3VXSE

The complex between h27-14 tcr and hla-a24 bound to hiv-1 nef134-10(6l) peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
242
structure length
242
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSSWDTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxsE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxsE02
1PZ5A 5J6HA 4NQUA 3WN5A 1MCCA 4ZMAT 4UV4L 1DBAL 4WNQA 1HK6A 1TJHL 3RKDD 3ZKMC 1A3RH 5E00B 1SEQH 2DDQL 2IC2A 2P7TB 1S5IL 3MNWB 4N8PA 4M61A 4P2RA 1D5ZA 3CFDA 4D9RE 3DXAA 1NMBL 4XB7A 3H9HB 4O00A 4DGYL 2YRPA 2NY1B 4LLAA 3UBXI 2AJUH 4MSWA 1NGPH 2BDNH 1JL8A 1QHOA 3ZE0E 4JAMA 4KGJA 1IGMH 2V5MA 4PG2A 3UDWA 3T1WA 3AY4A 3DVGB 5F1NB 5C0AA 3ZKXB 1G9NL 2Z4QA 2CKBH 1HCVA 1IMHC 5K9QG 2CJUH 1X6LA 1UWXH 4S1DC 4P46A 5IVXB 3KYNA 4OLZH 3RIFK 3W2DH 1F2XK 2IAMA 5EZOL 1G9MC 4JKPL 2FBJH 3RVVC 3C6LA 4ZS6C 5T5FH 3FN0H 1ZLSH 4H26B 4ELMF 3PIQB 1ZHLB 2HJLA 4LLVA 5EZLA 3S4SA 1DBKH 3RVUD 1ACYL 4DK3A 1J8HD 1U92A 4OAWA 4JR9L 3ARBB 5C0RL 1RULL 2K7QA 1P4LA 2VZ1A 2FLBT 3ECBA 4GQPH 3EOBB 2P5EB 1XGRA 3CDYA 3ILPB 4XMPH 3S37L 3ZT6A 1IQDA 4OCYH 2FR4A 1JRHH 4JM2B 4PB9L 3BEWA 5AYUL 1OP5K 3IETA 2DLHA 2HT3C 1P4BH 5BVPL 1ZGLA 4S10A 5E7FA 2VN4A 1Q1JL 3SJVA 2H8PA 2EECA 5KSVB 4OLXL 1ZLUH 2WWKO 4GMTH 3VE0B 2C3XA 1NUDA 3PWNB 2W9DH 4N0UE 1R3HB 3I75A 3PWLB 1XGPB 3D0VA 2HFFA 4XPGH 3BPCB 1S9YB 3V5KA 2BCKA 3O9WC 2VDKH 2VDNL 3H7LA 3WJJA 1U8KB 3QIWA 1T1YA 4XNZC 5CJXA 4HX1A 5EWIH 5J0BA 4ZUTB 1H9VA 5CZKA 2AXFA 3I9GL 2HKHL 3CAFA 3RL2B 5EU3A 4AK1A 5K9KB 3GZKA 4NBYB 1IILE 3OAYK 2HRPL 3VFVB 1V7NH 5HSFA 1LK2A 3BZ4B 2XZCH 1A7PH 3AC0A 2UUDH 4Y5VC 4I4WB 1IGIL 3FQRB 5I8KL 1GGTA 3SDAC 4ZUSB 4ZFOA 3QT2A 5E7BA 2WUBL 2X4PB 3SN6N 3IF1B 1FFPB 4WI9A 1CU4L 1RZKC 3TH4T 3KG5A 4AEFA 3ARQA 2D7OA 1N7ML 2XACC 3FQXB 1ZGLP 3MOQA 4O4YH 5DD5H 2P8LA 3F12A 2VLKE 3GIVB 5BS0D 3OMZA 2XNAA 3WXWL 4CBPA 5CP3H 5SWQA 4BFIA 2I9TA 3PWPA 3VXSE 4TUOB 1K6QH 5CSZA 1M71B 3Q0HA 5C07D 4GXVH 1A7BA 3BP4B 4RWYH 4NFDA 3RWHA 2H6PA 5L7XL 2FX9H 4XCNB 5MERB 1CGSH 3VI4F 5GGVY 1QLRB 5D5MA 4DQOL 4R7NB 1SYSA 1QHPA 4LL9A 2G75B 5GGSY 1JI1A 3HAEA 4KK9D 2CDEA 2DQEL 1CGWA 4HCRL 1YJDH 4KRPC 2ATPB 5M94B 2DQFA 2D4DA 3RAJL 2F53B 3F7YB 3EBAA 1WEJL 1S7VA 5FYJE 4CVXA 4MNGE 5D2NC 4PJ8A 3W9DA 3ULVC 1BD2A 5CIPB 4HWNA 4MD5B 3QXVA 2OJEA 4WDIA 5HHQB 4Y19D 4CGTA 4YDKL 1QPXA 3V8OA 2A1WH 5D2LF 5BVJA 3HE7C 2AV7B 3R8QA 1OT1A 3MV9A 4NNXA 2CRYA 5D1XD 3UYOD 5BMFH 2D7TH 5IKCB 5HI4D 1FDLH 3MBEA 1D5IH 5DUBB 5CD3B 2DRUA 4FQ2L 5FYLH 5HGGS 2BXYA 4MJIB 2YZ1A 4FMFA 5J06A 4EI5D 1CZ8H 3PGFL 3C8KB 4BZ2L 5ICXB 1T5WA 2N7BA 1WFTA 2WBJA 2XTJE 2F9BT 4RZCA 2PO6A 2VE6B 1SY6H 4YXKH 1N26A 1A0QL 5KANG 4LPWA 3LKNA 1WT5A 1A6TB 3L7EB 5HYIA 3EUUA 2VL4A 3HNTL 1CGUA 5C0BA 4Z8FH 4G80A 4U3HA 4GRLC 3CSGA 3JVGA 4M1DL 2Z92B 3LQAH 3WHXB 4Q6IC 1FL6B 3H9SB 3R1GH 4KK5D 4KV5E 5E1AA 3CCHA 2IPKA 1K4DB 4LU5L 5GRUH 3ZL4L 4P9ML 5I66A 3MCLH 2EIBA 2VNCA 4KJPD 3ZYZA 1G9NC 1W72H 4LKXA 4NRYB 3G9VA 2AABL 4N8CL 1MF2H 4Y7MA 4HMEA 1N6VA 3SGKA 3NA9L 4KGLA 3GHBL 3IVKB 2B4CH 1HKLL 1I1YB 2JIXD 2R0ZH 2R1XA 1MNUL 3MRFA 4JQIH 1GPOH 1UWXK 5DJDB 1AY1H 1MCWW 5EU5B 5DQJA 3BZDA 3LEVL 3GMLB 1OQOA 3WIFB 1Q9LB 5EU6D 2BNRD 5GGVH 1AXTH 2BNUB 1EJOL 5JOPD 2CR6A 4AJ0A 1YEHH 1RUPL 1E27A 5DRNA 5E94B 5IB3B 1JYWA 2IG2H 4JCLA 4NKMB 5B4MD 1TCRA 4XP6H 5F7UA 1UJ3A 1N6QL 3TT1H 4KDWA 1IM3A 5E8PA 4BYHA 4YDLC 5D9SB 1JPFA 4HWZA 4R7DA 2FO4A 3D85D 1LD9B 3ZKND 2ICEA 4XNUL 5K9JH 5DJAA 2EXYC 3H3PH 3QISA 5D7SL 2A6JB 4CU8A 4HBQA 4KVNL 3QZWA 3CDCA 1A6UL 1FORL 3SY0A 4EIGB 5AZ2H 1ZT1B 1LO2H 2WQRA 1CFVH 4IHOA 3S88H 5F7MC 2R4RL 4X99A 3ZE0F 2CKBB 3WFZA 1MWAA 1XR8A 1ZLUK 1BREA 2ZUQB 5MEPA 1ZHNB 1XGYL 3JXAA 1JJUA 2V5RA 3KNBB 4K2UL 3UTTD 4FOMA 3SKJH 5F9JB 3O8XD 2J8HA 4NQCB 4H1LH 5T1MA 4FTVD 5BZWA 3ETBF 3NAAL 3TO2A 5J1AB 5CEYA 4XPAH 1KPUA 5DVMA 4YBQD 3SDCC 3RUGA 4NP4L 5CZXD 3QEQD 1E4WL 2VDPL 2ZCKH 4GFTB 5E6IA 5MENA 1NC2D 1UM4L 5B8CB 1QRNB 4Y4KC 1VACA 3FL7A 2EDOA 3ZDZF 4JY6B 4QHNB 3C2AL 2B8OT 1J1OH 1FVDA 4PJFE 2YD2A 4LHUA 1P6AB 2UUDK 2PXYA 5KSBF 3GEWB 5EU4A 3U9PL 5JXEC 1CGTA 2R2EB 4ZUVB 3RJQB 1A02N 2JB6A 1DUYA 2Q3AA 3DSFH 4CN4A 1ONQB 4L8DA 4MNHA 4WW1A 5HI5D 3MV7B 3ZHKA 4P3DB 3TVMA 1P4IL 2PW1B 3O6ML 5SWSE 5HGBA 4I3SH 2E3VA 4IEFB 1UZ8A 4WHYG 2IF7A 3VFWA 3VWKB 2QKIA 1I4FB 4R90L 3WXVL 3JWOL 4OB5H 1U8HA 2X4QA 4OFPA 5I16A 3CFIC 3OAUH 2XN9D 4YC2C 4RGND 1AO7E 3KXFD 1CXLA 4XXDB 2A6DA 1D5XB 3I84A 5DUMH 2VC2H 3OHXA 2XY1A 1Q94B 2Q7NA 4FZ8H 2X42A 5IW1B 3MRGA 2X1WL 3V7AE 1G0XA 1HQ4B 2NXYD 3LIZL 5E03A 3BIKB 12E8L 2C7UB 3BP7B 4KZDL 3VGAB 2EDBA 4LIQL 4MD0B 1I8MA 1JZ8A 1IEBA 1KG0A 1F6AA 4QCIB 5E99L 5BRZA 1RVFL 4G6KL 3UROR 3NABL 5HPOA 4YDVA 1VB9A 4XNQA 2QBWA 5FYKD 5DRZB 4XC3L 3WJLA 3G6JB 1FV1B 1HXMA 3GMRA 1N4XH 4HAFA 4PGDB 1OARL 3O0RL 2C3VB 1S7UA 4K9EH 4MNQE 3HG1E 1KT2B 1NFIA 5HHOA 4PJXA 3NZ8B 4QY8B 2XXCB 3KJ4B 1A4KA 4PS4H 4HUWB 4K71B 3WKML 1NAML 3DPBA 4Y4HD 1A6AB 1J1XH 1RZ8B 3HB3D 1UQSA 5ALBH 1WZLA 5I9QB 3RA7H 5F89B 5DMIH 2RAMA 3MXVH 1MJ7H 2EIDA 1IBGL 3EYUH 4LCUA 2MJWA 1PYWB 5FM5O 1IKNC 2FJGA 5LGHH 1MRDL 3BXNA 3FO1A 5FHAH 2X4SA 5TQ0L 3NIDE 4OUUB 3V4VH 4PP2B 2BERA 4U1GC 3L5WB 2OTWA 4URTB 1I3GH 4JJ5A 4UT7L 3T0DA 4PG9A 3CFJB 3QUKB 5H35A 43CAB 4E41B 2Y9RT 3T65A 3NCFB 3S6CA 1OWRM 1CFTB 1JGDA 3RKDC 1YN6B 4FFWD 4OCLC 2ICES 5D2LB 3IXTB 3WUZA 1KEGL 3BP5B 2DTMH 1GZPB 2OBGA 4ONGH 3EKCA 1CLZL 5JPMA 1XIWB 1KB9J 5FF6B 2JELH 1NKOA 1BBDH 4IOIA 3KPSE 5TDPA 1K85A 4HZLB 1I85C 2HKFH 2VLLB 3D1MC 5L8LB 4P4KA 2AKRB 4HPYH 1DQQB 3VW3H 4I3GA 1XCTA 2RBLA 4LEXH 2VDOL 4ODBD 1HIML 5C09A 1OSPL 3HI1B 4PJAA 3QCUL 1YPZE 4R97B 4HXBH 3QJHA 2H32H 5EZJB 4KTDL 3D18A 2PYFB 3ARFD 5IFHH 4G9FD 4OCXH 1T21B 4Z6AT 5JDJA 4M4RA 4EI6A 4OGYH 1DLFL 2R23B 3LOWA 3VWJD 2P4AB 2D9CA 4PGBA 5FKAB 3BQUB 3CSPA 1B4JL 3IGAB 1OOAA 5FGCE 1AE6H 1JK8A 2FIRT 5E95B 2CO6B 4ONFH 2VTFA 2WW8A 1AGCB 4X9IA 4NN7C 1N0XL 2V2XB 3B3IA 1FGVH 2H41A 4UMGA 3RVUC 4DAGL 1KCVH 3D25A 2DLTA 1OAKL 3IFOA 5JHDA 3FQNB 4FA8A 5DI8A 4P3WA 5C9JA 3CU7A 3QUXD 2I26N 1J5OH 3VMPA 4JRYA 3Q3GB 1NFDE 5DZNA 3QEGH 3GRWA 4LSQL 3IAQA 4QWWD 4U1SA 2BVEA 4NWTL 4O2EB 2PYEB 4KV5F 1CF8L 5GJSH 3QAZB 3SCMB 1MFCH 1JIBA 2F8XC 5DT1H 5EFIA 3BEVA 3MGOB 5EBGA 1X5JA 1J1PL 4UU9B 5H8DA 1WF5A 1QR4A 3VD3A 2WK2A 4XWGL 5FECB 3QRGH 3WIHH 4F7CA 3EDEA 5C0CE 4IDLA 2YD6A 3VDAA 3C08L 5HVHB 4N9GA 1A3QA 4PYHA 5CILH 4I2XA 1J9CT 3DYPA 4WFHD 1NGXB 4HIJA 4DJMA 3GMQA 3BH9B 4B5EA 4WTXA 1S9XB 4XMLL 3I6LD 5GGSB 2XTLA 4MZ3A 3WUWB 1L7TL 4FFYL 3HC0B 5IBLC 4WV1C 1RMFH 4X6BB 1A1OB 5JOFB 3P73B 1A6VH 1YEDA 2Z8WC 3LD8B 5F6IC 1WICA 3V6FA 3DX6B 3QYCA 1QSFD 5CHNB 4LP5A 5IG7B 1R3LB 1KELL 4M4PA 3M17A 3GHEL 4LCCA 5JMRA 4M7JH 4YHIA 4NDMA 4WW2C 1JPGB 5E2UH 2X9XA 3OR6A 3GUTA 4LNVA 2P46B 3RNKB 2Z8VC 5IWLC 2F15A 1UYWL 1KGCE 5ISZA 4I77H 1INQA 2AJZB 5JR1H 3JWOC 2VR9A 2EDJA 3AXLB 2HJFA 1O7VA 3SDYH 1V3MA 1D5MB 2Z91B 5EU7E 4XTRD 4C57C 3AAZB 4EOWL 2FWOA 4H1LB 2WMPA 4PRPD 3NCYS 5HPMB 2H2PD 2V7NA 4MA3A 3RHWF 2BMKB 1MIEL 4I5BA 1B6DA 4J3OC 1MEXH 1HH9A 2AXJA 1HHIB 5KSBB 2YKLL 2V9TA 1RUML 4KK9C 1XAUA 4NQVA 3CSYA 4OCRH 1J05B 4MA8L 3DI3B 5F1OB 3LSOA 2IPUG 3Q6FA 3LEXB 1UB6B 1ETZA 4M43L 2J8UB 3P9MB 2YUVA 1IRAY 4RDQF 4X9BA 1WVZA 1I8IB 3QCTL 4GO6B 5EBMB 1W2KT 2CGRL 3O3AA 2X2YA 3VFTA 3BVNB 4L4VB 3G5YB 5MEQB 4KMQA 5FYKL 3ZYJA 3IDYB 4PJFF 3CK0H 2DLIA 3DUUA 2MMXA 2DQJL 2XKSA 3NACL 1H8SA 2Y07H 3P11H 2ZCHH 5DQ9A 1B6UA 1TZHA 2DM3A 5D1XC 3RGHA 2MQCA 4ZPTA 1RUKH 1YEEL 3LHPL 3VXMA 4UUJB 4KZEL 2AV1A 2I27N 1FE8H 5D1ZB 2VXSH 2WUCH 4EI5C 5CCKH 4U0QB 3SDXE 2F19L 4WUKH 3FQWA 3PNWB 5HYSG 4F3FA 2NY4D 4YHKH 1PFCA 1W0YT 5IIEB 2HTLD 1Z0NA 1K8IB 3T3MF 1WAAE 2CMRH 4ZO6A 3O2VH 4NUGH 1JUFB 1PG7W 2B1HL 1MCEA 3RY5A 5LQBH 2PKDA 2GJZB 4ODSL 1NMAH 3TBVB 5I19H 1MLCA 5I1DA 4NC1E 1BFOA 4D9LL 4WU7A 3OKMB 2EC9U 5DJ8A 4KK5C 4NN5C 4W6XB 1AFVL 4YFLI 2XQBH 3MJ6A 3D3VD 1DQLL 1MAKA 4CKVX 4XPHH 1XR9B 5DJCB 3H9ZA 2H26A 2NXZB 4KJPC 4Q9RH 5F8RC 2YRLA 5FOBA 4PBWD 4YZFE 2J3SA 3IJHA 5LAXA 4NPYB 2CK2A 4X4ME 4Q9QL 4QRPE 3Q6GH 5EOTB 4JFDD 4AMKL 1CXEA 1MHEB 3BGMA 1G9MH 5CJOL 1PKQE 1QFUL 1N3NB 1LO3L 3J8F7 5T3ZD 1BVLA 1MHHA 5CGMA 1QQDB 4Y5VA 4RBPH 3RTQB 3TCLB 1HYSD 2DWEB 4XC1L 3NIDF 2CIIB 3N1QC 5I1LA 3ZTJG 4QOKD 5FM5M 2VABB 3DROB 4EQ2A 3IYLW 1CIDA 4LVOC 5B4MC 4NQDD 2B1AL 1I9JH 5F9WB 1IEAA 1FG2B 4NHCH 1WCQA 4L4TA 4OLYH 1DBMH 2ESVA 4P2QA 1P7QA 4CVUA 3UTSA 5H2BA 1ODAA 1MVUB 2ITDA 4PRNB 4LLWA 4GAGL 4UTBL 4F37F 3K4AA 3S96A 3QI9B 3IS0X 2H32B 4JFQA 2IQ9L 3FONB 3KPQB 1NBVH 5ID0B 3QIBB 4U1KB 4LQFH 4WUUA 1CDJA 2DB8A 5SV3A 2Q7YA 1YPZF 3BMWA 3QO0B 4BKLB 1IZJA 2CDGA 4P2RE 5KAQG 1WBXA 3U6RA 5IESH 3DXAE 3O8XC 3P30L 4ACPA 1IAKA 2BOBB 2GITB 3UBXA 1D6VL 1CT8A 1JFQL 1RSFA 3MJ8A 1SYVB 3VGBA 4M02A 3WFBL 2C1OA 4B7LA 4X6EB 3TJHD 4YBQC 5D2NA 4U1HA 3FQTB 5CZXC 2VLJD 4WFEE 4LVNC 4HJGA 1BFVL 4Q6YA 1GAFH 1NBZB 2YK1H 1JMZA 1Y6KR 4TRPH 3WIIH 3K8KA 5HYEA 3BP6B 4QTIL 5C0AE 3HE7A 1OGAD 1EFQA 1A7OH 5ACZB 5B3JE 3IDGA 1D5BA 4H0IA 2E6JA 4DUVA 2EYRA 2H45A 1G7QB 4UIMA 2FZ3A 3I3EA 4P23A 4BFBD 1L6XA 5HI5C 1T1WB 5HXMA 1NFDF 4YR6B 1HHKA 4YX2H 2GEEA 4UT6H 1YYLL 5ERWB 2H2SD 3H42H 3QUZA 7CGTA 4HPOH 3RHWK 1F4XH 2QLVB 1AP2A 4P9HH 1LE5A 1KN2L 4ODXA 3QCVH 4RGNC 4YXHH 1WBYA 1ZHKB 4C55A 4ZXBA 1IL1A 2OSLB 5IMKA 2VXVL 4GKZB 1G84A 2NXYC 4NT6A 4HWBL 4PJ9D 1P7KB 5C08E 1KLUB 3RWDB 4Q6IA 2X41A 3BMVA 4ZDHA 3U0WL 5A2FA 3STLA 4OV5B 3TT3H 1NEUA 5HYFA 3NFPB 3ULVH 4LAJH 3VH8G 3HRPA 4BZYA 3SJVE 4BQBA 1EEQA 1YUHA 1UCBL 4EN3B 4QXTA 4PRHD 1MFDL 5J57B 2FSEB 1T66D 2AJYH 2VXUL 3RBGA 2ADJB 4MXWH 2VQUA 3RIAF 5DK3A 1QVOA 1QKZL 1JPTH 5FGSA 2ADGA 3TBTB 4AG4H 4JG0L 3S34L 3ES6A 1CTNA 3PGCB 3DURA 1KENH 4MXVE 3MJ7A 4Y4HC 3MJ9H 3C6SB 4G8FA 1X5ZA 2F5BH 1NGWB 2EDWA 1WZKA 3DECA 3JV6B 4UV4H 1DBAH 1G6VK 1ZMYA 1JGEA 4X6DA 1S5IH 1EXUA 2O5XL 1VEOA 3LPGA 5BW7A 1UM5H 2DIAA 5EBLB 3K2MC 4DGYH 4JVUA 4TPRH 4P59L 1BJ1H 4ZYKB 4Y1AA 4NNPL 3GKWH 3HPLA 4FFWC 1AJ7L 3L7FA 5JHLL 1EGJH 1DVFB 4K3DL 2GCYA 2ZNXA 3C60D 2O26U 1S5HA 3PWPE 4PJBF 3PG2A 1I3RA 3W81A 4JREB 5A16A 4PRIA 3MR9A 1XGTA 1G9NH 2OZ4A 1S7TB 2A0LD 3VFUA 5D7IF 1RUAH 1RZ7L 1X7QA 5D5ME 1B0GA 4NJAL 5IK3B 3M07A 4X4YB 5GRVL 3D2UD 5EZOH 1FYHB 4U6HA 4JKPH 2DLGA 3GSNL 3O4LB 3ARFC 1BM3H 4HH9A 4LLMA 4XBEL 3SDCA 1H3GA 2VIRB 4E0RA 5CKGA 3HC4H 1BF8A 3ESVF 3RX5A 2UYLA 1NSNL 1NANI 2ILLA 2NNAA 3FOMB 1ACYH 3VWJC 4Y4KA 2VLRB 3ARDB 1HXYB 3NN8B 1QYGL 1CDUA 2GJ6D 5IEKA 1IGTA 3QNXA 4JR9H 4MDJB 5C0RH 4RBPK 3FCTA 3SDXF 5T3ZL 2XZZA 2QQLL 3P4MA 4GG8A 4TNVK 3MV9E 4OIIL 4RMSA 3WLBA 1DQMH 3S37H 2NTSP 5IF0B 4BA8A 5IJKC 1B0RA 1J0HA 5EOQL 1WAAF 4M6NH 3TN0B 5BVPH 2VXTH 3HR5A 4D9QE 2ZJSL 4HUXA 3MLZL 1Q1JH 4PJEB 3QUXC 4LLDA 1CLOL 5T1KB 1CLYL 4LLYB 1A4JA 3GMMB 3PE9A 4K7FA 1VKXA 2RCSL 1YC8A 2VDNH 4ZUUB 5J8OA 2VDRL 5I1AB 2D2OA 3FO0L 1XH3B 3FFCB 4JRXA 5M7QA 3I9GH 4GRMB 1VGKB 2HKHH 5GHWH 3PP4L 2H3NA 1IAIL 5GGUA 3PWJB 4CDHA 1LDPL 2JJVA 5C0BE 1NJ9B 2YPVL 5AAMA 4LDOB 4LDEB 1C12B 3AVEA 3DMMD 2OTPA 3VFOB 2HRPH 2XA8H 4W6YB 4YGVA 5FO9A 1J0JA 2R0WH 5JDSB 1PEWA 3FT2B 3HTLX 1IGIH 3MZTA 4DGIL 2Q8BH 4FFZH 1D7FA 1FYTD 5DS8B 2WUBH 2JK5A 3B9AA 4WI2A 1CTOA 4GS7B 3OGOE 3JTSB 4WFGE 4R3SB 5IT2H 1G7MB 1YNTB 5DXWA 1FBIL 5AUMB 1SVZA 4Y89A 2F54D 1B2WL 2C4FT 1YC7A 4QLRA 3O41B 4KI5F 3SEPA 1O5DT 3LPWA 2DTSA 1IFHL 3ZDXE 4LEOA 4D0DB 3O45B 4C56A 3SQOL 4PRBA 1N5YL 1JTPA 2W60B 3L3HA 4IRSA 3BGFB 4IOSD 2DQCL 2NY6C 3VXOA 2BVTA 3MRQA 4JJHA 2AK4D 2ICWJ 2Z8RA 3SE9H 1AIFB 1IKNA 1R6VA 3P77B 5L7XH 1M6OA 3R06B 4QF1B 4BZ1H 2ZSWB 2Q76B 1IT9L 4KKLD 1GRWA 1WFOA 4NOFA 5SX5H 1U2CA 3GSOB 1IAII 4G6ML 1YYML 3UZEA 3V6OC 3D39B 3D69A 4F15C 2DQEH 2JCCB 4AY0A 4HCRH 2H2PC 3DUHA 5ACLA 5DUPL 1YMHB 4N90E 1H3TA 3DRQB 1L9NA 1WEJH 2MQ3A 4ZQKA 1FAIL 3VMNA 2V17L 1IM9A 2FEDD 4XPTL 2ORBH 3V9FA 3MLSH 2BXZA 3RY6C 1I85A 4EZMA 3KHQA 35C8L 3LKPA 2FB4H 4F33A 4YDKH 2NW3B 1YNLL 3G5XB 3VXQA 2P48B 2VWEE 3SE8H 3S37X 3BPNB 2X4OB 1EIBA 1QBLL 4Z7UA 3UJJH 2AI0L 3QA3A 4O58L 1JWSB 3QSKB 5KBNC 4FQ2H 4KROB 4EDWL 1NCCL 3ROOA 3MV8D 3JTTB 5GSVA 2E6QA 5KS9B 3PGFH 3K1KC 4ZFFB 2NY1D 3RUGE 1NDGB 4NO3B 3C2SA 4NHUB 1LP9B 2DQUL 4RWHA 4FXKA 5MENE 5I2IA 3CPLA 1A0QH 5EO0A 2PTVA 1LGVA 4I3RL 3R0NA 3KDMA 3TIDA 4E9LA 1RJYA 3HNVL 3T2QA 3HNTH 1RJLA 2VQ1B 1D6EB 2XFXB 3W0WA 1J8HA 2NY4C 5CEZD 2HTLC 1M7IA 1OTSD 1KCLA 2O61A 3PABB 3C5ZD 2HN7A 4LU5H 4P5MB 2IALB 1RIHL 4P9MH 4L3EE 4IJ3B 1A9EB 1UXWB 3Q5YA 2X4RB 4DKFL 5EZIH 4GAYA 3IKKA 1TVHB 4M48L 5TE6H 2UWEB 2EO9A 3REVB 3TNMB 1FRGL 2QADC 2OYPA 4K3JH 1XZ0B 2AABH 4OI7A 4P5TC 5L2KB 5IB1A 3T1FB 2NY3B 3V0VB 1T4KB 1LEIB 1AGFA 1WJ3A 3KLSA 5DDHA 3T0BA 1Q72L 3B9KB 3HUJA 3VXUA 3ARBD 1MNUH 3QB7C 2X1QA 4OD2B 4Q97A 1F3DJ 1BFTA 2P5ED 1KJVA 2COQA 3QNZA 3LEVH 2YN5A 1CVRA 1YMMB 5JW3L 3L3DA 1WC7B 1N0LA 4OIBA 1G6RA 4MXVF 5HVWA 2SEBB 4OI8A 1EJOH 1I8KA 4ZOAA 4I18A 3FTGB 3E1F1 1QP1A 3D0LA 1N6QH 3IDMA 4PJBB 4GRLB 1Z6JT 1S7WA 5HHOE 1L0XA 2YBRB 3CC5A 3GJEB 5GIRA 4WI6A 5D7SH 3DBXB 3MA9L 4PR5A 5D7IB 3VFNB 3QUML 5IWLA 4F2MB 3IXAA 3EYVB 5ID1B 4NZUL 4OZFA 4MHHG 1SHMA 5FUZH 5DMGD 4OZHB 4ZAKD 5DJ2B 7FABL 1NFKA 4NQSA 3MNVB 4NKDB 2G2RB 3QXAA 1WIOA 4NO5A 4M5YL 2GYSA 1XGYH 2A73A 2OI9B 1HI6A 3O2DH 5IR1A 2J4WL 2XZQL 1K2DA 3Q2CA 5E4IA 3NAAH 1TDQA 4Y4FC 5D5MF 1T0MA 4WO4A 3EYFB 1I75A 1LWRA 1OP3H 3MLWH 3KPRA 1JF1B 4C54A 2VDPH 5IV2A 1VEPA 5E4EB 5LWYL 1T1XB 1UM4H 3MRDA 4V2CB 3PV7A 2AEQL 3HCVA 3QG7L 4U6XA 4XVTL 5GRZA 2BP3A 1MCBA 3C2AH 3G5ZB 4AEIL 1GH7A 3NH7L 4K55A 5TDNB 5J1TC 1FH5H 3TJHC 2R8SL 3U9PH 1IAMA 5HDBE 1TITA 4JFPB 4M9PA 4MDIB 1T0PB 3MRLB 2YEZB 1MRFL 2B20A 1V7ML 4KKAD 5JQHC 5F7EL 2VAAB 2BVPA 4DGVH 3X12B 5JW4R 5JPNA 1P4IH 5D1XA 5A1AA 5DMKB 5F96L 2WLZA 2F53D 1LNUB 1AKJB 4R90H 3JWOH 2IPTH 1LHZA 1ZA3A 2GSGA 3T77A 3EO0A 4D3CL 1MVFA 4XH2B 4DOHB 3HS0B 1C16B 3QDMA 2GTZB 1R3KA 1UVQA 5E2VL 4BFGA 2H2SC 4NSKA 3TO4C 4KZDH 4R96A 4M5ZL 3DHMA 1ZA6B 3O3DA 1HHGA 3ME0A 4XNMB 5JHDE 2P5WB 3CZFA 3ARPA 3RWIA 4GW1A 3T4AB 3ARVA 3GSQA 5DD0H 5DTFB 5E99H 1RVFH 5T1DL 5IEHB 3IKCA 4JRYE 2YPLD 2Z31A 1ERNA 4PJ9C 4U6VL 1KB5L 3VXPA 4HMCA 4C59B 1C8PA 1CN4A 4MJID 1OARH 2RR3A 5IB5B 2F74B 3O0RH 3PL6B 4OGZA 4UDUB 2AS5M 2XKNB 3U46B 1G0DA 1R0AH 1X6NA 4APQB 3BGAA 3BW9A 4MAYB 4WHTB 4JHAL 2EE9A 1IGCL 3WKMH 4HG4K 4KJQD 1NAMH 4QRRA 4PJHE 1T66C 2VJXA 4LKCA 4KHTH 4XGZA 4FMKA 2ZNWA 4FNLH 2HVJA 1CIUA 1I1FA 3KS0H 4K7PL 4QHMB 4JPKL 4U7SA 2VL5A 4LSSL 5TE4L 4ETQB 3ZDXF 4JHWH 3TBSB 3UCRA 1EBAA 4M61B 4P2RB 1D5ZB 1ED3A 1XF5B 3HI6L 3OKKB 1L0QA 1FVCB 4N0YL 5AAWA 1MCNA 3OGCA 3ULUF 1WLHA 4QXWA 1ADQL 5ENWA 1S3KH 2XRAL 3GSXA 4S0SD 1F11B 1BWMA 5F3HA 5F7FA 4MSWB 4J4PD 3U7YH 1ES0B 2ZPKH 4MAUL 3HZKB 3EOAA 1P1ZB 4X7CC 5A2LH 2LQRA 3L3GB 4HHAA 2MOVA 3MLVL 4JFOA 1CLZH 4PGJA 1TZGL 3SKMA 3FB6A 4MQ7A 5ISZE 5ITBL 4MS8D 2W9EH 5FB8B 1E6OL 3BFOA 4S1QH 5CEZL 4XVJL 1CICA 1P7HL 3C60C 4J3SA 4LSVL 2NQCA 3QCUH 4HGWB 2BSRA 3P3YA 3QQ9D 3RDTA 3WD5H 3DRTA 3Q1SL 3O3BA 1U93B 3HMXL 5L6YH 2VXQH 4LAQH 1QR1A 2A0LC 4TTDD 4U49A 4JZJB 3VXTA 1VFBA 3GSRB 4UINH 1OTUD 1DLFH 5CBEB 3A67L 3S4SB 3O8XA 1T22B 4FQXA 3UO1H 3ZO0A 2DI8A 1ZXQA 3ARXA 2GHWB 4HXAH 2BZDA 3GI8L 3O3UN 3QDGE 3RUGF 2HJKA 5MEOB 4LRNH 3QEQA 3GSVA 5JW5A 1N0XH 5DC0A 1I7UA 2APWA 2NY5L 1HKFA 1NC2A 3CDGB 1DQJA 2JJSC 3IETB 1L9MA 1OAKH 4PLKD 3DTXB 2D0FA 1KTKE 1IAOA 4YGAB 3WFHA 3VDBA 5J13C 4LSQH 3V5KB 3OZ9H 1DDHA 2BCKB 3E6FA 2CSPA 3QIWB 4NWTH 5DYOA 1CF8H 5D8JL 4EBQL 3VXME 3TA3A 2X89A 4NNYB 5BZDA 1KPVA 3QHZL 1KTLA 3HNSL 1J1PH 4G6JL 2N56A 4XWGH 4X6CA 4PJGA 3QQ3B 4NOBA 5DVNA 5JUEH 1FFNA 3C08H 4LSUL 2ZUVA 5DD3L 1A1NB 5T1LB 2ZKHL 1T2JA 3C8HA 3BOVA 1FL5B 4XMLH 3MV7D 1L7TH 4FFYH 4JQVC 3HRZA 2VN7A 5C0DB 2X70B 1OP3K 2KH2B 2CRIA 3DMMC 3DV4B 2IANA 1FFRA 1IC4L 3RY4A 3K8LA 3TV3L 4ZUWA 3PQYB 4NQEB 4HV8A 1KELH 2XNAB 5EUKA 3ZT5A 2D7MA 3OX8A 4Q2ZA 2VH5L 5CSZB 1NDMA 2LVEA 1UYWH 4L8SC 1W0WB 3RWHB 3K4DA 4XNXL 5F97E 3HPJA 2OK0H 3V6ZB 1BP3B 1JF6A 3NPSB 5IVZB 5TF1L 3DVNB 4IIQC 3HAEB 4ZOBA 2X4TA 3U30B 4ELMA 2A2QT 3ORJA 3TJEL 3EJZD 4OKVA 4XAKD 3LH2H 4YPGA 4NUJA 5CEXA 3ARGA 3WUWG 3BKJH 4CVWA 1DBBH 2J2ZA 1S7VB 4CVXB 4N0CC 3W9DB 3E6HA 1BD2B 4KKLC 2YKLH 4Y2DD 1RUMH 2FJFB 1IE5A 4G42B 1R3JA 2A83B 1YY8B 5I8CA 4O2CA 5BVJB 1HSAA 1AD0B 4Z5RB 4NNXB 2V7HA 3V5HA 2ESVE 4P2QE 2I25N 3UTSE 5KVFL 3FOLB 1RZGB 4LMQI 3GK8L 4G8GA 2BY3A 1RPQA 2EIZB 2Q20A 2Y7QB 3MRJA 3K0WA 4JQXC 5FYKH 2PW2B 3QPXH 5CD5D 2DQJH 3QNYB 4KAQH 4WHDA 4ZPVB 4DZBB 3NACH 5HDBF 2KKQA 4F8TA 4WUUE 1WITA 3RL1B 3FHAA 4PJAF 1T5WB 3UX9B 4HQQH 2YXFA 2RFXB 4HC1H 4C83A 5F1SA 4E41D 1YEEH 1TJIL 4RZCB 2PO6B 3O6FA 3TH2T 3LHPH 4H1LG 3QFJB 1ITBB 4EDXA 3D48R 1UWGL 3EYOA 3ARFA 3MXWL 4S1SL 3DJ9A 4G9FA 1ZV5A 2FRGP 3H6JA 4M8QA 5F3BB 2YC1B 3NCMA 2R2BB 1XIWD 5HI3D 2J7LA 4LCWA 4XBGA 4ZS7H 5D2NE 1AHWA 3ULVE 2NY1C 5IOPB 3UPCA 3V0WL 3VWJA 3DLQR 2HFGH 4P2OA 5GRWA 5BQ7A 1FNLA 1QSVA 2HVKA 4Z95L 3MBXL 2E7BA 5MI0B 2AJVL 5IQ7H 2LU4A 5E1AB 4FQHA 3CCHB 2IPKB 5HGDA 2XWJA 3F58L 2D31A 2B1HH 1A6ZA 5HD8D 5FYLD 1JHLH 2ZUWA 4O5LH 1KCRH 3ZKXC 1S9WA 3PGDA 4LKXB 5DC4B 1G7IA 4OGAD 1QSEE 2O5ZL 4D9LH 3QUXA 4U0RB 3MYJA 3A6CL 2J88L 2DLFL 1B4RA 3U83A 3EYQD 1P6FA 1OP9A 3O2WH 4X98A 3BQUD 2R1XB 3FT3A 1LEKA 1NCUA 3MRFB 1R24A 5TPWL 2R4SH 4J3TA 2BVOA 3SOBH 2AEIT 4QHKJ 4Q9QH 4PJHF 1MAMH 2MKLC 3HE6B 2G9HA 2L7UA 4AMKH 4LSTH 1K9TA 3ARBC 1E27B 2QHRH 5DRNB 1H0DA 1FAKT 5CJOH 4CN1A 3S3JA 5FA4A 4H8WL 5CZVL 1LO3H 1G7PA 4LFHG 4NO0A 3DV6A 3BPOB 4JM2C 1JPFB 4HWZB 4PJ5D 2NY5C 4XC1H 2PYED 1IJ9A 1NGPL 3MUHL 3O6LL 3ULSA 5HYQA 5I1CL 1VADA 1VENA 3GMOB 1NMCB 5F88A 1EFXA 1IGML 4DWHA 2GKIA 4X8JA 4OF6A 2B1AH 2BJML 4P4RB 4JM4L 1A9BA 5CS7A 4N68A 4YDJB 2CKBL 3ALWA 2JJTC 1MWAB 4Y5XA 5DRWA 3VRLE 5MEPB 1DFBL 5KOVC 3IDUA 2FNBA 3WLWD 4F7MA 3MLYL 4OLZL 2FDBP 5F7LB 1CBVH 1QUNA 4ONHB 4RAUA 1WCBA 5T1MB 5DMGC 1I3VA 2IQ9H 5BZWB 1ZSDA 1OCWL 3TO2B 4NQXA 5F6HJ 1FNGA 4B41A 3L3JB 4X6DE 5A43C 5I1EH 3BWAA 5ITFA 4TSAL 3OG4B 5FAAA 5T3XD 1DBKL 3X3FL 5MENB 2XZAL 4HWBA 3MA7A 4JN1L 5DRXA 4IMLA 4RAVA 4D0CB 1D6VH 1JFQH 5DJ0A 5CJ5A 4CW1A 3MRCA 5IB4B 5EU4B 4RGMC 4OF8A 4ZG1A 4OCYL 4WFFE 1JRHL 4MMXC 3RY6A 2JB6B 2BNRB 1Z9OA 1CDIA 4CMMB 4L8DB 4BJLA 4MNHB 2ADIB 4XCYA 3MROA 4PRIE 4QTIH 1NEZG 3TVMB 5F9DC 3MMEB 3U36B 3QIUA 5C6PB 4GAFB 2W9DL 2QL1A 1DN0B 3VFWB 3X3GL 2QKIB 4XPGL 2BSTB 4LNRA 3R8BB 2VDKL 3D85B 5I16B 5EWIL 3NTCH 2LFGA 4KKAC 2A6DB 5HTSA 3QWRD 5ABDE 4C4KO 1ZOXA 2FEEL 1OSZB 3NFNA 5E8OB 2V2TB 2WV3A 1I8MB 1NGYB 4I48A 5I1JH 1IEBB 1KN2H 1KG0B 1KULA 1F6AB 1HILB 2X4UB 5BRZB 5CINH 2H9GB 3LCYA 4L4VD 2C3GA 3FKUS 4B0MM 4LHQB 4YNYB 1HXMB 3GMRB 3TPUA 2IADB 4FZEL 2J6EA 4B50A 4MJ5A 4ISVB 4JPIB 1JRHI 4PJXB 3VXRE 1A4KB 4O4YL 1BQHG 2W0FB 2YUZA 3PDOA 4HS8H 5DD5L 4E5XA 3P2TA 1U36A 2C3WA 1UCBH 2R2HB 1MFDH 3SKUD 4M1GL 2VXUH 4JKWA 1MHPH 1TQBB 4P5TA 1MLBA 1K6QL 4OZ4A 1G7HA 4GXVL 3LY6A 4OZIA 3GBMH 1MIML 4BSVA 5F9OL 4RWYL 1KXTB 4LLUB 3MRKB 4JRXE 3DUSA 1T7ZA 1CGSL 4G9DA 3QXDA 3BXNB 3S34H 2X4SB 4KJQC 3FO9B 4HIEB 2CLZA 1GGYA 5CGYC 4N1EA 4XVSH 1OAUL 5C6TL 4CADB 4EUPH 1GL4B 1YJDL 2FEEI 3T65B 2EDQA 4ZSOA 1REIA 2OQJA 1NANH 4Q9CA 4KUCD 5HY9A 2PR4L 2XN9B 3KXFB 3FAXA 3WYRA 5HHPB 2VLKD 4O51A 3MODL 4JRWA 5IVNA 2NXZD 2C1PA 4P4KB 3TPKA 4PJCA 5T5NG 1BX2B 4XP4L 5E9DA 2WINA 4J4PC 4CU7A 1XCTB 1XF3A 1JYVA 1AJ7H 1ITCA 1U0QA 4K3DH 4NQDA 5C09B 1FDLL 2E9IA 2DKSA 4PJAB 4C56E 4AEEA 1U8OA 1Q9WA 1KXQE 3TCXA 3ISWA 5FYLL 3MCKB 3EW3B 1BIHA 3VCLB 4MS8C 4QYOB 4KC3B 1JHTA 3W11D 4N0UA 1RZ7H 1CXFA 4PY7A 4ZODA 3RTQD 4U33A 4UILH 4H88L 4NJAH 1KLGA 4GAJL 4YXKL 4PGBB 5E5MA 1F02I 4OFVA 3QQ9C 4Y4FA 3M1BB 1YECL 1JK8B 3G04A 1HHJA 3GSNH 1YDPB 4Y16A 1RQ5A 5J3HD 4KXZH 4TTDC 1KIQA 3F62A 1U3HB 2EDHA 5BV7H 1OTUC 2W1NA 1NSNH 2E9WA 3LQAL 4NO2B 3D25B 1HEZA 1F4AA 3IFOB 4MB3A 1IEHA 1QYGH 2R1YB 5DI8B 3R1GL 1XT5A 4Z7QE 2E27H 2B0SH 3LB6C 4J8RA 3QI9D 4JRYB 1CFSA 4QGTA 4QHKI 3QIBD 2D4FA 2AP2A 4TSBH 1I7RA 4Z7UE 2ZUXA 5EOQH 2M26A 1MF2L 4PLKC 2ZUQC 4HSQA 1OGAA 2W07A 5EFIB 1FFOA 5DHYB 3PWUB 2ZJSH 3I6GA 4WJ5A 5D7JD 1CLOH 2B4CL 3TYFA 3OB8A 1AQKL 1SMOA 4JQIL 4QT5B 1GPOL 3TNNB 1AY1L 3VXSA 2RCSH 1F4YH 2GT9A 3RGVA 2ZUSA 5HYSA 5GGVL 4I2XB 1KYOK 2BC4A 3PP4H 3UTQA 4HKBB 3TO4A 1IAIH 1OTTD 4FQLH 3IFNH 5B8CC 1LDPH 5KSAB 5J56B 3JV4A 2VDLH 2YPVH 2W0LA 4HKXA 4JEGB 3W0WE 3WNKA 1J8HE 3TT1L 1NCNA 3FAWA 4XRCB 2EYSA 5T3XL 2WBKA 5D93B 2A77H 3BPLC 4KRNA 4DGIH 2FH8A 3BYYA 3UP1A 4JFHD 4LCCB 4MNGA 4NDMB 2FJHA 1SBSH 2V6HA 4JY5L 5F6HI 4XB8A 3GUTB 3KPPB 1J12A 5AZ2L 1ZTXL 1LO2L 1OW0A 3S88L 3VWKC 5EN2B 1CFNB 1INQB 4F7EB 2VLME 4QHLA 1B2WH 3BHBB 1SJHA 1E28A 3BN9D 5E8NA 1AGBB 4PRHA 2EDEA 3LRHA 2ZOKA 5JO5B 3HUJE 2HJFB 2C4FU 4JFFB 4KK6D 3GIZH 4FHBD 1N5YH 1FC1A 3SKJL 3O11A 3F6IA 4U1IA 3VRLF 2V7NB 4MA3B 5FIEA 2X40A 5L8JB 3VGAC 1B90A 3LRSB 4WI8A 1CD9B 1ND0A 3K74B 4I5BB 2AK1L 3T3PE 4KY1H 1F3JA 4QXGL 5DJ6A 3V4UH 2XOTA 4NQVB 4EN3D 2CDFA 1HSBB 5EUOB 2VMFA 3KPLA 2MQ0A 3EJZC 3TZVD 1J1OL 3LS5L 5DUPH 4X6DF 5I75B 1JZ3A 3REWA 5AD0A 1KJMB 4J3XA 1X5IA 2EDDA 1Q8MA 3BISA 3VFPA 1FAIH 4OCSL 2V17H 3VFTB 5DA4A 3KJ4C 5B22A 1U8IA 3DUUB 3QG6B 1WWCA 1T1ZB 1A64A 2OZ4H 5BS0E 4I3SL 1TZHB 3IFLH 4KJYA 1GOFA 4ZPTB 3LQZA 1QSFB 3TESA 1DEEB 5F8QC 4OB5L 3WSQH 3ZYIA 1QBLH 4LRIC 5J1SC 5LCVH 5D7KD 3GBNH 2YD8A 3MCG1 2FIKB 4WENB 3N06B 4EDWH 1NCCH 1G1YA 3MLXH 4FZ8L 4LIQE 2A9NL 3DI2B 4NKOA 3ZHLA 4F9PA 2DI7A 4NJ9H 4L3CA 2DLEA 4LPUA 2Z35A 2DI9A 1YJDC 4XHJD 3U7AA 3KPRE 3UAJD 1Z5LB 3FQWB 5ESQB 3D2UA 3BZFB 1NBYA 1JNNH 1OVZA 2CR3A 4Z0BH 3WFEH 3BESR 3VFRA 1XIWC 2IBZY 3HNVH 5HI3C 2K7PA 2JJSA 1N4XL 2ZWLT 1T83C 1KEMH 1MLCB 5I1DB 4K9EL 5F1IB 2HT4D 1T20A 5DJ8B 1MH5A 3FB5A 1QTYT 5E8DH 4PS4L 2X1PA 4R97C 4XP5L 2E6PA 1S8DB 1RIHH 2FD6H 5B39B 5HD8C 1J1XL 5I8EB 4M48H 5FOBB 4KHXH 4DFHA 5D96B 5DK0A 5ALBL 3IDJA 3QDJA 2GQHA 1I9RH 3R0MA 1YN7A 4OGAC 5DMIL 4V1DB 3MXVL 5LAXB 3UEZA 5C0ND 1RZIB 3EYUL 1K8DB 2VLRD 3ARDD 1XGUA 1Q72H 5LGHL 3QDME 1KIPB 3BQUC 2HH0L 3WFCL 3V4VL 3BGMB 1C5DB 1CG9B 1UWEL 1X9QA 2DQGH 3OXRA 1I3GL 5INCA 1MHHB 4EUPB 1JWUB 5GRVK 3KYKL 1CYGA 4JQVA 2X6MA 3LQAC 1Y18A 3HG1D 4G8EB 2FX8L 4HGKC 4Z7WA 3TBWB 2ICWA 3VH8A 3S7GA 3DMMA 4AENB 4ONGL 4BK4A 4CMHB 1J7VR 5F7DA 1FJ1A 4GKNB 5T1KD 2JELL 5SV4A 1A21A 3TC9A 5C8JB 4JB9L 4L4TB 4HPYL 3VW3L 3DIFA 2J1KA 4P2QB 4IRZL 3QAZC 3PV6B 4GRWE 4LEXL 3SCMC 3MREA 3P0GB 4LSRL 2OP4H 3FFCD 2PTUA 5DWUL 3TF7C 1CD8A 4HJJH 3QUMH 4HXBL 5A3ID 4XAWH 2B4CC 4NZUH 4JFQB 4L8SA 3U0TB 4OGXH 1RJCA 2W38A 2NTFA 5IFHL 2YS4A 3V6BR 4RIRA 5SWSA 7FABH 5HVHC 3BUYB 4OGYL 3BH8B 2CDGB 3M45A 4JFEA 3WLWC 3U4EB 1RURH 3D3VB 1TENA 4HIXL 1AO7A 2AK4A 2J4WH 5ANMB 2JF1A 5KZCB 1AE6L 1EO5A 2VZSA 2I9LA 4PIRF 3AREB 5FO8A 5D1QB 4ONFL 3MJ8B 5JOPE 1J18A 3LD8C 2C1OB 5FV1L 2X1OA 3L5JA 5BV7B 3KGRA 2D7QA 4P99A 2R1WA 4JFDB 5CKAA 2AEQH 5IFJA 4N8VG 1UB5A 3NCJL 2FATH 4PJDA 4XVTH 4OBSA 2QJDA 4PY8J 4AEIH 1J5OL 3IDGB 1D5BB 2CH8A 3F7RA 5GRXG 1F5WA 1PY9A 4XVUC 1EAPA 5C0FA 2FX7L 5IB2A 5FGBC 4JQXA 1LEGA 3RPIA 4P23B 1MRFH 4XBPB 5DD6A 4MNQA 1MFCL 3PHQB 2NYYC 2OXHA 3NOIA 2IFFL 4WI5A 5AG8A 2DWDA 3G08B 2ED8A 2MPAL 4HF5L 3D39D 2BRQA 2PTTB 2F8OA 4Z7UF 5BO1H 4NGHL 5F96H 3QRGL 3UTTE 3WIHL 3K46A 5E00A 5DHVH 4M7ZC 4FTVE 2NW2B 4QXUL 3UZQA 3FRPG 1WBYB 3IFPB 2YR3A 5CILL 4ZXBB 4D3CH 5IMKB 3H9HA 5C92A 5FHBL 3MUGA 1ZANH 1R5VA 3QEQE 1WV7T 2HA1A 3ESUF 1A6VL 4M5ZH 4ZDHB 1P84J 2FYYB 4JY4B 5EO1B 4XI5D 2WIIB 2Q3ZA 4OT1H 3QFDB 5T1DH 5EORH 3DVGA 5F1NA 2VZVA 4OQTL 1I8LC 4JLRA 5C3TA 3IDYC 1G9EA 3ELAT 4QXTB 2OTUB 2DL9A 4KROD 4M7JL 1F58L 2ARJA 4WRLA 2DIBA 2DQHL 2IBGA 3KPSA 1QVOB 4OCNC 4JE4B 4I77L 3TEUA 1OLZA 2ADGB 4N1HB 3ES6B 4PFEA 5AYQA 2UVEA 1IGCH 4K07A 1H15A 3T4YA 4H0GA 4PV8B 3SDYL 4F57L 4GG6B 4X6CE 5D1ZC 1YPZA 3VGDA 5KTEL 1NCAH 4JFXA 4HFUL 4HK0A 4PJGE 4RGNE 4H26A 5ADPH 4MZ2A 1U91B 2R2CA 4K7PH 1G6RH 3HUJF 3DNKA 1CL7L 5C0GA 3ARBA 1EXUB 3MACH 3EOBA 2P5EA 3HI6H 4N0YH 3QBTB 3GBLA 5H37H 1CDCA 1ADQH 3QPQD 4JM2A 2XRAH 4OCRL 2IANE 2VZOA 4OM1L 4IRJA 4Y1AB 3HZVB 2QSVA 1VEMA 3INUH 3T3PF 1OY3B 1EEZA 1KGCD 3HPLB 1AD9B 1GJIA 1J11A 4K9EC 5L2KD 3GFUA 4HIHB 1XF4B 4KH2A 3VE0A 5C1MB 3PWNA 3MX0A 1S5HB 1R3HA 3PWLA 1M7DA 1I3RB 1L4IA 1MCPL 1XGPA 2P8MB 3B9KD 5E2JA 5F9AC 3CK0L 5A16B 2DBJA 3GO1H 3WDJA 1TZGH 2APTA 4UDTB 2JJTA 2NXZC 3OJ2C 3ARWA 5ITBH 2BOCB 1I9EA 4ZUTA 1E6OH 1X7QB 2DAVA 5HVGB 1KN4H 1B0GB 1YMMD 4MWFA 2Y23A 4K3HA 5K9KA 1WTGT 5HJ3B 4F58L 5JORA 2RQ8A 3Q1SH 2D9QB 4U6HB 1DJSA 1SEBA 1FE8L 2WANA 4HH9B 3HMXH 3SHSA 3W11C 4E0RB 3BZ4A 2CUHA 5LGJB 2BVQB 1HDMB 3RTQC 3E8UL 1TIUA 3FQRA 3N1FC 5LJYH 4WUKL 4ZUSA 4X4XB 1CL7I 3CD4A 4YHKL 2X4PA 3IF1A 5IEKB 1IGTB 2CPCA 2Y5EA 4S1RL 3P4MB 4GG8B 1RHHB 4NUGL 5CLWA 3O4OB 2BNQB 3FQXA 5F9WC 5LQBL 3MRHB 4J12A 3VRIB 3ZDYE 4G8GE 1PX3A 3TFKC 1U8NB 1B0RB 3RVXD 5I19L 4R4ND 3BJ91 3HR5B 2FBOJ 3CJJA 4HUXB 4TUOA 2OMBA 1V8HA 4LLDB 1N64L 1OL0A 3QI9C 3BP4A 1A4JB 4XPHL 3MRNA 3QEHA 2O5YL 4Q9RL 4XCNA 1A14L 5MERA 3QIBC 1VKXB 1X44A 5JA8B 4GBXB 2XT1B 4R7NA 4LVEA 2G75A 1BJ1J 4G9FE 1T2XA 3C60B 3T0EB 1A5FL 3Q6GL 5D7JC 3HNSH 5HGHA 1SJVA 2F53A 4NM8H 5FO9B 3ZE2F 2DYPA 1UXSA 4CVZB 3SKNB 4MD5A 4K7PX 4RX4D 4FABL 5C2BH 1OTTC 4UOW1 2JK5B 1FHGA 1T3FA 4U7MA 2AV7A 2BHZA 3GSWB 4OFYD 4HLZH 1E4KC 3C8DA 5J89A 4OI9A 5IKCA 5J9PB 4NHCL 3W39A 1AKJD 5DUBA 5CD3A 1P5UA 3TV3H 4EIZC 1NUNB 2YUXA 3C8KA 5IP4A 3QEUA 1A6WH 4RNRB 1NBVL 4R2GD 4GRWF 2VE6A 3OTTA 3BN9C 4X5XB 2P5WD 5DEFB 3DVIA 1A6TA 2XI9A 4M7LT 3L1OH 1BEYH 5TF1H 4KK6C 5IESL 3DX7A 4U1JA 4R0LC 3N9GH 3TJEH 2Z92A 5E56A 1RAMA 5E5UB 4KI5D 3WHXA 1UT9A 3PL6D 3I6LE 3OKLB 1FL6A 4JHBA 3H9SA 5ICYB 5IW3A 3BIAX 3CFBA 1RFDL 3RWFA 1IM9B 1A47A 4UAOB 5CIPH 2YK1L 4TRPL 3WIIL 3LKPB 1OAXH 4EN3C 3H0TA 3RP1A 4NRYA 2R9HD 4FRWA 3WNPA 1DCLA 3VFMB 3QWQB 1WWBX 1IKFH 1MI5A 3LN4B 3N1MC 4R26H 4WTZG 4YPJA 4OD1H 1I7TB 5DJDA 4TN9A 4P2RD 3ROOB 2E7LC 4YX2L 5GSVB 3K2UH 3GDBA 1UA6L 3GMLA 3H42L 1Q9LA 2D0GA 3MRIB 4OSUH 4HPOL 4PJIE 1F4XL 2F54B 1TJIH 4P9HL 2Q6WB 1NL0L 2Y4SA 4PRPE 3ILQD 1UWGH 3WO4B 4X4MA 5E2TH 5I6XB 1E0OB 4QRPA 3JV5A 3NZHL 3TIDB 3FHQA 5D9SA 1MAJA 4W81A 3S98A 4XHJC 3V0WH 2MWCA 3CXDH 3W0WB 1Q0YL 1FNFA 3TT3L 2A6JA 3MBXH 4LQ1A 1EAJA 4P46D 4WU5B 2AJVH 1FZJA 4XZUB 2O61B 2HN7B 3F58H 3WL9B 1ZT1A 1QBML 4JREC 1BIIB 2IAMD 5L8KB 3QUYB 4GAYB 3VRJA 2AJYL 2CKBA 4EXPX 4EJ1C 5GGTL 2ZZUT 1ZHNA 1UKSA 1EBPA 3MOBH 2VZTA 3MO1B 2HT4C 1PY4A 1T0NA 4L1DA 4QTHA 3A6CH 1JPTL 3AROA 2J88H 4NQCA 1CXIA 2DLFH 4AG4L 3CVHH 2L4OA 3VXUB 3W9EB 1KENL 2QTEA 5J1AA 5HYJA 4M6AA 3MJ9L 2NZ9C 5TPWH 3OKEB 1BVKB 2F5BL 4JPVH 5D7LB 1ZLWH 5DJZB 8FABA 2K9UA 5C0NC 3V4PL 3SGJC 1G6RB 2YA0A 1QRNA 2DMKA 3ARDC 4X6CF 4JY6A 5TJWK 4Z9KB 4MA7L 4AM0B 4PJGF 3SJVD 4I18B 3MV8B 3X14A 3VD4A 1UM5L 4H8WH 5CZVH 5BXFA 1OF2A 1GZQB 2N1KA 3LKQA 4ODVH 4TVPE 4ZUVA 3IDMB 4TPRL 2W0KA 1JZ5A 3LV3B 4Z7VB 1ONQA 5ELIA 4QNPE 3QIWD 3GKWL 1N2RB 4X7EC 3O6LH 4ZTPL 3MUJA 5I1CH 3CC5B 4I8DA 4HIIB 5GIRB 3BRGC 3U0PA 3TN0C 1EGJL 4PR5B 3GKZA 3BD5A 3AMKA 3X13A 2EDXA 5HHNA 4LARH 1JN6B 3IXAB 1FVEA 1M05B 4OZFB 1C1EH 3VWKA 5TFSL 2BJMH 4OZIE 4JM4H 1BZ7B 4RSVA 4MB4A 1RUAL 1EJ6A 4XXDA 3EO9L 5T1LD 1A2YB 3L5XL 1DFBH 1Q94A 1W0VA 2DMBA 4G6FB 4MB5A 4YAQB 4GQ9H 3MLYH 3C5ZB 1HI6B 2C7UA 5A3IC 2OR9H 1K2DB 1GC1L 4MD0A 1OCWH 5I76A 1BM3L 1T0MB 4WO4B 4PB0H 4ZSOE 4W4OC 2D0HA 3P4NB 4QCIA 3HC4L 4Y88A 2M1KA 1MHCB 5I1IH 4TSAH 5T3ZE 5IV2B 3X3FH 3B2UD 4BH7B 2XZAH 3PQYD 3G6JA 4NQED 1FV1A 4O02L 1RJZB 4JN1H 1WWWX 1TCMA 4GS7C 3PWPD 4PJCE 1IGFL 5E9DE 4HKZB 1BAFL 4QOKE 1DQML 4YHZH 5C08A 4QY8A 4HUWA 4NQDE 5GS0D 1U8MB 3W5MA 1EEYB 1ZVSA 3B8YA 1A6AA 4M6NL 1RZ8A 5CP3A 2VXTL 1B0WA 2EXWD 4NFBA 2I07B 4HS6B 5F89A 4XHQA 1K5NB 3BGFC 1F13A 3X3GH 4KDTC 2YHGA 4M1CD 4LRIA 3UTOA 1PYWA 1X5FA 1FN4B 2P1YA 4J2XA 4NZJA 3T77B 2DS4A 4PJ8D 4RISL 1Q9KB 1BD2D 3L5WA 2FHFA 3AS3A 4YHLL 5GHWL 3CFJA 3QUKA 1R3KB 1GCFA 43CAA 1TVBB 4KTEH 1CFTA 3SDDA 4ZAKB 3O3DB 2XA8L 3IXTA 3BP5A 3UJIL 3CFKA 1FIGH 3RWIB 2R0WL 3GSQB 1GVIA 1ORQB 2YSSA 2QQNH 3OR7B 4HZLA 1JGVH 3IKCB 2VLLA 2Q8BL 4FFZL 2Z31B 2VLJE 2AKRA 3CLFL 1DQQA 3BE1L 3P0YH 1KTDB 5IT2L 4FZEH 2VOTA 3TM6A 4PJ7A 4XI5C 4RGMB 4YO0B 4AZ8A 1OGAE 3HI1A 4U6YA 2WBJD 3BPNC 1RU9H 4JGUA 3LS4L 2PO6D 1EA9C 3QFJD 1S9VB 1K4CA 4QRRB 4KROC 1EZVY 1D9KA 2ZG1A 2VDMH 4YHPB 1CE6B 3OKOA 4ZTOH 4LKCB 4M1GH 1T21A 3IU4H 5IM7B 4XGZB 1YQVH 2R23A 2HVJB 4CL7A 1MIMH 1HINL 5CJQL 5F9OH 3SE9L 1SY6A 1MJ8L 2VL5B 4M7KH 2OJZH 5FKAA 3BQUA 4U7KA 3IGAA 4P9HC 5E2WH 2NMSA 1FG9C 4BZ1L 3GJFH 1AGCA 3CX2A 3EZ8A 1VERA 4JFYA 4OF5A 2V2XA 5HHMB 2A38A 1OAUH 5C6TH 3LZFL 1UG9A 2J5LB 5M95B 3FQNA 3UTPD 4WCYL 2IMNA 4X6FB 1QLEL 4G43B 2PR4H 3EOAB 4Z76B 3DHJA 3D9AL 3MRBA 3K7UA 5TQ2L 3TBYA 4ZOCA 2ORBL 3Q3GA 4HHAB 3MLSL 4MLSA 4PV9B 5DK2B 5ICZB 4LCYB 3QPQC 3CUPB 2YPKA 1QNZL 3MODH 2FB4L 4IJ3C 3FB6B 4O2EA 1W72A 3MRRA 3SCMA 4XP4H 4X7FC 1J10A 4RMUA 3I02A 1EMTL 5IHZB 1JV5B 3SE8L 4PRHE 3UC0L 3ULUD 3MGOA 1CICB 3T8XB 4Q9BA 3WHE0 2NY3C 4R4BA 5F72S 3GMPB 1M7XA 5FECA 3UJJL 5AZEH 2OS7A 3B9KC 3HE6D 4M62L 3RDTB 1J0IA 2YPLB 3DRTB 5EB9A 3O3BB 1HHHB 2CD0A 4MJ4A 2M8XA 3KWWA 1QR1B 2P43B 5JW4Q 5CUSL 1NGXA 4P57B 4XWOD 2UVFA 3BH9A 4H88H 4N90D 3WUWA 5GGSA 4GAJH 2AGJL 3HC0A 2I5YL 4X6BA 1A1OA 3C5SB 1ZLWK 5JOFA 3P73A 5LBSL 1YECH 4G3YH 4OCMC 4HFWA 4Y2OA 4CDGC 2HJKB 1DUZB 4PJIF 5D72L 5CHNA 1I7UB 3FJTA 4X0KB 5IG7A 3WFDH 3HLAA 1DQJB 1X5XA 1VSCA 4KPHH 3DYOA 5CJBA 1UH4A 1JPGA 1IAOB 3KS0J 1PAMA 3TIEB 5EA0H 3QO1A 3RNKA 1S7XA 4Y5YC 1B3JA 3WFHB 5DGRA 5EZIL 3SE4C 3OPZH 5TE6L 1NLBH 1RIVL 3HFMH 4K3JL 3RVXC 1EO7A 3TA3B 1D5MA 1KPVB 2Z91A 2UY7A 4I0PA 2F5AH 3AAZA 2OI9C 2DJSA 3KLAA 5E6ID 4UNVA 4H1LA 5MEND 2KL6A 3CVHB 3F8UB 1FNEB 1AQKH 5I17A 2XICA 1GC1C 4X6CB 4ODTH 5B38G 4LHUD 2HP4A 5FKPB 1FFNB 3I6KB 3KAAA 3LKOB 3OKYA 5E4EC 4ZFOL 1MREL 3LKRB 3HRZB 1FGNL 3TVMD 2J8UA 3P9MA 5ESAA 2GJ6E 1I8IA 1G7JB 5D6CB 2IANB 3SKOB 3QQ4B 1FIEA 3BVNA 4WGWB 3G5YA 4BK5A 5MEQA 1I8LA 5T3XH 5FM8A 1I1AA 2I60L 2EIEA 4IMKC 2JE8A 4Q2ZB 2D03L 4S2SB 4JY5H 5IQ9B 3PJSB 3D87B 4WGVB 1IGJA 2V2WA 1NDMB 3QDJE 4N0FB 4G7VH 5FUZL 4QNPF 1DN2A 3RWGA 1ZTXH 1NC4A 3QJFB 2EICA 4UUJA 1KJ2H 5ADOH 3C09B 1O0VA 1I7ZA 5BRZD 5D1ZA 5JNYA 4M3KB 2CQVA 4H25B 4OZIF 5F7KC 4ELMB 3O2DL 2YN3A 4NM4L 1EERB 3PNWA 2W65A 4YPGB 4QHUB 4NUJB 2R0LL 5EO9B 3ARGB 5IIEA 4BQCA 1VESA 4L9LB 1FO0H 4Z7WE 2IMMA 3MLWL 4MQTB 5HHOD 3E6HB 2AK1H 4FQCL 3ZTNL 1JUFA 3JV0A 1OB1A 4QXGH 2XWTB 3VG9B 2GJZA 3TBVA 2KPNA 5I71B 5TDOB 4Q58C 3A6OA 4L9DA 1EO8H 5I8CB 4O2CB 3LS5H 4KI5C 1OAYL 4U1MB 5I15H 3O3EB 3PL6C 1FH5L 1FYTE 3BN3B 2GIYA 4R8WH 4OCSH 5C6WH 4APQC 1MUJB 3L9RB 2PUQT 3BPLB 3PP3H 4MAYC 3IJSB 1XR9A 1MCJA 4NWUL 5DJCA 4PJCF 3UYRL 4ZD3H 3BKCH 3BZEA 1MJJB 3EYSL 4DGVL 3L3IB 3TP4A 2X7LA 1R5IB 4L3EA 4MD4A 4C83B 5GRJH 4JFEE 3O6FB 2IPTL 1TFHA 4G8IB 4JDTL 4EDXB 1DLHA 2XA3A 4A6YH 3EYOB 2AK4E 4UZGA 1U2HA 4HBCL 5E08L 2A9NH 4YXLH 4LCWB 4XBGB 3U7WL 1EZVX 4KK8C 1AHWB 4TVSa 5DD1H 2X44D 3LRGA 4P4KD 1CFQB 3F5WB 4P2OB 5BQ7B 1T5XA 3GJFK 2VABA 1G7LB 5GJTL 3ILQC 5DD0L 3VMOA 5C09D 1TVDA 4WEBH 1H3VA 4PJDE 2XWJB 1FG2A 3AY4C 1BHGA 1A6ZB 1NEZA 4JVWA 4AT6B 1QLFB 4OJFH 1MVUA 3IDXH 4I13B 4PRNA 3TLRA 1R0AL 5IGXH 4JO4L 2H32A 4Y2DB 4YHOL 4XP5H 3KPQA 4X98B 2OL3H 5DSCA 4U1KA 2UZIH 1R24B 1FLTX 3K80A 1HWHB 4KHTL 1D3CA 3QO0A 4JZJC 4FNLL 3ULUL 2EH8L 1U3HD 1KJ3H 5IMMB 1KPRB 2BOBA 4JHWL 4PGZA 4Z7OE 2CK0H 2G9HB 3GGWA 2HH0H 4M6OL 3WFCH 3ZSTA 1SYVA 2XYCA 3GJFB 3FB8B 1VHPA 1UWEH 4JRYD 3T2NH 3FQTA 1S3KL 4XPFH 4FN0A 1H3PL 3VGHA 4NO0B 3DV6B 1Z3GH 3MNZB 5EIVA 5K9OB 3MJGX 3OF6A 3U7YL 5DVOA 3KYKH 1TLKA 4ZFGH 4GKSB 4BFEA 2MHAA 1VADB 5HYQB 3BP6A 3S35L 2ZPKL 1H5BB 2FX8H 2NR6D 3DARA 4KFZC 5F88B 1CCZA 5ACZA 3C9NB 1BQHA 4X8JB 1U8QA 1G7QA 5B3NA 5CEZE 1IQWL 1UENA 5T33H 4LOUD 1V3KA 4MCYB 1NGZA 3OV6A 1A9BB 2W9EL 4JB9H 1VFUA 1MWAL 3QIWC 4Y5XB 5B39G 4IRZH 4S1QL 4YR6A 4BUGA 1CXHA 4LBEB 4LSRH 5DWUH 4F7MB 4ENED 4JO2L 5ERWA 1INDL 3WD5L 2IQAB 5KSAD 3WIHA 5C0JA 5L6YL 1YEGH 2VXQL 4LAQL 1FNGB 3G9AB 3LDBB 4J1UB 1NCTA 1ZHKA 4UINL 5DVLA 5ITFB 4GKZA 2P5EE 3DO7A 5FUCE 3UO1L 4JKLA 1HN1A 1P7KA 4EUPG 2L0DA 1WUNT 4HIXH 3RWDA 5CFHA 4HXAL 3MRPB 5DRXB 4GSDL 1I1CA 4YWGL 4OV5A 3EFDL 4CW1B 4LRNL 3LPFA 3NFPA 2KZWA 1S7RB 2GTWB 3B2UC 4Q0XL 2FSEA 1AI1H 3MROB 2YOCA 4JFFD 3IDNA 4Z0XA 3NCJH 2DM2A 3AU1A 3QIUB 1AQDB 4LNRB 2FX7H 3OZ9L 3LKSB 3ZKMD 3TBTA 4PJ5B 2OXGA 5JIKA 3PGCA 4U31A 2E7LA 3JWDL 4QRSB 3NPSC 3U1SH 2LU7A 2ENSA 2RB8A 5HDQH 3VFGL 2IFFH 4YK4B 5F70A 1NGWA 1FZOA 3IU3A 2MPAH 3JV6A 4HF5H 3U30C 3BSZH 4J23A 1N5AA 4PJHA 4NGHH 2YWYA 4HW6A 4M1CC 4U3XA 5EC1A 5KAQF 1CVSC 4I48B 5JUEL 4X9HA 4QXUH 1ORSB 4PJ8C 5EBLA 5DJXA 5LKNA 4XP9L 1CGXA 3L3KA 4FQ1L 2EDRA 2MSPA 5FHBH 1HH6B 2BVYA 4ZYKA 4YBHA 2HLFD 4EVNB 1FLRH 1DVFA 1PKOA 3RWEB 3H8NA 2HG5A 4LGSB 1KYOJ 3FT4B 3AM8C 5E6YA 3VXMD 4E5XB 4OQTH 2FL5B 4CNIA 1QEWA 3PXHA 5BOPA 2ADFH 2W59A 1F58H 3LMJL 5A2JH 4ZS6D 2DQHH 3SGDH 1MLBB 4OZ4B 1A7QL 3PP3K 5IK3A 2XIDA 5FV2A 2Q87A 3V5DB 4X4YA 2YD5A 2E8YA 3DUSB 2PO6C 2NLJB 1U3ZA 1KJ2B 4HUUA 4RFOH 2OK0L 3O4LA 2F53E 2MNUA 2VIRA 3P4LA 1WT5C 4F57H 1C08A 1H3UA 3P9LA 4P5KA 5KTEH 2YD7A 4HFUH 1JNHA 1WIPA 1J0KA 3FRUB 2AEPH 2GK0A 1JPST 3LH2L 3JVGC 3VI3E 2HT3D 1H8NA 3BKJL 2XXMB 4M7ZB 1CL7H 1DBBL 4TUJA 5HY9B 1FO0B 5MI0C 1KF9B 2IPUK 4RA0C 4NQTA 1FZKB 2VSCA 1U58B 3K8MA 5IF0A 4OM1H 3QDGA 4Z7WF 2AJXL 1MELA 2HAZA 1TNNA 5FDWB 3TN0A 2ID5A 1CK0H 2F58L 4V1DD 4PJEA 4U0RC 4MJIE 1EEUA 3A6BL 5I73C 1YA5A 3OXSB 3GMMA 1MCPH 1UJTA 3QPXL 4KTYA 3RI5F 4KAQL 2ATKA 4ZUUA 3VGEA 4ZNEE 1JHTB 4N0UB 1XH3A 1RK1A 3ULUC 4HQQL 3BKML 4GRMA 4HC1L 1VGKA 5EC2B 5HI4C 1HE7A 1N59B 4F58H 1NJ9A 4TYUA 4FQPA 3HE6C 1QOKA 1S7QB 1S78D 4A6YB 4W4OA 1U42A 1HHJB 3H3KA 3NCCB 2EEDA 4Y16B 4ZS7L 1A1MB 1NKRA 2DM7A 5JDSA 3H9SE 3FT2A 3ZYOA 4ZO7A 3LN5B 3BPOC 3E8UH 4L4TD 3S36L 4XWOC 2HFGL 1Z9MA 2ESVD 1HEZB 4P2QD 1P7QD 5DS8A 3UTSD 4PGEA 5F7YC 5IQ7L 3JTSA 1NMCC 4R3SA 1MFEL 1G7MA 1YNTA 4PRAB 4S1RH 5FFLA 3GRWL 2KQNA 1CFSB 2X9WA 1MI5E 1JHLL 2GAZB 4O5LL 1KCRL 1N8ZA 4JPWL 5CP7A 4PJDF 4RQQA 2NY7H 4D0DA 4FG6D 2WP3T 3I6GB 1N64H 4KRPD 2VLKB 3O2WL 4KDTA 1WFNA 2OL3B 5KZCD 4JG1H 1PVHA 3O9WA 1AIFA 3HHRB 3P77A 2O5YH 1A14H 1T7XA 3ARED 1A6PA 1MCDA 2R4SL 5D1QD 3PHOA 3VXSB 5LVEA 3R06A 3SOBL 2M2DA 2ZSWA 4NKIH 2GT9B 3RGVB 2EKJA 2A9ML 3D39A 2JCCA 1A5FH 1MAML 2CXGA 4LSTL 3HZMB 3HE7D 2QHRL 5KSUA 1YMHA 2AAVA 3FZUD 1CGYA 4BUHA 1GGBL 4Z7OF 5IW6A 2EYSB 3SDAA 5IMLB 5C0EB 3B2VH 1UCTA 4P23D 4FABH 5J12B 4W68A 4MNGB 2NW3A 1DANU 3OKDA 3G5XA 4PTUA 4J3WA 3TVMC 3SO3B 4UIKH 3OAZH 4R4FH 4C58B 3QUZD 2Y1VA 4QHLB 1OAZL 4NQCE 5E8NB 1JZ2A 3ZKNC 25C8L 4HULB 2ZOKB 3JWDC 1PX4A 4NN6B 4ORZC 2CUIA 5HYJE 1T03H 5KS9A 4ZXBD 1CBVL 3BDYH 1I9IL 4ZFFA 4PTTB 1AGDA 4NO3A 4NHUA 1LP9A 1BLNB 3N0PB 2CIKB 3K81A 5HDOA 2PN5A 2XQYK 1QRNE 1BMGA 3U2SA 5I1EL 5A40E 2XTJB 4JZOA 5D7JB 1LO5A 5EOCL 3MRMB 3WBDA 2VQ1A 3DGCR 5DJYA 3STZA 1D6EA 2XFXA 1T2QH 5AD0B 3MV7E 5E6ZA 4DKEL 2VUYA 1RFDH 4DCQB 3U9UA 3RFZC 4ETYA 4JM2F 2IALA 3T0XA 1A9EA 2X4RA 2C3HA 3IRZA 2AQ2A 2UWEA 3WNOA 3REVA 1T89C 3TNMA 3AB0B 4CN6A 4X4ZA 1EHLL 4MJ6B 1TQBC 4N9OB 5L2KA 1KSRA 3T1FA 4KJYB 4YQXH 1L6ZA 1HCFX 2VISB 3LQZB 4IS6B 2VR5A 1ZEAH 3NTCL 3RIFF 1QSEA 5D71H 4OD2A 3MJ9A 5ILTH 1FFQA 3VA6A 3EFFB 2DJUA 5CBAA 4P2CG 1KLFA 4HH8A 4L3CB 5IHUH 3L95B 4NRXB 1UA6H 4L5FL 1UFUA 2Z35B 1WC7A 5JIHA 5J6GA 2EEAA 2SEBA 4Y1AD 4CRPA 4XCCL 4QRQB 5I1JL 1NL0H 1NBYB 2BY2A 3G6JE 4XAKE 3FTGA 4WWKB 5CINL 3NZHH 4R0LB 4GRLA 4N8VA 4PRID 4IBLT 2Y36L 4P4KC 4M8VA 1RK0B 4MCZB 4PUBH 4FXGA 3GJEA 5CSGA 1EUTA 1Q0YH 3DBXA 1EGJA 1CD0A 3VFNA 1T20B 1DP0A 1F4HA 4F2MA 4AH2B 1MH5B 3EYVA 5ID1A 1T80A 3SE4A 4HS8L 1PG7L 5IMOA 1QBMH 1S7SA 5SWZA 2VUOA 4OZHA 3HI5H 4QRTA 3TZVB 2R0KH 3SDCD 3RWCB 1KCSH 2EDKA 4NKDA 2G2RA 1MHPL 2IBBA 5FXCH 5GGTH 1LQSR 1JYXA 1INEL 1F90H 15C8L 1UACL 1RUQL 3GBML 5IBTH 5IBUG 5JLZB 5CMAA 4Y4KD 1Q0XL 1XGUB 3B6SB 5LGKA 3FRPA 2DMCA 3EYFA 3HB3C 4XNYH 3OXRB 4XVSL 5D2LE 2BNQD 3DSNA 1U3HC 2XG4A 1T1XA 3V4PH 2Y6SD 3MYZA 2ICWB 1RZKL 3G5ZA 3VH8B 4MA7H 3KJ6L 3VI3F 4JFPA 3EOTL 4PJ7E 4RX4A 4PJFB 4Q7DA 4GBXD 1DR9A 3ABZA 4ZTPH 3VGGA 1H3WM 1QFOA 2VAAA 5FYLE 3X12A 3DX8B 2NR6C 4OFYA 4QRUB 4JRXD 3T0ED 5DMKA 1F8TH 1KC5L 2ERJB 3AUVA 2KUTA 5TFSH 4LOUC 4ODWA 1LMKA 3CVIL 4FS0A 5SWSB 4KVCL 4D0BB 3MC0A 5EIIA 4HS3B 2EE3A 3EO9H 4LK4A 5GSRA 3L5XH 3WEXA 4UILL 4XH2A 4UV7L 3HS0A 2EE2A 1C16A 3C5JA 2GTZA 4TOYL 5FOJA 4ENEC 1RZFL 5KW9H 1F2QA 4JDVB 1AO7B 4E42A 5D70H 4Z78A 5KSAC 4KKCD 1ZA6A 1GC1H 2R15A 5FO8B 2YZ8A 2DQTH 3U4BL 5FCSH 2CLVB 2KDGA 5DTFA 2YA2A 2Q86A 1Z9LA 5BV7L 1BZ9A 4LGRB 3BUTA 5D93C 5H37G 1TXKA 4XT1C 3FB7B 2IH1A 3LVEA 4O02H 1BZQK 5IFJB 3MZGB 1ZLVK 4LCCC 2E27L 2B0SL 2PYEE 5IB5A 2F74A 3PL6A 4UDUA 2GFBA 2XKNA 5JXEA 1IGFH 1JTTA 3N1PC 4IRSD 1BAFH 4APQA 4HWEH 5C71A 4U1NB 5C0FB 4W6WB 1BQLH 3AS1A 2UZYB 4MAYA 4WHTA 5DZOA 5GXBB 4TSBL 3RPIB 1MCWM 4MNQB 2YD1A 2NX5A 3HG1B 4X7TA 4F37K 3VXRA 3OAZK 2DBLL 4LPTA 3WHE1 2DWDB 2BVUA 1CD1B 1TMCB 3U4AA 1CWVA 3B9EA 4QHMA 4ETQA 4QWWC 4U2YA 4NBZB 3TBSA 4TQEH 1YY9D 3KLHD 1F4YL 1NCBH 1XF5A 3S97C 3OKKA 1FVCA 2NY2B 1IM9D 5I74B 4HAGA 4RISH 1NQBA 4HKJB 1G0YR 4YHLH 1F11A 3MUGB 4HCRA 1U8LA 3OG6B 4FQLL 1R5VB 3IFNL 3CLEL 3ZSSA 2VDLL 4YZFF 1ES0A 5TF0A 2DQDL 5T3XE 3I3BA 2EKSA 3MGTA 3HZKA 6CGTA 5I75C 4KXZI 3UJIH 1P1ZA 1VPOL 3TWCL 1IZKA 1KIRA 2XWBB 3L3GA 3OJMB 2A77L 3H7BB 4JLRB 4UNTA 2OR7A 4NRZA 1TZIA 3T0WA 4DZ8A 2ARJB 3CLFH 1SBSL 5L88L 3BE1H 5FB8A 4MA1B 2HLFC 2GSIA 3SGEI 4XCFL 4GW4B 3KPSB 4PRDB 2B5IB 4HGWA 4HDIB 3LS4H 2X9YA 4JFZL 2NPLX 1U93A 2AEWA 1H15B 3T4YB 3GIZL 3ZDZE 4JZJA 1YPZB 5ALCL 2VO5A 4JFXB 1PQZB 4HK0B 4PGCA 3GSRA 5CBEA 2DQIH 2Q8AH 5KSBE 2AQ1A 2WAHA 1HINH 5CJQH 1T22A 4AEHH 2A6KA 3S5LB 3W0WD 1MJ8H 1JMXA 3S3PA 5C0GB 4MX7B 4F7PB 4KY1L 5MEOA 4X7DC 2HLAB 3V4UL 2J8UE 4XTRC 43C9B 3QUYD 5FGCB 4ALAL 1WZMA 3CDGA 4L4VE 3LZFH 4IRJB 3DTXA 4NCC1 4WCYH 1EEZB 1QLEH 4HEME 2OM5A 1TJGL 3D9AH 5TQ2H 1Y6MR 2VLMD 4MGXA 3KPMA 4HLZG 1M7DB 1ZS8B 3VXUD 5HHVH 1QNZH 5AG9A 2DM4A 3HZYA 1T6VN 2OZ4L 3DX9B 3RIAK 3JBG7 1EV2E 5D96C 5D7LD 4IM8A 1NFDB 4NNYA 1EMTH 3IFLL 3UC0H 5JIPA 3CX5K 4MWFB 3PWVA 4YHYB 3WSQL 1C7TA 5IBLD 3CH1A 5JORB 5LCVL 3GBNL 5B3JF 4M62H 1U3YA 4JN2B 1SEBB 3MLXL 3HMWH 3QQ3A 3QXTA 3SE3C 1CLCA 1JNLH 5GS2D 4NJ9L 3MLUL 1U41A 1A1NA 4LVHB 1PD6A 5T1LA 3N85H 3EAKA 1CDHA 3C87A 5CUSH 3DETD 1U8JB 1FL5A 5C0CB 3FN9A 4PD4K 2AGJH 2I5YH 4CJ0A 1JNNL 2X70A 1S78C 4Z0BL 5C0DA 3DV4A 5LBSH 4G6AD 3WFEL 3OSKA 4CMHC 1RZJH 1UEMA 2Y5TB 5D72H 1NCDH 3SPVB 2A6IB 4W4NA 3BRDA 3G6JF 5FK9B 1KEML 3PQYA 4KMTL 4NQEA 4U1LB 4RFEA 1XF2B 1II4E 3KYAA 3R4DA 4D8PB 4WTZA 5KVEL 4G6FD 5E8DL 1P69B 2FD6L 4POUB 1W0WA 3MRNB 3N50A 3QEHB 2BFVL 3GSUA 4KHXL 4WO4D 4B53A 3V6ZA 1RIVH 5IVZA 4U4BA 1I9RL 1IGYB 4ORGA 1CDYA 3B8SA 3DVNA 3V52H 3KPRD 2YXMA 4FG6C 1F42A 2UZXB 3O2DA 1SMAA 4N5ED 4NBXB 5HGHB 5CAYB 3LQMA 2AVGA 4ODUA 2KQMA 3AREC 5D1QC 3J7HA 2DQGL 1EPFA 2LAGB 3MLTB 4J7RA 2DYPB 1UXSB 3VXNB 5BV7C 2FJFA 5JW4N 4G42A 1SJEB 1MREH 4WV1A 5TH2B 1OHQA 1YY8A 2A83A 2YWZA 5KG9A 2EO1A 1T3FB 1FGNH 1AD0A 2G60L 4Z5RA 1URLA 1SVCP 2APXA 2CRZA 3FZUC 3RZWA 3FOLA 1RZGA 1EHNA 2ZCLH 4HMDA 3AM8A 4YIQB 5C0IA 2EIZA 3W39B 1HYSC 2Y7QA 1F00I 2PW2A 3CFEB 3EGSB 4P23C 3QNYA 2I60H 4HD9A 3O6KL 4WW2A 4ZPVA 4DN3L 4DZBA 3OJDA 1OGTB 2OP4L 4JDZA 1EVUA 3FO2B 5TE7H 4KUZH 4PJ7F 4HJJL 2D03H 4OFKA 5FYJU 3RL1A 4Y5YB 4XAWL 3QEUB 3QDMD 4UQ2B 4CJ1A 2RFXA 4L29B 4OGXL 5IFAL 4O2FB 3QUZC 4WHCA 3QFJA 3GMNB 5GS0H 2HWZH 5BS0A 3EHBD 5F3BA 2YC1A 3ARYA 2R2BA 1DQDL 1JI2A 4ZXBC 3HAEH 3UPAA 4D2NA 5GZND 1R3IL 1RURL 5C07A 1NBQA 4YJZL 3DX7B 4U1JB 2MCPL 5IOPA 2Z31D 4NM4H 4YDIH 3ARUA 5F71A 4NZTH 2GUOB 2R0LH 3PDDA 1VFAA 3CFBB 3RWFB 3SDXB 5DQDH 4KQ4H 4FQCH 3W82A 3ZTNH 1J87A 3DO3A 4GUPA 4QRRD 3H0TB 2FATL 2GW5A 4DN4L 4OLVH 4YFDB 1OAYH 3FN3A 1BBJB 4LSPL 3LAFA 1MI5B 4JFHE 3RU8L 4KKBD 3UTZA 1KACB 3FMGH 3I50L 3BKYH 1X5HA 2BSED 3K3QA 4RMTA 1FSKB 4Y19A 1NAMA 4NWUH 1RIUL 3UYRH 3X11A 3OKNB 3EYSH 4IDJL 2P24B 4K8RD 4HZAA 5JQ6L 5HHMD 2LAAA 2ZG2A 3IS1X 5BO1L 1WBZB 3S3SA 4XMKL 3ROLA 3E2HB 3IDIA 3HE6A 4JDTH 1QA9B 3NCEB 4DKAA 2DIJA 5BW7C 4QRPB 1LO0H 2ZSVA 4EI5A 2ZUUA 4HBCH 5E08H 1ZT4B 1JVKA 1ZANL 3RNQB 3U7WH 2HT2D 4WI4A 1PKQB 4R2GB 2G5BA 2LU3A 4N0RA 5AWNL 3VD7A 3MFFB 3GMOA 1CICD 1LE9B 1FZJB 4OT1L 1J86A 5GJTH 2ARWA 2Y25A 5EORL 3UPRB 5H94A 1CE1L 4HK3N 4P4RA 3CSBA 3L6FB 3RDTD 4WY7H 4HT1L 3VRJB 4YDJA 2HFTA 5GS1B 1QRKA 3RVWD 3WE6B 5KN5B 1T0NB 1U95B 4QTHB 3VJ6A 4ONHA 4LF3A 4JO4H 4DEPB 4FQXD 1VFOA 4YHOH 2B39A 4I9WD 2R29L 3RZCB 3F7VA 5HYJB 4BH8B 3EJJX 3ZZ1A 1FPTL 1NCAL 1PW3A 5D7KE 4Z77B 3L3JA 4OM0L 1TTFA 3MOAH 3VD5A 5ADPL 3ULUH 1PZ5B 5J6HB 8FABB 2EH8H 3G5VA 3WN5B 4WNQB 1G6RL 1JE6A 2JIXA 3WV0A 3V0AC 2ZG3A 4D0CA 1FCCA 3MACL 4M6OH 5FUOL 3V7MA 1LO4H 3CFDB 3X14B 4UI2A 3NPZB 5IB4A 5BXFB 1H8OA 3DXAB 1OF2B 3LKQB 3O4OC 5DR5L 1H3PH 5EU6A 1GHFL 2BNRA 5HGAA 1MPAH 4WI7A 4CMMA 3VG0L 2YD4A 2ADIA 2Y6SC 3ALPA 3INUL 3S35H 3TA3D 5E1HB 2X89D 2DF3A 2J8UF 1QFPA 3F65A 4HWUA 3U0PB 3MMEA 5IVOA 4JAMB 5D4QA 3X13B 3U36A 5HHNB 4YE4L 2IH3A 1FVEB 1DN0A 1M1SA 3BAEL 1IQWH 2BSTA 5C0AB 3GO1L 2HFEA 4Y8DC 2A74A 2YMXL 1R5WA 3D85A 3UZVB 5LXGL 2Z4QB 4GKOA 2EZ0D 1MWAH 4GBXC 1TNMA 1DE4A 4QGYA 1KN4L 2OX5A 4P46B 4G7YL 1W0VB 1MQKH 3O4L