3UPAA

A general strategy for the generation of human antibody variable domains with increased aggregation resistance
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYDADDLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPNTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kappa light chain variable domain
publication title General strategy for the generation of human antibody variable domains with increased aggregation resistance
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3upaA00
3BD5A 2AJYL 3G04A 1A7RH 3QNZB 3MBEA 3MRHA 5BV7B 3QQ9C 4ZMAT 3LEVL 3VFVA 4ZAKD 2A6KB 4J3WA 4HIJA 4XP6H 1FL6A 3VW3L 3PHOB 4RFNC 2VTFA 4J1UB 2ZOLA 1LGVA 1XGUB 4JY6A 3LN4B 4NQTA 4MA8L 4WVRA 4UUJA 2A9NL 3BN9C 4ZYKB 2GK0B 4A6YH 3O6MH 5C0CD 4OF0A 2BXYA 4YBLC 1ZANL 2QHRL 3MJ7B 2DQGH 4EI5A 4ENED 5HVWA 1XZ0B 1J8HA 1IGIL 4MB4A 3HS0B 1JNHB 1YC7A 1DCLA 5KTEL 2X9WA 1GOGA 5JQ6L 4R4ND 4KHXH 3CLFH 4G43B 4YHLH 3RAJH 1NH6A 3CNKA 1RUKH 5FYJU 3UCRA 5HYJB 2QEJA 1QBBA 4MD4B 4F9LA 4KJWC 4ZS7H 3MNWB 3L95A 4O02H 3IVKA 1Q1JH 4QNPE 3GIZL 3JVGC 1DBJL 4LVNC 1BIIB 3U6RB 2Y25A 2BVEA 1U8QA 1IBGH 4MDJA 4AIZA 1T0MA 1WFTA 2AW2A 5I15L 1L9MA 1ZS8A 4HGWA 5IV2A 1QA9B 4KKLC 5HDLA 1O7VA 3HPLA 5J6GB 3R1GH 1E4KA 5IK3B 4MNQB 4TVPL 3DRQB 3CX2A 2RFXB 4FQ1H 4M1GH 3O6LH 3MV8E 1ZLVH 4HS6B 5FB8A 3HC4H 5DK2B 1A6VL 1ED3B 3DXAB 2B1HH 2FNBA 4DKFL 4OLXH 5GHWL 3B2VL 4PJEE 4LSTH 1JWMA 1KIRB 4WWKB 3BP4B 5CP7A 4HULB 3ULUE 3G5ZA 1J1PH 4P5TD 4ODUA 3QUMA 3PG2A 1VFAA 4LDLB 1IKNA 3FFCA 1SJEA 4XVTH 3LY6A 5ID0B 2DI7A 4PJHB 4OGZA 1ZVHA 3UTSE 4AT6A 3UTZA 2F19L 2BNQA 4ZPTA 1LEKB 4KHTL 1M7DB 1HWGB 2R23A 3GKZA 3BYTA 1MFAH 3IETA 4WI2A 5ITBH 2AI0L 4GQ9L 2UWEF 2H32B 2R2HA 4KVCL 3BQUD 1VGKB 3FL7A 4JO2L 3X12A 2YEZB 1E6OL 5BV7L 4JDTL 4Z5RB 1AGEB 4HX1A 4LLWB 4U1JB 5IQ7H 2X70B 1JP5A 4JFDE 5EH1A 4OCWL 2VXQL 1KT2A 4Y1AB 3RI5F 3N1QC 5CJXC 4H25B 3EZ8A 5J12C 3T0EC 4AEEA 2OZ4L 4LK4A 4AIXA 3UTTD 2JK5A 3WFEH 2YKLH 4D9LH 4OV5A 2FEEI 4JHAH 3NA9H 4P59L 2DKUA 4Q9CA 3MZTA 1KJ2H 3P9MB 4BH8B 1FZOA 4LQFL 5HYSA 4Y19D 3BRFA 3ECBB 4LHUD 3WJJC 1EO8H 1IAOB 3NOIA 3PWVA 4P2QA 1RD6A 4EQ2A 3THML 3BGAA 4JQVC 5I1LA 1MHPL 1VACB 3PL6D 5DD5L 1HYRC 3HZKA 4XX1E 3LZFL 4PTUB 3ULUC 3U48A 1Q9WA 1QVOA 2QJDA 1B4JH 1NAKL 1UJ3A 4F15B 1I7RA 2HT3D 3OKEA 1P5VA 2OM5A 4N8PA 5KSBA 4LLDA 5FYKL 4HT1H 1FYHB 5CLWA 1EAPB 2XWTB 2HA1A 2BY2A 5T1LA 4K8RH 3RDTD 3MRLA 4NDMB 1DBMH 4WDIB 5DZLA 4WUUE 4ODVL 2FD6L 5IHZB 4YDLB 4XB7A 4XXCA 2ORBH 4LLVB 1S8DB 1KV3A 2NYYD 1CL7L 1JZ5A 3VFPB 4HKBA 4Z7NF 1TMCB 1YN6A 3IAGC 5DEGB 3BKCH 4ZFOL 1FZKA 4PRPD 4N1EA 3SKNA 3O3DA 2OL3A 2RBLA 2EXYC 2NLJB 4KMTL 1MQKL 4MA7L 1J1XL 2APVA 2IGFL 1T1ZB 4ZTOL 4PGDB 3LQZA 4HCRL 2OLDA 4PPTA 2GAZA 3SDAD 1PSKH 3KYNA 5L7XH 4U7SA 4I1NB 3C8KB 4G9FE 4L9LA 1BREA 2Q6WA 4PP1C 3S6CA 1ORSB 3IDIA 4NJ9L 2DTML 3RWDB 1MLCA 3AY4A 2VJXA 5BMFL 4G80B 3QG7H 4HUVB 1EEYB 3LHPL 2NXYB 3EHBC 5H8DA 4D3CH 2E7CA 3LDBC 5SWZD 3SQOH 3BVNA 4O00A 2FYYB 2QSTA 3DETD 1BVLA 4EOWL 4IOFC 3RPKA 4PRBB 4OFKA 5JW4R 3D3VB 3QUXB 2C7UB 5JPMB 4IRSB 3ARGA 4YPJA 1NCWH 1MAJA 3CK0L 5BZDB 4P46D 4YHML 3MR9A 4Y4FB 4J4PA 3BD3A 4PGBB 5L6YH 1JRHH 5TF0A 1FO0A 5C7XH 1RZ8A 4ZPVA 2J8UA 3I3BA 2RAMA 2HFFA 5L2JB 2A1WL 3S88L 5GGUA 4B5EA 1LE9A 2PTTA 1MIMH 1P6AB 3W0WD 3GMRB 1P4LB 1FG2A 2RCSH 3C9NB 2BNRD 1PKQE 2W07A 5ERWA 4QHUB 3VFOA 4KUCD 2V7HB 3MNZB 4U31A 5F8QC 1B88A 2JE8A 3RTQC 1NLBH 3D39D 3FB7A 5B4MD 4NRYB 4MQ7B 5FHAL 3QCTH 2VISB 4W6WB 4ETQA 4Z7WF 5EZLB 3WIIL 5B8CA 4MJIB 2CDFA 4YDVA 3ES6A 3G9AB 3KVQA 4YX2H 1KPRB 3V6FA 4QXGL 5DD1H 5FYJL 5D2LA 3LKPA 1CXIA 1C12A 2ZSWB 5FUOL 1BJ8A 1KEGL 3RWCB 3T04D 1FNEB 2XACC 5D70H 2P8LA 3SJVE 4QHLB 1DQJA 5C08E 4S0SD 3SO3C 3MUHL 1N59A 4LBEA 2XPGB 1KB5A 5EIIB 4TTDC 1UEMA 1HQ4B 5D9SB 4Z78B 3VD4A 3RKPA 43CAB 1HEZB 3QWQB 4F57L 3JWNC 1I9IL 4FNLH 1IEHA 4IRJD 3IDGB 5ADOL 5AYUL 2D7OA 1H3WM 3WMSA 3IDYC 4RMSA 3DV6A 2BHYA 4Q6YA 2H8PB 1PZUB 4Y16D 3BOVA 2G9HA 3CDCA 1X5ZA 4PLJD 3BGMB 4XVSH 3PP3K 4Z7VF 5ADPH 3QB7C 1J1OL 3T2QA 5CZKA 3M8OH 4U3CA 3RIAF 4G6KH 2FX9L 3C6SA 3BPCA 4JB9L 1YUHA 2V2TA 3WNMA 4PBXA 4R90L 4I0PB 1N5AB 4ZYKA 4QKXB 4RX4A 3PWPB 5DQDH 1JMXA 3MBED 3QDGD 4LHQB 3M17A 2ZSVB 4F7TB 3WNNA 4PREA 4GRWF 5IB1A 5DLMH 3QJFB 5ICYA 5K9KB 3UPRA 3BIKB 2GQHA 3BEVB 3A0OA 3VFTB 3PGCB 3BHBB 3QEGH 3V5KA 1FGVL 4FG6D 4RGOH 3DO7A 4KGJA 4MJ6B 2AJ3B 3BH9A 5E1AB 1F4XH 5IOPA 4UB0H 3P4MB 4G3YH 1MCKA 3MRIB 1BF2A 1MHCB 1ZVSA 3BO8B 4RMQA 3ZTNL 1A6WH 4HUUB 1YMHA 4JHWH 3LPGA 5J3HC 1S7XA 2CUMA 4HUXB 2YUVA 4TSCL 1QFWM 3RZCC 1CGSH 1KCUL 3G5VB 3OJDB 5ALBH 1GGCL 1QA9A 1JNNH 5DJ0B 3FN0L 4FQLL 4X5LA 5DVMA 1BM3L 3DRQA 3QDAA 3TH2T 2E6JA 1EIBA 1BFVH 1RUML 2F58L 4MHHG 5D7JA 2WINB 4NQSA 4FFVD 3STLB 4HS6A 5DK2A 4JVPA 4FABL 1ED3A 2UZIH 4X6DB 2K9UA 1CS6A 4KK5D 3F7YB 1FBIL 4EBQH 2QHLA 3U7WH 3DSFH 4WEBH 4LLMA 4A6YB 4Y2DC 1MVFA 4G6AC 5HHVH 3FO2B 3FQUB 1I1YB 2DQJL 2O5XL 3VWKC 3QDME 3GSUB 2PO6B 4AEHL 1QBMH 3P4NB 2DI9A 2EKSB 5SWSA 5IVNA 3MACH 3EJZC 1T1WB 3ZTJH 3QI9B 2BERA 1P7HL 4U1LB 1M7DA 5I9QC 1WIUA 5IROC 4Z0BL 4KQ3H 3BDYH 4B41A 3SE3A 1ZTXL 2P24A 3BIBX 4KDWA 3B9KC 5J9PA 4IOIB 4YEEA 4JY4A 4EUPG 4LDEB 3WFHB 1DEDA 1VFBB 4Z5RA 2I60L 5E2JA 3LS4L 4OCXH 4LGPB 5FHBL 4U1JA 4NZRL 3LRSA 4N90E 1BFOA 4S1RH 2NY6C 3JZ7A 5I74B 3QH3A 4NSKB 3GBNH 3MLZH 4QTHA 3GMQB 2XKNB 4Y1AA 2JELH 2DRUA 2YXFA 4P9ML 4W6YB 2H9GB 1TJHL 4YWGL 1GC1C 5GRJL 2OJEB 1U91B 3K8LA 2VN7A 4MLIA 4ZO8A 3WYRA 2IPKB 5JDSA 4OCSH 3SDYL 4IMLB 5TGBB 2XRAL 3ROOA 3ECBA 1J0KA 7FABH 4E5XB 1IAOA 1ZVYA 1MCQA 5D6DC 5BJTB 4P2RE 4LL9A 5F1KC 5E99H 1T1XB 3VRLF 3TVMC 1T0PB 5AAWA 2AKRB 2C1OA 4QXTA 5CILH 1E4JA 3VCLA 4PTUA 1S9VB 3HMXL 1P6FA 1XF5A 4RZCB 3VFSA 3AXLA 2HWZH 2M2DA 1OP3H 4FTVB 3EO9H 1UH2A 3O11A 2ADJA 1EH9A 4XPTH 3NPSC 2QKIB 4AM0B 1NFDE 1WT5C 5TF1H 2NY0D 4OLUH 4O51B 3SKJH 4EXPX 4JM2A 4ONOA 3QUKB 1V7ML 5T33H 4WDIA 4L5FH 1G7MB 4GXUN 1XAUA 4LPVA 5F1NA 2J1KA 2VLKE 2YZ8A 2Z91B 4YDJB 5IGXH 1UGNA 2LAAA 4OF5A 1TLKA 1U41A 4HK0B 5BQ7B 1EHLH 5DEGA 1BZ7B 2PXYD 1I1AC 4PJ8B 1CFQB 4AEFA 4WI3A 2NLJA 1MIEL 4MGXA 3G6AB 3RVTD 3AAZB 4UV4L 4KXZH 1C5BH 4XNZB 4Z7VE 3C8KA 3EKCA 1Q0XH 1RUQH 5ACMA 4A6YL 5EO1B 3O6ML 1I3GH 1X5XA 1EJOH 3RWDA 4DOHB 4NNXA 2DMKA 1RK1A 2CJUH 3VXPA 4M7LH 1KJ2B 4PJ9D 3TPUB 3U79A 5JW3H 1D5BB 5FM5M 2ITDB 4GRWE 1MFDL 4JKMA 1ZLSH 3D3VA 5CIPA 2NCMA 3KLAB 3RAJL 3TFKC 5JDJA 1H3VA 1PKOA 1HH9B 3RNQA 5F7UA 2ADFL 4QRRE 4YGAB 4X6CE 4O02L 2EDOA 3RIAK 2JIXB 4QXUH 3BUYA 1P4IH 4PJCA 2W9EH 1HXYA 3MJ6A 4QRPD 1IBGL 4OI7A 4FQCH 1P4LA 5FO8A 1X9QA 4F7CA 3VFMB 2DQEH 3MV7E 3DX7A 4MXVF 4GSDH 3RWJB 4FFYH 1QUNA 5J11C 4MQSB 4QHUA 4FQ1L 4M1GL 3E2HB 2HVKB 4N0RA 4Y4HD 4NRYA 3SN6N 8FABB 1GSMA 5GQBA 4CJ0A 1R3HB 5GJSL 1AGBB 3I9GL 2DM2A 4MJIA 3TH3T 5JW5B 1LMKA 4EUPH 3QQ4B 5DRWB 3QPQC 1R3KB 4NHCL 2P43B 2ZCLL 1YNLL 1QYGL 2BP3A 4JO3H 1KLUB 1G9MC 4GBXA 2ZSWA 2HLAB 4YBQD 1J11A 3LRHA 5KBNC 4QHLA 1KENL 1GHFH 1PBYA 2X4SA 4QCIA 4WNQA 3QXTA 5D1XC 4NO0D 2VKWA 1C8PA 5ECJE 4M03A 3MJ8A 4FZ8L 1IEAA 1NGXA 4GW1A 2LTQC 2EH8H 1MFAL 5ITBL 1AIFA 1HEZA 1F90H 2C9AA 1FGNH 1PD6A 4Z77A 2Y7QB 3IDGA 3U2SB 1WF5A 3WNOA 1UWEL 4P23C 2CLRA 1JCKA 3S97C 1CDHA 3FMGL 1MHEB 1Q9LB 2UY6A 4LNVA 2HJFA 2FATH 2BDNH 4R0LB 4I18B 1DQLL 4OM1H 1HHHB 2P8PA 2A6IB 1EHAA 1PDKA 5EU3B 4YXLH 5I1AA 5HVGB 2CMRH 3T1FA 3GSRB 1MNUH 5TFSH 1ZT1B 4D9LL 4HDIB 4JHAL 3NA9L 4X0KB 2EDYA 4NPYA 4ZTPH 5FKPA 1KJ2L 4KMQA 2EIEA 1G7JB 3PF2A 1A1MB 3KPPB 5CINH 3H9SB 1EO8L 1UACL 2ZSVA 4N5UA 4WV1C 5L2KD 4APQA 2PYED 1WFNA 2HT4D 4I5BB 3RGHA 5IF0B 2QR0B 5K9KA 3BIKA 3RNKB 5D1QC 5I8KL 3CFCL 2GJ6B 1LE5B 1SEBB 3VH8G 1L7IH 2AK1H 5DRZA 4FXKB 3B2UC 4GAGH 3VRLE 2W91A 5I17B 5ICXA 3TZVB 4UDTA 4XHJD 1HN1A 4RAVB 5E1AA 3DMMB 2CO6B 1FIGH 2R2BA 3C60A 1KOAA 5EU7C 1K5NB 3VFNA 3LB6D 5HGAA 1M7XA 4I4WA 4ZD3L 3O9WC 1DBML 3FCTA 3OAYK 1FRGH 3EDFA 1RI8A 1OGAE 2ORBL 4HUXA 1NC2B 3QCUL 5DS8B 1X4YA 4M7KH 2WBJA 5GS1A 1PX3A 1NCBL 3UJJL 5CZXC 1ONQB 1CZ8H 5IM7B 3BKCL 4UQ2B 3GSNA 3WIHA 5ISZB 1H15B 3ULVF 5GGVY 4NT6B 5CWSB 1T4KA 4IIQC 4PV8A 1OSPL 4OD1L 2P8MA 1WBZA 4KI1A 3STLA 3T77B 1M05A 4HAGA 3MBXH 3QG6A 4LSVH 2VXUH 5CMAA 5BRZB 1D5MA 4QF1B 1RVFL 4OTXL 4NQED 1WBXB 3LSOB 4KKCC 4WI4A 5CSZB 3NCCB 3TWCH 1I9JH 3NAAH 2DWEA 1SYSB 2JB6B 1B9ZA 1B6DA 3MOAH 4D3CL 3SQOL 5EU6E 1G9NL 5A2JH 4HD9A 2XTJD 1IJ9A 2RQ8A 3MLSL 4ZDHB 3WD5H 3U30B 1FN4A 1YNTA 3EOTH 4K3EH 4H0IA 5L6YL 5DI8B 3WFZA 1Q94A 3CX5K 3Q5TA 3QIWB 1WFOA 3ARBD 2R2EB 3VI4F 5HD8D 5DD6A 4R2GC 4WU5B 3G5YB 3KXFD 2FO4A 4HK3J 2NMSA 3U46A 3VXSA 2R4SL 4XCNA 1CDYA 4ZO6A 4PLKC 1H8NA 1OTTC 4JKWA 1JFQH 1S7SB 1FORL 4Z7QF 4HJGB 3ULUH 4NSKA 4TNWF 4MB3A 4A2MA 2VC2H 3G6JA 2EIBA 2Z8WC 2XNAB 4FQXC 1KTLA 5C1MB 4NN6B 4MXVE 2H9GA 3BISA 3OAZH 1G6RL 3O6KH 4GG6B 12E8H 2NY3B 4O9HH 5C0FB 1YZZA 2IPTL 1NMAH 5MERA 2CDEA 2NY2C 5F7DB 3BP6B 3OR6A 1VGEH 1WAAA 3HC3H 4HFWA 4MS8D 5MHSD 5DD1L 1T1XA 3CMOH 2AKRA 4I13B 3DBXB 3ULSB 5BS0D 1YEEH 3U0PA 2BNUB 2ESVD 1FPTH 2NZ9C 2EIZA 5L88L 5D70L 1F4YL 1V3LA 3FOMA 2J8HA 3G08A 5HDQH 2ERJC 5TQ0H 5EA0H 2QQKH 4K3HA 1XCTA 4HLZG 3MRMB 3X14B 1FQ9C 4O2EB 2NY4C 3MV7D 3QUKA 1UCTA 1A7PL 2VZUA 1KXVC 2A6DB 2Y06L 4FNLL 5ETUA 3TN0C 5DJ6A 1RIUH 2EO9A 2VDQL 4LCYA 4PBVC 3EZJB 1NBYA 3IYLW 3OTTA 3FB5B 5E00B 1GAFH 1RURL 4HK0A 4JANB 3QHFL 1BZ7A 3KLHD 1FJ1B 2OJZH 1DLHB 4JFFB 5CGYD 1C7SA 1NAMH 3JV5A 5T1KB 3V95A 4XVSL 1YEDB 5ADPL 3V0WL 1V5JA 4I0KA 4NQCD 2QSCL 1NMBL 3M8OL 5IP4A 4OV6F 3CVHH 3DIFA 4L8DB 1LK2B 3L3HA 1RY7B 3MRQA 3QIUB 5J4MA 5E6IC 5C07A 2IANE 4OFVA 2F8XC 4RGND 1U3ZA 1MJJB 5CJQH 4RCAA 5A2IH 1IE5A 1EVTC 3KS0J 1D5BA 4CRPA 3WL9A 1ZSDA 2CR3A 4HWBH 1BD2D 2FH8A 3IDNA 4U1KA 3H3KA 3T2PA 3VXME 1CD8A 2VZOA 3WS6C 4F2MA 3SGEI 5C71A 5MENA 4FQJL 4YDIH 2CXKA 3GI8H 5B39G 4JHWL 4QRUB 2I5YH 2FH6A 2GIYA 1BAFL 4GUPB 3VXUB 5CJBA 4MX7A 2ZCKH 1CGSL 2NXZD 5ALBL 3CLEL 2X4NB 4KAQL 4WUKL 3U4EB 1L6ZA 1YQVH 5AZEH 1GIGH 1QSEB 1HINH 5T3XD 1KJMB 3SDDD 3VFMA 1OP5K 3PWNB 4NKDB 4PFEA 1PYWA 3RWJA 1H3GA 4HUWA 3CGTA 3JUZA 1KJVA 3RBSA 3TA3B 3HRPA 3MV11 1BFVL 5TDNB 3ZSTA 2NR6D 5I1EL 3ULVE 1F45A 1S9XA 3SDXE 8FABA 2Z93B 3MRFB 5AG9A 5E9DD 5TE4L 3QQ4A 3OPZH 5GRXG 4PJXB 1YMMD 5C09E 2J88L 3QIBD 3SE9H 4EBQL 2YPLD 2D4FA 3MREA 4UT6H 3DRTB 1KLUA 4PRHD 2CLVB 5BW7A 4XMPH 1VPOH 1QRNA 4NNYB 1OTSC 3TLRA 1U8NA 2DYPD 3HE7C 2UYLA 5IUSA 4OGXL 2JJUA 3U0WH 4N0CD 5JHLH 2WIIB 1HQRA 3HN3A 3MACL 5HYIA 1A1NA 5GRYA 3C5ZA 5KVGH 1DUZB 2WBKA 4R3SB 4KQ3L 1MFBH 2E9BA 3BSZH 3V0AC 1S5HB 1ZEAL 2DDQL 5I1DA 2YBRA 3UTPD 3FZUC 2BJML 5IEKA 3FQXB 3VI4E 1LO2L 4HWNA 4S1RL 3VG0L 1T03H 3ISWA 1CIUA 3HZMB 4Z7QE 3H9YA 5LGJB 4ODWB 5EU3A 1YDPB 5AYQA 4G8EA 3RL1B 3ULVC 2P5WB 3VD3A 3VWJB 4RIRB 2IAMD 2FR4B 3KJ4C 2ZWLT 1G7JA 1XH3B 5IVZA 3RFZC 4GXUM 2DB8A 1N2RA 4L4VE 4JRXD 1S78D 4OFYA 3KPOA 3A67L 4EUPB 5DMYA 3IJHB 4XAKD 2Z31A 1J05B 4RAUB 2XICA 3FO0L 4JG0L 3H8NA 2VITB 3EO9L 2DS4A 3FRUB 1UM5H 3U9PH 4OLYH 3DMMA 1Q72L 2ZUQC 4V1DE 3H0TB 2E7BA 1XR8A 2B4CC 4WFHE 1K5NA 2KKQA 1B2WL 1EEZB 5TDPA 1JWSB 1RIVH 2GTZB 3LD8C 4LSPL 2FSEB 1CVRA 3QSKB 4QRTB 4RFNB 1UM4L 1UH3A 4C4KO 3IFLH 4HBCH 4GRLD 3FB8B 3N9GH 1JNJA 5HGBA 1NC2A 3MCKB 1XF3B 3QUYD 3WHE0 3ZKND 5AUMA 1FYTB 4P3CL 1MFCH 3R0MA 2EXWC 2ZUTA 5CWSA 3WSQL 1DBKH 2OTWA 5C0DA 4PJIF 3KDMA 4WI8A 5A3ID 5TE7H 4Q0XH 3UPCA 1OF2A 2I27N 1OT1A 1T7VA 2EH7H 3T0BA 3KPSD 3L5WB 4RWYL 1MCHA 3RU8L 3W39A 1RJZB 4GQPH 3SCMB 1MLBB 5BRZA 3ALWA 1NBQA 1R3IL 1RULL 4TUKH 4HWEH 2FGWL 1K6QL 2JB6A 3BEWB 4JFQA 3MLUH 1RPQA 1CLZH 1L9NA 3E8UH 3MO1B 1M71B 2HT2D 1ZLSL 4LVNB 5JNYB 2L4OA 1IQDB 5IBTL 4P4RB 5F7FA 1D6VL 4ZDHA 3RVUD 3VXQA 2X1WL 3DV4A 2VLJB 4PJBB 1T5XB 4DZ8B 3NIFF 1DQMH 1OAXH 3BDXA 3ARWA 1CXEA 4KPHH 4YAQB 4CW1A 2G2RA 3VRJA 3C2SA 1JZ4A 4K94C 1OLZA 2GITB 4WI9A 2P5EB 4WU5A 5I1CL 2NY1C 2NW3B 4NN7C 5I1KL 5DEFA 4ODBD 1IZKA 4AQOA 5ITFB 2DQEL 5GISL 1UKQA 1UZ6E 1J8HE 4PUBH 4QOKB 3D87B 2EYTA 3C5JA 4TUJA 5MEPB 2OMNA 2KL6A 1DQQB 1NBZB 1TZHA 4RGMC 3TP4A 3FO1A 1G84A 3D85D 3W11C 3ZHKA 1FAIH 4QGYA 2ADIB 2X4QB 4ZUVB 5F7DA 2YPVH 3BP6A 4XMLH 1TPXC 3IXTB 3MLRH 5ENWB 1DVFA 5E7FA 3DTXB 4JO3L 5MI0B 6CGTA 5HI3C 4BSVB 5E4EC 3DX6B 2BNUA 5J89A 3UO1H 3M1BA 2JB5H 4M6ML 1I8IA 5HDOA 5KN5B 4IDLA 2AK4B 4UINH 3V4PL 3MUGA 3NZHH 3H2WA 2EDWA 4PRID 4LSRL 2D03H 1EDQA 2AEQH 5I30H 2DD8H 3TCLB 2BY3A 2EH8L 2EE3A 2X1PA 1FGNL 5J12B 2ENYA 1ND0A 3HE6D 4GKSB 3T0EB 5GS0D 3MV8B 4U05A 5D8JH 2BSED 5EBGA 2YHGA 3CCHA 1GXEA 4Y2OA 4X7FC 4L3ED 4WI7A 5F7YC 3VGEA 4F8TA 2X1QA 3KYKH 4S1SH 3JTSB 4PJEB 4EI5C 3R06B 3VDAA 4HUKB 3HI1A 5CD3B 3GMNB 3O3AB 4EN3D 2N7BA 1HHJA 3FFCE 4WCYL 2NTSP 5LVEA 1YYLL 2BCKB 4ODHH 1MNUL 4KJPD 4M6AA 4EDXA 2FEEL 2HN7A 3GSWA 3KLSA 1OTUC 1EFQA 5CHNB 5B38B 4F9LC 1JF6A 5FFLA 5CINL 2M1KA 3DLQR 3WIFB 3F7VA 2CIKB 3STBA 4UT7L 5D1ZB 1IT9H 1U36A 3ZDZF 5D71H 4IDJH 3GSQA 4W81A 1NDMA 4NHUB 2AEPH 4GAGL 4MVBD 3K7UA 3FQTA 1W0VB 5KZCB 1ZE3C 3HG1D 2F8VA 3UMTA 4ZUTB 3VI3F 4LMQE 1FIGL 4XHQA 5EC2B 1E4KC 1BGXH 1U2CA 2NNAA 4OCYL 4OLVL 1J0YA 4HXAH 5T3ZE 2BZDA 1AKJD 4JFDB 3DPBA 5DRNA 1QO3B 4YHIB 3O3BB 1EXUA 4JN1H 5J7CC 4ONHB 3QXAB 2NTFB 2VSCA 4C56E 4DGVL 4EXKA 3I3EA 4Y7MA 3HLAA 1Z3GH 2V17H 1J87A 1G9MH 5IB5A 4P2QE 4OB5H 4N8VB 1CZ8L 4L29B 3FT2A 3PWNA 2FBJH 5BO1H 1J18A 5DFWH 5J6HB 3CDFA 1RZ7L 3O6FD 3Q5OA 5HYQA 5MEOA 4K3DH 25C8H 4PJIE 2ZG3A 4L8BA 1IKNC 1HHGB 2DJ4A 3TBVA 4B50A 4HZAA 1MJUL 1A7QL 1NAMB 5KSBE 1A6ZB 2BVQA 4LOUC 4QHMB 3LIZH 1Y6MR 2VXUL 4LSVL 5I1JL 3CVHB 4WENB 2AGJH 4NWTH 3IDMA 3L5HA 5ACLA 1I9JL 4CKVX 1BJ1J 4JDVA 4HQQH 5ESVB 4TNVK 5IQ9B 4M62H 2UUDK 4NNYA 2R0ZH 3NFSL 1L0QA 4G8GD 1OAKH 2YSSB 3QDJD 3MFGB 4D9RE 3BP5A 3IJYB 3K4DA 4GFTB 1QTYT 1S9YA 4K3EL 2R0KH 2UZXB 1BJ1H 4HPYL 4QHNA 2BVOA 4JG1L 3FHQA 2HKFL 4BQBA 4R3SA 1II4E 2ZP0T 3PHQB 3RTQB 4YLQT 2BSTB 4Q97A 3S4SG 2H2SC 4KVNL 2FLRT 2EC9U 3D0LA 1N3NB 4KQ4H 5DC0A 2HLFD 2MCPH 1JPGB 5FM5O 3N85H 4G9FB 4Y4KA 5IW6B 1Z5LB 4YHZH 5F96H 2GTWA 3ULUL 1IGJA 5L8JB 5K9QI 2H41A 1KN2H 3RA7H 1F6LL 3B9AA 3MFFB 2XZCH 1SM3H 1CQKA 1IAIM 3Q6FA 1E28B 1MRFL 3DVGB 4ODWA 3QHTC 1VHPA 1WQVT 3E0GA 12E8L 5DTFA 4PLNC 1EFXB 3TYFA 1UJ3C 1HOCA 2IPUG 3TESA 3SO3B 1QFWH 5C0BD 3WLWD 1XH3A 3LOWA 2ITCA 3O2DH 2XKSA 4XCFL 2Y07L 3RGVA 1VGEL 5JLZA 2IBZX 1I8MB 2Q76A 1K4DA 4HS8H 3CDGA 3S7GA 2J6EH 4EUPA 2HTKD 4PB9H 3L5JA 1YEEL 5KJRL 4XXCC 4X8JB 3OKOB 4I3SL 2D4DA 5FO7B 1NUDA 5E2UH 1DUYA 3IDYB 3JV6B 1NSNL 5EA0L 1XIWD 2QQKL 4R7NA 4NKOA 15C8H 3H0TA 4FZEH 3MRCB 4JPVL 1G7QA 1U3JA 1FC1A 3P4OA 5EULV 2XQBL 3GMPA 3LKNA 1T6VN 4LF3B 1PKQB 4JKPL 1TVBB 2XWBA 4QRTA 1TZGL 2E9IA 1HSBB 1U95B 2XZQH 4JPWL 4L9LC 4XPAH 4G42A 3HA0A 4GKNB 4WJ5A 1YEGH 4G8IB 4NC2B 5C86A 1LK3L 3AY4C 1SY6H 5DDHA 4YZFF 5D2LE 5HPOA 2ENSA 2APFA 4TOYL 3S9DB 1GGBH 4OZHA 1NAML 2HJLB 2JJSA 3QZWB 3KPRB 1Q8MA 4RA3A 4XPGH 2AP2A 5I16A 4I77H 1PQZA 4LMQI 2V7NB 3O81A 2R0WH 3ARGC 3KPNA 4XPBL 2FL5B 3SJVB 4OI9A 4KUZH 4ZFOA 3HI5L 4S1DD 2Q1EA 4CU8A 4J4PC 3BKJH 4W68A 5C0AA 1JTOA 1PEWA 5E94A 5HHQA 4KKAC 4RMTA 5CJQL 5D7SH 5KS9B 1U8PA 1A7NH 5T1DH 4L8CA 4JZNB 4JR9L 5HHMB 1KLGB 1ACZA 4LEOB 3WDJA 5F7EL 1DN2A 4R4BA 3EDJA 3IAQA 4GW4A 4N1CA 1JYXA 3QO1B 4HWBL 4OZFG 3RZCB 4ZOEA 4MDIA 1ORQB 1TTFA 4KK6C 1D9KA 3ZDZE 2VDRH 1WZMA 4NP4H 1S9WB 1T5XA 4DZ8A 3JWDC 3LN5A 5KW9H 5E6ZA 2RR3A 3ARED 4YDIL 2G60L 3VI3E 2OK0L 3PQYD 5FECB 4PGCB 4FP8H 4LHUG 2DLGA 3TIDB 2I5YL 3TC9A 1UA6H 5C9JA 4OT1L 2LAGB 4P4KA 2ZCKL 4Q9RH 3EYQD 5F71A 1U92B 4URTB 5B8CC 3HCVA 5GGTH 5CSGA 1YEIL 4HIHB 1M7IB 5ESQA 5AG8A 5GPRA 2PETA 4AK1A 5JO5A 3NACH 4J12A 2WIMA 4U2ZA 1UB5A 2JCCA 4CADA 3VXNA 5DHYA 1LILA 1DQQA 4CVUA 1NBZA 2YUZA 5CGTA 1REIA 3EO1B 3VWKB 2YA1A 4OCMC 1HCVA 1MCLA 1P69B 5DUMH 3TO2A 4LNRA 1V3MA 2ZPKH 5EN2B 2X4QA 3P73B 4ALAH 3O41B 1AO7B 2CRZA 3SGDI 4G7VH 5I9QB 4RWHA 4BSVA 4TQEH 3B9KB 1P1ZB 5IB3A 1D3CA 1FV1B 3DX6A 1VPOL 4UILH 5DURD 1NMCC 2DLHA 4R8WL 5F7LB 5FYLE 3AS1A 2X1XR 3S35X 1JHTA 2OR7A 2YD9A 4MWFB 1ETZB 4C56D 1WBYB 1MREH 3WDIA 3WV0A 1R5IA 5CEZH 4CVZA 5CCKH 2X44D 5HVFB 2BK8A 1ERNA 3P30H 5C6PB 4MNHB 5E8EA 3MROB 3FONB 2X4OA 3LV3A 4PY8I 1AY1H 1BHGA 1AGFB 4JO1H 4MSWB 2NX5B 3U1SL 2DKSA 5T5NF 4F7PB 1KTDB 3VA6A 3S37H 5JOPE 1T03L 3U7YL 1U3HD 1X5FA 3ZKMD 3MLYH 1ITCA 4HWZB 4JPKH 3TVMB 5CD3A 3EYFB 3GHEL 5D5MA 1T04A 2BC4B 4H20H 2PTVA 4UIMA 5E8DL 2M26A 4KJQD 3NFPB 1IC4H 1IGYB 5SWSE 5F3HA 4BZ1H 1RIHH 3NPSB 4NWUL 4OUUB 4LRNL 2KPNA 1ZAGA 1KCSL 3Q3GB 2GJJA 4GO6B 1KELL 5JMOC 1F6AB 5D1ZA 1AJ7H 3HHRB 4UTBH 3VGDA 3O3UN 5DMGD 1HH6B 3L3KB 5FA3A 1KBGH 1W0VA 1BEYH 3GI9H 3RHWF 1I1CA 3B8YA 3OKNA 4OLYL 3ZYOA 4Y1AE 3VFWA 5EC2A 2UY7A 2DMCA 2B7DT 4N9GA 3IAPA 1I1AB 1JZ3A 4YHOH 4OBSA 2YMXL 3PIQA 4N5EC 5FOBA 3O4LB 5IBLC 1OAZL 1YEKL 4O5LH 5D7JC 4OZIA 1Y18A 2ADGB 3FQWA 2YZ1A 4HBCL 2A2QT 4CAGA 1UZ8B 3O0RH 5DMIL 1FSKC 4JRYD 4M00A 4P57A 1A9EA 3VGAC 1RQ5A 4F9PA 5J8OA 2K1MA 3CIQA 3UXFA 3D2UB 4NKQB 4K7PH 1KTRL 4CN4A 4MAYA 1DBKL 3VH8A 4HF5L 1PZ5B 1T6WA 3Q48A 4WGWB 4D0DB 5I8CB 4CMHC 4DGIL 1AFVH 4Q0XL 1WWCA 5DWUL 4DGYH 1NLDH 2NPLX 2QADB 1N6QH 5D7LA 5TH2A 3OKLB 1J0IA 5BXFB 5SV3A 3FOLB 2B39A 3JSSA 5IIEA 1TIUA 3UAJD 5DVKA 4PJGA 4X4MA 4KZDH 1NFDB 3SE3C 1A0QH 3SDCA 5IEHA 2X9YA 2CIIA 2VLME 4PJ5D 1CLZL 1D6EB 4K07A 4QGTA 2IBGA 5IMLB 4PY7A 3GIVA 3RRQA 4TVPD 2VERN 3FN3A 1AC6A 2VLKB 3E6HA 3MRKA 3PP4L 4WO4B 3ME0A 4JLRB 1WZ1H 3CFEA 1GC1L 4MXQC 1DQML 2ARWA 4X6DF 5J11B 4KPHL 1UADC 3G6DH 1LO5A 1U8HB 5EIVA 5IFHH 1ZT7B 5AZ2L 4RDQG 2I24N 3QUZA 1IFHH 2R1WA 4E42B 3UBXG 1JI2A 4HZLA 1OAUH 5F1OB 1T5WA 5B3JE 2AXFA 3D1MC 1OGTB 1OARL 1IL1B 1Z5LA 1KF9B 3RVWC 1LO3H 2D0GA 5I6XC 4H88L 1WK0A 3TBTB 1MOEA 4PR5A 3D3VE 5KG9A 1C5DB 3U0TA 4O2FB 3DURB 4L4TB 2R9HC 5DJDA 3QEUA 1PJ9A 1OW0A 1KCVH 1NGZB 1RV6X 5DSCA 5D1XB 2R29H 2YPVL 1S7QA 4JFHD 4ZFGL 4P3DB 2Y23A 3V9FA 3HKFA 4FFZH 2LTQB 4JM2C 4JDZA 4X6CB 4PJCE 3RWFA 3DECA 5DJYB 3QYCA 4X8JA 4ZFFA 4JO4H 4H26A 4WI5A 4P23B 5FO7A 2W9DH 2WM0A 4QEGA 1EJ6A 1S7VA 1FDLH 3JV6A 1KCRL 2PW1A 4JAMB 1J0ZA 5C0NC 3DVNB 2VDPL 2D03L 3N50A 1ULVA 1CE1H 1C7TA 1DBAH 4OM0L 1D5ZB 4S11A 1UG9A 2X4PA 3Q6GL 3NFNA 4P2OB 1JK8A 3LMJL 2YN5A 4MJIE 1HSBA 3FT4B 5D8JL 4UIKL 4OF3A 1JGEB 4G9DB 1EK3A 2BX5A 5HYJD 5ILTH 2Z92B 1NGWA 4S1SL 5DFTA 2VAAB 4WW1B 1WIOA 1KFAH 5GGSB 4WV1B 4R96B 3F12A 1IAKA 1SEQH 2NXYC 1QLRB 3O2WL 5D1QB 3OJMB 4NN5C 1FZMB 2VZVA 4XP4H 2VR4A 4NM4H 3REVB 2QSQA 3HUJA 3MRJB 2A0LD 1Q9OA 5C6TH 1KXTB 2ICES 3ARFD 4WIQA 1XF2A 4Y4FC 5FCUH 4JJHA 2BRQA 3KPQA 1UCBL 4HH9A 2XXCB 1UXWA 5HPMA 2H1PL 4MNQD 3NBNA 3O9WB 5HI4D 4XBEH 1RU9H 4D0BB 1CYGA 1E27A 3C5SA 1CR9L 1AXIB 1TVHA 1IAII 4X7CC 2XA8L 4LQ1A 2BFVL 1N5YL 5L9DL 3DXAD 3ZL4L 5BCAA 2MHAB 3GJFH 1N0XH 1PW3A 1BGXL 3HAEH 3RWEB 4YHNB 1YC8A 4HXAL 1KLFA 5FO9B 1VESA 4IIQB 4XAWH 2IQ9H 1QHOA 1OPGL 2PYFA 4PGCA 4WWKD 4JN1L 3QP3A 5F88B 1FNAA 5C8JB 5IVXA 2VDKL 4J6RL 1Z3GL 3ZLQC 3EFDH 2FB4H 4FQ2L 1WLHA 1BBJB 4ELKB 3OG6B 4J3OC 3DX8B 1G9ML 5F3BB 1IARB 1M7IA 1JI1A 4PS4L 2FBJL 5FKAA 1NBVL 2W60B 4LCUB 2G75A 3U4BH 2EE2A 4GBXC 1QSFA 3QULB 1Y6KR 2OTUA 3EO1A 3WN5A 25C8L 5EBMB 2BRRL 1K8DA 4M61B 3GO1L 2D7PA 4ONFL 5F6IB 1N4XL 2W0FB 1AI1H 1UYWH 5B39A 1RZIA 3O41A 2VZTA 4NWTL 1MHHA 1R5WB 4HQQL 5KANI 2X7LA 2L7JA 5F97E 1Z0NA 4XCYB 2DIAA 4JGJA 4NCC1 3L3DB 3WJLA 5JOFA 1OGAB 3GMOA 1HYSD 1GOFA 5GGRB 4OIBA 1OAKL 1AE6H 4EI6A 2MTPA 1ETZA 1FFPA 5M7QA 3QO0B 4N8CH 3MGOB 3QFJA 1U8LB 5DA0B 4NZDA 3T4YB 4MNHA 3T0XA 1FVEA 1R3JB 2Q87A 5CSBA 5D7IB 2X41A 4PGZA 2VABB 2LABA 4IHOA 5ANMA 4M1CD 1ZA3B 4XPFH 3N85L 5FYJD 1XCQB 4YHZL 5F96L 3MJ9A 5TQ2H 5CBEB 1JGVH 1FCCA 1KN2L 3K4ZA 4APQC 1SM3L 4G6MH 2HTLD 4HWZA 1BBDL 4RMWA 4ERSL 3TO4A 2F9BT 3F5WA 5EU6B 1K2DA 1MCFA 4ACPA 3NFPA 4M8VA 1S7UB 2QLVB 1QQDB 3QT2A 5J1AB 3CXDH 3C60C 1LWRA 3D6GA 2WWKT 4HS8L 4JFYB 3S4SB 2NY4B 2V9RA 3KWWA 2J6EL 5JR1H 3IGAA 1MEXH 4LAJH 4DZBA 2C26A 3VFRB 3VXSE 4NKMB 3TN0B 1WWBX 3BN3B 2AJXH 1CE6A 5TPWH 1ZA6A 3GSOA 3WNPA 5IMKB 2Q8BL 2WBJC 5GS1C 5CEYA 2B2XL 3QUMH 3G6JE 3RL2B 3SY0A 1MCNA 1H3XA 4LCWD 3TT1H 1TDQA 1EUTA 1EZVY 3RVVD 4GAYB 2A6JB 4X99B 1YEJL 2J7LA 2P1YA 5HJ3A 5GRZA 2WLZA 5FEBA 2XZQL 3QUXD 2DM3A 1JGUH 1S5IH 3BW9B 1F11B 2HRLA 5E5MB 5E6IB 3KLDA 1YEGL 4IRSD 4M7JH 1WAAE 3BWAB 4I48B 4NOBA 4FQIH 3P0GB 1H3UA 1CLYH 1OSZA 1U58A 1Z6JT 3EYSH 2FEDD 4NFDA 1E4WH 4FTVE 1FVDB 3OXSA 3V5DA 4DKEH 4KUZL 3LKRA 3PV6A 5T3ZH 5IR1B 3OHXA 5JXED 1PG7H 3NH7H 2FCBA 1MUJB 3BKJL 1B6UA 1SMOA 4NO3B 2R1YA 3MRBB 4XNUH 1BQHG 1ZLVK 3T2NH 5KSUA 3CMGA 3LS5L 3VA2C 4ZXBA 2Z8RA 4KJYA 5LCVH 1A6AB 1W72H 5IMLA 5D7LD 3CFDB 4YPGB 4ODTH 4PV9A 3H42H 3IDXH 2DWDB 4WO4A 4JLRA 2GUOA 1DE4A 2I07B 1JUFB 2I9TA 5I74C 4NUJB 3ABZA 2KDGA 2UVFA 2C3VA 4FQQA 4U6YB 5F7MC 3D69B 5DR5L 5JPNB 5DMKA 1U8HA 5BZWB 4QY8B 5EZJA 5E56A 3GRWL 5C07E 3BQUB 3VE0B 2FX7H 2Z4QB 3RY4A 4Q9RL 1WISA 2HYMA 3W82A 1I8KB 3O8XA 4X80L 1J8KA 4M48H 2ATPB 3BPNC 1MH5A 3OX8B 3NZ8A 3NACL 4U4BA 2VLLB 1WCQA 2ICWA 4LKXB 4K9EL 2F5AH 1DQDL 2X89A 4XWGH 1AXSB 4ONGL 4NUGH 3RWHB 2VLRA 3MNVB 5JXAH 3MV9A 4OFIA 5DUML 4HS3B 2A77L 4DTGH 2ZPKL 1U8OB 4HFUH 5MENE 4UV7L 4DVRH 3VXMB 2GFBA 3ZHDA 3V6BR 4ALAL 2EDLA 1WZKA 1I3RA 3SGDH 2R1XA 2H2PC 1K9TA 1G6RA 3U7AA 3OKKA 4TQEL 2XFXB 3BI9X 2FGZA 3EFFA 1B0RB 5GS2D 4UILL 1WC7A 2VDNL 2CQVA 3ARTA 3MUZ1 4PY8J 3IF1B 2EE9A 3BZEA 5E8PA 1I9RH 3C6LA 4I0PD 4K3JL 1KIUA 1MREL 3PWPD 4GG6F 4E0RB 1T7ZA 1D5XB 1IGFH 3ETBF 5DJZA 1RUAL 3MSPA 1D5ZA 2H3NA 2OR9H 5ID1B 1AY1L 2HH0H 4M6OL 4JO1L 3VMPA 5FM4A 5T1MB 1I1RA 2XN9A 4ORGA 2DOCA 1CICA 5C0RH 5B22A 2CK0L 2GCYA 1I7ZA 2VDOH 3SDXB 4WHTA 5F1IA 4YGVA 3T8XB 1C08A 4J3VA 2GKIA 4MCYB 5E08H 3MLYL 4PRPB 1G9EA 1RJCA 4JPKL 1QLRA 5JW4N 2Q8AH 1MCPL 4X6BA 2CGRL 4QO1A 3F6IA 3PABB 1FZMA 1I1FB 5HHOA 3REVA 4AY0A 4F33B 4H20L 4U1SB 3SDAB 1FFRA 3FQNB 1N8ZA 4DN4H 4KTYA 1CI5A 2NY7L 2ZUQB 3BPLB 3FJTA 1YY9D 3ARDA 4JKLA 3EIFA 1AR2A 4F7EB 4E41A 4X9GA 6FABH 1IRAY 3PNWA 2HVJB 1AJ7L 3KPMA 3LD8B 4YFEA 1UVQB 1PLGH 2PTUA 1GOHA 4XBGB 1CXFA 5SWZB 2FX8H 3CFBB 3HZVB 1T0NB 5FUZH 4HHAB 32C2B 1KBGL 5DO2D 1CDIA 3GI9L 5D6CB 3UJIL 3MCG1 5HDBF 4ZNEA 5FGRA 1MI5A 1D5IH 2YWYA 4J7RA 2VQ1B 3MGTA 3HMWH 5FGCB 1DLFL 5KSAA 3CUPA 4YHOL 3UZQA 4JY5H 4YUEL 5TDOA 1A64A 5F88A 3SKUD 4U1IA 3VFGH 2F53A 5C8JA 1S7TB 5C0JB 2DM4A 4D0CB 1U93A 2X9XA 4R26H 5EFIA 2D31A 4AENB 1BBJA 2EYRB 4L1DA 5DK0B 2PO6D 2KQNA 4I0CC 3TCXA 1LNUA 5KVMC 1RJLB 4OF7A 1F13A 3QI9D 1TZIB 4L4VB 2YA2A 1RZJH 5DFVC 2GJ6E 2A38A 5CJ5A 3SKMB 2DQUL 5BW7C 1TVDA 2FJGB 1HHKA 4GMSL 1DDHB 2J5LB 4K7FB 3X3GH 3S96A 2ZCHH 1SY6A 4G8FB 1NLDL 4Q7DA 4M61A 1S7RB 3ARQA 3RP1A 4NQDA 2J4WL 1CDBA 4NO5B 3MODH 3O3EB 2W0FA 1RMFL 4V1DB 3C5ZC 9CGTA 5C70A 1TTGA 2DLFH 3QWRD 3S35H 4ODXA 5TJWK 1MCWM 2B1AH 5DJCB 3X13B 5I1IL 4BK5A 3S34L 4XCYA 5FF6A 4DWHA 4LCCB 4XGZB 4LAQH 3L5XH 4NN7B 3MC0A 3QEQA 4P5MB 1M6OB 2CRIA 3FFDB 4K2UH 4OCNC 4YC2C 1T3FB 1AP2B 3ULVL 2GSIB 3V0VB 1YJDC 3GJFB 3T4YA 4YE4H 4C58B 5C0EA 3MA7A 3S8WA 2EE6A 4XZUB 4LVOC 4HJ0C 5D93C 3GB7A 4AG4H 3HAEB 5IB4B 4U1MB 4PJXF 3ILPA 4RGMB 5D7IA 5LWYH 3LKOB 4IRJB 2XZAH 3WXWH 2GSGA 5BRZE 1E4XH 4FTVD 3EJJX 2WUBH 3K1DA 1LO3L 1TPXB 3EOAA 5EBWB 1BQLL 2Y9RT 1GL4B 5EO9A 2H26B 1F4HA 5IW1B 5GGTA 5E4EB 4OLWH 4ZAKA 1F8TL 3L9RB 2Z31C 4JFOB 2AV7A 4OZ4A 2X6MA 5GSVB 2B4CL 3L7EB 1QNZH 4N0FA 3HNSH 3G04B 3DMMC 3QXUA 4X9HA 4G7YL 2BMKA 2DI8A 3MBEB 1LO4H 3MRHB 3OAUH 3OB0H 3VD5A 5C0CA 4XPHL 2V5YA 4LGRB 3VFVB 3WO3B 3S4SA 4PJ8D 4HIJB 2DICA 4LSUL 5C2UB 1FL6B 3BJ91 2ZOLB 4FN0A 4DK6A 5E70A 4UUJB 1VFUA 5IMKA 2EDNA 3B6SB 1XGQB 1FE8L 4NGHH 2Q7YA 3TYGH 3MRNB 3LH2H 1DFBL 5JZ7D 4GG6E 4GAYA 3HB3C 2OCFD 1INQA 4ZOBA 3INUH 4Z9KB 3DUUA 5E5MA 3GK8H 3ZYJA 2IF7A 1YNKH 4OZGB 1EA9C 3AU1A 1BOGA 4I48A 2AQ2A 2VYRE 1JRHI 3L95B 3OB8A 3IVKB 1E6JH 3QCVL 3QJHB 2JIXD 4XP4L 4F58L 5GZNC 4D2NA 3HR5A 4MDJB 1U8QB 5GGQH 4AIZB 1CG9A 1T0MB 3W81A 1ZS8B 3L3OB 4HGWB 5IV2B 4K8RD 1NGPH 1AD9B 1YYMH 3HPLB 4K94L 3GGWA 1AR1C 5FCUL 1AHWA 1T22A 3H7BA 4YXHL 3MOBH 2X4RA 3PDGA 3KJ6H 1MJ8H 3MRBA 4NO3A 1AQKL 4NRZA 4UBDD 1EHXA 4U3HA 1F58L 3I6LE 5FB8B 4P5TA 1IAIH 4X4ZA 3WKMH 2IJ0C 4OZHF 5DJXA 3QPXH 3V4UL 1BF8A 1YEHL 4U6YA 3CFKA 3D69A 1JWMB 5KOMC 4PJDA 4XAWL 4B0MM 5CP7B 2IQ9L 5BZWA 3VXRD 5IJKA 4MA3A 3G5ZB 3MYJB 3OXRA 4QY8A 3DYOA 3QUMB 4M6NL 3VE0A 3BQUA 1VFAB 5HI5C 1SJEB 1DANT 4LCIH 5JHDD 1IGMH 1LQSR 5ELIA 2WW8A 4MXWL 3UTZB 2BNQB 4HC1L 4Z95H 1A6TA 2O5YL 1JL8A 4U6XB 5FV1L 3V4VL 1KTKE 2R23B 3QRGH 1DVFC 3IETB 2VLLA 4G5ZL 4LKXA 4OZFA 4PJBF 2R2HB 4UI2A 3X12B 1MAKA 1BMGA 3E1F1 3MNVA 4S2SA 4HX1B 4BZ2H 3UTTA 3WFDL 3QXDA 5IG7A 4OGAC 4Z8FL 1UYWL 5CD5D 5EWIL 2OXHA 5E1HB 4Y19A 4LHUA 4IS6A 5EUOB 1KIPA 1KN4H 3V2AR 5E24E 1T21A 1MVUA 4MMZC 3PL6A 1JGDA 4LVHC 2JK5B 4OV5B 1QSEE 4M5ZH 4QWWC 2P45B 1AE6L 4M7ZC 1KIQA 2F54D 1FZOB 3QDHA 5HYSB 2F5BL 2WP3T 3PWVB 2XV6B 1W72B 4E0RA 1YECH 5IMMA 5CIPH 3H9SD 3P0VH 5I1LB 1C1EL 3EDDA 2E7HA 3K4AA 1W8OA 3RDTA 1DZBA 3CU7A 4XCEA 2IPUK 1Q9WB 5J13C 2GJ6D 1QVOB 1QD0A 5T3XH 4MLSA 1UJ3B 3F7PC 1I7RB 1WGOA 5EU4A 3OKEB 4PJXE 3T8XA 5KSBB 3RVXD 3TZVD 2WZPD 1WEJH 4WFGD 3UJTH 1A4KA 1JGVL 1Q9KA 5T1LB 2PXYB 3MRLB 2Q86A 3ZO0A 2P44B 2AXHA 1JPSH 1SMAA 2YXMA 1FLRL 1XF4A 3DVIA 4I3RL 4L8SB 3SDAA 1YN6B 5CJOH 1TCRB 3DHJA 3CXDL 3VGGA 5LQBH 1FZKB 4BFEA 3SKNB 3O3DB 2OL3B 4F7EA 5ISZD 5DHXB 1R6VA 1LDPH 4XBGA 3K46A 1AD0B 4PJ9B 5SWZA 2AQ1A 3LQZB 2GAZB 1T0NA 4PJEF 4YIQA 4BQ6A 4L9LB 3IDIB 1DQTA 3CX5J 1MLCB 2P42B 3ARDD 5IBUG 1F3DJ 3QUML 4P46A 3ULUF 1IQWH 3BGFC 3LEYH 1GGIH 4KRPC 2DLIA 4PJFA 3BVNB 3TT3H 1JVKA 4BKLA 1QRKA 1KB9K 1BVLB 2P5WE 5C0JA 4GMTL 1X7QA 3ARGB 1EMTL 2AXGA 1JGUL 1U8JB 2NY5C 4M7JL 1MRDH 3MR9B 3LKSA 3W0WA 2PW2A 5IHUH 4KK9D 4HIXL 2KZWA 4XNQA 3FAXA 4FQIL 1QG3A 2BNRA 5JW4Q 1LEGB 4U1NA 1CLYL 1FO0B 2RIKA 2Y36L 2XWJB 1IC5H 1ZHBA 5E5RB 1OM3H 3HR6A 5F9DC 3SKMA 5DF0A 2J8UB 3GJEB 3QIWD 2HFFB 3EYSL 1E4WL 3QNYB 3D39A 3WXVL 4Y4HB 1LE9B 2PTTB 1S7RA 1NL0H 1X5JA 5T3ZL 2E6QA 1FG2B 3OZ9H 3IFNL 1R5VB 5F89A 1LO0H 3DYMA 5MP6H 5ERWB 1CLCA 3VFOB 3V52H 3NABL 1VFMA 1CXHA 4ELMA 4ETQB 4NQDD 4WI6A 2NY3D 4X7SH 5B8CB 2CDFB 4TSBL 4Y4KC 3ES6B 1QLEH 1M6OA 4OF8A 4OZHE 4U1HA 3V6FB 5I1HH 4GRMA 3N0PB 3FQRB 4NCDA 1QEWA 1S7WA 1R0AL 3ESUF 4HV8A 5D2LB 3LKPB 3I02A 5A2LH 3EDKA 1T1YB 1C12B 1JJUA 3IS0X 4XP1H 3TJHD 2FIKA 1UXSA 1JZ6A 3HAEA 4U1MA 1I3VA 3VRIA 4IRJA 4X9FA 3I6KA 1DQJB 5C0AE 1ES0A 1MCSA 4ZS6C 4V2CB 3T0DA 3D25A 1ADQL 1KB5B 3RGVC 4Y16A 4FMFA 3KYMA 4KV5E 1HKFA 1LD9A 5IW1A 3HI6L 3OWEA 8CGTA 1KNOB 4XCCH 5LBSL 4JQIH 5CEXB 3WIHH 2D7TL 3GSNH 1NMCB 5GSVA 5IESH 3E3QE 2BXZA 2VLJE 2OL3L 2C4FU 1SYVA 3I85A 3DV6B 4TULH 1HWHB 3ZT5A 1T66C 3JTTA 2G9HB 1P4BL 3VJ6A 4QTIH 1HIML 3QDGA 4PBWD 4C83B 3NPZB 3EJYC 3UBXA 4JFFD 1QFUH 2PYEB 2P5EE 5T1KD 4RBPK 4KXZI 1QKZH 1NC4D 1G7HA 3C6SB 3BPCB 5GRWA 1YUHB 2V2TB 1GPOL 4XH2A 1PGRB 5F7NC 5H94A 3BMWA 3C2AH 1VEMA 1QBLL 3QIUD 3ZE2F 5HHXH 5JW4M 1IM9D 2CRYA 3B6SA 1XGQA 4QOKE 5LKNA 3CSBA 1A4JB 3M17B 4PREB 3MRNA 1IGFL 5IB1B 2EYSA 3MXVH 1WTGT 4JFED 1CFNB 4OIAA 5ICYB 2JJSC 3UPRB 3ZDXE 2E5EA 4R7DA 4MHHI 3V5KB 3DO7B 2ZJSL 4RISH 3BH9B 3LQAH 1FO0L 3I2CH 5CFHA 3SCMC 3RZWA 4OZGA 5IOPB 3D9AL 3ILQD 5E08L 3X3FL 1ZVSB 4C55A 4Y5YA 5E2TL 1YMHB 5AD0A 1U8KA 3QJHA 3OF6D 3WLBA 3JWDL 2AK4E 1S7XB 4BZYA 4JQXA 3BAEL 3VXUD 5T5FL 1UT9A 1D9KC 3L3OA 3E3QC 3OG4B 3SGJA 3X17A 4OLZH 4J8RA 1AD9A 1WVZA 5K59F 1QSED 1NCCL 2ID5A 4EVNA 4JFZH 4NQEB 1UM6H 2FJHA 3GSVA 3T0EE 5D7JB 3TA3D 4NQSB 4P4KC 3GM0A 2XTJB 2XIDA 1X5YA 1FSKB 1CXKA 5KVDL 4MAUH 3VGAB 3BRDA 3RKDD 5I18L 3BT2L 1JHKL 2C4XA 4MD0A 5H35A 2XI9A 3FAWA 3HMWL 3UYRH 5GS0H 4Y5XA 4I2XA 5D5ME 2BVTA 1FFNB 4LLMB 4CMHB 3MYJA 2FHBA 4H5SB 1JV5A 4XTRD 3HNVH 1RZGB 1S3KL 1KB5L 5A43C 2DQDL 3GHBH 5KS9F 2D9CA 4R26L 1L7TH 3R8QA 5KSVB 1U9KA 3PWUA 5SWSB 5LG1A 4M1DL 4Q2ZB 4DAGL 4U6XA 5DUPL 2EC9T 5MI0C 2VXVH 5ALCL 2P24B 5CS7A 3SE8H 5J9PB 3EYUL 4JY4B 2ZCHL 1NCDL 4XRCA 3R4DA 4RA0C 3BKMH 1GRWA 1DBBL 3LRSB 2NQCA 3TBYA 1BFOB 1U8IB 1CGWA 1VERA 1L4IA 2ZUXA 3QH3B 3NCYP 4NQVA 4QTHB 5EUOA 2DLFL 3NIGE 5F21B 2GT9A 3HPJA 4GS7C 5M94B 4Y5VB 1NANI 3UX9B 3S35L 1RUPL 4AEIL 4RFOH 5DMJB 5BVJB 5C92A 5FGBA 3OKYA 5JDSB 3V6ZA 35C8H 4NFBA 2PCPA 3VWJD 1AH1A 3ROOB 1BPVA 2FHCA 1W72A 3Q0HA 1FNFA 1FNGA 3MMEA 4BQCA 3V5HA 5I6XB 4FFWD 5EC1A 2C1OB 4QXTB 5IHBA 3VCLB 4G6JH 4AG4L 3MCLH 1XF5B 2R8SH 5K9JL 5DT1H 3SBWA 3VFSB 3AXLB 4C54A 1WZLA 4NKIH 1N64L 5IJVA 3O11B 2ADJB 3W2DL 3SKOA 5DD0H 4UTAH 4CN6A 4PJGE 4X4ME 2N7AA 4OSUH 1ZLWH 4WWID 4JM2B 1MFEL 2PXYA 5H37G 3QQ9D 5D1ZC 1MY7A 1QR4A 1J7VR 5FYLL 1Q38A 4WFFE 2DBLL 5F1NB 1YY8A 4L8SA 2R69H 1QNZL 3JBG7 2MCG1 2CKBA 1TCRA 3BN9D 3I75A 4G6FD 4PB0H 1FYTD 1BECA 3AS2A 3BKYL 1CFSA 4WTWA 4U33A 5C2BL 1EGJA 1AD0A 2Z35A 1H9VA 4PJ9A 3EOBA 3BH8A 4CU6A 1IVLA 1B3JA 4TPRH 2R4RH 4F9PC 2JF1A 2Z8SA 4NNXB 1UQSB 3T0WA 5I66A 1RK1B 3UPAA 2UWEA 4KJWD 3GSXA 4MAYC 4OGYH 3ZE2E 3VXPB 1IM3A 3LH2L 4A2LA 1NGYA 3STZB 4Z76A 4WHDA 1J5OH 3O4OB 4NN5B 3R0NA 5CIPB 4KTDL 5JA9A 1A7OH 1U8JA 4QRPA 2VOTA 2NXZB 1YNKL 3RNQB 2VLJD 4KKLD 2FHFA 4IBLT 1PY4A 3SDDB 2A9MH 1TJIL 5F9JB 1OVZA 1LEGA 4Z7OF 2XWJA 5E7BA 4EDWH 3SDCC 1JGLH 2Q3ZA 4DN3H 2IH3A 3GJEA 3BUYB 1JZ2A 1G0XA 2HFTA 3QNYA 4M43L 4PJCB 1HXYB 3GZKA 4Y4HA 2R56L 4Y2DA 2EDJA 1YJDH 1KPUA 3F6LA 5FO8B 4F7CB 1NGPL 1YYML 1R5VA 5E9DB 3DX7B 3SGKA 5ACZB 3B3IA 1FNSL 5GGRY 3MOBL 1MJ8L 4W4OC 5FDWA 3KYOA 4QOKD 3QIBB 5K59E 1ZLUK 5KVFL 3QUZC 3W5NA 4LIQE 3FT3A 2RJMA 1IAIL 4LLYA 4TSAH 4DK3A 3EO0A 2APBA 2FECI 3P11H 4NO0A 1DEEB 3KPRE 4KK8C 1A21A 1KEML 3FQRA 3HUJE 4GBXB 1T1YA 3GNMH 5DJ2A 4CVXA 1IGCH 5LGHH 3RPIA 1X5KA 2VDML 4LCIL 1OW0C 3SOBH 1NFDF 1V3KA 2X4SB 4QCIB 2VWEE 4WNQB 4TRPL 1ZOXA 5HGGS 4KI5F 2VZ3A 4XVUC 3VDCA 5KS9E 1BQHA 1EERB 3MJ8B 2HMIC 1IEAB 1NGXB 4GW1B 4X6EA 2VQUA 5HHME 1WUNT 3A6OA 1AIFB 1Q0YH 1TQBB 1KNOA 4XVJH 2D0HA 3BPOB 4Z77B 3UYPA 5CEXA 4C4KT 3O2VH 2C1PA 3T0ED 2CLRB 4BZ2L 1HXMA 3MV8D 1NEZG 1CFVH 5SWQB 3QDMA 4X7TA 4C83A 2HJFB 3WFCL 4JRXB 5L2KA 2P8PB 2PYEA 4UT9H 4H1LG 5IVXE 1BJMA 2IFFH 5I1AB 1HKLH 1OAYH 5GGVH 3T1FB 4R9HA 3CSPA 3ULUD 3MLVH 4NPYB 2ZUYA 3MOQA 5FKPB 4OIIH 1T80A 3CVIH 2CH8A 3L3JB 5FA4A 1A4JA 2ZOKA 1EHNA 3NN8A 4LARH 4APQB 1NFKA 3UZEA 3U36A 3UTSD 3P0VL 1CFNA 1QSFE 1RFDL 4IRZH 3LKQA 2R2CA 2IWGA 2EZ0C 5DRZB 4XNYH 3KG5A 1IAMA 5DZOA 5ICXB 4AH2A 2EO1A 4U6VL 4UDTB 4X6CF 5CUSL 1VA9A 1AO7E 4HSQA 1KJ3L 5KZCD 5DO2C 1VADA 3RI5K 5GXBB 2R2BB 3C60B 3QNXA 2VWEC 2LQRA 3NTCH 1VCAA 4LSSL 3VFNB 5HGAB 2OQJB 4I4WB 3OR7B 1A3RH 4JFDD 3FCTB 2EXYD 4Z7WA 2COQA 5FK9A 1JPSL 2PR4L 5F7HA 5CGMA 2E9WA 3VXOA 2WBJB 5GS1B 2VL4A 2MPAL 1RZFL 3QFJE 5CJOL 4PP1D 1K3IA 3GSNB 3K2UH 4NQEA 1T4KB 4PV8B 5EUKA 4GAJL 1MRCH 4AL8H 5FV2A 5LAXB 3EHBD 2NX5E 4GG8A 2AJVH 1LDPL 1WBZB 2P8MB 2WLYA 3P0YH 4IOFD 3GBMH 5F6HI 4TN9A 5D72L 4ZSOB 1M05B 1TETL 4N9OB 3QG6B 5CMAB 1UEYA 1D5MB 1N7ML 2GHWB 2XOTA 4HXBH 2YUWA 3WO4C 2UUDH 5DEZA 5JIPA 2VE6A 3L6FA 4M9OA 2DWEB 2X4TA 4I8DA 4ODSH 1XEDA 3LEYL 1FFNA 2I9LA 1GZPA 3K80A 4H5SA 1CD1A 3ARBA 2GJZA 1RZGA 3T0VA 3WN5C 4WGVB 4WUUD 2W0PA 2IH1A 3KXFA 4AJ0A 2X42A 4MJ2A 5KSVA 2UVEA 5DUBB 1MRDL 1FN4B 1YNTB 4HGMA 5DXWA 2E8YA 5IHUL 4Q2ZA 2VUYA 4O4YL 3B83A 1H3PL 4POZC 4MMXC 2DLEA 1P7KA 1Q94B 4UNVA 1IC5L 2YR3A 4XP9H 4RFEA 3RTQD 4DJMA 5DD6B 4Z7OE 2FO4B 3QRFM 3U46B 3VXSB 4XCNB 3WJLC 2V2XA 5IBUB 1JPTL 1MFNA 1U8IA 3X11A 3OZ9L 1YEFH 4G9FD 2Z8VC 4BH7A 4M4PA 2AJYH 4XC1L 4JM4L 3O4LE 3G6JB 5BOPA 2GK2A 4Y5VA 1KTLB 4K23L 3SE4A 2FLBT 4HKXA 3LEVH 5BVJA 5BS0A 5EOTA 2ESVA 3TIEB 3TNMB 1G7IA 3VW3H 1EFXD 1V3JA 3LCYA 3LVEA 1BZ9A 4MA8H 4WEUD 2CDEB 5MERB 1QLEL 4ZUSA 3KR3H 4YNYA 1XGPA 4LASL 3OR6B 3BPNB 4PRIB 5EBLA 4HFWB 4TTDD 1JYNA 2VIRB 1ZANH 4PRNA 3TO4C 4FQHA 2QHRH 3U0PB 1UWXK 3MV7A 1IGIH 4X4XA 3CDYA 2EIZB 3L3GA 1INDH 4H1LH 4XC3L 1CU4L 1XF1A 5A40E 2QSVA 5JQ6H 3FOMB 3G08B 3CAFA 1XCTB 4NOFA 4WY7L 1JNLH 4KI5E 3IB4A 3V79C 1QPXA 3QQNA 4XWOC 4HJJH 4ZG1A 5ETUB 3RX5A 3GSNL 5DJ6B 4NQCA 2ZKHH 1Z9MA 4LCYB 1KC5L 5IESL 2Y1VA 3HRZA 1NBYB 3B8SA 3WBDA 1I4FB 1DBJH 3IKCA 5GZOC 2Y4SA 1LHZA 1A7RL 2VDLH 2QQNH 5I15H 5DJ8A 3WS3A 5D7IF 4ISVA 2VRAA 2Y6SC 1MY5A 1QFUL 4TVPH 2UZYB 2NY5H 4XP6L 5EO0B 1MQ8A 3KPRD 3DIFB 4OCRH 3L3HB 3MRQB 4KGLA 1BD2A 5C07B 4MCZA 4I9WE 1A6VH 5HHXL 1TNMA 3SJVD 3HG1B 4LKCA 1UQSA 5C08D 4DKFH 5GRVL 3B2VH 2DQGL 3MXVL 4KH2A 4L4TE 3STZA 3PXHA 1G0YR 2WWMC 5HHMD 2VLRE 4KHXL 3WL9B 1ZSDB 3MV9E 4OFDA 3CLFL 2QADC 4BFBD 1P9MA 4YHLL 5J3HD 3IDNB 4U1KB 1RUKL 3RZCD 3I2CL 4KWUA 3PGFH 4BYHA 2GYSA 4F2MB 4ZS7L 5MENB 3TJEH 3SDDA 3UEZA 5F9JA 3N06B 2F19H 4DEPB 1S9KC 3DI3B 1Q1JL 3WNKA 3IJSA 4WU7B 4KI5C 4ZXBC 1T7YA 1Y0LA 2OSLA 4M93C 3O6FB 2AI0H 2X4UA 3CD4A 4MX7B 3MA9H 4OQTA 1HSAA 5C6WH 4WO4C 5F8RC 4MA1C 3BXNA 5HYFA 1E6OH 5BV7H 4JDTH 2WQRA 5E9DA 3AUVA 3IU3A 3R1GL 1PYWB 3CJJA 5HTSA 5ACZA 4HUWB 1KJVB 1YMMA 3ROLA 3QIBA 2YPLA 2VXQH 4OCWH 2XN9E 3O6LL 4PRHA 2WMPA 4Y2DD 4G6AD 1S9XB 3HC4L 2B1HL 3VWKD 4XI5C 2OZ4H 2DYPA 4OLXL 3O8XC 1G7LA 4BSJA 2A74B 3VGBA 4LSTL 3EJZD 1AO7D 1DEEA 3MREB 1GGYA 4X5XA 5HHOE 1J1PL 3THMH 4JZOA 2W59A 1QRNB 3B9KD 1MHPH 4RMVA 1U8NB 4MJ5A 4KKBC 1L7TL 4Y8AA 2EEBA 4XVTL 3RWGB 2UYLB 3VMNA 3EGSA 2DQFA 4BJLA 1HQRB 2OX5A 1NAKH 5EU7E 1A1NB 1CT8A 4E41E 2NY6D 3C5ZB 3U4AA 4F7MA 3OGCA 5FYKH 1K85A 2LU7A 2VXVL 3GRWA 4PP2A 4AZ8A 4X5WB 5I1DB 2YBRB 3O45A 1IILE 4JHBA 5D7KE 2GY5A 4ZUUB 2NX5D 5IEKB 1MI5E 5IQ7L 3C6LC 1FIEA 1J88A 3AFLA 5SWQA 1C16A 2IAMA 5C0BB 2GY7B 4YC2B 1FLTX 1OAQH 4JRXA 2W0KA 2F53E 4CMMB 1NANH 4LVOB 5D93B 3TVMD 2CPCA 2CK2A 4P2OC 1O0VA 4G8EB 1CF8H 4KMTH 4MA7H 3WFEL 1CICC 1J1XH 2YKLL 43C9A 2IGFH 4MQXC 1R3LA 4HCRH 4CDHA 5IVZB 3QDMD 1N2RB 3L3JA 3KNBA 1XIWB 2C5DC 4NJ9H 3KPOB 5BMFH 2DN7A 3CZJA 4HKZA 3LHPH 1NCNA 4MYWB 2Z31B 4UU9B 3IFOA 3I50H 1B4JL 3T09A 4EOWH 4GRLA 2D9QB 4D94A 1CIDA 2KH2B 1J0HA 3L3IA 2AQ3A 3QUYA 2BOBA 4HT1L 1XR8B 1DSFH 3ARDC 4GOSA 4YHMH 1QR1A 4N90D 2H32H 4K8RL 1I1AD 2OQJA 5TDPB 1N6UA 3OR7A 4HG4K 3O4LD 1JYWA 4ZUWA 3QEQE 5HGBB 4F37F 2ICWI 5T5NG 2R69L 1NPUA 5BVPH 3KPSA 2A1WH 3GMMA 5AUMB 3S88H 4PB0L 3K0WA 5MEQA 3D2UD 5KSAC 3W9DB 2OI9C 4BQ9A 4POYA 2OTWB 1FFQA 3SDXF 5C0DB 4XT1C 2AERT 3F8UB 5LAXA 3KDMB 5D7IE 4P2RD 2CRMA 1OF2B 4PTTA 1PSKL 5L7XL 3PWLA 4PJ7A 4ZSOA 1SBBA 3W39B 1SJHA 3PDOA 3TFKD 3LEXB 3WIIH 3QG7L 5JORA 3W9EA 4M3KB 3TBSA 4JFQB 4UQ3B 3IU4H 1XR9A 3H7LA 1J5OL 3PQYB 4QXGH 3P77A 5FYJH 5EZOH 4DVBA 4S0TD 4IMKA 3VXQB 1JYVA 1EBPA 1KEGH 1NCWL 3DV4B 5F6IC 5AWNH 2BHZA 2BHUA 2E7MA 5DUBA 2VLKD 5C0CE 1CXLA 2E3VA 4QRQA 4CW1B 1JRHL 3BZFA 4EDWL 2G2RB 3VRJB 3GBLA 1JGLL 5C7XL 4KY1H 3CH8A 1YA5A 4XP5H 1MIML 1I9IH 4OAWA 1YJDL 5DEFB 3D85A 3MLPA 5ADOH 2RCSL 1AGCA 1GCFA 4IEFB 4BUGA 3HE7A 2ZNXA 3QPQD 4UOJA 4N0UA 4ZODA 4DFHA 1NUGA 2EYTB 4KROC 4NNPH 5L8LB 3C5JB 2BVPA 4TUJB 1NLBL 5CEZE 4HPOH 1TZHB 3FO1B 3IKKA 4KKNA 1J1OH 3QCTL 4KZEH 3G5XB 4L4TD 3TIEA 3TNMA 1QFWI 1A3LH 3P11L 4L3CA 2GEEA 4KUCF 1ZWIB 5D1XD 3PHSA 4YX2L 4PRIA 1IKFH 1CFBA 2HRPH 1DVFB 5I75C 2VIRA 5ESAA 1XFPA 4QRRD 4ZAKC 1KYOK 2EICA 2HP4A 1X5IA 2E9JA 1AQDA 3M1BB 1I8IB 1XGTA 3HE6A 1CTNA 1EX0A 4P23D 3MUGB 3MTRA 1FGVH 4WFEE 1MJ7H 4L3EA 4CNIB 1F3JA 3LN9A 1XT5A 1YN7A 1UC6A 3EW3B 3NVQA 3PGDB 1HILA 4ENEC 4JGMA 2A73B 1ND0B 1UJTA 2IBZY 4LVHB 3ZTNH 4EN3A 4LFHD 4R4NC 4PG9A 1I4FA 3RJDA 3CCHB 4M7ZB 5FIEA 1CFVL 4YFLI 2V5SA 2XXMB 1KCUH 4XBPA 1GGCH 3HI1B 3KAAA 3FN0H 4FQLH 3RY6A 5INCB 5SX5H 2MQCA 3DGGA 4UT9L 1BM3H 5EO0A 3S37X 3Q1SH 1HHJB 4G6KL 5D1QD 1ZHKA 2MFNA 5J13B 2F58H 4EDXB 4OD2A 3B2UD 1FP5A 2HN7B 3GSWB 4FABH 3T65A 5DQDL 2ICEA 1QFPA 3HG1A 4OKVB 2BOCA 3F7VB 5KAQF 4FHBD 5DLML 2EEAA 5IMOA 1AKJA 3AS0A 3O9WD 4IRZL 3GSQB 5HY9A 2MSPA 1NDMB 3QEGL 5C3TA 3UTTE 4L4JA 4U0QB 4XNYL 4RGOL 1P7QD 3SPVA 4F3FA 3FQTB 2WANA 2DQJH 2O5XH 1ZXQA 3VGHA 5I0DA 4Y19E 4S1QH 1F4XL 1O5DT 4AEHH 1AHWC 4UB0L 3EYOA 4G3YL 5CZXD 2NNAB 3RKDC 3TPKA 4D9QE 1ZHLA 5DRNB 3S5LG 1A3RL 1A6WL 4WU7A 1EXUB 1EVUA 4PG2A 2CDGA 2X2YA 4GXVH 4P5TC 3O6FA 4S10A 3HLAB 4AMKH 1V7NH 2YC1A 5DHVA 1NFIA 1UZ6F 5FYKU 4CJ1A 5IB5B 5F6HJ 2DBJA 1FVCA 1JNNL 4P48A 5GJTH 4NCC2 3FT2B 2E27H 5FHBH 5I2IA 4KKCD 5GS2H 3BGFB 4KRPB 1IGTA 1JMZA 5HYQB 5IFAH 4K7PX 2K7QA 4OZGF 5E0QA 5MEOB 3GUTA 4ZQKB 3BQUC 4P9MH 4L8BB 4QRSB 2O5ZH 2UZIL 1FCGA 3TBVB 5E2WH 1TJHH 4YWGH 2BVQB 5FCSH 1HHIA 4G8GA 4TUOA 2A74A 3QDJA 5GIRA 3IFPB 3SDYH 4PRPE 3IDMB 5C3LD 3HNTH 4JDVB 5SX4I 3U7WL 3DSFL 4WEBL 5HHVL 4F37K 3NCMA 3UYOD 2JJWA 4XXDA 1AGDA 1ZT4A 5IKCA 4R2GD 3RWGA 1QBML 3HMXH 2XKUA 3MRPB 4MD5A 4LHJB 1OGAD 3MRGA 4DCQA 2D7QA 3MLTA 3BP5B 4PLKD 4Z7UA 5DGQA 1S9YB 1W0WA 1DANU 4QHNB 2BVOB 4LIQH 4U6HB 3BDYL 4HH8A 5SWZE 1P53A 4FQXD 4X5WA 3ARSA 1A02N 1NKRA 3PL6C 5HHPA 1DR9A 1V7MH 2QL1A 3SQBA 1PY9A 3D0LB 4ZUUA 4OCXL 1IZJA 4Y4KB 5DVLA 2HT3C 5FGCE 2GTWB 5FXCH 5C0BA 2NY2D 1IGJB 1B0GA 3GBNL 4PJFE 2MQ0A 2V2WA 3MLZL 2JELL 4Q6IA 2VXSH 3FTGA 4HLZH 2HJKA 3NIDF 3Q6FB 4NZUH 4CMMA 3PWJA 3RDTC 1WSST 5DTFB 3DSNA 1MIEH 1A7BA 5ICZA 4PRAA 3TYFB 2NZ9D 1HOCB 5EU6D 3QFDA 4OCSL 4Q9BA 4UV4H 3W0WE 2NYYC 3WE6A 2ITCB 5B21A 3KR3L 1MWAA 7FABL 2BNRE 3RGVB 4PD4K 1XIWA 5JLZB 1GZQA 1FG9C 2Q76B 2DL9A 2R0LH 4NZJA 3U9UB 1K4DB 3CDGB 5E99L 4X4YB 2WK2A 2YD5A 2NY4D 5CILL 3D39E 4UU9A 3P9LA 3WHXA 5KOVC 3CSYA 5EUOF 1INDL 2HWZL 2W0LA 1A2YB 3A6BH 3TN0D 3SDAC 1DUYB 1MFDH 4Q9QH 4TNWK 4NO2A 4LGSB 4NKOB 3BPLC 4R7NB 4XPTL 4JN2A 1G7QB 4B53A 4RQQB 3P4OB 5TF1L 4OLUL 3B5GA 1JNLL 3GMPB 3LKNB 3SKJL 4UAOC 2ADFH 4PYHA 3OSKA 5T33L 2CKNA 2XWBB 4L5FL 2IALA 1QOKA 4ELME 1F97A 4HJJL 1NDGA 3DETC 2ZKHL 3AVEA 5K9OA 5CEZD 4G42B 5IGXL 5DJAA 4WJ5B 5E6ID 1EHLL 1OB1A 2VDLL 3ARFB 4P46C 2QQNL 3T3PE 1DL7H 5DDHB 2CLZA 5IFJA 4OZHB 3W9DA 2NY5L 2X10A 5KSBF 1F2QA 5I16B 4OUOA 2WWKO 2CXGA 1PQZB 3K2MC 1C5BL 4LDOB 4OCRL 5IW3A 1Q0XL 1RUQL 3MRRA 3KPNB 1W8NA 4ZFOB 1JPFA 2LFGA 3ET9F 1J10A 4BUHA 1I3GL 5C0AB 1EJOL 3DO3A 3LEXA 4LP5A 3I9GH 4JVWA 5E94B 5GJSH 3T2OA 4EIGB 5HHQB 2CJUL 2VXTH 3DUSA 4M7LL 4WFED 1U8PB 3AREA 4L8CB 4UQ3A 4OF6A 4NHCH 4X8XA 3QWOA 3A6CH 3OKMB 2ZCLH 4R4BB 1YNLH 5JW3L 4GW4B 1QYGH 3PQYA 3DX9B 3QBTB 2J5LC 3GJFK 5I73B 5B4MC 3QEHA 4MDIB 1D9KB 4JREC 4XNMA 1EUUA 3PGFL 2J2ZA 3QDGE 3JV4B 3MV01 3LN5B 1KENH 4M8QA 4M5YH 1X5AA 3TJEL 4QT5A 3B9DA 1P84K 3W5MA 1OL0A 4FZ8H 3SHSA 4QXUL 4YR6B 3MJ9H 5C9JB 1P4IL 2W9EL 4LCCC 4P4KB 3MA9L 2AV1B 1Z9SA 2BY1A 3HCVB 4FQCL 4OD3H 1UWEH 3H9HB 3FKUS 1D7FA 5ESQB 4GSDL 2IAND 4JVUA 4FFYL 5JO5B 2ATKA 1L0YA 1UB5B 2JCCB 2JJTA 4CADB 3FMGH 3VXNB 4BQ8A 5DHYB 1MF2H 3VMOA 1NQBA 1DQLH 4IRJC 3G5XA 1OTSD 3TO2B 4OZGE 4LNRB 4NC1E 3HE7D 1RK0B 2J8UF 1LDSA 1ZWIA 1HI6A 4FQPA 2LE9A 4YXKH 4Y16C 4C56A 3VXMD 4PGEA 2QQLH 3CC5A 3BX7C 1UACH 4PLJC 5IB3B 3AROA 4D9QD 3OMZA 4YHPA 4CU7A 4HIEA 5EIQA 1KPVA 2AJZA 2FZ3B 5I8KH 3CFCH 1JHTB 3FRPG 3FZUD 1GHFL 1HDMB 3MQIA 1QLFB 2W65A 4PJIA 4CNIA 3MBEC 1R5IB 4HMDA 4CVZB 4PRDA 3CXHJ 1U3HA 3H3BC 4GS7B 1T2QH 1VKXA 3PGDA 5E8EB 2IC2A 1F90L 4BSWA 2X4OB 2A73A 2QV2A 3LV3B 2J3SA 4ZD3H 3OL2A 3S36X 1DTUA 1SHMA 2PF6A 3ULVD 1ADQA 2RHEA 1NEUA 2EDTA 4FG6C 4WW2B 5D2LF 1CDGA 2FJFA 3QCUH 1I7TA 4I2XE 3AGVA 3UJJH 1NCBH 1RZKC 3RWIB 2FATL 3P9WB 2BDNL 1OAQL 3UTQA 4OM1L 1U8MA 2CR6A 5INCA 2Q7NA 5C09D 5D5MB 3F7RA 4YXLL 5C0IA 1T04B 1CF8L 1OSPH 1FZJA 2CMRL 5TFSL 3NIDE 4UIMB 4OD1H 4ZTPL 2BNQE 5F3HB 2MMXA 2C3GA 4NC1C 2PUQT 2ARJA 4YH6A 3N1GC 4MNGA 4OKVA 2Y72A 1RVFH 4OTXH 7CGTA 2D0FA 4LCWB 4Y5YC 1H0DA 1RJYA 2OS7A 4JZJA 3IXAB 1HNGA 4FA8A 2NW2A 1X3DA 1L7IL 1NEZA 2AK1L 3C87A 4JQXC 4FFVC 3I50L 2KZ1B 5FA3B 3WHE1 1G9NH 1ZK9A 3SGJC 3OKNB 4BELD 1MAMH 4JRYA 2ICWJ 3MLSH 5EUOE 3VFWB 2Z0BA 2YK1H 4KK5C 2H6PA 4N9GB 5HGHA 3T3MF 3KPLA 4H1LA 1DSFL 2EXWD 2YD1A 3PIQB 2IADB 1RAMA 5FOBB 3DVFA 1B4RA 2O61B 4PJAA 1I7UA 5IB2A 1FRGL 3K81A 3L7FB 5I0ZA 4OZIB 1Y18B 3FQWB 2FRGP 4Q58C 3DROA 4M7KL 5BVPL 4P57B 1A9EB 1A9BB 1OCWH 2R4SH 3AMLA 1IEBA 3G9VA 4MAYB 4Y5XC 3BE1H 2FWOB 3VH8B 4M3JA 1FORH 3MRDB 4L4VD 3BIAX 1G7PA 4PJ5A 4ZQKA 4QRSA 3UBXI 2XG4A 5D7LB 1G6RH 5TH2B 3MBXL 1WCBA 3N1PC 3IFPA 3ZTJG 5H2BA 5IIEB 2IPTH 3TWCL 3NAAL 4V1DD 4PJGB 3MOAL 1LEIA 2J8OA 3SDCB 1PG7X 5IEHB 2CIIB 2WQ8A 3IU4L 4ZFZA 4EQ3A 4WFHD 1UENA 2DQCH 4PY7B 3GIVB 5EZOL 3RIFF 4UDUA 1Y6NR 2A83A 2NY1D 3MRKB 3MRPA 3E6HB 5AWNL 1YPZB 3WD5L 5L88H 4X9BA 3CFEB 1BLNA 3BUTA 1F4YH 4FXGA 3EOTL 2IQAA 1G0DA 1UFUA 5IT2H 4HMEA 1LO5B 3MZGB 4U6HA 1ZGLM 5D2NA 3QUZB 4KY1L 4RRPG 2GW5A 2R1WB 4OQ1A 3T4AA 4HZLB 5FGBC 1T5WB 1FFOA 1A7PH 4XP5L 3D18A 2AXFB 2Y06H 1GJIA 3W11D 2VDQH 2UWEE 1JFQL 4YQXH 3D0VA 3BESR 1N6VA 1RURH 3RJQB 3EAKA 2FBOJ 2VC2L 3QHFH 3QNZA 4NNPL 2YD3A 2NY0C 4PR5B 1VENA 2C4FT 2P7TB 3L1OH 1CCZA 4IJ3B 5CAYB 5KG9B 3R8BB 3U0TB 5HI3D 3O6KL 4HPOL 2YUXA 4NZTH 2A6KA 5DJDB 3H6JA 3SBWC 5KVEH 4O9HL 3QEUB 4POUB 3V0WH 4KZEL 4QRPE 2QSCH 1NMBH 4LPTA 3PHOA 3QAZB 4J1UA 5IWLA 1XGUA 5DSCB 1A3LL 1NMAL 3LN4A 3ORJA 2FECL 4N0YH 1S7QB 2GK0A 3HC3L 3U9UA 1IKFL 2HRPL 2PXYC 5GRUH 2J8UE 2OZ4A 4X4YA 4JDZB 3CMOL 4AYFA 3RWFB 3MJ7A 1XZ0A 4ZFFB 1FPTL 3RVTC 3HS0A 4H26B 1JNHA 2RB8A 1A2YA 4L8SC 1S7VB 1U0QA 5HDQL 5TQ0L 2PW1B 4G43A 5HVHC 1MJ7L 5HYJA 4RQQA 4J3SA 4MD4A 2QQQA 4KFZC 1WJ3A 1PG7W 4EI5D 1J8HD 2X4PB 3MNWA 4FQJH 1X5GA 3NFNB 4PJ9C 1TXKA 1JK8B 4K3GA 1RIUL 5BOZG 4U0RC 1Z9OA 4YJZL 2PN5A 1GAFL 1G1CA 1BIIA 1BAFH 2O26U 3U6RA 3TV3H 1NGWB 1OTUD 3ARFA 3CLEH 4KAQH 3OBAA 4WUKH 2OJZL 1I3UA 4HEME 3F12B 1IAKB 5F9AC 1EV2E 4D8PB 5J6GA 5IK3A 4MNQA 4Z7NE 1CGUA 3Q1SL 3CVHL 2RFXA 3HUJB 1O7SA 1Q9OB 5I1EH 2D2OA 4JM2F 1J12A 3BJLA 3DXAA 1VEOA 1XF2B 3KPQB 4HH9B 1UXWB 5TE4H 5HPMB 4HCRA 3N1MC 2J88H