3UPAA

A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
b'DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYDADDLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPNTFGQGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kappa light chain variable domain
publication title General strategy for the generation of human antibody variable domains with increased aggregation resistance
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3upaA00
1AY1H 3SDXE 4Z8FL 2ZUTA 4L8BB 4YHNA 3MV7B 4TUJB 4R0LA 2BJMH 4L9DA 4KFZC 43CAB 1K9TA 5JW4Q 3V5DB 1JGUL 1QFWH 3WFHA 4RIRB 4UV4H 4HLJA 3QDMD 3BOVA 1GGIL 5CUSH 4ZMAT 5L2KA 4OTXL 2HLFC 1IC7H 1NAKH 4I5BA 4LOUC 3QUKB 2O61B 4D0CB 3WFEH 3TWCL 4NBZB 1OCWL 1MVUB 3RNKB 4WFEE 3BDYH 4JO2H 2A73A 5GGQL 1X4ZA 1FL5B 2EIZB 1JPTL 4KTEH 4NKQB 1G9EA 4ZQKB 3DWTA 4WW2F 2O5ZH 3NZ8B 1T1YB 3QDAA 3RBGA 4D0BA 4X4XA 1BZ7B 3BAEL 5D1XD 1YJDL 3OKNB 4NKMB 3HAEB 1UYWH 4XXCA 3QG7H 3G6AB 3PV7A 5DO2D 4TUOB 3QG6A 3TFKC 3SOBH 1HIML 5EO9B 1AD0B 1B2WL 4XNYL 4N0UE 2CDGB 1FRGL 5HPOA 5C0EA 4WO4D 2A9NL 4P3DA 2V9TA 4MLSA 4O9HH 5TPWH 4KK6D 4PGCB 5GQBA 4G8EA 2CH8A 5FKPA 4PGBA 1RVFL 5AWNL 2Q1EA 3QQ3B 5MERB 1OPGH 1RUAH 5I1IH 2DQFB 4FQHB 1IAII 3PJSA 2X7LB 5DJ2B 3SGKA 4UILL 4HAGA 4FMFA 3PV6B 3BKYH 3BESR 2PXYD 5E9DA 2OX5A 4JJ5B 3SDXB 1ED3A 2J2ZA 3HLAB 5A16A 5DC4B 4JG0H 3GSXB 1YDPA 4R4FL 2HMID 2ZCHL 5FF6A 1ZK9A 4HIIA 1F90L 3VW3H 4YPGA 1X7QB 1YEJL 1A21A 1RFDH 3VGEA 5GHWL 3MCKB 1EUUA 1KTDB 3CVHH 5D7KD 4WENB 4Z77A 5B4MD 1HKFA 2E9WA 4NN5B 4CJ0A 2J4WL 2X09A 3N85H 4OFPA 2VJXA 1QSED 1SEQL 1XF5B 3HN3A 3S88H 2VZOA 3L1OL 3TZVC 3P9MB 5CEYB 4U1KA 3BQUA 1NDGB 4JO3L 3ZT5A 4DK3A 2V9RA 2ADJB 1CQKA 4HXAL 3RL2A 3H9SA 3ZDXF 4E0RB 4OLUL 3QZWA 5F7FA 4LRNL 1Q94B 2XV6B 3GMQA 4FN0A 4E41E 1CICB 3O4OB 1GC1H 4LGPB 1VCAA 4N0UB 5I1LB 1EGJL 5IR1A 4QY8B 1OM3H 4JFXB 3UX9B 5CBEA 3MLUH 1UH3A 1Q1JL 4D9RD 3QRGL 2WWKT 4JPWH 4U1NA 1MCBA 4FQLL 4NWTL 1XGYL 3RWHA 5IOPB 5D7IF 5IG7B 2V7NB 3EYVB 5IWLC 5AEAA 1ZHNB 1WEJH 3H3KA 3W39B 1EHLL 5B3NA 4PB0H 1BZQK 3EOTH 4JFOB 5JHLH 3C87A 5CSZB 1K2DA 3DJ9A 1R5WB 1MQ8A 3L3JA 3PGDA 1I8LC 3MNVB 2CKBL 4X6FB 4ZFFB 3PWPD 3NCBB 5DJAB 1KB9K 4KMTH 5INCB 1DL7L 1QNZL 4KTYA 4KTDL 1KCVL 3RDTA 3LB6C 2CIKA 5J13C 3F7QA 5CEZE 2VISB 2QQNL 1XH3A 3VI4E 1VPOL 4JY4A 3UTQA 2F5BH 3OJMB 4JVUA 1NUGA 5IJVA 4RWHA 4RA0C 1CDBA 5I0DA 1DR9A 3LPGA 3H9ZA 2NMSA 4DEPC 3ETBF 3IDNB 2EDYA 4GBXD 4ELKA 1N6QL 5BOZG 3NACL 4E41B 4Y19E 2IAMC 1BF8A 3MLYH 4KQ3L 4N0CC 3O6FB 3ULUD 2P8MB 5CEZL 5EU4B 3WDIA 3CX5J 2I5YH 3B9KC 4P2RE 3T0EE 2F74B 4IOIB 4JRXE 5HHPB 3T3MF 4KMQA 2GW5A 3FFDA 2NQCA 5JPMB 4PJDA 2CKBB 4XCYA 3FOMB 4XHJC 3IVKA 5CD5C 4DGVH 3U46A 3GIZH 4QCIA 3V7AE 1XF3B 4JFQA 4ENEC 3U7WH 4PBWD 1J1PL 1F3JA 4P46A 3P9LB 2N4IA 3TT3H 3DUUA 2GTWB 2W60A 2HJFB 3JWDH 3AVEA 4XMPL 5DWUL 5DF0A 2CDGA 5D7SL 1UJ3A 4RQQB 2LTQB 3N1QC 3T0AA 4HS8L 4MAYA 2RHEA 4ZODA 4LARL 5HVHB 2E7CA 3KXFE 3QHZL 5I6XB 4MJIE 1Z6JT 1HQ4A 4H1LA 2FO4B 2XZQL 4MA7H 4E42B 5LXGH 1HCVA 3TN0C 4Y4FD 3UPCA 3N1PC 2VWEC 2PYFA 3MV9A 1U8MB 2BC4B 2XPGA 2AP2A 4RFNC 1YNTA 2IWGA 5EBMA 3HLAA 4ZD3L 3SDDB 1VGEH 2ED7A 4GLRH 2LVCA 3C8HA 5F7DA 1EA9C 4YO0A 1A1NB 1C5DA 4N5UA 4M61B 4JM4H 5I2IA 1X7QA 4XAWL 2HYMA 3SGEH 1CE1H 1YMHB 1P5UA 4M3JA 5EZOH 5KS9F 1RJLB 2EC9U 3OKDB 4XVTH 1P84J 3AFLA 4Y19B 12E8H 4LHUG 3DVFA 1NC4B 3VE0A 2R0KH 3KS0J 4P2RB 5FHAH 1F8TH 1CLOL 1TZIB 3P9MA 2BVPB 4JRXB 5IQ7L 1ADQA 4JDVA 3RGVC 1NDGA 3BHBA 3LHPL 4CVZB 1A02N 3LZFH 4L4VA 3P4MA 3B2UD 3BGFC 3GMLB 1G9MH 4ONGL 3NIDE 3GZKA 1RU9H 4N8CL 4X80L 5D70L 2VXUL 4N0RA 5K9QI 2R1WA 4JB9L 3QJHA 3T8XB 3P0GB 1A47A 1Q94A 3MROA 3VFUB 1ZHLB 5DJXB 3IF1B 4FFVD 1N8ZA 5GGUA 2JB6B 3D2UD 3RTQC 4F7MB 3RUGF 2VDLL 4PRDB 5MP6H 2QKIA 5HHQA 4LLDA 1HE7A 2YC1B 3KXFB 4JM2C 4MJIB 4YHIA 3RA7H 1GZPA 4GRMA 1IM3A 4QRSB 1JNJA 1KJ3L 4NM8H 2AXFB 3B5TA 5ELIA 3L6FA 5IQ9B 4ODVL 32C2B 3EYVA 4Y16B 2FSEA 1ZWIB 3HMWL 1XIWB 1OP5K 3EZ8A 4RMQA 4WFGE 4MXVF 3ARDD 3BIBX 1MY7A 3UDWC 5ALCL 2VH5L 4XMLL 1PQZA 4JFOA 5EZJB 1JZ7A 5CSZA 2HFGL 4DN4L 5KVMC 1LDSA 4HKJA 1M7DB 1GHFL 2NZ9C 2XWJA 5IB4B 1HH6B 1FORH 1N7ML 3C6SB 4L29A 5H35A 4F58L 4J8RB 2VDPH 1S5IL 4ODHH 3WKNA 1NGXA 2OTWA 4HV8A 3QUZB 3UJJL 1UVQB 3SGJC 5D6DC 2EDWA 3FO9B 1QHOA 4F7PB 4NQVB 3LKNA 2P48B 5DK3A 4ODSL 3MGTB 2Y6SD 1P2CB 1P4LB 1A3QA 3HZYA 1C5CH 3LQMA 3P77A 3WIHH 3IU3B 1JWUA 1U8NB 4HKBA 4ZTPH 3NCJL 5DRXB 2WUCH 3N0PB 4LOUD 5FUZL 4PRHB 5F8QC 4X4YB 3PNWB 2GFBA 5JIKA 3S7GA 4UBDC 5IBUB 5C0AD 5C0NC 4IRSC 5JPMA 1I1AA 3LKSA 5IHUH 2Z8SA 3RAJL 4G9DB 3L3KB 5BVPH 4D3CH 1ND0A 4EUPH 2R56H 3MBEC 1CWVA 4APQA 1N2RA 2GTWA 4K3JH 4CW1B 3TFKD 1HDMA 2X4OB 3V0WH 3G5ZA 5DD1L 5KANI 4M6AA 4MA1B 3GBML 1UB5B 2Z31C 2R4RL 3ZT6A 1UWXH 4XWGH 5FHBH 3K4ZA 5DI8B 3RGHA 3BE1H 1ES0A 4JGMA 4WEMB 4F57L 4LKXA 1VFAB 1YQVH 3MA7B 1VFBB 3MCLH 4Z95H 4PJEA 5IMMB 1YECL 4S1QL 3O4LA 3QUMH 3DPBA 3J8F7 5K9QG 3ARFD 1FVEA 3DLQR 4ZUTA 4E42A 4JKPH 1IGMH 1EHXA 3S5LB 3OB8A 4Z7VE 3BX7C 3WS3A 1CR9L 3F7YB 3OF6D 3EFDH 4FQCL 2BC4A 5DJ8A 1R24B 3FN0L 1UWXK 2CK0L 1G1YA 2EYTA 2HAZA 5E1HB 2Q7YA 5HDLA 4ZS7L 4TOYH 4H26B 4JY5L 4MQXD 3I02A 5MEOA 3SQOL 1LD9B 5E7FA 1CTNA 1TJHH 2BDNL 2JJSC 1RK0A 4N90E 4XH2A 3EO9H 4L5FL 4YWGH 3N9GH 5EIIB 3WLBA 3BD3A 4HH9B 2FECI 4TN9A 4KVNH 4JN2A 4BH8A 5BMFH 3UPAA 1A4KB 1F97A 3TZVD 2DBLH 2NR6C 3T0EA 4BSJA 4JRXA 1B0RA 1NLBL 2CLVA 2X1XR 3CSPA 4ZXBA 4CADB 3GBLA 4ZUUB 3D25A 5CP7A 3ALXA 1YMMD 4XMKL 1A6UL 5E56A 1RUQL 2MHAB 4XCCL 1BM3H 3IU4L 5EBWB 4OIBA 3C5ZA 1FDLH 3NFNA 1U41A 4MD4B 4UIKL 2D31B 1JYVA 3WHXB 1VSCA 2X6MA 3HI6H 3WNLA 3O0RL 3FT3B 4PTUA 1CLZL 4KI5F 3WUWG 4EI5B 3HNSL 3X14A 4WCYH 3KPMB 5E6ID 1RURH 5CIPA 4Z7VB 2AXFA 4OCLC 3ZE1E 2R1YB 3EOAB 5T3ZE 4KZDL 3T0XA 1T2JA 2XKSA 1FZJA 4RFOL 1NFDB 4NM4L 1M7XA 2AGJH 1QP1A 3EOYG 5E70A 4AIZB 3FO2B 4QGTA 2YD3A 1JHKL 1J8HD 5EC2B 3MRFA 3CFDB 5FCUL 1BHGA 2DDQH 4RAVA 5J06A 2I25N 2OL3H 5C07A 2F54A 3C6SA 2NY4B 5CWSA 1FZMB 3VGHA 1AO7E 1LP9E 4ZFZA 3GDBA 4C4KT 1PSKH 1OAKL 3K2UH 5C08A 5LAXA 3LB6D 5T3ZL 4L3EE 4OD1H 1U8LB 4YNYB 5FK9B 3BFOA 5KANG 4EEEA 2L7JA 4OZFB 3VXRD 1GZQB 3HI5L 2EDDA 3MRPB 2OXHA 2J88H 5FB8A 4JDZA 5EOQL 5ISZA 2YS4A 4XC1L 3EYUL 2B4CL 1Q9OA 4LFHD 5C0JA 4CVXA 2IAMD 1X5KA 3X3GH 1HHJB 3HE6B 4XCEB 4N0CD 1TETH 4QXUL 1EDQA 2DYPA 3CU7A 3VFRA 2X41A 2AQ3A 4HCRL 4XVJH 1OB1A 4YHML 4XCFL 3RNQB 5FAAA 3QQ9C 1SBBA 3GIVA 3CLFL 4L8DB 3C2SA 1SJXA 1QUNA 3GSQB 4XHJD 2CIIA 1NQBA 4NFBA 4CN4A 5IIEB 5HDQL 4QLRA 1FVCA 3CH1A 4ENED 1JIBA 1IGTB 2HN7B 1LE9B 1ZHBB 4MCZA 1DEEA 4HHAA 3IDJB 1IEBA 3GJFB 2DBJA 4OD2A 3IDMA 3DX7B 1MQKL 3RWGB 2R8SH 4N5EC 4HUXB 1UB5A 3PDOB 4YGVB 1QG3A 4X5LA 5HGGS 4OQTA 4L3CA 3FHQA 1A6TA 5GGVH 3E6FB 1IE5A 3MFFA 4M1GL 4KUZH 3FO0H 4FFYL 3FO1A 4Q9RL 4IHOB 2Q76A 1AO7B 1LP9B 3IDIA 4I0KA 4WI8A 4YZFE 2HRPL 5B39B 2HH0L 4TSAL 4L3EB 4ZPVA 2R0LH 1DFBL 5HHVH 1NGQL 3MRRB 2PR4L 4EDXA 1FFNA 2YUXA 4Y8AA 1BQUA 5L88L 4YHYC 3QDMA 3C60C 3JUYA 4F7EB 3ME0A 1T6VN 4LCWE 4UV7H 4NO3A 3SO5A 3N1GC 2HTKD 3GFUA 4HH9A 2LU7A 1EAPA 2YPVH 3VFOA 4GSDH 5DMKA 3IJSB 1NFIB 3VRJA 5HGHB 3HZMB 1DANU 2OSLB 1T21B 1EBPA 3RGVD 3MYJB 2WBWB 1BGXH 5D1XA 1NDMA 1TJGL 1FZOA 1U2HA 2HFEA 4Z18A 1YEGH 4DGIH 3QO1A 3KYOA 1I1YB 5D2NA 3TJEH 4RMWA 2NW3A 2AJYH 2N56A 1T03H 1MFDL 4OZ4B 4WO4A 5FM4A 1KENL 1NSNL 3IJHA 1N5YH 1ULVA 4PV9A 1A0QH 1JF6A 3KLAA 1CGYA 2LV4A 3B2VL 4IOSD 3RTQD 3WO4B 2QSCH 3GRWL 4U4BA 3TBSB 3L9RB 1YYLL 1IGJB 1V05A 5E4EC 3IFNH 3I2CL 2GYSA 1F4WL 3MJ8B 3WFDL 3BXNB 5A3IC 1D9KB 2GK0A 2PXYA 5C9JB 4LCIH 2ZUSA 4GKSB 5IROA 1EX0A 1CDGA 4Y5YC 35C8H 3OR6A 4RGOH 3B6SB 4AEIL 4QHUB 2CDEA 2ERJC 5DD6A 1MIMH 4LAJH 4PGZA 4HXBH 5DD5H 1UZ8B 3UTPD 5D4QA 2B8OT 2DQHH 4MJ2A 4DKAA 2FEEL 3FO2A 1OAYL 4LSTH 2NZ9D 5EC2A 4IS6A 4LCWB 4U1JB 2JELH 5GRJH 1QSEA 5JXAH 3VXME 1BX2A 5D6CA 4LSPL 2Y1VA 4WTZG 1HHKA 4N8PA 4ELMF 3NCEB 2JCCB 4ALAH 1KBGH 3QEUA 1LO2H 2G9HB 4PYHA 4JHZA 1U8LA 5GGTA 2FYYB 1S7QB 4K8RC 4KAQH 1F4AA 4FZEH 5KSUA 2MQ3A 3MRPA 2DKMA 2BNQD 3C08L 1YNLL 3T65B 4WW2B 4DW2L 3VFNB 4Z5RB 5MI0C 3GK8L 4KJPC 2FZ3A 1CU4L 2V17L 1WJ3A 1IZKA 3QWRA 5DFWH 1NL0L 2DQJL 1ACZA 5GJSH 4FRWA 3AROA 5LVEA 5ADOH 4OJFL 4F8QA 3EO0A 5KSAC 2RR3A 3FB8A 1ZTXH 1QKZL 4F33A 1QEWB 2I24N 1FNSH 2D0HA 3U79A 1A1MA 4YPJA 3VXOA 2RCSH 5ECJE 5C0ND 4IRSD 5AAMA 3DGCR 3RKDC 1DQLH 5GS0L 5L8JB 3IKCA 4LLMB 3QI9A 2FCBA 4ODTL 2HN7A 2ZSWB 3MBED 4X7EC 2RFXB 3GJFA 2E6JA 2NY2B 3PGFH 3DXAD 2DLIA 1XZ0B 1JWMA 1T89A 2R0ZL 3PE9A 3PDOA 1N5AB 3PWPA 2CDFA 2MJWA 2Z31D 5GRVK 1JYNA 4JG1H 4P5TD 4I9WD 4R8WH 1J0ZA 2LAAA 1YN6A 3RP1A 1FH5L 3CDFA 4F37K 2YHGA 3VXMB 3W9DB 4L9LA 4I3GA 3A67H 4LLUA 3QEQD 5IB1B 5IVZB 1RSFA 4XZUA 1VB9A 3U4AA 4Z7UA 3W5NA 2FHCA 3TBYA 3LKQA 4MJ5B 1EFQA 3ROOA 5B8CC 4GBXA 2AEPH 4R7NA 3VXQB 3UTTD 3OXSA 3DRTB 3KPOA 5BZDB 3X12B 2PW2A 2ZG2A 5AYUL 4PR5A 1LE5A 1IGFH 3WNMA 1NJ9A 1O7SA 4G5ZH 5J6GB 4P2CG 4OLWH 1BQHG 4NHCH 1DBKH 4LHQB 4X6BA 1UG9A 2DAVA 4JN1L 5JDSB 1CT8A 5D7LD 2P44B 4H20L 3I50H 2NXYB 5DEFB 5EIVA 3DSFL 4D94A 1TZGL 2OSLA 3T3ME 4XBGA 4NIKB 3VFGH 1PGRB 4XRCB 1YPZE 5DHXB 4GMTL 1HSAA 4X7DC 4MNGA 4YUEL 1P9MA 4XNUL 5BV7H 3VFSB 2IBGA 5I8KH 3CVIL 1M7IA 3EYFA 3WD5L 4X5WB 1T0MB 1A2YA 3DTXB 4ZO7A 2GJ6D 2PO6C 1I9IH 4DTGH 2XQYG 5JA8B 1T80A 1JV5A 4J3OC 4BELD 1JHTB 2E7BA 2CD0A 1BFVL 5EFIA 1FG2A 2F19L 3CX2A 1MFBL 4Y4FA 3HPJA 4OF3A 4Q0XH 2EE6A 3CUPA 5I8EA 1RZJH 4EDWL 1FNFA 1U8KB 4OI8A 5F3HB 5JLZB 2JF1A 4Z78A 1EERB 1EJOH 4KK5C 1YA5A 3QUYB 3SKJL 4AENA 2EH8H 3CFKA 1MJ7H 1ITCA 3C5SB 1DDHB 3LQAH 2XRAL 1X5AA 3ARGC 4K71C 4U1JA 5KS9E 2Q86B 3WNKA 5SX4I 4H5SA 3WKML 3CFCH 1GC1C 2OK0L 3BPLB 4X6EA 4U1MA 4Y2DB 1B4JH 4S0TD 3VH8B 2IF7A 2G9HA 1P1ZB 5ACZA 1A9BA 4W4OC 3MNWB 3QDJB 1YPZB 3QWQB 3FCTA 2EEDA 2E8ZA 3HI1B 5EU3A 2C4XA 3T65A 2NX5D 1VKXA 3VI3F 1NMBL 1EO7A 1BFOB 3VA6A 2NY7H 3SBWC 3LN5A 3D2UA 3DURB 5ANME 3QO0A 2NNAA 4HQQH 2XZAH 4LSVH 1GCFA 5F96H 2YPLD 2BVQA 4JQXA 1N59B 1UACL 3CZJA 2WM0A 3E8UH 5D71H 5IBLC 5T5NF 3RUGE 4MD5B 5DDHA 5CFHA 4M43L 3WLWD 5IB5B 2DD8H 1I3VA 5D2LE 3SEPA 1IAKB 3L95B 5L0QC 1RUKL 4LQFH 4NQDE 2CKNA 4N1EA 3TJHD 3ARDA 4X7CC 1OWWA 3V52H 4OLXL 4PREA 1HSBB 1KG0B 3KPQB 3P2TA 4GW5A 2WINB 4MXVE 4N5ED 3O2VL 4U49A 3BP5B 5ICXB 3ZTNH 3V9FA 4XP1L 4K3EL 1JE6A 3QCVL 1KCKA 2VXSL 1AGCA 4TNVF 5KS9B 4HGWA 3IFPB 3VXMA 4UT7H 5C3LD 3W9DA 5JW5B 3BKML 4V1DD 3NCMA 1EHAA 5DJZA 2VLMD 5IVZA 3U36A 3HRPA 3L3DB 3MX0A 1AI1L 2H3NA 4JHWL 1EUTA 3ZYIA 4KKCC 1S7XA 4KKBC 3MRMA 4OLVH 3C60D 2AXHA 1KXQE 2QQKH 3V0VA 5IESH 4AK1A 1TJIL 5BZDA 1IKFL 5GS3A 3FTGA 1DBMH 1AHWB 5IJKC 4GMSH 4QO1A 1V8HA 4YHLH 3VFVA 4JZJC 3MLRH 4HS3A 3WS6C 4N8VG 3Q6GH 5ANMB 4WDIB 4ZO6A 1CE6B 3LEVH 1IGYB 3IGAB 3LS4L 1OOAA 1KFAL 3RUGB 3T08A 1FFQA 3CX5K 3K4DA 3BISA 1CGSH 1UH2A 5CHNA 3MRDA 2XA8H 2DQEH 4O2FA 2DWEA 3T2QA 5D2LB 3I3DA 4M5ZH 1Q9KB 4OCYL 1U3HB 4NQDB 5DK0A 1DVFB 1HYRC 3INUL 3TNNB 1G7PA 3VGGA 3F8UB 5EH1A 2BSSB 3ARYA 5D7IA 3BP4B 3W2DL 3GB7B 1PKQE 5DRWB 3KLHC 1FL6B 4Y4KB 4QRRE 2ESVE 4XBEH 5MENE 5TGBB 1I9JH 1S7UB 1JHTA 1A5FL 4N9GB 4XPFH 3ARFA 4YXKH 4IMLB 2BVUA 1C08B 2CR3A 4UOW0 5A3ID 3HAEH 1KGCD 1D5IL 4DKEH 1KIPB 2OYPA 1EHNA 4QHKI 3DROB 1G7IB 1EEZB 4Z8FH 1A7NH 1AGBA 1DLHB 2P24B 3VGDA 4YHZH 4WWKC 1KEML 5EOTA 2V2XB 1I3UA 1G9MC 2E6PA 1Y0LA 4X7TB 1IEHA 5T3XH 4IEFB 1UB6B 5DRZB 5INDB 2H26B 4OTXH 1CF8H 2B2XH 1IEAA 3RWDB 5FA4A 3AAZA 3TZVA 1MFAH 1P84K 1NGWA 4ZPTB 2I9TB 2AVGA 1WZMA 3EHBD 4OUOA 3QXWA 4F15B 5FO9A 5DFVC 4K8RD 3MNWA 3QSKB 1YMMA 2VO5A 4KPHL 3QQNA 2EO1A 1EXUA 3HI1A 1KLGA 1K6QL 1EBAA 3GSNA 4U1LA 1KSRA 4IMKA 1BVLA 4KJPD 1BFOA 4UIMA 1NEZG 1HIMH 3QA3B 4OF8A 1B2WH 1PKQB 5IFJB 2A9NH 3MR9A 1X9QA 1T3FB 2F53E 1ADQH 4QRRB 5ITFA 1U3JA 2ESVB 3R0NA 3QDHA 1KYOK 5MENB 1UZ6F 5BW7C 3RKPA 5E6IA 4AYFA 1HHIA 2NTSP 1BQLL 3RKDD 4ZUSB 4OV5B 4HJ0C 5IWLA 4KI5E 2X4NA 1IL1A 1NKOA 4GUPA 5HGAA 5CJ5A 2A6KA 1PZ5B 3VCLB 5DVNA 1K3IA 4LVEA 3AS0A 3MRBB 3AREB 1YEJH 1J8HA 1I8LA 2I07A 1N64L 2VDOL 1M71B 1F2QA 5E5UB 5ICXA 3IT8D 2V7HB 4GAGL 2IH1B 2PTUA 1NCAH 3U4BL 1JPSH 3ARVA 1QZ1A 2J4WH 4QRUB 4PY8I 1OTTD 1SEQH 2EXWC 1BOGB 5D7JB 5HHNB 1G84A 3PGCA 4GXVL 4L8CB 1LK3L 2ZSVB 2L4OA 4RGNC 1AQDB 3VXRA 1AQKL 3QNYB 3FB5B 3VFPA 3L3DA 3D85B 2BFVL 4M4PA 3F12A 3STLA 5BJTB 2IQAB 5GS1B 3ZTJG 3T4YB 3C6LC 1DQDH 2GITB 3RWIA 5C09E 3L5XL 1IKNC 1W0VB 4ZOBA 1AHWA 1BIHA 1A22B 2ICES 4ZS6C 1EGJH 2HTLC 1WIOA 4WV1A 2F53B 4X7FC 3A6OA 1QR4A 2OJZL 6FABL 5J3HD 2C4FT 1Q1JH 3L3IB 3GHEL 4S10A 4HUNB 5EC1A 4JHAH 3TEUA 4FQLH 3V79C 1QQDB 1AR2A 1XGYH 2EKSB 2W1NA 4NNYB 4Z7QF 5IVNA 2EIDA 2DTML 2FLBT 3T04D 1CL7H 1QBLH 5B22A 4HKZB 4LAQH 1EHLH 1HOCA 4GW4A 4XNXH 2YXMA 3GKWL 5CJOL 3H0TA 4HMDA 1HN1A 2C7UA 2PO6D 1F58L 5EBGA 5J1AB 3RX7A 4NWUL 3MODL 2GK2A 3KR3L 2A83B 2VABA 2GAZB 4PJAE 2UWEA 4OCNC 4P9HL 3NH7L 1FO0L 1QNZH 1MIEH 4KTDH 4U3HA 4NN6B 5TDNA 4OZGF 1KIPA 4KHXH 2QQNH 1CFQA 1VPOH 4JLRB 1X6NA 2QSQA 4JKKA 1DLHA 4PY7A 4QXGL 5E99H 1WZ1H 5FO7B 3FAXA 3U83A 2EE2A 4ODWB 3ULVH 4MMZC 4NBYB 4CNIA 4KK5D 5I19H 2V2XA 3ARTA 2ZKHL 3DYPA 4OSUL 5T1MA 3JV0A 5JPNB 3FQNB 5C09B 2VQ1A 3SPVB 5DRZA 5INDA 2UV3A 2GCYA 2BNUA 5F89A 4QRPD 1KELL 5IUSA 5F1IB 5CEZH 1KNOB 3WIIL 4G7VL 4GW1B 4X0KA 4G6KL 3RGVA 4J3VA 4HK3N 2DLFL 4KV5E 3P0VL 4GRLD 2MQ0A 1G9NH 4MWFA 3BO8A 2G5BB 5L7XL 1MI5E 1XF2A 5J9PA 4HWZA 1FO0B 4HUWA 1DQMH 1YC8A 4WFFE 4OIIL 1KJMA 1JZ4A 2VDNH 1KIUA 2NTFA 5IW6A 1R3IL 1G7MB 4L8SB 1NMAH 4WFHE 3ABZA 4EN3B 1BPVA 1MCPH 3RTQA 5D7SH 2D3VA 3MRQA 5ITBL 1CFBA 1FFOA 1J05B 2A74B 4K7PX 4PJAB 1QYGH 3P73A 1MREL 2XZQH 1GGUA 4JFEE 3RVWC 4O58L 2NY3C 3GSWA 3R8QA 4QNPE 1X3DA 4ZAKD 1UWGL 2E5EA 2XWTB 3B8YA 4ZD3H 3UDWA 4R2GD 1FNHA 4I0PC 2MPAH 4CVUA 2X42A 5MEQA 4W6XB 4K23L 3CZFB 4GLRI 4OGXL 3M8OH 4ETQB 1FGVL 3I9GL 5C0CD 4M6OL 1R3KA 1YEHL 3NPSB 1QPXA 2FJHB 4RGMC 1CFNA 5CIPH 2Y9RT 2IFGA 4PJ5D 2K1MA 1SHMA 5F6IC 2YWZA 1FP5A 5H2BA 5HHNA 1FIEA 2CRIA 3WIFA 1P7KB 1A6WL 1VEMA 3GI9L 5KOMC 4ELME 2VL4A 5IQ7H 2FX9H 3SGJA 4U1IB 4QYOB 2BNQA 3RJQB 4CAGA 3N50A 3K7UA 2FO1A 1M05A 4KKCD 4N8CH 1TVHB 2QR0A 3QHTC 4HEME 4KKBD 5GS1A 4KUCF 1MI5B 3OAZK 3PWVB 4JB9H 4KC3B 4OFDA 1JZ8A 4PJFA 1CBVH 1U58A 4AH2A 4FQ1L 2IFFH 1SJHA 1FYHB 4UT9L 4U6HA 1BD2E 5DJ6B 4V2BA 3OAUH 4UU9A 4XNZC 3I6KA 1S7VB 2VDLH 2GSGB 5JOPD 4HUUA 4BFIA 2VUYA 5HYJE 2HP4A 1C12B 1MH5A 1S78D 4IRSA 3MOQA 1NAML 3OSKA 1YEIH 5LWYH 4LGSB 3VD4A 2XICA 4HT1L 3BPNB 1E6OL 4JFEB 1XGTA 3D69A 1KUMA 4Y5VA 4P2OC 2AQ2A 5F9AC 3RVTC 4PRIE 2I60H 2G2RB 3GMPA 3HMWH 3DXAA 3V0AC 4ZFOL 1NCCH 4Z9KB 1SYSB 5E8DH 3G5YB 1X44A 4XMLH 2Z31A 1ORSB 4M8QB 1CLYL 4HKXA 2ITCA 4P5TA 1N0XL 4GAJL 2Q6WA 5DK2B 4EVNB 1V3JA 4P4RB 5HVFB 4Z76A 1N7MH 5SWSD 3RY4A 4ORGB 1S5IH 3HKFA 3QEQA 4G8IA 1JWSB 3U7YH 2R0WH 3OXRB 3GBNL 1LK2A 2JLLA 3LKPB 4U6VL 2E7MA 1RIHH 4K7PH 5KZCB 3RBSA 5K9OB 1CG9B 3BH9B 3UJJH 4ELMB 1C7SA 1VENA 1Q0XL 1NAMB 3UTTA 1QRNE 2IGFH 1CQYA 4Q2ZA 2MSPA 1UC6A 3H6JA 3BWUC 1FLTX 3IKKA 1CCZA 3U4EB 3VMPA 2DJSA 1XCTA 2I26N 1FHGA 3IAQA 4A2MA 3NPZB 1U8HB 1HH9A 2VDQL 5BS0D 1BD2B 3LMJH 4ZFOB 3QAZC 5FUZH 3MLZL 3PWUB 4OCMC 3U9UB 3EFFA 5JIPA 4U1GB 3V5KB 3TPUB 3FMGL 2N7AA 4NC1C 3RIFK 3ZKMD 3QCUL 4NRXB 4PLNC 5E1AA 3NBNA 5HYJB 3SE9L 2VIRA 1IC1A 4G8FB 5DFVD 2BVOB 5JW3L 1Y18A 3EYOA 2R1XB 1FO0A 5EOCL 5J89A 4M9PA 3L7FA 2M2DA 1FNLA 2W9EL 2GJ6A 2H1PL 4PRIB 1EZVY 3P11L 5DURB 1LWRA 3EGSB 4M7LT 1YC7A 4H25B 3H9YA 3GMOB 1JK8A 5DUBA 2R4RH 4UZGA 2V9QA 1J05A 3LKRB 3W11C 4RA3A 3BEWA 5FKAA 1BVKA 4FQXC 1YY8B 1YECH 4S1QH 2J12B 1FVDA 4IIQA 1UM5L 4KRLB 4OM1H 5ALBL 3UJTH 2Y72A 5CLWA 2FEDC 4P23D 1CR9H 1F45A 4HJ0D 3FRPG 1J0IA 3TBTB 3DNKA 5EZLB 2CK0H 1P5VA 4HIXL 4HC1A 4O2CA 5GRUL 4Y1AE 4RX4D 2AI0L 1QRNB 2HRLA 1U95B 3SQOH 5DT1H 3U0WH 2ZOKB 3KHOA 5CJQL 4S1DC 3ZL4L 3MRGA 1C5BL 1NC2B 1RZKL 4AEHL 2AJZA 3VWKC 3O8XB 2OI9C 3S4SG 1MCWM 1G1CA 4PTTA 5GISL 1YY9C 4G8GD 3RL1B 2VZSA 3V8OA 5AUMA 2W92A 2G75A 3C2AH 4RGND 1ZS8B 4GO6B 2DIJA 1MWAL 1NLBH 2XWBB 4PJGF 2HKFH 5EU5B 5ILTL 3DYMA 3ARXA 4K3DL 2NX5A 3N1MC 1J7VR 1CGXA 1IAIL 3C6LD 4X9HA 4XMKH 1A6UH 8CGTA 1RUQH 4Y8DC 3UTSD 4JFFD 2J8UA 3B9DA 3R06A 3VG9B 3GGWB 5A1AA 3LEXA 1JRHH 2A6IA 2GUOB 2YZ1A 4KVCL 1UQSB 4ZS6D 1QBBA 2YPLA 2FR4B 2P7TA 2HTLD 4N1CA 3IXAB 1FFPA 1XFPA 5FGBC 2GSGA 4OZFH 2AJSL 1GGTA 2Q8BH 4MA3A 3HUJA 4PJHA 2B1AL 2JJTC 3V6OE 4ODUB 2NYYC 3BJLA 3QFDA 2AJ3B 3HNSH 4P4KC 5DC9B 4XVUC 1YUHB 5AG8A 2GSIB 1NGPL 3DRQB 4YBQC 2G2RA 5DTFB 2XY1A 4PB9H 3HE7C 1MWAB 3F62A 4Y1AB 4RFOH 4OCRL 4GFTB 5FECA 3LH2L 3QXVA 1OAZL 3Q6FB 3SCMD 3EDEA 1T2QL 5I1JL 2VZUA 3QXAA 2BCKB 4V1DA 3P30H 2YA1A 3O45A 4DN3L 5C6TL 3GJFH 4EUPG 5DEGB 1ZVHA 1VGKB 3A0OA 3WE6A 2B0SH 1MAKA 2PYEE 5FYJE 3ES6B 5TDOA 1WF5A 4MHHI 5TQ2L 4OZIE 4C58B 1BJMA 3C60A 1QFPA 2ARJB 5GGRA 1IBGH 2MCG1 3WXVL 5I66B 3DECA 4QTHB 4XC1H 1LMKA 5BV7C 3EYUH 5I1HH 3S9DB 2B4CH 4GXUN 2Z91A 3OB0H 2DWDB 1RJYB 1IT9L 3GJFK 3JXAA 3MRJB 4F3FB 3FQWB 4KUCD 4HWBA 4FQJH 3NABL 4RISL 5JW4M 4BKLA 5I1CL 3U9UA 1EVTC 4HCRH 1UM6L 4RMUA 5FOBB 5FYJL 2FL5A 1FZKA 3CLFH 4HIHB 1ZGLP 5TH2A 3OB0K 3FONB 1KPUB 3REVB 3VGBA 5HDQH 3F5WB 1WBZB 3IETB 4CMMB 4ZOEA 4JPKH 3QFJD 4PRIA 1UXSA 4X99B 3OKMB 1I75A 1KACB 1JTPA 5IF0B 3P4NB 2XFXA 2EYRB 4NZRL 2MKWA 2FATL 4WY7L 4C83B 5A43C 4M1GH 3OGCB 3SGKC 1YY8A 4WEBH 4FFYH 4Q9RH 2Z93B 1QSFE 3W0WE 1DUYA 5AYQA 4LHUB 2HRPH 2K3TA 4X8JA 1TVBB 4TSAH 2IPUK 5DHVA 3RVWD 1DFBH 2QHRL 3OQ3B 1NGQH 5EZIL 4OFKA 4FOMA 4TULH 2PR4H 3RPKA 1VDGA 3SKNB 2GTZA 2PYEB 4OZIB 3AB0B 3H9HB 4S1SH 1GYAA 4R26L 1PBYA 3RY5A 4NT6A 3OAYH 3OKEB 2FX8H 4ZDHB 1OAXL 3Q48A 5C0GA 5FYJU 4MNHB 1D5BB 1U2CA 1ZGLB 3RL1A 4HJGA 4LVHB 4OGAD 2UVFA 3T3PF 5FV2A 4LASL 3VXPA 4EZMA 5JNYB 2A1WH 3HZKB 5T33L 1TJGH 3F65A 1AKJD 2IADB 5C6WH 1KCUL 2F5AL 5JO5B 5HSFA 1T1WB 3TBVA 3CDGB 4FQIL 2PCPB 2C3HA 4FABH 1MFDH 4O51A 1MJJB 1KENH 2VLLB 3BIKB 5J11B 1MRFH 4I4WA 2GUOA 5EOCJ 1UQSA 4GAYB 3B2VH 3MRCA 3IXAA 4P3CL 3D18B 1YYLH 4I3SH 1A6AB 5TQ0L 4MHHG 3VXSD 3J7HA 3KPRD 4JO4H 4LU5H 3DIFB 1KULA 3WFDH 2WWKO 4ODUA 1SJEB 4QRQA 1ONQA 3WSQL 1UZ6E 1QSFB 3W0WB 1BJ1J 5F7EL 4NUGL 3BMVA 1ORQB 5K9KA 3NFPB 4P2OD 2VDRH 1OP3H 4XAKD 1F3RB 1GXEA 5A2FA 4PJ7F 5J56B 1U9KA 2V2TB 1U92A 5F1KC 1P4BH 3U9PH 2YSSA 5DUML 4PRNA 1MHCA 5E2VH 1OAYH 1BEYL 1Z3GH 4S1RL 1P7HL 5I30H 4RZCB 5DD0L 5HGDB 4GJTB 3RDTC 2DQTL 1OP3K 1AP2A 1MPAH 5CJXA 2P5WE 3QUXB 3WMSA 5IKCB 4QRTA 5DQ9A 4NZJA 5K9JH 3DX6A 4M93B 5HHOD 4H88L 2HVJB 5CSGA 3WL9A 4OD3L 5DSCB 5B8CA 4PP2B 2OTUB 1EFXD 1YNLH 5T1KB 3GUTA 1INDL 1HKLL 1IAIM 3GSUB 3GK8H 3MRNA 5C3TA 4MDIA 4XPTH 2H9GB 2VLRD 1NL0H 4BSVA 2DQJH 5DR5H 1I7TB 3V4UL 1URLA 3H8NA 4DKFL 4F3FA 4PJIE 1SBSH 1S9VB 3E2HB 1QKZH 4PRAA 1FJ1A 5IFHL 3DVNA 1BF2A 2LABA 5C0BD 3WHE0 1BQSA 1NCBH 1FBIL 2NY0B 4FTVD 4Q6IB 1EEYB 4XNMB 1UCBL 1H8SA 4MA8H 4R90L 1WIUA 4KKAC 4B41A 1KPUA 5IMLB 4PJXA 3FFCE 5KN5A 5BXFB 25C8L 4ODTH 3O3BA 4YIQB 4R96A 1NANH 1QBML 1V7NL 2PO6A 1I7ZA 4W68A 5JHDD 2DI9A 1RAMA 4K9EH 1I85A 2ATKB 2R0ZH 2EYRA 3GO1L 4ZYKB 3TCLA 1T5XA 1ZA3A 2D7TL 3PL6D 5F44A 1OQOA 2HJKA 1F6LL 3W11D 3SY0B 3QIBB 5C0AB 3T2NL 1M1SA 3THML 3CVHA 1L7TL 2DQDL 4HFWB 1NGZA 4EI6A 3DHMA 3HCVB 1X5ZA 1FN4A 2Z93A 5EUOF 1X6LA 1AR1C 2X89A 2P5WB 3KJ6H 4JDTL 4LDLB 4L4TE 3FT4B 3DSNA 3VFWB 2VUOA 1RQ5A 2FEDD 4X98B 5E4IA 3ZDYF 4NRYB 4OZGE 7FABL 5C0DB 3MACL 1N6UA 1S9WA 1MLBA 1EK3A 3H9HA 3OKOA 1PX4A 2Y7QA 3ECBA 4IOFC 2X4RB 4ISVB 3ZKNC 4S1DD 1YJDC 4QRPA 5FM5O 1LQSR 2CRMA 4LEXL 2R69L 4NN5C 3VWKD 5E2JA 4HBCH 4MNHA 1D5BA 4PJIB 5ESQA 4FP8H 5IEHB 1I8MB 4GRLA 1KXVC 5EBLB 2H6PA 3TA3A 1TZGH 3JWOL 4WU5B 2RB8A 2D4DA 5CMAA 3MRIB 3WUWB 5F1NA 2WLYA 3MREB 3FB6A 3CVIH 2B1HH 3FFCB 3GMRA 1LO4H 4D2NA 5KG9B 3SBWA 1JHLL 5ESVB 4RMTA 2OR9H 2PCPA 3WD5H 3O4OC 3EJZD 1ZGLM 1K5NA 2C5DC 2M8XA 4JVPA 1H8NA 1I1FB 4X9BA 1JNHB 3OJDA 43C9B 1W0WA 4JFDE 4U6YB 3PWLA 3B5HA 3O9WD 3Q3GB 4M48H 1CFTB 2VC2L 5JQ6H 3LIZL 1N4XL 3CC5A 1WTLA 4PJ8B 1P4IL 2F19H 1MFBH 4M6NH 3T1FA 4IJ3B 3GSNH 3KDMB 2NYYD 2A9MH 4MXWL 1QSFA 3D3VD 4ZAKA 4P4KD 5C2BL 4XVUD 2HT2C 3HS0B 4TVPE 3TH4T 4BZYA 2FECL 1V5JA 1RHFA 4OZGB 1QO3B 3KJ4B 1KCSH 2ATPB 3HE7D 3WFCH 1A14L 5C0CA 3DUSA 5EA0L 1ZA6A 1OGAE 3ZKQD 4P2QE 1F11A 2I27N 5HHMD 2EDBA 2ZUVA 1QLEL 2CUHA 2JK5A 4NO0B 2BOCB 1D3CA 2BHUA 2OZ4L 1C8PA 4LSUH 3QCTL 2NW2B 4TSCL 1RZ8A 4HK0B 1MRDL 1P7QB 3JTSB 4M4RA 4TVPL 3UTOA 2R2CA 5M7QA 1I8KB 3EJJX 3M17A 1T04A 2VNCA 4NJ9L 5KVEL 4NP4H 5HI5C 3DVGA 5DFTA 5IV2A 4HWEL 2V6HA 4AJ0A 3MCG1 5DSCA 5BVJA 1IZJA 3TT1L 3O6MH 1PY9A 3BSZH 3WJJA 4CBPA 1NBVL 1NMBH 3MJ7B 3SE8L 2FWOB 5HY9A 4YAQA 1J0HA 3QEHA 3S37L 1NLDL 5IJKA 2C3VA 2GY5A 3OHXA 4NKIL 4JZJA 3TYGL 5ADPL 5BCAA 3QPQC 1QACA 1MLCB 5IB2A 4JFDB 1AE6L 5A2IH 1U8OA 5D96B 2FB4L 2Z4QB 2BNRE 1XGRA 4RDQG 5CILL 4LCUB 3DO7A 5CD3B 2EDTA 3HR5B 1JYWA 3GSRA 3KPTA 1I4FB 3W82A 2VSDA 2GT9A 1G0XA 2EECA 4TQEL 4K7FB 1CN4A 4OLXH 4NZUH 5IHZA 2A2QT 5HGBB 3OZ9L 2UZXB 3O2VH 2Z92B 3B9KB 4HAFA 2BZDA 4FNLH 5KVFH 1OGAB 1EH9A 3ILPA 4P2QB 5SWSA 3NAAL 4HWNA 2NY1D 4MS8C 4XP1H 5HVHC 1S8DB 3SY0A 5I6XC 4QHMB 4WI9A 4LEOB 5FYKE 2VXSH 1OAUL 2YEZB 2YD9A 2UUDK 4PUBH 4YH6A 1FAKT 1LEGB 1OW0C 2EH7H 4X98A 3M1BB 5IK3B 3KPPB 4JFHD 3SDDC 1AI1H 4JHWH 4UDUA 5FA3A 3KAAA 4C59B 4S2SA 4PV8B 4XXDB 5IVXF 3WFBL 1G9NC 1T22A 3E6HA 4LHJB 5K33A 1CFVH 5F9OL 1WBXA 1CZ8L 1TQCB 5FYKL 4NZTL 2P49B 4UOW1 2WIIB 5BS0A 3CD4A 4MDJA 3U0PA 3GHBL 3TO4B 3WV0A 3EBAA 3TN0B 1KXTB 3VDAA 1T66C 1HCFX 3T0EC 4DQOL 1NCWL 2Z35A 3BPCB 4IDLA 4H8WL 2DL9A 2ZNXA 3LS4H 2AEQH 5ID1B 4ZXBC 5T1LD 2BSTA 4HLZG 1CDJA 2WUBL 3S4SA 1C7TA 2BNRB 2KZWA 1D7FA 4P5MB 3H9SD 5E2TL 1GGBL 4Z7WA 1T20A 4YDVB 4OCYH 4XVSL 1AXTH 3INUH 2V5TA 2HLAA 1K4CA 1ZT1B 1OD7A 1XR8B 1KN2H 3MJGX 5DZOA 4YGAB 3UBXA 4QKXB 3OKKB 3OKLB 3X3FL 5SWZD 5KSBA 4J3UA 2FDBP 3TBWB 2BRQA 4J3SA 3SHSA 2VZ3A 5BW7A 3BZFB 3UPRB 1A5FH 4OM0L 3C8KB 1H3VA 4P0DA 4TPRL 3BGFB 4P23A 1FNGA 1G7JA 3NVQA 3REWA 4NYLA 3UAJC 4RMVA 4UQ3A 3B3IB 3F6IA 4FZ8L 4L4TA 1CGVA 1K8DB 1XIWC 4OZGA 4RX4A 5I15H 3KYKL 4Y5XB 5FYKU 3MGOA 3K4AA 1QVOA 2FJFA 1UT9A 1PLGL 1DLFL 1AGEA 5KAQG 2DQUL 4JFPB 1A7PL 2DRUA 5ABDE 4X6DF 4G8GA 4JM2B 4CMHC 4NO0A 5I74B 3WIHA 4LF3B 3V5HB 1J0KA 1K8IA 1CFSB 2QHLA 3QZWG 3RDTD 3R4DA 3U2SB 4C4KO 4NDMA 5MEPA 2EICA 1GAFL 1PKOA 3BN9C 3E1F1 4OZHF 3WN5B 4D0DA 1S7RA 1QTYT 4KKLC 3MV7D 4AT6B 1R3HB 5I1EH 4PJGE 1C1EL 1VFUA 2EDHA 3HPLB 4KY1L 5DYOA 5EO1A 3UTSA 4K94H 4JFFA 2W0FA 3BJ91 1Q9WB 2IANE 1AXIB 3CPLA 4M9OA 1IKNA 1Z5LA 1N26A 5A2JH 4XP6L 1MCCA 2GIYA 3BWAA 4YR6B 4JFYB 3FQXA 2CQVA 2HFFA 4JFDA 1E27A 1WAAF 2OJEA 4OT1H 4LCUA 1KEGL 1BQLH 3CFBB 4UQ2B 4CDHA 4KKAD 2OZ4A 2I9LB 1I3RB 1TCMA 2CLZA 3QXDB 4HS6B 2D0FA 4UNTA 2BK8A 3KLSA 5ICYB 1SY6L 2AJVL 4MA1C 3O41B 1J1OL 2A77L 2HWZL 3SCMA 2IBZY 4HX1A 3UZEA 2Z92A 4FXGA 4XPBH 2XTJE 4G42A 1HEZB 1A3LL 5GJTL 4Y88A 4GAGH 4UINH 2CXGA 3U4BH 4QHMA 1TQBB 1RIUH 1DSFH 4XNQB 1BQHB 1SEBA 1AR1D 4G80B 1RULH 4JQIL 2WQ8A 5CZVL 3OR7B 4M7KL 1BWWA 5ID0A 1AQKH 3MBEB 4DZ8A 4I48A 2EZ0C 1U8PB 3VFTB 1U8IA 2BFVH 1PEWA 4G6FB 3RFZC 4XPAH 3LD8C 4PJGB 4AM0B 1VADA 5SX5K 4XXDA 1ITBB 3KWWB 3HC4H 4UB0L 4WW1A 3TIDB 2R9HC 4IOFD 2C9AA 4NO5B 2IANB 4PGEA 5F6HI 3L5XH 3I3EA 2WIIA 2ADGB 4NQSA 3FQRA 4PJBA 5E8NB 2PTTA 3L5WB 4X6CA 3SJVE 5B38A 4QHNA 3GJEB 3BDXA 1OY3B 1WVZA 2ZNWA 1B9ZA 5AG9A 4WFED 5I16A 3WDHA 3MOBL 5ID1A 2ADIA 4JCLA 1MCEA 2X4TB 5GIRA 2IPKA 3SDCB 1WC7A 1JPGB 1AD9A 3VG0H 4WTXA 3QFJA 5F1OB 3ZE0F 4ZUVA 3I6GA 4OCXL 5ICZB 3D0LB 4H1LG 3LN4A 3GKWH 1CICD 1KOAA 5E8OB 3LSOB 2IALA 5EORL 3OKKA 5E95B 3WO3B 1D6VL 4X7SL 3MODH 2AEWA 3LQZB 1HILB 3NZHH 2XTJB 1BIIA 3E3QC 2ORBH 3OG6B 5F3BB 2ZPKL 3BZFA 3JV5A 3O3DB 1X5IA 3STBA 1FO0H 4EI5C 4OIAA 5IROC 4XBPB 2UVEA 2O5XH 4YXHH 2HMIC 1FIGL 2HT2D 1Q0YL 5F88A 4MCYA 2OTPA 1MCSA 3WJLC 1R3JA 5F1SA 1CYGA 3PP4L 1BLNB 1OF2A 1WISA 2ZKHH 4CN1A 4OSUH 3LRSB 4G43A 4EJ1C 3WNPA 1UFUA 2FJGA 4D8PA 1E4WL 2NY4C 3NFSH 1HYSC 1KELH 2APFA 3SJVB 1FL3A 3O3EB 4UTBH 3WIIH 3EW3B 4HC1H 4G6KH 4KWUA 1IVLA 1CIDA 1X5JA 3T3PE 1IC5L 1AKJA 5HI5D 4GS7B 3C9NB 3FRUA 1SMAA 1SYVA 4C56E 2XA3A 1X5FA 1BVZA 5CGYC 1R3IH 4BA8A 3RWEA 4TUKH 4NKOA 3V4PL 4P5KB 4E41D 3BVNA 1PD6A 3TH3T 5MHSE 3HE6C 1LDPL 3O6FD 4CRPA 1AFVL 5ITBH 1OSZB 3Q5TA 5GGSY 5GSVB 1FNEB 3VXSA 3KPRA 3FQUA 3QPQD 5L8KB 3FZUC 3ARPA 3PIQB 3LRGA 3B4NA 5DQJB 3OG4B 3L5JA 1A4JA 5LKNA 4XX1G 5IB3B 1ZEAL 3QI9C 4P2OA 4PRBB 2I9LA 1I1CA 2IPTH 4YBHA 5C0RH 3VFMA 5L9DH 1G7HA 5IMOB 3FB7B 1GGYA 3TGXA 5ICYA 3DMMB 2WBJB 1E28A 3Q2CA 3FQTA 1ETZB 4G6ML 3O41A 4YDJA 2O26U 2VLKE 2BX5A 4LCYB 4I8DA 1FGVH 3I9GH 4OUUA 4YFLI 4NJAL 5EULV 1CD1B 1GOGA 1YEHH 2X70B 5I1KH 2B4CC 1KC5L 4ONHA 1ZVSB 2CXKA 4I18B 2IQ9L 2VXTL 3TF7C 5FUCE 2UY6A 4L9LC 1JF1A 3D9AL 2DQGH 4BQ9A 4BZ2L 3MZTA 1G0YR 4LSQL 4MB5A 4N8VB 1NFDF 5HHOA 5CEZD 1M6OB 3OMZA 3QJFB 1WCBB 1EFXA 4PRPE 3SDDD 1MFEL 1RJCA 4CJ1A 1A7BA 2DKUA 2DQCH 2CK2A 4C56B 2VLRA 4ZUWA 1PZUB 1KIRB 4FQ1H 4XPHH 4MSWB 4M8VA 4UT9H 4Y19D 3D39E 5CINL 1UA6H 1MUJA 4OFYD 5C0BA 2V5SA 3QIWB 1NC4D 1ZSDB 3F6LA 4PG9B 2WANA 4P2RD 3T0ED 4FTVA 3DV6B 4YHOL 4GAFB 5I73B 4JRXD 1XAUA 1NAMH 1T7XA 5BRZE 3ZKSD 5E00B 3CU1A 1F6AB 1P9MC 4Y4HB 2J6EL 4HJJH 2ZUQB 5EPMB 4WUUE 5BZWB 1SVCP 2WZPD 1JP5A 3P0YL 1RZGA 2F58L 3GSOB 1OARL 3MBXL 1OAQH 1QA9A 1JF5A 1QR1B 1WIPA 2FD6L 4LP5A 3RPIA 3PL6A 1MNUL 3WO4C 2VLKB 2OQJB 4R7DB 5E8PB 1N0XH 1R5IA 1S5HB 4HH8A 3ZE2F 4GAJH 1NFKA 2K7PA 3O3DA 4Y4FC 3KXFD 4MJID 1D9KC 4KI1A 1S7WA 4JZNB 5F7MC 5DA4A 3Q0HA 3SE4A 3BRFA 3NGBB 1DQJB 3V7MA 4U6VH 1SJVA 5IT2L 5CJ8A 4WNQA 4Y16D 1L0QA 5HJ3B 3ZDYE 1QLFB 3BZ4A 1XIWD 4JR9L 4PRPB 1Q0XH 5ETUB 3CK0H 1Z9OA 1T7YA 1ZHKB 1KTLA 4U6XB 3RU8H 3TO2B 4M7ZB 5J6HA 3LRSA 3VWKA 2E7LC 5E4EB 5DLML 1FPTL 4OBRA 1D6EB 1FGNH 1NEZB 3CLEL 3D39B 1KB5L 4LQ1A 1J5OL 3FOLB 4P9ML 5F9JA 4ZSOA 2NXZB 5DS8B 1S9YA 4X9GA 1NCNA 5DJYB 4Y5YB 3BN9D 1EO8L 4R3SB 3QUZD 5E08L 4LKCA 4HPOH 3B9VA 3SE9H 1I8IB 1Z9LA 4NHUB 5BRZB 2H8PA 1MCOH 4F2MA 4I3RL 4KKLD 1HZHH 2AJUH 3ZDZE 2Y5TB 4WW2C 1T83C 3IS1X 1KT2A 3QH3B 5EOCH 1WBYA 3MRKB 4WUUB 4WHTA 2YXFA 2W9EH 4Q74A 4MX7B 3QIUB 3P11H 3EDDA 4YDKL 4ETYA 1A1OB 1DANT 1QLRA 5C8JB 3O9WA 1LNUB 2J3SA 1KIQA 2DYPD 5CBAB 5IEKA 4JQXC 1AY1L 4NQTA 2JJTA 2P47B 2FIKA 4XCNB 2BJML 2BOBB 1UM5H 3D3VA 5ALBH 3S36H 2WMPA 2Y25A 1QFWL 1KB5B 5MI0B 3PWJA 1XT5A 1JGEA 5CUSL 3G5VA 1NCUA 1HQRB 4PD4J 3HE7A 1CXEA 1C16B 1NAKL 2JIXB 1GVIA 4WFGD 2AI0H 5KSAB 4P49A 4BQBA 4Z7OE 4J12A 1JGVH 3MV8E 4NRZB 5CJQH 1XCQB 1C5BH 4JO2L 1OL0A 3BPOB 4KTEL 4PP1D 1T5WA 3Q5OA 2YN5A 4OLYH 3HRZB 2X4UB 3ESUF 3GMNA 1JL8A 1RZ7L 1AXSA 1GH7A 1UYWL 5DMIH 1YYML 3QG7L 4MB3A 3ARBB 3ZHLA 3WNNA 4UAOB 4MLIA 3SOBL 3JTTB 2EZ0D 1VACB 4IRJB 4O9HL 2Y6SC 4ZNEE 4JRYA 5SWQA 3MRHB 3R8BB 2ZOLB 3IS0X 1OPGL 2R9HD 4U3CA 1RUAL 2J7LA 2YBRB 5I1IL 3G5XB 2JCCF 3PDDA 1JMXA 1MJ8L 1H3XA 4F7TB 1TZHA 1AGFB 5JORA 2YZ8A 4X8XA 1RJZA 4KVCH 3G6JE 1EPFA 4K9EC 1FAIH 1JRHI 5C1MB 5JUEH 2AJSH 4PG9A 2R23B 3C09B 4JQVC 3TVMB 4HF5L 4Z0BH 4DZBA 3CFEB 4NGHH 3LV3A 1S7TA 5H37H 1RFDL 4Y4HA 2X4QA 3MV11 3D6GA 3GI8H 5CCKL 1NBQA 2D7MA 1FE8L 1NGPH 3DV4A 3KHQA 4O02L 3P3YA 3K1DA 4U2YA 3S5LG 1IFHH 2XTLA 5FO8B 4PJ7A 4XP5H 3MV8B 2OQJA 4FFZL 5I1JH 1S5HA 3ARFC 2Z0BA 3O2DL 4JRWA 1F3DJ 3MUGB 1MRCH 4EI5D 4HUVB 4U0RB 4QXTA 4A6YL 5IMKA 4GKZB 1MCWW 1JGLH 4MQXC 1CXIA 2OP4H 5TQ2H 4E5XB 3LAFA 3RRQA 3QUYC 3V6FB 4NQXB 1ZAGA 5DMGC 3KPSE 3NCYS 5HYSA 4JZOA 5IVXE 2XKNA 3MLUL 3BGMA 4N90D 1OLLA 1IT9H 1JYXA 3BW9B 5ERWB 3L3HA 3HMXA 3NABH 2NY4D 2VL5B 3MUJA 1HYSD 4PLJD 3G6JB 4UNVA 4Y2DC 1NBZA 5T1LA 1MY5A 1D5MB 1UM6H 1WEJL 4RDQF 1KLUB 5I76A 2AV1B 2P43B 1I8IA 2VQUA 5GXBB 4NHUA 5DVOA 3ROLB 2VE6B 4R4NC 5JHLL 3VXNB 1FYTE 4U1HB 1E6JL 1EO5A 2XQBH 2YPKB 4IMKC 4TNVK 4UUJB 3C5JA 4O2EA 2VAAB 1B0GB 2V2WA 3QWRD 1JZ3A 2ZCLH 3DBXB 5CGYD 3QWOB 3V4VL 4K71B 3ARGB 4A6YB 1QBAA 5SWZA 2R2BB 3HE6D 4AZ8A 3DETC 3U1SH 3RWFB 4J3WA 4NZRH 5E94A 2FATH 3TM6A 3Q5YA 4PGDB 4LBEA 1V3LA 4BM7A 1W2KT 3FZUD 3IFOB 4TRPH 5E6IC 4JKMA 5D1ZB 3MFGB 2BOBA 5D1QB 3M45A 4MJ6B 1IAOA 3MLXL 1UM4L 2YUWA 3X13B 3V6ZB 3QI9D 1Q72H 5EUOA 1L0XA 1G6RL 1AGDA 2WQRA 5EZIH 5T3ZD 2ICEB 4N0FA 4JGJA 3MLYL 5EU7E 3JBG7 3AM8A 3BH8A 1T0NA 2I5YL 3KPSB 3O11B 2EYSA 4QF1B 3GSVB 5IVXB 2C1OB 1SM3H 1OAXH 1DBBL 2X4PB 5ENWB 3STZB 1HXMB 2AAVA 1IQWH 4X6DE 1RK1A 1DE4B 5HPMB 3U6RB 1AO7D 5L0QB 3U7WL 4LLYB 3QQ4B 2VDMH 4L3ED 4L8BA 4LASH 3TT3L 3MV7A 4TUJA 3JWDL 43CAA 3HZVB 4OZHE 3V5DA 3VD5A 2ITDB 4RIRA 4NUJB 4JFZH 1FYTB 4HIEB 1KCUH 2HG5B 2YD5A 3MRHA 4MNQE 3KPNB 4KK8C 3RJDA 2ICWB 2ARJQ 5DQDL 3IDXL 5F7HA 5KSVB 1AHWC 1G6RB 3QUKA 2O61A 2ILLA 4D0CA 4MA7L 3T0DA 1MVUA 2HT3C 4WV1C 5CP3A 1WT5A 3RNKA 3F7VB 1YPZF 4P3CH 1FL5A 2EIZA 4R97C 2AKRB 4ZQKA 4NKDB 1VGEL 1KJ2L 1KV3A 3NZ8A 1NMCC 4YXLH 1T1YA 1YNKL 1WAAE 3WSQH 5I18H 1BZ7A 2NY6B 2VITB 1QFWM 3OKNA 4JM4L 4NKMA 3HAEA 4NUGH 3G6AA 1CE1L 4TUOA 5EZOL 5EO9A 1AD0A 4XVTL 2X1WL 3SO3B 12E8L 4CVWA 4PGCA 2CLRB 4Y4KC 4BFEA 3WHE1 1NCDH 2R0KL 2R4SL 1R3LB 2VZVA 3QQ3A 5KAQF 1CLCA 5FHAL 5MERA 1D5XB 2DQFA 4FQHA 2X7LA 4MAUH 5DJ2A 1RZIB 15C8H 3LZFL 6CGTA 2FEEI 3MXVH 2DQTH 3PV6A 1JVKA 1D9KD 1ZV5A 4X6DB 1RU9L 2BRRH 1XGQB 4JJ5A 3SDXA 4WEUD 3SDAB 3GSXA 2R2HB 1DCLA 4P3WA 4I77H 1G7LB 4OZHB 2DIBA 5HYFA 1KPVB 1KJ2B 2IPUG 5BO1L 1HKLH 1RIVL 2XI9A 3MCKA 1W72L 1KTDA 5MP6L 2NY5H 4I13B 4MNQB 1U3ZA 5DJ0B 5JR1H 2HTKC 3PHOB 4LCWD 4LLVB 2AW2A 2FNBA 3RA7L 5TDPB 3KYAA 3BW9A 1XF5A 2DOCA 4DKFH 4NQCE 1JNLH 2VL5A 4LMQE 5CEYA 2W65B 5IFHH 1U36A 3T77B 1RHHB 2ADJA 4MQ7B 4F15C 1W0YT 3PHQB 2KBGA 4WWKB 4E0RA 4BSWB 1T1XB 1J1XL 2EDLA 3WEXB 1XEDA 5JIHA 1CD9B 1VFOA 1HNGA 1CICA 1L7IL 1QBMH 3ZE0E 4N0UA 2Q20A 4PRHE 5I1LA 5DZLA 2R2BA 1NANI 2AK4E 2XACC 2P5EE 4QY8A 1OP5H 4JFXA 4PGJA 2VN4A 3GO1H 4PY8J 3HG1E 4XC3L 3VJ6B 1OGTB 3RZCB 2D7TH 2JKXA 5D2LF 1XMWA 1W72B 3THMH 3H7BB 2ZCKH 1IM9B 1L7TH 2BY1A 3IFOA 3C8DA 4RMSA 5TFSH 1HHGB 5IOPA 4JDTH 5IG7A 2V7NA 4QHLB 3X13A 5C71A 1MHHB 1ZHNA 3QPXL 4IRZH 3W39A 4AIXA 5I1DB 1MFCL 4PBVC 1C5CL 1IGCL 7FABH 2GY7B 5E5MB 4ZTPL 3BUTA 2WUCL 4XGZB 4FHBD 2NY2D 3AREC 1R5WA 5EDXA 1U91B 2LVEA 3ISWA 4PJDF 3MNVA 1H5BB 4X6FA 4ZFFA 4K94C 3UC0L 5DJAA 4HUMB 3MV01 4LEXH 4XPGL 1KJVB 5INCA 3FN9A 4GQ9H 4TYUA 2Y06H 3VXMD 3AS3A 1KF9B 1N3NB 4NQCB 4P59H 2VISA 1EGJA 2AEIT 4LVNC 5K93A 3JWOH 2EEBA 3CSYB 1B3JA 3V0WL 4POZC 1J87A 5E8EB 3RQ3A 3TYFB 2ITDA 5GS1C 4ERSH 2B7DT 3IDNA 3KYNB 2VXVH 5LCVL 3U82B 5GS0D 1KB9J 3HNVL 3U0TB 4E41A 1AIFB 1JHLH 1YQVL 4Z95L 3MCLL 5C6PB 4G6JL 3O6FA 2P8MA 3QUML 2P42B 5AD0B 5EU4A 4WHYH 2DLHA 1ZKAA 1IGML 1PVHA 4OKVB 2AK4B 2P5EB 1K4DB 2F74A 4IOIA 2BMKB 5HHPA 1UKTA 3FT2B 1Z9MA 5JDJA 3HG1B 2NXYD 4WVRA 4LCCB 2CKBA 1J18A 1GPOH 1N4XH 3FOMA 4J3XA 3MGAA 1XF3A 2NZIA 1MF2L 1MFNA 4MXWH 4LSRL 4Y5VC 4KI5C 5C2BH 5I8CB 1TJHL 3O2WL 3P9LA 4NQUA 3G6DL 4NNXB 2HJFA 3EO9L 1Y6KR 4YQXL 4EUPB 4F9LC 4M6ML 4K07A 1PAMA 1IC4L 5TF1H 4Y7MA 4RQQA 1NUDA 5M95B 2ICWJ 1ZT4B 5ESAB 4KVNL 4P5TC 3W81A 5I71C 2DBLL 2H41A 4MZ3A 1HINH 4AMKL 1QLEH 1S7SB 4ODXB 4ESKA 2FO4A 2OZ4H 2GJZB 4QOKE 1I7RB 2VTFA 3QCTH 4TSCH 3QUMB 4X6DA 1QSVA 3PQYE 1U8MA 1OW0A 4NN6C 4OFIA 3SDDA 1A7QL 2AABH 3OV6A 4EOWH 1FDLL 5KVEH 1NFDE 3VGAB 3AS2A 4HWEH 1A1NA 4M61A 4OZHA 4FXKB 3B9AA 3E0GA 3QUYD 4LDOB 5DMGD 1YMHA 2Y36H 1NBVH 1X4XA 3BI9X 3SE8H 1RJLA 4RRPA 5DC0A 3OKDA 4X5XB 5IVOA 1FLRH 4Y19A 4U1SB 4OFYA 5EU6E 3RWCB 3RWJB 2DTSA 1NC4A 4NFDA 3TYGH 3V95A 1QOKA 3UJIH 4P2RA 1TZIA 3JV4B 2BVPA 5FDWB 4LL9A 4Y2DD 1KPRB 3OGOE 4CVZA 1SMOA 2FB4H 2BSRB 3GMLA 5CILH 2EE3A 1U3YA 4WU7B 4K3HA 4R4ND 1CXFA 3VWJB 3T8XA 1J88A 4J6RH 3BP6B 3MRLB 1T4KB 3VFUA 1ZHLA 4KRPB 5DJXA 5IW3A 3IF1A 2DDQL 2JB6A 2OL3L 2A6JB 4Z6AT 4F7MA 3UMTA 3D0VB 4PJ9B 3K2UL 4PRDA 4U3XA 3DETD 2YC1A 4OGYL 5LGJB 1OGTA 3RZCA 3NAAH 3KXFA 4MJIA 3VRIB 4IIQC 3ZE2E 1V7ML 3LKOB 1DBAL 4QOKB 4QRSA 1F4XL 2J88L 5CAYB 5IQ9A 3QHFL 4LVOC 32C2A 3TPKA 3PQYB 1DQQB 4Y16A 3JWNC 1JUFB 1U8QB 1ZWIA 1XIWA 4GG8B 4OB5H 1OHQA 2XN9E 4YE4H 5GS2H 3R1GL 1DJSA 4HULB 2DM2A 5EZJA 2JB5L 2P8PB 2VLJE 1TETL 5DXWA 5DD3H 3NCCB 2X1OA 1M7DA 5IB4A 1HH6A 3L3GB 1BBDL 1CZ8H 3NPSC 3MO1B 4J8RA 3AUVA 5EU6B 3CIQA 4JAMB 2OL3B 1UENA 2RIKA 2NY3B 3QUZA 3SKOB 1FG9C 4DQOH 3ZKXB 2XZCL 3DX8B 1UVQA 4GOSA 3WDJA 1J9CT 2WUBH 4WHCA 4I0PB 3FO9A 3ULVF 1TMCB 5E2TH 1GGBH 2R8SL 5E8EA 4NQVA 4F7PA 5AZEL 3MGTA 1I3GH 2OXGA 1P2CA 1P4LA 4XVSH 3U0TA 5I75B 2MKLC 3EKCA 3IU3A 4KK8D 1U8NA 5DRXA 2PW1B 3I75B 3FO0L 4JPVH 3KNBB 2CMRH 2YD6A 4PRHA 3A6BL 4N0YH 3PHSA 5F6IB 4X4YA 2HT3D 3PNWA 2AK4A 4CU6A 4PJCE 3WLWC 5HHVL 4OM0H 4X4ME 1EVUA 4YFDB 4TPRH 4M7LH 4OAWB 1CDUA 1HI6B 4G9DA 3L3KA 1RPQA 2BP3A 3TJHC 4FZ8H 5I8CA 4NQDD 1XGUB 5KTEH 4CW1A 1PEZA 2X4OA 2XN9B 4WI3A 2DJUA 3O6KL 1ZT4A 4Y4KD 1PFCA 2VLJB 4GSDL 4PJAF 5DI8A 4YJZL 4NC1E 4HIJB 1DLFH 1VFAA 1Y6MR 1VFBA 3MA7A 3MXWL 5IMMA 3QNZB 2DQUH 1A7PH 1BAFH 3X11B 1S7SA 1MAMH 1BGXL 3S5LA 4LFHG 4DVBB 1S3KL 3F7YA 3EZJB 3O3UN 5SV3A 1YEGL 1R24A 4DGIL 2BSED 3TJEL 1VEOA 2DMBA 3F58L 1IQDB 2AJYL 1T1ZB 3MLTB 2MCPH 1G7QB 4H26A 3BKJH 3MMEB 5D5ME 1A0QL 4KY1H 4LRIA 3S96B 1LD9A 2AV7B 4XHQA 1YEDB 3NIGF 5EUKB 3L5HA 3DX9B 2ZZUT 2AK1L 4YHKL 3IFNL 3UYRL 1B90A 5EIIA 3H3PL 4XP6H 4U1SA 4G9FE 1TCRB 2IH3B 2JCCE 4WJ5B 1FQ9C 1YN7B 2Q8AH 1PYWB 4KV5F 3ARUA 3CCHB 5IW1B 1A4KA 4I2XE 4U1GC 2O5YL 3JV4A 2CO7B 3H2WA 2D03H 2AS5M 4PJCB 4RGOL 4CADA 2A6DB 4GKNB 4O5LH 3M07A 4NOFA 4ZUUA 1NBYB 4HXBL 3UEZA 4DGYL 5DD5L 5HYQB 1E4XH 3T0VA 2MHAA 4DFHA 1HWGB 5EBWA 2C1PB 4FA8A 4M1DL 3NTCL 2JELL 4HFUL 1SY6H 5JXAL 4MD4A 3AS1A 2D31A 1L0YA 4O00A 1J1OH 2A77H 2HWZH 3WYRA 3WHXA 2W0LA 4QRRD 5EWIH 1TFHA 2QQLH 4ALAL 1P6AB 2ESVD 1LO2L 1JFQL 3H42H 3ARZA 5LGJA 3QULB 5MEND 3FT3A 3HHRB 4QNPF 3ZLQC 4EI5A 3IAPA 3KPMA 2W9DH 4Z7VA 3RI5F 1A6ZB 2R1YA 5HI4D 2HA1A 3EOAA 4KKNA 2G60L 4M7KH 3DO3A 3DGGB 5TE7L 3WJLA 5ADOL 1NFDA 4LSDA 3BKCL 5D5MB 3SDYL 4AIZA 3RY6A 1ZTXL 3CMOL 1IRAY 4LLQB 3ARED 3L3OB 3AC0A 2C26A 4UB0H 3L7EB 3CFDA 4FQXB 1UXWB 3GNMH 3O8XC 1FZMA 1H0DB 2RCSL 1FCGA 4BH7B 2NLJB 3AXLB 4NQEE 4G9FB 5LQBH 4Q97A 4GG6E 2HKHL 5D7JD 3EHBC 4I2XB 4EXKA 4YNYA 5FK9A 1RV6X 4J1UB 4OZFA 1GZQA 5CEXB 5E0QA 5F7KC 3RHWF 5D9SB 3FKUS 1KN4H 2RQ8A 3PGFL 5DHYB 3OWEA 4POZD 1NCTA 5HDBF 1JN6B 4RAHA 3O3AB 4OCXH 5E6YA 5IM7B 3VG9C 4EBQH 1HHJA 3BUYB 3HE6A 2XNAB 4XCEA 3QNXB 5EORH 3ZYOA 2WBKA 3DI2B 4X7SH 2F53D 4LSSH 3RNQA 2WSKA 3AU1B 1I1RA 3GMMB 1DN2A 4L8DA 4LDEB 2QSTA 3GSQA 3MUHL 3P4OB 1T7ZA 4WUKH 3ET9F 4OAWA 3SE3C 5IIEA 4FQ2L 2AEPL 3K0WA 1IGTA 4O4YH 1LE9A 1ZHBA 5E03A 4KI5D 2YN3A 3IDJA 5L2KE 2GKIA 1FIGH 3DX7A 4G5ZL 3RWGA 1ZT7B 4HW6A 2DLTA 1DBKL 4HUXA 1LO5B 3OJ2C 3PP4H 4YGVA 4RBPK 4PD4K 3ARSA 3VDBA 2EDOA 4RAUB 3E6FA 3EOBB 8FABB 3ESVF 1DN0B 2HVKB 1OTTC 3QNZA 2A0LC 4IHOA 4ZFGH 4OCSH 2QADB 1X4YA 1AO7A 1LP9A 5CJXC 4NQEB 3BP7B 4BUGA 5B39A 4P4KB 3GM8A 5I8KL 4L3EA 4GG6B 2P46B 5FFLA 5C2UB 3MRRA 3LCYA 4HCRA 1ZLSH 1LEKB 2MWCA 4UDTB 5F70A 1IC5H 1O5DT 2WP3T 1G7QA 3S96A 4DTGL 1HXYB 4F7EA 5C09D 2P8LB 3IRZA 4Z0XB 3CXDL 2CJUH 1MHEB 2IH3A 1FV1B 3IJSA 1NFIA 4Q0XL 4JY6B 4RNRB 5J3HC 5HGHA 4OCWL 3HZMA 5E9DE 2D7PA 1T21A 3JSSA 5C92A 1RZJL 4YHNB 2FHFA 3MYJA 3QDJE 4R0LB 3V6OC 4M62H 3WFHB 1I1YA 2ZUYA 1MJ7L 5L2KB 3LQAL 4OZ4A 3TLRA 4I5BB 1QD0A 4EN3D 1F3DH 1I85C 4M7JH 3O6LL 3BRGC 2IG2L 3TBSA 1B4JL 3L9RA 3SGDH 1IGJA 2A73B 1CDCA 1IGIH 3MJ8A 2J5LC 3BXNA 1RUPH 5TE4H 1D9KA 1KC5H 5CGMA 3PWNB 3MLVL 1QFHA 2IQ9H 5C9JA 4N9OB 4X4XB 4GKSA 4UTAH 4ZOCA 4HPYL 1IJ9A 3B6SA 2DICA 3QG6B 4QHUA 1TENA 3ZO0A 1MFEH 2CSPA 3UZQA 1UZ8A 3AB0C 4P3DB 1GOFA 2F8XC 1LHZA 4G8EB 5FKPB 4PGBB 1F13A 4HQQL 1K3ZA 4LSVL 1VA9A 5F96L 1Q9LB 2X10A 2E7LA 4LCWA 3L7EA 3E8UL 3B9EA 3PJSB 4OI7A 5H8DA 1UXWA 1WWWX 2DD8L 1PG7W 5CINH 4G9FA 2JCCA 1R0AH 3MLPA 3LOWA 4LQFL 4GRLC 5E9DB 5FUOL 1ED3B 2FYYA 1S7QA 3TA3C 3GRWA 3EYQC 4EIZC 3HC3H 5A16B 1YDPB 4J1UA 2X40A 3T2OA 3HB3D 5FF6B 4HIIB 1MVFA 1WWAX 4B0MM 1YEKH 1FCCA 2Z8RA 4K2UH 2R2EB 4OBSA 3HTLX 4WW2A 4YPGB 5DHYA 4Z5RA 3VFNA 1T83A 1MI5D 4UT6H 1OLZA 4YK4C 5KVDL 4WFFD 3HMXH 1SQ2N 4Z77B 1EV2E 2FH8A 2E6QA 2F58H 1OARH 3UYOD 4WFHD 2XNAA 4DAGL 5J11C 3K8LA 1QEWA 4Z7UF 5T1DH 1MNUH 2M26A 4U1KB 3LS5H 3BQUB 1GIGL 2W38A 3GMMA 1GGCH 3RL2B 4KZEL 4U05A 2OLDA 4LLMA 4ZAKC 4OLVL 4BFBD 3QZWB 3ULUF 4JFED 2ZSWA 5IT2H 2QQKL 4R2GC 5IESL 3GMQB 2BY0A 2RFXA 1L9MA 1DBML 4JR9H 4AG4L 1XZ0A 4YHLL 4YLQT 1N5AA 5IR1B 3Q6GL 2F15A 1L6XA 5CBEB 3LEVL 4R6UA 4JHBA 4PJDE 5DLMH 1FPTH 3IXTB 3S8WA 4H0HB 4U1NB 2XA8L 2DQEL 3VRLE 4D9QE 3RWHB 3QUXC 3BP7A 1MEXL 4P9MH 5IB1A 2EDRA 4HEPG 4M5ZL 3OPZH 4OZIF 2ZUWA 5KZCD 5E08H 2XKUA 4MJ5A 1TXKA 1EMTL 4M93C 5IGXL 3VXQA 3WJJC 3DRTA 2QL1A 1T7VA 1K2DB 3L3JB 3PGDB 4XBEL 5FYLE 3X12A 1I9JL 4OFVA 2ID5A 5T3XE 3VXUE 5J6GA 4YXKL 2P8LA 3EYSH 4DVRL 4M1CC 5JDSA 3E2HC 2CIKB 3MV9E 1BD2D 5DEFA 5DEZA 1S78C 3BMWA 1XH3B 4JQVA 4LIQH 2PF6A 3LDBC 4JY4B 3UTQB 1A7NL 1CD0A 3MJ9L 5HYJD 2NY0C 4XRCA 4YHZL 5IJVB 2WLZA 1BJ8A 3MOAL 4Q6IC 3UCRA 3VFSA 5FYLL 4ELKB 5T3XL 4X5WA 1RD6A 1T0MA 2C3GA 3DTXA 1CF8L 2APTA 4PRID 5CP3H 2B2XL 5DURD 3I6LE 1YEEL 2YK1H 5IHLB 1MFAL 2QJDA 4KXZH 4OV6F 1BWMA 2DQIL 3FFDB 4XI5C 3QIBC 1J0YA 4L4VE 4PJDB 2NY5C 1ZMYA 4XCYB 5FM8A 3IVKB 4PPTA 3U46B 3PWNA 3ARRA 4QCIB 4JFQB 3R0MA 1RZ7H 4KDWA 4FS0A 1U8KA 1F3JB 4P46B 1YYMH 5F3HA 5JLZA 2HT4C 3DUUB 1JJUA 2W60B 2QEJA 2HFTA 1JGUH 3QUYA 4JREB 1UJ3B 4AEEA 1QRND 1ADQL 2COQA 3KS0H 1GGIH 4MAYB 2J8HA 3C5SA 1DDHA 1Q9LA 1NC2D 3JV6B 3VXUB 1MJ8H 2Q86A 1HQ4B 3O8XD 4H1LB 2XOTA 4KU1A 3TWCH 1OCWH 3ZKMC 4Y2DA 3VH8A 2PYFB 2UYLB 3MV9B 1A3RL 5GGQH 2XPGB 1JPTH 1Z2KA 4Q9CA 1P1ZA 1YNTB 5EBMB 4HF5H 1CS6A 5F7DB 3QDJA 1YPZA 4YO0B 3BAEH 1C5DB 1H3WM 1YJDH 2R2EA 1L9NA 5I2IB 4XX1E 3CXHJ 3NA4A 2YKLL 5CCKH 1WICA 3V6BR 2FRGP 4EIGB 1FE8H 4XNYH 3CFJB 1FRGH 1NCAL 4O02H 1JPSL 3DURA 2XIDA 1RVFH 4M03A 1MCFA 1OQXA 1QFUL 5AWNH 3VE0B 4GKOA 3O81A 1N59A 4FFZH 1MOEA 4JDVB 4MD5A 3BHBB 4CU8A 3O2DH 4UILH 4L4VB 3P4MB 1MCQA 2VQTA 5IB5A 4PJ8C 4Y89A 4P23C 4IJ3C 4N68A 1IAKA 3L95A 3DHJA 1DQDL 2R1WB 3QJHB 4A6YH 1U0QA 4R4FH 3MROB 2ZCHH 3KJ4C 1O7VA 1F90H 1N8ZB 3BIAX 5GGUB 1HSBA 1KG0A 3JWOC 3KPQA 5HTSA 2WINA 4Y1AD 5GHWH 3BP5A 5TE6L 1LILA 2QKIB 5HHQB 4AL8L 4G3YL 4LLDB 5C70A 3I84A 4YHIB 5KS9A 3IXTA 2A0LD 3IFPA 5KOVC 1GZPB 4GRMB 5JW5A 4JHAL 1I7UB 3FHAA 1IM3B 3L1OH 3L6FB 2F9BT 3ORJA 5HYIA 4JO3H 1CL7L 5F72S 2FSEB 1QBLL 2ZUUA 4LAQL 2B20A 4HXAH 4XNXL 1HNFA 4JKWA 4OLUH 1WWBX 1JI2A 5E24E 1PQZB 2LQRA 1N0LA 4LRNH 2EDEA 2H32B 3ULVE 1E6JH 4HKJB 2XWJB 4W70A 2YD7A 4PJIF 1A64A 4PJEE 4GT7A 4MB4A 3O4LE 1H9VA 4NN7B 3NMEA 5C0IB 3V4VH 1UKQA 4L29B 5H35B 2B5IC 1NGXB 1MIEL 5ANMA 4Q9QL 2OTWB 4WDIA 1CE6A 4HV8B 1IGYA 3IGAA 4KHXL 3QRGH 3RUGA 5D96C 5E99L 1WZ1L 4NWTH 1MJUL 3ULVL 1NUNB 5D2LA 5I19L 3MLXH 1UM4H 1Q9KA 5JOFA 1U3HA 4NQDA 3TNNA 1DVFA 3LKNB 2EDKA 1MAJA 3HZYB 1G6RH 3OBAA 3P77B 2BSSA 3BP4A 2D7NA 1JWUB 3GB7A 4HKBB 5DRWA 5DMJB 3RZWA 1FL6A 4Y4KA 5DZNA 2MFNA 3PG2A 3SCMC 2CKBH 5TGBA 1S7UA 2GFBB 4N9GA 3MZGB 1DZBA 4LLWB 5IHBA 4IMLA 1I1AB 1DBBH 3LKSB 2BHZA 1C08A 1DL7H 1G9NL 1KCVH 4X9IA 2X89D 3DROA 1G7IA 4LHUD 1EEZA 2EIEA 5H37G 1DQML 1ND0B 2VDNL 2E27L 2EXYC 2P24A 4TTDC 4APQB 3SN6N 1N2RB 1MCIA 1HDMB 1NMAL 3G5ZB 1MCPL 2DM3A 2PYED 3MJ9A 5FYJD 4X7TA 2FBOJ 1N6QH 1TNMA 1UB6A 1P69B 3NACH 3U30C 1ES0B 1LVEA 2H26A 4LKXB 4ZTOL 3TH2T 1TQCC 4PJEB 3NIGE 5DQDH 3DARA 4KQ3H 3JV6A 3IDXH 3O4LB 3RWDA 5T5NG 3VXUA 1QYGL 1FVEB 4ZUTB 1LO3L 3TO4C 4ZPTA 2I9TA 1TPXB 3WS3B 2UYLA 5DJ8B 2C3XA 2CPCA 3TA3D 3EYQD 2EYTB 4UMGA 1KJ2H 2Q7YB 1GL4B 1YNKH 2MPAL 2EKJA 5I9QB 3IFLL 3I02B 5MEOB 1J1PH 2OCFD 3M8OL 1RK0B 4XH2B 4XMPH 3QA3A 3QDGE 4OF6A 5DWUH 3MQIA 3WLBB 2APVA 5C07E 3CFJA 2F54E 1D5ZB 1PKQA 5IFJA 4XP4L 3N06B 1T3FA 5C08E 4A2LA 4QRRA 4HS8H 2ESVA 4JN2B 4BH8B 5FIEA 2R4SH 5MENA 4LARH 1UH4A 3T0EB 3NIFE 3QHZH 4I1NB 1X5YA 4HZAA 1B0RB 2CLVB 2CRZA 3QP3A 4ZXBB 1U6AL 2FX9L 2WW8A 3D25B 2BERA 4ZUSA 5CP7B 4OV5A 2QQQA 5ISZE 1QSFD 3W0WD 3GEWB 3C5ZB 1PZ5A 4K7PY 3VCLA 1CBVL 4IDJL 2D0GA 3W5MA 2IFFL 3NFNB 4H8WC 3H3BC 4Y2OA 4Y5XC 3MRBA 1KYOJ 3AREA 2MOVA 4XAWH 3OAUL 1PDKA 5BO1H 1INEL 1M71A 1RIVH 3B5GA 1W72H 4OI9A 2V7HA 2IH1A 1YEIL 3OAZH 4D9LL 4QRUA 5LWYL 4OGAC 4PTUB 5I74C 3P40A 1BOGA 2Q3ZA 5D7JA 3VXTB 3X14B 1WCQA 4LK4A 1I7UA 5CIPB 4L8CA 2ZSVA 1CLOH 4Q58C 3QUXD 3OKYA 1AQDA 2AXJA 1BREA 3QNYA 3FB5A 2WK2A 1ZOXA 3LHPH 3WN5C 2I60L 3D85A 4G7YL 2K7QA 4ONGH 1FZJB 5BJTA 1NCCL 2IQAA 4X80H 2ENSA 5D70H 5E8DL 2VXUH 3T4YA 2GITA 3EDFA 1J1XH 4R4BB 9CGTA 3IDYB 5T1KD 2H32A 2FGZA 2UWEF 3MRFB 5HDBE 5CS7A 1W0VA 2R15A 1ACYL 1L7IH 3QDGB 4RAVB 2JTDA 4CMHB 5C07B 5C0IA 3B8SA 2F54B 5CWSB 4ZFZB 4M1CD 2F53A 5C08B 4M5YL 5LAXB 5KJRL 3U7YL 2R0WL 1F4HA 4KROB 1RIHL 3F7RA 4K7PL 4XC3H 5I1AB 5J12B 3BZDA 3L3IA 1LEIB 1X5XA 3TP4A 2NY0D 2YR3A 1KJ3H 1QQDA 2AQ1A 2EKSA 2IGFL 3QDME 4NNYA 4OQTL 5FB8B 4HBQA 4JDZB 4ODVH 5FOJA 5ISZB 3QPXH 1Q9OB 4HKZA 1MFCH 4F9LA 5T5FL 1IGCH 3BT2L 5C0JB 4CVXB 5ALCH 2VH5H 1WLHA 2HLFD 5J1AA 2HFGH 5F6HJ 4DN4H 3UBXI 3LMJL 2DYPB 2A83A 1GHFH 1UADC 3VFRB 5C7XL 1OB1B 2GAZA 3RVUC 4LLWA 3UC0H 2V5YA 5DJDB 3GIVB 3OL2A 4F58H 4XI5D 3QIBD 4XPGH 1BECA 1TQBC 2EEAA 3LEYL 2CIIB 4CL7A 2P5WD 4JLRA 1FVCB 3CH1B 5D2NE 5L6YL 3BD4A 4MCZB 1DEEB 4HHAB 3K8KA 1IEBB 5FO7A 2HT4D 4ODWA 3T2PA 1MCKA 4OD2B 5F7NC 3IDMB 5CSBA 5IBTL 2IJ0C 4ODSH 4JM2F 2K9UA 4POUB 5LCVH 5JPNA 3FQNA 4L3CB 5C09A 1A6TB 3HNVH 3E3QE 3SPVA 3MFFB 1RUML 1WFUA 3NCJH 4MD0B 4LGRB 4G6JH 3ALWA 3FO1B 1X5GA 2Q76B 5F1IA 4OM1L 1KNOA 5D93B 3IDIB 4GW1A 3UJTL 5HDOA