1J87A

Human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
168
Chain Sequence
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPHA-SUBUNIT
publication title The analysis of the human high affinity IgE receptor Fc epsilon Ri alpha from multiple crystal forms.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 168
sequence length 171
ec nomenclature
pdb deposition date 2001-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j87A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j87A02
2VRAA 4JPIA 5EUKB 3QDJB 4XGZB 3HE6A 1YEGH 1NFDA 4X9IA 3CVHL 5T1KB 3P77A 4TUOB 3SE3C 5JOEA 2PNDA 4JPKH 2FH8A 4AMKH 3GMNB 4M02A 2R29L 4GRMB 5CJXA 3NCFB 3E6FA 1ZEAL 4LSPL 2FEEI 2WUCH 1QR4A 5CILL 1A3RL 1NBYB 3BYTA 2WZPD 4RBPH 4MZ3A 4NWTH 5HHMB 2ZUWA 1DUZB 1F4YH 5F6IB 4M9PA 2OQJB 4M3KB 2YKLL 1D5BB 1SEBA 3EYFA 1AHWC 1XGRB 4BQ6A 1BD2E 1D7FA 3E6HB 2BSSA 4HBCH 5CJOH 4MNGE 3STLA 3VMNA 5BMFL 1MCOH 5L9DL 4GBXC 1CE6B 1OTSD 1XGUA 1ZXQA 4PTTA 3V6FB 3ZYOA 4F8QA 5TPWL 3CXDH 3G9VA 1RZFL 4OT1H 4JG0L 1BIIA 5CZKA 2F53D 1N2RB 4Q9RL 5ISZE 3QDGE 5JHDE 1WTGT 2C7UB 4PJBE 1BAFL 5A3IC 3QG7H 3WFCH 4C54A 1MRCL 3LSOB 4OLUH 3B3IB 2OJEA 1RMFH 3C60C 4H1LA 4KY1L 3SKOA 4PRBB 5CJ5A 1RFDH 4ZOEA 5GGTH 1IAIL 1T1ZA 2FEEL 2ZUQC 1IAIM 2UZIH 2VE6A 3MRMA 4PJ8B 3LQAL 4QTIH 4ZUSA 5EU4B 1U58B 4TVSa 3ZE0E 3T2PA 2DMCA 1DSFL 1D9KB 2ADJA 1UJ3B 3AVEA 3L3OB 2EDLA 5FUOH 1A5FL 2Q7YB 5JQHC 1KG0A 1I1RA 4GSDL 1D6EA 4NJAL 5D96C 1SYSA 5A43C 4C4KO 1FNGA 1GGBH 2BNUB 3MREB 2B1AH 2DIAA 3K8KA 1NFIB 4RFOH 4GKOA 4C55A 1LILA 4P46B 4WO4D 4PJFF 2E8ZA 5TDOA 4YBQC 1TJGH 3H9HB 1PEWA 3MV8D 1R6VA 3IDIA 3S9DB 4P23A 4XH2A 2PO6D 4MLSA 3EHBD 3LIZH 2VLMD 4JPVH 4APQC 5DQDH 1UH3A 3K4AA 5E99L 4H25B 3LEYH 5KVEL 1MCQA 4UV7H 5MENA 4WFHD 1LDPL 3BZFB 1J5OH 5FKPB 2X4SA 3C6LA 2R8SH 2Z8WC 3FT4B 3BMWA 2XTJB 3S35H 4IMLB 2J5LC 1MEXH 3IDGA 3TBYB 3GJFK 1T21A 1YNTB 4HUWA 2VZVA 5ESQA 1KCSH 1TJHL 3QHZL 5FHAL 4HIJA 5EBMB 3DYPA 3TEUA 4MXVF 4F2MA 4MS8D 4ONFH 3IDMB 2XIDA 3DHMA 4TULH 3STZA 5L6YL 3GMLB 5EO1B 2EO9A 3RUGF 5FM5M 4OZHB 4U1LB 3LHPH 4ODTL 1QFOA 4L8SA 4LARL 1SJEB 4MXWH 1G7PB 3RZWA 1YECL 4Z7WA 2ZSWA 1S9WA 3TBWB 3RNQA 2P5WD 3VXMA 4L8DB 2VQTA 1C7TA 2Y6SD 1KYOJ 4J3WA 4JG1H 1UWXH 1KXQE 4NCDA 2ZOLA 2AXGA 1TCRA 3LN5A 3TBVA 3MBEA 4M62H 1RZKL 5I1KH 1YNLH 4NRZA 4Q6YA 2VN4A 3QZWA 4UU9A 4D0DB 5F7UA 5IBTH 2OXGA 4XP5H 4LU5L 3WIIL 4DJMA 4A2MA 4DUWA 4MJIB 1V7MH 3R0MA 1KLGB 1KULA 3TBSA 5H8DA 3PWLB 3O6KH 4PRPB 4C83A 4W70A 43CAB 1JGUL 1ZTXH 5EZLA 3KYNA 2CK0L 2AABL 3CMGA 4FQ2H 1PLGH 4WO4C 1KXVC 3QEUB 4ERSL 3QCTH 3OXRA 3DVGA 2GTWA 4PD4K 5MEOA 1JGEA 4NZUL 4DUXA 2R0WH 3AM8A 4XPAH 1ZA6A 3MCLH 1A1NA 5E2JA 5DUMH 1YY9C 4JZJC 1IGFH 3MA9L 4OGZA 1NGPL 2AQ1A 3FQWA 1P7KA 3DMMC 3B83A 2E5EA 1EZVX 1JZ2A 3QNZA 1N7ML 4KH2A 3NPSB 4KTEL 3TCLA 2QSCH 2X6MA 2A38A 4JLRB 1U8JB 2EH8H 3MMEA 4M61B 1KC5H 2Z91B 3UBXG 2NY3B 3QP3A 4NQDA 1EHLL 4FMFA 1BD2D 4PJ8D 3WHXA 3HKFA 4LCWB 5CEYB 2GCYB 4KUCF 2QKIA 4MS8C 4P2CG 3B9DA 3DVNB 4J12A 4EI6A 4W6XB 3DX7B 1S7WB 4E9LA 5M94B 4JY5H 5ALCH 5K33A 2YWZA 4N5EC 1RI8A 3EGSA 2EC8A 3DBXA 1HH9B 3QDGD 3VXPA 5JHDD 1EH9A 2DLTA 5TQ2H 3C5ZB 3FN0H 3TWCH 3LPWA 4XPGL 4MLIA 1YEDB 3MZGB 3GMRB 2UUDH 1QFWL 2APVA 1E27B 4QHUA 3MJ9A 5C6PB 4PRNB 4YDJA 4M8QB 1A7NH 2FYYA 2ICWI 3BDBA 5IW3A 3O2DH 4Z95H 4WCYH 3OGCB 4R7DA 3QJFA 1WEJH 4HFUL 1CU4L 5F9AC 3DSNA 3DURB 1WC7B 4Z7OE 5EU6E 5F6IC 3T77B 3T0VA 1V3MA 1AKJB 1RZ7H 3IDXH 4I4WB 5LWYL 3DX8B 4FQLL 3RVXD 4JFZL 1J12A 4LLQB 1YDPA 4WW2A 4MNHA 3TT1H 2W38A 3CSYB 1HEZA 5IMLB 3QPQC 2NNAA 4D9QE 2V9TA 1CFSB 1M05B 4MZ2A 3HRZB 4E41E 3MC0A 4LBEB 2LU4A 3B5TA 1V7NL 3T3MF 4AIOA 5IFAL 5A16B 1F4XH 2R2BB 1SEQL 1MCDA 2GK0B 1FPTL 3KDMB 4UINH 5FGCB 3TA3A 4N0UB 3G5YB 2A9NH 3HLAA 5KVFH 3NACL 5DRZA 3Q1SL 3ARWA 4PV8A 4CNIB 1QTYT 1WFNA 4HJGB 3RY6C 4EDWL 3HR5A 5I73B 3KPPB 3H6JA 1T5WB 5BRZE 3KNBA 2Z93A 3KYOB 4NFCA 1LWRA 3WFHA 4K7PH 4YHOH 32C2B 4M93B 4ZO6A 4PJ8C 4YK4B 3KPRA 2FWOB 1IGIH 4EDXB 3D9AH 3GKWL 3HI1B 1O7VA 5LXGL 1D9KC 1N6QL 1UJ3C 2BX5A 1DBBL 4LCCB 4LCIL 4GOSA 4U6TA 5K9OA 5FYKU 1C7SA 1R5VA 2Z31D 4AEEA 5IQ7L 1RULH 1I9RH 3VXOB 5JDSA 4J3XA 3DARA 3DETC 4PRPD 2AV7B 2W0PA 4QHNB 2GYSA 4NO2B 3VXNA 1XZ0B 1KJ2B 2B5IB 1KEGL 5B4MC 4M6AA 1K4DA 3NA9H 4P46C 3OG6B 4U6HA 2BNQB 3MJ8A 1CGXA 3N1PC 2CLVB 4RMQA 4R90H 4D9LH 1HINL 1BF2A 5FB8A 3QEHA 3Q5TA 3G6AB 4JVUA 4LSVH 1S7UB 2EH7H 2O61A 1DQLL 3C8DA 5SWSE 1IGJA 1WBYB 4WI5A 5C9KA 1QLRA 2DL9A 5DRXB 3FT3A 2X7LB 1HIML 2AV1B 2MCG1 4R3SA 1YEEH 3DX6B 2XTJC 3MRCA 4ZS7H 4X7SH 4BH8B 2AK4A 2M8XA 3VFOA 5JW4M 4OF7A 3DI2B 2V2XA 4JAMB 1JTPA 2WIIB 4FQXB 1KJ3H 2M26A 1KIPB 1T6VN 4XXCC 3ZT7A 1D5MB 2V2TB 1FGNL 3DIFB 3BQUD 1HSBB 2AEIT 5B8CA 3RZCD 1PYWA 4PRIA 4JRXE 5TFSL 4M43L 4ODHL 5BJTB 3EO1B 4MDIB 4ZFZB 2R2HB 3P11H 3MLYL 4G3YL 3O4LA 2ED9A 4XVJH 2D7QA 1SMOA 1KT2B 5F6HJ 6CGTA 2DLGA 2EDFA 3TZVA 3UTSB 4ETQB 5I1EH 1EEQA 3EYQC 4KXZI 4EIGB 3HPJA 3V5DA 5CBAB 3JTTB 4Q9CA 5T1DH 4EJ1C 4OAWA 1A9BA 1I7UA 4M00A 1NANI 2D3VA 2EXWC 3MLUH 3JUYA 3OAUL 1INEL 1A7PH 1T0MA 4JB9H 1EHXA 2Q3AA 3FFCB 1IT9H 2BSTB 1O5DT 3Q6FA 5C0CE 5A2IH 1NC4D 5B39B 4KQ3H 3LDBB 4FNLL 3KLAA 4NQEB 4Z18A 2HFGL 1OPGH 2H41A 4JFEA 4U33A 2DWEA 4JRYA 5D9SB 5FF6B 1MREL 5EUOA 4KC3B 3WDIA 5D8JH 1BVKA 4RRPG 3WJJC 3SHSA 4NKOB 5I17A 1K8DB 4GXUN 2ADFL 3REWA 5DJAB 1VADA 3HI6H 1CG9A 3SDDB 3WKML 3RP1A 2NYYC 1VFUA 3O9WD 4K3JH 2O26U 4PRDB 3NPSC 1LK3H 2DQDL 2G2RB 1T1WA 2UZYB 5EU6D 1VGEH 3OKEA 2NW2A 5TE6L 5D7IF 3F7PC 4OLZL 1NAMH 2NY3C 5DEFB 1ZGLM 2J88L 3MRFA 5ADPL 2GJ6E 2R0ZH 2E27L 3FKUS 4CVXB 4D9QD 1WT5C 1XR9B 2HLFD 4P3CH 1BZQK 3QIWA 3EJZC 1X44A 4E41D 2YPVL 3MNWA 5F21B 4BUHA 4LDOB 4NN6B 4PIRF 1CL7I 4KMTL 2XPGB 4Y2DB 1HXYA 4KAQH 3C5ZC 4I18A 3ARRA 2DL2A 4G42B 1OAUH 1JE6A 4N8VB 1GZQB 4Y5XB 5DJXB 5BRZD 3Q0HA 4HJ0D 4PYGA 5IJVB 3BEVA 3H9ZA 1AH1A 1E6JL 4GRWF 1FVEB 5DMGD 3V9FA 3WO4C 5DS8A 3SE4C 2EDJA 2QR0A 3G6DL 5E8OB 4MQXD 1R24B 5E6IA 2BFVL 4M6NL 2DBJA 1RVFH 5KANG 1I3RB 4K9EL 4KDTA 1ZE3C 2AEPH 4PJAF 4A6YL 3JWOL 4YWGL 3T09A 5HJ3A 1ZT4B 1A6PA 1L9NA 4QHMA 5DWUH 3D48R 1X5JA 3O2WH 4IMKC 3UTTE 1QO3B 5KBNC 1KB5H 1L7TH 4U6VL 3IFPA 4Y4HD 2DQTL 1CL7L 1FL6B 3MO1A 4GAJH 3OF6A 2WMPA 4FQXD 4RMSA 1EAPA 2QQLL 1CICD 3F7RA 3DUSA 2RGSA 3WN5B 4BFIA 2EDWA 4NM8L 3O3EB 3BZ4A 2PYEA 4OZFH 3QUXD 5A2KH 4M5YL 1LP9E 4ODWA 1R5IA 5I73C 1WWAX 2HT3C 2Q20A 3BOVA 4TSAL 3BZEA 4LDLB 4YO0B 3WLBB 3X3FL 1ZLSL 3CLFL 4M93C 5D2LF 3NMEA 1I8KB 4G43A 4YK4C 1AQKH 5C7XH 3F58H 3QIBA 5LKNA 2DYPB 2DI8A 2VDLL 2N1KA 3BXNA 2BDNH 3L3KA 4XWGL 5IMKA 2XT1B 1AP2A 4LF3A 1Y0LA 3FN3A 1B4JH 3CFIC 3GM0A 2BC4A 5I19L 4TRPL 4JRXD 5F7FA 3OJVC 5FA4B 5HI3D 1J1PH 4RAVB 1NCUA 4LSSH 2YPLA 1A6AB 3I85A 4MD0B 4HJ0C 4DKEL 1F6FB 4N8CH 3FMGL 3TFKD 1AO7B 4KU1A 1CXFA 4WHYH 2MTPA 1GC1L 5ACZA 4Z5RA 2Q8BL 2R4SH 1MCFA 1Q0XH 5EBWA 5DMGC 4E5XA 2DQIH 3LQMA 3IF1A 1HHIA 4G6AD 4ZXBA 1ZKAA 2H2PD 3RA7L 4NJ9L 3EIFA 5DXWA 5DURB 2X4TB 1CD9B 5F96H 1G7HA 3VGBA 3P0GB 4M6OL 1D6VL 2HRPH 2G75B 4V2CB 2YSSA 2LV4A 5DUBB 4HWBH 5B3JF 4N0FA 3BAEL 4OQ1A 4NP4L 1NLDH 3D5OF 3NABL 5C0DB 4TSBH 3WXWH 5LCVL 4HK3N 2OL3L 1ORQA 2WWMD 1FG9C 4JVPA 4EUPA 2D7TH 4FQXC 3HNVH 3QJHA 5JXEC 3B2UD 3BRGC 3C2SA 1W0VA 3MYJA 3VI4F 3NZ8B 4MX7A 5ITBH 1T5XA 3LKRA 4Z7NF 5DC9B 2JCCB 4L5FH 3GSUA 1RUMH 5E6ZA 3V52L 5KG9B 4MWFA 3ARTA 4NZTL 2WP3T 1Q9LB 1JHTB 5HI5D 2C1OA 3SDXA 5H2BB 3L3DA 2EDTA 1XCTA 2CIIB 3TYFA 1JV5B 5GGRB 3WFBL 3PHOB 4LFHD 3NFSH 3ALPA 4HUUB 4U6XB 5HHOB 2W9LA 2V2WA 3KYMA 1U8MB 2R0LL 4U7SA 4RAUA 1VKXB 4ZFGL 2A6IA 5I1AB 2LAGB 3P73A 5F89B 4BQBA 3M1BA 2GJ6D 4GLRH 1KF9B 1NMBL 4U7MA 3QWOA 4FXGB 1QZ1A 3U0PB 4I3SL 4PB0L 2VZ3A 3LN4B 4WIQA 2AJXL 4LLVB 1PEZA 3ZT5A 4JO3H 5HHPA 5J6GA 5FM8A 3LDBC 4YNYB 5DI8A 4K94H 5IV2A 2D03H 3L7EA 2BERA 1QRNE 1C5DB 1NMCB 3FONB 1OF2B 4CADB 1K4CB 5EZJB 3SDYH 3CNKA 1LMKA 1MIEL 2ICWB 1OAQL 4NPYB 4Y89A 4BJLA 3D0VA 2DN7A 1S78D 4R0LA 4U1HB 4CVZA 1FZOA 2HTKD 2DBLL 3SDDC 3LQAC 5IHZB 2QJDA 5F9OL 5MP6H 4NQVA 5L9DH 1DR9A 3HZVA 4LPVA 3VXRB 1JGVL 2DKUA 2NX5A 4V1DE 1JWUA 5CP3A 3T2OA 5GRVL 2CSPA 3CFKA 2GHWB 2W60A 4Y4FA 4NO0B 3U36B 2F74B 3B9KA 4HQQH 5D2NE 4Q9RH 4X6CF 1CD8A 4UDUA 5JR1L 4CMMA 1AC0A 2ZCHL 2ADGB 1WBXB 3UTTD 7FABL 2DYPD 4XNUH 5L2KE 5HHQA 5KW9H 4BSWA 4I3GA 2X2YA 3BWUC 4D0CB 1A4JB 2UY7A 4NN6C 3GUTA 1CGYA 4NYLB 1DVFB 2VIRA 1Q0YL 4RMTA 1M6OB 2W9DH 1YQVL 2W0LA 4HMDA 4PY8J 4Y2DC 3ZE2F 3GJFA 4OF0A 4QNPE 5HY9B 3VFSA 4FZ8H 4QLRA 5TF1L 4EI5D 1MPAL 4Y5XC 1MJ7L 2P44B 2G60L 2DQJH 3MUHL 3DSFH 1A5FH 1NDGA 3BGFB 3HMXA 4PY7A 4AH2A 2DICA 5E8PA 4GSDH 3G6JA 1BECA 1PZ5A 1BP3B 2NY5L 2DI7A 4OTXH 5ALBH 1DN0A 5I9QB 4ZO9A 2GEEA 2H2SD 5JO5B 5DJ2B 3PWUA 3T2NH 2GITB 4Z0XB 3F5WA 3K2MC 3QUYD 4DTGL 4ZOCA 5EN2B 4TPRL 2ERJB 1MWAA 5DEGA 2CLZA 3RVVD 4ALAL 3OR7B 3V8OA 4AEHL 1PGRB 5JNYA 4GMTL 4MJ6A 1OGTA 4Y7MA 4KUZL 5E99H 4FMKA 4ZUVB 3FB8B 3E8UL 1OAZH 4CMHB 5C2BH 3VFNB 4HX1A 3WN5C 2X4NA 4P5TA 3IXAA 3PP3K 3KXFB 5TH2B 2OJZH 3EYOA 2IPKA 2MKLC 3BD4A 4NUGL 4CW1B 5L8LB 1Q9KA 1ADQH 5ID0B 4XP6H 5DD6A 2X70B 3CLEH 5FHAH 5HSFA 4WY7L 2BNRA 3H0TA 1EGJL 3NN8A 4LLYA 5GPRA 1AGFA 3MV7A 2P8LA 5LGKA 1FIGH 1JMXA 4ODTH 4LARH 1YECH 3OR6B 5TDNB 1FO0A 2J8HA 4XCNA 3ZZ1A 2OR7A 3QDMB 1INQB 1RK0A 1DLHB 5F7HA 4AT6A 4XNMB 4WTXA 3GSNA 1DQTA 1U8OB 1B2WL 2P8MB 4Y5YA 4L8BA 4EI5C 1MJUL 1JVKA 1T04A 5DR5H 4AL8L 1A2YA 3L6FA 5FO7B 3KLHC 1TZIB 1GHFH 3TJHD 4P9HC 2I25N 4QTHB 3MNZA 5F3BA 4LU5H 8FABA 5L7XH 1ZS8B 2HKHL 1FIEA 3AY4C 3PHQB 4I0PB 2JJTA 4P2OD 3WUZA 5CIPA 3JV5A 4LAJH 5IVXF 4WENB 4XPTH 1ONQB 1DQMH 1CZ8H 4MHHI 3ZTJG 4PJFE 1WBZB 2FR4B 2Q1EA 3QXTA 3UTPE 2AJ3A 3TPUB 4NNXA 1NSNH 3TO4B 1BFVH 2R1XA 1JNNL 4KKCC 3QUYC 2ZCKH 1AI1L 2L7JA 2ZG2A 2O5YH 3VXRD 3UJTL 4NZUH 3I6LE 3ESUF 3RVVC 4MD4B 5EC1B 1KTDA 4GW1B 5BXFB 2P24B 4JHZA 1TXKA 4PJ9B 2FLRT 3BIKA 3MA9H 3O41A 3U4BH 4DVRL 1SJVA 3NCJL 4HK0B 5IUSA 4KFZC 4OLVL 3MXWH 1QRND 3CFJA 4POYA 4O5LL 1PD6A 4OZIA 3FO1A 4LEOB 5B39G 1DQDH 1S7TB 3AMKA 3GDBA 1E6OL 2FCBA 12E8H 1A7QL 1U8HB 3GSQA 4LPUA 4MXVE 1G7IA 4K7FB 5IFHL 4UQ2A 3FO2B 3VXTB 4MCYB 5KAQF 1U3HB 3RUGE 2IALA 4GG8A 2HFFA 4V1DD 3EO9L 5J56B 3KS0J 3V4UL 1E28A 1W72L 3N1FC 5I15H 5BVJA 4G7VL 1I7RA 2BSRB 5E9DB 5L2KD 1RK1A 5J1AB 5E08L 5TGBB 5DQ9A 3V8CA 3LEVH 2XWTB 2VLLB 3RTQD 1MY5A 4GXUM 1P4IH 1AD9A 4NHCL 3CXHK 5FO9B 3CSPA 4GLRI 1W8OA 2HH0L 1HHHA 3PQYB 5I8EA 4KKLD 2BP3A 3VXSA 3I2CL 3QWRD 4OGAC 1R3LA 4HFUH 4P2OC 1NCDL 5IWLA 1U91A 5ANME 1HI6B 4OB5L 3ARYA 4F15B 4MA8L 5FYLL 4S2SA 4XC1H 1B88A 1EJOL 4LFHG 4N8VG 2JB5L 2GFBB 2ORBL 2R15A 1G7MB 4MQ7A 1ZOXA 2FIKA 5IEHB 1IQDA 2FZ3B 3IT8D 2PCPA 2O93L 4MNQB 3W5NA 1CF8L 4U1SB 3QO1B 1U8LB 4HXBH 3N50A 4JFHE 5HHVH 2CD0A 3SO5A 1FAIL 3HI5H 3L3GA 1D5XA 2HFTA 4OFYD 3Q1SH 3GK8H 3HC3H 5DFVD 1ND0B 3FOLA 1FV1B 4J8RB 4LCUA 4QRSA 1X5HA 3GBMH 1NKOA 3PGCA 5HDQH 2FX9L 3RJQB 3SPVA 1EEUA 4OSUL 5I71B 4DQOL 1DVFC 5D7LE 2W65B 5DFWH 1UM5L 3KPOA 3MFFA 1ZLVK 5ESAA 5CEXB 2F19H 3BKML 2ESVE 3MGTB 3WS3A 3RDTD 3JUZA 5EA0L 3V7AG 4X9BA 3J8F7 1VA9A 3FQRB 4JANA 5CGMA 1KV3A 3BGFC 3RVTD 1QNZH 1L9MA 2XWJA 1H8NA 1F90H 4PJGB 5C0GB 4KJQC 1FG2A 1FSKB 4BYHA 2VXSL 1UCBH 1FYTB 4G8GE 3MRPB 1I1AA 4MQTB 1JPGA 2EDYA 4CU6A 2AK4E 3ZHLA 4H1LH 1VESA 3V4PL 4HUKB 4BFEA 1ZHNA 1JHLL 3PE9A 5HDLA 4IRSB 3PWVA 4MA1B 1DQQA 1NC2A 2ERJC 3T4AA 5EB9A 1S7QA 4P2RA 2R2EA 2YD2A 3BDXA 1QBLL 3BJLA 1JNLL 2BXZA 5IVNA 1UXSB 2CDGA 3LAFA 3SJVA 5DJ6A 4U1IB 4WU5A 1BZ9B 3BD3A 1J8KA 3QA3B 1WV7T 5IW1A 3EYUL 4CMHC 2F9BT 4PGZA 1HIMH 1AXSB 3SDAD 1YEHL 2YMXH 4PJIF 5ICXA 3W9EB 1DL7L 2VMFA 4I0CC 3P4NA 3T3ME 2BHUA 5IB5A 4L4TB 3SKJH 15C8H 3UTPD 2OTWB 1Q1JL 4NKDA 5GISL 3PV6B 4F7TB 5E4EB 1BQLH 1INDH 4PGCB 4YHMH 3DX9A 2ITCA 1U95A 3I6LD 3HMWH 3X12A 3F7VA 4JR9L 1ITCA 2IBGA 3NIGE 5DFVC 5T5NG 3IETA 3H3KA 5DJZB 3WFDH 4RGOL 3TYGH 1A47A 1IEBB 1ETZA 5C92A 5F7KC 1J7VR 4RX4A 5M95B 1IGCH 3UPCA 4Y4KB 1I8IB 2MCPL 4TTGA 4JFEE 3NFPB 2ARJQ 2FB4H 4GKNA 1N26A 4DGVL 4LAQL 1QOKA 5C0BB 2XG4A 2IG2H 1G9NL 4K2UH 4I0PC 1UCTA 3DGCR 4JY4B 3T04D 5CJ8A 4OV5A 1IC5H 5IOPB 5JOFB 3MCKA 2IH3A 4L29B 5AZ2H 1RIHH 4HHAB 5F7YC 3QUZA 4C56B 4DN3L 3NFNA 1O0VA 3SGKC 5E8DL 2O5ZL 4JFOA 3TO4C 1AIFA 3Q6GL 4G5ZL 4KK8D 1I4FA 2I60L 4MNQD 1X5KA 4R4NC 5ENWA 4U1KB 3RGVD 1KFAH 1MREH 3VXQA 5C0AA 4KKNA 2H9GB 2NY6B 5BZWA 5HYIA 2HT4C 3G5XA 2X9XA 5IEKA 1SJHA 1VFBB 2VZOA 3D85D 4ODSL 2AXFB 4PJ9C 5IKCB 4J3OC 3ECBA 2IH1A 1YJDL 3TJEL 1FZKB 1W8NA 3I3BA 4PYHA 1LO5B 2E9JA 1JUFB 2BVQB 5D6CB 4BZYA 3O45A 2D0FA 5J9PA 1JRHH 2DQDH 2YBRA 4I5BB 4JO1L 2WBKA 4F57L 5C8JA 4FQQA 2YC1B 5TE6H 2PTUA 3SCMB 3UCRA 4OLZH 2B4CL 3BEWB 3V6OC 2RCSL 3O3AA 5KSBB 4KPHL 3O6FD 5I1HL 4JY6A 1CGUA 1UEMA 4WUUB 2XXCB 4GW4A 4W81A 2E27H 5GGQH 1N0XH 1JK8B 3ULUH 1U3HC 1SHMA 4HKJB 4HT1L 2V17H 1FFNB 4AEIL 3OKMA 4K9EC 4KWUA 4DW2H 5MEQA 4JFHD 1RUPH 1TQCB 1XIWB 4PP1D 3JWOC 3ZHKA 5I8OL 2OM5A 4NNYB 1ZLUK 1WGOA 1MY7A 2GT9B 3F6LA 5D1QB 1G7LA 3IU3A 1DLFL 3SOBH 3C9NA 3V0VB 2DD8L 1NAMB 3G5ZB 3MJ7B 5FYKL 4PD4J 4X5WB 3MYZA 4M7KH 5EBLB 5GZOD 3AB0B 2F54A 3ZSSA 4Y5VA 1WLHA 5JUEL 5I1CL 4WW1B 5D7LD 5GZNC 4XC3L 4KUCD 3JWNC 2RB8A 3AAZB 3ARFA 3V6ZB 3UDWA 2CR6A 3BRDA 4HPOH 2C3VB 1ZT1A 5FO8B 4ZUTA 1Z5LA 2ESVD 3RY4A 3X11A 4Q0XH 3FL7A 3MGAA 3NPZB 1J1XL 1ZANH 1A4KB 3GJEA 3MLRL 4GG6B 4F15C 1NEZB 1R3HA 3VFRA 3ARED 2VL5B 4H20H 3VGGA 1HKLL 4X6BA 4JO4L 4H8WH 4Y19B 4B41A 2DMBA 3RWJB 4AQ1B 4OCXH 5IB2A 4EN3D 3WHE0 4F9PA 4HCRH 4G8GD 4XPBL 1KIQA 3RGVC 4GFTB 2AK4D 3P3YA 1B9ZA 3BP7A 2VB5A 5J3HC 3BN9D 1WTLA 1MFAL 3AXLA 4J3UA 4ODXB 5D7IE 1JHKL 1VGKB 4MJ5B 4Y1AA 4DCQA 3HUJF 1KPUB 3VJ6A 1J05B 4QOKB 1GC1C 1IKNC 4MA3B 5I71C 4ZPVA 4XPHL 1UYWL 5BO1H 5J0BA 1HCVA 4UTBH 5LGJB 3FRUA 4KI5F 3W2DL 4HJJL 3DI3B 4DGYH 5IIEB 4B53A 2GSGA 1K6QL 3PIQB 4ZG1A 3QRFM 1QSFB 5E70A 5CKAA 4FG6D 4XWGH 5E2TL 1FH5H 1UA6L 2NY2D 5GRXG 5I16B 4YIQA 2A6DB 2XQBH 4OZFB 5DTFB 4ZNCD 2IQAA 4G9DB 1MAML 4F7MA 3RIFF 3BP6B 3MRKA 1FSKC 3ZMRA 3QXAB 5T1LA 4JDZB 4HIHB 2RFXB 2OSLA 2YOCA 3Q2CA 4H5SB 1L6XA 3FMGH 2XN9E 1P7QB 5AG8A 2J8UA 1IC7H 4GRWE 4JN2B 1CT8B 1CXIA 4IRSC 1XH3B 4MA1C 3MUGB 5TDPB 4OKDA 3KPSE 5DK0A 5DHYB 4CU8A 5CHNB 3RA7H 4NJ9H 5KSAA 2NLJA 3CUPB 2NTFA 2UWEF 2HFEA 4PJAE 5DJCA 1NBVL 3AFLA 1E4XL 5C09B 4WTZA 1D6VH 5HYEA 3OB0K 4Z7VF 1YYLL 1ZHKA 4PJXB 4JM2F 1MIML 3O11B 5ERWA 5JLZA 2VR9A 1WIPA 5HVHB 2HLAB 2FL5A 5E4EC 2RIKA 5D4QA 2A9MH 3HS0A 4JVWA 4ISVA 1SBSL 4P2QA 2EIBA 3TO2B 3WXVH 4UDTB 3S88L 3LKSA 2R69L 1YEJH 3I6KB 4XXDB 5DD5H 4YFLI 2AKRA 4L3EA 1RHHB 4M1DH 5IB1B 1A1MA 3FB6A 1S7RA 1A6VH 5I76B 2UV3A 5D2LE 3OKDB 3VDCA 1PKOA 4M03A 3HB3D 1N5YL 1OGAB 1T2XA 3VRLF 4JFXB 3WNKA 3GNML 4Y4KC 4OD1L 1SY6L 5GXBB 4X6DA 5IVZA 4FG6C 2CRYA 2DKSA 3U4EB 4L4VA 1NMBH 2A6JB 4I3SH 1A14L 3PDGA 1IBGL 4Z7UF 3W5MA 1MQKH 4NKMB 2AJXH 2I07B 4C59B 3UYOD 2HJFB 1BF8A 4L8CB 4JKKA 2FO4B 5DFTA 3O3BB 5E2WH 1IQWH 2HJKB 2IBBA 3MLZL 1LE9A 4J3SA 1FL3B 1P2CB 2VABA 1I9IL 3BKJL 5EO9A 3TGXA 1CDHA 3RX7A 4ZFOA 1A3LL 5IJKC 1RZJC 3GSXA 4HS3A 1N5AA 1J8HE 5FOBB 2NY6C 1U8IB 2MSPA 5A40E 3WEXB 3K46A 1W2KT 1XT5A 2NXYD 4F58L 1HQ4A 3T1WA 5B3JE 4F33B 4QCIB 2VLKE 3CPLA 3WIHL 1BEYL 4HGMA 3ARBB 1JGVH 4DGIL 3SCMC 4LNRB 1JWMB 1VPOL 4NSKB 3VGAB 4XVSL 5FYJH 1YNKH 4Y0GA 2V7NB 5SWZA 1MFCH 4UBDC 4CJ1A 3VI4E 1IAKA 1JRHI 5KS9B 4Z7NE 7FABH 1U8KB 2YUVA 2YUXA 2YRZA 4IRZL 4LQFL 5JPMB 4WI2A 5LAXB 5L8KB 3MRGB 1R3IH 5EZIL 1TQCC 1XIWC 2EDQA 1LEIA 2G5BB 1UZ6F 4PJHA 5IQ9A 4BKLB 2EE9A 1FN4B 2P5EE 1ZSDB 5D1QC 5EPMA 2A6KA 4I2XB 1OTTC 1NBZB 4PUBL 3G5VA 3AB0C 1ZHLB 1HH6B 4Y2OA 1LNUB 2ZUSA 1FFPA 1P1ZA 3K2UL 1CGWA 1KELL 1I7ZB 1YMMA 4FOMA 2XOTA 3I3DA 3MR9A 3BUYA 5B21A 3F62A 4JFFA 2NCMA 3RNKA 1TQBC 2FJGB 3H9SA 3ZSTA 1H3PH 2VISB 3FQUA 4KKBC 1X7QB 1I8LA 3JBG7 3OL2A 3C5SB 3MV01 1B0GA 3RPIB 2X4OA 2EEBA 2FJFA 3BPNB 2JK5A 5EWIH 3MV9B 1JGDB 2NXZB 2IAMB 3KPQA 1FLRH 4O9HL 1MCWW 1DDHA 2W1NA 5ECJE 4YR6A 2IJ0C 2C3XA 1RZIB 4M48L 2KBGA 1NGQH 3RBGA 4WHCA 2XN9D 3RHWK 5GS3A 1Q72H 3E8UH 4GRLB 4Z7UA 3K4DA 5D71L 3LRGA 3CH1B 3QFDA 3KPSD 3SKMB 4XMPL 4PGDB 2P47B 1M7DB 2CLRA 4NUGH 4XBPB 3A6CL 3PWPA 3JV6A 4MAYD 2X89D 3QSKB 4LMQI 1JYNA 4X6CE 1GOHA 5C0IA 3K0WA 2H32B 3KLSA 1K85A 1XF5B 3IJHA 1CIDA 2E3VA 5IG7B 2K3TA 1OAXH 2Y06L 1N59B 4U7KA 3D25A 3ARPA 1MVUA 2P8PA 5BS0B 3I9GL 1EFXD 3JV4B 3ZE2E 2CXKA 2APXA 43C9A 5CGYC 1WK0A 1X4YA 1K8IB 1R0AL 1B2WH 5JHLH 4J7RA 2EYTA 2ZJSL 4X4MA 4AL8H 3KS0H 5C2UB 1NPUA 2BOCB 4LHUB 1TETL 3QAZC 4UT7L 1KIUA 4GXVL 4NQCE 5CD5C 3TBTB 1ED3B 4ZQKA 2EE2A 1KCRH 3GIVA 2X1XR 5FYKE 5I6XB 2Z9TA 1F3JA 5DJ0B 1KBGH 1XF1A 2WWKT 3IFLL 1SQ2N 1TZGH 5T3XE 5EOTB 1Q94A 1JCKA 4QRPE 2LAAA 5C0NC 3MJ9L 3VA6A 3M8OL 5AEAA 2I9LA 2VH5H 4Y88A 4IIQB 1XGPA 5J12B 2ZSVA 5FDYA 1MHCB 1SYVB 4UUJA 3UAJC 5EU5A 2ITDB 3SE9L 1U0QA 4LSTL 3F65A 4O02L 3FHQA 3HPLB 3ARBD 3GI9H 5DD1L 4JKWA 4KROD 5HVHC 1QUNA 1BOGB 1AQDA 1X5LA 1JTOA 3IS0X 4JKLA 5HYQA 5E8NA 3W0WA 4GKZB 3IFNH 3UZEA 3L5WA 3CC5A 3S36X 4Y16B 1B90A 3WFEL 4RFEB 1J8HD 3WJLA 1HYSD 3FQNB 2I9TA 3OBAA 1E6OH 1YEIH 3BZDA 3EW3B 4QXTA 1A7QH 1DBMH 5E8EB 5ITFA 1U8PB 3G08B 2VLKD 3Q3GA 4MXQD 5FFLA 4LPYA 4HEPG 3MLSL 1HILA 3SE3A 4HIIB 1FCGA 2PR4H 2AJUH 4HKBB 2XKUA 1ZHBA 3JSSA 4ZDHA 3IFOB 4ODUA 5HXMA 4U1NB 3VFTA 2APBA 4QRQB 5JW3L 4FQPA 4G8EB 3UXFA 4EUPH 2Z35A 3MX0A 4NUJB 5GQBA 2OZ4L 2O5XL 4ELMA 3U83A 1JWSB 3CCHB 4QT5A 1RUQL 2Y7QA 1OP3K 3GSRB 2JIXA 3ARQA 5ESVB 4WI8A 2P5ED 4RISH 4OCYL 3DTXA 4PJCA 4OZGF 5INDA 1U8NB 3D18B 3P9MA 2EIZA 2J4WL 5I2IB 5IVXE 5D5MF 4GBXA 4JHBA 1KN2L 3BJ91 3OHXB 3HC4H 4JQIL 3QEQE 1V05A 1FGVL 3WD5L 5GS1B 4YHKL 1KGCE 5GS2D 5E5MB 2DM7A 1PKQA 1IRAY 4JJ5A 4OF6A 1QR1A 3QHFL 1T7YA 2DDQL 4P3DA 3PGDB 1IEAB 3ARBC 4JN1L 5F1NB 1NCAH 1F58H 1YPZA 3C60A 3VGAC 1MFNA 5D1XB 5J1SC 3GMPB 2N4IA 3DXAB 4PJEA 4X7CC 4X4ZA 1T03L 4P4KA 3IRPX 1FAIH 1G9ML 4QRUA 4X80H 2ZP0T 1PQZB 1NEZG 2QQKL 5TE7L 4HFWA 2WANA 1MI5B 2WBJD 3IDNA 4EOWH 4PJ7B 2NW3A 1T7XA 4L4JA 4PLKC 5E94A 2CXGA 2HTLD 3ROLA 2CO7B 4PRHA 2FX9H 4PV9A 4XX1G 4JPIB 3TC9A 1YYML 4ONGL 2B0SH 3HE6B 1A0QL 1NFDB 1ORSA 3PL6D 3ZTNH 1MUJA 3P77B 2DQEL 3RX5A 4Q9QL 1MCNA 1EUUA 3NA4A 1OARH 3WLWC 1UWEH 3E6FB 5CP3H 1J0JA 4PGEA 3BT2L 1A9EA 4HWUA 5IGXL 1HWGB 5EU7C 1FRGL 4NC1E 4ZAKD 2VXSH 3PG2A 2ATPB 1OCWL 4UT9L 3MRRA 2EEAA 1NGZA 2E7CA 5CBEA 1SEBB 3RWGA 5F7WC 3ZL4H 2WP3O 3CH8A 3BPNC 3W9DA 2BSSB 3VD7A 3STLB 3QCUL 3V5KA 4AG4L 4H88L 2NXZC 2IAMC 1XGUB 4PTTB 3AS3A 1L7IL 4JE4B 3ARZA 3GJFH 4OZFG 1BIIB 4K3EL 1QLEH 2CKBA 5DLML 4NQCD 5D72H 4GRLC 2MWCA 3ETBF 2EE3A 2XV6B 5I1IL 1OSPL 4EBQH 2F53A 2Q3ZA 5FYKD 3OPZL 3HMXH 2OJEB 5T3XD 3QULA 4H1LB 1G6RH 5ETUA 3SKOB 1CDUA 4QRPD 2VDOL 4HW6A 3SGJA 3UTQA 1T1ZB 2FX8L 2YA0A 3MRMB 5J57B 1CLCA 1G9NC 1TENA 5C0RL 4MGXA 3EFDL 5BZDA 1UWGL 2PXYD 4JDTH 2JLLA 2WBJC 1G7JA 2ADJB 3BH9B 2W59A 1PX4A 2P4AB 3CFCL 1RZGA 4MHHG 5H94A 1QSEB 3QISA 1KG0B 4WHYG 3VWJD 1D6EB 2EXYD 1SYSB 1ZK9A 5AYQA 1FNGB 5GS2H 1NGXB 3T0EE 1AC6A 1VHPA 1QHOA 3IKCA 1WZ1H 5C0AE 2GY7B 1YJDC 4Z78A 5TDOB 1NL0H 2N7AA 4KK6D 1NMAH 3FAWA 5JQ6L 5BV7L 3UJJH 3IDIB 4WO4A 1EFQA 4P23B 2GIYA 4XH2B 1YY8A 2AEQL 4U6YA 3LMJH 3MV8A 5I6XC 1AJ7H 1BZ7A 3QUML 1N3NA 3DRTA 2PO6A 1P4BH 3QR2A 5HYSA 2PW2A 4DN3H 1UVQB 5MENB 1CFVL 4IIQC 2O5ZH 2R4RH 1FBIH 3RFZC 3T8XA 2X4SB 3C6LB 3OKOA 5J7CC 3IDGB 3D69A 1T21B 3CIQA 2MHAB 3GSNH 4HUWB 4FABH 5ESQB 4ODSH 3WS6C 3N85L 4HIJB 4JCMA 1N6VA 4F2MB 4PJIE 1Q9OA 4NO5A 4EVNA 4UZGA 4G6JL 4Y16C 3STZB 3O0RH 4KJYA 4QRTA 4CGTA 1V3LA 4JO1H 1Y6KR 1CDYA 1OLLA 1HDMA 1A8JH 4Z7WB 3FB7A 2ZSWB 3QEQD 1S9WB 3DUHA 3RNQB 1KGCD 3VXMB 5I1HH 4YQXH 2JJWA 1NGWA 2Y36L 1KENL 1A6UL 2P5WA 2ZOLB 3DV4A 2AXGB 1TCRB 3LN5B 2DLEA 4ZPTA 3TBVB 4CBPA 3QZWB 4KI1A 1K3IA 4LKXA 4UU9B 3GB7A 2XTLA 3L3IA 1H0DA 3KJ6H 4P5MA 3N9GH 2HVJA 3T65A 4HULB 4KJPC 1TMCB 3TBSB 1QVOA 4D9RE 3C2AL 1NBYA 4C83B 2DTML 2R9HD 4DEPB 5T3XH 5EZLB 3KYNB 3UO1L 3RIAK 1HYRC 4PS4L 4XC3H 5JIHA 3MODH 3RRQA 3OXRB 4OZHF 3DVGB 3ARDD 5CZXD 2GTWB 2VDRL 3ARUA 3E6HA 4K07A 5MEOB 1JGEB 1HHJA 3L7FA 3HZKA 1RUKH 5CS7A 2OX5A 1ZA6B 1A1NB 4PPTA 5I30H 4D3CH 2RBLA 2DIBA 5HHXH 3FQWB 1OY3B 5GS1C 1P7KB 4LQ1A 3QNZB 3ZYJA 3S98A 4AM0A 3TCLB 3FCTA 3MMEB 2HVKA 2LTQB 4NQDB 4O58L 5FHBL 5D1XC 2DOCA 4TNWK 3WHXB 1EEZA 1TJIH 2HT2C 1DUYA 1MF2L 2QKIB 1BD2A 2YD1A 1J0HA 4PJ8A 4MNGA 1BQHA 1Z3GL 3ZT6A 2BXYA 4EI6B 1KTKE 2N56A 2QSTA 3EYSL 3EGSB 3DBXB 4DFHA 1CGTA 1QSED 3V4VH 4Q7DA 2HWZL 3LS4H 2WNGA 3VXPB 4YHIA 1OTUD 5JORA 5DUPL 3CXHJ 3HE6C 3UJIL 2FLBT 4YUEL 4YDVA 3QDGA 3I02A 5JHDA 4PJBA 3DVIA 1Q9WA 3GIZH 5J1TC 2BNUA 4QHUB 1TVBA 2J6EL 1UA6H 4YDJB 5CJXC 1WFTA 2FYYB 1LO3H 4R7DB 3QJFB 4R8WL 4MVBD 3O6MH 4UOW0 4IOSD 5CCKH 5E6YA 2DQUL 2VLJE 2DJUA 2X09A 5CJQL 5C6TH 1YDPB 1GOFA 2EZ0C 4WW2B 4MNHB 5E7BA 4TUKL 4BSVA 1UKTA 4XHQA 5ID1B 3MJGX 2Q87A 4YDKH 2NNAB 3ARDC 4LSQL 3T0ED 1DFBH 3MLVL 3P2TA 2EDHA 4I48A 1KXTB 1KPRB 4OCWL 3TBYA 1A6WL 4UT6L 1UM4L 1YNTA 2DLIA 5B38A 3TA3B 5DO2D 3HLAB 4IS6A 3TESA 4LHUG 4G9FE 2LU3A 4OM1H 2XQYG 4PV8B 1DEEA 5DHVA 4U05A 3N1GC 3HR5B 1MVFA 3KNBB 2Z93B 1P69B 4TNVK 3WFHB 1G7PA 4X9GA 4WNQA 4UB0L 1SBSH 1CLYL 2EIDA 4KJWD 3RL1B 3TN0D 3KPRB 2BVUA 3WSQH 3B9EA 1MCLA 4S1QL 2GJZA 3HUJE 4P4RB 2CPCA 5K9OB 1R5VB 4KI5E 2M2DA 5HPMA 5JDSB 4WDIA 2CGRH 1AD0B 4U3HA 4ONHA 5IHUH 2Z31A 1AXIB 4RSVA 3GNMH 4YXKH 3B2VL 4OD1H 3DV6A 3VXNB 3QIUD 4FQ1H 5GRZA 4PRPA 4WWKD 1F3DJ 1K4DB 5GGVL 4U6HB 2I26N 4XP4H 4YXHL 3C08L 4HWEH 3ET9F 4ZTPH 1BWWA 3T1FA 1BPVA 3MJ8B 3G04B 1OM3H 3H7LA 4P23C 5HBBA 35C8H 3CFEA 5FB8B 2B20A 4AQOA 5BQ7A 3EOTL 1A14H 2ZPKH 4LDEB 1GAFL 3QEHB 4FZEL 1A02N 2O61B 4LEXL 1IGJB 1I3UA 3BI9X 4NGHL 2A1WL 4RZCA 5KVDL 3WJJA 4OCNC 1HKFA 1QLRB 1GYAA 3FT3B 2AJYL 4F9LA 3VW3L 1J1OL 5FK9A 4PJ5E 2MMXA 4D9RD 3C6LC 4R3SB 3HNTH 3MRCB 5EZOH 2UWEE 3T0EC 3VFOB 4Z7QF 4X4YA 1S7VA 3MLXL 1LEGA 1RIUH 4HUMB 4IBLT 1X6LA 1ACYL 4TUJA 4Z7VE 4IDJH 1IGYA 3KLDA 1UXWA 2PTTA 2FHBA 5IESH 1S7XB 1MWAL 2GCYA 2C5DC 1FFQA 5B8CB 1XMWA 1PYWB 4PRIB 4N1CA 2DQGL 3IDUA 3BQUA 1VPOH 3RZCA 4EKXA 1S7WA 4YPGA 2G9HB 1X5IA 4N0YL 4FFYH 1CXEA 1P4LA 4RMRA 5SWQB 5KZCB 3HCVA 2NY4B 1HH9A 3O4LB 4LCYA 1BJ1J 3S4SB 2GW5A 1BHGA 1VACA 4FTVE 2IFGA 5HYJE 2H6PA 3TZVB 1KB9K 1KN4H 5AZEH 2VJXA 3HPJB 4JFFE 3V5DB 3BHBA 1X5FA 4M7JL 5EOCL 4OAWB 1A9BB 5JA8B 1I7UB 5KVGL 5KTEH 3GRWA 4M8QA 5H37H 3BFOA 3VRLE 4OJFL 4P59H 3RWHA 1MFBH 1S3KH 5EOQL 1T22A 1C12A 3C6SA 1T0MB 4R4FL 4Z77A 4P9ML 3OXSA 1U9KA 3HAEH 5DMJB 2F5BL 4DEPC 3PXJA 5I1JL 5IP4A 3EOYG 3Q6FB 2IPTH 1QYGL 3LV3A 4M5ZL 3RAJL 3KLAB 3HE7D 1DCLA 1BQUA 1QQDA 1NC4A 3KR3H 4GMSL 1LHZA 4Z7UE 2DWEB 1GPOL 4I8DA 4JRYB 2Y4SA 5EUOB 3AM8C 1BVKB 3PJSA 2KDGA 1KCLA 4IMKA 3S37L 1UQSA 3KHOA 4YHZL 5LVEA 4IRJD 3WNMA 1VADB 4L1HA 4R6UA 4JGJA 1BGXH 1T1WB 2CDFA 4HZLA 1EO8L 2FSEA 3OKEB 2NW2B 4HMCA 3O9WA 2VLJD 4XBGA 1FAKT 4LL9A 4R96A 2YN5A 4WI3A 1S9VA 4KTDH 2LTQC 5EU6A 4LLMA 3HZYA 4M1GH 3IVKA 2VDMH 2OXHA 3MRFB 1R3JA 1EVTC 2CJUH 2JELL 2NMSA 2XKNA 3FO0L 2Q86A 4M8VA 3QIWB 3HG1E 3I84A 4UQ3A 3MNWB 3GMOB 4FXKA 4L9LA 3CDYA 2HKFH 4FFWD 4E41A 5I8KH 1N0LA 2XA8H 1S9YA 1QBMH 1J86A 1J87A 3EOAA 3LD8B 1HXYB 2E7BA 1J88A 5H35A 2XZQL 4I18B 4G9FD 5GS0L 3F8UB 3QH3A 4HEME 3IRZA 1LO0L 4OFIA 2FGZA 2NY7L 2QHRL 4Q74A 5FCUH 2KPNA 2Y06H 1FFRA 4RAHA 3BEVB 1UZ6E 4WUKH 5BRZA 4H1LG 5D1ZD 2BJMH 5DS8B 3D0LA 2QR0B 2BVYA 4L3CA 5E6IB 4AIXA 4CL7A 1DN2A 3QFJE 4X4XB 1DQJA 4U1MA 3U1SL 5D70H 1S7UA 1QA9A 3GFUA 4WW2C 5HJ3B 4KI5D 5IBLD 2FD6H 4YC2B 5CP7A 1JMZA 3QB7C 2VTFA 4O2CA 3MCG1 4HF5H 2IF7A 5CSZA 3LVEA 2H8PA 3IFPB 1YN7A 1S5IL 4X7FC 3IFLH 4FQJL 4HH8A 1RURL 4G6KH 4BSJA 5EORL 4ODVH 1EAPB 4Y4HA 1WAAF 4YDIL 5A2LH 3MZTA 4H26A 3KPMA 3DUSB 3TA3C 5DJDA 2D7MA 4FQXA 4BFIB 4QXUH 1BFSA 5DMIH 3BZ4B 1CICA 3CVHA 2PYEB 3LKOA 2E7HA 5MI0B 2OI9B 4ODWB 1R5IB 3DUUA 3NIDE 2YD9A 5KSVA 3TIDB 2ICEA 3QUXA 3BZEB 3CVIL 4X7DC 4X99B 3V95A 4PJ5D 3ARGD 4ZFZA 4G43B 1U8QA 3SDCD 4OKVA 3D3VE 5E2UH 3BN3B 4HC1L 3THML 5A2FA 3BXNB 3L3KB 4CU7A 5IMKB 1AP2B 4LF3B 5C1MB 4ZSOE 4XCCH 1Y0LB 5HVGB 3TVMD 2AJVL 2BVPA 4JM2D 3BESR 4OM0L 2AI0L 4BZ1L 4OLWH 4QXGL 1WFUA 3VXUE 3BVNA 4ZO7A 2YPLB 1X5YA 4ZYKA 5CWSA 3VWKD 2VDNL 2MNUA 1EHAA 4JRXA 4POZC 2VXTL 5IMOA 3T2QA 1LDSA 3P9WB 1D5IH 4OIAA 4Z5RB 5DD0L 2DJSA 4FTVD 5HYJD 5EBWB 1GGTA 4K8RL 3UYRH 3VFGH 4HKXA 4E5XB 3IF1B 1HHIB 1NKRA 1TNMA 4ZXBB 3NH7L 2OZ4H 3LRSA 5GJTH 1FNSH 1LGVA 2R56L 1RUQH 2NZ9D 1G7HB 1G9MC 3MXVH 5FUZH 1KPVA 2DB8A 4AENA 4PG2A 1KJVA 1S9XA 3QZWG 2YSSB 3PWJA 2WBWB 5ABDE 3ULVL 1CGSH 1NAKL 5JW4Q 3MRDA 3FQTA 4LPWA 1KUMA 5DK3A 5C07B 4GAGH 5BVPL 3SBWA 1ORQB 4TSCL 1H3WM 4LVOC 4OGXL 4EUPB 1Q8MA 2DQHH 3E2HB 4OQTH 4E42A 3QJHB 4PRHE 2FATL 3TV3L 1FVCA 5K9JH 4UV4L 1W0VB 3MYJB 4MX7B 4W4NA 1FZMA 1T5XB 5B8CC 3LKRB 3HHRB 1IILE 2XZAL 3P0YH 4Z8FL 1Y18A 3GSUB 3VFMA 1YA5A 2X40A 4MWFB 2YEZB 2GAZA 5C08E 3RWFA 2C1OB 3SDXB 2HJLA 3L3DB 1XCTB 3TYFB 4KHXH 1NLBL 5GRVK 5FA3A 4I9WE 3SY0A 2V2WB 3TZVC 2FX7L 3KYMB 4PJDB 1WAAA 3O2VH 3LB6C 1GZQA 4RAUB 1I9JH 2A6IB 1XAUA 2VDQL 2BRQA 5T5NF 3P73B 4S1SH 2IADA 3M1BB 2CKNA 4EXPX 3S36H 3QWOB 2V5YA 1BREA 2PTVA 2GJ6A 3ALXA 2UVEA 2YD5A 3HG1D 4OIIH 4P5KA 5J89A 1BWMA 1TVHB 4QRRE 5HHPB 5J6GB 3P0VL 4FS0A 1RJZA 3TT3L 2NTSP 5BOZG 5ADOH 1BBDL 3BDYL 5DI8B 5GRUH 5IHLB 5IV2B 5E1AA 3L7EB 2JCCF 1IKFH 2QQNH 1IAOA 1CR9H 4HXAL 2XYCA 3OJDA 5ICYA 2YR3A 2HN7A 3D0VB 2DI9A 3M45A 4R0LB 5FAAA 4CVZB 1FZOB 1C8PA 4OZGE 4B0MM 2APWA 3DLQR 5DZOA 3MLTB 4AG4H 4GUPB 4NQVB 3S96A 3PP3H 5D5ME 3HZVB 4LHQB 4I3RH 1GGCH 3QFJD 1L7IH 4G6ML 3NOIA 3LEXA 3O3EA 3U30B 2NX5B 1JWUB 5HGDA 3CFKB 2A83A 5CUSL 3MBXL 2W60B 4KRLB 4Y4FB 4JFDE 1AR2A 1BX2A 3B9KB 4TNWF 3IAPA 4UDUB 5D7JD 4CMMB 2ZOKA 2CRMA 1OSPH 4JDVA 1DBJL 3QIWC 5HHQB 4BSWB 5HGHA 3V0WL 1FP5A 3UTTA 2DYPA 2IANB 4XBEL 2GKIA 3CZFA 4XCEA 3GUTB 2VIRB 3LD8C 2WK2A 3GJFB 4I18C 4LLDA 3MOAL 2ID5A 3VFSB 4H0IA 1NCBH 4WI6A 1UB6A 2R23A 3BP4A 3BUTA 4XNYL 25C8L 1J10A 3BMVA 3VH8A 4DAGH 4EI5A 1FORL 4M1CC 5D6DA 1LP9A 1NDGB 4PY7B 3WMSA 5E5RB 4AH2B 1UG9A 1I75A 5E8PB 3PP4H 1OAKL 3G6JB 2Q6WA 1CLOL 1PZ5B 1RHFA 2AGJL 3GMMA 1CTNA 1RU9H 5DGQA 4H0GA 1IC4L 1AGDA 3D3VD 1I3GH 1V3KA 1DN0B 1N4XH 5E6IC 4FQIH 2BCKB 1O7SA 4WFHE 2F5AH 1DANT 1NUNB 3PWUB 4KDTC 3F5WB 4RQQA 4B5EA 3UPAA 1LO2H 2EDRA 5JQ6H 2X4TA 4YC2C 3QUKA 1MWAB 3QUYA 5DEGB 3VXUD 2CLZB 4GQ9H 3BSZL 2EYRA 5DUBA 5JW5A 3KPLA 3ME0A 5C07D 1OGTB 4LSRL 2MPAL 1U2CA 4WTWA 5GSVA 2VXUL 1F6LL 5LQBL 3V0AC 2DQCL 2I27N 4N1HB 2KH2B 4HIXL 4PG9A 1Z0MA 4HX1B 3UC0L 1JIBA 2X4NB 4P5TB 1MCPL 1KJ2L 3IXAB 2C3WA 3EYOB 3QDJE 4OI7A 5MI0C 1BFOA 2IPKB 2OI9C 3U46A 3NZ8A 1FNLA 1Q9KB 3OQ3B 3PNWA 4TNVF 1GGIL 5DD6B 3UEZA 4I77L 3C60D 5BCAA 5I8CA 5L88H 3QRGH 2BNRB 3H0TB 3NN8B 3OKKA 2VZSA 1C16A 4BFGA 4ZMAT 2COQA 2VO5A 1AGFB 3BRFA 1GZPA 3MV7B 4XCFH 2P8LB 4XPFH 5GGRA 4OF8A 3GHBL 1YC7A 4HUXA 1FO0B 4XCNB 2VN7A 5HGAA 1RK0B 3Q48A 3H2WA 1VKXA 4NO3A 5HHME 5I1AA 3UMTA 3QNXA 2VSCA 2AVGA 3U4AA 2QHLA 3OWEA 3GSNB 1WFOA 1A6UH 4Y5YB 4L8BB 4YGVA 1T04B 3S3PA 1A2YB 4X6EA 3L6FB 3IAGC 4WEUD 1UM6L 2OP4H 4F37F 5CKGA 5C08D 3A6BL 1MRFL 2B2XL 3D2UB 5F3BB 1MNUH 2APFA 2W9EL 4ZUWA 5IFJA 1QFPA 8FABB 5JXAL 4X98A 1BM3H 4JREB 1Y6MR 2VLRB 4I9WD 5CIPB 4ZXBC 3QEGH 3HTLX 4YBQD 1NCWL 4P2OA 4W4OA 5FUCC 5EZJA 3S4SG 4APQD 3UO1H 1QRKA 2KL6A 2AJ3B 4NNXB 2ICWA 2R1XB 4ZD3H 1MCHA 3B5HA 3NIFF 3FZUC 5E2VH 4Q9BA 4YHNA 4WJ5A 4UNVA 4QRRD 1IFHL 1KTDB 3NTCH 3VXRA 1D3CA 2YK1H 3HZMA 4NCC1 3P30H 3BIKB 3O41B 2PETA 3E2HC 5DJYA 1SVZA 3CDGA 3JWDH 3U36A 3CFJB 1MHEA 3P4MB 4OZIB 3FO1B 5DF0A 1AE6H 2ADGA 1QRNA 4QYOA 4YHLH 3LH2H 2NY0B 1A7OL 1PG7W 2IAND 3U82B 1EMTL 3EDDA 5FHBH 1G7IB 3V6BR 4UQ2B 2ATKA 4CJ0A 2AW2A 1ZLVH 5HDBF 1M6OA 5DT1L 4BH7A 3RI5K 4PBWD 5I18L 3K8MA 2IALB 4GG8B 2HFFB 2WWKO 4AJ0A 4NKIL 1FNFA 1AGBA 4JFDD 4R26H 1T0PB 4V1DA 2Z8SA 1MH5A 5GHWL 2KKQA 5DUPH 1TITA 4YUEH 5J6HA 1I7RB 5D2NA 1KTRL 5IT2H 3HR6A 4F8TA 1RK1B 2F58H 1CFNA 5ELIA 5DQ9B 1AGEA 4U1JA 2OR9H 4DN4H 5L2KA 4LRNL 3ELAT 1VCAA 4GKSA 1AD9B 4IM8A 3H3PH 2XTJE 2FNBA 2VDPL 4YXLH 3RTQA 1HHHB 3LS5H 5I8EB 4S1DC 4UTAL 3VXSB 3S3JA 1R3LB 4UILH 4HAFA 1U91B 3MUZ1 2BRRH 3QWRA 1R3KA 4OFDA 5T3ZL 4O51A 3GZKA 4S2SB 4R0LC 1MCRA 1FQ9C 1YY9D 4MQ7B 4OZHE 2FIKB 1IQDB 4QKXB 4ZFFA 5CEZH 4LSQH 3VFNA 1EUTA 3DMMD 3E3QE 3RVWC 4MDJB 1F11A 3U7YH 3U30C 3IJYA 1DBKH 4OCWH 3WL9A 3J7HA 1JFQH 4UT6H 5C71A 3B9KC 5AWNH 4X0KA 3LCYA 3L3GB 1J11A 1ACZA 3O8XB 5FDWA 1IC1A 3M07A 1MFDL 3FOLB 1RD6A 4PB9L 4OFYA 4MJIE 4LCUB 4QRSB 1T3FA 3PGCB 3SPVB 5KJRL 2VXVH 2EEDA 3OR6A 4PRPE 1XF2A 3KPOB 4N5ED 1PSKL 5F1IB 2ICCA 3L5JA 3MFFB 3T08A 5ESAB 3ZKXB 4JHAL 1FLTX 1X5ZA 3QDJD 1E0OB 3IJSA 2R1WA 1CVRA 3WS3B 4JM4L 1EIBA 1UADC 3EJJX 5T1KD 3D2UD 1JGLH 4JANB 3RDTA 1G9EA 4OGYL 2ZCLH 3DO7A 2CKBH 2VLRD 1KCVL 5DJ8A 1FG2B 4TTDC 3ZKMC 3L1OH 2VXQH 4JKPH 1ZGLA 2MOVA 1JPGB 5GGVH 5HHMD 4KZEH 3LQZA 4TVPL 1ZHNB 2FBJL 2XFXB 1U6AL 3PWVB 1DQQB 1NC2B 3T4AB 1S7QB 1UEYA 4P2RB 1EZVY 2R2EB 1IL1A 1SJXA 5F9JA 4LCWE 3TH4T 1KIRA 2IGFL 3QPQD 2LFGA 2CDGB 3K1KC 3SJVB 1JPTH 2A1WH 5DJ6B 4WU5B 5EC1A 1QFHA 5GS0D 5JPNA 2ZKHH 1WZKA 4GQPH 1NGYA 4P5TC 4P9HL 4LIQL 4G6FB 2IMNA 4B7LA 3P4NB 3GBNH 5T5FH 2IC2A 3SDAA 4YX2L 1H3UA 3A6OA 1HOCB 4ZNEE 5LGHL 1I7TB 4NKDB 4M6MH 4PJFA 4PJGF 5MEPB 2C4FU 3V6OA 4P57A 4HG4K 5IM7A 3F7YA 3DX9B 1PW3A 2ITCB 1G7QA 3AU1A 3U2SA 1U95B 1IGML 3SQOL 3X12B 4XNXL 3ZKNC 2Z4QB 3F7VB 3V5HB 3K7UA 3IETB 5C0FA 3PGFH 3C87A 2X4PA 1ZLUH 4A6YA 1D9KD 5AG9A 3R4DA 1IMHC 1ETZB 3DROA 3IAQA 1B3JA 4HCRA 4EUPG 3F12A 3BPCA 4URTB 4OCRL 3DETD 4ESKA 4LSDA 3WUWA 4GKNB 2VLLA 2EYSA 1GH7A 1F42A 5KVGH 5B4MD 1EJ6A 4HD9A 4P46D 1NUGA 4JREC 1C5CL 3MACH 4OV5B 4DKFL 3VU2A 1XCQA 3MCKB 1MHPL 2IH3B 3RUGA 5FGCE 5A1AA 3S34L 4N0UE 3NAAL 4XCYA 3IU4H 3QUZB 2XRAH 1HSAA 3NFNB 4M5ZH 4ZTOH 4QWWC 4JFOB 1AIFB 4KV5F 1SM3H 1I4FB 3ILQC 4NZRL 4WEBH 5L8JB 5ENWB 1MJ8L 1HHGA 3VXQB 3AROA 1MHHA 4MNQA 3U9UA 1OB1A 2KQNA 3G5XB 3RGVA 5IEKB 1SJHB 2XTJD 4KZDL 4KQ4H 5CZVL 1MRDL 5GS0C 3D85A 3PDOA 3QT2A 4QGYA 3O8XD 5J9PB 3WE6A 3U9PL 2XZCH 4Z7QE 4KRPB 1T80A 4FQQB 5C8JB 1IGTA 2E6QA 3TNNA 2NY0C 4JPWH 2DLFH 5ANMA 1FDLL 3O3AB 1ND0A 5DA4A 5DGRA 4JY6B 4K8RD 1AXTL 2JELH 4MAUH 4GW4B 3O6FA 3OZ9H 5DQJA 4HIEA 4X9FA 4ZS6D 3OKMB 2JKXA 4BZ2H 5MEQB 2BNQE 2K7QA 4JPKL 4MA7H 2VDKH 4LGPB 2OR8A 4NBZB 3EYQD 4RDQG 3SKNB 4F7PA 5I1GL 1J0ZA 1G7LB 3IU3B 1RUAH 4HWZA 3C9NB 4NN5B 4HDIA 2WUCL 2FO1A 3TCXA 4MJID 5K9QI 2NR6D 5IMMA 2F54B 2EXWD 4NWTL 4Y5VB 3ZYIA 2E6PA 2BOBB 4KVCH 4JFQA 2OL3A 3ARFB 3PUCA 3KYKL 1UACL 1VFOA 4LASL 5D7LA 4G7YH 1ZT1B 4ZUTB 1Z5LB 4HBCL 5CJOL 3X11B 1MCOL 3FT2A 5KSBF 4KK9C 1F2XK 3GJEB 2IPUK 3CXDL 4M3JA 2ESVA 1R3HB 3VFRB 1X9QA 1OQXA 3GO1H 3BKYH 1YMHA 4X6BB 4U1IA 3AREA 3OB0H 4Q2ZA 3ES6A 3VFPA 5IB2B 3GSWA 3SQBA 1FFOA 3QG7L 1T2QL 3WFCL 4HMEA 3W9EA 1KIQB 3L3HA 4N9OB 2NYYD 4EN3A 1S5IH 1DZBA 1RMFL 5EFIA 1RFDL 4R97B 4G8GA 2DQFA 3BP7B 5GGTL 3MRJA 2Y25A 3UTSE 3BX7C 1KCUH 3AXLB 2UZIL 2NY3D 2MFNA 4JHWH 2OK0H 3FOMA 3O8XC 3NCMA 4LCWD 4LSUH 3OKNA 2ICWJ 4Y1AB 4DCQB 4KMLB 3VJ6B 1CTOA 3EJZD 3P4OA 4ZPVB 2X9YA 2ZWLT 3FFCE 2YS4A 2VKXA 1T0NA 4OCSH 4K8RC 4X7TA 3FRUB 4GG6F 3ZKXC 3E3QC 3L5IA 2GSGB 3C5ZD 1GGBL 4NQEE 1U3ZA 1GOGA 1FZJA 4ZS6C 5DYOA 2B1AL 1A6TA 3NFPA 1WJ3A 2IQAB 3VFUA 4F7MB 1JYXA 2Q8AH 4BZ1H 3MRKB 3ULVC 1CDIA 3MUJA 1JL8A 3LIZL 5T1LB 4JPVL 3T0DA 5K59F 2OSLB 2WLZA 2NR6C 5C70A 5DHVH 3R1GL 1VSCA 2J8UB 2HMIC 1DBAH 1AKJD 3HNSL 4UV7L 3M17A 4M7ZB 2ADIA 4O2EA 1J5OL 5DK0B 3NH7H 2R8SL 5KSAB 2NLJB 5HD8C 2NTFB 1MEXL 5IJKA 2HFEB 5DJCB 4W68A 2VZ1A 4KDWA 1NBQA 4J3TA 1KCSL 5EBGA 2AJSL 1ZHKB 4HH9B 1AGCA 2JE8A 5ERWB 1JUFA 5D6CA 3MOQA 5JLZB 5JIIA 5T3ZE 1NAKH 4JZOA 3LHPL 1WAAE 1DJSA 4MXWL 2CIKA 3O6LH 1KACB 5EH1A 3FRPA 3HS0B 4TQEH 2HT3D 4ISVB 2B8OT 4P2QB 3PHSA 5GRJL 1A7RH 3PWNA 4I1NB 4JG1L 3TH3T 1ZVSA 4LOUC 2AK1H 3LKSB 1TZHB 2A2QT 2AKRB 4L3EB 4M62L 5I1KL 1A1MB 3FB6B 1YNLL 2JF1A 1DE4A 1S7RB 3ULSA 4RWYL 5GGUA 5IBTL 4XP5L 4Z0BH 1Z9LA 1OT2A 2EDBA 4NNYA 3X14A 1V7ML 1F97A 3H9YA 1EHNA 3O6KL 4UIMA 3G5ZA 3AS1A 4X6DB 5C0JA 5IVZB 2C3HA 9CGTA 5DEZA 3E0GA 4PJXF 3IYLW 1GRWA 4L4VB 4FQ2L 4OLXH 1KEMH 1PLGL 3R06B 2D4DA 2CH8A 5L0QB 3QQ9C 2EDOA 4BQ8A 3QCTL 4P49A 5ICZA 4CN6A 2BNQD 3V7AE 4NOFA 5DMYA 2H3NA 3QUZC 5DC4B 1A4KA 5DUML 3EDFA 4YFDB 1IGFL 1QACA 1NJ9A 2RHEA 4HLZH 1LE9B 3GI8H 2VABB 5EO9B 3BP5A 4ZFOB 2IQ9H 3UTZB 5HGGS 1IZJA 3GSXB 2D2OA 2CMRH 4HS3B 1N5AB 4QHKI 4PR5A 3TP4A 3QQ3A 4XMKL 2QSCL 5DRNA 4WU7B 4E0RA 2EH8L 4RGNB 5IB3A 5SX4H 1E4KA 2DLHA 2D0GA 3MLWH 3LKPA 1HQ4B 3K4ZA 1QEWA 4HAGA 1V8HA 4O4YH 5IF0A 3CPLB 5JXED 3FQXB 4FP8H 3LOWA 5SV4A 4KRPC 3GRWH 1KB9J 3L5XH 3RJDA 3KJ4B 3U7WH 4JY5L 4MJ5A 4X8JA 1W0WA 5ALCL 5SWZB 5FKAB 2X41A 4DVBA 1C5BH 1IAKB 3IGAA 4RGMB 1NDMA 1X4ZA 5TQ2L 3FN0L 3RI5F 1AO7E 3TWCL 1H5BA 4JCLA 1NUDA 1CDJA 2HG5A 3LKQA 3ZE1F 4GH7B 4M7LH 1UZ8A 3PIQA 3UTSD 1LEIB 5C6WH 1UGNA 4Z6AT 4PJHB 5IQ9B 1P5UA 4Q6IA 1A7NL 2EDKA 5EPMB 2ZUVA 1L0YA 4XZUA 3O2DL 4G9DA 4J3VA 4NN5C 4LCCC 3RL2A 4N5UA 2ZUXA 4Z95L 4WCYL 1WEJL 4U49A 4HBQA 4LVNB 4YZFF 5IR1A 5D7IA 1CQKA 1RZ7L 1FFPB 3IDXL 1P1ZB 4JDZA 4YE4H 1YMMB 3FFCD 3ARFC 4JQVA 3UDWC 3EJYC 2WINA 5C3LD 1CLOH 2B5IC 3MR9B 1XGYH 3T3PF 3TT1L 3RNKB 3H9SB 1EXUA 4NQED 1XH3A 4J2XA 1S5HA 3FQUB 1C08A 2I5YH 3FFDA 5CHNA 3D1MC 4JKMA 4JO2L 1JNHA 2AERT 1F4XL 2FJFB 5KS9F 2JK5B 4LGSB 2JCCE 3P9LA 5F93C 2ED7A 4UINL 3KPQB 4DFIA 2A9NL 4Z9KB 4F9PC 4BELD 5KVFL 4YR6B 3SDDD 4LRIA 4XP1H 5EC2A 4HPYH 5I1DA 1AY1H 4LSRH 5HHOE 2HLAA 5AAWA 2XN9A 2ZUYA 1W72A 2D31A 4K7PL 1BFTA 1I1FA 3QFDB 4YHOL 3UC0H 1KJ2H 2Y07L 2OYPA 3TO2A 3NBNA 2CLRB 1IGIL 3KPSA 4OLYH 2CQVA 3D9AL 3PWPB 3JV6B 1CGVA 3QYCA 5GRYA 5F8RC 3LZFH 4PJAA 3BYYA 5C0IB 4MAYA 1OAYH 2FRGP 2X89A 3W82A 1RULL 3SE8L 1I9RL 1IJ9A 5T3ZD 4Y2DD 2XACC 3VRJB 1P6AB 1HCFX 4AYFA 2UVFA 3D25B 1MVUB 2P8PB 4NBXB 3GBLA 1BVZA 3NA9L 43C9B 4NM4H 5EULV 4OFPA 1EFXA 1KLUA 5TQ0H 2D4FA 2EYTB 4R90L 4D9LL 5F7NC 3UPRA 4LSVL 2IWGA 3WDHA 4N9GA 2EH7L 4YHPA 1MRFH 2I07A 3CVHH 1OP3H 2EKSA 3VXRE 2L0DA 2FEDC 4ZQKB 4HKZA 3GIVB 5D2LA 1EDQA 4M7ZC 5HHNA 2R29H 3I50L 1F3JB 1NCWH 3VD9A 1YEEL 1ZEAH 4LSPH 1Q94B 1JN6A 4X7SL 1F4WL 3O3DA 1A3RH 5CILH 4ZS7L 1CFQA 2I9LB 1XGPB 2ZSVB 1G0DA 4UUJB 5EU5B 4K3DL 5FV1L 1KJ3L 2YKLH 1WCBA 2BY3A 2NY1B 5BMFH 3ARBA 1CDCA 1Z9SA 1AQDB 2Y1VA 3RGHA 5TPWH 4HS6A 5HYQB 5M7QA 5E8NB 1RZFH 3CGTA 3W0WB 4JG0H 5DZLA 5SV3A 3P11L 3CC5B 2FBOJ 1Y6NR 4XVJL 4HS8L 5J11B 1A7OH 5I1EL 2I9TB 1U8KA 1BAFH 4DOHB 4TVPD 1J8HA 4DK3A 1MRCH 5F9DC 4QXTB 1RZ8A 4KY1H 5ITFB 1RZJL 4R4BA 3A0OA 3Q3GB 3FTGA 1IM3A 1ERNA 5H37G 3RWCB 1IAIH 4MYWB 4JQXC 3MLUL 1X3DA 1HILB 2VLKA 3MRIA 1OP5K 4I2XA 1A7PL 2BSED 3LQAH 1IT9L 1M71A 3O3UN 1ZHBB 3U79A 3KLHD 5GHWH 1DSFH 5EIIA 4ZDHB 4KQ3L 2XKSA 3D6GA 4ODUB 3VFTB 4X6FA 1AO7D 5L0QC 5L2JA 2Z35B 1OPGL 2Z92A 3BIBX 4ELMB 3TPKA 1G6RA 4QT5B 1Z9MA 4NJAH 5D8JL 3RIFK 3EYVA 2Y7QB 1U3JA 3KXFE 2JIXB 1K2DA 3DTXB 4PJCB 5INDB 5DURD 1QFUL 2BY2A 3HI6L 3MQIA 3P9MB 2EIZB 1T1XA 2CR3A 2P5EA 4K3JL 4KKCD 2OTUA 3X13A 1YUHA 4B7IA 1VENA 3L3JA 2VERN 1VGEL 1MFEL 1CFBA 1NAML 1TIUA 1D5ZA 3NIFE 1PKQB 2R0ZL 4I0KA 1QR1B 2QADB 1M7IA 3PV7A 3QDME 4P3DB 5KVEH 5TJWK 2J8OA 4XNQA 5DMKA 4P99A 1ZT7A 4P3CL 1LDPH 1YPZB 3KJ4C 5SX4I 2V5RA 2RAMA 4PJEB 1T83C 4P4KB 1MCSA 4QRUB 2ZUQB 4RGMC 4KAQL 1G84A 4HFWB 2H32A 1F4HA 1TJHH 3IDNB 1OAUL 3QHZH 3OX8A 1T89C 2NW3B 5E94B 2R1YA 2E7LA 1S7SB 5HHOD 2K9UA 2WBJA 3ROLB 4FQHA 4PV9B 5L6YH 1N8ZA 4BFBD 3MSPA 5HDBE 1ORSB 3JV4A 1MUJB 4K3GA 5IROA 3PL6A 1K8IA 4LVNC 5T1MA 3UX9B 1CFTA 1T7ZA 1RVFL 1BVLA 3C5JA 3GM8A 1RZKH 2AEPL 4X6CA 4HLJA 4PGEB 4UAOB 5EO0A 1LD9A 5DWUL 4MSWA 4XB7A 3WIIH 4BUGA 2P7TA 1FL5A 3O2WL 3MRRB 5DVKA 4OGAD 1KB5L 1L7TL 1NGZB 1I8LC 2R2CA 5EDXA 2OCFD 4ZAKA 5CBEB 1LE5A 3RWGB 5E95B 1XGQA 4GAJL 4PRAA 4XAKE 3W9DB 3V5KB 4PJ7F 2I24N 3I75A 3V6OE 1JGUH 4ETYA 2CK0H 2AABH 5FYJU 4ERSH 2CKBB 4QF1A 5K9KA 3Q5OA 3L95A 1NFDF 3PABA 3AS0A 3OTTA 3OJ2C 4YAQA 4NQCA 2XG5A 2F53B 4NRXA 4NO0D 1BLNA 1XF3A 1U92A 3GSOA 1NGPH 1AQKL 1B0RA 5C7XL 3F58L 3ZO0A 5ETUB 5BW7C 3UTQB 4J6RL 1N7MH 4RMUA 1M1SA 5LGHH 2BDNL 5E9DE 3RVUD 1T6WA 4JFPA 4QRPA 4KTEH 1CXLA 1B4JL 3CFBA 3KWWA 3IKKA 4HSQA 1EHLH 2ICES 1DVFD 5BZDB 1G7JB 4WTZG 3PQYE 3HC0A 1J1PL 1XR8A 4NQSA 4LSSL 2DS4A 1VDGA 1RZGB 2PXYA 2SEBA 5H94B 1OQOA 5HGBA 2HP4A 3VWJA 2R4SL 4OCLC 2DQIL 2Q76B 4WRLA 3IKCB 4KJQD 5IW6A 4WV1B 1ZVYA 4XPGH 3CCHA 4MNQE 4XTRC 1QFWH 4WO4B 5F96L 3IDYB 4W6WB 1YY8B 1FHGA 2HRPL 4U6YB 2BMKA 3D39B 1A22B 3MV8B 1BZ7B 3UZQA 1N3NB 3DRTB 2PO6B 4HWBL 5HYSB 1NLDL 5DA0B 2PW2B 4TSBL 4NHUB 1NMCC 1CU4H 1OVZA 3T8XB 4LPXA 2D7TL 3UROR 3HNVL 5LWYH 4FQLH 3H7BB 3OKOB 4JFZH 3VCLA 2V5MA 2VL4A 5HPOA 4KRMB 3D69B 5ITBL 2GK2A 1L0QA 3KXFD 3VFWA 2NY1C 4NQXA 4WFFE 4L5FL 4YFLF 1Q9OB 4NO5B 4EVNB 1V7NH 1XF4A 5IFAH 3LKNA 1T1YA 5J11C 1SEQH 4QRTB 1FPTH 3NFSL 3WJLC 1HDMB 4RA0C 5IVXA 3EFFA 3CAFA 3NACH 3FB7B 4PJGE 1G0YR 2VWEE 3NCYP 3RVUC 4EDWH 2VUYA 1FYTE 3QEQA 1NGWB 1AXTH 2J7LA 3WDJA 3QDMD 2P5WB 3DV4B 5JZ7C 5E00A 4ZPTB 4IOFC 2X9WA 1Z9OA 3QNYA 4LKXB 3JWDC 1JZ6A 3QDHA 3K3QA 3GB7B 4JO3L 1SMAA 3L3IB 1H0DB 3GKWH 4P5MB 2HVJB 3T65B 5LXGH 5I1GH 1N6QH 1IAII 4K94L 3DOSA 1DBBH 1QVOB 2D03L 4LCIH 5F7DA 5TE4L 1II4E 4OUUA 5IK3A 5IQ7H 4I0PD 3SDYL 2ATPA 2L7UA 1TPXB 1WZLA 5I9QC 3KYKH 1UACH 4L4TE 4LASH 1PY4A 1KEGH 3VDAA 1HHJB 4MMZC 3L7FB 3TO4D 3HZKB 3MRBA 4Z7WF 5MP6L 3DGGA 4OD2A 3ARDA 2N7BA 4M7LT 4R4ND 3BW9A 1H3VA 1HINH 4KV5E 1WWCA 3RWEA 4K23L 3ZHDA 2HT4D 4HQQL 1DQLH 4ZUUA 4PJ9D 4WHDA 2Y72A 4AM0B 2QADC 1T2QH 2WIMA 3FCTB 4XNUL 4CVWA 2HVKB 2ILLA 5KW9L 1SY6A 1W0YT 4XAKD 4LNVA 1EEZB 4P4KC 3QXDB 1DUYB 4KDVA 1BD2B 2W9DL 1A1OA 1YN6A 4MNGB 1EAJA 1XFPA 4FZ8L 1BQHB 3HFML 4XWOC 2JJSC 5F9WB 3MOBL 3ULUF 5C0BE 2VQ1A 4PBXA 2ZG3A 4U3XA 1U3HD 1FGNH 2AS5M 3BH9A 2DQJL 4NDMA 4YHIB 3U6RB 4M9OA 3DSFL 5JORB 1EEYB 5TFSH 4M43H 4ODHH 1QSEA 2X1PA 4QY8A 4YDVB 5ISZB 3QDGB 3I02B 3QG6A 5JHDB 4C56E 2BVEA 1I1YA 4PJBB 1MCWM 1Q9WB 4OTXL 1OOAA 3MLYH 4G3YH 5ALBL 2VSDA 1TVBB 5E9DD 4O00A 3WNOA 1NGXA 1LK2B 1DEDA 1JZ7A 5JOPE 3T2NL 1PG7X 2FJHB 5FECA 1VFAA 1U93A 1BIHA 1HNFA 3ILPA 4UAOC 5GZND 2X4QA 3D39D 3WIHA 3PQYD 5F72S 1H15B 1IVLA 3R1GH 3OAUH 1A6ZA 1INEH 3U0WL 1UVQA 4BSVB 3HNSH 1OAZL 1PDKA 2WSKA 3BH8A 5C2BL 5KSBE 1ZLWK 4PTUA 5F8QC 4FNLH 3DWTA 2OJZL 4I48B 2HFGH 1OTSC 4WUUE 5F3HA 1K3ZA 3T0EA 3MRLA 4OZ4A 1ADQL 2MHAA 4NCC2 1CLZL 4XP6L 5B38B 3EAKA 2YD4A 4IS6B 3IS1X 3CLEL 3P4LA 2AJSH 5J3HD 1DEEB 3QI9B 5DHVB 3O81A 2ADFH 4JFYA 2WAHA 3B9VA 3WKMH 2VAAA 3HAEA 3SGJC 1FIGL 2IMMA 2XY2A 5F7LB 4G8IA 3MRQB 4KXZH 4TOYL 4HV8B 5I66A 1WWWX 4PREA 4AZ8A 1ES0A 2Y23A 3BGAA 4LVEA 4WNQB 5FEBA 5GRJH 1NANH 1PVHA 3QQ4A 4NFBA 2J88H 2GJZB 5EIQA 2HA1A 4S1RL 4WW2F 3QPXL 3TN0A 5ADPH 5DR5L 4WFFD 1QBBA 2DWDA 1GHFL 4YJZL 4RWYH 3GHEL 2GTZA 2YPVH 4F80A 4GG6E 5HPMB 4WDIB 5L7XL 5LJYH 4ONHB 1YEFL 2Z31B 3CMOL 4PJIA 3S6CA 2R0KL 3RU8L 1JI2A 3FB5A 4KMTH 3DV6B 4Y19E 3Q5YA 4XPTL 4WV1C 1DQML 1CZ8L 1PY9A 4D0BA 1Z6JT 1JI1A 4XX1E 2BVOA 1FYTD 3QIUA 3SN6N 4WWKA 3T1FB 1UB5A 1NSNL 1BFVL 1K5NA 1AR1D 3IDYC 2GSIA 5CD3A 4HK3J 2ZCKL 3CFEB 1CBVL 5BQ7B 5DK2A 1E6JH 5K59E 2O5YL 4J4PD 4IRSD 2F8XC 2PO6C 3EHBC 1FVDA 1PG7L 4RZCB 3TLRA 3G6DH 2BFVH 1QFWI 3HN3A 4M6NH 5DDHA 3U4BL 3U0TA 4HG4J 5FK9B 4K9EH 5D7SL 3MXWL 4QOKE 1MELA 3I3EA 4A6YH 1YC8A 3JWOH 3DO3A 4MB3A 4YWGH 1HZHL 1DQDL 3S5LA 4X4YB 1S7VB 4XMKH 5I74B 1LEGB 2B7DT 5CLTA 5B3NA 12E8L 5AD0A 4L4TD 4TUJB 3TNMB 4U6VH 2DQTH 1CL7H 1IGYB 1QSFE 1UXWB 2PTTB 1EBPA 2QQLH 1J0IA 1EA9C 3BQUB 1T4KA 5K9QG 3RZCB 5JW4R 1OD9A 2R39A 3LY6A 4NM8H 4YPGB 1P4LB 1HQRA 3HCVB 4LCYB 4M5YH 5ISZD 1VACB 2FECI 5I15L 2H6PB 2RQ8A 2VITA 4FN0A 4TSAH 2Y6SC 5ILTL 4XRCA 3X3FH 4JRWA 1KB5B 1ZLSH 3CLFH 3BHBB 3LEVL 1FYHB 3DECA 4Y4KD 1P4IL 1QFWM 3FO9A 2X4RB 2VDLH 1T20A 4NRYB 3DPBA 2Y5TA 3RWHB 4O2FA 3UTOA 1T22B 5KSUA 3SKUD 1C12B 3C6SB 3DRQA 3WO4B 5C09E 3VGHA 5C0BD 4Z77B 5FIEA 1TFHA 2AQ2A 4YGAB 3VRIB 3OXSB 5CFHA 5GIRA 5I19H 4PJXE 1IM9B 4W6YB 3LV3B 2VWEC 4TRPH 4DZBA 4XC1L 5I0DA 1TPXC 2K1MA 1CI5A 1QQDB 5FGSA 1NC4B 4C56D 3H42L 4DKEH 3UZVB 1AR1C 3HE7A 5INCB 5ID1A 1GC1H 3FN9A 5F6HI 3PJSB 2Q8BH 4J4PC 2YD7A 5JOPD 1UQSB 4JO2H 4HXBL 1KPRA 4QHLA 2FECL 4G80A 4YHYB 2NY6D 5HHVL 3QI9D 3HI5L 4IRJA 2CDFB 4HZLB 1S8DB 1MCBA 2FSEB 3WCYA 4PGJA 1OSZA 3GK8L 2CDEB 3O9WB 4XBGB 4M6OH 1P84K 4R96B 3HC3L 1S9VB 1OW0A 4GAYA 5EU6B 4LLMB 1OGAE 3HZYB 3IVKB 1RQ5A 3B8YA 2VLJA 3WNNA 3GBML 3NIGF 1R3JB 5HDQL 3BAEH 4NP4H 3SCMD 3NABH 5FYLE 5LCVH 4F7EA 1KJMA 2XKNB 3IB4A 4UBDD 2Q86B 2EIEA 2OL3H 2Y07H 4J1UA 3RL1A 5F9WC 4UQ3B 4WUUD 2F19L 2OZ4A 1H8OA 4FXKB 4MJ2A 3B6SA 2L4OA 4L9LB 2X05A 3KYAA 1KTLA 4E41B 1FNHA 1S9YB 4P4RA 3EOAB 1HHKA 5CMAA 1GL4B 5H35B 1X5XA 2UYLA 5EUOF 1QNZL 1A64A 1XIWD 2GUOA 3V52H 3SE8H 3QH3B 3ZE1E 1F90L 4G9FA 4NZTH 1AD0A 5D1QD 1UH4A 1UCBL 3WFBH 4IOIB 1OTTD 5BRZB 4OQTA 1HN1A 2R0LH 3D0LB 4ZFGH 3G04A 4L3CB 5D1ZA 4YZFE 1DQJB 4U1MB 2YUWA 3HUJA 1QA9B 4PB0H 5F44A 1R5WA 3T3PE 4KKBD 3RVXC 1T7WA 5CP7B 4PBVC 2AJZA 4O2CB 5I0ZA 5CSZB 3I50H 2YMXL 5IHBA 2H8PB 4Y19D 1YN7B 4JGMA 4FQCL 1F4WH 5KS9E 2A74A 15C8L 3SKJL 1UC6A 4Y4HB 2WQ8A 3ROOB 2W0FA 2WV3A 4H26B 2V9RA 3KPMB 5DJDB 1MIEH 1FE8L 1BQLL 1V5JA 4K3DH 1INDL 4YHML 1OAQH 4WHTA 1CICB 3QI9C 3CVHB 5AUMA 3LKOB 3GEWB 3HMWL 2DBLH 3DUUB 1S7XA 5KSVB 2EC9T 5F9OH 2ICEB 3QUXB 4I2XE 5SWSB 2ARJA 4ELKB 4ORZC 2G9HA 4JZNA 2X1OA 3WFDL 4AY0A 1U8QB 5HYSG 4QOKD 3TYGL 5SWQA 4F3FA 4HS8H 4OKVB 3R0NA 3S4SA 4PJ5A 4X5LA 3ARGA 2J3SA