1J87A

Human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
168
Chain Sequence
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPHA-SUBUNIT
publication title The analysis of the human high affinity IgE receptor Fc epsilon Ri alpha from multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 168
sequence length 171
ec nomenclature
pdb deposition date 2001-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j87A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j87A02
4QO1A 4XC1L 3QH3A 7CGTA 5IHUL 4BM7A 4Y16C 3IDXL 4JO2L 4YX2H 4GXVL 4WFGE 3QAZC 4PJ9D 3FT2B 1XIWA 3S35X 2N7AA 4PJ5B 2YN3A 1GYAA 2M1KA 4WGWB 4GW5B 5KAQF 3T65A 4QRRA 4PRAB 3HFML 3CDGB 2NX5E 1LEIA 3EO1A 2AK4D 1MHCA 1VADA 1UM5H 2NY6B 3V79C 4XWGL 1G7JB 3ZYZA 1YA5A 4X6EB 5DRWA 5DK3A 3VGEA 1NH6A 1ZA3A 4NZDA 3FOMA 4ORZC 3SGDH 2OR7A 4JY5H 1JTPA 3ULUF 4N8VB 1CFNB 3MLZL 4LEXL 1CGXA 3BKML 4NRZB 4KJQC 5DJ2A 5LCVL 4QTIL 1S7TA 3HI1B 3FAXA 2PO6A 3IJYB 3QQ3B 5FO9A 4IIQA 4LMQI 4KU1A 4R7NB 2OM5A 1FL6B 1GOFA 5FF6A 3W9DB 2ORBH 4LHUD 4QCIA 1UA6L 3C6SA 1HWHB 4XMKL 4AG4H 3QFJB 2AQ1A 5GRJH 3OKOA 4NQDB 4MCYB 5I1IL 3RX5A 2G2RB 5JNYA 4XP1H 3CVHB 3MRCA 4JN1H 4QHKJ 3GHEL 1MEXL 3VD9A 3DX6A 1R3JB 4LSRH 1FLRL 5CSZA 5CINH 3P11L 2EIZA 3UTTE 3NCYP 4FFZL 2ZUVA 4XP4H 2AKRB 1AH1A 4J3WA 3MV9D 3PDOB 3GMRB 2NXZC 1V3LA 3B9EA 4Y2DB 5GSRB 1CR9L 4JR9H 5EU6E 3BT2L 5JOFB 4MDJA 4G3YH 4Y2DC 2ZOKA 4IOIA 3DX7B 1WZKA 5GS0H 1IAKA 1F4WH 1JNHA 4XPAH 3HS0A 4HF5L 4CU8A 2UZIL 3MJ9L 3UZQA 5BS0E 1BWMA 3OF6D 3O3EA 5DMGD 1SYVB 3DHMA 3P40A 5J6GB 2GITA 3WFBH 2D7TH 4HDIA 4OZFB 3X3FL 5E99H 1S3KH 2GJJA 1OTSD 3B8SA 3LQZB 4KTDH 4NQCA 1E4KC 2ZOLA 4F7MB 2GW5A 3EO9L 4QT5A 3JUZA 4BSVA 4UT6H 3KPMB 3OB0H 5I1CL 3QUZD 4MS8C 1KF9B 5D96C 5L2JA 1AC0A 1SEQL 1VFAB 3HUJF 4G8IB 1G9MC 1QSEB 1FN4A 1AR2A 2P42B 3S3SA 3WO3B 4LLQA 1Q9KB 1PEWA 1QOKA 3U6RA 1AGFA 1RULH 3F5WB 4UMGA 3HMWL 2GJZA 2HJKB 5A16A 3G5YA 4AJ0A 3TBYA 1JPFB 1P1ZA 1UM6H 3BRFA 3FB6B 2AXFA 1YYMH 4NO2B 3QEQB 5EIIB 3QUYA 3ROLA 1FDLH 1OAYL 3SBWA 5C9KA 3E6FA 1MAML 1IVLA 4LLDB 1F8TH 1A6ZB 3WKMH 3B6SA 5GZOD 5I17B 3BW9A 32C2A 4JDVB 3PV6B 4HMDA 4ONFL 1KXQE 3VGGA 2R29L 4S1DD 2IFGA 3HLAB 1QNZL 5ADOH 2IF7A 2EZ0D 2YZ1A 3RNQB 3OKYA 3OR7B 1IC4L 3PE9A 4DW2H 4IEFB 4UAOB 3V7AE 1IGML 2WW8A 3SDXA 1OSPL 4M6OH 4JG0L 5HHQA 2F53A 2F74B 2XTLA 3B2VL 5KTEL 1XF5A 4UAOC 3D69A 1BVLA 4FP8H 5E95B 1X6LA 5ITFB 4AIOA 1VFOA 2VSCA 3BUYB 1I1AA 3N1PC 3DHJA 1MHEB 3G04B 3SKMB 5TF1L 3S36L 4BSJA 5DC0A 2IAMD 1BIIB 3I84A 3BSZH 3QHFL 3G9VA 5HVFB 3MLSL 4PV9A 1T7ZA 1T2JA 5C0CB 1NMAH 3OXRB 1HCVA 1FPTL 1ZTXL 5K9OB 1RURL 4N1HB 4KV5F 1JYNA 3KPSB 3KNBA 1JWSA 1TCMA 1DEDA 2C3WA 2LAAA 5LKNA 3SJVB 3MFFA 3MNVB 4KVCH 1NDMB 1JZ3A 2OP4H 5CJ8A 3ZZ1A 1KEGH 2A0LD 4O02L 4JO1L 3VRLF 2XOTA 4L29A 3TT3L 3MR9B 4NKMB 4G6AC 1SY6L 4Q9BA 3NCJL 3G6AB 2R8SL 2ARJQ 3C6LB 5I6XB 4UTBH 1JI1A 2HVKB 3X17A 3T0EA 3BRDA 4TNVF 4X8JA 1MCRA 3A67L 5CJ5A 2FBJH 3C6LC 5I6XC 4ZQKA 3WNLA 1XF2A 4ALAL 3CMGA 5F70A 3TPUA 5DGQA 4RAUB 5JMRA 1MWAB 3SQBA 5CFHA 1QKZL 5KSBF 4XVTH 3HE6B 3M1BA 4G8EB 3C8KA 1KB5H 1S9VB 2XN9E 3QXAB 5BRZB 1OGAD 2AJUL 4JFYA 5DJDA 4JRXE 3HE6C 4U1NA 3T4AB 1IC5L 4X6CF 1KSRA 4A6YH 3Q6GL 1D7FA 1OP5H 1VEOA 1T03H 2DKMA 2OQJB 5F9OL 5TE6L 3MGOB 2C9AA 5B39A 3BO8A 1AO7B 2IEPA 4YHMH 1RVFL 1HZHH 3FN3A 1A4JB 2N56A 1BVZA 1FGNH 1BLNA 2X09A 2GT9A 5GS2D 2JE8A 4P4KA 1G9ML 1M05B 4AENA 5L2KB 2GJ6A 1ZGLA 1K8DB 4UILL 3UO1H 4O9HH 1I1RA 5JQ6H 1EEZA 5JDSA 1NFIB 4G6ML 4CL7A 5KVFL 4ETQB 1U8PB 2AEPH 2QQKH 4PGCA 5EOTA 1MJ7L 1E6OL 1HSBB 1RUPL 4N1CA 1LMKA 5TDNA 1CE1H 3MNWB 1G9NC 1S7WA 3JV6A 4PJ5E 5TDPA 3ROOB 3FQXA 4XNMB 4TVPD 2A9NL 5LAXB 5I75B 3QCVL 3VFRA 3MV7D 2G9HB 5TE7L 1JF1B 1MCFA 4NWTH 2B2XH 2FJGB 4QRSA 5I75C 2D9QB 3TNNA 2YWZA 1A5FH 4U1IA 1X5HA 5ICYA 1MCHA 1F58L 4ZUSA 3IDYB 3DUHA 1M7IA 4ZSOE 1G6VK 2QQLH 5DVNA 1N64L 3VXPB 1Z9MA 3BYTA 1V05A 1T3FA 1QUNA 4YO0B 3CH1A 3SOBH 1KB9J 4OD3L 1G7QB 2VISB 4KKCC 3NABL 1U91A 3ARRA 3QQ9D 4I77L 2P24A 3QFJE 4Z5RB 4KKBC 3VD5A 1PZUB 5HYJD 4I48A 3HE7B 2H9GA 4MX7A 3KJ6H 3VXRD 4I3RH 5C07A 1NAMA 4YBQC 3DPBA 3SDDD 3OR6B 4PJFA 3FFCA 2DKUA 3HE7C 2VLKA 4EEEA 4X9GA 1KCVH 3R06A 1J05A 4D9RD 5KVDL 3FQUA 3OKKA 4JO4L 4JAMA 4OZGE 4R97C 4LPWA 4LFHG 1SMAA 4KY1H 4EOWL 1YMME 3TJEH 3CFJB 4DZ8B 4LIQH 4TSBH 5J11B 2K7QA 3TV3L 3LN4B 1I8LC 4CW1A 1OF2A 1RHHA 3LKQA 2RIKA 3PWJB 2WIIA 2NW2A 1U9KA 4TULL 4G8GA 3R1GH 5J11C 1WFNA 1S7XA 1CXEA 2Z8RA 5TDOB 4YHLL 1A1MB 4K8RH 4G80B 2AXHA 5K59E 3CDYA 3UJJL 5JXAH 2OXGA 4OZHF 3QPQD 1IKNA 3ARUA 1P4LA 2ADFH 4HXBH 4OM0L 2A6DB 1MWAL 2UY6A 1IEBA 2EEDA 2VZVA 5A40E 4XBEH 1EAPA 5DD5H 5DJCB 3Q6FB 4JLRA 3UEZA 2Z92B 3C60D 1UCTA 4XHQA 4HWBA 4H1LH 3VXOB 5DJZA 2DQTL 4CRPA 1MCPH 4RBPK 2R4SL 4K7PL 4PLJD 4U1SA 4V1DA 3B8YA 5CD3A 1S9YA 1II4E 3QUMA 5F9JA 3IETB 3QIWA 1ZHKA 4OLXH 4EVNA 1HH9B 1EX0A 2AXGA 2COQA 4P2QB 1CG9A 1J0JA 1FO0B 4KDTA 1BPVA 1LO5B 3QEQE 2WUCL 5J8OA 3PUCA 4Y1AD 2UUDK 1YMHB 5SWZA 3BISA 1JYXA 2CO6B 3AU1B 3UC0H 3QQ4B 4M7LT 2CGRL 4IMLB 1G9NL 1DBKH 1R24A 4N90E 1RJYB 1DDHB 1I8MA 2BHZA 2OTUB 5IM7B 4XBPB 4LOUC 3OV6A 1C8PA 5IKCB 3V0AC 5HI3C 2CSPA 4X98B 1IGIL 3PNWB 1EK3A 1Y6KR 4M00A 2B39A 4WHYH 5INDB 2R0LL 5GS2H 5HYFA 5FDYA 4ZS7H 3GGWB 3ULSB 1M71B 2X9YA 2BX5A 1FZKA 3DV6A 2DQCL 4LSPH 3QPXL 3KWWA 1IARB 1OM3H 5CJBA 3PWLB 1QQDB 4UBDD 3ETBF 1OQOA 4X9FA 3IS0X 3X3GH 1AGBA 2MHAA 4YXHH 1ZLSL 3W39B 2FR4B 1CN4A 5C0CE 1ITCA 1A1NB 1EXUB 1EFQA 3SE3C 3KPSE 3VRIA 2GFBB 3SCMD 4RNRA 1KPRA 3F7YB 3SJVE 1A64A 1OLZA 2XY1A 3CD4A 4J4PA 5ESQB 4TUJA 5CD5C 3KR3H 2NYYD 3KS0H 2FATH 4B53A 4TVPH 3LD8B 3RWEB 3VGFA 1DQDL 5C7XH 1CL7I 1T1XB 1EJOL 4NRXA 4ZYKA 4R3SA 5CJOH 4OD1L 2C1OA 2IG2H 3BPOB 4AIZB 3D0LB 5CGMA 4GRMA 5J4MA 1P4BH 1NBYA 5C0EB 4QHLA 4EI5B 4PJEB 4NGHH 1AJ7H 1WZMA 3BPOC 5MEND 4F7CB 5ISZB 3EHBC 3EOAB 2GHWB 5ESVB 4MMXC 4Z7VB 3GIZH 4EI5C 3EUUA 3TM6A 2CLVB 3DETC 2A6JA 3LQMA 4LCYB 4RMUA 4KK9D 5GRXG 1IGFL 4QHMB 3GSQB 3BUTA 2NTSP 2FDBP 5BRZE 3T1FA 4PLKD 4RCAA 1F02I 3QWRD 3P4MA 5K9KB 5LQBL 1F4XH 3BVNB 3C08H 3WFHA 4X80L 4H5SB 2R0KL 3EW3B 2FNBA 3KXFA 4HWNA 1MPAL 5AYUH 5F7HA 5EZJA 1QVOA 2GQHA 3IFNH 2A9MH 2NZ9C 2QADD 5C8JA 3UBXG 2DOCA 2IPTL 4R8WH 1HOCB 3OAUL 3GIVB 3TN0A 1MNUH 4ZDHB 3HG1E 2R0ZH 4FZEL 1MCCA 1TNMA 1I1FB 4QTHA 4MDIB 2BSSA 4QKXB 4J6RH 4OCRH 3AREB 4N0UB 4QGTA 2ZZUT 2W65B 5I8OL 1SJEA 1CTNA 3BKCH 3SGKC 3DV4B 5DR5L 4DKEH 1JZ2A 4G42B 5L2KE 3AREC 3U9PH 1T20B 2DLEA 7FABL 4RWYL 3SDAA 3OG4B 4NQVB 1MCJA 5EC2B 3VE0A 1YC8A 2A38A 2OJZL 1XIWD 4HIJB 2AJYL 5D2LB 1K2DB 1AKJB 4JCMA 2CKBA 3EFDH 3SQOL 4L4VA 1F3JA 2Y5TB 4R4BB 3PGDA 3H3BC 3RVXD 5I15L 4DVRL 2ZUUA 3ZE0E 5HPMB 1FO0L 2X1PA 4KH2A 4GQPH 5AUMA 3QXTA 1KN2H 3WSQH 1I75A 5ACMA 1BQLH 1CDHA 1INQB 4HUUB 1FYTD 5T1LA 2AK1L 3S98A 1NJ9B 5KG9A 2C4FU 5CJQH 5CKAA 4R6UA 4OFIA 3O0RH 1HXYB 4YHZL 1K4DB 2CUHA 1GAFL 5EU3B 1VFBB 3BJLA 1BFSA 2IPKB 1LDPH 3ZKND 4QHKI 5L8JB 1ZWIB 4UUJA 3B3IA 1R3IL 5EU5A 3C8HA 4O2EB 2CDGA 5C0AB 2HTKD 4UT9H 2G60L 3ARYA 3WBDA 1CFSA 1RZJH 1Q9LB 1XCQB 3BP4B 1A6UH 4R7DA 5FHAL 3MRQB 4H25B 1HIML 2HJLB 3ARSA 5TQ0H 2EYTA 4JB9L 1DSFH 1TJGH 5A43C 5CILL 4X6FB 4JQXC 5IBLD 3SKJL 1FNHA 4M43L 1ONQB 1MREH 2GAZB 4ZNCD 1C7SA 3DOSA 4ZTPL 1G7LB 2V5MA 3GMOB 4NHCH 1OQXA 3TESA 3MV8D 5J1AB 3G5ZA 1D5ZB 3OB0K 5HGDA 5DUPH 5KW9L 4FRWA 1ZA6B 1CL7H 2Z8VC 5GRYA 5L7XH 5JLZB 1WEJL 1E6JL 3GUTB 2VDQH 1HQ4B 1TVHA 2YEZA 1UENA 4NFBA 5D5MA 4C54A 4XCNB 3RY6C 4WUUB 5DJAB 5HDOA 3V5KA 2NY0D 4EI6B 1CLCA 3CLEH 1OCWH 4OLUL 3QG6B 5HI5C 3IJSB 3TCLB 4CAGA 4XNUL 1WQVT 3DMMA 4FXLA 4ONGH 1T2QH 4L8SA 4Y8AA 1NCCH 2X44D 3SE4C 1EJ6A 4ZOAA 1SHMA 4LSVL 4B7LA 3WHE1 4Z7QF 4WUKL 1QA9B 4LCWD 5L6YL 3UMTA 4UDTA 2X4TB 1BIHA 3WL9B 2ATKA 3O3DB 4Q0XL 4DGIH 4YFLF 5DJYB 3LKPA 3EDKA 1JZ7A 3P0VL 2DWEA 4UOW0 2Y6SC 4QWWC 1A47A 5FGCB 1HXMB 2UV3A 4ZD3L 5FA3B 1OARL 1KGCE 5C0NC 4QXUH 4YDKH 3JWOC 4OCWH 1RHFA 3D85D 4XAKD 4U31A 5EU7C 2AI0H 2AV1B 1GGCL 2E27H 4KI5F 4XCEA 2EDTA 3GBNH 4ETYA 3N50A 4P2YA 4G9FB 1QACA 1IM9D 5IEKA 3MBEB 3SO3B 1MFBH 2VLJD 4Z0XA 3VCLA 4KROD 5ICXA 5IB5B 3T09A 2X42A 2BFVH 3ZKMC 3FO0L 2WMPA 2CR6A 1YEIH 3SO3C 5BW7C 2DQIL 5CBAA 1DQJB 3IU3B 1BF8A 3ZTNL 3K2MC 3FHQA 4XCYB 1I85C 5ID0A 3OBAA 5IV2A 4C83A 3BEWA 4LSUL 3TLRA 3IDJA 2CIIB 3H7BB 5DJ6A 1Q9OA 2F5BL 3Q1SH 1PAMA 4YHYB 5FB8B 3JZ7A 3U0PA 4Q6IB 5CCKL 4GKSA 3WHXB 1ZEAL 4DN3H 1NUFA 4H20H 3LN5A 3JTSA 1K8IA 4YHYC 4HG4K 2PKDA 4MNHB 4Q6IC 4XT1C 2HRPH 2PTUA 2YSSA 3EFFA 3N1FC 1AD9B 3F7RA 1T1WA 4PJHF 5IJKC 3OKEB 4MD5A 4MB3A 5AEAA 3RWHB 5SWQB 2B7DT 4LLMA 1A3LH 4MNQA 2KH2B 4ODHL 1ORSA 3QDMD 1DUYA 1PKQA 2WQRA 1N6UA 2IJ0C 3K8LA 4D9LL 3ZYOA 4MHHG 1MCQA 4KQ3H 3IXTA 5HHVH 5IB2A 5DUBA 1YQ2A 5I1EH 1BGXH 4E42A 1P9MC 2K9UA 3ARDB 5SV3A 1QPXA 3MUJA 3LRGA 1U8QA 1T1ZA 2ZUTA 4NHUA 3K80A 3G6JA 1QLRB 3DI2B 2IAND 3N1MC 4PJAA 4PJEE 1DP0A 1U58A 3P30H 3ARDC 3G5VA 4L8DB 2Q8AH 5DHVA 1F97A 5ISZE 3MODH 4K3JH 5E8DH 2BSTA 2Q7NA 4Z7VE 4XGZB 5GSVA 4ZFOA 3PIQB 5HYSA 1F45A 5MERB 3B5TA 4CVXB 1UH2A 1QRND 1YC7A 1VCAA 2EYRB 3NIDE 2HLAA 3GJFB 3FZUC 2WNGA 3OKMA 3VDBA 2QHLA 2FCBA 1IRAY 4LCCB 2XZCH 1FNGA 2R0WL 1MCBA 4O5LL 5J0BA 4OD2B 2Y1VA 3REVB 3BIAX 2J88H 1CT8A 2GCYB 3V6OA 2HAZA 4LCCC 1FCCA 2ICEA 1QPPA 3BIBX 3VI3E 4PRIE 2D0FA 1CDCA 1I3VA 1UWGH 3L7EA 5DMKA 5FO8A 2QSCL 5TE4L 2BVUA 4Y4KA 2P8PB 2XKSA 1N3NA 1KCRL 4GMTH 4QXGH 3VFSB 1UACL 2F19L 1WAAA 5C09D 4U33A 1NFDA 4OZ4A 3QG7L 1MY7A 2MPAL 3TO2A 4Q7DA 4PJCF 2P5ED 5IVOA 4NJAL 5HDBE 4YPJA 4J8RB 5I16A 2FX9H 4J1UA 4FN0A 4U3HA 1GC1H 4HAFA 4M62L 1S9WB 1A7OL 1AXTL 3WDIA 4PJFF 3EZJB 2R1YA 3MROA 2BY1A 1EERB 5MHSE 1ADQA 2XWBB 5IFHL 4O58L 1EFXA 1C5BL 4JKPL 2E7LA 4HJJH 5T5FH 4ESKA 5IW6A 4LKXB 4BZYA 3ALWA 2ICWA 3C5SB 4XPHH 3CU1A 5F6HI 1TZIB 1XGYL 3HRZA 4MCZB 1UZ8B 2J8HA 1U3YA 5IIEB 3VFUB 5IJVA 3RTQA 5C0AE 3BKYH 1N5YH 4AEIL 1V7NH 4LHUG 3FN0L 2FIKB 2RCSH 1M4KA 5FUZL 1MRFH 1IGJB 1QSFB 5E5MA 3FFCD 4AMKH 5E08L 1FHGA 5FK9B 3HNTL 3VXMB 3S5LG 5MEOB 1MRDL 4L8BB 1T21A 4Y4HA 1NBZB 2ZNXA 2ZUYA 3MGTB 3D39B 3O3AA 5DQDL 2DQEL 4CDGC 4WO4D 5C0DB 2EKSB 4PYHA 4DJMA 4WFGD 3DRTA 2H26B 4MD4B 1HQRB 3VFPA 5DS8A 5C0BD 2BDNH 4LGPB 4S1SH 2IQ9L 2JJSA 2VDLH 3E6HA 4G43A 4FOMA 5DC9B 1RZIB 3BPCA 5ICZA 2D3VA 5E2TL 4MXWH 3MQIA 4NQXB 4OCLC 2EE3A 5GRUH 1BREA 4QXTA 5CUSL 4KVNL 5FYKU 4X6DA 3LIZL 4HEPG 4RGNB 1JGLH 2HN7B 4P0DA 1YQVL 1YN6A 4O2CA 1J88A 1JPSH 4WUUE 5EBWB 4WW2F 2JB6B 1J0ZA 2OI9C 4XPBH 3GSXB 4NRYA 2EH7H 1NGYA 3OJDA 3QCUL 4R2GB 3V4UL 5FGSA 1MJUL 5I1LA 1M7XA 3ZDXE 2QKIA 1P6FA 4QRTA 4R2GC 3GI8H 1TPXB 3MRRB 2AXJA 4NNYB 2HLFC 1VB9A 1OWRM 2BNRA 4Y2OA 4TRPH 4XC3H 2X10A 4L4TA 1ZE3C 1TPXC 4ZODA 1JWUA 2BJMH 1QFWI 1S7VB 1KIPA 5IR1B 2L4OA 3QDGA 3IFPB 1MVUB 2CJUL 3LEVL 4YC2B 3ARBA 4LLWB 3GSVA 4ODUB 3UTTD 5GJSL 4X8XA 1M6OB 2X4NB 5L88L 4X9HA 1U8HA 1CBVL 4DGYH 3O2VL 5EU7E 5FGCE 2LV4A 3NACH 5LGJA 3RZCA 1LQSR 1HEZB 2F8XC 1MJ8L 3O6LH 3ZDXF 3CFKA 3DX8B 4NBYB 1FZMA 1JV5A 4KKAD 5EN2B 4LSDA 4KC3B 3BX7C 4G9FE 5I19H 1Z3GL 4FZ8H 4KRNA 1HHJA 4EBQH 4I2XE 5EUOA 4NO5A 1KNOA 4BFEA 3KPNB 2LU4A 3MA9L 4JVUA 5BS0D 3TO4A 3I6LE 5E8EA 3UBXB 1JMXA 1J1OH 3BE1H 4YAQA 3MRBB 4LRIA 4GRLA 3CMOL 1FFRA 1D3CA 4PGDB 3DGGB 3O8XA 3OZ9L 2P8MA 3CFBA 5E6IB 4OFPA 4RMVA 4ZOCA 3VFVB 3T0WA 4Y5YC 4LSQH 1QFOA 4PRPB 4M1DH 4X0KB 1FL5A 5E6IC 1ND0A 4H0HB 3OG6B 4MVBC 3TBVB 3OKNA 1IFHL 3O6FB 3REWB 5E8OB 4XX1G 4LEOA 3FN9A 1WT5C 1NUDA 2XFXB 2WINA 3TVMA 1JWMA 1CTOA 3O6FC 1HDMB 4H26B 1W72A 2EECA 1EHAA 3I9GH 4PJBB 3GSOB 4YDIH 4D0CA 2FZ3A 2YS4A 3BH9B 5C0FB 1JPST 2ERJB 1INDH 1HHHA 4OGYL 1EHXA 3WIHL 4JHWL 4JPKH 2X4SA 2AJZB 4HKBA 2ERJC 2BK8A 4H1LG 2XKNB 3QI9D 2D7MA 1YEFL 4M9PA 1FC1A 3NA9H 3VRJB 3C9NA 3CVIL 4M93C 1NGZA 3RGVC 3BGMA 1SVCP 5FYLL 2C7UB 3IJHB 3BZDA 5IGXH 3DXAA 4QF1A 5DUMH 4KZEL 1PYWB 3W0WA 4OKVA 1H9VA 4NUGH 2PYEB 3MRGB 4J2XA 4WY7L 3IKCB 4MNGE 5F88A 4BUGA 1TZGH 3IXAB 4F33B 3V6BR 5F89A 2UYLB 3A6CH 1T0MB 3AS2A 2YC1B 4TQEH 1S7UB 2XXCB 4I3SL 1FG2B 2Z91A 3KLHD 1NAMH 4IHOA 3V4VL 3WFDL 4RISL 2B8OT 1IAII 1QD0A 2X4OB 1A6WL 2DQDH 2PXYD 5LWYH 1KJ3L 1C12A 5EU4A 1YECH 1OT2A 4NM4L 3MLTA 5E1AA 5F8QC 5KVGL 1BD2B 3KYNB 5IMMA 1QFWH 1XGTA 5T3ZL 3FFDB 1K5NB 3S3JA 1CD1A 4E41B 5D7IA 4HH9A 1J11A 3IGAA 4WHYG 3LKRB 5HI4D 1EO8L 1HH6B 2I24N 2VXQH 4DWHA 5GGQH 5IB4A 3JUYA 2Z8WC 3H6JA 5E4EB 3Q3GB 5IFAL 3STLB 3VXUB 5IMKA 1J5OH 3KPOB 5GISH 3I3DA 4AT6B 3OSKA 3SKUD 1Q0XH 4KPHH 1FZOA 5LGHL 4OZIB 4LK4A 2L0DA 3T4YA 1W2KT 1ZHLB 4YHKL 5I8EA 3L9RB 2QQQA 2SEBA 2C3VA 2XN9D 2Q8BL 2DI8A 3PP3H 4KHTH 4F7EB 4JRXD 3VFWA 3D0VB 3SGJA 1BQHA 3UTZA 1U42A 2JELH 1QYGL 2JLLA 1LK2B 5IEHB 4YGAB 4ZNEE 4YR6B 3S37L 4U1GB 1CCZA 3GO1H 3M8OL 4G5ZH 2BVOB 4OLZL 3TIEB 5DYOB 5I76B 2XQBL 5CGYD 4HPYH 4MJ6A 2Z93A 4O4YL 4HUVA 4MJIB 4U1GC 4HHAB 1BJMA 4MWFB 4YHNA 1HHGA 4HKZA 4I0PD 3TBSB 5JXEA 3EYVB 5D7LB 1CLZH 2XKUA 2GK2A 2H2PD 4WFHE 3IDMB 5L8KB 4JM2C 1U2CA 4PGBA 1Q1JL 5IHLB 3HC0B 5TF0A 3P77B 5T1KB 4O2FA 4ODXB 1ZS8A 4LGRB 4F57L 4RMWA 1QSFE 2R39A 4HCRL 5DC4B 1KXVC 5H37H 4D0DB 3FO9B 4KJYA 3BH8B 3WDHA 1AR1C 3VXME 2XWJA 4UV4H 1FV1B 1NGQH 3CK0H 4WNQB 4YEFA 1RUAL 1FSKB 5FYLE 5JORB 2PUQT 4PJ5D 4GAJL 4Y19A 4Z7WB 1JGUL 2E9JA 1WC7B 3L5XH 1VKXA 2RFXA 1KIQA 1FSKC 2NY6D 3VXNA 1KACB 3EYQC 1A7PL 1KLUB 4XCCL 5IUSA 4XBGB 4OUOA 4KJQD 1C7TA 3P73B 4HIHB 4LBEB 4W81A 3MA7B 5D1ZB 3SE8L 3SE9L 4PRDB 2JIXA 4JRYE 4F9PA 4HMCA 4K7FA 3R8QA 3O45A 1YPZB 2H41A 5GS0C 5HHOB 3G08B 4OLWL 5D1ZC 4YHOL 1OAUH 1R5IB 4M1CC 1KG0B 2QEJA 3U4BL 3LV3A 4P2CG 5IB1B 1U8NA 2EDRA 5GQBA 1IAIH 1MFCL 4NBXB 1L7IH 4DEPB 3QFJD 3MRLB 4NQDD 4R90L 1RU9L 1MIEL 2VDOH 3K3QA 1JJUA 4DEPC 3CFDB 5FCUH 4Y0GA 4G6FB 2WK2A 1I9IH 3WNKA 4K2UH 2AEWA 1T22B 1WBXB 5ACZA 4FQXB 3CXDL 4KHXL 1DE4A 5GHWL 4WU7A 3WXWH 2NY5H 1EHLH 1H8SA 4S2SB 5IESL 4FQXC 4QOKA 1T1YA 2DAVA 3QUXA 4Y2DD 3UPRA 1VEMA 2ITCA 4BH7B 3V0VA 3RL2A 1CDJA 3NH7H 1ITBB 4CN6A 3AAZB 3MRJB 1N26A 4GKZB 4P23B 3ARFA 3HC3H 5F1KC 1GZPB 2V7HA 3FO1B 3CUPA 1H5BA 1EGJA 1XF3A 3WS3A 2Q76A 1N5AA 1JRHI 4K23L 4P23C 4I5BA 4X5WA 1AHWB 4GT7A 5C08A 1MHHB 2I60H 1CGVA 1UM5L 1R3HA 2C4FT 1L4IA 2XG4A 4I4WB 2BRQA 5J57B 5J12C 1H3XA 3FB5B 1AHWC 4A2LA 4WI2A 3ZYIA 3GSWA 4MS8D 4A2MA 2KL6A 4HSQA 1KOAA 4PRPE 5D6DC 4PPTA 3EIFA 2PW1B 4JFFA 4WW2C 1W0YT 1UXWB 1LNUA 2FHFA 4BKLA 3G6JF 1QBMH 1T7XA 3N1GC 2CKBH 1QSED 3I6KB 5CHNB 2ORBL 5SWSB 4XVUC 1F4AA 3FQRA 2G5BB 1DVFA 3TZVB 3FT3B 4Z95H 3RIAK 3DJ9A 4ZUTA 4WI4A 4AG4L 4LPCA 5GRJL 1B0RB 1NC2A 4BQBA 2A2QT 5IT2H 4PJBE 3DARA 5JW3L 3TZVC 2VDKL 3LY6A 2DYPA 3L3HA 3VGAB 5FYKD 2HJFA 3PP4L 4WWKB 1H3VA 2ATPA 2D7QA 3QEQD 4XP1L 4JN1L 4XPGH 4C4KT 1E4WH 2C3XA 3HR5B 2YBRB 3VGAC 4WWKC 5DEFA 5CINL 4N90D 3BIKA 2UWEB 1VACB 2AJ3B 5E5UB 1W0VB 2EO9A 1T66C 2Y36H 5EWIH 3CC5B 4RAVA 2CIKB 3BJ91 2NX5A 1AGCB 1N0XH 1XR9A 1DQQB 3GSRB 1WWWX 25C8H 2VIRA 5FGBC 3MRPA 4WW1A 4JR9L 4LHUB 2H6PB 1Y18A 4MLSA 3PWNA 5I0DA 1F6AA 5EPMA 1MRCH 3LHPL 5GRVK 1LP9F 5GS0L 4NC1C 1E28B 3DO7B 1QO3B 1F4WL 5A2FA 1NFDF 4XPAL 5EO9B 3UDWC 4RRPG 3S5LB 4GG6B 3RWJA 5KSAA 5C0CD 5SV4A 6CGTA 1ZSDA 3RVWC 4LPXA 3NCMA 5E99L 3T3MF 1S3KL 1T04B 3WUWG 3KPSD 3SKNB 4UU9B 3BP6A 3FCTB 3WE6A 3SJVD 5DFVC 4G6AD 1KPVA 4JFEB 1BD2E 3IAGC 4UT6L 4Q9RH 1BOYA 1QFPA 5GGTA 3MNZA 4E41E 1J0KA 3WNMA 3O2DH 1YJDL 3T3PE 1UYWL 4B7IA 4M48L 3T2PA 3VH8A 5CSGA 2HWZL 1OP3K 1N6QH 4I9WE 4LARH 4KUCD 2J6EH 1RULL 3KYOA 2ZP0T 1P5VA 5HGAA 2VDRH 3VXUE 3T1WA 1UM6L 2JK5A 1A1OA 3D18B 3BP7A 4PB9H 1GCFA 4OZIE 3HE6D 1FDLL 5EU6A 5DURD 3WFEH 5DMGC 1SQ2N 1U92B 4U1HA 2Z4QA 5TH2B 3WKML 3B9KA 2AERT 1IL1B 1Z2KA 4UIMB 5IF0B 3C5JA 1V5JA 2I9LA 4NYLB 4X7TA 5ADOL 4GW4A 1UB5B 4LSSL 5EUKA 1OD7A 3GMNB 3B43A 4JPVH 4X83A 1AO7D 1TFHA 4F2MA 1TCRB 5JZ7D 4Z7UB 5HY9B 4X6DF 2W92A 4MJIE 4FP8L 1JN6A 5JW4Q 3LMJL 3L6FB 5AD0B 5D7LE 5F7EL 3P9MA 5IQ9B 4JHBA 4R9HA 3BSZL 5L2KD 1S5IH 1NMAL 2V2WB 4HZLB 3NFSL 1R3KB 1A9BB 2Z31A 4XZUA 4NQSB 4KVCL 2OSLB 4JO3L 1K3ZA 1F13A 1D5BB 3BN3B 4TUKH 2FHBA 4NUJA 5JOPE 3KYKL 4S1DC 2I25N 2V9TA 2EZ0C 1RZGA 2FWOA 1YDPB 3NVQA 4Z7WE 5FKAA 3RNKB 1SYSB 4ZFFB 2XI9A 4N0FB 2CO7B 4DCQB 3VW3L 1XZ0A 3PQYA 1OGTA 4PJDA 1CU4H 2VITB 2HFTA 2RHEA 1EPFA 2BC4B 5KSVB 3O3BA 3WNOA 3RVTC 2EDXA 4JPIB 4PJCE 1GRWA 2P48B 4ELMB 4LVNB 4K8RC 4XVTL 4U1KA 1MCKA 4NQUA 1KB5L 4ODVH 4X99A 5DZNA 5HHOE 3Q2CA 3U30B 4KKCD 4LVNC 3UAJD 1NL0H 2CDEA 3OTTA 4IOFD 3RKDD 2L7UA 5JO5A 5EUOF 2NR6C 4JM4H 4A6YL 3U30C 4ERSH 3RPKA 1U2HA 4H1LB 4LVEA 3CZFB 4YBQD 5FYKH 4MD0B 4NZTH 5A2KH 5F21B 1BQUA 4YHML 1T0NA 2XZAL 3TBTB 2R2HA 3EYOB 3AM8A 1U8MA 3V5HB 1ZGLM 1RJLA 4NDMB 3X11A 2XNAB 3ESVF 3LRSA 4JHAH 1QTYT 2NXYB 3O6KH 3SGEI 2W38A 4U05A 2VAAA 4YQXH 5B8CB 4S1RH 4X5LA 3RWDA 5KN5A 4P5TA 2IFFH 2DLFH 2AQ2A 4GG8A 2IH1B 5J6HA 3VWKA 5JIHA 1CXLA 2AEPL 1JPGA 5GIRB 4IRSA 2M2DA 2VZTA 5CEYA 2BNQA 1X4YA 3VD3A 4U6HA 1D5XA 2JCCB 2E6JA 3MJ9A 5DXWA 1X5FA 1L7TL 3MRIB 4P48A 4U1JB 5I8CA 3BZEB 3FQWB 4WHTB 3MPCA 3TNMB 3VDAA 1TXKA 1G7MA 4NWTL 4YH6A 3P9WB 2CXKA 1J1XH 1SMOA 1RZ8A 4ZUVA 2WV3A 2XA8H 4BZ2H 1U95B 2M26A 4C56E 1KJVA 3KHQA 2HT2C 3IAPA 4LMQE 1OD9A 3BHBB 3OPZL 4HBCL 1R3LB 3FRPA 5IW3A 3UX9B 1ZHNA 3JV5A 5GS1B 1T83A 2VNCA 5F7KC 1X9QA 1KGCD 1ZXQA 4M7LL 1S8DB 3SOBL 5GS1C 1I7TA 5GGUB 5ENWA 3VXTB 3WS6A 3MRNA 5GGSB 1ZGLP 1YEDA 5JR1L 4LLYA 3V9FA 4P2QD 3KJ6L 1Z6JT 4F58H 2IALB 3MV7B 4Y16A 2AK4E 3OX8A 5ETUB 3HZMB 4OTXH 5IHBA 1UC6A 1QFWM 1KCVL 4DK6A 2LABA 3DUUA 3QO1B 4LASL 1U6AH 4MQXC 3AB0B 5F7WC 3GSUB 1BJ1J 4LOUD 5HTSA 5IVXB 5D7IF 1U8KB 2UWEE 4YHPB 4KY1L 5E7BA 3MJ8A 3U4EB 3AB0C 1D9KB 4TSBL 1VPOH 2E8ZA 4PRAA 3B9DA 3CDGA 4D9QE 4YEEA 2ZJSH 3VXSA 4HK0B 4HX1B 3RKPA 1LO0H 3RVVC 4NC1E 2WBKA 1EEQA 4ODTL 1YNKH 1FGVH 1W0WB 2X1QA 2YA1A 3QFDB 1T6VN 2FD6H 5HYJB 1JNLL 4G6KH 4ZSOA 2ADFL 1CFNA 2EDYA 1F11A 1OAXH 4NRZA 3LZFH 3UTSA 4GG6E 2A73B 2R2EA 3ZT5A 5HYQB 3QQ3A 2Q86B 3SDDB 1MSPA 4XBEL 1CVSC 3S8WA 1VESA 1TNNA 2HP4A 5CD5D 1I7UB 4GAFB 3SDDC 3VU2A 4MAYB 3RVUD 4JFEE 1EUUA 1LE5A 4NSKB 1RIUL 1Y0LA 1SY6A 5ITBH 2IPUK 1MCPL 4MAYC 3ZHKA 2CKNA 1YEEH 3I02A 1VGKB 1OAKH 1R3JA 3MXWH 4Y5XA 3SGEH 1EZVY 4HIEB 4OZGA 3B9VA 3D1MC 2FX7H 5IVNA 3GM8A 1ZK9A 3KGRA 3EHBD 5KS9A 5C70A 1SEBA 1DN0A 2VDMH 4LAQH 4OLXL 4LGSB 1YMMA 2AKRA 5DFTA 3BKJL 4M61A 3PL6A 4H88H 5BCAA 3IVKB 3QPQC 1C5DB 3DURA 3MO1B 1IZKA 4JFDB 5FM8A 5BXFB 3EDEA 5BZWA 4LLVA 4Z0BH 1KTDA 4M6NH 1MFNA 4JE4B 1MCEA 3UC0L 5D70H 4BSWA 2GTWB 4TNWK 4BFIB 1DBKL 3IFOA 2KKQA 2YZ8A 3QDAA 4P9HH 4S10A 2GSIB 3NFPA 2F5AH 4JZJB 3HAEA 3C60C 2FLRT 1SYVA 3TEUA 4XNZB 4L9DA 2V9QA 1CVRA 1E4KA 1PLGL 3TBWB 3BZFB 1MI5B 4BQCA 5GGVH 3NZ8B 5D9SA 4PGEB 1KCSH 2PETA 1V3MA 4U1LB 4XNZC 4ZS7L 4Z7UE 4OFYD 4MXVF 1YNLH 4OV5B 1NMCB 3ARED 1OM3L 1RZJC 3X3GL 2P7TA 2H8PB 4MSWB 5JA8B 1NMCC 1J8HD 4Y1AB 2NTFA 4OQTH 3RY4A 3TYFA 1KELH 5DD6A 3RWFB 2P45B 2VE6B 1IAIM 3NIGF 5FIEA 1RUKH 4PTTB 1P7QA 1JUFA 5BO1H 2EDQA 1AKJD 4P2RB 1OHQA 1L9MA 3F5WA 1T7WA 2JKXA 1SJXA 1FFNB 3KR3L 1R5VB 5MEPB 1BZ9A 1SJVA 3NPSC 4FTVD 2FATL 4M7KH 5ALBL 1TZHB 3T2NH 4TVPL 3WEXB 4OUUB 5IB3B 2VLRA 4LIQE 3VFOB 1B4JH 5MHSD 1I8KB 5D7SH 1ZV5A 1A6ZA 2CR3A 2O93L 5DQ9A 1P4BL 4YXLH 2I07A 3HPLA 2R23A 4CADB 5I1GH 3HLAA 1AJ7L 1KXTB 2AJVL 2QLVB 4FQPA 4XX1E 5HGHA 4R96A 3CCHA 3RNQA 3SPVB 2Y9RT 3KPRB 3QDJA 5I9QB 4I0CC 4JY6B 5AAMA 5F1IB 3GIZL 4ELME 2P5WA 2YD5A 5FOJA 2NW3A 4Y88A 5BV7H 2Q6WB 5C0AD 3QO0A 4M5YH 1ODAA 1IQDA 3ULVD 5I9QC 3QUKB 3PHQA 4PJGA 3LEXA 3QRGH 4RIRB 3V5DB 5FDWB 3PGCB 4IRJA 1LDSA 1F4XL 2AJXL 3C08L 1BX2A 5K93A 3H3PH 3T0VA 1FVEB 5AYUL 3DYMA 4K3GA 4OT1H 3IFNL 5BJTB 4XP5L 4MZ2A 5CZXC 5K9OA 2FB4H 1MNUL 2R0ZL 3LB6D 4NO0A 2X9XA 4WTZA 1QR1B 3MRFB 1VA9A 3WFZA 4J6RL 4GQ9H 4PY7B 3PF2A 4OCRL 4PJIB 5ESAA 3FT4A 1N4XL 4DKEL 2FEEL 4AEHH 1D5MA 3U9PL 1FIGH 3C6LA 3BZ4B 3VD7A 3L3GA 1T89C 5EZIH 2HFFA 3U0TA 5ID1A 2X41A 5HI5D 2E9WA 4X4YB 5BOPA 2YK1H 3ARVA 1KC5L 4LHJB 3FRUB 2CUMA 1OGAE 2V2XA 3EFDL 2PR4H 4Q6YA 2VKXA 1GVIA 4NKQB 4HK3N 4PLKC 4DKFH 2JCCE 1MH5B 2KZ1B 5D93B 1KN2L 3O4LA 4Y5VA 4YGVA 1BQLL 2QADC 5EBMA 1L6ZA 5BRZA 4U49A 4RQQA 1Q8MA 5D93C 5CJQL 4MQTB 3CU7A 1U93B 3B9AA 3RGHA 1LO2H 5I66A 2G75B 3OHXA 3QH3B 4HH8A 3MGOA 1SVZA 1UKSA 3HG1A 5C0ND 2CH8A 5D1QA 1XIWB 5J3HC 2J8UA 4JDTH 1RZJL 1A4JA 2KDGA 1AXSB 4WEBH 1OPGH 3BD3A 3O3UN 5F3HA 1LEIB 3EO1B 1MHCB 1VADB 1XIWC 3L7FA 5IW1B 5TQ0L 4ZS6C 2BSRA 2AW2A 1DSFL 1TJGL 1M05A 5DRWB 3A6BH 3OKLA 5CLWA 1ZA3B 3JVGA 3FOMB 4G9FD 3RVXC 4NN6B 3MBED 1LO4H 4DTGH 2DQHH 3MV7E 5DJ2B 4PBWD 4NN6C 4FQ2H 4IIQB 5FO9B 2WQ8A 1EMTL 2WM0A 5DUPL 5FF6B 4XXDA 1A6PA 2X4QA 3ZSSA 4OI8A 43C9A 5EBGA 1HSBA 5L7XL 4QCIB 4G9DA 1YY8A 5IVXE 3C6SB 1Q9WA 2R4RH 2VDQL 4IIQC 1HE7A 3NGBC 2WSKA 4RDQG 4XNQA 1NGXA 1FFQA 1I7RA 3OKOB 2Y07L 3U1SH 8FABA 3CLEL 3TWCH 1JF1A 1WZ1L 4UV7L 5JNYB 3DSNA 2HTKC 5KSUB 3MRCB 5I73B 2ZKHL 3UYPA 3DX6B 3N0PB 4NPYA 5CBEB 4ONGL 5CSZB 1PQZA 2NZIA 5I73C 5HYJE 3VXRE 4E5XB 1UFUA 1A7NH 4ZAKA 4MAUH 1MHPH 3PDDA 1KCKA 2FJFA 1NCAH 5EH1A 3QXDA 1KT2A 1DCLA 1Q0YH 3VG0H 4DGIL 3HE7A 2ZOKB 2XRAL 4IOIB 1PG7H 3CFEA 1IAKB 1JNHB 5CMAA 5F3BA 3HS0B 2NY0B 4HGKC 3OR6A 3O3EB 4QXUL 2BP3A 3RWCB 2GITB 5J56B 4HDIB 3QIUA 2NY0C 4QRPA 2D03L 2AGJH 2E27L 1MCWM 3WV0A 3GBNL 4QT5B 4BSVB 3VWJA 2VH5H 3BXNA 4AL8H 1MFBL 3ULVH 4CUCA 2BY0A 4JFDE 5E56A 5L2JB 1GC1C 1CGTA 4I8DA 1YEIL 3T0AA 1FN4B 2LAGB 1DBBH 4LLQB 1KN4H 4ONOA 1JVKA 4G6JL 3U6RB 1AGFB 1NGPH 4LP4A 2A6DA 4ZXBA 4RX4D 2GJZB 5A16B 3RAJL 4MA1B 5F44A 3TBYB 1P1ZB 1PG7X 3GRWH 3T77A 2AXFB 4LFHD 3Q1SL 1MI5E 4LP5A 4XVJH 1G1CA 4ZFGH 2YPVH 3QUYB 1BFVH 4MA1C 1RFDH 3ROLB 4QHNA 3ARWA 4PP1C 4HS3A 1YN7A 4H20L 3E6FB 5HSFA 3B6SB 2JB5H 3BW9B 32C2B 3LN9A 4WFFE 1A4KB 3QUYC 3MLWH 2R9HD 4M8QA 4WI6A 4N9GB 3MACH 4D3CH 1I3GH 2XA3A 3ZE1E 5TGBB 4Y7MA 4Y1AE 3K4DA 4NZJA 4XAWH 1YY9D 4Z6AT 2LU7A 3SDXB 4KROC 5CSBA 2F53B 4P2RE 4WGVB 3RZWA 5MP6L 5DZLA 3D69B 4OGAD 2C3GA 1FO0A 4WDIA 4KQ3L 5HHVL 2XQYK 3PQYD 1I1AB 4N1EA 4K7PY 3EYUH 5I1EL 4KGJA 1I9RL 4PV9B 2A77H 3AU1A 1RZ7L 1I1AC 3ILPA 2X70B 4NCDA 3KNBB 1ZLWH 1TTFA 1DDHA 1NEZA 4NZRH 1N7MH 3O9WA 5BZDA 2VJXA 3JWOH 1NEUA 3MODL 4K3JL 3GMPB 4X5XB 3KPRE 5DWUH 4FFVD 1JYVA 3KLDA 3FL7A 4W4OA 4X4MA 4OIIH 2XIDA 3D25B 3NZHL 3UYOD 4XP9H 2DJUA 5INDA 4GRWH 4IM8A 2H1PH 2DMKA 3T0EB 3M45A 1BBJA 5H8DA 1M71A 1VGEH 4X8JB 3GM0A 2P4AB 1QSFD 4OLVH 1XF2B 4PUBL 4PJXB 4K3DL 3B5HA 2MMXA 5KZCB 5IFJA 3VXMD 3H9SD 3ARGD 1A1NA 3ZKXC 1XF4A 3D39D 5F97E 1OAZH 2XZCL 1YNTB 4NCC1 4PB0H 2GFBA 3IDGA 3M1BB 5DD1H 4AK1A 4U6VH 3OXSA 3OJVC 1NCUA 4KXZH 4EIZC 4ZUWA 4PJIE 1IT9H 1LEKA 3SHSA 5DJDB 4U1NB 4FFWD 1ULVA 1UWGL 4UNTA 3G6DH 3PDGA 1DEEA 2BNQD 4QXGL 3HC4H 1RZFH 4RGND 1OTTC 5I8KH 3BO8B 4RFEA 4TUOA 5GRVL 4OLEA 1BAFH 2V2TA 2EXWC 2FSEB 4OB5L 2FX9L 1BLNB 3L1OH 3MYZA 4R2GD 2GT9B 5ISZA 3VFMB 2ZSWA 4AQOA 5ESVA 5I18L 1GC1L 4PG9B 4P4KB 2HLFD 1MJJB 5ANMA 3T0BA 2HTLD 5HGGS 2B5IB 4ZPVB 4AENB 4CBPA 2CLVA 2GJ6B 4GUPA 5GGTH 4WV1C 5ALCH 1ZGLB 3GSQA 3RQ3A 2I9TA 3FAWA 3IFLL 1T6WA 4HS8H 4HJJL 5T5FL 3U2SA 2B5IC 3P9LA 1EEZB 2D31A 3C8DA 4K71B 4H5SA 3WDJA 4CDHA 4HAGA 1A3RH 2NCMA 5EOTB 1LILA 4XPHL 1E27A 4S0SD 4HGWA 4K71C 5TDNB 2GY5A 3BKYL 5C09B 1ZLVH 4F7TA 1S7WB 1P2CB 3JV6B 5TDPB 3SGKA 5E2UL 1V7NL 3FQXB 2P5EB 2RCSL 1B6DA 4PRIA 3GMLA 1MRFL 5EULV 3F6IA 1CYGA 3HI6H 1G7PA 1TVDA 2GSGA 4QRSB 4IOSD 4MQ7B 1H8NA 3TNNB 2CMRL 4YBHA 4U1IB 5ICYB 1DFBH 2K3TA 2EC8A 1UQSA 4NQVA 1GIGH 3P4NA 4JFOA 1M7IB 1TLKA 4KAQH 3V4PH 1WWCA 2BDNL 1KULA 4RMRA 2VDLL 5DT1H 3WFCL 3CH1B 3E8UH 3VXSD 4GJTB 5HPMA 2W9DH 1S7SB 1XGRA 2KUTA 4WFEE 3KPQA 5GRUL 4AM0A 3Q5YA 3KLSA 1I9JL 1U91B 1IE5A 4P5MA 5E6ID 2P24B 3V95A 1NUGA 4UQ3A 4MVBD 4HUUA 1JGLL 2QHRH 5HYSG 5JW5A 1JPSL 2V17H 1NAMB 1PJ9A 1WV7T 3FFCB 5KSBA 2VLKB 2EH7L 4B0MM 2K7PA 3O6FD 3R06B 1J05B 5KJRH 4XC1H 2ZCKH 3FQUB 4OF0A 3OKKB 4DOHB 4POUB 4JAMB 3IDXH 4JO2H 3IDUA 3CPLA 3CGTA 4TSCL 5EOCJ 5T5NF 1RJZA 3GI8L 5DVKA 5TQ2L 3TH4T 4X6CA 1KJ2H 2X9WA 4ZO7A 3MV8E 4TRPL 5K59F 4WO4C 3AMKA 4CW1B 5IOPA 1LEGA 1OF2B 1RHHB 2HJLA 3LKQB 2WIIB 2NW2B 2BERA 2BJML 1TQCB 4IRZL 4G8GB 1S7XB 3TH3T 3IF1B 1QBAA 1JGDA 1NC4A 1TQCC 1ED3B 2XICA 1X5JA 2GAZA 4IS6A 4ENED 1TIUA 1P4LB 2C5DC 5LCVH 4QTIH 2P44B 5FV1L 2ED8A 3NACL 1RIVH 1REIA 1EAPB 4YWGL 4OJFH 2PYED 5IMOA 3QB7C 1UA6H 4U1MA 2I26N 4I3GA 4XMKH 1HQ4A 4K07A 2Q3ZA 1L6XA 5I19L 2WWMC 1YEKH 5DJZB 4JDZB 4QY8B 4EBQL 1BVKA 4WUUA 2IQAA 3QG6A 4N5ED 3PWUA 4V1DB 3SE4A 3KYMA 1J1OL 3IJSA 3BE1L 4JGJA 4WJ5A 1FLRH 4RSVA 5M95B 3P11H 4P3DA 1X5AA 3QIWB 1ZHKB 2YRZA 4DQOL 1ZT1A 2X05A 2EIDA 4EVNB 2AXGB 4F7PA 4XWOC 1CG9B 4M1DL 3QIWC 1HHIA 5D7KE 2GI7A 2VKWA 5GPRA 4LNRA 1RJCA 4XAKE 3TYGH 5SWZB 1CDBA 3GFUA 3NCEB 1BJ1H 4APQA 2PCPA 4N0YH 4NNXA 4FQIH 1JP5A 3BPNB 4I9WD 5DJYA 1R24B 1WCBA 1A6TA 1I8MB 1C5CL 4HF5H 3BN9D 3MJ9H 1NSNH 2WWKT 3CSGA 3I9GL 3ARQA 5FA3A 4YDIL 3WNPA 4ACPA 1G0YR 1XCTA 1INDL 4JKLA 3X3FH 3BWAA 1XGQB 2N7BA 1G6RA 3SDXE 5JPNA 4P57A 3TP4A 3DV6B 1FZKB 1XGPB 3EO9H 3HPJA 3KWWB 3IU4H 4I2XA 3NA9L 4HKJA 3PABB 5SX4I 1UEMA 3GSNH 3I75A 1AGBB 2MHAB 4OAWB 3DYPA 2B4CH 5IGXL 5DUML 1OTUC 1HYRC 4MA7L 3MZTA 4UNUA 3KVQA 3E2HB 1DQJA 4YPGA 1GGIL 5EO0A 4R4FH 1B3JA 2E7BA 4RNRB 1KPRB 3TH2T 5C0IA 1P84J 2AEIT 3W5NA 1OAQL 1V8HA 4MJID 3E2HC 2WBJD 3JBG7 3SDCA 1DJSA 3RU8L 4DZBA 4TQEL 4KUCF 3RX7A 2FEDC 4OZHA 1RY7B 2F58H 5K9QI 4Q6IA 1UJ3A 4ZYKB 3F7VB 3PWPD 4R3SB 3WHXA 3U82B 2C1OB 5FYJU 1H8OA 5IBTH 5T33L 1AR1D 1NKRA 5LWYL 4GRMB 1NBYB 3LKSA 1YECL 2R29H 2R1WB 3QI9B 4QHLB 2ZUWA 1UZ6E 2BY3A 2F54A 4EDXA 4UQ2A 4PJXE 5GZND 2ZG3A 3BQUA 3LAFA 1QFWL 3MRHA 3QI9C 4KMTL 2YA0A 4W70A 1IGMH 1QEWA 4DK3A 5JOPD 1OSPH 1RIHH 4YFDB 5INCB 1FNEB 3IDNA 4L3CA 2X89A 2IANE 4NO3A 3T1FB 4C59B 2GTZA 2VXQL 3PWVA 5GGQL 2NY5C 1T4KA 3P4MB 1Z9SA 4PJ8A 3KXFB 5TF1H 5EZJB 1QVOB 1N59B 5IP4A 5GISL 1LVEA 5C8JB 2VQ1A 1AY1L 3ARDA 3TN0B 4KPHL 1WCQA 1QBLL 1QRNE 3VXQA 4QTHB 2PXYB 4MNGA 3KLHC 2BSSB 3TN0C 4AZ8A 4BH8A 4O02H 4JO1H 3R8BB 2PXYC 3TT3H 1RZKH 4PGZA 1CGSL 2JELL 4LVOB 4XGZA 1SY6H 3FB8A 2GJ6E 4L3ED 3ZDYE 3PIQA 3QNXA 3SDAB 4X9IA 3CX5K 2RB8A 3VE0B 2EYRA 3ZE0F 3GJFA 4LVOC 4G5ZL 2CKBB 4HPYL 4WCYH 4P2OA 2O61B 4ALAH 3H42H 4G6FD 5HI4C 5IK3A 3RL1A 3UPCA 4R26L 1P69B 3PGDB 1CLZL 1UWXK 1D6VH 5DFWH 5B21A 3RDTD 5AUMB 5C09E 1INEL 2EICA 3QEHB 5T1LB 2P5EE 1JE6A 1MFAL 3MUGA 1Q72L 1ZHBA 1ACYH 1O5DT 3QJHB 4JFQB 4UV4L 2P8PA 5D1XA 1NGQL 3CK0L 3HAEH 5DRXA 4UUJB 3B3IB 4MQSB 2HH0H 1T7VA 5EU5B 2CDGB 4D0BB 1RVFH 3P4OA 1JZ5A 4U2YA 1CFSB 5LG1A 4R4NC 5EOQH 2H3NA 3G5XA 4R7DB 2NY3B 2JJUA 4I0PB 4JN2A 4RMSA 4KGLA 1NKOA 2EYTB 1H0DA 2EDWA 4GKNA 2IMMA 2VR9A 1FVDA 2NY3C 2ILLA 4I0PC 4ZNEA 5E24E 1BFOA 4YIQB 4UILH 3C5ZA 1V7MH 4HUXB 4LKXA 3K74B 4LKCA 1FRGL 4YBLB 4G6MH 3G5ZB 5EZLA 3FFCE 5HGDB 2VLKE 5D7JD 3C5SA 1LD9A 1A6AA 1UXSB 2D7NA 4V2CB 1UZ8A 4DOHE 4YBLC 5SWSD 2DWDB 3MV11 3TZVD 1L7IL 1SJHA 1TVHB 5D5MB 3H0TA 4N68A 3E0GA 2A9NH 2VDOL 4U3CA 1XFPA 2E9IA 5C0BE 3WIHA 5TE7H 3D9AH 4GBXA 2XYCA 1MF2H 4WWKD 5FCUL 5FK9A 1Z5LA 5F7LB 4G8GE 1PEZA 4CVUA 1CK0H 4GOSA 3LCYA 1NBZA 3O11A 3MGTA 1T66D 4LCIL 3V8CA 4GXUN 2NY6C 4L8SB 5HPOA 2EE9A 3QWOA 2H26A 1N64H 1HQRA 1A9EB 2NY5L 4H8WL 3WXWL 4YNYA 4L8SC 4LHQB 4UDTB 4D9QD 2BCKB 1TETL 5K9JH 2DM4A 2BVQA 2ATKB 1BQHG 1WGOA 4K9EL 2F9BT 3UZEA 2EYSA 3BP5A 4I77H 2FBOJ 2YPLA 3MREA 2C26A 2HN7A 3LKPB 4JFXA 4JRYA 1FYHB 4ZXBD 3RVWD 3GSXA 1AGEA 1AFVH 3GI9L 4MMZC 1A7QL 5DFVD 2I60L 5KVDH 1DLFH 4K3EL 3ULUD 4IDLA 3EKCA 5HHXL 1JNNH 1MFDH 5B38A 3BDYH 4PBXA 1EAJA 2VZOA 4XCEB 5BQ7B 5IVZB 3MRRA 4EOWH 1G0DA 4LSTH 4JFED 4NNYA 4CMMB 5DA0B 3D2UA 1ZVSA 2KPNA 3TV3H 5IEKB 4Z0XB 3VCLB 5ICXB 4KRPB 5GGRB 2BHUA 1LK3L 1QBML 4DVBA 5SWZE 5IR1A 4YLQT 5I1JH 1T2XA 5CBAB 5DRZA 1MVUA 4KRPC 4Z95L 1M6OA 2ADGA 4HC1H 5TPWH 2FLBT 5ID0B 4PJ7B 5IV2B 4C83B 5IT2L 1MIMH 1QBBA 3IDJB 5DJ6B 5ADPH 1PX3A 5HJ3A 4JZOA 1Q9OB 3LS4L 4NM8L 2D7PA 3U0PB 4XPGL 2I5YH 2PF6A 1JBJA 3LQAH 5EN2A 3JTSB 1OP9A 4TN9A 1K8IB 3B4NA 1R5WA 2UVEA 2DQTH 1U3HA 2DBJA 2YSSB 5FCSH 3EFFB 2Y36L 4K7PH 4HJGB 3RJDA 5LXGH 1KIUA 1T1WB 4WI3A 3VFGL 1N0XL 5JA9A 4Y5YA 4M6AA 3J7HA 4MD5B 25C8L 4ZPTB 4YXKH 1F2XK 4LLMB 2Z0BA 2DQUH 1DANU 3VFVA 1DUYB 2YKLH 4O51A 1PKQB 2Y7QB 2UY7A 5DMJB 4PRPA 1ES0A 4X0KA 3QZWA 3IXTB 5IB2B 1WT5A 5DUBB 3QXVA 4P59L 1BOGA 4PJEF 4E42B 4YUEL 5M94B 3FO2A 3MMEB 4HCRA 4Z7VF 4NHUB 3MJ6A 2PW2A 1JMZA 3G6JB 4HIXL 1CD0A 5E2VL 4MB4A 3A0OA 4PJAB 4GW1B 4PP2A 3G5VB 1G7HA 4I13B 3BEVA 5DHVB 4FXGA 3PGFH 4Q9RL 3NIDF 3BAEH 4LPUA 2BSTB 5JUEH 1K4CA 4JQIH 1FAIL 1IM3A 4ODSH 3O2DL 4ZFOB 1ZLVK 3EDFA 3RGVA 5E94A 2HLAB 2O5YL 4PRHD 2J6EL 3RVTD 4PGJA 5ACLA 3OKMB 2VDRL 3KXFE 4R0LA 4K8RD 2OK0H 5I1HL 3VI3F 4PREA 1FNGB 4PB9L 4P5KA 4FABH 3WFEL 4P46A 2NR6D 1CICD 1CT8B 3JWNC 2ICEB 4FFYH 4UOW1 3DVGA 3GJFK 5DMKB 5FO8B 5I74B 2RJMA 3V6OC 4B41A 3LS5L 5DZOA 5HDBF 1DQTA 4OD1H 4HUNB 1N3NB 5JW4R 4JPVL 2PNDA 4GAGL 3CVHL 5I74C 5AAWA 2DM7A 4OZ4B 3TO2B 3D3VD 1LE9A 1CXKA 1BD2A 4XI5C 2VZ1A 4OCSH 5F9WB 5I16B 4KK8D 4J1UB 1K6QL 1OY3B 4ISVB 3FFDA 5FGRA 4E41A 2NXYD 5F9WC 1S5IL 1U8IB 2R1YB 3MROB 2WIMA 5DURB 1EFXB 1G7IA 1HH6A 3LPFA 3MLYH 2EE6A 4PJHA 4OF8A 4X80H 2R0KH 3Q3GA 1MPAH 5DQJA 2NY7H 3VXUA 3KPOA 4P4RA 1FZJB 3HRZB 4J3SA 4TUKL 4BYHA 3STZA 3OAUH 3FTGA 3QNZA 5IJVB 3RTQB 4FZEH 4OZIA 3OB8A 1JHTA 1TJHH 3SKOA 3ULUH 1F2QA 3RTQC 1NDGA 4F7EA 4FA8A 3PHOA 5E5MB 5FYJD 1BMGA 2EDOA 1CU4L 2HT2D 5DR5H 3UXFA 1LK2A 5JZ7C 4KZDH 1CGUA 4AEEA 4Y4HB 4HJ0D 4PFEA 2OZ4H 3RWIA 4DAGH 1WFUA 2AJYH 3DRTB 3TIEA 4ODVL 1XR8A 1ZKAA 1HI6A 3VFPB 1AD0A 4HHAA 4JJ5A 4JM2A 3I6GA 4MWFA 3E6HB 1NL0L 1KENL 1X7QB 4G43B 5D7LA 3BPCB 4QXWA 5ICZB 1MY5A 2P1YA 4QXTB 5D5ME 5FYKL 4Z18A 4NZTL 2YA2A 5E9DD 2EDFA 4EN3D 2AK1H 4HUKB 3T2OA 1RUMH 5T1KA 3UTQA 1YN6B 4O2CB 4FNLL 1GGTA 4JANA 4ODXA 3VH8G 2Q7YA 3NTCH 4MQXD 1CD8A 5C0JA 4OFDA 1PX4A 4YHZH 4NRYB 3X13A 4S1QH 4M4PA 3H3KA 3OJDB 1NGYB 1H3PL 2ZG1A 2V9RA 4KMQA 4EQ2A 5EB9A 5I1LB 4JHAL 1R3IH 4N8PA 1UG9A 2VXTH 1IGYB 1T5WA 2QKIB 3O6KL 3ZE2E 2A83A 5CIPA 4YQXL 3MRKA 1D9KD 3RVVD 4ZFOL 2BNRB 4X7EC 2IFFL 2DLFL 3IDYC 4L4TB 1JWUB 5D2NA 1KLUA 4LVHB 1I1YA 1UCBH 4PJCA 3QDGB 3UAJC 3SKJH 4IOFC 2VL5B 4LBEA 3ARBB 5D1ZA 4NQDE 3GSVB 4MGXA 3RKDC 4D94A 4ZTPH 5HHOA 1U8HB 4Z76A 4NFDA 1MFEH 3B2UD 4BQ9A 4P9HC 3ARBC 3LKOA 5LGJB 4UZGA 5KW9H 5F6HJ 5MEQA 3DECA 3L3OB 3CFKB 4WEUD 2ARJA 1J1XL 1A2YA 1E6JH 1WEJH 2OTWA 5B3NA 4BZ2L 4MAYD 3ET9F 3OAZK 2XT1B 1HKFA 1HHJB 1NLDH 5EUOB 3MRMA 2GIYA 5T3XD 4NO5B 4OCXL 1KNOB 5KVEH 3S88L 3TO4B 5E8EB 2V5TA 4TTDD 3TIDB 1OSZA 4XNUH 3MOQA 4YAQB 4MA3B 2OL3H 4GRLB 5EFIA 4FQXA 3O8XB 2P8MB 3CFBB 4Y4FA 4NJ9H 2PTTA 1FBIH 4FXKA 4PJ7E 2HG5A 2WP3O 4LSVH 4GRLC 1NBVH 2XPGB 2X7LA 4F58L 1FL5B 3O8XC 2OS7A 1A8JH 5CZKA 4JFDD 2ARWA 1XGUA 3OKNB 2ZSVB 4QRUA 1WSST 3MRJA 4LEOB 1U6AL 3CFCH 4Q0XH 3QULA 4P23A 5EOCH 4GMSL 2WINB 3ALXA 4OM1H 5DK2B 1JWMB 1SBSH 3P0VH 3U7YH 1W72B 3AFLA 3TA3A 1B88A 4ZD3H 1HN1A 3HCVA 4D0CB 2VXVH 1AHWA 3DROA 5BV7B 2IADA 3LKNA 1HHHB 1MI5D 1QSEE 2ZJSL 5D6DA 2NNAA 2X4SB 1GGCH 4WW2A 1NCBL 3GEWB 5BV7C 1YNKL 1FVCB 3ZHLA 4C56A 3NCBB 1PKQE 2EXYC 2ESVA 4ZFZA 4WFFD 4UINH 2DLGA 3C9NB 1OAXL 5FYKE 3BGMB 3FO0H 3UJIL 3DXAB 3CXHJ 4QF1B 2DLIA 5T1DH 1TQBB 3W0WB 4OKVB 4XPFH 5CHNA 3FHAA 2G5BA 3EDDA 3ZTNH 3FT3A 3ZL4L 4P2RD 5DEGA 3TJHD 5F88B 1TQBC 4PJ9A 5DI8A 4PJAE 1VHPA 5EDXA 5JHDD 1KEMH 3DI3B 2D2OA 2MQ0A 5F89B 5ITBL 2DKSA 2AK4A 5DDHA 2Z91B 2B0SH 1ZEAH 3DSFH 4IHOB 1OAKL 2CQVA 3HTLX 3MXWL 3MOAH 3HR5A 5CP7B 5FYJH 1C12B 5EU4B 3NN8B 5IBUG 2ENSA 2AJ3A 1W0VA 3MLTB 5E1AB 3L5IA 1J12A 5IMMB 2FYYA 1XGTB 3KPRD 4J7RA 5KANI 1CD1B 1KB5A 5HYEA 5D7IB 4HH9B 2CLZB 3IGAB 1JPTH 4Z0BL 4LHUA 3SDYH 1Q94A 3UDWA 2H6PA 5D70L 3V6OE 4D9LH 3VA2C 2NY4B 1WTGT 5DJ8A 4A6YA 3OKDA 5CZXD 5IB4B 4L3AA 3OGCA 5DO2D 5AWNL 4P9HL 1U41A 3FRPG 2WBWB 4OCMC 2F5AL 3RVUC 5IMKB 1RK1A 5C2BH 4RWHA 2YD3A 2HVJA 4OGXL 4AEFA 1WAAE 1T04A 1FZOB 5GGVL 3WNNA 1RI8A 3LD8C 4UU9A 1KCSL 3I2CH 5I8EB 2SEBB 2C3VB 3QIBD 3U7WH 5HDQL 2MOVA 3LSOA 2DICA 3VFWB 2XG5A 3MV9A 4U0QB 3MV01 1BQHB 1O7VA 2YD4A 5FECA 5ERWA 1KIRA 5ABDE 4OQTL 1HNGA 3BMVA 1KELL 1RUKL 5BO1L 3VFTA 3F6LA 5IHZA 4MJ6B 1CIDA 2Z93B 3RY5A 3NIFE 4YHNB 5IG7B 1DBMH 3OF6A 3BGFB 4M7KL 3T2NL 2E8YA 3D18A 2MCG1 3F12A 5FKPA 3AUVA 4O5LH 1FNFA 2NY2D 4PGBB 5JXEC 1B4JL 3QJFA 1AO7E 1EBAA 5D7SL 5IMLA 4XNXH 5TH2A 4JY4A 4HG4J 3L5WA 2ZG2A 1ZS8B 1R0AH 2R56L 3EDJA 2AJSL 2AQ3A 4XVSH 3QUZA 5FOBA 1ZOXA 4M6MH 2XXMB 2XWJB 3WXVL 5J3HD 5T3XH 1IC7H 2V7NA 4HFWB 1J8HB 1KCRH 2IBZY 2F19H 4XPTH 1RK0A 1Z0MA 4M5YL 1G6RH 1G9EA 4Y19B 4ZS6D 4Z77A 5J06A 4QRRD 2CRMA 1VKXB 2RFXB 1KIQB 2CDFB 1GGBH 4LCUB 3CSYB 2H32A 4UDUA 5FUOH 3TT1H 4F15B 4FTVB 4RGOH 1A7OH 1FNLA 2YD6A 4OT1L 1ZLUH 1RMFL 1QP1A 4KUZH 1QHOA 2VOTA 4O58H 4D8PA 1C5BH 5B3JE 2FB4L 4JKPH 4XRCA 4F15C 4LAJH 2JIXB 3CH8A 2DQFA 1J18A 3C2SA 1BZ7B 2PO6D 1URLA 3LV3B 4F9PC 2HT3C 1CFQA 5IQ7H 3NCYS 1U8NB 3OAYH 3ECBA 4WFED 4DN4H 3NCCB 1FIGL 2W0FA 3FN0H 2YD8A 5JPMA 2BNRE 3FOLA 3H7LA 3F7QA 4L4TE 1UB6B 3ULVC 2PR4L 3HNTH 3L3DA 4F80A 2IAMA 1MRDH 2BC4A 3S4SA 3HAEG 3QDGE 5DHXB 5ACZB 5CEXA 1DE4B 4MJ5A 4Q2ZA 2R1XB 3SY0B 4WU7B 4Z7NF 2RQ8A 4JHZA 1G1YA 2A6KA 2ADIB 4Q97A 1VSCA 1MCDA 2EDLA 2IQ9H 4QOKB 2OR9L 1T1YB 3TC9A 2CK0L 1DBAH 3LB6C 4L4JA 5E2TH 4BA8A 3UPRB 3DTXA 2ITCB 5EORH 4GKOA 1LO2L 3M07A 3V0VB 5CUSH 4YE4H 5C6PB 3CZFA 3LIZH 3CNKA 3N06B 4MD0A 3ARFB 5BVPH 2HKHL 1YQVH 2ZCLH 3CUPB 1H5BB 2WLYA 5FA4A 1XF3B 3MLVL 3WS3B 5E8PA 2Q76B 1R6VA 3EYOA 1N5AB 5D4QA 4L8CA 3THMH 3ARFC 4WEBL 1OPGL 4X5WB 3QCUH 5C08B 3V4UH 5K9QG 2DD8H 1R3HB 3RFZC 1MJUH 5IWLA 4XCFH 1UJTA 2VR5A 3GSWB 4NQCD 4YDJA 4JFFB 1OGAA 2HKFL 1LNUB 4CNIA 3DGCR 4BKLB 3V0WH 3U7AA 1LWRA 3X14A 1WFTA 4E0RB 1GZQA 4PJBF 5I1DA 1GHFL 1ORQB 3LEVH 1QHPA 3FQRB 2VDPL 1IAMA 3CJJA 4ZUTB 2R4RL 1X5LA 2LE9A 5L88H 1PSKL 2VLLB 1NC2B 5C9JB 3BZEA 4ZUUA 3ZSTA 4PP1D 2DYPB 3L3HB 4M4RA 4WHTA 5D7KD 1MJ8H 2HJFB 4KRMB 2ATPB 4GRWB 4EXKA 4G7YL 3QUYD 4B5EA 3W11D 2P8LB 1U95A 2J4WL 4JKKA 5IROC 3BIKB 1MAKA 5HGBA 4P2QE 3MC0A 1Q38A 1LO3L 5C1MB 3TCXA 2ED9A 1YEHL 4WTZG 4ZO6A 4RAVB 3AXLA 5DJXA 3GMMA 2NX5B 1MHPL 4HXAH 3K4AA 1XR9B 3W0WE 3MBEC 5GGUA 3MCKA 1ZT4B 3CMOH 3MRPB 3IRPX 3MXVH 2F53D 1Q0YL 1Y18B 3VG0L 1F6AB 5EPMB 5CZVL 2QQNH 4XHJD 2D7OA 1I1AD 3MV7A 3QA3A 3MOBH 5ETUA 2NY1B 3L3KA 4LDOB 4KI5D 3JWDH 2D0HA 3RWJB 3SN6N 1ZSDB 3WN5A 3QNYA 2AGJL 2BNUB 1U8KA 1E4XI 3BP6B 3WE6B 4YHPA 2PTVA 3T3PF 1YYLL 1KPVB 2VH5L 4QEGA 1OW0A 1QRKA 3FJTA 3K7UA 3RWGB 4HWUA 3ULVL 3JTTA 4OGYH 2W9EH 3L3JA 4HMEA 1F00I 1OP5K 1I3RA 5F7YC 1T5XA 3WIHH 1KLGB 4JHWH 5KVMC 5GRWA 3T0ED 4HPOL 1W0WA 5FM5M 1DBBL 3VH8B 4YFLI 5HYJA 5C6WH 4HBQA 1YEFH 3INUL 3KYOB 1FJ1A 1M7DA 2XV6B 5BMFL 4OZIF 1C1EL 3VXRA 2I27N 4M3JA 5HGAB 2IBGA 2VUOA 5HYQA 4URTB 5DSCA 4IBLT 2C1PB 4YDVA 4X4XA 4XMPH 3SDDA 2ITDA 3T04D 2JK5B 5F96H 2DMBA 2EEBA 3GRWL 1A1OB 3BP7B 2W91A 4ZFGL 2YPVL 1BFVL 1RFDL 5EU6B 1RAMA 2VO5A 4LQFH 1S9KC 4PTUA 1QR4A 4U1HB 2Z4QB 1A0QL 4TSAL 3B9KB 3GKWH 2YN5A 1H15A 3GJEA 1UM4H 4NSKA 3WLBA 3MLWL 2O5XH 3C5JB 4U7MA 1OTTD 5DTFA 4D3CL 4I3SH 1I3GL 1L0YA 3B9KC 1HYSD 4GW4B 4JZNA 2MKWA 3V4VH 3WFDH 4JM2F 4RISH 2EXWD 4UNVA 2AS5M 1P7KB 1A6WH 4XAWL 1NGWA 4OCYH 1KJ3H 1I9EA 5ILTL 4F2MB 1SM3L 1WICA 2J5LB 4NM4H 3IYLW 1JN6B 5CKGA 4XNYL 3P9MB 5T3ZH 3RJQB 2AEQH 2LVEA 2J5LC 2DJ4A 3L95B 4P4KD 2KZWA 3BGAA 2GJ6D 1NLBH 2A77L 1EO8H 2EH8H 3DIFB 3C60A 5H2BA 4XZUB 4N0UE 1DANT 4Z7WF 1P5UA 3BRGC 3JWOL 1J8HE 4NUJB 2R9HC 1LP9A 1KJ2B 4IDJH 4OIIL 2MKLC 5C3TA 4ZG1A 2P47B 2EDNA 3DWTA 4XP9L 1DLHA 4U1LA 2OJEA 5D2LE 4QHUA 1F90H 1RZGB 2FWOB 2Y06H 4Y19E 3QP3A 5ECJE 5FKAB 3VI4E 1YY9C 3PJSA 3U48A 3PQYB 1OGTB 4PJDB 4FTVE 1YPZF 3T0XA 3W81A 3DVNA 3FMGH 3O3BB 4OGAC 4PR5A 4Y1AA 3S37H 1B0GA 3H9HA 3M8OH 1B6UA 5DD1L 2YUXA 4U6VL 1MCSA 4FQLH 3GB7A 1IT9L 1VFUA 2BOCB 3HZYB 2CDEB 2MQCA 1CF8L 4P9ML 5DJ0B 1NCTA 3LH2H 4OUUA 3G6DL 4OIBA 1Q1JH 5I30H 1E4XH 3HC4L 1RZFL 3ULVE 4FFVC 4XH2A 5KAQG 1T0NB 2APXA 2VL4A 4F57H 1IGTB 1BAFL 5C07D 2R2HB 3GK8L 1U8MB 3I50H 3L5JA 1RJLB 2VLKD 4TPRH 3L1OL 3X11B 1QFUH 3H9SB 3ARGB 2UUDH 3LRSB 1RV6X 4I18A 2Q6WA 3AVEA 4HT1L 4JVWA 3BD5A 2Y72A 2PYFA 3SCMA 3ARGC 1BHGA 1WBYB 3GMQA 3LEYH 3S37X 1YUHA 3RWDB 4M3KB 1AE6H 3PGCA 4P5TB 4QOKE 2JJTC 3KPTA 1JK8A 2W60A 1ZANH 4GG8B 1A7PH 1FVEA 3VWKB 4G8GD 1JPGB 4X7SH 1OB1B 4IRSB 3KPLA 3GHBL 3DVFA 5CEYB 4ZO8A 2BNQB 1CFTA 2QR0A 1D5XB 4FFWC 4U6HB 5IBUB 4Y4FD 3SE9H 4L9LA 1FH5L 1EVTC 4IRSC 3MRFA 4NKOA 2VQTA 4J3XA 4S0TD 5I8CB 4YHOH 4RGNC 5MENA 3HI6L 1G7MB 5DD0L 2ICWJ 2GUOA 2WWMD 3K46A 3EOBB 5I2IB 1RZ8B 1N2RA 4ZUVB 3BZ4A 2A1WL 4NQEA 4M03A 5C3LD 5LVEA 1RU9H 1KJVB 3WIIL 1MIEH 3GSNB 2YXMA 2HTLC 3FRUA 4JFFE 1NPUA 3C87A 4RA3A 3QWRA 3EYSL 3RUGB 1N0LA 1KTLA 2VXUL 1NEZG 4V1DD 2FO4A 5DT1L 5HDLA 1B9ZA 5DK0A 1HK6A 2B4CC 1I7TB 1T83C 4XWOD 5FO7B 2DS4A 3MRNB 3RA7H 2VC2L 3QIWD 1MH5A 4KHXH 3ISWA 3CLFH 4M5ZL 5HHMD 4LLYB 2QHRL 3KLAA 4YC2C 1FNSL 1GPOL 2D4DA 2V17L 2UWEF 4GRWE 4HV8A 4W6YB 3N9GL 5F1NB 1P53A 2QJDA 3DUUB 5SWZD 4F9LC 5KJRL 1XEDA 2ZCKL 2IGFL 5CWSA 2Z8SA 1HWGB 4HUWA 3MJ8B 1KJ2L 1GXEA 4K23H 1AXSA 4WIQA 1HILA 2Q1EA 5IW1A 3VXSB 1UKQA 1CDIA 4GG6F 3T2QA 2CLRA 3S34H 1BZQK 5JW4N 1DQMH 5EC1A 3BDBA 1HKLL 5E8NA 1D6EA 1FYTA 4ZSOB 2BOBA 1OTUD 3ES6A 1F11B 3UTSB 3QRFM 5E2WH 2R2EB 2DQJL 1T0PB 2GKIA 1RIVL 1ERNA 2CRYA 1X3DA 1GH7A 2KBGA 4OJFL 3ARXA 4KTEL 3EGSA 2FEDD 3TPKA 1P84K 4J4PD 3QWQB 1LE5B 1YEKL 5JW3H 2VDKH 1Y0LB 5HBBA 3RPIA 2W1NA 3PP4H 3Q5OA 5EA0H 3V6FA 1QSVA 1RZKC 5KSUA 3I02B 3DYOA 5EIVA 3VMOA 4Y5XB 2ADJA 5HHPA 5CBEA 4OZGB 1AIFA 3HI5L 5HHNB 4RGMB 3UTOA 4PV8A 5KS9B 1PY4A 2AV7B 1C16B 1DN0B 1SEBB 2XTJB 5B4MC 4Y5XC 3DRQA 2NXZB 4E5XA 4N0RA 1YMMB 5DVLA 4ZTOH 4M61B 5CIPH 3PL6B 3MV8A 3L5HA 1NFKA 4HFUL 4RGMC 5DRNA 1BBDH 2B1AH 3W2DL 3MJ7B 2EDKA 3DURB 2XTJC 4ENEC 2BXZA 4LLUA 1KFAH 5BZWB 4LLVB 3U83A 3EAKA 3BFOA 1P4IH 1WWAX 3CDFA 3PL6C 1KTDB 3HZKB 4N8CL 3TYGL 4N0YL 4FQIL 5KBNC 2BMKA 3LHPH 4BSWB 2M8XA 3IFOB 1IKFH 1C08A 4KJPC 3EO0A 3ALPA 4RZCA 2NLJA 4NKIH 3KXFD 3NFPB 1NSNL 2VZ3A 3HAEB 4Z7UF 1DBJL 3RWCA 2EC9U 4KK5C 1ZLUK 4OI7A 1EEYB 4PD4K 2DMCA 5DEZA 3TN0D 4LL9A 5D9SB 2WUBH 4N5EC 3UYRH 1F3DJ 1ZT7A 5D96B 3MLXL 1WLHA 3IU4L 3NMEA 4LCWA 1B4RA 3GSNL 2R15A 2P7TB 4M1GL 3MBXL 2APFA 2B4CL 1BECA 1YJDH 3OAYK 1I7ZA 1UYWH 2NTFB 3TYFB 3SDAD 2HT4D 4M48H 4Q58C 5DD6B 3NFNA 2HWZH 1CDUA 1P7QB 4R4FL 5H94A 1JUFB 3MLUH 3X12A 3K8MA 4L4VD 4F3FA 2ZPKH 3VGDA 1YEJL 3O2WL 4GSDH 1BZ9B 1JIBA 3BD4A 3D85A 2F58L 3WUZA 5E4EC 3NAAL 3BN9C 1IBGH 2VLRB 5A1AA 4JFPB 5IBTL 3LVEA 5T1LD 43CAA 1A4KA 5C0RL 4QYOA 4WHDA 5DQ9B 4TOYL 4ELMF 1IM9A 2Z9TA 2I07B 3HPLB 4N9GA 2R23B 4V2BA 2VLJA 4HWBH 3PQYE 4PJDE 5TGBA 2DRUA 2DBLH 3JXAA 1I4FA 3CCHB 4LSSH 4R96B 4BQ8A 5E5RB 5HGHB 3QDJB 4M8VA 3QXWA 4R4ND 2J1KA 2CRZA 2P5WB 2NW3B 1RIHL 3QO0B 1IQDB 4ONHB 3PHQB 3QUMH 3MUY1 1J7VR 4PJGB 3LEXB 5JDJA 4BZ1H 1B90A 2NY3D 3LMJH 1J10A 2WBJB 4XXCA 2J2ZA 3ILQC 4IRJB 5F7EH 1BX2B 4FQJH 4WU5A 4JQVC 3RBSA 1TENA 2IH3A 5LBSL 2WBJC 3QEUA 5I71B 3AS1A 1FFPA 4IRJC 4J3VA 3PWPB 4JG1L 4L5FL 2X70A 1HINH 1IQWH 3NFSH 2IBZX 4NO0B 5I71C 4TVSa 4JO3H 1H3WM 4KFZC 3CSPA 4X5XA 5ESAB 1RZKL 3FT4B 3GMPA 5JTWA 1DTUA 3H9SE 2R2BB 2YPKA 1D5MB 3KG5A 3KYKH 3D39E 3D25A 3L3GB 5GZNC 2HFFB 1MQKH 3U0TB 5ID1B 3WD5H 3QDMA 3MGAA 2QBWA 4MYWB 1MLBA 4FQQA 3FB7A 2JCCF 2V2XB 3JV4A 1PW3A 4LF3A 3VW3H 4WCYL 2GK0A 4PJXA 5H35A 3H42L 2HA1A 3HMXL 3DMMD 4QRQA 2BNQE 1D6VL 1YNTA 4RGNE 3O4LB 4Y5VB 1ZVYA 1CFVL 4YGVB 2MFNA 5EBMB 4RQQB 2IANA 1CQKA 1NAKL 3NPZB 1QLEL 1U8OB 1AGDA 3V52H 4Y5VC 1ACYL 4F8QA 2VDNH 3MLRH 3QEGH 5I66B 2X1XR 2V6HA 3KPPA 3OHXB 3S35L 4L3EB 1U0QA 3BESR 3LQAC 1T80A 3KDMA 5DD3H 2HH0L 3G9AB 3HG1B 1QRNA 3VMPA 5D1QB 2XZAH 1HHKA 2J8UB 2FSEA 2FO1A 3RUGE 5EOQL 3UTPE 1NCWH 5F3HB 4WV1A 5D1QC 3VFMA 2DTMH 3L7FB 4PG9A 4PBVC 1MJJA 6FABH 1BM3H 2BSRB 2ED7A 3U36A 4ZPVA 2XWTA 4GAYA 1JGVL 3RDTB 4OCNC 3OKLB 1QLFA 2PN5A 3UP1A 1V7ML 3ARTA 2F8VA 5DMYA 4N0CC 3H8NA 5IVXF 3RDTC 3JVGC 4KRPD 1G84A 2AVGA 4M7ZB 5KANG 3O41A 3K81A 1AQKH 4XXDB 4Z7NE 2X4QB 2WAHA 43C9B 4G9DB 4M7ZC 4DUWA 1YY8B 4YX2L 1Q9WB 4ORGB 4XNQB 3CFIC 5C09A 3K2UH 1NGXB 1P2CA 1I7RB 5DVMA 1L7TH 4NC2B 3U9UA 2P5EA 1E0OB 5SX5H 1DUZB 1GJIA 8FABB 4KMLB 1MCOH 3D9AL 1MF2L 1BP3B 4OF6A 4F8TA 4C58B 3VXSE 2VZSA 1A14H 4MQ7A 1CK0L 2DB8A 4NPYB 5DHYB 3STBA 1F4HA 2EIBA 1PQZB 4ODWA 3VJ6A 4HBCH 3OPZH 5JIIA 4YZFE 4JY5L 3UTSE 1IJ9A 1AQDA 3DBXA 2EO1A 3EYFA 4ZAKB 1ZVHA 4OSUH 2J12B 3BMWA 1PKOA 3NBNA 5D7JB 4OLYH 5FAAA 4M7LH 5EO1A 5K9JL 1S7SA 2FJFB 4MNQD 2H32H 4ZAKC 4Z7OE 3QXDB 3GNMH 1KT2B 5D7JC 5JR1H 1O7SA 4NP4H 2B1HH 3CFEB 5CMAB 5F3BB 3HB3C 3LRHA 4R97B 1JFQH 1FFOA 5L0QB 4HWEH 1AFVL 3WJLC 2LQRA 2W0LA 4FMKA 4LASH 1QZ1A 1DLFL 3QIUB 1F4YH 5EBLA 1J1PH 4LSRL 4QRPB 4ELKA 5L0QC 4KRLB 4EDWH 1JNNL 1MFDL 4WO4A 3BDYL 5KS9E 2XTJE 3QIUC 4XP4L 4LSTL 4H0IA 3K0WA 3VWJB 3BXNB 3SO5A 4U6XA 2FH6A 5C0BA 1UH4A 4MXQC 3RIFK 2FL5A 1GL4B 3VWJC 2PYEE 4ODTH 3IF1A 5I1JL 2VB5A 3HZVA 1ED3A 1JNLH 3T0DA 4G3YL 4HC1L 5TPWL 4ZXBB 1UT9A 1MIML 5FEBA 4G8FB 5ADPL 3WJJC 5E03A 3T77B 3HA0A 5D8JH 3WFBL 4ZXBC 2D7TL 4XB7A 4AQ1B 2I5YL 2BRRH 3LQAL 3ZE1F 4QHNB 4HS3B 1YN7B 1MLCA 4KTDL 4HQQH 1FQ9C 1W8OA 3LDBB 4JDZA 4QY8A 1RIUH 2FGWH 3ULUC 4AH2A 4M8QB 5LXGL 1NQBA 3LDBC 4Y4KD 3FONA 3ZHDA 15C8H 2FEEI 1EUTA 1S5HA 4PRBA 4YXKL 4XI5D 1D5IH 4X6BB 4EQ3A 3UTTA 2DQUL 2YD9A 2YKLL 3BKJH 3RP1A 3VG9B 4WDIB 5CS7A 1TVBA 3T8XA 1YYML 1I3UA 3VG9C 2VLRE 2X4PA 5JMOC 3ILPB 1EFXD 1F8TL 3S96A 1FORH