 5DD3L 3QUZB 4CDHA 3CUPB 1EFQA 1WLHA 4TUKL 4YFLF 4CU6A 2X6MA 3GI9H 4LCCA 4PJ8A 4ZUSA 3NOIA 1FPTH 5T1KB 4U6XB 5HYSB 4BH8B 5HDOA 5C0CD 1MJ8H 3ESVF 1KJ3L 2VLKA 4JZNB 5IK3A 1BZ7B 1S9VB 1S7QA 5EPMA 5K33A 5ICYB 1IAOA 4QXGL 1MAKA 3ABZA 2VDRH 5GGTH 4DFIA 5J57B 3UJIL 1HKFA 1RUPL 3E2HB 4XC1L 2NLJA 2YK1L 5FO9B 1AGFB 3KLAA 3QO1B 4LLUA 4ZOAA 4JDZB 4PJ5D 3EFDL 3TV3L 4G6KL 4WY7H 4GMSL 3RJDA 3MJ8A 3SQOL 3B3IA 4PJEE 1MHEA 4EBQL 4TSBH 2PYED 2HKHL 4NM8L 3RWJA 2EH7H 3NPSB 1VFMA 4S1DD 2JCCA 1NMCB 2X9WA 3QDMB 4I13B 4M1CD 5TH2B 3MYJA 4CW1B 2X1XR 4Y1AE 2VLJB 5I1JH 3FAWA 4P9HH 4KK9C 3VXME 4MXWH 1KCVL 1YJDL 1PLGH 2HFFA 1W0WA 4KGJA 4AK1A 5TDPB 2WK2A 2Z31D 2IFFL 1FL6A 4HS6A 3BSZH 4FFVC 1IEHA 3FO0H 3RZCA 3QG7L 3UTSA 4XPTH 1IQWH 2CIKB 4PV8B 2DQEL 3O8XD 1Y6NR 4MA3A 1OSZA 4TOYH 5F71A 5KVDH 4QXWA 3KXFD 3LOWA 2VAAB 4U0RB 3CLEH 4U3HA 4MJ5B 1IJ9A 1IGCH 4PJAB 1UACL 4XPFH 3BPCA 4G8GA 4RRPA 5JOPD 3ARED 2EDXA 4QLRA 4WFGE 3L5IA 4GG8A 5F7MC 5EOQL 3UTPE 3X13A 4YHYC 3MRHB 4ONOA 5ESVA 2P8PB 2ATPA 5A1AA 5TF0A 1J1PH 4LLDA 3DXAE 3N1GC 4L4VE 4NQCE 5T3XD 4BFGA 1SVCP 5FOBB 3I3EA 1RURH 4G80A 1RJCA 3ECBB 2H6PA 4YIQA 4GKNB 5D7IB 1DP0A 2JK5A 5L6YH 3KWWB 2MOVA 4KI5D 4TVPH 2DJSA 3NIDF 3KHOA 1IZJA 4EUPG 3PQYE 4NO0A 2FJHB 3NTCL 1NGWA 5FF6B 1NGXB 3CDGA 1Q9WB 1SBBA 1JF1B 1C7SA 4OZIF 3TO4C 1G7LA 2X4RB 5EOCL 4PTUA 3C6LB 4U6HB 3U1SL 2NTFA 2EE2A 4UQ3A 4OBSA 4ODXA 3MA7A 3GIZL 4XAWL 1TETH 4FQCL 2F53B 1FORH 5DLMH 4JANB 1BM3L 3FT4B 5BVJA 3QQ4B 2WNGA 2NY3D 4ZDHA 5AUMA 1KPRB 3QIBA 3RGVA 1F4YL 5KVGH 1U93B 3VCLA 5HGAA 1HSBA 4KK6C 5I17B 3LB6C 4C55A 3PABA 4LLVA 4AZ8A 3U7AA 2PXYA 3Q5OA 4G7VH 5HYJB 4G6AD 4S0SD 5E00B 2JJSC 1AQDB 2MQ0A 4KKBD 5FHAH 3JV4A 1EO5A 2JELL 4CMMA 2OJEB 4WW1A 4GUPA 1UM6H 3FFCA 1L4IA 3DPBA 1IVLA 3SKOA 5MEQB 2O5ZH 4CJ1A 2X2YA 3DUHA 5KVEH 4WCYL 2J7LA 1A64A 2Z91B 1YECL 1CL7I 4QXUH 2HRPL 2VUYA 2NY6B 3MCLL 2C9AA 2LU4A 5I16B 3TBWA 1E4WH 1GZPB 2R23A 2V2WA 4JDTH 1ND0B 3TVMC 5E9DB 5DVOA 2UVFA 1U95B 2EIZA 1M6OB 1HWGB 1F58H 3MO1A 2DQTL 3CXHJ 1N59B 4YXHL 4AEEA 3OXSA 3A6BL 4NT6B 4X6DA 1JZ4A 1I1FB 1KENH 5HYSG 2AKRA 1W72A 5TPWH 2MQCA 3OAZH 1W72L 3F7PC 2HT4C 2BSRA 5KZCB 1S7UB 1NFIA 3OGCA 3QEQA 4OIIH 1VFAA 5D7SH 3RBGA 3OV6A 3QJHA 4AT6B 5KSAD 5AG8A 1YPZA 3AVEA 5MEPA 2BFVH 4M7JL 1SM3L 1QPPA 5C2BL 1QKZH 4IOIA 3C5JA 1JUFB 4KU1A 4BQ9A 2DQDH 4DK3A 1DL7L 1ZT7A 2FIRT 2WWMD 1PY4A 3ILQC 2DAVA 3WSQH 3SJVA 5TQ0H 1MCKA 1DQTA 2B8OT 3I2CL 1OLLA 2KDGA 4TSAL 3U46A 4WFFD 5GJTL 1EAJA 3SDDD 4N9GB 4S1RL 3B6SB 3WO4C 1CQYA 5C09B 2IAMC 5IB2B 3ZYJA 5JA9A 4PJXE 3OHXB 4UZGA 4WU5A 5D7JB 4H88H 5HDBF 3EYSL 3SGJA 1EH9A 3LH2H 4X6EB 4XI5D 2X1QA 5E4EC 4KJWC 5D71H 1BFTA 3HPLA 3B9VA 4NOBA 4OGXL 2IG2L 1XGTB 4J1UA 2XWTB 4NN7C 4DZ8A 4EUPA 3BD3A 3GM8A 3F58L 1IGYA 4OQTA 3RWCB 1U92A 3F12A 4HIHB 4XP1L 4OQTL 1ZXQA 5JORA 2ID5A 1WV7T 4M61B 3VXRB 2XQBH 2F54E 2VDKL 4P4RA 1U8MA 2VDQH 4OF6A 4MJ4A 2BVOA 1I9IL 3RVUD 4HULB 1E4XI 5CJ8A 4O5LH 4WW2B 1JK8B 1WWAX 1GGIH 2EDTA 3O9WA 4NKDA 3R4DA 5E2UH 4QTHB 1FFOB 3PGCA 3P9WB 4AMKL 4MZ3A 4XNXH 3V52H 3ZSTA 5IB5B 5J56B 2DQUH 4M1GH 3CDFA 4PPTA 5FYLD 4FTVD 4U1IB 1IC5H 4GRMA 2K3TA 3UPAA 3Q48A 5E70A 2IBZX 1Q72H 5LAXB 1ZA3B 4S1QL 4YXLL 3W0WA 3P9LA 4POYA 1WFOA 2IANB 3C2AH 3OGOE 3U36B 5IJKA 2CO6B 4GAGL 1A9EB 4PGCB 4K71C 2IMNA 4DUWA 1TLKA 3UJTH 1L6ZA 3ZKND 1QRNA 1IC7H 3RHWF 4QHKI 2IH3A 2SEBA 1F90H 2X4OA 4L3EE 4J3VA 1YQ2A 5DF0A 3DV6A 3ESUF 1IM3A 1P4BH 1LO2H 1KIPA 2QSTA 4QRPE 3QUZA 4JKLA 5KJRL 3WEXB 3CUPA 4ZOCA 5DDHB 1WFNA 3ULUH 5GGRB 4JB9H 5I19H 4XVJL 2V5MA 2OQJB 4OD2B 4RGNE 2J8UF 5T1KA 3D85B 4U6XA 1RU9H 5HYSA 4BH8A 4UNVA 2XYCA 4U7KA 4WFGD 5DA4A 5I73C 3CVIH 1NFKA 1JJUA 4PB9L 3P4MB 5J12B 4JZNA 3HR6A 5ICYA 2OP4H 3UTPD 1JL8A 2CQVA 3EDJA 5C6TL 4RFOL 1U6AH 1LWRA 3V0AC 4JFFE 3RVWC 5D5MB 4NQDD 3JWNC 3DXAD 1FLRL 1AGFA 5FO9A 4PJ9D 4WUKL 3QO1A 3FB7B 3WD5H 4FMFA 4JDZA 3QFDB 4LPYA 3D25B 5T33L 2Y72A 3MXWL 5DR5H 4HUWB 3QUMB 4NHCL 2VXUH 3QDMA 5F8QC 5TH2A 3PQYD 4CW1A 5CD5C 4GSDH 2CR6A 2VLJA 3HNVH 3VD3A 3GRWA 3O81A 3GRWL 1PG7W 4NRXB 5CGMA 2EZ0C 4Z7VE 2ERJB 5TDPA 4JG0H 1PDKA 4DGIL 2LVEA 5BVPL 2XA8L 1A1NB 2Q7NA 2DI7A 2J4WH 3T09A 3X17A 4AQ1B 2FLBT 2ED9A 3MZTA 3EZJB 3LCYA 4NKQB 2WZPD 4PJHB 1G7QB 1EMTL 1B0GA 2CIKA 4PV8A 5KSBF 4FQXC 2E8YA 4YK4B 2Z31B 5JW4R 3ZE0E 4G7YH 4YWGH 2AK1L 2VAAA 4LQFL 4MXVF 4EQ2A 5FYJH 3T0DA 4MJ5A 4PJAA 5HHOB 5GS1B 1P84J 2DLTA 1HZHH 1U3HC 1T22B 5E99L 3VA2C 3KR3H 3O8XB 3TN0D 3SDAB 3KPSE 4AG4H 2BY3A 1VFUA 3PP4H 2NY1B 4L9LB 3K74B 4LHJB 3QPXH 3FAXA 4HUUB 3F8UB 2PN5A 3MRHA 4N0UE 1EZVX 3AREB 2P49B 1GSMA 4HQQL 2P8PA 1YEFH 2W9DH 3KS0H 3QCUL 3OWEA 1BBDH 1QOKA 25C8L 5F9WB 2F58H 2UZIH 4N8CH 5FOBA 5ANME 3CC5B 1RZ7L 4HIJA 3VD4A 3ECBA 4Y5YB 4HMEA 4GKNA 5D7IA 4GXUN 3VXTA 3KWWA 2FRGP 3VGAB 4YFDB 5DK3A 1NUFA 1EK3A 5FF6A 1NGXA 3KLSA 5I6XB 2A74B 1Q9WA 3NA9H 4IJ3B 1JF1A 3VRIB 2JJTC 3WFBL 4P23D 1FBIL 5IBTL 2X4RA 4PRPE 3W2DL 4JPVH 5CSGA 3SDYL 4X7TA 3C6LA 4U6HA 3LKRB 2N7AA 2CGRL 4XMKL 4M6NL 4YDVA 5E8DL 2DQCL 4YX2L 3BN9C 2F53A 3NCYS 2BNQA 4TVPE 1WJ3A 3TIEB 4JANA 1G9ML 4O2EB 3FT4A 3QQ4A 4H8WC 1CLOH 4DJMA 1KPRA 1OF2B 4ETQB 1YEJH 3BWUC 5FUCE 1U93A 5EO0A 4OI7A 4MDIB 5I17A 2R0LL 1Z9SA 1KTDA 5HYJA 5DEZA 5E00A 3VDCA 1RZJC 1AQDA 1A3RL 2FATH 2OJEA 4PTTB 1AQKH 1S9XB 3VFWB 3CDYA 5DTFB 2Y23A 5FM5M 5MEQA 4NNPL 3EYQD 3IDGB 5FK9B 1YY9D 1CFTA 4NCC1 1MCEA 1IZKA 4LHUD 4Y4FC 4Z0BL 2Z91A 3UYOD 2EC8A 5KANI 3CU7A 4QTIL 1AJ7L 3DX8B 5I16A 2E8ZA 1ND0A 1U95A 1KCLA 2CDGB 1M6OA 3WNNA 4BSWB 1N59A 2QSCL 3RWGA 2LFGA 2DYPD 2ENYA 4NT6A 5FYKU 3KYNB 1I1FA 1G7PB 2F54D 2J8OA 3HUJB 3V5DB 3WBDA 3RTQC 4HHAB 1JF6A 3BH8B 1DBKH 4V2BA 1S7UA 3V7AE 3EUUA 4AT6A 2B1HL 4MA8H 2YC1B 2BRRL 3E0GA 5FHBH 5DD5H 4N1HB 2G5BB 3LQMA 3S35X 4U2YA 4ZD3H 5TF1H 1JUFA 5M94B 1OT1A 4FFZH 4BZ1L 2EC9U 3IU3B 3B5TA 4N90D 4WHYH 1HXYB 1G9NL 1XGPB 3ZDYF 3MLZL 2WQRA 1ZVHA 1XR9B 2W9EH 4NKMB 5EU5B 4MLSA 3H0TB 2P4AB 1IAIH 1QFWH 3C09B 1NMAH 4LOUD 4XBEH 4WHCA 4ODVL 4LKXB 2FJFB 4N9GA 5F9OL 4YPJA 4ZFFB 4P99A 1VDGA 5C09A 5IB2A 3VFUB 5EZOL 2DICA 3OHXA 3VXUB 2F5BH 5D7JA 3UZEA 1FO0H 2VXVL 2VLRE 1N0XL 1N3NB 3U7WH 4UU9B 4N0RA 3RPIB 2FO1A 4XCEB 3EHBC 3KPNB 4X6EA 2OI9C 5JTWA 3QDJB 3AM8A 1A7BA 1CDJA 2J8HA 4DKFL 2YD3A 1YC7A 5IFHL 4P5TC 1XGTA 5F93C 2J88L 5D1QC 5D72L 3RWCA 4RAHA 1INEH 4HIHA 5DFTA 1F42A 1KLUB 4NJAH 3VXRA 1A3LL 3BZEB 3WLWD 4F7TB 1TTUA 4HPOL 4MD0B 1QFPA 2JKXA 1IC4H 1UXSA 3UAJC 2XKNB 1I3GH 5CWSB 4R26H 3JSSA 4WW2A 1JFQH 4N5ED 5FUOH 4QTHA 2VISB 1FFOA 2EE9A 4KTYA 4WFEE 1F4XH 3H9HB 5IB5A 2B2XH 3TEUA 1R6VA 4OZGE 3TZVB 5ESAB 4U1IA 2EKSB 1T03H 1L0QA 2A83B 1A7NH 5I71B 4GW1A 5LAXA 2CLRB 2DTML 1ZA3A 3V5KB 1JPFB 1MFAL 2FX8H 4HWEL 2IANA 3U36A 4LRNH 3JV6B 4PJEB 1QFHA 1EUTA 1TIUA 5IVOA 1A9EA 4PGCA 2B20A 4DGVL 2APVA 3T2PA 5AAWA 4W4OC 1P7HL 4ZUVB 1WZ1L 2VNCA 4Y1AB 3CH8A 4XPAL 2XTJC 1A6VH 4OAWB 3WHXB 4OGAC 4YHMH 4YHKH 3VXMB 1EV2E 2OZ4A 4JFZL 5C70A 2Y06H 5DZOA 3REVB 1U8PA 4HBQA 1S3KL 1Q1JL 5K9QI 3WEXA 2AVGA 1X6NA 5T1DL 4GG6F 3C5ZD 3PL6D 1WZKA 4K94H 2JJUA 2XA3A 3UCRA 2WUCH 3NCJL 4OD2A 3CPLB 3D85A 4IEFB 3EOTH 3HAEB 3RA7H 2HTLC 1X5AA 7FABH 3DHMA 3UTTD 4IRZH 1C1EH 4R3SB 2K7QA 4JFEE 5I30L 3P4MA 1FYTE 2D3VA 3A6CH 2ADFL 1XAUA 4EZMA 4A6YH 1EEZB 2HTKD 5D5MA 3IKKA 3ULUE 2NR6C 2YXFA 5BW7A 4P9MH 1BOYA 3FB7A 2X4SB 2XG5A 3FT3B 3QFDA 3D25A 2EXYD 3B9KD 4NCDA 3VXPB 4YAQB 2R8SL 4HUWA 1UM4L 3QUMA 4HD9A 4NQDB 3QUML 3DXAB 4ZFGL 5LBSH 4PJ9B 2CK0H 2MSPA 5A2FA 4NQCB 5HJ3B 3DMMC 5TE4H 4JHAH 2P46B 1RZFL 4KUCD 2VDPL 2WANA 3D9AH 2CK2A 4NRXA 1RJLB 5CJXA 4GOSA 4K7PX 1AGBB 4N8VB 1A1NA 1HKLL 2VZOA 3PQYB 2DTSA 5HXMA 5D70L 5HHNB 2JF1A 4ZFOB 2CRIA 2K1MA 3BD4A 4UBDC 2VTFA 3H7LA 4PJHA 1J05B 1G7QA 4TVPD 3CVHB 2ADIB 2W9LA 2Z31A 2DIBA 1FG2B 1HH6B 5DJ2B 3REWB 5CHNB 3NZHH 4QHLB 4C54A 4MQXC 4M9OA 1MJ7H 4PBVC 2NY2C 5GS1A 5E4IA 3FQRB 4ZXBC 3HE6C 1T22A 2JB6B 2R2CA 3MJ6A 3O8XA 4PRAA 4JM2F 3PNWB 1UZ6F 2BNRE 3NFSH 3IETB 4FZ8H 4L9LA 5GGQH 1FNFA 4LCYB 1WIUA 5GRYA 4IHOB 4HUUA 5EORH 4IRJD 4M3KB 4AL8H 4LF3A 1OAXL 3BKMH 3GMNB 1B6UA 3AREA 2K9UA 4IS6A 5D2LF 4HJJL 2A77H 1IT9L 4ZUTB 5E5MB 4POZC 5EFIB 5CEXB 5FYJE 2HVJB 1T2QH 4KJPD 3CC5A 1H3GA 4Y5YA 4L5FL 1X5XA 1VA9A 1JZ2A 3TWCH 1NBQA 1P5VA 3O2VL 3EO9H 4LLWB 5IK3B 3GMMB 3G6JB 4EN3D 3R0NA 2A74A 3PWPE 1EO8H 1NCAH 1Q9KB 1DQMH 3VRIA 5F7YC 4DKAA 4NDMB 5LWYH 2NPLX 3IJSB 1K4DB 5IHBA 4DN3L 3UYRL 2P5EE 3LKRA 2KH2B 4HC1A 3TT1H 4HC1L 3B9AA 1BQSA 1D9KC 3TIEA 2FX7L 1NAMB 4O2EA 1OAUL 3O2DL 3W9EB 3QP3A 5GRVL 4FFYH 4ZNEE 3LS4L 5HI5D 1QFOA 1OF2A 5C0IA 4ETQA 4HWZB 3GIVB 3M07A 1PQZB 5TFSH 5HHQB 4MDIA 5ADOL 4P2QE 2XV6B 3HI1B 1CFNB 1RUAL 2XZQL 1DBAL 1EA9C 2YWYA 4TRPH 4FP8L 3O6LH 3DROB 3IS1X 4HAGA 4YDIL 3SKMB 2JCCF 3RP1A 1EERB 2N4IA 2E7MA 2E7HA 2LU3A 3FO2B 2KUTA 4PTTA 1RULH 2AJYH 4U6VL 1R5IB 1B2WH 5LXGH 1BWWA 4Q9QL 5DTFA 1YN6B 1E6JL 4KTDH 3AS1A 3IDGA 1JTOA 5FK9A 1CGSH 4TNVK 12E8L 1G0DA 4N0YL 4MWFB 4PJXB 4OGZA 3TIDA 1OT2A 2QR0B 2CRYA 4KQ4H 2ZUYA 3MYZA 3DX8A 1OAKL 1RFDL 2NY4C 2Y07L 1KJ2H 2WUBL 2RJMA 3MRQB 3SEPA 2W0PA 1RUQH 4N8PA 4BSWA 5FCSH 4OZFB 1N64L 1CIUA 5CS7A 3KYNA 4YEEA 1G7PA 1FV1B 3HUJA 2AV7B 3V5DA 3HAEG 4HHAA 5EA0L 5IESL 3BH8A 1DQLL 3MLYH 2E5EA 4W6YB 4OIBA 3SE4C 3NZ8B 2YC1A 3C5SB 4M9PA 5JO5B 1FSKB 5GGUB 3ZE2E 2F54B 3PGDB 4R4FH 5FGBA 2G5BA 2O5YL 5DURD 4GKZB 3IU3A 5D6CB 1NFDE 4NQEE 4Y88A 2CDEB 3MUY1 1XGPA 4RGOL 1RUKL 4OV5B 4D9LL 5F88B 3Q6GL 2AJSL 4AEIL 1XR9A 4XNUL 2VZUA 4NKMA 2J12B 5EU5A 3QXDA 5KW9L 3H0TA 3D18B 5E2TH 3FQUB 3BESR 2VOTA 4ZSOE 1DVFD 4M7LL 5DJCB 4LKXA 2FJFA 4ZFFA 1T3FB 1RZKC 3LQAH 4PB0H 3VFUA 3VXUA 5CILL 5MI0C 5AYQA 4WO4B 1FNLA 4N8VG 4WGWB 3ZKQD 4U49A 4PP2A 4UU9A 4EDWH 4XCEA 2B0SL 3K8MA 3KPNA 1J5OL 5HHME 1PAMA 4HCRA 3LMJH 4OGYL 1WTLA 4ONGL 4HCRL 4X9BA 3JWOH 5JPNB 2PR4H 4TN9A 1LDPH 2HJKA 1TVDA 4L3EB 3N50A 4QHNB 4WFHE 2DDQH 5F7UA 1UQSB 1ACYH 2OYPA 5DWUL 4QRPB 1T0MB 1KLUA 4RWHA 3PWLB 5ALBH 4UNTA 4QNPE 5A2IH 3D87B 3BZEA 4F7TA 5EU7E 3ZDXF 4CVZB 4FABH 4MD0A 2ZG1A 4K3HA 2MCG1 4AENB 5M95B 5AEAA 1FYTD 4RGNB 4LDEB 2XKNA 1T7YA 1XIWD 5CWSA 2EDFA 4OSUL 2Y6SD 5MHSE 1PFCA 2YXMA 3ULUD 3DVNB 2VISA 4HUNB 1CDIA 1N6QH 3KLDA 2XQYG 3G9AB 5CZXC 3H9HA 1DR9A 2V9QA 5TDOB 3TZVA 2ZKHH 4QRTB 4JFFB 4KUZL 5ESAA 3IF1B 2EKSA 1MFCL 1WK0A 4Y4HD 4TNWK 3QXAB 2CLRA 1SMOA 2CMRL 2JIXD 3KGRA 1JPFA 4LARH 2I07B 3MOBL 3U48A 5H2BB 1H5BB 5DGRA 3JV6A 4PJEA 5K93A 4LDOB 3AMKA 1G7HB 4G6ML 5FYLL 3IDXL 4ZUVA 4NO2B 4M7ZB 3SY0B 1X4ZA 4Y5XB 4Y1AA 4OAWA 4XNYL 3WHXA 4X6DF 3NN8B 4OI9A 1EBAA 1FZJB 3OKNB 3KDMB 4MGXA 4NOFA 4XBGB 3REVA 4C56D 5KVFL 4MAYD 3PWUB 3TFKD 3BQUC 1YPZF 5AWNH 1T89C 1KCRH 5E6IB 3CPLA 3BPLB 2FGZA 2NXZD 3MPCA 3C60C 3HAEA 3F5WB 4BUGA 4B0MM 3LEVL 4R3SA 3VRLE 2PTVA 4A2LA 2CIIB 4NJ9L 2YD9A 3V6BR 4ZTOH 1IM9D 2ZUWA 1U41A 4UTBL 5MENE 3CNKA 1EEZA 2Q8AL 7CGTA 1TQBC 3KPSB 3RAJH 1JGVH 3LN4B 1MF2H 2X4SA 4IDJH 3MLWH 5HHVH 3JBG7 5FYJD 3O6KL 5DJXB 3VXPA 4YAQA 1OTSD 3IDYC 4N0UB 4KRPB 5JA8B 2XKSA 4NQDA 4MJ2A 3DXAA 4PJ9A 4M6ML 2AQ1A 4NQCA 5HJ3A 2PO6C 5B3JE 4M48H 1UM5H 5ANMB 2DF3A 4GAFB 3PWPD 1Z9MA 4WWKC 5D1ZC 2FX9L 4YGAB 2EDWA 2DWDB 1RJLA 1OGAE 4OZFG 3FCTB 5GGSY 5IFAH 3GK8L 5J3HC 4ZMAT 4N8VA 5ADPL 5B22A 6CGTA 1V8HA 3PQYA 3QEGL 3BIKB 4NZRL 1MCLA 1N5AB 4HBCL 5HHNA 1GGBL 4ZFOA 4K8RL 4J2XA 4ZFOL 3SE3C 1J05A 4O58L 3IGAB 3CVHA 2ADIA 4PRPB 3CVHL 1FG2A 1HH6A 2IF7A 3O3BB 4XTRD 5DJ2A 3REWA 3RIAK 4CKVX 4OM0L 5CHNA 4QHLA 1G1CA 3MACL 3RDTC 3EYFB 2BZDA 3FQRA 3O6ML 2JB6A 3W9DB 3I9GH 1S7XB 4RMVA 3V0VB 3PNWA 3IETA 3ISWA 5CP3A 5DT1L 1ULVA 3ULVC 4WGVB 4LCYA 3BEVB 3WJLA 2BX5A 3CH1A 4IHOA 5F70A 1RUMH 1H0DB 5EH1A 2E7LC 3GMNA 1DQQB 2A1WH 3OPZL 3QUYD 1MCFA 4FHBD 3KJ6H 1DBJH 4LSSL 1B0RB 4I5BB 4KKNA 4NZDA 1NH6A 4ZUTA 5E5MA 5EFIA 3EFFB 3BZ4B 2I60L 4J7RA 5CEXA 2HVJA 1B90A 2XG4A 3DHJA 1KTLB 4IRJB 3IB4A 5C3TA 1VGEL 4JM2C 4YQXH 4FN0A 4EI5B 3FN0L 5JIKA 1ITBB 5I1GH 3VFPB 3X3GH 4YHLH 1TMCB 4UV4H 1PGRB 4JLRB 3QWRA 4LLWA 1BZ9B 3GMMA 3G6JA 4FQ2H 3MTRA 3WIIH 1HNGA 4X99B 1Q9KA 2DLGA 1JNNL 1TDQA 4Z7WE 3WJJA 4ELKB 4NDMA 3S88L 3IJSA 1K4DA 2BVYA 4OM1H 2FHBA 3RNKB 3H3BC 4BKLB 2VUOA 2HT2C 1G0XA 5FOJA 3AROA 2LVCA 5IG7B 2QSQA 1KB9K 5GRJH 4NO3B 1NAMA 1QLRB 3W9EA 1MJUH 4YHOH 1NAML 5I1EH 3VI3E 2Y9RT 1OTTC 3BYTA 3VFMA 2VR5A 1YNKL 1MRDL 2EH8H 4PJ8C 4HWZA 1S9WA 3GIVA 3WXWL 4R4NC 2RGSA 4JCMA 5HHQA 3HI1A 1CFNA 1AR2A 2C4XA 2ZCKL 4KKAD 1VACA 3DROA 4YDLB 3SKMA 4D9RD 1OOAA 2DJUA 3RIFF 3L1OL 3C8DA 4J23A 3FO2A 3NPZB 1YEEH 3VFRB 1HHKB 2XKUA 4HDIB 5L88L 3VXSD 1YN6A 2DBLL 4TQEH 2IALB 5HHMD 5C0DB 5GSRB 4NZTH 1DFBL 4MWFA 4PJXA 4Q74A 2QR0A 2BDNL 2VLRB 1NSNL 4CVWA 1IILE 4NNXA 4NUJB 4WFHD 3MRQA 43CAB 3U9PH 4XP9H 3U30C 2GW5A 1A7RL 4F9LC 5EDXA 1QYGL 4OV6F 1ZS8B 1QA9B 4OZFA 3S37X 1NBVL 3GB7B 5ICXB 1FV1A 2AV7A 1PBYA 1CFVH 2P8LB 4YR6B 4EIGB 5EUOA 4XPHH 4PJAF 3NZ8A 3T2NH 4H0GA 5DMIL 5MHSD 5JO5A 5GGUA 1DQJB 3INUL 2F54A 3PGDA 1UWEH 4HPYL 1G6RH 4TVSa 1JGEB 3RZCC 4GKZA 1XF3B 3QQ9C 5D6CA 1SBSH 4ZAKC 3DSFL 4X7EC 2CDEA 2DJ4A 3JUYA 3T08A 4OV5A 5F88A 3AUVA 4K3DL 3TC9A 4JY4A 3N1FC 4C4KT 4XPBL 2GITB 4RFEB 2R29H 3FQUA 1AXTH 4OZGB 5DJDA 2IQAB 1T1WB 5DJCA 5D7IF 4U1KB 2AJUH 1OW0C 2EDQA 5JHLH 1T3FA 3U0WH 1MCOL 1X4YA 1J1OL 4M62L 5D7LE 3C6SB 5D7KE 1WEJH 3CFEB 4PRNB 4WO4A 3IS0X 1DVFB 1I75A 1B4RA 3BT2L 5CEYB 4LDLB 5JPNA 5KSUB 4GRLD 4HLJA 5M7QA 3NCCB 4L3EA 4QHNA 1AO7E 1NC2D 1UQSA 3RI5F 3V4UH 4QRPA 4HF5L 3WFZA 1T0MA 4OFDA 3PWLA 4MNGE 4RISH 3TM6A 1GIGH 2IPUG 4PJFE 3LKOB 1JYNA 1JWSB 5KVMC 4PUBH 4AENA 1CE6B 3CCHB 3TJEL 3PP3K 1N8ZB 4JN1L 1N5YL 4UV7H 3DVNA 4KHXL 4OCXL 3STLB 3EO0B 3QXTA 1FYTB 3UYPA 5TDOA 1N6VA 5C9JB 1QNZH 2VZTA 4JFFA 4QRTA 2VSDA 3IF1A 2WLZA 1TZHA 5DS8B 5C08D 5FGSA 5HI4D 2VE6B 3QXAA 3GI9L 2I07A 4BUHA 3SGDH 1FPTL 5H2BA 1H5BA 2AXJA 3QB7C 5J11C 3L3KB 4Q58C 1CICD 5ILTL 3GUTB 1G7HA 1OGAD 1PKQA 4ONHB 4F33B 4Y4HB 1I7TA 1MJ8L 1QHOA 4NO2A 2JIXB 3K1DA 5DJYB 3SY0A 3QIWB 4Y5XA 5AAMA 4D0BB 2VDRL 1MSPA 5GGTL 3NN8A 4GFTB 1FZJA 3OKNA 3KDMA 4XBGA 1M7IB 1WT5A 5C0JB 4NC1C 2M1KA 5FEBA 1CE1H 3PWUA 4WY7L 3V7AG 4TSBL 2EH7L 5K9JH 4P2RE 5HHXH 3HFMH 2R9HC 3F5WA 3RWFB 1JP5A 3P0GB 5CGYC 2APBA 2CIIA 5I1JL 5JZ7D 4P9HL 2IQ9H 3QT2A 3N06B 4MXWL 3OKEB 1YA5A 2NXZB 3IFOB 3PIQB 3KPSA 2BNRB 4UOW0 2Y7QB 1CTOA 1KT2B 3P11H 3LN4A 2EIEA 3BX7C 4L4TD 3NACH 2P5WE 4LNVA 3BSZL 1H8NA 1D3CA 3ZKMD 1IM9B 3FO0L 2QEJA 4PJDE 5DJXA 1CDGA 2VDNH 1GGCH 2G75B 4N0UA 4PLJC 1IQWL 2FEDD 3CLFH 4XPTL 1NCDH 3BKYH 3KLHD 2ZOKB 5J13C 4TOYL 5ID1B 5J06A 5KVDL 3RY4A 3K4ZA 2HAZA 3QCVH 3CLEL 1IGCL 4Y5VB 4XPFL 3MNVB 1N7MH 1KCKA 4DEPB 3DGGB 1R5WB 2DWDA 3QHFH 4UIKH 4XT1C 2A38A 2W1NA 2XICA 3FCTA 2HMID 2B39A 5DC9B 3GSXB 4HS3B 3BFOA 2QQNH 4LAQH 5F1IB 1ZA6B 3BIKA 1N5AA 4JREB 2AJXH 3V95A 3PWPB 2ADGB 3VFTB 5DO2C 3UPCA 3ARGD 3H9ZA 4MA1C 2E6QA 3SGJC 3NIGE 3VDBA 1J1PL 1T04B 2R2EA 3IGAA 1SJVA 4PRPA 1J0KA 3O3BA 4JQVA 2CJUH 2P5EB 2ZCLH 3V4VH 2D7QA 2F19H 1X5ZA 3TA3C 4WW2F 1RURL 3QJFB 2OMBA 3HB3D 2LV4A 3RWEB 1QZ1A 3EYFA 3ZKXB 5L6YL 5KANG 3L95B 1VERA 4LL9A 1BD2E 3W9DA 1S7XA 5GGVH 3MBEC 3QIUD 1VHPA 4TVPL 3V0VA 2UY6A 5DEFB 5DQDH 3UP1A 3BEVA 3GJFH 2EDLA 3T0WA 2Z35B 1H0DA 4KWUA 1YEDA 1TFHA 4P2QB 5GHWH 2X5PA 5LCVH 5H35B 2N1KA 1A0QH 1B0RA 4I5BA 1J12A 3WXVH 3EFFA 3BZ4A 4P3DB 1DQDH 1KTLA 4IRJA 3OXRB 1TETL 1FORL 1T1ZB 4EI5A 3QUYB 5MERB 3K80A 3TF7C 1PG7X 3T0BA 5B39B 3VFPA 5DMGD 2VMFA 4CAGA 3VXQB 1P9MA 1TCRB 4JLRA 1BZ9A 3IFLH 1HILB 2YS4A 5KVGL 2DN7A 4X99A 3JWDC 5IFJB 5DYOB 4ELKA 4CVXB 1MQKH 4G7VL 1NEUA 4L29B 1H9VA 3O2WH 3RNKA 4BKLA 5FHAL 3WKNA 5B8CC 1ZLVK 1JNHB 6FABH 3HE7C 1UM6L 2FD6H 35C8H 4O00A 3PWJB 3ZYZA 5IG7A 3O6FD 1ZV5A 2GAZB 5F3BB 4HUMB 2M26A 4NO3A 2O5ZL 2OCFD 1FNHA 4JQIH 1QLRA 4Z78B 4KTEH 5KVEL 3KPPB 4ELME 3HC0B 1P6AB 1Q0YH 4QXUL 5D5MF 2PNDA 4MA7H 3FOMA 1WIOA 3THMH 3S96B 1RHHB 4LAJH 1E4WL 4XRCB 4RWYH 4JDTL 4MAUH 1XH3B 3WCYA 1NFDB 4NQEB 5IIEB 1F58L 3VWKC 3DSNA 1ITCA 4FXLA 4FG6D 1KENL 5TPWL 5D7LD 2EE3A 3GBLA 5E8PB 5F7EH 3B4NA 3BMWA 3D2UD 3VFRA 1AGCB 2JLLA 4EKXA 4E0RB 1HHKA 1T4KB 3H42H 1F4WH 4OIIL 4HDIA 5D7SL 5EB9A 4ZSOB 2IALA 3MV7E 5F6HJ 5C0DA 1IE5A 5GSRA 2BFVL 1KJVB 1EXUA 4BK4A 5C3LD 2M2DA 5F7WC 3ZDZF 8FABB 2VLRA 4U1JB 1QKZL 2DQDL 4TTGA 3VXSB 4NUJA 2AERT 4PJIE 43CAA 1AO7D 5HHMB 2P24A 2VL4A 4PJHF 5DZLA 3WSQL 4JVWA 5TQ0L 1KXTB 2WP3O 1Y18A 1ZS8A 2UUDH 4D8PB 2AI0H 1FZOB 3GB7A 5ICXA 1UCBH 3U6RB 4YXKH 2Q1EA 3MR9B 4KDWA 4M7KL 2VIRB 2P8LA 4XNQB 4YR6A 2ZUVA 4I0PD 5GS3A 4U6TA 4IOFC 3H6JA 4J8RB 1FO0B 1DQJA 2CUIA 4Z7QF 1CGUA 4H88L 1TJHH 1HCFX 3PUCA 1JGEA 3UC0H 1Q38A 3LH2L 1XF3A 2EDRA 1JN6B 5D71L 2IWGA 5FIEA 1P84K 1VCAA 3NCYP 15C8H 4Y4KB 4GRWH 5K9QG 3ARRA 3OKLB 4YHNB 4X98B 2GITA 3MGOB 4HKXB 4RFEA 3UX9B 2V7HB 1IKFH 1AKJB 2IQAA 1VESA 4R2GD 1T1WA 4U33A 5B4MC 4U1KA 3SE8H 2XQBL 1T66C 2G60H 2VDQL 1RD6A 4RX4A 4YZFF 3C6SA 1B4JH 1FZMB 2GUOB 3LY6A 3HC3H 4PRNA 1S7RB 3I75B 3UO1H 1DVFA 4O5LL 2ZUQB 1GGIL 2OR7A 1OAZH 4QT5B 5E2UL 5GXBB 5CEYA 5DUBB 4WHDA 5KN5B 2APTA 5KSUA 4XNXL 4QYOB 2LQRA 3V52L 4ODBD 2DQUL 4M1GL 3HNTH 4HWNA 3U82B 4P2RD 1LP9E 1RVFH 1IC5L 1QUNA 1JE6A 3OKDB 3U0PB 1Q72L 2NYYC 2YA1A 3LKOA 1JWSA 3WFCH 4L9DA 4HZLB 3C2AL 1WUNT 3M8OH 1CE6A 2Q8BH 1NC2B 3CCHA 2O93L 4V2CB 4F3FB 3UJTL 1N8ZA 4X5WB 1EPFA 4U1MB 1IC7L 3S8WA 5J7CC 3TPKA 3SPVB 3STLA 3EO0A 4NFBA 1JGUH 1F90L 2W92A 3OB0K 4ZS6C 1FYTA 1RK0B 5GGSB 5JIHA 5C9JA 5MENB 1WVZA 1P4BL 1LO2L 2CRZA 4D9QE 1HEZB 2CXKA 1T83A 1HI6B 3ULUL 5DS8A 1FIGL 4JB9L 5I19L 2RR3A 2VE6A 4ZPTB 1J0IA 3UZVB 4JQXC 5B39G 1J88A 1JPTH 4CN4A 1RU9L 3L3KA 3RQ3A 3GUTA 4F37F 4J6RH 4M93B 3JVGA 4ONHA 4F33A 3CVIL 4J3TA 3GBMH 4Y4HA 3H9SD 2JIXA 5DJYA 1C5BH 3BWAB 2NY0B 4NKOB 4A6YB 2OP4L 3QIWA 4YBQD 4C58B 2H2PD 5C9KA 4IRSD 4B41A 4D0BA 2VWEC 5J9PB 2HRLA 5CEZH 2V5RA 3G9VA 1CICB 3HUJF 4MCZB 2IFGA 5KOMC 1OGAB 3S35H 1M7IA 3PHQA 5DRZB 5CZVH 5C0JA 3WD5L 4R7NA 4YNYB 1H3VA 3ZL4H 1FE8H 3HMXA 1BJ8A 4PGEB 4ENED 5DR5L 1P7QD 3MJ7B 4P3CH 2F8OA 2VXUL 3RWFA 3T77B 3MOAH 5JOEA 4GSDL 4PS4H 4E41E 3UDWA 3HNVL 2R56H 1MCHA 4W81A 2QTEA 3IFOA 4JG0L 4XP4H 3PIQA 3UBXB 2BNRA 2Y7QA 1FFNB 1KT2A 4JRXE 2J4WL 1LDSA 4G8IA 4L8DB 5F1KC 1U42A 1UCTA 3MLSH 4IMLB 1IM9A 2D9CA 3HRZB 2G75A 3T0EC 2DD8H 4TSCH 1PVHA 1OY3B 1GC1H 2ZOKA 1VFOA 3FMGH 5ID1A 3AS2A 4G7YL 4YWGL 1MRFH 5BO1H 5FYJL 4CN1A 3SCMD 5BS0D 1A6AB 4Y5VA 2I9LB 3MNVA 4LEOB 1JPSH 1HZHL 4PLKC 4WTWA 5IW3A 3DGGA 1R5WA 3EJZC 3KR3L 5HVHB 3U83A 4AG4L 3GSXA 4HS3A 3PP4L 1CDUA 4X4ME 2VR9A 1ZA6A 3QPXL 5F1IA 4PRDB 3WNPA 3DUSB 3PWNB 3PWPA 2ADGA 4LFHD 3VFTA 2LABA 3T65B 1WWCA 1ZVYA 4PGZA 1YEFL 5L2KE 4Z7WB 1T04A 2W9DL 2RIKA 1BBDL 3K4DA 5MEOB 3RKDD 2X9YA 3ARDB 1C7TA 2F58L 2P5EA 2UZIL 4N8CL 5D96C 3QJFA 4UT7H 3ARGB 3RWEA 3RVTC 3L95A 4I18B 1YMMD 5CKGA 5KS9E 4JZJB 1KLGB 2DMKA 5DEFA 4ZNEA 5BRZE 1YUHB 3MRCB 5I15H 2Z35A 4LSRH 5LGHH 4LRIA 5C92A 2UY7A 4P2QA 5H35A 3W11D 4WW2C 4MQTB 4OUUB 3FQTB 4JPVL 5TQ2H 4PJEF 3DWTA 4IOSD 5GZNC 4P3DA 2VABB 1IGJB 4P5KB 4U1LB 3OXRA 4KXZH 1W8NA 1B9ZA 1Z0NA 1T1ZA 4JKKA 3QUYA 5MERA 2EICA 2HT4D 5TJWK 4RDQG 2VLKD 3HPJA 5B39A 5GS0H 1I8MB 3VXQA 4Y2OA 1CLOL 1TCRA 4U7MA 4OT1H 2CO7B 1CDCA 1HILA 1YEJL 1Y6MR 2P1YA 3CXDH 3T3PE 5DYOA 4ZNCD 4MNHB 4CVXA 3VW3H 2AJVH 1K5NB 2W60B 2J6EH 5D1XB 4L29A 4Y8AA 3SDXA 3ZMRA 4MB3A 3VFGH 4ZG1A 5I1CH 2DQGH 1JNHA 1OP5K 2FATL 2OZ4H 4XWOC 4K9EH 5I1KH 1ZGLM 1AQKL 3PWJA 4LSTH 2GAZA 4GQ9H 5F3BA 2OBGA 2IBZY 4Z78A 1S78C 1LE5A 5ISZE 4JR9H 3KPPA 1MI5E 3MRNB 4CMHC 5IQ9B 3HC0A 5C0NC 1D7FA 1XGYH 3S96A 1RHHA 4PRIE 1KJ2B 5GRUH 4Z7UE 4XRCA 5E03A 1XH3A 2FYYB 4X5XB 3KPQB 1NFDA 5IMMB 1X5YA 2VZVA 4NQEA 5IIEA 3GBNH 1OQXA 1SQ2N 1U3YA 4K7PH 5DXWA 2RHEA 3ARSA 5J12C 5E8PA 1LNUB 1DBKL 1AGCA 2ZCHH 4KKLD 3VDAA 4E0RA 1T4KA 1JNLH 1U58B 3SQBA 3CGTA 4ZSOA 3JUZA 1R3IH 4MA8L 5BW7C 3VWJB 3WKMH 1KJVA 4Y19E 1LILA 5FHBL 1S5IH 5DD5L 1CT8B 1FDLH 4OJFH 5D7LB 8FABA 4ZD3L 5TF1L 4U1JA 5EC2B 4FFZL 2LTQC 5FO7B 3VXSA 4HMDA 4U1GB 4LSUH 1MELA 2R1WB 3BGAA 3FONB 1NGPL 5EOCJ 2ARJB 4NQSB 3DLQR 3RX5A 4LGPB 2W9EL 4D8PA 1RZKH 3ZTNH 1FZOA 1IFHH 1DBMH 3Q2CA 2EDKA 3U6RA 1S8DB 3MR9A 4I8DA 1NQBA 1IAIL 1QFWL 4UDTB 1NMAL 3HCVB 4XBEL 4XHJD 1AO7B 1CVRA 2B5IC 2EO9A 4S1DC 5CJXC 3W82A 2ERJC 2DB8A 4BQCA 2G5RA 1JI1A 4J8RA 4M1CC 4MNGB 3R0MA 1I3UA 3OAYK 1FO0A 2F5BL 4PJFB 1FO0L 1B0WA 1XEDA 3GSQB 3UTQB 4Y16B 3U7WL 5SWQB 2GQHA 3UBXG 2XXCB 1JRHH 4LSQH 4I0PB 3SDCB 3KPLB 2DI9A 5C0RH 2CKBH 1B3JA 2HLAB 2XIDA 1JN6A 2Z31C 4X7CC 3TH2T 4D9QD 4F7CB 4P4KC 1SY6H 5FUZH 4BA8A 3CJJA 4YBLC 2R69H 4Y4KA 1QQDB 3JTSB 3OKLA 4YHNA 4X98A 5EIIB 5IT2H 2L0DA 3MGOA 1INEL 2V7HA 1AKJA 3O8XC 5ACLA 1CQKA 4NJAL 1BGXH 3LQZB 3P4OB 1WGOA 5IW1B 2YHGA 1FZMA 4KROB 2GUOA 4HKZB 4FXKB 1IC4L 3H8NA 4WI5A 5DGQA 1S7RA 3G6JF 3AREC 1BJ1J 4OCRH 3TESA 2Z8RA 3I75A 4LVHB 4MD4B 4R2GB 1I3GL 4R26L 3QIBD 3RGVD 4KK5C 1YYMH 1JFQL 5FUOL 4GRWE 4K23H 5DUBA 4XNMB 3BJ91 1F4XL 2HFGH 4QYOA 4DGYH 2B2XL 2CKNA 2A2QT 3TYFB 1F2XK 1T03L 2BHZA 1A7NL 2HKFH 2DM3A 3U0PA 2DOCA 5TDNB 4BZ2H 3ETBF 2D9QB 2A9NH 2FX8L 3GSWA 2ATKA 1S9KC 4HZLA 3TGXA 4LRNL 5FYKH 1NC2A 2VZ1A 5T5FH 4P2RB 4KI5C 4F3FA 2GCYB 3L7FB 4NCC2 4X5WA 4U1MA 4D94A 1HOCB 4JRXD 1MCDA 3SPVA 3BN3B 4J4PD 2OTWB 1A6VL 1RK0A 5EO1B 5GGSA 3QRFM 4V1DE 4YHML 4YHKL 1I8IB 5MENA 4M8VA 1UJ3C 2Y06L 2AABH 1HEZA 1ZLSH 2PW2B 1CGVA 4HZAA 5CP7B 1HI6A 1M4KA 2L7JA 3QEQD 1Z9OA 2KQNA 2P5WB 3P0VH 1AFVH 4K94L 1G6VK 4ZPTA 2XTJE 2WUCL 4PJXF 1PJ9A 3OAUH 3EOTL 1KEGH 3RA7L 2NY3C 7FABL 4KV5E 4IRZL 2EE6A 1WCBB 3BPNC 5DD0H 1C1EL 5F1SA 3ROLA 3BWAA 4NKOA 4A6YA 3A6CL 2CR3A 4A6YL 1NKOA 1FCCA 3QI9D 5GZOD 5J9PA 2A73B 3SJVD 2VO5A 1CICA 3D0VB 3OJVC 4MCZA 1OGAA 4G6AC 2I5YH 5DRZA 1EO7A 2R1YA 4KHTH 4KKBC 5EUOF 2F74B 4YNYA 3D69B 3AY4A 3DVFA 2FO4B 4PGEA 4Q9BA 1MCWM 2ICES 1E6OH 5SX4H 5HDLA 4HT1H 1CIDA 4NRYB 1NDGB 5J1SC 1PYWB 5LBSL 3T77A 4K55A 1UKQA 2OR9H 3IAQA 2GI7A 5TE4L 4JHAL 5IROA 4JPWH 5CEZE 3V8CA 3NFPB 1GYAA 2FHCA 3CFIC 4YHYB 5CUSH 1P7QB 2YN5A 3JV5A 4XWGH 1BD2B 3V4PH 3WDIA 4QO1A 4WI4A 3UBXA 3U4EA 1FFNA 3CFBA 4L8DA 3T4AB 5FGBC 1ERNA 4E9LA 4IMLA 3HA0A 3HRZA 1N2RA 3UEZA 2R0KH 5AZEH 1BIHA 5KSAC 1EAPB 3H2WA 1HHJB 4L4TA 2X1OA 3NZHL 1GAFH 1A6UH 1MJ7L 3ULVH 3O9WD 1A6AA 4DCQB 2I9LA 1UKSA 3BIAX 2M8XA 4LEOA 3C09C 2WWMC 2Y5TB 4XAKE 3O4LE 3TPUB 3NFSL 1CTNA 5T3ZH 4FZ8L 5GGQL 5LGKA 5E95B 3MROA 5EORL 4PRDA 3DUSA 3PWNA 4AL8L 3FTGA 1BF2A 3BKML 4NN5C 1BLNB 4MB4A 1O7SA 3T65A 5IBLD 4Z7WA 2A77L 3SDDC 3E6FB 1PSKH 3W0WD 3P0YH 1UG9A 5MEOA 3ARDA 1T2QL 2P8MB 5F3HB 3MRMB 3RX7A 3V0WH 1JPST 3ARGA 1U9KA 3G6AB 5MP6H 3KPRE 4XI5C 4EXKA 3TWCL 4JZJA 5EC1B 1ZOXA 2VKWA 4UT6H 5DC0A 4HFUH 1KLGA 3EO9L 1MWAH 4AIZB 5ITBH 3K2UH 4ELMB 1DE4B 4KDVA 4DW2H 3MRJA 1YUHA 3MRCA 1EO8L 1FNSH 5F7HA 1NCAL 3QUZD 3B5GA 1DQML 1YYLH 3S36X 2ZUSA 1KIRB 4XCFH 5LWYL 1ADQH 3C9NA 3FQTA 3U4AA 1ODAA 4DWHA 3JZ7A 5ALCH 3EIFA 2VABA 5F7LB 4K7FB 3HZYB 4Y19D 1IGJA 1QD0A 3OF6A 4K3JH 4P5KA 4U1LA 3TT1L 5DUMH 2W91A 1QSEE 2X4QB 3RVUC 2V2TB 2DRUA 1MOEA 4L3AA 1I8MA 3MV7B 5HPMB 4FFYL 1AE6H 1U36A 4XCNB 2D03H 9CGTA 1AXIB 5EU6E 3W81A 5TFSL 5SX5K 4HH8A 2ESVE 3LN9A 4PJIB 1K5NA 2FR4B 1AGDB 4TRPL 2W60A 2Z4QB 3O6LL 3TJHD 5D1XA 5SWSE 4CDGC 1Z3GH 3QQNA 4JO2H 4JHWH 2PYFB 1DEDA 2FB4H 1RULL 2AJYL 3GHEH 5L0QC 3QDMD 4MNQE 3NH7H 2R15A 3QO0B 1B2WL 3MRPB 3ZE0F 5LXGL 1JRHI 3UJJH 4KTDL 2VLJD 1CGSL 1URLA 1XCTB 3ZKNC 4NWTH 1LK3H 5IQ9A 1G0YR 3WIHA 5C07E 1N4XH 4EDXB 4FFWD 2YD4A 1X5LA 4TULH 4KQ4L 5F1OB 1KJ2A 1MUJB 3V6FB 1KJ2L 2JB5H 1HYSD 2YUXA 2FYYA 2ZSWB 4I0CC 2WAHA 3KPQA 5IMMA 1RUQL 1X9QA 3WO4B 4I9WD 2IAMB 5L2JB 3JTTB 5TE6H 1JNJA 1I1YB 1JZ7A 4OKVB 1LNUA 3IXTB 1ZE3C 3MLYL 1U58A 3MZGB 5CJ5A 5E4EB 1CU4H 4NPYB 5IMOB 3VWJA 3TBSB 2ORBH 1G6RB 4R4FL 1CT8A 5D7LA 4GAYA 5DJ8B 4NN7B 4HKBB 2X1PA 2XRAH 1UACH 4IDLA 5FO7A 2WWKT 4KUCF 2XACC 4NQXB 4PJ9C 3FONA 5HGHB 2X10A 4NQSA 3BUYB 1A1OB 3MFGB 3F7RA 2AJ3B 4LVOB 5CFHA 4S11A 5BMFH 1S8DA 5E2TL 4UDTA 3HCVA 1CZ8H 1AO7A 1IBGH 2NW2B 1LP9B 2X4UB 3LQAL 4PB0L 4MNGA 4HSQA 5IVZB 1FHGA 3RWIB 2AJZB 4PJFA 3CFDB 4XCYB 2ZSVB 3GSQA 3UTQA 4Y16A 4R4BB 4EDWL 4I0PA 3ARXA 1IGFH 3SDCA 3KPLA 1KPVB 2HLAA 3LMJL 3CFCH 3QRGH 4GXVH 4F7CA 5EWIH 2PR4L 1FFRA 3Q6FB 2WBWB 4UILH 1LDPL 1QQDA 2BP3A 3JTSA 4F58H 3OJDB 4K7PY 5EIIA 4GLRI 3C6LD 1ACYL 5CP3H 4H5SB 4RCAA 4U3CA 4K71B 4JRYE 5ALBL 5IEHA 2F8XC 1Q9OB 3LQZA 4IIQC 1II4E 2GTZB 3D3VE 2Z0BA 3LPWA 3P4OA 3QR2A 5IW1A 4FABL 1QSFE 2ADJB 4FXKA 3GI8H 5D6DA 1M7DB 2EXWD 1Q8MA 1A6PA 3A0OA 4MD4A 5HI3D 3TN0C 4HJGB 3IXAB 4LNRB 2VKXA 1EUUA 1M71B 1L6XA 4OD1H 5B38B 2R2BB 4UINH 3EDFA 4GW5B 4XNMA 3ZE1E 2UV3A 5DZNA 5HDQH 1NMBH 1U2CA 2ZKHL 1BFSA 3TYFA 3JXAA 4M02A 4H25B 5TDNA 3T04D 5I73B 4WEBH 1NBZB 4LARL 4WJ5B 3BD5A 3DBXA 5HGGS 3RL2B 3MLRH 3T3ME 4N1EA 1AD9B 4O9HH 4P2RA 2GCYA 2NY6D 3L7FA 4WTZG 5FCUH 3MLUH 1HOCA 3KPOB 5E9DD 1GCFA 4E41B 2OTWA 4P23C 5EO1A 1I8IA 3FZUD 3VFSA 2X7LB 3QYCA 5CP7A 3ZSSA 4JRXB 2ZWLT 1G7MB 3SN6N 3T2OA 3TNNB 2P5WA 5AWNL 3OJMB 1KCRL 1GGTA 4F8QA 4WU7B 3S37H 4I3SH 5HYQB 4XAKD 1WCBA 5FM4A 3QFJE 4KQ3H 4R0LC 5A40E 1UT9A 2EEBA 4ZTOL 1JI2A 1EEQA 3MJGX 1I1AD 2A73A 5LKNA 1FGVH 3LKQB 1WIPA 2ZG3A 3D0VA 5D93B 2OL3B 3HE6D 4FQXB 1DL7H 1UWXK 1WWWX 2EC9T 1JGVL 1FL5B 5E1AB 2A0LD 1MF2L 2F74A 3H9SA 4IDJL 3D69A 3MLWL 5HHVL 2L7UA 3I2CH 2FO4A 4Z8FH 4H0HB 3QI9B 5LJYH 2P42B 5C09D 1WBYA 1U3HB 4NRYA 3KPRD 5L2KB 3EYQC 1NDGA 4GG6E 1YY9C 2FH8A 4F15C 1FGNH 4Q0XH 3RUGE 1JWUB 3BH9B 4K3EH 4M48L 4O4YH 1UM5L 3VFOB 3NFPA 1CXIA 4XZUB 1P7QA 3QDHA 3SKNB 4MMZC 1BD2A 5IFAL 5KS9B 4GMTL 5FDYA 5I74C 3BE1H 1ZT1B 3T4AA 2ZUUA 3WS6A 4XC3H 5BRZB 1CL7H 3VXRD 2G2RB 2I26N 4PG9B 3RX8A 4JFXB 2H1PH 1EAPA 1H3PH 2NX5E 4A2MA 1NANH 1HHJA 2OJZH 5ID0B 3BI9X 2PCPB 1G7IA 4DCQA 2JJVA 4XVSH 2IPTH 3I9GL 2XPGB 4XXDB 2Y5TA 2ESVD 3TPUA 1XGUB 3GJFB 4YDKH 1HINH 1IGMH 5EG6C 1RUML 3V6OC 1IQDA 1Q0XH 4PRHE 3RHWK 1BLNA 3SKUD 2A1WL 4LOUC 1J18A 1E0OB 5GS0D 3KJ6L 1DBJL 3E6FA 1ZEAL 4DVRH 2IAND 3IRPX 2OSLB 2NY5H 1EIBA 3ULVE 3L3GB 2P8MA 5F3HA 3MRMA 2BVQB 2UWEA 2PUQT 4XP6H 3G6AA 4YQXL 2ZOLB 1FJ1B 5T3ZE 3L3HB 5I1GL 3JWDH 5EC1A 3X3GL 4YHLL 4M03A 4UV4L 2JJSA 4AIZA 4ELMA 1DE4A 3MRBB 1XMWA 3QEUB 4FQ2L 3ULUF 3WIIL 4WTZA 5IV2B 2DLIA 4PRIB 3KVQA 2XFXB 4Z7UB 1KIRA 4KGLA 1YMMA 1UEMA 1WITA 1HNFA 5EOTB 4UDUB 4OM1L 1S5HB 4Y4FB 2L4OA 3D85D 3LHPH 1K4CB 4K7FA 2QKIB 1XGRB 2Q86B 1ZSDB 1RZIB 2X4QA 4BFEA 2V2TA 1KB9J 5GRJL 5B38G 4N5EC 1MJUL 4YHOL 2V5YA 3MV7A 5HPMA 5I1EL 1LE9A 1M05B 4XCNA 2EDBA 4Y19B 5B21A 2EH8L 1KACB 3BEWB 3RTQB 5JW4N 2VXQH 2W07A 4PJIA 4RNRB 2FR4A 4DK6A 1FVCA 2Z4QA 3S6CA 3TYGH 3RY5A 1E4XH 3U0TB 1DN2A 4ZUUB 3I6LD 1RZ8B 4HV8B 1YEEL 3QO0A 1HSAB 3MRPA 4X4YA 4OFVA 2GHWB 4TQEL 3X3FH 1MHCB 1OWWA 1XCTA 4NZTL 1QR4A 3P2TA 4WUUE 5CBAB 4PJCE 4EDXA 1MUJA 3V6FA 1LEIB 3TT3H 2ZSWA 3ULSB 3U9PL 4GW4B 1QLFB 4XP9L 3F7QA 1MCRA 4X6CE 4LLMB 2IAMA 4JRYD 4YHIB 3C5ZC 1DLHB 3PL6C 2ZNXA 3T2QA 4B7LA 5L2JA 3JTTA 4P9HC 1I1YA 5IHZB 3AS0A 1KYOJ 1AGEB 3OBAA 4OKVA 1CFVL 3IXTA 4FNLH 2YZ8A 4F7PA 1I7UB 2GK2A 3RU8H 2PTTB 4XPHL 4NPYA 2OI9B 3T2NL 5IMOA 2X41A 1OM3H 5HHOD 3TBSA 1G6RA 2E3VA 5L7XH 3GHBH 1T7ZA 4P5TB 1G6RL 1MCNA 5DJ8A 3SDAD 4G9FE 4HKBA 5D1QB 3N1MC 2NY1D 2YR3A 3HZKB 4FQPA 2HTKC 1SBSL 4NQXA 3WUWB 4QRRE 5HGHA 2OM5A 4GRWB 3BUYA 1A1OA 1MREH 4AYFA 2AJ3A 3W5MA 2EXYC 3SO3C 3B9KC 2DM4A 3BRFA 2R29L 1AXTL 3L3OB 3UTSE 3DYOA 2NW2A 2AJUL 2X4UA 5JHLL 5DRWB 3U0WL 4OCSH 3DRTB 5IVZA 5I1LB 5IQ7H 2AJZA 3CFDA 1WEJL 4HIXH 1A47A 4C59B 2AK4E 4XCYA 2XZZA 4G8GE 4R4BA 4NM4H 1KPVA 4Y0GA 3VG9C 1FNAA 5E2WH 1J0HA 3ARVA 1S9YB 3FT2B 1I1CA 1PG7H 4MHHG 5F9DC 1KCSH 3Q6FA 5JQHC 4I1NB 4LPCA 3OJDA 5FYKD 2BVUA 3AXLB 4I77H 4AIXA 4V1DB 1A7PL 3K8KA 4H5SA 3V4UL 4M00A 1TQCC 2DKSA 4RISL 5FV1L 1GIGL 1Q9OA 2H32H 3ZYOA 2GTZA 3GEWB 5F7NC 1KN4H 3QFJD 1NC4B 4PUBL 4XMKH 2ADJA 2JE8A 2XTJB 4LVNB 4XP5H 5FUCC 1M7DA 1ES0B 5I8CB 4B50A 4Q6YA 5CJOH 4HJGA 4CBPA 3C60D 3IXAA 4LNRA 4UV7L 4Q2ZB 1MLCA 4X7FC 5B38A 2R2BA 4S2SB 2D4DA 4GW5A 3SDXF 2AXFB 1JYXA 1XF4A 1LK2B 1QNZL 3G5ZB 2WV3A 3F62A 3U79A 2JJWA 4HKJA 4OZHB 5C0EB 4H25A 3AAZB 1P9MC 1IAKA 3DO3A 4KJPC 1T1YB 1NBZA 4QF1B 2DLHA 4WJ5A 4RMUA 3RL2A 5KSVB 1AD9A 3ZE2F 1L0XA 3LKPB 4P0DA 4D0DB 3QDGE 4BQBA 1NFDF 1F02I 2Z8VC 2EIBA 2QQLH 3KPOA 3EJYD 3GSNH 4P57B 4EN3C 2OK0H 2PO6D 4ZPVB 1DUYB 4MJ6B 2FGWH 2YUZA 4M5ZH 2X7LA 4WIQA 4QOKE 1I85A 1CE1L 4JRXA 1NANI 3DMMB 5K9KB 1G7MA 2VLLB 5C0BE 4J4PA 3TNNA 3FFCE 1MNUH 5K9JL 1NJ9B 3HFML 4OTXH 4WU7A 5EBLB 5HHXL 5HYQA 3P9MA 1F00I 3E6HB 4XGZB 3ZHKA 3WO3B 2H26B 2DKUA 2D7NA 4NC1E 1CLZH 3E3QC 1WICA 4OLVH 3TBYB 2YUWA 5FECB 1P4IH 3V79C 1KXVC 2IQ9L 1T2XA 2P44B 1QHPA 3LKQA 2OL3A 4DZBA 4FQXA 1YEIH 3O4LB 3BGFC 1I8LC 5E1AA 1FL5A 3MNZB 3P11L 2GIYA 4JY5H 4XMLL 4X4MA 3NACL 3ELAT 3ULVD 1JZ8A 1AHWB 2FIKB 3LPGA 4N0CD 1I1AB 4QNPF 3QI9A 1F6FB 1P1ZB 3QH3B 2VDNL 1GGCL 2B4CC 2NY2B 4KFZC 2NY7H 3CLFL 4GBXC 4ZXBB 1NCDL 1U3HA 3BKYL 3HE6B 3VXUD 1IAIM 1QFWM 2Z93B 5T3ZD 2IBBA 3PV7A 4FA8A 1NBYB 2DQIH 3IAGC 1JWUA 3BH9A 3VI4F 4X5LA 3QCVL 3VFOA 1KXQE 4NP4H 3B83A 3QDJD 1N7ML 2VN4A 4XZUA 3SKNA 3QHFL 4UIKL 1QTYT 3KPRB 5KS9A 2QQNL 1ZT1A 4LAQL 4I3RH 4OKDA 2AJXL 5BRZA 3ARQA 5I1IH 4J12A 4UOJA 3HN3A 2EYRB 2G2RA 4QRQB 4PG9A 4JFXA 3IAPA 3ZO0A 3LV3B 1NKRA 2CJUL 2ZCLL 4PJ7E 3V4VL 2F19L 3U7YH 3BOVA 4GKOA 5ID0A 1TENA 4ONFH 2PCPA 3WUWG 2WIMA 4RDQF 1J0ZA 2JJTA 1NPUA 4I2XE 2XPGA 4XXDA 5GGVL 2VSCA 1RJYB 3TBTB 4JG1H 2QV2A 1XGUA 1UEYA 2ZJSH 1ZHKB 1UXWB 5DQDL 3GJFA 4PJBE 3TZVD 1H3UA 2O5XH 5EU6B 4Z7OE 4ODWB 5GHWL 1DVFC 2ESVB 5LCVL 1OHQA 1CF8H 1LD9B 1D9KB 3ARYA 1HQ4B 1A0QL 4B53A 1DBBH 2OSLA 5SWSB 3WXVL 1KFAH 1DQDL 4WUUD 3DI2B 1SHMA 1MCPH 2PF6A 3L3GA 1F3DJ 2BVQA 4MNQB 2ZOLA 1L9NA 3QG6B 3VRLF 1FJ1A 3GNMH 3L3HA 4KVNH 4Y1AD 1F45A 4G9DB 4BJLA 4ERSH 4HJ0D 3RVVD 3VXMD 5C07B 3IFLL 3MRBA 3QEUA 5IV2A 5FKAB 1UJTA 4P59L 3MRDB 4PRIA 5JQ6H 2XFXA 4Z7UA 4WI8A 1OAQH 2EDEA 1MQKL 1PKOA 4PP1D 2DLFH 5EOTA 3O2WL 4UDUA 1S5HA 1R3KB 6FABL 1K4CA 4U7SA 2FD6L 2QKIA 35C8L 1XGRA 5GS2D 2Q86A 3OJ2C 1ZSDA 1RZIA 4Z6AT 5B3JF 1XIWC 1J7VR 2OLDA 4JQIL 2Y6SC 4KTEL 3ULUC 1M05A 3CFJB 1Q0YL 4QRRD 4MA7L 2CLZB 5ITFB 4Y19A 3THML 3BEWA 1VKXB 3RTQA 4RWYL 4MAUL 1S7SB 2YA2A 4G5ZH 1BZ7A 1S9VA 4RAUB 4RNRA 3STZB 3FB8B 4ZAKD 1OAYH 1T21B 3A67H 4Y4HC 4G6FD 5F44A 3U0TA 1A4JB 4ZUUA 5F7EL 4HV8A 4K2UH 3V7MA 1HSAA 4L4VD 3H42L 3I84A 1F4WL 2YMXH 4NQCD 3BKCH 3PF2A 1LMKA 4CJ0A 1MHCA 5FKPB 3OG4B 3HMXH 4WI2A 4OCMC 1UYWH 1KGCE 5CBAA 3OG6B 5E5UB 3BXNB 1LEIA 2V17H 4NQTA 1EJOH 4K8RD 4GW4A 4M43H 1JGLH 1SJEB 3RVXD 4XH2B 4LLMA 2VXTH 4MAYC 3TFKC 4YHIA 5I75C 1EGJH 1B6DA 1DLHA 2YD8A 2AI0L 3DGCR 1UCBL 5IHZA 3UDWC 4YXKL 4H20H 1OD7A 2NXYD 4RMQA 1I7UA 1AD0B 2NXZC 2PTTA 3S3SA 3FJTA 4JRYB 4KJYB 1SYVB 1UZ8B 3D3VB 1TJHL 4P5TA 2C4FU 1QSFB 3R8QA 5D1QA 3UC0L 2CKBB 3HZKA 4KMQA 5DSCB 3BKJH 1OLZA 1WCQA 1J86A 1OARH 3FHAA 1CGXA 4LEXH 3WUWA 1J8HE 4Z7WF 15C8L 3PXHA 1OTSC 5KBNC 3L3OA 1IKFL 4AY0A 5DRWA 3SE8L 3DRTA 3QDGD 1V7NH 2G60L 5I1LA 4UAOB 4JREC 1B4JL 3C87A 4BQ8A 2E7CA 5I8OH 3SGKC 3HC3L 3VI3F 3PWVB 1A14H 3UO1L 3QWRD 3P3YA 3FHQA 1OAZL 1S9YA 3FT2A 4P3WA 2QQKH 2DQJH 2YRLA 5T3XH 4FOMA 3B2VH 4YC2C 2W0LA 4JGUA 2J5LC 5C0BD 2YSSB 3HNTL 3AXLA 4HGWB 4PJGE 4V1DA 5GIRB 2FJHA 2COQA 1RVFL 2F8VA 4BH7B 2A9MH 4XTRC 1SYSB 4W4OA 3EBAA 1IC1A 4Z9KB 2X70B 4PY8I 3WFCL 1NC4A 3M8OL 4R97C 4LRIC 2Q8BL 3IJHB 1ES0A 5I8CA 4F57H 3QAZB 3WHE0 1MFEL 3O2DH 3HG1E 1ZANH 4C83B 4Q2ZA 3VD5A 3QFJB 4S2SA 1JGUL 1V7MH 3NAAH 2AXFA 3B2UD 4N9OB 5I18H 1UWGH 3QUYC 1LK2A 2ZZUT 3G5ZA 1YZZA 4E42B 3C60B 1DDHB 4OZHA 1DBAH 5C0EA 32C2B 3AU1B 4RBPK 1T1YA 3LRHA 4QF1A 4BELD 3MRGB 1JPTL 1UB6B 1GGUA 2BNQE 2AW2A 3LKPA 4PLJD 4J6RL 3UTZB 5DI8B 1ZHNB 4NGHH 4D0DA 1TQBB 3EO1B 3RUGB 3GBML 3GMLB 2WW8A 4P57A 1C5BL 5JXAH 4ZPVA 1DUYA 4MJ6A 5CEZL 3O45B 3PP3H 4F2MB 3QHZH 4KK8D 3S35L 5CZVL 1GZPA 1MFDH 3ZL4L 1FE8L 2YOCA 5E9DA 5K9KA 2PO6B 4QRUB 2VLLA 3P4LA 1N64H 2PW1B 4HEME 2VWEE 2RCSH 4FQQB 4WWKB 1L7TH 2CDFB 2X4TB 1J10A 1NJ9A 5D1ZB 5EBLA 5J89A 4P3CL 3GDBA 4YDJB 1OQOA 3MOAL 4XGZA 5EZJB 2H26A 3IDNB 2NX5B 3EOYG 3WLBB 1V5JA 4PS4L 1EHLH 3TBYA 4OFPA 2OTUB 2R56L 2VJXA 4Q97A 2A6IB 4KKAC 4R7DB 4XP4L 3O4LA 2WM0A 4XVUD 2XZCH 3MNZA 2ENSA 1X3DA 3BISA 3MLSL 5C0AE 3AB0C 5DFVD 1AHWA 1I1AA 1P1ZA 3QH3A 4PRHB 4PJFF 2R4SH 4ZXBA 3HE6A 2DD8L 4OLXH 4TSCL 4DTGH 1GC1L 2Z93A 1E28B 3FMGL 5A2JH 3MRKB 1NBYA 4WO4D 4MYWB 1MRFL 5BO1L 4DQOH 3B6SA 2W0KA 1JPSL 3T0EE 3KPRA 1PEZA 2HH0H 3DX6B 4GS7B 4L3ED 1UGNA 2OX5A 3GMQB 1T2JA 4XNZC 4NIKB 5EU7C 4QRPD 5DK0B 3FO9B 2EYRA 1GPOH 4JM2B 3BRDA 4QRQA 3RWHB 1TJIL 4ACPA 2VDMH 3DUUB 2XWTA 4Q9RH 2AEWA 1YNLH 1Z5LB 3D39E 3LV3A 4ODHL 4OF0A 1BQUA 4RGND 3CX5K 5JDSB 1NUGA 3WIFB 4UT7L 1JVKA 5KTEH 4H1LH 4M61A 1MFBH 3CZJA 1RJYA 1H3TA 1MWAB 5DJZB 5LQBH 1KBGH 1BF8A 4Y2DD 1ZHKA 1UXWA 2E9IA 1A21A 4G43B 4JFFD 4MB5A 5I15L 5IOPB 1BJMA 1JK8A 4LSRL 5EU6A 5LGHL 4MSWB 3O11B 4ODWA 4KZDH 2ESVA 2Y5EA 1LD9A 1D9KA 5TQ2L 3BIBX 2ZUQC 4LPTA 5SWSA 4ZQKB 1Q94B 1KGCD 2ICWJ 2QQQA 3MOBH 4MNQA 4E5XB 4O2FB 3DOSA 4X4XB 4ZODA 3X14B 3QG6A 1PY9A 2YPLE 5BOZG 5GS0L 3L5XH 5FYLH 1G9EA 4G9DA 1QBBA 3VMOA 1TJGH 4WUUB 4L1HA 5C07A 4OT1L 4GRLC 4PJCB 5JDJA 1CLCA 4KC3B 5FKAA 3MRDA 3CXDL 1PX3A 4ZFZB 4PG2A 2J6EA 5KAQG 2AJVL 3VW3L 2J6EL 3EYUH 4WTXA 4JM4H 2H9GB 2NLJB 3VFGL 4X6CB 5I1CL 5E6ID 2H8PB 4LLUB 1RIVH 2DQGL 5HHPB 2OZ4L 4P46D 3LD8C 4K9EL 5I1KL 1T5XB 4OQ1A 5DDHA 3B3IB 1MHEB 4LSTL 5GGRA 3BPOC 4GQ9L 5L8KB 3PDOB 4IMKC 5CIPH 2OQJA 1KN2H 4JR9L 4P2OD 3U30B 3CFJA 4LGSB 4IM8A 4K94C 1P7KB 2CLZA 5ITFA 1F3DH 1XGYL 1VKXA 1I7RB 1X5FA 5GRUL 3KPSD 1NL0H 3DV4B 4G9FB 1S7SA 1W0WB 4UIMB 1MPAH 4HWBA 4RAUA 3STZA 3FB8A 4M93C 1FCGA 5EU3B 3GBNL 3SE4A 1T21A 4QRRB 2ZPKH 3NIGF 5HI4C 1REIA 1A4JA 4K7PL 4KRPD 4HS6B 1R24B 1OTUD 3GGWB 2ZCHL 3RZCB 1JNLL 1CICC 5IKCB 1R3IL 4ZAKB 3MV9E 5T1LB 5FKPA 3WKML 1A6WH 3QULB 2VDOH 4G6FB 1ZLVH 2DI8A 1S5IL 2EKJA 3UZQA 4OJFL 1CLYH 2AK4B 2HP4A 4D3CH 4L4VB 4QXTB 3BXNA 4G8GB 4LSUL 3OR6B 1SJEA 5C0CE 4XH2A 2C7UB 4HLZH 4YHZH 2FSEB 5AG9A 1RZKL 5A43C 3ZTNL 3FRPG 1IFHL 1EX0A 1DBML 4PRPD 4WVRA 5D8JH 4W70A 3WDJA 1AD0A 4NZUH 4YO0B 4JRYA 4KJYA 1GH7A 4PJ5E 3HG1D 5JNYB 1UZ8A 3D3VA 1MRCH 3VH8B 1QBMH 5JZ7C 3LDBC 2PYEE 2NXYB 1JRHL 3IFPB 2CKBA 1WQVT 3I6GB 4LSQL 5DD6B 5DSCA 5C0RL 2CKBL 4LSPH 1SY6A 2BY1A 4OZ4B 5HHOA 1SY6L 5FUZL 3L9RB 2R69L 5AYUH 1JCKA 2GTWB 3LRGA 3SDAA 3ZKMC 3CDGB 2X4PB 2AEQH 5IT2L 4QCIB 5BV7H 2FEDC 4PIRF 2UWEF 3OPZH 3F6IA 4JFHE 1G7LB 2X44D 3KLHC 3S36H 1LQSR 1BGXL 3NVQA 2Y4SA 4EI5D 2AXHA 4LASH 2HLFD 3Q3GB 3TP4A 4ELMF 4OCRL 3PWVA 4X80H 4Z95H 1WFUA 3R8BB 1T5WB 1YYML 2HMIC 1KULA 4WHTB 3X12B 4K23L 1NGQH 3QDGB 4RA0C 3KXFE 2HFGL 3L7EB 4DGYL 4NC0B 2YSSA 3D6GA 3HI6H 3ARGC 5JOPE 4HGWA 1LVEA 5GIRA 4NZJA 5J11B 4JZJC 4NBZB 3NIFE 1ZGLP 4QOKB 2HKFL 4BH7A 4JPKH 1RK1B 1SYSA 4BZ2L 4KI1A 1I8KB 2A9NL 2X70A 5C0BB 3HB3C 4YLQT 3HNSH 4JGMA 1RMFH 2V5SA 5FM8A 4U31A 3IJHA 5FYKL 1RIUH 3RIFK 5T5FL 3QIUC 4RGMC 4YZFE 5T3XE 4HGMA 4PJIF 3QFJA 1TZGH 5HYFA 2HN7B 1T89A 4RQQB 2E9JA 4AQOA 1Z6JT 2QBWA 4NSKB 2AABL 4KI5E 4E42A 2W59A 3C60A 1ZLSL 4HUVB 3BDXA 3LPFA 3OXSB 32C2A 3AU1A 3P0VL 1AFVL 2IJ0C 4YGVB 4Q6IC 1F4HA 1U8HB 2E6PA 5IGXH 1UB6A 4DUXA 2UZYB 2LAGB 2BSRB 4OF5A 1BREA 2BXYA 3OAUL 1KEGL 5DMGC 3UTZA 5DI8A 1ZHNA 3F7YB 2VLRD 1C08B 3EO1A 5DD0L 5MEPB 3RUGA 1S9XA 3GMLA 3VFWA 3RWDB 2XZAH 2J1KA 1GL4B 5HBBA 3C8HA 1AIFB 1JF5A 3C5JB 3TLRA 5CKAA 3O45A 5J4MA 3VG0H 3WIHH 3LIZH 4F2MA 3IDIB 4DKDC 2HFTA 1NDMB 2I5YL 5J13B 4KHTL 1KTRL 1E4KA 3HHRB 2PO6A 2FEEI 3LZFH 3OB0H 1D5IH 2CDGA 2Y25A 1E6OL 4BSJA 3O6FC 4FQQA 4LU5H 1T7VA 2VLME 4WWKA 2CDFA 4CN6A 2X4TA 4PGBB 1CXLA 5D1ZA 2HJFB 3FRPA 4HT1L 3FL7A 5DD1H 3NMEA 4YDJA 3W5NA 5EZJA 3IDNA 2OR9L 4GJTB 2NX5A 4PJ7B 3WLBA 1ZKAA 4RFNC 4JPWL 1QFUH 5CUSL 4LCWE 5IVXE 4XWGL 1ZLUK 4I2XB 2A6IA 3V4PL 4R7DA 4ODUB 5ETUB 1I3VA 4WFED 1T0PB 4KRLB 5C0FB 4FG6C 1M7XA 4PJBB 3TA3B 4ORGB 3NA4A 1HXYA 3DJ9A 2NQCA 3H3PH 5DMJB 2DLEA 2VC2H 1YEKH 4PRHA 2DS4A 2R0KL 2VH5H 5AZEL 1CCZA 1P4LB 3MBEB 1FC1A 2YPLD 1QLEH 2BCKB 3G6DH 4RX4D 1E28A 3WNKA 5IF0B 3MRKA 2C5DC 2DL2A 3RI5K 1C12B 1A6UL 4G3YH 3ULVL 3G04B 3S34H 4OD3H 4GKSB 2E7LA 4EVNB 4Z5RB 2R4RL 1N3NA 3DX6A 3JV0A 5T3ZL 3GMQA 3RPIA 5HTSA 5E8EB 3QDJA 5DK0A 3FO9A 5TGBB 5F6IC 1ETZB 1U2HA 1VEMA 3BP4B 4I0PC 3RWHA 3IDJB 4M7LT 1PSKL 1SJXA 3VH8G 3DUUA 1T1XB 3KPTA 1Z5LA 1KLFA 1PZ5B 5JDSA 3WIFA 3V0WL 4B5EA 4WV1C 3QQ3B 5MP6L 3CK0H 2D31B 4R6UA 1CD9B 4JFED 5K59E 1MWAA 4UT6L 5DJZA 4HFUL 2V6HA 5FAAA 1MWAL 5ITBL 1A7OH 3K2UL 2BXZA 4G43A 4DW2L 5B8CB 3NABH 3HE7B 4X7DC 2EDYA 1FNSL 4X0KB 5IOPA 1HCVA 1DJSA 1YYLL 2DIJA 4MSWA 4F9PC 3O11A 4KDTC 5D6DC 1ADQA 4XCFL 4TYUA 4LVHC 3GO1H 4R2GC 1LO0H 1ADQL 4EQ3A 4Y2DB 1NCTA 3MV9D 5I76B 2MJWA 1V3LA 5ALCL 4Y89A 2BJMH 4ZQKA 1Q94A 4K3JL 1GHFH 1JMXA 5DUML 2A83A 4KKCD 1GXEA 4E5XA 1QBAA 4O2FA 3HLAB 4X4XA 3X14A 1KJMB 3MODH 3V5KA 5ILTH 3NCEB 5E6YA 1CR9H 1MEXH 2BVPB 3QIWD 2E6JA 4UMGA 4NHUB 3VWKB 1AE6L 2D03L 4WUUA 2VB5A 1I7ZB 4L8SB 4PJCA 2OMNA 5CSBA 1BQLH 3QWOB 5EUKB 3VGEA 5I2IB 1PZUB 4ZFZA 4R8WH 2IC2A 1UA6H 1T6VN 4OFIA 5DUPH 2H9GA 1Z3GL 4X6CA 3VXMA 2H8PA 4JO2L 1FQ9C 1DUZB 4JHWL 2EIDA 5HHPA 4Z7VB 2MWCA 3N9GH 1CFQB 2FB4L 3GHEL 5HSFA 3NH7L 1CFSB 1T5XA 4HXAH 5FYLE 4FTVE 3UJJL 3PDOA 4D0CB 5DQ9B 3VU2A 4NWTL 1LK3L 1F13A 4NO5B 2CH8A 4F9LA 1N4XL 5T5NG 4KMTH 1P7KA 4P46B 4TULL 1I7RA 2KPNA 2BNRD 3DV4A 2KQMA 4G9FA 2JB5L 3MV8E 4C4KO 4CU8A 4UIMA 5JXED 4HG4K 5EU3A 4JFHD 4P2OB 3WFHB 3KS0J 4R9HA 4I4WB 4QRRA 1J8HB 4P4KD 4QY8B 3MUZ1 5EBMB 1IL1B 4MDJB 1S7VB 1R24A 5DHVH 2RB8A 5TE6L 4LGRB 4Z7NE 3GGWA 3BVNB 3FN9A 3FT3A 1B0GB 1CU4L 5IKCA 4ZAKA 5T1LA 5CJQH 4PLNC 3BAEH 3QULA 2ORBL 1OP5H 3HMWH 5KOVC 5JW5B 5KS9F 4YBQC 2H2PC 4YHPB 3ILPB 4IRSC 2Z92B 2AK4A 1HK6A 2XRAL 4L4VA 3FB6B 4QXTA 5CCKH 4M1DH 4CRPA 3OR6A 4KK5D 1OW0A 4MVBD 5D2NC 2C7UA 4LPXA 4CNIB 2FSEA 4ZTPH 3V6ZB 5BMFL 4ENEC 1AGBA 4G8EB 1OVZA 1MCIA 3O0RH 1CZ8L 2P5ED 4PJGB 1IBGL 5A3ID 4NQDE 3MCG1 3K1KC 4YO0A 4P5MB 1HHGB 4LSVH 5JNYA 4CL7A 4U2ZA 3WS6C 1W0YT 1VGKB 1X5JA 3VH8A 1AI1H 2BK8A 3O4OC 4LIQH 4FQ1H 4HIJB 3VE0B 2MCPH 3IFPA 3I6GA 1IGFL 2YWZA 5F1NB 5DD6A 3O41B 3VXTB 3CFCL 2X40A 4OZ4A 3QRGL 4GXVL 2C26A 3HG1B 5EWIL 3T3PF 1I9RH 1CDHA 3L9RA 3H7BB 2H3NB 4P2QD 5HVFB 4F58L 2GTWA 4UILL 4KJQD 2X4PA 1RZGB 4QCIA 1T20B 1RAMA 2QHRH 3QWQB 1RI8A 2YBRB 2H32B 4X7TB 4YBHA 3Q3GA 3SCMC 1GZQB 4YDVB 3GI8L 1TNMA 1ZLWH 2D7TH 4QHMB 3ARFD 2BNQB 2DQHH 1HWHB 1T5WA 1VENA 4Z7UF 4WHTA 3BW9B 3X12A 3QDGA 4OD1L 3OAYH 5C6WH 1RHFA 3P4NB 4UINL 4GAJH 4XX1E 3L7EA 4HK3J 1MIEH 5HDQL 1NMBL 5EO0B 5ABDE 2WBKA 4GT7A 5BCAA 2VLMD 3FN3A 3RKDC 1KTDB 4QOKA 1RK1A 3VJ6B 3ZTJH 5BQ7B 4WEBL 1I8KA 4OLWH 1MCWW 1LEGB 5C0BA 1HHHB 3SBWC 3MLRL 4KRNA 4HK3N 4O9HL 3WNLA 2GKIA 4LCWD 1KNOB 3Q5TA 1CFTB 1QBLH 5FCUL 3MLUL 3GSNB 3G6JE 1EVUA 4JKPH 4NQED 3V5HB 1F97A 2K7PA 2HN7A 3K7UA 2OTPA 2OXHA 3MC0A 4RQQA 4NN6C 2HWZH 4NSKA 3W11C 5A2LH 4LCCC 1JWMB 3MRLB 4HUVA 2C3XA 3SE9H 3G5VB 1PQZA 3RWGB 2X05A 1D5XB 2MNUA 1U0QA 4YGVA 1A1MB 5C0AB 1U8HA 3M45A 3TCLB 1EVTC 5DC4B 3S37L 4I3SL 3NGBC 5FFLA 4OFYA 2W65B 3F7YA 5EIVA 2W0FB 1FNGB 1C08A 3GJEB 1R5IA 1FNEB 3MREB 4KQ3L 3RWDA 4XB7A 2AGJH 2IGFH 1AIFA 1NCBH 5GJSH 1FGVL 3GMPB 3HZMB 1CGTA 3T0EB 2B4CH 3IDIA 5J1AB 1LO5B 1NDMA 4KAQH 1ZT4B 1CK0H 1SEQH 4KMLB 1MAMH 3J8F7 4Z8FL 2P48B 1FH5H 5DVLA 3A6OA 2CUHA 4LVEA 5F21B 4M7KH 4PGBA 2HJFA 1QSZA 4RZCB 4TTDD 2QJDA 1FGNL 1KYOK 1YJDC 4Q0XL 3D39B 4ZYKB 4PJ7A 4K3EL 4O4YL 1XF5B 2GY7B 3ARZA 3ZT6A 1A9BB 4GRWF 1QG3A 1D6VH 1G84A 3C5SA 1NUDA 2QHLA 1TTGA 4I2XA 1TTFA 4Y4KD 4ODUA 5DVKA 5KG9B 1T80A 3BE1L 3L6FB 5JR1H 5ETUA 1CXHA 5C0FA 5D96B 4PJBA 1AKJD 4XC3L 3TA3A 4ORGA 4OLUH 1CL7L 4KKLC 1CYGA 5EUOE 3QUXD 2BCKA 1P4LA 3MBEA 2H1PL 4PBXA 1H3PL 3D18A 5IF0A 3VFVB 3MLXH 1C12A 2IPKB 2OJZL 3GSOB 3MLVH 4P49A 5E1HB 4LVOC 3G04A 4BQ6A 4XVSL 3FFDB 4GKSA 5GRVK 2BSSB 1CXEA 1UXSB 2IPTL 4FQLH 4EVNA 3LAFA 4Z5RA 2YPLB 3S5LB 2BRQA 4APQD 4YDKL 1HINL 1IGML 3QPQD 4IBLT 5E8EA 1Q0XL 2CPCA 5TGBA 1ETZA 4XHJC 4N90E 5DHYB 2MFNA 3BP4A 3IDJA 1NLDH 2PETA 3QEHB 4KVCH 1DCLA 5GRXG 5C7XH 4DVRL 3QXUA 1T1XA 2P47B 3F7VB 2NY5L 1PZ5A 4GW1B 3P77B 3MJ9H 4X6BB 1IKNA 5GSVB 3KYKH 3V6OE 4KV5F 4PREB 2ICWI 4XP6L 5TE7H 3QQ3A 1JHTB 4OLZH 2D31A 1E27B 5CINH 3MV8D 2RBLA 3GSRB 3JWDL 4M5YL 1R3HB 5ESQB 4CVZA 1MIMH 5MEND 5B8CA 4F37K 1A4KB 4OZHF 3HE7A 4X0KA 1LHZA 1OP3K 1SJHB 3DETD 4JFYB 2FZ3B 3R1GH 4JFEB 4XNQA 1U8LB 2ZUTA 5E7BA 1U8PB 4Y2DA 4DN4H