3UPAA

A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYDADDLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPNTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords kappa light chain variable domain
publication title General strategy for the generation of human antibody variable domains with increased aggregation resistance
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3upaA00
3RVTC 3W82A 3ZL4H 2AQ1A 4N5EC 2QKIA 2OMNA 2P24B 4EUPB 1DQML 5IB4A 3OZ9L 2WBJC 1OSPL 4PJGF 1I1FB 5F6IC 4GMSL 3WIIL 1NFIB 4BKLB 3OMZA 1FFOA 1GGYA 3ABZA 2I07A 3O81A 5BO1H 4KV5F 4WW1B 3VXMA 5GRWA 4R7NB 3QJFB 4DGIH 1HH9B 5DI8A 1WFTA 5EUKB 4X99B 3U83A 3VI3F 4GQ9H 2DDQL 1LP9E 4HS8H 5IW6A 2ICWI 5GRJL 2XIDA 1KJMA 2FCBA 2WUBL 4GAGH 3MC0A 3IXTB 5EU6A 3MNVA 5FCUL 4DQOH 5D1XA 1G7HB 3T8XB 1G7IA 4QKXB 4XNUL 3TIEA 2CO6B 3OAYK 4RWYH 5C0GA 1T83A 3GBML 3VDAA 1T2QH 1UT9A 1DCLA 4OCSH 1FGVL 2EXWD 4J8RA 1DUYA 1QBLL 4XHJC 3C6LC 3QUXB 2W59A 4MQXD 5C07E 3O11B 4JRYE 1CXKA 2GITB 4G80B 5ANMB 5FV2A 1DQDH 3G5XA 2V5RA 2EDWA 4P57A 1S7TB 1F2QA 2Z4QA 3PJSB 1QSFB 5L7XL 2OXHA 4LP4A 4PS4L 3RGHA 4WTWA 1UKQA 4PGCA 3KR3H 2R0WL 4BSVB 4HQQL 4JAMA 1CDBA 3NAAH 4WWKB 2PW2B 4BK5A 5C6TL 3HE6B 5H37G 4DUVA 5EU4A 4K23L 2VLME 3BX7C 2R1WA 4YDIH 4Q0XH 4DTGL 3MBED 5C0DB 1NCWL 2AXGB 4N0RA 5BS0E 1YUHB 3WDHA 2ILLA 1UYWL 4R3SA 4Y4HC 3KPQB 4FQIL 4M8VA 1VACB 2H8PA 3G04B 2L7JA 4RX4D 1CXHA 4KDWA 3SY0A 5HD8C 4HT1L 5LWYH 3L5WA 2FWOB 4FABL 1RV6X 5J1AB 4O9HH 3EGSB 1JN6B 2JK5A 5D6DC 3WN5C 2UWEE 5LXGH 2CSPA 3FN9A 5LGJB 4N9GB 5BW7A 4LSPL 2Q6WB 4RBPH 4UT6L 3CZFA 2APTA 4HD9A 4L8CB 3KPRD 3KYNA 5ICXA 4LCUB 1IKNA 5BQ7B 2DYPA 1I3VA 4RDQG 4U6HA 4FQPA 3RUGF 4ZO8A 3F7YB 3T09A 3JBG7 4G8GA 4NPYB 3P0GB 5CMAA 1A1OB 4MJ2A 2FX9L 1QRNA 1RZKC 3STZA 4M93C 1F58H 3IDXL 2BOBA 3FQWB 1YEEL 5BVJA 3WS3B 4UUJB 4TRPL 5I1DB 4PGDA 4U6VH 1MY7A 1ERNA 4R0LB 1UA6L 3HMXH 3TPUA 1VGEL 1CU4L 1F8TL 4DK6A 1PJ9A 4OLVH 4ONFL 1DVFC 1HSAA 3RPIB 3U4EB 3UPRB 1B4RA 2CKBH 1ZEAH 3HAEG 2E27H 3OKNB 4GAJL 3CVIL 4WI9A 4F37F 4M6OH 1NCBH 5CEZL 3PWNA 3K2UH 2R4SH 1M6OA 3MLVH 2DQFB 4XMPL 1OTUC 3RVXD 1H8OA 4AH2A 2HVJA 2NZ9C 3WO4C 4L8SB 4FNLL 3VXUE 4JZOA 4HIXH 4DN3H 4YFEA 2GJ6E 1BD2A 2KQMA 4U1NB 3V5KA 4N0UE 1H15B 2VLKE 3C5ZB 3JTTB 5D1XB 2NLJB 1FBIH 1T66C 4FXGA 1DUYB 2YD4A 4GRWB 4YXLL 2WP3O 3L9RA 2WWKO 3BQUA 2Z91A 1JRHI 4ZNCD 4HBQA 1G9NC 3TJHC 2AV1A 4JJ5B 3MR9B 5B3JF 1TVBA 2WUCH 3EZ8A 2Z4QB 1UH3A 4F58L 2EIZA 3MMEB 1KCUL 1BFVH 2DTMH 1F5WA 3JZ7A 4JZJA 4Z5RB 2UY7A 4QYOA 5E7BA 4LK4A 3JWDC 4AENA 1A7NL 3GSRB 3OGCA 1AO7D 5EU4B 2B0SL 3MJ8B 2R1WB 4C56A 4R90H 2E8YA 4JFZL 3SDDA 2B1HH 2DWEA 4XC1H 2V17H 2RCSL 5HGHA 2NW2A 1QYGH 5BV7B 3CMOH 4U49A 3KYOB 3QUZC 5B39B 3PWJB 2JJTA 3BVNB 2FIRT 4OQTA 5I8EA 5EOTA 4HKXA 4U1IB 1OT1A 4UOW1 1CFQA 4PJBB 2NXZB 4FP8H 5GSRA 3SY0B 3FO0L 4MXQC 2J8UF 1KCRL 3L5WB 4GAFB 2CUHA 2JK5B 4M7LL 3MJ9L 5FHAL 4F37K 5HYSA 4TN9A 4Y5VC 1WTLA 3BP4A 3ZE0F 1A5FH 4TSAH 4M8QA 3QCVL 4EBQH 2ZCLL 3IFLH 3VD3A 2J1KA 5JR1L 1YEFL 4OFKA 3GO1L 1BBJB 4I3RH 5ICXB 3FFCD 3PGDA 4Q9CA 4JM2A 3HR6A 3CSGA 4ZUTA 4GQPH 1R5IB 3U0TA 4G8GB 4IRSA 5JNYB 4YHKL 3OF6D 1AR1C 3VFUA 1HILB 1QRNB 2QADC 1RU9H 1NCTA 2FHBA 5F1IA 5BVJB 3Q48A 4Q6IB 3B2UD 3S37L 3T2NH 1FLRH 2HP4A 4GFTB 1DBBL 4F8QA 4NM4L 5E5RB 4OD2A 4ONGH 1RUMH 1P9MC 1EEYA 2ICES 3BE1H 1FSKC 3KPOB 4JN2A 4P48A 4Z78A 2OI9C 4NNXA 3MV7D 4KK8C 3NCYS 3HC4H 1NCAH 3LEXB 1CE6A 1W0YT 3BD5A 4EXKA 3W0WE 4ELMF 3VMNA 3MOBH 4MAYA 3RQ3A 2H3NB 5C8JB 3BO8B 3W2DH 4NHUB 5DA0B 4MJ6A 2NTFB 1KN2H 1VEMA 4ODTL 4PP2A 4FQHA 3IDIB 4L8DA 4P3WA 3CVHL 1QP1A 3BW9A 2HVJB 1VPOH 5EUOA 4LPVA 1ACYH 3PIQA 4ZDHA 1FO0L 1W0WB 1PBYA 2B2XH 3HA0A 1JGUL 4Y1AD 1EUTA 1RUPH 3CX5J 2VRAA 5T1KB 1YMHB 1N0LA 5ITBH 3MO1A 4HIEA 2HMIC 2BVUA 3TT1L 2OSLB 4WUUD 1U3ZA 1XH3A 4YO0B 3EDKA 2NY3D 1S7XA 3BSZH 5TDOB 2X4SB 2Z91B 2GSGB 3ZDZE 3MRKB 4PJIF 3VXSE 2J6EH 4S1RL 5AUMA 4CMMB 1FDLH 5C6WH 1TVBB 1WCBB 3EFDL 2PCPA 3LOWA 1RIUH 1A1MA 1U8KB 4QRPD 3RWJB 3TM6A 1SEQL 1SVCP 1FC1A 4NUJB 2VC2L 4WO4C 3QXUA 3MBEB 1U8JA 3FONA 3DJ9A 3QDMD 4QYOB 5TQ0L 3G5VA 1JGLH 3FJTA 4XP5H 3O8XC 2D03H 1JNNL 3BGFC 5CJ5A 2XXCB 5T3ZE 1X7QA 4HUUA 3OAUH 4OLXH 2DWEB 1FNFA 5L2KA 3GIZL 5IFAL 1A7OH 4WDIA 4I3SH 4X7TB 5BXFA 4ZUWA 1HINL 1HHHA 2OL3A 3V0WH 2AV7A 1KCVH 4POUB 5IEHA 3BKCH 2ZUSA 4URTB 1EO8L 1VFMA 2QHRL 1X5GA 1KGCD 1CFQB 1S7RB 4ZOBA 3UJJL 3ZKXB 3K80A 3O3BB 4UV4H 4DJMA 2H6PA 3ULUC 3KPRB 4GSDL 3TA3A 1MI5A 4LLDA 3O6FA 5CCKH 4U1MB 3ZO0A 1JP5A 4XAWH 4FQ1L 5TQ2H 1N8ZB 2V5YA 4UDUA 3P4OB 5KS9B 1T0MA 3UTSD 4HMEA 1I1AA 2B39A 2KH2B 5I1AA 3LY6A 1KT2A 1FVEB 4JFXA 4I77L 5I8KH 4Z8FL 1RK0B 5GIRA 3VMOA 3DSFH 2J12B 1AP2B 3F7QA 2ITDB 1CLYH 3CFKB 4N5UA 4XBPA 1IGMH 3LN5B 2MWCA 5FM8A 4CKVX 1H5BC 2ADIA 4LCYB 1EEYB 3MBXH 3BYYA 4JN2B 5E8EA 3PWVB 4OF7A 2ATKB 4O58L 1QG3A 1AE6L 1JRHH 4O2EB 5E5MA 5F7DA 1Q9KA 3MJGX 1BBDH 4OF0A 3DV4A 3V6FB 1NUDA 2F58H 1CE6B 3EYUL 1UG9A 4MAYB 4JFFD 1WC7A 5EZJA 1GC1H 5KSVB 4WW2C 3ISWA 2RFXA 4X4ME 5LKNA 5BJTA 5FGBA 4PP2B 4FQHB 3ULUE 4QRRD 4RGMC 4DEPC 3S88H 1KFAL 2C5DC 1D6VL 5E03A 1G0XA 5I9QB 2DD8H 1KTLB 3M17A 2I9TB 1UGNA 4PRIA 1MREH 5ALCH 3RGVD 4XMKL 2BNUA 5MHSD 5ERWA 4ZDHB 3GKWL 4CADA 3G9VA 3D0LB 3PDGA 1J12A 4LSRH 2OTUA 5HGBB 5JORA 5CUSL 2R2HA 3ARGD 3MRLB 2FO4A 15C8L 4OZGA 3U2SA 4PGEB 3I50H 2XNAA 3H42L 2NW3A 4LPXA 2ZCHH 2FSEA 3ZKQD 2H2SC 3CFDA 3B8SA 2X4NA 4N0CC 3DECA 3ZTNH 4KV5E 2IBBA 2WBKA 2VWEC 3GUTA 2LAGB 1SM3H 3W9DB 5FDWA 3L7EB 3EYVB 1BOGB 2B20A 3VI3E 1NSNL 3QEGL 3DVNA 5I1CL 1EFXA 4NGHL 1CIDA 1AO7B 2Z8RA 3V4UH 3VDCA 3RWHB 4ODUB 5TF1L 5HVFB 3HS0B 3U0WH 2JB5H 3TBWA 3R1GH 1ACZA 1K8IB 4R9HA 3QRGL 2AJVH 5B22A 4JY4A 3DMMA 4RRPA 2VLJD 2ADJB 3BPNB 4K7PX 5FHBH 1T1WB 1J0KA 1LD9B 3MXVL 5SV3A 1CGSL 5L2KB 2KPNA 2HT3D 4WDIB 5D4QA 3U30C 3H9YA 4FA8A 5HYFA 3AM8A 3HR5A 3BKMH 4KI5C 1B2WL 1PG7L 3FOMA 3MLSH 1IBGH 4Z7UA 4HUWA 1N64L 1H8SA 1HHHB 4L9LA 4X6EA 5KSBF 4W6YB 2ERJC 3O6ML 4UV7H 2I60H 3E6FA 4HWZB 3MV9A 3PQYA 4TUJA 1JHKH 4M6ML 1AC0A 2CDGA 1H3TA 3FFCB 2DQCL 5FK9B 3TA3B 1NC4A 1YY9D 5TDNA 2Q3AA 4LLDB 2JCCA 4F3FB 1Q9OB 2XZAL 4NKMA 1NMBH 2AP2A 3KWWB 2PUQT 4IJ3C 2AK4E 5GRUH 1FNLA 3HG1A 1T0MB 5A1AA 5KOVC 3WKML 3KXFD 4KTDL 2WZPD 4KK6C 1SHMA 3EO1A 1BWMA 2W0PA 1F3RB 3CFIC 5TE6L 4LLYB 4KK9D 3MV7B 1LEGB 2YRZA 3QA3B 4HZLB 3RZCA 3RTQC 2BC4A 5CSGA 3H3BC 5H8DA 3TLRA 4GJTB 4FQXA 4DW2L 4XWGL 5F7DB 1Q9KB 4IMKA 2DKMA 3K0WA 5F9WB 3BDYH 4X5LA 1WZKA 3RUGE 2DQJH 1WICA 3TH2T 3VWKC 1WC7B 3VRIB 1VFAB 5FOJA 2JELL 1CTNA 5IK3B 2RFXB 5C0AA 2KZ1B 5BJTB 3RU8H 2FBJH 5DQJA 1AI1L 2QQKH 5FB8A 4MHHI 3CIQA 4D0CA 5I71C 3NTCL 2D4DA 4PRIB 3FAWA 1ZHKB 1ZTXL 1CVRA 4WUUB 1JPTH 1XF4B 3SJVD 1N59B 2OZ4H 4PJ9A 3L5IA 1AXSB 4L3EE 2YZ1A 3P11L 4Y19D 5CAYB 2AJYH 2NY3B 4OZGB 1MJ7L 1G7MB 3U2SB 1IL1A 3AS2A 4MCZA 3WMSA 2A9MH 2MMXA 1XR9A 4HF5H 3ARDB 2IANA 2AJZA 4JREB 2R56H 5GRVK 3BAEH 4PB9L 4QRPB 3EYFA 4F7EB 3LKSA 4HW6A 1O7SA 5JDSA 2X4UA 1TQBB 2A1WL 1PYWA 4DN4L 4GKZB 2FDBP 3K7UA 5KZCB 3ZKMD 2FEDD 3B6SA 2DM3A 1X5YA 4WRLA 5K93A 3O3AA 1IZKA 5A2IH 5EFIB 1SYSA 1JFQH 3VXQB 4HG4J 4BZ1H 5J7CC 1N2RA 5JIPA 4DWHA 3DMMB 1C5BH 5D1QA 1YPZF 5EU3A 3OTTA 4PG9A 4M1GH 4LARL 2V9RA 2R39A 1A7BA 4ZAKD 5GZND 3HR5B 1RUAL 1YQ2A 2XZQH 4ENED 1NGQL 4O4YL 3B5TA 3O45B 4HUWB 1EHLL 1C1EL 1KXTB 5HPMA 1EEUA 1WGOA 3THMH 3CC5A 1OCWH 3PQYB 3L3IB 4QOKE 1NGWA 3CSYB 1CT8A 4NQVA 4LCIH 5C0CA 5I30H 3WJJC 1X4YA 3UTSB 2HRLA 1I7UA 1KTRL 2F74A 3DBXB 2BSRA 1BF2A 1U3HA 5B4MC 1NC4B 2NCMA 1PW3A 2O93L 3JWOH 1X4ZA 2W9DH 2X40A 3TH3T 1NFDA 2WQRA 1LO5B 2EH8H 3HG1B 5JO5B 4W68A 1Y6MR 5CP7A 3QDGA 3UMTA 3LKOB 3SKUD 4N0FB 5IJKA 3NIGF 2P8MB 4GG8A 4JQVA 4GLRI 3WL9B 1XIWD 3HCVB 1QD0A 4RMTA 4YXHL 2P8PA 2J8UE 5GJTL 2FJGB 2Y36L 1HQ4B 4HC1L 7CGTA 3WBDA 1MJUH 1LQSR 2J4WL 1CLCA 1OGAE 2ZUVA 1FVCA 1J1XH 4JFDE 3UZVB 3ZE0E 3BP6A 1NLDL 2X05A 1EJ6A 3KPMB 2R0LH 2PXYD 1M7IA 4LDLB 1WWCA 3QXDB 4K9EC 3TBSA 4QRRB 2EDRA 4ZNEE 5FCSH 1EXUB 3KPSE 5IVZB 3RVWD 3S4SG 1OOAA 3PHOB 1B0GA 3RGVB 3MRDB 4PJ8D 4NQED 2Z35A 1CCZA 1KF9B 1KJ2H 3UTZA 2YSSA 3HMXA 4MA1B 1BREA 1TMCB 5KVGL 2QR0B 5KW9L 3ARGB 3B9KC 5IBUG 3ZTJG 3OKMB 1HWHB 3EOTH 4QHUB 1H3WM 1A6ZA 2X7LB 2WINB 3SKJL 2VH5H 4OSUH 2CKBA 3DETC 2JKXA 2IALA 4PJ9B 4Z76A 3MODL 4WWID 1QO3B 4ELME 3DRQB 5IB5B 1T1ZA 3JSSA 1J0ZA 1CLZL 2NY0D 4ELKA 2NMSA 4MCZB 3MA7A 5A2JH 2P45B 5MEND 4QY8B 5ESAB 1KSRA 2AJZB 4KRPC 1IM9D 1E4JA 5C9JB 4Z0XA 3OKOA 4C4KT 2Q8AH 2ICWJ 3EYFB 2D2OA 2NYYD 5J3HD 4B0MM 1UZ6F 1E4KC 2X4UB 4G6KH 2D31B 2AJXH 3VXNA 2XXMB 1ES0A 1XF2A 2VLJB 1T20B 3E2HC 3NA9L 2EDXA 1PKQE 4X6DA 3FT2B 3D69A 3QEHB 5I6XC 2HTKC 4WFFD 2PETA 2DL9A 3QG6A 5FO7B 4H1LH 1OAZH 3QHFH 3QPXL 1NEZG 3QI9D 3K4DA 5I1LA 1R5WA 5L6YH 1HI6A 1DEEA 5D71L 1MLCB 4D0DB 4OZ4A 2CRMA 2PR4H 3DO7B 1A6UH 4N1EA 3WNPA 1RIHL 3KPLB 4Z6AT 5CD3B 1AFVL 5GGSB 2EEAA 1HXMB 5DFWH 5HPMB 1RHHA 4LSQL 4IBLT 1CG9B 2AXFA 4XBGA 1NGWB 4LIQH 5SX5K 1CT8B 2A0LD 2X4PA 4NQVB 2EE2A 1W72L 2PTTA 3UYRL 4RSVA 1LHZA 2BSRB 4JGMA 5EIVA 5GGVH 5HHMB 3MRGA 4CVZA 4ONHB 3TYGL 1A6TA 5E8NB 5H35B 5E70A 1DQLL 5MI0B 3BXNB 3EO0A 1QFOA 5CP7B 3UROR 3QDGB 4L29A 1XGYL 3X3GH 3BZFB 4QXTA 4KJPD 4PJEF 4PJFB 3QEQE 5F9OH 1GPOL 2Z31D 5L0QC 2FGWH 5JUEL 1OAYL 2DLHA 3GMQA 4CU8A 4ODXB 3Q2CA 5E2TH 1I3RA 4Z7NF 1FVCB 2ESVA 1WZ1H 3IFOB 3LSOA 2E9IA 4LPUA 35C8L 3QIWA 3DURB 1HSBA 2FB4H 4YHOH 3HE7D 4WFEE 2P1YA 1MHEB 1VGKA 5FECA 3VXRE 1VDGA 2VDOL 4Y8AA 3UP1A 4IRJC 2EZ0C 2XT1B 3B9DA 2VE6B 2WIMA 4HBCL 5D7LA 5E6IC 3QB7C 1B0GB 4YFDB 4H8WL 1D6EB 1XGRB 3MA9H 4IOFC 5FUOH 3SJVB 3MCLL 1NDMB 1IC7H 1JPGA 3QO1B 4Y19B 1OQXA 2ZSVA 4I0PD 3VXOA 1A6ZB 3SPVB 4P46C 2QSCH 5EA0L 3NGBB 5CJOL 2ZUTA 2D0GA 2XRAH 4JY6B 3MTRA 3RX5A 1MRCL 4IMLB 4LKCA 4HDIA 1T1ZB 4S1QH 4KQ4L 5DUBA 3WFBL 5IBLD 3ULVF 1T1XB 4QGTA 4IRZH 2GJZB 1L7TH 1KULA 5T5NF 4M6NH 1A1NA 4QGYA 4FFWD 4K3DH 4Z0XB 3OKOB 5K9KB 1OD9A 3I6LE 3TBTA 2FLBT 4L3CA 1HDMA 2R1XB 4JRXE 3L1OH 3DX8A 1CZ8H 1DBML 4LSVL 5FV1L 4AEIH 4HIIA 5KTEH 1MRFL 3WO3B 3ILQC 3MSPA 2VN7A 3MRPA 2ZUYA 1KB5L 3ARFC 3TPKA 3PV6A 4PGZA 1BWWA 5F1NB 1RIVH 5IQ7H 1WT5C 2AJUL 3TFKC 4OF6A 3F7PC 1NAMA 4ZAKB 5FDYA 4DVBA 4G9DA 4GLRH 3HMWL 1UEMA 1R3KB 1EVUA 4NO0D 2J6EA 2ZOLB 3LQAH 4MA3A 2VL4A 4G43A 2EKSA 1R3IL 4XPBL 1HI6B 2MOVA 5ELIA 4KZDH 1OHQA 3L3GA 3OPZL 5B38B 4D8PA 4YZFE 3D85A 3N1MC 1T22B 2YD2A 3EYQD 1F4XL 4MGXA 4HX1B 2BNQD 3TCLB 3BHBA 4XNMB 1YDPA 3NBNA 1AGDA 4L4VD 1S9YB 2E7HA 2LE9A 2D9QB 1U91A 2P5EE 4M3JA 4XBGB 2IPUG 5GHWH 1ZA3A 3EZJB 1T21B 4JLRB 4QRQA 4Y5YA 2COQA 1INEH 5C0ND 1XIWB 2EDNA 4LKXA 4ODVH 1UH2A 5CJXA 5KVFH 5LCVH 2EIEA 3TJEH 3HZYA 4N8CL 2BVEA 4XWOC 5DJYB 4UILL 4YHYC 5KSBE 1CFVL 4KVNH 2FJFA 1I8MA 3DNKA 4L29B 3GJEB 1G7PA 4XI5D 2AABH 4QXTB 1HKFA 2PXYB 4YIQA 4M61A 5KAQG 1OARL 3GJFB 3IFNL 1G9MC 3GMQB 4FTVD 1DQMH 1KENL 1CGVA 1NEUA 3OZ9H 3D3VA 1OSPH 2Q7YB 3U79A 1KLFA 3DYPA 4IEFB 3ZHDA 4GMSH 2FIKA 1U8LA 3LSOB 2YD5A 3QIWB 1HSBB 2EEDA 3K81A 3F8UB 1RK1B 4PJ8B 3T0ED 1ZHLA 4NQEB 3NFSL 3RDTA 3HC3H 1RZ7L 3DX9A 3VG9B 4Y5XC 1JYNA 3CFJA 2VDPH 4YPJA 2DDQH 2IJ0C 1CYGA 1WWWX 1ED3B 5GRJH 3D6GA 4PYHA 2WUBH 1E0OB 3V6OC 2H32H 3VFMB 5FCUH 4PJHF 5GS1C 5EORL 3P0YL 4XNUH 1MCSA 3GBMH 5KVDL 1A3LL 4OCYL 1FGVH 3H3KA 4K8RL 5IESL 3L7FB 3U9UB 4PRBA 5D2NC 3RWFA 3VMPA 4H88L 1T4KA 3HNVL 1BJ1H 2YPLE 3LVEA 4KY1L 1ITCA 1P69B 2X4OB 5GGRB 5L7XH 4J7RA 2IEPA 1A1NB 5F9AC 1ZWIA 4PS4H 1X5XA 4G8EA 2R0WH 4OZHB 4O5LL 2P42B 5C6TH 1HDMB 1ZHBA 4K23H 2CIKA 2B5IC 4W4OC 5C07D 5CD5C 1JGVL 4JRYD 4LCCC 1PX4A 4DTGH 5FM4A 5IVOA 1NCWH 1QLFA 4MDJB 3RVTD 1LILA 3PV6B 4Z95L 3IRZA 3G6JA 1JL8A 1UYWH 4N5ED 2DIBA 4Y2DA 2WBJD 4JO2L 1FZJA 4FQIH 4G9DB 1DTUA 4GRMA 3V6OE 3CCHA 1J87A 4RNRB 5K9QG 1MWAL 1IGCL 3MQIA 2AEIT 4U0RC 1EAPB 5F8QC 4HT1H 1O7VA 3RA7L 4FABH 1BQHA 1VFBB 5DJ0B 3L3GB 5D2NE 1MCLA 2NY2C 4EI6A 2J7LA 3LDBC 1YEJL 1C12B 2YUWA 1AGDB 3LKQA 4PR5B 1LMKA 4TUOA 1FNEB 5EPMA 4LBEA 3SBWC 1U91B 3U7WH 1ZKAA 4U3HA 1HKLH 4LPYA 1QPXA 1YPZE 1DN0B 1ZANH 2GSIB 1JHLL 4KJQC 4LDEB 2FX9H 1KPRB 4XHJD 3C6LD 4PY7B 5ACZB 4F7CB 3IDXH 4U1LA 3MUHL 4I8DA 1YEEH 1CBVL 5B8CC 2Z92B 3C8DA 1X9QA 1C5CL 4Q2ZA 1UA6H 2MNUA 3O2DA 1G7PB 2X4TA 3ARZA 4XRCA 1VGEH 1CU4H 1F8TH 5ETUB 5DQDL 4NBZB 3HE7B 4YIQB 4ZUVB 4GAJH 3CVIH 5MEPA 2C1PB 5CEZH 4JG0L 1MH5B 1U8LB 4XCYB 3OXRA 4JN1L 2C4FT 2DLIA 1ODAA 4UT9L 2FNBA 5BMFL 3P4MB 4XMPH 4ZQKA 3UTPE 4XNZC 3MOAL 4WHYG 3DX9B 1MCKA 3NIGE 4Y4HD 5HYSG 5INDA 3CFJB 1IC1A 4FNLH 4EDWL 4NOBA 2CK0L 2VISB 1KYOJ 5HD8D 2YD1A 1LO3L 5JW4R 1JNHA 3FQUA 3VFOA 3GSVA 2EICA 5ENWB 2IGFL 3MRBB 3WDJA 1BQSA 1CFSB 4JM2F 2DLTA 5F7UA 1FGNL 2EDOA 1I8IB 4MCYA 3VI4F 3NPSC 1E28A 4MJIE 3QDJE 4YXLH 4LCWD 4P3CL 3D39E 5HYQA 1HHJB 5JOFA 4PRAA 5IEKB 1XMWA 3NH7L 4IDLA 3MRJB 3GMLA 1KIRA 4WHCA 2H2PC 4F58H 4PLKC 2YHGA 1LDPL 2IAMA 3BISA 3RWGA 3FCTB 1OL0A 3NA4A 3VGBA 1RFDL 2OZ4A 1HYSC 1A7NH 4MSWA 3U0PA 2B0SH 4JFZH 3D1MC 1EERB 5F7HA 2RCSH 3BIAX 3U4BL 3MCKA 1FL3B 1DVFD 3V8CA 4Y2DB 2GUOB 2D3VA 5EUOF 3RWIA 5BS0A 1S9WA 2VXTH 2BNQB 1U8MA 3FRUA 5F1SA 3FO0H 3SGJC 3GSNL 1KCRH 2OJEA 1OTUD 1IT9L 2NZ9D 2BY2A 3LD8B 3MJ9H 4M7LH 1U8NB 5FHAH 3WS6C 4WWKC 4EI6B 3GJFH 4KH2A 3VW3L 3QCVH 1KIQA 1QEWB 4P2OA 5AG9A 5EPMB 1WAAA 2WLZA 5JR1H 1YEFH 2P7TB 2X1QA 4NWTH 3GO1H 4G6AC 1P4IL 3L5XL 4EZMA 1KB9J 3I6GA 5SWZA 3GEWB 2PKDA 1T66D 4N1HB 1IQWL 1NC2A 3O2WL 4MWFB 3V7AG 4AG4H 1X5KA 3LRSA 1FNGA 4OKVA 1OAKH 4U1LB 1FHGA 3GSQA 3KJ6L 1LE9B 3TJHD 3S37H 3QAZB 4F15C 4FTVB 5TE7H 5ITFA 1UJ3A 2BSTA 1FV1A 1DBBH 1QHPA 2ORBL 3B9EA 4J4PC 4NM4H 2X4TB 2R69L 2AQ3A 1ORSA 4XRCB 4XC3L 1U6AL 2B4CL 4DOHE 4DGYL 4U7MA 2AAVA 1HHKB 1P53A 5TDPA 4NSKB 3V6BR 4G6ML 2CLZB 1YN6A 43C9A 4ODBD 3M8OH 3LQZA 5DA4A 4E5XB 4V1DE 4RCAA 4YXKL 2YEZA 4TSCL 1P84J 4JM4L 3OR6A 2FEEL 1I8LC 3E0GA 4OCLC 1S7QB 4MXWL 1J7VR 1MCBA 3IDYB 5TH2A 3QUZD 4GOSA 3FQXB 1EX0A 1MHPL 4PJEE 4TNWF 4AYFA 5C0JA 1XFPA 1FO0H 1JUFB 4X9BA 1OVZA 3ULVC 3MREB 4HZAA 3W0WD 1JGUH 1N7ML 4MXQD 2HFEA 4Z7NE 5T1DH 3FQUB 1ORQB 2XN9A 1TPXB 1MEXL 1OLZA 4XH2B 5C08E 3VXUA 3VFOB 2GJ6A 3MACL 2EDQA 4LRNL 3DUSB 2VLKA 2JJSA 3U82B 5HYQB 4Q9RL 4EI5A 1J88A 1ULVA 4PRAB 2QBWA 1KJ2A 4S1RH 5I16A 3BEVA 1MIML 3CFBB 2DF3A 3FKUS 1OD7A 4QXGL 1P7KA 3EFDH 5C07B 1SEQH 4JRYB 4RIRA 2VC2H 1AR1D 5TQ0H 2QADD 5C0BA 5GS0L 5I73B 2ITCA 3GBLA 2EIDA 1VENA 1JNNH 2Y06L 1N5AB 3U0PB 1TQCC 4CN4A 2WBJB 5IP4A 3QDHA 1ZT4A 5D1XC 4JPIA 3VXSD 1CFTB 3GIZH 5IFAH 3HZVA 1AXIB 2Z93A 1T83C 3MCKB 4KK8D 4KJYA 2DB8A 3ULVE 5E56A 1HINH 2P4AB 5BS0B 1AGCB 2E6JA 2UUDH 1MHHB 3X12B 1EO8H 2VITB 2QHRH 3IDMB 3UAJC 1XGPA 2VKWA 1C5DA 1QFWM 4RISL 1NL0L 4GSDH 5TFSL 2A6IA 5SWQB 3FFDB 1BIIA 2V2WA 1YC7A 5L9DL 3MRQA 3RY4A 1GIGL 4ODWA 5EU7C 5I75C 4EIGB 4FQ1H 4W6WB 5GS3A 2DQTL 3AMLA 5E00A 1PG7W 3C6LB 4H1LA 1L0QA 4OCRL 5GGQL 3VXME 2I9LB 2UWEB 2HMID 1FZMA 1EBPA 2OCFD 2IBGA 4MLIA 4R96A 4TNWK 4I77H 4ODHL 1GZQB 5IMOA 4Y0GA 3CLFH 4PD4J 2G5BA 5EBMA 1P2CB 1NGZB 1EBAA 3AB0B 5I8OL 4XNYL 1WJ3A 5IHLB 4H20H 1S7SA 1YEIL 2CJUL 2CLVB 1FNGB 4OKVB 5E2WL 4KZEL 5EU6E 3ARTA 2K7QA 3TZVA 2WLYA 4RRPG 2F9BT 2DQGL 2BSTB 4EDXA 3QWOA 2ED9A 2YOCA 3MV8A 5M94B 4NZUL 4O58H 1AE6H 3J7HA 4WO4D 3MRHA 5DEGA 3UO1L 4Z7VA 5D7JA 1D9KA 3EYUH 5DHVH 5BW7C 3O8XD 3CX5K 4Y4HB 1D5BA 4U33A 1YN6B 3BWAB 2IMMA 4PJ7F 43C9B 4LEOB 3LQZB 5CGTA 3RWDB 1IKNC 2AEQL 4JO3L 5A40E 1KFAH 1U58A 1D6VH 1JZ8A 4Y1AA 3MXWL 3OR6B 1S8DB 1J1PL 2EE9A 5EU7E 1E4WL 3NVQA 2DQUL 2A6KA 4OIIL 3U9PL 4Q6IC 3WN5B 1P1ZB 3GKWH 3NIDF 4IS6B 3LQMA 3TNMB 4LHQB 3DHJA 4FXLA 5GRZA 15C8H 3FB7A 5IKCB 1FZKA 3H42H 4X8JA 3ULUD 3VXUB 1JTOA 2GJ6B 2XY1A 4N0UB 2VLKB 1WEJH 2XG5A 3PDOB 4O02L 5E94A 3MRFB 4M93B 4BFEA 1NSNH 3QEGH 3ZDYF 4NGHH 5F7LB 4OFIA 2R2EA 3FB5A 1T03L 2X1XR 1B6DA 2C3VB 5HYJA 5E6YA 2BRQA 1F3DH 5TF1H 1I9IL 4PJHE 1I8KB 1VADA 1X5AA 2ITCB 4YDLC 4DZBB 3MYJB 1FFQA 5HTSA 1DVFB 3B5GA 4NIKB 2W9LA 3KYMA 1MCOL 3QRGH 1UXWA 3RNKA 5FO9B 5HHPB 5JXEA 3WFZA 3R0NA 3H8NA 5IB2A 3OB0H 4AQ1B 4JPIB 4BH8A 3MXVH 2O5ZH 1CGSH 4JFOA 3HZVB 3S3SA 4LNVA 2ENYA 2Z8WC 4KJYB 1UM5L 1MFAL 4NO5A 2X4QA 2UZIL 5GGSY 4BFIA 1B2WH 1PG7H 1YEDB 2CRZA 3BQUC 4FFZL 1N64H 2JB6A 3VGEA 3WO4B 2RIKA 3O6MH 3T77B 2WK2A 3CFCL 5FEBA 4HS6A 3UTTD 4N0YL 4LRIA 3JWNC 1YNLL 4GW5B 4M6MH 4JZJC 3KDMA 4JG1L 5I0DA 3WHE0 1IGJB 1J8HA 2WIIA 1MVUA 3N1QC 2V2WB 3QQ3B 2XZAH 3IU3B 3V95A 1GCFA 3MRQB 4X0KB 4ODWB 5A16B 3VFGL 4YHML 4YBLC 3SDDC 4X98A 3PL6A 5DJAA 4QNPE 5DMIL 4NO3B 3WKMH 4KTDH 1ZGLA 1BJ1J 4MQ7A 1G7QA 2H2SD 5BO1L 3RBSA 3WIHL 4N0CD 4TOYL 1BD2E 2JJTC 3JV5A 3C8HA 4RAVB 1S7SB 1IGTB 4GW1A 1REIA 3PGFL 3FQTB 3BUTA 4GAGL 1CDUA 1LNUA 4DQOL 3IDNA 1KPVB 4DW2H 4XWGH 3MRHB 5DEGB 1AGBA 3MRNB 1EEQA 4B7IA 4KHXL 1RQ5A 4Y8DC 2QQNL 4KC3B 8FABA 3QUZB 2ZCKH 1VERA 5D2LA 2JELH 3OG4B 2IFFL 2VR4A 5HYIA 4U1SA 1DQDL 3PF2A 4JM2C 1R6VA 3FT4A 4JHAL 4Z9KB 3GSWA 1A6VL 2ARJQ 2VL5A 5DEFB 3W0WB 1AI1H 3G08A 1UQSB 4X5WB 2YA1A 1V3MA 4IRSC 1BVKB 4KI5D 1JI1A 5JOPE 5FYLE 3NTCH 1OWWA 4C56E 1EO7A 5J56B 1CF8L 4NYLA 3S36X 5KN5A 2QQQA 1MPAL 3FB7B 3P11H 4R26L 4CJ1A 4YDIL 1NFDF 3UJIL 1FZKB 2Y6SC 4Q0XL 1DZBA 4XPAH 3IETA 3RAJL 4LEXL 4AJ0A 4MAYC 1WUNT 4PJGA 5DK2A 3GMMB 4GO6B 3TCXA 2PYEA 4HGMA 3HLAB 4PREA 4PJ5E 4P59L 2QADB 5IVNA 3MLTB 5CP3A 3GFUA 3GMNB 4L3ED 3IVKB 3OHXB 2H32A 5I9QC 2V9TA 4KK6D 4OI9A 8CGTA 1RJLB 4UQ3A 3TIDB 3RL2A 1MQKL 1UJTA 3VXSB 2OI9B 3EYSL 5ESQB 3KYMB 4OUUB 3RNKB 4RMSA 3RTQD 3VI4E 3OJ2C 3HZKA 4LARH 4HCRL 4P2YA 2GAZB 1FIGH 2X4QB 4BFIB 5EO0A 1RSFA 4OFVA 5CSZB 3SQOL 2NX5D 5IHUL 3VWKD 2YPVL 4KTEL 2VDKL 1EHLH 5FYJL 2OR9L 3OKDB 3WFEL 1C1EH 1MOEA 1NKOA 1A8JH 1DUZB 1DE4A 3BH9B 2VABA 4NN6B 4J3XA 2XKUA 3IJHB 2HJLA 3KDMB 5JQ6L 1RZIA 5I2IA 4A6YB 1DN2A 5D7SL 4C55A 4BFBD 5ISZA 2XY2A 4HKZB 3TVMA 1YNTA 4GKSA 1CI5A 1WFOA 1NCBL 5KJRL 4P4KA 4J3VA 5EUOE 4LVHC 1K85A 2C3WA 4JFPA 4ZFOL 3LPGA 1ZGLB 4MQ7B 2CLRB 2EYRB 2AK4A 3MFFB 4YXHH 5GJTH 2Y36H 5IB3A 1K8DB 5GXBB 4HC1H 4WO4B 1F6FB 2J4WH 4X6DF 5F3HB 3VFWB 3O8XB 5I1KL 1NLDH 1LNUB 2APBA 2Z8VC 4OIBA 1BPVA 5ICZA 5F21B 5DJZA 3TA3C 4LLUA 4Z7OE 3O6FC 3LB6C 2VQ1B 3SN6N 2W38A 1AGBB 2YBRB 4GAYB 1OAQL 3WLBB 4ZFGL 3DVGA 1D5XA 1JZ4A 4MD4A 4RBPK 2QSVA 1IEAB 1I1AC 4OCMC 4R97C 4YX2L 1A14L 1OGAD 5JPNA 2DM7A 4U1SB 4TSBL 3FT4B 4JFDD 1CN4A 5KVGH 3D25A 4HLZH 5DD0L 1R5VA 1CLOL 3QJHB 2V2TA 3AXLA 3K74B 3SKJH 3PHSA 1UEYA 3KPSD 2DOCA 5L2KE 3MODH 4E0RA 1QBML 4LP5A 4HS3A 1M1SA 1TCRB 5DVLA 5IIEB 4TTDC 2OM5A 5GGRY 1RZ8A 4R90L 3FQNB 1CLZH 4YDJB 4UBDD 5E9DD 5F8RC 5B4MD 5IF0B 2UV3A 1FYTE 4HG4K 4GKNA 3VA2C 5DK2B 1TZGL 1AQKL 5E2VH 3VFSB 5FGBC 4DGVH 1V3JA 3BPLC 2HYMA 3BIKB 1MI5E 4LSTL 4AL8L 1H5BB 3NA9H 4HAGA 1Y6NR 5DMKA 1BJ8A 1U93B 2OTPA 1E27B 2C7UB 4KGLA 1WCQA 2UZYB 1ZT7B 2Y4SA 3P9WB 2XACC 4KJWC 4UU9A 3IFLL 3DTXA 2OBGA 1SJHA 3HPJB 3QPXH 3ZKSD 3NZHL 5JQHC 5IJVB 2GT9B 1VKXB 5KANG 4YHPA 4KTYA 4RGMB 4DEPB 5D71H 5AG8A 1QKZL 4OUOA 2BZDA 5LVEA 2QEJA 1RIHH 5D5MA 2Y7QA 4JB9L 3VD4A 4LSQH 3TBYA 1JK8A 4RMUA 3CPLA 1FLRL 2R1YB 1FFPA 1OF2A 3B9KD 4Y89A 1W72H 1JNLL 3BE1L 3UYRH 1AY1L 3MRIB 1QVOA 4TTGA 4F33A 4U6YA 1R3JA 3DETD 4QOKA 1JE6A 2BDNL 3FOLB 3TVMB 3DMMC 4LPTA 2VZOA 4I3GA 5I1EL 1XZ0A 3D0VA 1DQLH 4BA8A 1XGQA 4F7TA 3BPOC 1XGYH 3LKRA 3AM8C 5DSCA 4KRPD 4XCFL 2AK4B 3MJ9A 2ZUXA 1GPOH 5GRXG 4L9LC 5JUEH 2XICA 5EU5B 3KPPA 5DDHA 1A6AA 3KPTA 5C6PB 2F5AH 3EHBC 4X6BB 3U36A 2ZKHL 1K5NA 35C8H 4KVCL 1HEZB 3VXPB 3KYAA 4CN6A 1S7UB 3V52L 4F2MA 3L3KA 3FO2A 5DJZB 4LLUB 4HSQA 2AXHA 1M05B 1Q9LA 2B1AH 3QEQD 4HBCH 2HTKD 4M48L 5ESVA 1LO2L 4JGJA 4PTUA 4MD4B 3ARSA 3BSZL 2G75A 4H8WH 3L95B 2Q76A 4JHBA 3V0VA 5JPNB 2ERJB 3MCLH 3RUGB 1FDLL 4JFQB 1JF6A 4IM8A 4POZC 4Y4KA 3FL7A 5MP6L 1QFWL 4WFED 1BJMA 3EJYC 4L1DA 3VXRD 2FLRT 4FZEL 3DX7B 5DRZA 4M62L 5MENA 4J1UA 2KL6A 5CJOH 1WITA 3RZCC 2ENSA 3S34L 43CAB 1MRCH 5I18L 2QQLL 4KQ4H 1RZ8B 4WU7B 4IJ3B 4OFYD 3WFBH 5K33A 1X44A 2CH8A 3CVHA 4FQXC 4PJ7E 3FO1A 1NQBA 4Z7UE 5JW4Q 3H6JA 2UYLB 3SEPA 3PP3H 4IMKC 4X6FA 4L3EB 3VGAC 5L2JB 4NZRL 4ELMA 2HN7B 2ATPA 2KUTA 3MV9E 4GKNB 1FO0A 4ETYA 3L3HA 1AKJD 3V0WL 3WJLA 4MA1C 1MRFH 3NIDE 3PV7A 3BGAA 5D72L 2JCCE 2NNAA 3BJ91 4UV4L 2AGJL 4O51B 1X6LA 4X7DC 2YD8A 4A6YH 2JF1A 2AJUH 4PJ9C 4AIZA 3KGRA 1U41A 2Q87A 4JANB 2GK0A 3VFRA 1T5XB 4U2YA 1K4CA 2YPKB 3DTXB 3I6LD 4HIJB 3OL2A 1FAKT 1QBAA 1TZHA 4JRXD 5DS8A 1Z5LB 3RKDC 2F53A 1XCQB 1R3IH 2GTWA 4XPBH 3ZDYE 1Z9OA 4IRJD 2EZ0D 1UB6B 3OPZH 5I71B 5E6ID 1JNJA 1F4XH 3GSXB 4PV9A 3T04D 3OQ3B 1XF5A 5LQBL 1CLYL 2RR3A 4PJIA 5EOCH 4IOFD 3WSQH 2OX5A 2DL2A 1IGML 1CDGA 1RZGB 2PTUA 1H9VA 1FFPB 4OGAC 3DUUA 3AC0A 2KDGA 5D1ZA 4P46D 4U6YB 1B90A 2ARJA 2P5WA 5F97E 5F88A 4QOKB 5C0AE 1HQRA 1D5MA 1QLEL 3TESA 4E9LA 1XGTA 3ROOA 5D1QC 1XZ0B 4PV8A 2Z31A 5ACMA 4UILH 4CVUA 1TFHA 1XGQB 4M7JL 4F7TB 1Q1JL 2P5ED 5GS2D 3EDJA 3ZMRA 5SX4I 4HGWB 3VJ6B 5ALCL 1F3DJ 1FN4A 3KPPB 4PIRF 1A6AB 3G6JF 3O0RL 4Q9QL 1MVFA 1TDQA 2IANE 2J8UB 2BJMH 4HEPG 3TYFA 4P9HL 1LGVA 3ARFD 3IS1X 1U3HC 4F2MB 1OGAB 4N8VB 3NFSH 1A2YB 1OP5H 5TE4H 3VFNA 4JFDB 2VXVL 1BQHG 5JLZA 4PJDA 5BV7L 4IHOA 1A4KA 5FYKL 3AS3A 4JO1H 2UY6A 5MI0C 4OKDA 4JFEA 3TNNA 1X5LA 3V0VB 1MIEH 5T1LD 5IJKC 3PABB 3KPSB 2IADB 4JQVC 3MPCA 1IAOB 5EBLA 3V4UL 1DQQB 1TVHB 5EORH 3P0YH 2M8XA 5I74B 3T1FB 3GI9L 5KVDH 1A3LH 5DC9B 4OCYH 5DHVA 1CGXA 2BMKB 5IESH 4Z0BH 4J1UB 2HLAA 3EAKA 1MFBL 4ZFFA 1MAKA 4MAUL 1HWGB 2AJVL 3MLZL 4V2BA 4P0DA 4H88H 3HNVH 2W0KA 3F12B 4G8IB 4KY1H 5FHBL 3FO1B 4CW1A 4FFVC 1DL7L 2G60L 4ELMB 2AJSL 2ATPB 3PHQA 1HHIB 3BMVA 1L9NA 2G2RB 3BRGC 3UTOA 1KLUA 3L3HB 5C0CE 1OGTA 4O5LH 2C26A 4XWOD 5F1KC 5BZDA 3W11C 1JGVH 4ZOEA 5IMKB 4KKNA 1HH6A 2YPLD 5FO8A 2DQHL 5EOQL 1NFDE 4Z95H 4QWWC 2IPKA 2YRPA 4JO2H 1RY7B 4U1HA 3NIFF 2GK0B 3VFRB 5CFHA 5D6CB 2ZJSL 3U7YH 5H37H 1PKQB 1TZHB 4YEEA 1MWAH 1DQJA 2EE3A 5ALBL 2EDDA 2GTWB 4KGJA 4WJ5B 3GI8L 5T1MB 4N90E 1H3PH 1OAXH 3B9KB 3DXAA 4K7PH 4HJGA 4PV9B 2RJMA 2YK1H 1YEJH 5KG9A 5HDBE 4PJIB 3T3ME 5F96L 1F4AA 3OJMB 1NDGA 1BFTA 4F7PB 3DUUB 4ZYKA 2E7LA 2A74A 1QR1A 2OQJA 2NY5L 1F2XK 3MRMA 4MB3A 2ARJB 1FZOB 1B0RA 3PGCA 4KRPB 1D5MB 3BDYL 3BZEB 2DQJL 1XGTB 1ONQA 1CBVH 4KKLC 1C5CH 4QTIH 3P4LA 4DCQA 3QFJA 2Z9TA 3PWLB 1P7HL 5F44A 5F71A 4PBVC 3RU8L 2FBJL 2X9XA 4XP4H 1A02N 1JZ2A 1TLKA 3J8F7 2V7NA 4KHTL 3LN9A 1V5JA 4E41A 1C7TA 3E2HB 3R0MA 4K94L 3T0WA 2VLRA 1F6LL 5E8OB 4WTZA 4PJAA 4JG0H 1HN1A 3QEQB 5CD5D 1Z9LA 5I6XB 2Q86B 3O4LA 2NXYB 2HA1A 4MD5A 1EEZB 4KROC 1WFNA 1KTDA 3SDYL 4UT9H 5BMFH 3QQ9C 5H94A 4XX1G 3MOAH 3VFNB 3TO4A 5JLZB 4WEUD 3Q5TA 5I76A 2FX7H 4OD1L 1CD8A 1QPPA 3HAEH 2VKXA 2OR7A 1ZHNB 3VXRB 3ZT5A 2CK0H 4YFLI 4Z7WA 3QNYB 1LO3H 1JWMA 1W0VB 2CGRH 4X6DE 1WAAF 3LEYL 4U6TA 2OYPA 5FKAB 5KS9F 1QLRA 3H9SA 4JFYA 1PZ5B 2IGFH 2NY2D 3UTPD 4OZIF 1FGNH 4KRLB 1NBQA 2BK8A 2DJSA 4KMTH 2HLAB 1U0QA 3VE0B 1CQYA 1YEGH 3QIWC 4BZ1L 5DZNA 4F57L 1F3JB 2BSSA 1AKJB 4X9HA 3VRJA 4NZTH 1QOKA 1CDHA 4MNQD 5HDQL 1D5ZA 5LBSL 1DLFL 5CHNA 3S36L 1S9VA 3L5JA 4KJQD 4L5FL 4Y7MA 1UKSA 3PHQB 1EAJA 2DN7A 1BVLA 4XB7A 1RFDH 5L0QB 2IFGA 4MJID 3CU7A 3P77A 3ROLB 3GIVA 5EZIH 3N85L 5I30L 5FO8B 3CDCA 4JRXB 3U4BH 1J05B 4EVNB 5I15L 5J6GA 4PLJC 4S0TD 4YEFA 12E8L 1V7ML 4H5SB 4IRJB 3PP4L 4U1HB 5DEZA 5SX4H 5E6IB 4LFHG 2C9AA 2IH3A 2DS4A 1YY8A 4R4FH 2EH8L 5IW1B 5CGMA 3JVGA 4XP1L 2X41A 4NRYA 4NQDD 2A6JA 1R3HA 5IFJB 2ESVE 3RPKA 4NCC1 3KVQA 5ACLA 4TPRH 4HWUA 4P46B 2YZ8A 4G6JH 1NDGB 1J1XL 1F90L 3QNZB 3UC0L 2RGSA 2PN5A 3F5WA 5D7LE 1BAFL 1P4IH 3L5XH 3KJ4B 1WF5A 3R06A 3MRMB 2P5EB 4RGNE 1IQWH 5JHDA 3O2WH 1GHFL 2W07A 1BFSA 3HUJF 5DJ2A 3KJ6H 3D18A 3ELAT 2KQNA 3OWEA 1NGYA 3QFJB 2C1OA 2ORBH 3U1SH 1NUNB 3KNBA 2H2PD 4ISVA 4PLKD 4QHLB 4XC3H 1U6AH 3FT3B 5FA3B 1AD0A 1J10A 4DGYH 5KSBB 1KUMA 3ARFB 1KIPB 1HYSD 3ILPA 4OSUL 1KYOK 5CINL 4U0QB 3IXAA 4G6MH 4U3CA 3WNNA 3O3EB 4MD5B 3CXDL 4YXKH 1NCUA 1OQOA 4TSCH 4Y5YC 4YHIA 4F7MB 5J1SC 4JM4H 4TULL 4Y88A 3IGAB 2E7CA 4MXWH 5CJXC 1R3LB 3CD4A 4HC1A 1C16A 5IVXA 4C4KO 2XI9A 1CFBA 1KC5L 2W0LA 3BN3B 3P9MB 1DR9A 1P7QA 1A9BA 4LPWA 4H1LG 4WI2A 2PW1A 1N7MH 5C09E 1P6FA 4V1DD 5IM7B 1QLRB 4X4XB 4U1JA 1S5HA 4NJ9L 3ALPA 4LRNH 2R2BB 5TPWL 4WWKD 1F4YL 3NFNA 4AT6A 1DBAL 2XFXA 2BVOA 2VDNH 4Q9RH 4Q74A 2AJ3A 4U6XB 2CIIA 2XWTB 1A4JB 5CIPH 2C4XA 5LJYH 4C57C 2GJJA 4IOIB 2ZG3A 4G6AD 1MIMH 3QHFL 4AQOA 4YHYB 3QDJA 4QXGH 3D39A 3RDTC 3EFFA 1S9VB 3VFVA 4UNVA 3QFDB 4HXAL 2LFGA 5CEXA 5C08D 3B9AA 1AIFB 2YPLB 2PO6A 3D87B 3HHRB 3WNMA 4XCNA 4Z7VF 2QTEA 4MHHG 2Y06H 3KS0H 2K1MA 1Z3GL 5FF6A 4BYHA 1PEZA 5DHYB 4J4PD 5HHQB 4LF3B 4HFWB 5J89A 2V7HA 5CZVL 1T7VA 2EDBA 1UWEL 4MDIA 3DPBA 5J6GB 3L6FA 3PWPA 2HG5A 3QUMB 4P3DA 3KHOA 3MGTB 2IQAB 4Y5XB 3QULB 3OJVC 2CDFA 3L3DB 4P5MA 2IH3B 1ND0B 5DRWA 1KB9K 1KPUB 2VZ1A 1LK3H 4LQ1A 2R0KH 4RISH 3D3VE 2EC9U 1NL0H 1IARB 1R3HB 2IWGA 5E4EC 5TFSH 4JPVL 3EJZC 2O61B 5GS1B 2FGWL 3BKJL 2ZUQC 3ULVD 3GDBA 1GIGH 4GW4B 4KDVA 4I4WB 5DZLA 4OJFL 5FKPA 2DQTH 1KLGB 4NRZB 4OCRH 5DURD 5GGQH 1IAKA 1I7RA 5D2NB 1N6QL 1D5IH 4OLYL 2FB4L 3RY5A 4OV5B 4B7LA 1CD1B 4LVOB 4ODHH 4Y2DC 4JFHD 3R06B 4YHLH 2E9BA 5I8OH 5AZ2L 3K1KC 2MHAB 3GMRA 4BQ9A 4KZEH 1Q0XL 3QNXA 5E2WH 4BZYA 1YPZB 5DQ9A 2ICEA 1P84K 3C9NB 2DQGH 5EO1A 2ZOKA 2AXJA 2C1OB 3VXMD 1IC7L 4ISVB 2B5IB 4ZS7H 1HIML 1W72A 2VZVA 4LCCB 1GSMA 2JJVA 4NZUH 5CWSA 4WFGE 1AD0B 3UO1H 2LV4A 4WI8A 2QSCL 2R9HC 3ILPB 3L3JB 2VUOA 3BKYL 3IXAB 5F7FA 3H9HB 4Z77A 4ZUUA 4S10A 3RWEA 5EU6D 3F65A 4I2XA 5D1XD 1YJDL 2AEQH 3ZYZA 5CEYA 5JXAH 4KUCF 1LO0L 1Y18B 1G6RB 3ZDXF 3CUPB 4U0RB 1V05A 3MXWH 4NO2A 4WI3A 5C0EA 1L7TL 2DQIL 3EOBB 1E4WH 2ZSWA 2DQUH 3OXSA 1C16B 1KEML 3VCLA 1IGYB 5KBNC 3QAZC 4LHUA 3VD9A 1SYVB 3LDBB 3CH1B 3UAJD 2YC1B 1P7QB 5EOCJ 4HMDA 3G6JE 2VO5A 4Y4FA 4YGAB 1JJUA 4UIMA 5E08H 3H2WA 2VIRB 4XPFL 2V5TA 1R24A 1NMCC 3SDCA 4U1JB 3OSKA 3WD5L 1VHPA 2EDYA 2W65B 3PNWB 5D70L 3H0TA 2XFXB 3VRLF 3HNTL 4PGBB 2F5BL 1OSZA 2AJ3B 5DYOB 4O02H 4LLVA 5J57B 3LN4A 4PJCA 1I7ZA 3DO3A 2VR5A 3PG2A 5IOPA 5B8CB 5LAXB 4MJIB 3AREA 3QDJB 1T03H 3D39B 5I17B 3BOVA 4MLSA 4RFNB 1I9IH 3RL1B 5SWSA 3S4SB 3S98A 1G7JA 4JDVB 2VZSA 2VDLH 4RFEA 1CL7L 3QWRA 4UOJA 5FF6B 1FYHB 3RNQA 1TPXC 5IQ9B 4G42A 5D2LF 4FXKA 3BP7A 3I85A 2AK1L 2HVKB 4G3YL 1MFAH 3IU4L 2UZIH 4MB4A 1FH5L 1KV3A 2DMCA 3I6KB 2CDEA 4XNZB 2VDRL 5GS2H 4FFZH 4ZSOA 4D0BA 2ZP0T 5EN2A 4NQSA 4C83A 1I9JL 1KJVA 2GKIA 3CFCH 1CK0L 2P43B 1H3GA 2DYPD 2G9HA 4N0YH 2XKNA 1YNLH 4YC2B 4PD4K 4G8GD 4QEGA 2HKFL 2VR9A 1KB5A 1MCJA 2IAMC 3OJDA 1QRND 5I73C 1BFOA 2JIXA 4JZNA 2L0DA 5IR1A 1H0DA 4PRPA 3TWCL 4CRPA 3VFGH 3P73A 3QYCA 4YHMH 4K7FB 2HTLC 1X4XA 5FKPB 3NPSB 3UBXA 4IIQA 4GUPB 1S5IL 3NIFE 3U46A 1I7RB 4QHNA 5DMIH 4UTAH 4QCIA 3DRTB 1SBBA 4K7PY 4FQ2L 1U8OA 3WIHH 2X10A 3T0DA 3HC3L 4TOYH 3QZWA 3N9GL 1E6JL 1DFBL 3GMRB 5DMYA 2VDPL 3C8KA 3QNXB 3DWTA 5IG7B 1BQLL 1F13A 3PGFH 3D9AL 5EO1B 2ZOKB 2ZG1A 1NEZB 4UTBL 4ZFZB 1MNUH 1T04B 5CWSB 3IJSB 3IFPB 5I8CB 1AGEB 2J8OA 1OP9A 5DFTA 1JTPA 1HCFX 4HK0B 4KHXH 5I19L 1J0JA 1ZV5A 4P2OC 4PRDA 1BD2D 2FJHB 3BH8A 2QQNH 5T1KD 5GSVA 4Z77B 1M71B 4NNPL 4ZUUB 2FR4B 1EO5A 4BK4A 4DOHB 2IFFH 3ARVA 3LV3A 5LGHL 5MERB 3PUCA 5C1MB 4JHAH 3LKPA 4MMXC 2X89A 1A6VH 1IJ9A 3QXAA 3WFDL 2DQDL 5EG6C 3AB0C 3MNWA 4U1KA 1K2DB 5C0EB 3ECBA 4NKQB 4V1DB 3BQUD 1NH6A 3O41A 3OV6A 3ZT7A 3QIBA 3VXTB 2XQYG 1CF8H 3IKCA 1UJ3C 3U6RA 1UKTA 3R8BB 5IHZA 1MPAH 3C5SB 4R26H 2FL5A 5J0BA 1NGXA 3IAGC 3UJIH 4PJEB 4N9OB 4JGUA 3UDWA 4LLWB 2YXFA 1G9EA 2JJUA 2DJ4A 4NWUL 3I75B 5HY9B 3CDGA 3JWOC 3RAJH 4LEXH 3LPWA 5JOPD 3AFLA 4U4BA 3WXWL 2SEBB 2A6DA 3TGXA 4PJFF 4R4NC 3ZHKA 5C08B 1JI2A 4C56D 4P59H 4XX1E 3SDDD 3LN4B 2UVEA 5IOPB 4F15B 4XNXL 4NNYB 1M7DA 1WAAE 4TVPE 1MQKH 5ABDE 2XWBB 2F15A 3QBTB 1QHOA 3EYSH 3OX8B 2VLLA 4KDTA 2BCKA 3TN0A 1QFWI 4OZIE 3HPLB 5SWZE 3V2AR 5HDOA 3U7WL 5FGCE 4PJHA 4HCRH 1TTFA 5EO9B 1HKLL 4HUVA 2PYFA 1QR4A 1TJHL 4YJZL 1FG2A 1ZANL 3NCCB 2L4OA 1Z9MA 2JJSC 1JGEB 3SQOH 4RAUB 1MCEA 5IHUH 4KMLB 2CDEB 2YPVH 2VDKH 4KTEH 4NBYB 4EI5C 5FYJH 2OR9H 3WFEH 5F9JA 2V5SA 1Q94A 4NQSB 1WZMA 3KG5A 5HHVH 4IRSD 2Y5TB 2IQ9L 1TCMA 5JQ6H 5DURB 1OP3H 4WTXA 5D7SH 3ALXA 5GRYA 4R2GC 1MFEL 4YGVA 3EYOA 2QKIB 4X9GA 5JZ7C 3FB8A 5IB4B 3UYPA 3VD7A 1ZVSA 3JXAA 3FO9A 1X5ZA 2D7NA 5KJRH 3UBXB 4RZCA 2QJDA 2MFNA 2Y6SD 4MZ3A 5DLML 4I48A 3LZFL 1FFOB 4MJ5A 4M9PA 1B3JA 2I07B 1U95A 4ERSL 3VXMB 4MAYD 3SE3A 4EN3A 4N8PA 1ETZA 4GRLA 3QZWB 5CJ8A 2XQYK 5DI8B 5IT2H 3FTGA 3C8KB 2XN9E 1FL5A 1IRAY 5IW6B 3CFEA 1KXQE 1KJMB 5I1KH 3SKNA 1TQCB 4M7ZC 3QUKA 5EU6B 3MNVB 2J5LC 2BHYA 1P5UA 1G7IB 3TIEB 5C0GB 4DFIA 2DRUA 1OAQH 4ZFGH 4C58B 4J8RB 2VTFA 2O5YL 3RI5F 4MA7L 5D5MF 2DKSA 3NOIA 4YX2H 1A14H 5B3NA 4UIKL 3HUJE 4TSBH 3G5XB 3LKPB 5C0BE 4P57B 1JWUA 5DD0H 3ULSA 3L3OA 1CLOH 3ECBB 4QLRA 4OIAA 3QEUA 4RMRA 3CZJA 4PGCB 3S9DB 3TZVC 4JAMB 3K4AA 1QBMH 2CK2A 3GMPA 1MJJA 5I75B 4O00A 4MNGA 1NGXB 1F4HA 1QSVA 1TITA 3SO3C 1VB9A 5GQBA 5D7JC 2YA2A 3ZTJH 3CDGB 1D9KC 4KKCC 3I02A 2BOCA 1TZGH 1AQKH 2WANA 4R3SB 4QRTA 1J1OH 5DVNA 3AROA 1NBZA 2E6QA 2AI0H 5CILL 2VXTL 2H8PB 1LDSA 3BP5A 3UZQA 5L2KD 4H25A 2OS7A 4P23A 5EZLA 4PB0L 4LSTH 3OKLA 3RTQA 4PJ5A 4AL8H 4N8VG 3KLAA 4YDKL 2HT2C 2BFVL 5BZWA 4OCXL 4EUPH 3DIFA 2GTZA 3E8UL 4NKOA 2H45A 2BCKB 1OTTC 4KAQH 3U48A 2EO9A 1SJVA 3CZFB 2APFA 5LG1A 4PJHB 4NWTL 2VMFA 1PSKL 3OKKA 1BZ7A 3KYNB 3NZHH 1F45A 3TO2A 2Y23A 3TA3D 3RX7A 2DYPB 1MI5D 3O6FD 4U6HB 1KCSL 3LB6D 1MLBA 1QKZH 1ZLVH 4WHTA 3JTSA 3HI6L 3O4OC 5CMAB 4XZUA 2BNRA 4LIQE 4XCCL 4AG4L 3AU1A 4JB9H 1Q94B 3STZB 1OAKL 1I1AD 2BOBB 4NN5C 3MV8E 5TE7L 1MQ8A 2GFBA 3LIZL 4PGDB 4Z7VE 3T0AA 3FMGL 4ORZC 3E6HA 2HJKA 1UVQA 1JNLH 3TPUB 1AY1H 3WUWA 3RI5K 3EYOB 1HSAB 4KI1A 2BDNH 4JKKA 5E5UB 3FB8B 1J0IA 1TZIA 1ZSDA 5JXEC 4LASL 5I1EH 3RWCA 4Y1AE 2AVGA 4AM0A 3FO9B 3M1BA 4TTDD 3PWNB 3M8OL 4OZHF 2EC9T 3GSNA 1M6OB 4L4TA 5HGAA 5DK0A 4XCFH 3QG7L 4JVWA 1L0YA 2VNCA 4AH2B 3MX0A 2WAHA 1N4XL 4NQXA 5DRXA 1QSZA 4WU5A 1T5WA 3FTGB 1V8HA 3ZLQC 1FL5B 4LRIC 4NN6C 4YDLB 4JZOB 2DKUA 2ZKHH 1JV5A 1BD2B 3KS0J 4KVCH 3V5KB 5HVGB 5T1DL 2W92A 3QUKB 3V52H 4PRID 4KRMB 4M4PA 1DANT 3QDME 5INCA 4M03A 1CQKA 3GJFK 4M48H 1LO2H 4FXGB 4I18A 5JW5A 4I13B 4KJWD 3L9RB 4J3UA 5HYJE 4NC2B 3PL6C 3BQUB 4WENB 4XB8A 3HC0A 3LQAC 3ARDD 2AV1B 5F3BA 5BOZG 3LS4L 2CUMA 5DJCA 2EIZB 3VFPA 5MP6H 3ULSB 1QFWH 5FM5O 3MV01 4JZJB 4HHAA 4FZEH 4ZUSA 3T4YA 4M62H 1EFXD 4FRWA 4AENB 5BRZA 5KZCD 3S34H 3OGCB 3QH3A 4DVRL 2FECL 5I18H 2QQLH 4YDVA 1N6VA 1DDHA 4ZO6A 4C56B 3QRFM 4YBLB 3SDDB 2P49B 3LKNA 5HGHB 4MYWB 2NW2B 4ZO7A 4NZRH 3ZDXE 3I02B 3DMMD 2YUVA 4OB5L 2HRPL 4NQCA 5I8EB 2DWDA 4IDJL 1J8HE 1FYTA 4HKXB 5EOTB 4P23B 5EZLB 2Q20A 5AZEL 1I7TA 5D72H 5GSRB 4G8FA 4PJ5B 2AGJH 3KLAB 4M7LT 4UQ2A 3GB7A 1XF3A 2W0FA 3X13A 5BZWB 5HYSB 5ICYA 4BM7A 1BLNA 3BP4B 3MV9D 3PQYD 3EHBD 4OZFA 4M8QB 5HHOA 3T0BA 4PJDF 4NC0B 3ARBA 3VRLE 2XA8L 1RJZA 1MCDA 3PGDB 2HAZA 4JM2B 1K4DA 1NC4D 5J9PA 4ZUTB 2GHWB 3CLFL 4DZ8A 3E3QE 3U0TB 5D7IF 4IRSB 4WHTB 1UXSA 1A64A 2R15A 3GM8A 3VFUB 4JFFE 3VFTA 5LQBH 2APXA 1CGUA 3HG1D 4H20L 5DFVC 5C3LD 3AU1B 3FRPA 4M7KL 1L7IL 1OY3B 5EC2A 5F1IB 2BSED 3FZUC 4UNUA 4A2LA 1AHWA 1WBZA 4POZD 3EUUA 4OD2B 3VGGA 1QFHA 2XTLA 4Z78B 1L0XA 1HHGA 5A2KH 3EJYD 4X5XA 5D2LE 4NNXB 3TBVA 1ZS8A 1ZA6A 1QLEH 3REVA 2J88L 3RZCD 3RKPA 1AQDA 4GRWH 3RWCB 3M1BB 3H9ZA 4MJ6B 4M7JH 4FQXD 2D7PA 3GSNB 1Q1JH 4F9LA 1YMMA 4L8DB 1ZGLM 5DK0B 3BW9B 4OBSA 2EH7L 5EUOB 2AEPL 2NY6C 2V2XA 3PIQB 4GXUM 3EDDA 2MCG1 5C0AD 3MUGA 4BZ2H 5EBGA 2UUDK 3O0RH 1DEDA 4Q9QH 1IFHL 2HT4C 1QQDA 1EHAA 2BY3A 4WV1A 5L8JB 4XCEA 3HZMA 4P9HH 4PJGE 3MO1B 4V2CB 4HIEB 4APQA 2PYEE 3D2UA 1T2JA 1XH3B 2VXVH 3VWJA 4PJ9D 3TVMC 1GGTA 3DSNA 4ORGA 5BV7H 4I18B 5FYKH 1WEJL 4DKEL 1RZJC 1S7XB 4P4KC 4CUCA 5C7XL 1QFUL 2H41A 3RKDD 2L7UA 1E4XL 2NY4B 5AUMB 2IAND 2AQ2A 5F3BB 1OB1A 1CIUA 5DJCB 1U8PA 4EOWL 2PCPB 3VFPB 1A1MB 3GI9H 1QSEA 1U8JB 3FONB 2EECA 3G5VB 1VCAA 1MFBH 3PDDA 4WFHE 4MAUH 5E95B 3MLZH 4W81A 4KQ3L 5GZOC 5K59F 3V7MA 4OGAD 4PUBH 1X7QB 4LQFH 4HUUB 3IKKA 1HCVA 4HJJL 3OBAA 4LVHB 2O5ZL 2EIBA 1DL7H 5DO2C 2G60H 5JW3H 3UJTL 1I1YA 2AJSH 5BXFB 2YD9A 2ZPKL 4ZUWB 2Y07L 4PJ7A 3ARWA 4R4BA 5D1QD 5T3XD 2OL3B 3S6CA 2AV7B 4WTZG 1T7XA 4AZ8A 5IEHB 1F97A 1FYTB 2MJWA 4M6AA 4POYA 3HRZA 4PJAF 2WNGA 5ISZE 1FL6A 3MGOA 1CFNA 2DQHH 1A9EA 2H6PB 5EOQH 3DYMA 4JR9L 4UQ2B 3GB7B 1BHGA 3V9FA 1MI5B 3O6FB 3S97C 3C60A 3LHPL 4OZFB 5IB1A 2ZJSH 3ARBB 4PRHA 4UDUB 3IJYA 3T0XA 2F54A 5AD0A 1GOFA 4LGRB 1I1AB 5F1OB 1U3HD 4R97B 1KTKE 3SDAA 3C09C 5HHMD 5ALBH 4Z7WF 5I1AB 1A3QA 2YUZA 1KT2B 2X44D 3GI8H 4JFXB 2FEDC 1HYRC 5J11C 1Q72L 5GIRB 1LP9F 3RIAF 1BZ9A 5JHLL 3T65A 3QHZL 4ZOCA 4JPKL 3VFTB 3QDGD 3ARXA 5F96H 2IPTL 1IMHC 4XBPB 4LHJB 3DROA 5TGBA 2I24N 2ADIB 1T0NA 5E8EB 2W9EL 2NY5H 2NY7L 3MRRA 1ZK9A 2P8LA 3N0PB 5CBEA 1N3NA 3MGAA 5E5MB 3Q5YA 4N90D 2DMBA 2A73A 3DV4B 3O3DA 3VH8A 4OLUL 3REVB 1JWSA 2ZG2A 1DSFL 5EZJB 1B4JH 2ZCKL 3JV6A 3Q6FA 1QA9A 9CGTA 3OB0K 3EBAA 4FFVD 3BPLB 5KOMC 2ZWLT 3SE8L 5CEZE 4KHTH 3NZ8A 4OQ1A 3M17B 4BQ8A 4YR6A 4K94H 2BNUB 1PEWA 2V2XB 5F7MC 1XGUA 5ERWB 4LOUC 4XPHL 4G7YL 4CADB 2OTUB 3W11D 3QO0A 5JORB 2R2HB 1RMFL 2FO4B 2DBLL 3HNSL 3SDYH 4APQB 3BI9X 4K3JL 4UDTA 3AAZA 2XNAB 3D2UB 4YHNA 5EIIA 3W9EA 2NW3B 4XPAL 3WIHA 4QWWD 2FSEB 3K8MA 4CVXA 3CFDB 1HZHL 4OD1H 4ORGB 4NRXA 3U7AA 4FG6C 2X4NB 3QIUA 4UB0L 3OR7A 4ZTPL 1L9MA 1YN7A 1BF8A 3GUTB 4G9FA 5FDWB 5D9SA 1Q9WA 5KSUA 1RZFL 3DVNB 1U8IA 1EFXB 2VYRE 3LEYH 5I1JL 1U8PB 3X14A 2WM0A 4YUEL 3DLQR 3TBWB 4NQUA 4I9WE 3HTLX 4F57H 4Y16A 4JY4B 5F7YC 4P99A 1NUFA 5HDQH 5D5ME 5LBSH 1DLFH 1XCTA 3S36H 3WE6A 3RIAK 3BPOB 1KOAA 1LEIA 4L5FH 1FIGL 1I1YB 2EDHA 5CS7A 5B3JE 1RAMA 1OM3L 3FOMB 1RJYA 4PJ7B 4MMZC 4R4BB 4Z7UB 3O6LH 4KKLD 4L9LB 4X6EB 4PPTA 1TJGL 4FQLL 2ADGA 4X6CA 5I1IH 3E6FB 5DD3H 3MV9B 5ILTL 4Y4KC 3UTQA 4TUJB 3N85H 5I74C 3GMOA 2CDGB 3MGOB 4HKBA 4ETQA 1A9EB 1KBGL 4NBXB 5I15H 5DJXA 2VERN 1ZLUH 12E8H 1V7MH 2IF7A 2Z0BA 5TDNB 3PP4H 4HXBL 2JCCB 2YR3A 4NKMB 4XP9L 1JYWA 4HUXA 4L9DA 3G5YA 4KROD 5IVXF 5FUCC 5F7EL 4XP1H 3QQ9D 2FATL 1CWVA 3SDAB 3FB6A 2R23A 3RHWF 4QRSA 4CNIA 2C4FU 3EO1B 3QUYA 5HGDA 4AY0A 1SEBA 2GW5A 3T65B 3WJLC 1BVZA 2GY7B 2X6MA 1JHTA 4ZPVA 1F90H 3UC0H 1AXTL 4P2QA 4JVUA 3RZCB 1FG9C 5TGBB 4JKWA 1R0AH 2BC4B 1X5JA 1ZT1A 1BAFH 4HCRA 5K9OA 3AS1A 4HLZG 1CL7I 1RUKL 4FQXB 3X11A 1N3NB 4MD0A 3SCMA 2ESVD 3VGAB 1GHFH 5SV4A 5H2BA 2YMXL 3ZZ1A 3QIWD 4MZ2A 1YYML 1GOGA 3JV6B 1RZKL 2FHCA 1QA9B 5C0AB 3MZTA 4HKJA 1WIUA 3BGMA 4GBXA 4ZD3L 5DQJB 1MCHA 5FB8B 2J2ZA 5MENE 5D7LD 4D0CB 3UPAA 5KSAA 4OGYL 2N56A 4MS8C 1UM6L 5DJDA 3S5LA 5CINH 1XGUB 5FUCE 3E1F1 3V4VL 4OM0L 5HI5C 5D1ZC 4QF1A 3CXDH 4Z7QF 4ZFOA 1IL1B 4TULH 2LTQC 1XR9B 4PLJD 2IANB 4NRXB 3RJQB 4GMTL 3DGGA 2Z31C 3IRPX 3LKSB 4GXVL 1A22B 3IAPA 1B0WA 5IFHL 4WFFE 5JDSB 5E2VL 1KC5H 4RWHA 1WBYA 3WFHA 4DGVL 1PYWB 5DVKA 3ES6A 3R8QA 4MQSB 4YPGA 4X7CC 2VXUL 3SGDI 3B6SB 1MCWW 4WGWB 4NJ9H 5TPWH 4W6XB 4X8XA 3I3EA 1F4YH 1K3ZA 3O3AB 1DBAH 2DMKA 4C59B 2F53E 4ZXBA 7FABL 3JV4A 5CZKA 5EC1A 3AUVA 1SYSB 2NXYC 4P5TA 1I3GH 1N2RB 5IHBA 1T7YA 3RHWK 5D1QB 5EU3B 1IAMA 3VG0L 2YS4A 4PG9B 4P2RA 4JPWL 4HLJA 2MQ3A 1G9NL 4PJIE 4HXAH 4LSDA 3STBA 1LEIB 3WUZA 3DX6A 2YKLL 3A67L 1RJYB 4BSWA 3T2OA 2HFFA 1Z3GH 2ADGB 1IEBA 3CC5B 2I27N 3JWDL 2P5WE 5CZVH 3G5ZA 2W60A 4MA8L 5C0CB 3GMOB 4EQ2A 3D85D 1UWEH 1VEPA 1IGIH 4HKBB 1FVDA 4RFOH 4ETQB 4HUKB 1I7UB 2F74B 1U3HB 3V4PL 1MCIA 4F9PA 4HEME 3MLRH 4LHUG 3ZT6A 1NFDB 4NDMA 1L6XA 1JF1A 4G6FD 3ZHLA 2ZNXA 2FZ3A 3FB6B 1IQDA 4GG8B 1CICA 2VAAA 4JPVH 3QUYB 2P8PB 2OXGA 1EPFA 2DLGA 3BKJH 2P24A 4EUPA 1C8PA 4OJFH 3CU1A 1SQ2N 1HXYA 2F5AL 1JHTB 1OWRM 1I1FA 3P0VL 1N6QH 3BP6B 1INDL 1NFIA 4OLYH 2VXQH 4PJDE 1OW0A 3F6IA 1KN4L 3DGCR 4PJCF 1M7IB 3K2MC 4JFEE 3TBSB 2ICWA 3X11B 3D3VD 2KKQA 5AZ2H 1T89A 2B1AL 3WEXA 5H2BB 1HH9A 1Q0XH 5EUKA 4X99A 3SE4A 4M5ZH 2NQCA 1TETL 2Z35B 1IE5A 3CNKA 3UTZB 2YSSB 3RDTD 1CXIA 5I0ZA 1HIMH 3GK8L 4D94A 3IXTA 1G7HA 2A9NL 1E6OL 4QTHA 3S5LB 5J13B 4FOMA 2CKBB 3NPZB 3BKYH 2IALB 4NKDA 4Z76B 3QUXA 1Z0NA 3O11A 4X7EC 4F8TA 2E7LC 1YJDH 2GITA 4G80A 4QF1B 4LDOB 3KJ4C 1LO0H 4ZFOB 2HFGL 4ELKB 5IMMA 5T5NG 3MA7B 3PJSA 3V79C 1NPUA 1QSFA 1T6VN 2DQIH 1NKRA 5T3ZL 1TXKA 4WFGD 3INUL 1UWGL 1KEMH 3DGGB 2VSCA 5ADOL 2PW2A 2NPLX 3HE6A 4WI4A 3UBXG 1U36A 4XPFH 3VXNB 4UAOC 2BY1A 1ES0B 1XF2B 2AXGA 3WD5H 3EJZD 1YUHA 3HB3D 4A6YL 1IM3A 3T2PA 5D70H 3QZWG 5C09A 4X6DB 4JCMA 4L8BA 3HNTH 3D69B 5CLTA 2F5BH 4E42A 4L4VE 5EC1B 3KPQA 1VACA 3QG6B 3G04A 1EFQA 3NACH 3DXAE 4LGSB 5JDJA 4Y2DD 5I1LB 1R5WB 4YWGL 3MLUH 3TO4C 1F4WL 1DEEB 1A7PL 5J1AA 3RZWA 3EGSA 1JN6A 4OZ4B 3MJ6A 3GZKA 3P30L 5LGJA 3B2VL 5MEQA 4N9GA 3H7BA 5EOCL 3MROA 1CL7H 4LAQL 1IEBB 1RHHB 3WSQL 5IV2A 4O2CA 2AXFB 5IWLA 1GVIA 2CMRH 3G5ZB 5F9DC 2X4PB 5K59E 2AK1H 4KROB 5BQ7A 1NCNA 2PTTB 4G3YH 3IU4H 3RVUD 2C3XA 3RRQA 1HOCA 5DJ6A 1FH5H 2R9HD 3QFJE 4ALAL 4NPYA 2VDRH 4KKAC 3MRGB 4CVZB 1X5IA 1A1OA 3K3QA 1A6TB 1Z6JT 4JCLA 4G5ZL 4UZGA 1I9JH 2MPAL 4LMQI 1CK0H 4UUJA 3EO0B 5I1DA 3WLWC 4E41E 1GXEA 4YBHA 3RY6A 3T0EE 2VDQH 4R0LA 2VLRE 3QISA 2FZ3B 5E99L 2HKFH 4M1DL 3CH8A 3PP3K 4P9ML 3ZKNC 3CXHJ 4PJAE 1JBJA 2WW8A 1A7RL 1T80A 3O4LE 3O9WA 1NJ9A 3TWCH 3U4EA 3RPIA 3UPRA 3C08H 3ULUL 3OKNA 3BWUC 1I3RB 1HXYB 2APWA 2ESVB 1S5IH 5CBAA 3GNMH 5C86A 2BJML 4U1GC 1FAIL 1UACL 2JJWA 4FQ2H 1VGKB 2DQFA 5FECB 3MNZA 2ICWB 5TE4L 4Z7WE 3N9GH 1E6JH 3WFCL 1DFBH 4BELD 3WEXB 5D7LB 4L8SA 5GISL 4JO1L 2OTWA 3SGDH 2DBJA 3H9SE 1BQLH 3JVGC 4CU6A 4RGNB 2R8SH 3D9AH 1MIEL 4U1NA 4XP6L 1HNGA 1JPGB 4DUWA 1H15A 4UTBH 3C5ZA 4PP1C 1Q0YL 3CLEL 3JTTA 5IROA 4EXPX 3QPQC 2ZSVB 2NLJA 4WW2F 3VXOB 4QTHB 5I19H 4Z0BL 4NNPH 3BT2L 4NKDB 5KANI 4FFYL 1GH7A 3QXVA 5LGHH 1JZ7A 3C87A 4LKCB 1WQVT 4HDIB 1I75A 4LVOC 5T3XH 4JJ5A 3MR9A 1F02I 5DUBB 5IMMB 3WFDH 2DQDH 1JVKA 3MMEA 4FQJL 2X9YA 4Z5RA 3SDXF 5CGYC 3QXWA 3TBTB 1SMOA 4RMWA 4L3CB 3GSRA 3DX8B 2ED8A 4HIIB 3MJ8A 3KYKH 2AERT 2IAMD 3MRPB 3GRWL 4NWUH 3BPCA 1JMZA 4HULB 1IM3B 5C09B 3WXWH 1S78C 4L8BB 1NAMB 3CGTA 3KYOA 3ME0A 1ZAGA 5B39A 4E42B 3PWJA 2HTLD 3SKMA 4DVBB 3BVNA 2RB8A 3U7YL 3BZ4A 4U1IA 4WNQA 1RZJL 4PJBA 2VLMD 4XNXH 2K3TA 4MA3B 5GJSL 2MQCA 3CSPA 4G43B 2EKSB 1DBJL 1OP5K 2A77L 4LSSL 1GAFL 1H3PL 1OAXL 4D8PB 5BS0D 3D85B 4K7PL 4R6UA 2YK1L 4WIQA 3V8OA 3BHBB 5MEQB 1YDPB 3H7BB 3MROB 2GQHA 3LMJL 5IV2B 4O2CB 5C2BL 4KI5F 2AKRA 3K1DA 1BM3L 5DTFA 4ZOAA 5JHDE 1BBJA 1QTYT 1ZA3B 4NFBA 1TNNA 1TJHH 4QRQB 2FECI 4Y5YB 4G6FB 1HOCB 5DJ6B 1R5IA 5JNYA 4P2OD 4RDQF 4YHZL 4TVPD 5EB9A 4LKXB 1HILA 4J2XA 2A83A 3IS0X 2BVQA 1J0YA 1MCRA 3HZYB 5I1GL 4ZO9A 4Q6IA 4QTIL 1ZVYA 2Q8BL 4XAKE 5SWZD 2FJFB 1I8MB 1ROWA 2IQ9H 3WHE1 1NC2D 4XP4L 3KPOA 4MB5A 4RFNC 2PO6C 4OTXL 1MFEH 3O9WB 2EEBA 4JEGB 1NJ9B 4M61B 3LEXA 1U8HA 4X7FC 3WNLA 4G7VL 3D3VB 4HWEH 3FN0L 2H3NA 5C8JA 3BO8A 4NHUA 1ZLWH 5CBAB 2FIKB 2NTFA 1IAIM 5DLMH 4HWNA 3LZFH 1ZHLB 3IDIA 5IVXE 5HYEA 3LAFA 1IC5L 1JZ5A 1KNOA 3MFGB 4ERSH 3MNZB 1GYAA 3RDTB 4XPGL 2R0ZL 3PE9A 2FX7L 4R4ND 4LCWE 2OTWB 1W0WA 3UYOD 5ADPL 4YC2C 3TT3L 5T1KA 1YMHA 2CGRL 1EDQA 5T33L 4I0CC 2OSLA 2VXSH 3K46A 3F7RA 1PX3A 5E1AA 5EZOL 4LFHD 4YO0A 4X4ZA 5JW4M 1OT2A 2DLFL 2VB5A 5FFLA 2O5YH 4KMTL 4HUNB 4PRBB 3RWFB 1YEGL 4MA7H 5TDOA 2X4SA 2XN9D 1FFRA 4NN7C 4UIKH 3VXUD 2GSGA 1T4KB 3MRKA 2GJ6D 1W8OA 4CMMA 4NZTL 1FRGL 3TC9A 5AWNH 1SMAA 2VLKD 1WCBA 3WUWG 1U8KA 3RWJA 1XF1A 4YLQT 4NUJA 5FGRA 4EI5D 1ZWIB 5DF0A 2H1PL 4K07A 5E4EB 3MBEA 4G8EB 4PG2A 2ZUQB 1ZHBB 4YH6A 5AYUL 2CIKB 5HDLA 3PWPE 1ZGLP 3NFPA 5JA8B 1HNFA 5EZIL 5C0BD 1QLFB 1YA5A 5E8PA 4C54A 4R2GD 1MCFA 4HPYH 1Z9SA 4RX4A 3BPCB 4X7TA 4Z7QE 3G6JB 5JZ7D 1U8QA 1FZJB 3SKMB 3RFZC 5CILH 4GRMB 4FQCL 3CCHB 4R4FL 2E7MA 1KACB 3BZ4B 4PB0H 4WNQB 1UZ6E 1S7RA 4HFUL 3GM0A 5HVHC 3O3BA 4YDKH 2BHUA 1BQHB 3KPRA 2BFVH 1E4XI 5DD5H 4OCXH 1BOYA 4TPRL 4U1MA 3E8UH 3LKQB 1NBVL 2E7BA 4TUOB 4Y4FC 5JMOC 4LBEB 4G6JL 1N8ZA 2JTDA 3P4OA 2AKRB 5DRNA 4B5EA 1ADQL 5KS9A 1PSKH 5DTFB 3TV3L 3SDCC 3CMGA 5J6HA 4KPHH 1KCSH 4OZIA 1FVEA 1TNMA 2EE6A 5I1HH 1RK0A 2FGZA 3HI6H 4H8WC 1AP2A 1EK3A 4XCCH 2ITDA 3ET9F 2A83B 4I5BA 2MKWA 2BVQB 3CFKA 2EDJA 3X3FL 4Q2ZB 3EW3B 1SBSL 3AREC 3LIZH 3LN5A 5TJWK 3FMGH 3U1SL 5DGQA 1YZZA 4LCYA 3P4NA 1GGUA 3CDFA 2E9WA 3PWVA 2ATKA 1JCKA 1NMCB 3DOSA 4O2EA 4I2XE 4ESKA 4Q97A 3V6FA 3RP1A 6FABL 4WEMB 3TZVD 1WSST 3QQ4A 5A2FA 4LASH 2P47B 1U8HB 5MEPB 1N0XL 4H26A 2EDTA 3DV6A 5KSVA 3D48R 3MV8D 1UZ8A 3OXRB 5D7JD 1D9KD 3QG7H 4ZQKB 1KNOB 4KKCD 3GHEL 1JPSH 2JE8A 1G6VK 1N4XH 1KTLA 2I9TA 5INDB 4WY7L 2CRIA 4OZFG 3G6AA 3D0LA 5HGBA 3MRLA 1JNHB 1WISA 4PGEA 5A2LH 2HT2D 2R29L 3GSVB 3BDBA 4PJCE 3O2VL 3AY4A 5E1AB 1J0HA 2XWJA 4K9EL 4MCYB 1E28B 1NAMH 1OTTD 2VDNL 2MSPA 4IIQC 3FRPG 2X2YA 5JOFB 3W9DA 3L7EA 3EYVA 1BOGA 4YQXL 1A6PA 5SWSE 3GMLB 1KIRB 3LS4H 1AO7A 3N06B 1WIPA 3RWHA 2LU3A 4ODUA 3HUJA 2IAMB 3RWGB 1BIHA 3HS0A 3OGOE 5EWIL 1PLGL 4YBQC 5FYJU 1K8IA 4MSWB 4DVRH 3MLPA 5HYJD 3LRGA 3NFPB 2ADJA 4ZSOE 1EGJL 1T1WA 2QL1A 4YAQA 1LD9A 3CDYA 5E8PB 1KELL 4XVSL 2E6PA 4M43L 3T1WA 5JXED 4PJXF 1GZPA 4OB5H 1U8QB 2N4IA 2HRPH 3RWIB 1S9WB 1MFCL 4IDJH 4HWZA 5AZEH 1XR8A 1U8MB 3FRUB 5T3ZD 3BIBX 4PRPE 4YK4C 2OJEB 1LK3L 2X4RA 4HH9A 2R0KL 4KXZI 3IT8D 5IGXL 2MQ0A 3WXVL 3QIBC 3FFCA 5DZOA 2HKHH 5FK9A 3S35H 4KUCD 4D9RE 4YFLF 1MJ8L 4F3FA 1Q9OA 4KRNA 3AGVA 1KIQB 4P2OB 3ARQA 1NAKL 2XA8H 3OF6A 3KWWA 3UDWC 5DRNB 1J8HD 1D5IL 1WK0A 4GS7C 4HV8A 5J6HB 4OZIB