2FWLB

The cytochrome c552/cua complex from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
YTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c-552
publication title The electron transfer complex between cytochrome c552 and the CuA domain of the Thermus thermophilus ba3 oxidase - a combined NMR and computational approach
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport/oxidoreductase
total genus 30
structure length 134
sequence length 134
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fwlB02
2OJ1A 4ENZA 1ILUA 2UXFA 1V54B 3ZIYA 1OF0A 5I5MA 5B1AB 1ASOA 2OV0A 1KDIA 1HFUA 2A3TA 4JKNA 5B7EA 4DP0X 1ET5A 1RZPA 3BQVA 1N70A 3ABLB 1PLCA 3CVBA 4HCIA 4A68A 2E86A 1ET7A 1KV7A 4DPAX 2N0MA 3EH5B 3X1FA 3UAAA 2H5UA 4KNTA 1GYCA 3NSYA 3T71A 3CDZA 3FSAA 4AKQA 2TSBA 1ID2A 1GS6X 3FPYA 1GW0A 2PPAA 4E9VA 1BQ5A 2IWFA 3WKPA 4KO6A 1PLBA 2BWIA 1F56A 1BAWA 2XVBA 1J9SA 1IBZA 3FQYA 4HCFA 3NJMA 2OCCB 2I7OA 3PXLA 4G70B 5B1BB 1AQ8A 2AFNA 3WI9A 7PAZA 2ZXWB 2QPDB 5AFAA 3AG4B 4YSSA 1PZBA 1SDDB 1AG0A 3NP3A 2P80D 1SFDA 1IUZA 1J9QA 2VSMB 4M3HA 4E9YA 3V9EA 2JFCA 4G7SB 4NB7A 5I6KA 2XX1A 1NZRA 1JZEA 1SF3A 1DZ0A 3NJGA 3QJQB 4G7RB 1V10A 3FYEB 2DYRB 1KBWA 5A7EA 2IDTA 3TBBA 4A2EA 3NSDA 2YAHA 4A2DA 2J57A 3ABMB 1OOWA 2IDUA 4YSRA 2XYBA 1FA4A 3S3DB 3TA4D 2VW4A 1FFTB 3FS9A 5I28A 1HAUA 2XLLA 4NERA 3SBRA 3IN2A 1AS8A 3NYKA 1A65A 2UX7A 1CYXA 4DPBX 1ZDQA 3NJLA 2Y1AA 1BXAA 2IH9A 1B3IA 1GY2A 2PP7A 4HCGA 2AANA 3GDCA 1XB6A 3QJSB 2IAAC 4F2FA 2BP0B 3JT2A 1SJMA 2IWEA 4AZUA 2P80A 2VSKB 3AZUA 3T6ZA 1AZRA 3ZDWA 1J5DA 1ET8A 2YARA 2HZHA 4HIPA 1J5CA 1W6LA 1NDTA 4KOBA 3FQ1A 3H4HA 4F2EA 2XV3A 3D12B 5B1JA 1FWXA 2PCYA 3EHBB 2MTAA 4N8UA 1NINA 1SDDA 1NWOA 1OCOB 1L9TA 4K9JA 1MZZA 2DV6A 4FA7B 2PPDA 4G71B 4Q89A 1A4AA 2YAQA 1A4BA 2FQEA 3MX0B 1JVOA 4CSZA 1KCBA 2VMJA 3SBPA 8PAZA 5I6LA 4UAHA 4F7KA 1ZV2A 1RCYA 1OCZB 3PAZA 4BWTA 3CG8A 4DP1X 4DP6X 1L9QA 3PCYA 1ASPA 3NJKA 1W8EA 4KOCA 5PAZA 4E9RA 4KO7A 1L9PA 1PLAA 4DP8X 2Y69B 3ERXA 2PP8A 3X1NA 5FC9A 4KO9A 4BXVA 3AG2B 1OE2A 1L9SA 3ABKB 3H56A 1QNIA 3HEIB 3ZBMA 1E30A 2CCWA 6PCYA 3T6XA 1AR1B 5I26A 4HHGA 3AG3B 3JTBA 1TEGA 3UGEA 2GB2A 2QPEB 3T6WA 3OQRA 1J9RA 2LLNA 3U25A 2YAMA 1TU2A 1M56B 3UADA 1AOZA 1ZPUA 1AIZA 2CAKA 5ANHA 1GS7A 2BP0A 3EH4B 4G7QB 2GSMB 2BZ7A 1SFHA 1EHKB 1TEFA 1AZCA 1JXDA 3NSFA 4HZ1A 4CSPA 2I7SA 4P5SA 3UACA 1BYOA 3KW8A 1JXGA 3AG1B 2QT6A 1MG2C 2ZWNA 4KNUA 2FT8A 4EF3A 1KBVA 3MBWB 7PCYA 1PCSA 3EF4A 1NIBA 1A8ZA 4BXSV 1PY0A 2FTAA 4P5RA 5I6NA 3WNJA 4WTQA 2I85A 3IN0A 3X1EA 2JKWA 3QQXA 1BEXA 1OV8A 1T5KA 2PPCA 3N2JA 3NT0A 2FQFA 1PNCA 1IKOP 3OMIB 1OE1A 1BQKA 4UF7C 2GC7C 3ASNB 1R1CA 2AZAA 1GY1A 3NJHA 1AANA 1IBYA 1SHWA 1E67A 1BYPA 3X2QB 4E9QA 5I6OA 3TASA 4YSCA 2FT7A 3NSCA 5I6MA 3NJNA 4E9TA 2IWKA 2EIKB 1I53A 1V55B 3CVCA 3S3CB 1AS7A 2DWSA 3PAVA 1E5YA 4HAKA 2GI0A 3DTUB 1AZUA 1PAZA 3QPKA 4WKXA 1JERA 2YXWA 4GXFA 4AKPA 5B1JC 2DWTA 2CALA 2VW7A 3FU7A 1GR7A 2VM3A 1CC3A 2HX7A 1ETJA 3X1BA 1NIAA 1PMYA 2HXAA 2BP8A 4YVNA 1NIEA 1W6WA 2BO0A 4UANA 3T9WA 2PCFA 1SNRA 2CBPA 4HALA 3S8FB 4YL4A 1A4CA 5B7MA 1NICA 1VLXA 3KW7A 2H47C 3QJUB 4A2GA 4GP5B 2CUAA 1SF5A 4GP4B 3QJTB 3WKQA 3CZUB 1CURA 1BXUA 4YVUA 1A3ZA 2IDSA 4DP2X 3SBQA 2HX8A 1WA1X 4YSUA 2J56A 4JHVA 1JZIA 2FNWA 4YSTA 4E9XA 5D4HA 1MG3C 3SQRA 1RZQA 2B08A 1ADWA 4M4RB 4RH4A 4A66A 4A67A 3WIAA 1CUOA 2FQDA 1YLBB 1JVLA 2X87A 3IEAA 3TU6A 4QLWA 1E5ZA 2EILB 1IC0A 2QDVA 1NTDA 2W8CA 1KCWA 1NIDA 3FSZA 2W88A 2IDFA 1BQRA 3NJIA 3AY2A 2YQBA 2PLTA 4KO5A 3DIVA 2J55A 2XU9A 3UAEA 5IY5B 4DP9X 3OMAB 2GHZA 3PPSA 1JZJA 1NPNA 2BWDA 4GP8B 4E9SA 4W9ZA 1KGYE 2EINB 3FSVA 1WA0X 3FU7B 2GC4C 3X1GA 2DYSB 3IBOA 4BDVB 1DYZA 3QJVB 2AZUA 2FWLB 3ZX1A 5TK4A 4YSQA 2HX9A 3AW5A 3QJRB 2HRHA 1OCCB 2BP8B 2Q9OA 2YAEA 1AG6A 1PNDA 1AZBA 4HHWA 3FYIB 4AKOA 3RYMA 5I6PA 3CVDA 5LDUA 1ASQA 4QKTA 1XB8A 2VM4A 3NJFA 2GIMA 2YXVA 1JZHA 3UABA 1JXFA 1AS6A 2PP9A 3S3BB 3FQ2A 1TKWA 1URIA 2EIJB 2VW6A 3FT0A 4A2HA 5PCYA 4AX3A 1OCRB 2IH8A 5AZUA 6PAZA 3T6VA 5E9NA 5F7AA 5I5IA 3C75A 1JOIA 2XV0A 4DP5X 3GXUB 1PZCA 2ZONA 2BHFA 9PCYA 4DP7X 3TBCA 2UXVA 2UXGA 3V9CA 4YSPA 3OD3A 5B7FA 1J9TA 3IE9A 1NIFA 2Q5BA 1CYWA 2QDWA 1RKRA 1L9RA 2UXTA 2YAPA 2X88A 1L9OA 4GY4A 2B3IA 4TXVB 2BW5A 1KYAA 2ZOOA 3WG7B 3S8GB 5EHFA 2WO2B 4BDVA 2PPFA 5F7BA 2HLEB 2YAOA 1HAWA 4YSAA 2FJSA 3OM3B 2J5WA 4A2FA 1M57B 2WO3B 1JZGA 3G5WA 5I5JA 4AI7A 4W1TA 1KDJA 1OE3A 1ZIBA 3PLYA 2R7EB 4PCYA 1EZLA 4L0PB 4BWWA 4YSEA 3N55A 2HRGA 3DKHA 2AVFA 3FPXA 3PAUA 3NP4A 3ABGA 1GS8A 1MZYA 2EIMB 4G72B 1N68A 2XX0A 1X9UA 1PZAA 3WNIA 1ILSA 3EH3B 3HB3B 3FU9A 2DY2A 2XXFA 5D4IA 2UX6A 2XWZA 4YSOA 5B1KA 1AACA 1WS7A 2IDQA 4X4KA 1XB3A 3ASOB 1BXVA 2RACA 1GSKA 2GBAA 2H3XC 3GYRA 4ZK8A 2JXMA 1UATA 4GYBA 2XUWA 1WAEA 4YSDA 1QHQA 4DP4X 2BW4A 1X9RA 2TSAA 3NJJA 4N4YB 1ZIAA 1WA2X 4JHUA 2XV2A 3CDZB 5TK2A 1AZNA 2PPEA 4FAAB 3H4FA 1ZDSA 1QLEB 3FSWA 1MDAA 4KNSA 1NPJA 1XMEB 2WSDA 2XXGA 5B3SB 5AKRA 4BK5C 1WS8A 1M9WA 2YAFA 4PAZA 1JZFA 2R7EA 3BVDB 1AAJA 1NWPA 2FT6A 2NRDA 5D4JA 2FQGA 3FU8A 1SHXA 1E65A 4Q8BA 4BWUA 4E9WA 2BZCA 2MRYA 1PF3A 4NAJA 3L45A 4DPCX 3OMNB 2CJ3A 4MFHA 2VN3A
chains in the Genus database with same CATH superfamily
2OJ1A 3ZHNA 3BD3A 4P5KB 1AR1C 4TVPD 5KN5B 4L3AA 2X3AA 3W2DL 1I9RH 2FBJL 3C8KA 4BSVB 4UIMB 1U8OB 4L4VB 5FUCC 3EJYD 1UXWA 4M7JH 1ET7A 3GMQA 1EPFA 4H8VA 1H3UA 1NCBL 4RMVA 5E1AA 1JPFB 3O4OC 3NZ8B 5IK3B 5C09A 4CJ1A 4KJQD 4HUXA 5F7KC 4FZEL 3BT2H 3T2NH 4IS6B 4KNQA 4R26L 3BWUC 5TQ2L 4OZGA 1INDH 3VW3L 3GSXA 1A6ZB 4OLVL 4ODUA 2CO4A 1MFDH 5A16A 3QRLA 1M7XA 4MDJA 4X6DE 5GGQH 4GSRA 5ID1B 2FVNA 4Y4KD 4WUUE 2OMWA 1VERA 1F56A 3FQYA 1J9SA 4IKNA 1EXUA 4IOFD 5KVDL 4U2ZA 1K5WA 3U4KA 4UNIA 3PXLA 3ZZ1A 4U7MA 5J11C 4LOUC 4MJIE 4D2NA 2H0FA 1PEWA 3BGFC 1NSNL 4NIKB 1MFEH 3GJEA 1XH3B 2X4QA 1BPVA 5LNGA 3JTTB 5IHUL 5D1XD 2FCBA 3WS3A 1TTFA 1NC2D 3CBRA 3BWAB 5KBPA 2BRQA 4HG4K 4WW2A 5FB8B 1H5BC 1WG3A 5SWSE 3SDCB 2VDQB 4C4KT 1F00I 4TNWK 5I6KA 5L8KB 5DRNB 2W59A 1YHPA 3TZVB 3HFFA 1ECZA 5BRZB 5LO7A 3ULVL 5FGBA 4FDWA 4FL4C 1I31A 3JZ7A 3V5HB 4D9QD 3WUWA 1IAOB 3ENEA 5H94B 1FO0H 4XHJC 2X4SB 2DQJH 3IMVA 5FM5O 1EEUA 3LZLA 3OTTA 1U8IB 2XG5A 3GC3A 3QEUA 4JM2C 4PB0L 1FYTE 1YY8B 5EDSA 2CGRL 4ZMVA 4U6VL 1HVXA 3GSNL 1S7UA 5FGCE 2NX5D 3ISRA 2F1BA 4FEMA 4LVNC 3MJ7B 4XP6H 3MCLH 2FLMA 4G8AC 4RFNC 4QHUB 3FAWA 1ZDQA 4JANB 5A2BA 2IH9A 4H8QA 4RFOL 4XNAA 2ODIA 4L1LA 4MDIA 1O0VA 4B95C 1U36A 4Z0BL 4EOWH 1I9JL 4JQIA 2FEJA 2WKGA 4JPQA 5HGHB 3EOYG 1GTNA 4HIPA 1AGCA 2Z0BA 3FQ1A 2XV3A 5FYJD 3BWUF 1YA5A 1CLOL 2DIJA 3N40F 4OQTH 1KCVL 2MTAA 1QZ1A 5EUOE 1MWAA 2DYPB 3FTXA 3P54A 5IROC 5E8OB 2ZTBA 4NT6B 1FG2A 1ITCA 1M1SA 4ZX5A 1XGYH 2K7PA 2YAQA 4JN1H 5B39A 2P5WD 2E7HA 2GAZA 3ARFA 1N19A 4HFWB 2YA0A 4FTVD 4KRMB 1OCZB 25C8H 2DLIA 3DX0A 3BLKA 3FT3B 3FRPB 4JFEB 5B3JE 5C7XH 2QSCH 3ME0B 5L6YL 2GVYA 4CA4A 1DR9A 1TENA 1FV1A 3DX8A 1PLAA 3QO1A 2CIKA 4L9LA 2E6JA 1KIQA 3VI4A 5C70A 1A3LL 2AABH 4PFEA 5IB2A 3T5WA 2BMKB 2D4DA 2V9QA 4ZQKA 4R90L 2O5ZL 3CN1A 3EO1B 1QLRB 3IMRA 2AF2A 1KCKA 4N6RB 3VH8G 3V6OC 1KC5H 3LHPH 3N42F 4LRNL 4TVUA 1PZSA 2GCYA 4YQXH 1JK8A 3RVVD 4G1EB 1IGMH 4EE2A 3UGEA 4EZMA 4YIQA 4IBUA 4PTUB 1XR8A 4C55A 1PYWB 1ZS2A 2HRPL 2Y07H 4JZOA 3FU0A 3QNZA 5ITFA 2K7QA 5I71B 1AIZA 4PBVC 3CHPA 4NBZB 3QRFM 2CAKA 3LKOA 3VSUA 4ZMWA 3BH8B 4MS8D 3QZPA 3KYKL 5EOQH 3BLBA 3GUFA 5BJTB 3K6NA 1YN7A 2JSFA 4FI7A 3OPZH 4XH2B 3U9WA 1QYGL 5IR1B 1BYOA 1JN6B 2G60L 3O6KH 4LCWD 5DR5H 4UOJA 3BN3B 1R33A 2W91A 1KBVA 2B14A 3AY4A 2GY7B 3KG5A 4IIQB 3TWYA 3V6ZA 2IGFH 2DOCA 5ISZD 3OBAA 4NYLA 4PH8A 2JELL 5E2JA 5F8QC 2DM4A 3GXTA 4WU5B 2J88L 1NAKH 2UYLB 5I15H 2HH0L 3GZOA 3ARPA 1TZOA 3CFCH 3O9WD 2LTQB 3VXOB 5CM1A 1C5BL 2ZCKH 3AU0A 3OMIB 5C0IB 1LE9A 3F85A 2QV2A 2EEAA 3R8QA 3X2QB 4QOKA 3LQAL 1TO4A 1CXHA 1N5YH 3PY9A 4PQXA 1OQOA 1AXTL 2ZD0A 5AKTA 5T33H 3PYCA 4M93B 1HL9A 1T1XB 4TNFA 3DMMB 1OCWH 4N0UB 5IOPB 3TONA 4LCCA 1PAZA 3QPKA 3IGLA 3V0GA 3HRZA 3LIZA 3RPBA 4FQCH 4OW6A 4LLVB 2CLZA 1MCIA 4R5XA 5IG7B 5J6HB 4HWZB 4U6YB 2ODHA 3KGTA 3OXRB 4H20H 2OX5B 1WV7T 5EU4B 4O2CA 3IJSA 3TIEB 4P9HC 3VUAA 1HOEA 3BUYA 4OFDA 3T0VA 3AGVA 1W6WA 5CIPA 1E3XA 5F7DA 1KPUB 4RMTA 2J8UE 2CBPA 4MRCA 1NC4D 5ANME 4QNPE 4Z7UF 1YY9C 3UEQA 1PCXA 5CCKH 1KGCE 3O8XB 5IBTL 5FPIA 1U6AH 5T1MA 1EGJH 4X6BA 3VYNA 4Y1AA 3BVVA 5IVXF 5T3XD 3QH3B 1X6LA 3BQUB 4OVVA 3BUTA 2E47A 1IC5H 1L6ZA 3TBSB 3GMNB 2HT2C 1TQBB 4HXAH 3D4CA 4PREA 1U21A 3L3OB 4ZX4A 3K80A 1DVFD 3FT1A 4JFFD 3U46B 1G1KA 1KF9B 1BJ1J 4JO1L 3KGSA 3KXFB 4TVSa 4KI1A 5F7NC 3ZKMD 2BDNL 1EEQA 1SVBA 2OM5A 2YD0A 4GRLD 5DD5H 3RNQB 1O9ZA 4E68A 4XCYB 3KPNA 1LXMA 3GRBA 3C9NA 1L0PA 1WWWX 4KFZC 5FK9A 2HFFB 1F42A 1LO5A 2HA1A 4YPJA 1HWWA 4LL9A 1Q0XH 2YUZA 1TJGL 2VMEA 2XVKA 4GSXA 3K6OA 4OSUH 1JTOA 4MMZC 1Y7VA 2B0SL 4OLXL 4R5TA 5AW3B 1R3LB 1TMQA 3NJIA 3AY2A 5DJXB 2FL5B 2NSQA 4O4YL 4PJEB 1FORL 4BH7A 3U0PA 5HDWA 2AQNA 2XU9A 2W0KA 3FN9A 4DP9X 1HCYA 4HJTA 2HFTA 1CE1L 1KFAH 2ERJC 3D2UD 1XAKA 3QQNA 4HKXB 2CUHA 4W70A 4LLDA 1P7QD 4X4YB 5I9QC 2L4OA 2P7TA 2VZTA 5TK4A 2OK0L 4NP9A 3FB5B 2BSEA 3IMBA 1DQDH 3JZYA 1DBBL 3WIFA 1ZLEA 1ZS8A 5TDOA 2W0LA 5F3HB 4PRPD 2Y7OA 3LQZA 3TEWA 4NM4L 3QI9A 3AREB 4QKTA 4HJEA 1LHZA 2CG9X 4LMQE 4DH2A 1A6UL 5F9WC 1G0XA 1KIUA 1JUFB 2YUVA 4JY4A 4WFEE 5EPMB 4OZIA 1QRNA 4PBXA 4ZXBC 5ABAA 5ILTH 2NPLX 4K9EL 1N5YL 1QEWA 3QQ3A 1CS6A 1OSEA 2GTZB 5F7FA 2PTTB 2VGLM 4GUQA 4OD2B 5ECJE 2P26A 5I18L 5TGBB 1OGAB 1BMZA 1QSEA 3Q3GA 1MCSA 2C9SA 4WNQA 4WQOA 4R4ND 3INOA 1EEYB 4MQSB 5EO9A 4YFLF 2IDCA 5GRWA 4ERSH 3H9YA 4GMTL 3LXCA 3ZKSD 1HL8A 2DDQH 2WXOA 3EYQC 3CZJA 2X4OA 3RWCA 2V17L 1J1OH 5CGMA 1U95B 5L2KE 2CUMA 4B7IA 2XJKA 3GPSA 2JXMB 5IBUB 4I77H 2UV3A 1IX2A 3FL7A 3MRDB 5L8LB 4NO2A 4JRXE 4JKKA 2WQWA 1U91B 3J8F7 3SE9L 3DNKA 2PXYD 2O72A 3GM0A 2R0ZL 4IK7A 4Q9BA 1KCUL 2OQJA 1G7QB 4EVNB 3CH8A 3WG7B 4ZNEE 3H42H 3BH9B 2PETA 4OBSA 5KS9B 2UVEA 4XCCH 1JZ4A 1QP1A 1FN4B 5D1ZC 3S5LB 5EEYA 3LKRB 1GW6A 4PJ8A 2TAAA 4EN3A 5K9QI 3QWOB 1Q9OB 4PCSA 3UJJL 2R2HA 3VXSA 3ZIMA 4Z3EA 2G3NA 3BRDA 3N50A 3PJNA 3QYCA 3N41B 1ZT7A 2C26A 4UDTA 3T4YA 5E4OA 2VZVA 1A1MA 5HY9B 1BZ9B 4YDJA 3NRFA 1ZLVK 2NUTA 2EUXA 1QUNB 4DGVH 3BZ4A 1IARB 1NAML 1XR9A 4KKNA 4AVJA 1X9UA 3VSQA 3VFNA 1IGIL 3RTQA 2EYRA 1XIWC 4R4BB 2HAZA 2PO6D 2XWZA 4Q58C 1TYJA 4OCRL 1XF3B 3X11A 2K3TA 3EFFB 3LRSB 5IQ7L 2IDQA 3B43A 4OF3A 4OKVB 4KVNH 4UTBH 4ENED 1ZLWH 1PY4A 3TIDA 2ZX6A 4PP1C 3HE7D 1CN4A 5LCVH 3HMXH 4APXB 4HC1H 5EU3A 1DQVA 1OP5H 4UB0L 5E51A 4J28A 1WAEA 3CQPA 4RWYL 4NNYA 5I16B 4B27A 1BZ7A 1HI6A 5DJ2B 1RZFL 5GIRA 4X6EB 2EYTB 4YBHA 5BS0E 3DX6B 4URTB 2PCPB 1JTTA 1WBYB 4L1TA 3KWTA 3VFVA 4CMHB 1CG9A 3GMLB 1C16A 2NXYD 1MCHA 3E2HB 5IJDC 1I85A 3RVUD 1CICD 3VXQB 1M2OA 2EDRA 5B3SB 1FNGA 2DBJA 2JIXB 3N1QC 4BK5C 1P84J 3DOHA 1BLIA 4PAZA 5DYOA 2HJKB 3ZKQD 2OMYA 4NN7B 5LLIC 4PWEA 2E8YA 3ZKXC 4XNXL 1JAEA 3G04B 3WFCH 1GIGL 4QT5B 2R8SL 2X2YA 2XKUA 1IQDB 3IXTA 1YNKH 4PRHE 4TKWA 4W9DC 4J5VA 4E9WA 1SXBA 3QC5X 3VXRD 5GRJL 4DPCX 2EEFA 2CBMA 2EXYC 1KT2B 1VB9A 1FNSH 1U3JA 1M9SA 4CU8A 1MCPL 5INDB 4ZMXA 1ASOA 4HGKC 1VEMA 1DQLL 1KPVB 4Z7OE 5CJOL 5B7EA 2F9BT 1G9ML 2XICA 5E23A 1A6AB 1ET5A 3T09A 1FZKA 3GMMB 4K15A 1N70A 2G75B 1RLBA 2CDFB 1QEXA 2P42B 4R8WL 3SOBL 4NKDB 1Y18A 2LVCA 4Q4EA 5I30H 3DI2B 3V5KB 4TLUA 2QQLH 1D5XA 3OJMB 1BGXL 4P2RD 2H5UA 2IO5A 4N0RA 4XVTL 1KOAA 4ELMF 4KKZA 2FX9L 2WPGA 2HG5B 1VJSA 4PJ7F 4DKDC 2DMGA 3DJZA 3MJ9H 2OL3L 4GPVA 4P23B 5C7XL 4LVHB 3C09C 4OCWH 2QSCL 2IWFA 3FRUB 4OM0L 3NFNB 3PPEA 4KO6A 4NZJA 2CJTA 4P5TD 4X98A 2VLKA 3LH9A 2GSIB 4AL8H 3ZR6A 3SE3A 5C8JB 5DJ6B 4J12A 3IDNA 4PJHE 4QRSA 2QTVA 3UPRB 2RBLA 5C0CA 2XPZA 1H15A 4HOZA 1OB1B 1AD0A 1WAAE 1O9VA 3FCSA 4BZ1A 1X5HA 3IJYB 2GJ6E 4J3VA 3ZR5A 2NY2D 2LLLA 1I7TA 2P24A 4I9WD 3JVFC 4PGCA 43C9A 1AG0A 2A9DA 3CCHA 1Q90A 3MGOB 5DC9B 2NCEA 4JG1H 4BH8A 2Z35B 5DD0H 2VMCA 3PF2A 4FJYA 3STZA 1FFQA 1MCKA 3FFCA 4ZFFA 3G5VA 1QFWL 5EOQL 4L8SA 3S37X 1AQDA 1U8KB 1C12B 2QEJA 4PP2A 5C0BE 4G43B 4M7LT 4CVWA 5AL0A 2W1NA 3K72A 4ZS7H 3VD0A 3O6KL 3ABMB 1I1FA 2WLHA 3QFJA 3SKJL 3W81A 2H6PB 4APQA 2VCOA 2B9AA 3QJFB 3WD5L 1H3PL 1P84K 3L16A 5JQIB 2XQBL 4UIKH 1JVKA 3FS9A 4B3VA 1LEGA 1N9PA 5I1KH 1ZTXE 2CWRA 3LB6D 1YEGL 1E5CA 1L0YA 4UAOC 1I4FB 2WBKA 3V0VB 2ATPA 5ETUB 2Y1AA 4ZUVA 1I9IH 3C5ZA 5D96B 1KBGH 3QQ4B 4ORGA 4WV1C 5IUSA 1XB6A 4MBRA 3QUZB 5EN2A 3DRQA 1P4UA 3QISA 1BVLB 3T6ZA 1YMMB 5AG8A 1V5JA 4GAJH 3ZTJG 2HPOA 4WFGD 1E6OH 1W6LA 1KTLB 1ZPLA 2Y25A 3BX7C 3CBKB 3H4HA 4KOBA 3AQDA 3PGCB 5EOCH 5L4JA 4EI5A 1U8JA 2DMHA 4G8FB 2WIIB 4JDZB 5MEOB 4L29B 1N59B 5GGSB 1WWCA 3ESPA 2UVFA 2F53E 3FN3A 4FERA 2V2XA 1KGIA 5CSZB 4N8VG 3IVKB 3HC0B 2XXCB 4ZOEA 2VLMD 3DI3B 1A66A 1A3RH 2A1WL 4CSZA 4QEGA 3US9A 3WEXA 1KXVC 3QG7H 4I48B 3CK0L 2ROXA 3LS4L 3X3FH 1SPDA 2KT6A 2XTJE 1ASPA 1ZVSB 5D7KE 3RGHA 1MWOA 3SDXE 4AYFA 4E9RA 1A4JB 2K1MA 1Z0NA 1TG8A 4K23L 1RPKA 1J1XL 1SUHA 1FFNA 5AVXB 3SQOH 4HYTB 3MLSL 1MSPA 3LKNB 5JA9A 1RV6X 4HS8H 4PJAF 3NK4A 32C2A 1DUYB 4JFED 4X5LA 2VDKB 1EGJL 1FFPB 2K9UA 2VL5B 3MC0A 3KM1A 1URZA 4M7LL 3QFGA 1UQSA 2CHZA 1TTUA 1C08B 1T5WB 2IBZY 4LPVA 4FFTA 4ONHA 2OULB 5BUPA 1NGYB 2QQKH 1RPUA 4HWNA 1IC5L 3MXWL 4JRYD 2CDGB 3D0VA 1I8MB 3L3DA 4D8PB 4J7RA 5GZOD 2GY5A 3GSUB 3SO3C 1HXMB 3IFPB 1XGQB 2AITA 3M17B 2VYRE 5EU6D 4JQXA 1Q72H 3MYZA 4KTEL 5LB1A 2IQAB 1HZHH 1AO7E 4WFFE 4YHYC 2H9GA 2H32A 3BUIA 3FB7B 2YC1A 3FOLA 4NC0B 5TF1L 1E0OB 1NCWL 4HZ1A 2P45B 1DBMH 3EBIA 1N5AA 4JHWL 3WNMA 2LLGA 4HW6A 4S10A 1XTLA 4YUEL 1KY7A 1XO8A 3QHZL 4NWUH 2VLRE 2AJUH 4HF5H 4M48L 1NUNB 3H2QA 3QBTB 5H8DA 2H1PH 2Y5TA 1VENA 3L7FB 1EO7A 3EF4A 1T2XA 3UTSA 4F7EB 1S3RA 1A8ZA 3KLHD 5I6NA 4P5RA 2DEXX 2DQCL 1NUFA 3IN0A 4YE4L 3QQXA 4LLMB 3UAJD 1RZGA 2LE9A 4YGVB 5DHVB 2DBLH 1BWMA 1QTYT 1FYHB 2J21A 1KFAL 1L6XA 3OKKA 4PIRF 3IDJA 2XZAL 5GSVB 3BP5B 1A7BA 4GO6B 1T89C 2DTML 4LSPH 2WWMC 5IMKB 5IP4A 5KOVC 1QOKA 3EYOB 1FL3A 2IOIA 2EEDA 5CJQL 1JERA 6TAAA 1WFIA 2B20A 1RIHL 2E6PA 1CC3A 1HC1A 2YN5A 5C0FB 3WSQH 3B9KB 1BEYH 2A6IA 3VU1A 1D2OA 1KJ2H 3PNRB 2R1YA 5BOZG 5IEHA 1RJYB 3ILDA 3MRMB 3VCLB 1VCBC 1F11B 1CIUA 4B3EA 2JI1A 3DMMD 2V7NA 4FP8L 3L3HB 5IF0B 3QWQB 3SDCC 3V4VL 3DSNA 1SJVA 1GPOH 2YPLA 4L37A 3TZVC 2F15A 1ZTXH 4IU2A 4EXPX 4HALA 1S5HB 3LKQA 3W0WA 5DI8B 1E3ZA 3PL6B 1MNUL 4KKPA 4DAGH 1X7SA 2R59A 1A5FH 1YQVL 5GJSL 3TBYB 3AWGA 1IE5A 1KMGA 3B2VL 4IRZL 3T2LA 1A3ZA 3BO8B 3SKNA 1WBXB 1OW0C 1B0GB 2VDOH 3GFUA 5E8PA 3O8XD 2B39A 2J56A 3BWSA 5FYJU 4HVBA 5BRQA 1HH6B 1J7VR 4ONFH 4K8RL 5T3ZD 3ZYZA 5E8NA 1GTFA 4ALAL 3ULUE 1ZXKA 1JRHI 4AEIH 3BQUD 1FL5B 1MW0A 1YEDA 4P0DA 3VH8A 5HDLA 2NY0D 2HUEA 3RX8A 4JFXA 3V0EA 2IH1A 4HUWB 4MNQB 5F6HJ 3MNVA 3CSYB 4GO9A 1KGUA 2IVFC 4FRWA 5DZLA 1FZJA 2PTVA 4XBPB 5AALA 1JGLL 3ZK0A 4MJHA 4Z9KB 2AEIT 4N22A 3RDJA 1GYUA 3JUYA 5EA0H 3L4YA 1T0MB 1FBIH 4KBPA 2ED8A 3VD2A 3GS7A 2P48B 1NGXB 5IESL 1VKXA 3NCCB 2OSXA 1F90L 1SEBB 3GSOA 2GYSA 4P8QA 2EINB 5AG9A 2IV9A 5FR3A 5H35A 5D7LB 5DD3L 3EDFA 4OZHA 3RUGB 1FGVL 1I8AA 2ITCA 4PW9A 4KVNL 4N90D 4A7GA 2DTSA 4MASA 3SGKC 4KK5D 3JBG7 5AEAA 5AWNH 1PL3A 2PWEA 2LVEA 1T20B 5T5NF 2ZNXA 1DFXA 2GITB 4UU9B 4ABQA 2VSCA 1BBDH 3K7UA 3TV3H 3BPLB 4X80H 4ZUTB 2VZOA 5D9SB 1ES0A 3L3GB 3VWJC 3RKDC 1QFHA 4L8DA 3KM2A 4AIZB 3T8XA 5SX5K 1MPAH 4WEBL 3WXVH 4L3CB 4I1PA 5HDBE 3DO7A 4WI2A 2ZX9A 1XGZA 4QUOA 2WINA 1PD1A 4KVCH 4XC1L 5AZUA 1AR2A 3CXFA 1RVFL 2D7TL 3NGBB 3MJWA 5FDYA 3UH8A 4FXKB 5IQMA 1I7RB 5HHVH 4EO5A 4F7PB 4RGNE 4O2FB 3LSOB 4GKOA 3QIWB 2F08A 2GK0B 4PJGA 2X4RA 1PEZA 3GMPB 4J3TA 5KSUB 2UXVA 1MRCH 1JZ2A 3VFSA 3SPGA 1V7ML 3QNYB 3ZQXA 5IGXL 1OGAD 3LNFA 5L4FA 4P2OB 2BS71 2WZ6A 4HIJA 4WI5A 1CLYL 1MN4A 1YC7A 5DSCA 2VDRH 5FHBH 4BHUA 3CX5J 3GXIA 4OY9A 2X88A 4DETA 1Q1PA 5FS5A 1V05A 3ZQ9A 3QYMA 2HTKC 5JXEA 4P59H 3E7JA 3R06B 1JHTA 4OIAA 4YR6B 3TLRA 1WCBA 4D3CL 3JQOB 3L6FB 3MBEB 3NRPA 2JH2A 5FO9A 1U3NA 4LP8A 4TLSA 5GS0H 5CEXB 1WIUA 1K4DB 3IU3A 2A4CA 4BE5A 2FZ3A 3VAEA 5IMLB 1RULH 3PQYB 1HHHA 4Y9GA 1TJHL 4KK8C 2WO3B 4M93C 5E9AA 1FNFA 5I5JA 1KDJA 2FGWH 4X0KB 4OLYH 4P4RA 5HYQA 2C3VB 2KDGA 2V9UA 3E80A 3IDMA 1SOQA 3QJHB 3K2UH 3T77A 5JHDA 4MJ5A 3N55A 4HLZH 4LGSB 3ZHFA 1N67A 1WLHA 2ZOKB 3FPXA 2FO8A 3KPSE 3ARFD 4GBXB 5DJYA 2M2DA 3PP4H 3QK0A 2CKBL 4PRIB 5E1GA 4NCDA 5AVRB 2TRYA 2UX6A 4FFYH 4YSOA 4PJXE 1BIIB 4GI8A 4V2CB 4NNPL 4TULL 3TURA 1VRSA 3LAFA 2Q6WA 1CBVL 4WZ9A 3PU7A 4EQ2A 3O41A 5DWPA 4LASL 3ZDXE 3WE6A 4DZBB 1Z9SA 1UWGL 4Y2OB 5C08E 3X14B 2WAQA 5C0AB 4P2QE 2YLHA 4HK0A 4Z7VA 3ULUH 3F58H 4H8PA 3ZTDC 3TV8A 3Q8AA 1O7SA 2X6UA 4EJ1C 2YGNA 2VZUA 4M5TA 4D0CB 2G5UA 4ZPTB 1FO0A 1X9RA 4C59B 3INUH 5EZIL 1WA2X 1DN2A 3HR5A 1FVCB 1U42A 1T22B 2APFA 5TK2A 3BDXA 1A7NH 4FS0A 2R1WA 3QEQB 3RDTD 4PJCE 3WNLA 3HRPA 3I50H 2ZG1A 4Q6IB 4YC2B 4JKPH 1RL1A 1TCMA 4MZIA 3C6SA 3O6LH 5JXAL 2J71A 1ED3B 4UT6L 3BCFA 3TF4A 3QUHA 4Q9RH 4W9FC 4LZKA 5T8IA 2BCKB 5KSBE 2DQHH 4MD4A 1QFUH 3UIZA 3MO1B 4MAYB 2Z9TA 4FMKA 5DFWH 2P47B 3CFQA 2CR3A 3CZFB 3CVHH 4NP4L 5C9JB 4FXLA 4Q6YA 3GHBL 4KJYB 4OQTA 3ARBA 2RALA 1LO2H 4GXVH 1V54B 3ZKNC 4RA3A 3UBHA 5J6SA 1QSFA 4GAJL 4TQIA 3MRHA 4YHKL 5GQBA 4HHAA 4JDVA 1I7UB 5HD8D 4IRJA 1RUKL 2JNZA 4JO2H 2F19L 1CDUA 4KQ4H 3T1FB 2Z31B 3QIBA 1F8TH 1I1AD 4FQXA 5E6SB 3MRPA 3BP7A 5JIKA 4AQAB 3D4ZA 1MCWM 2GFBA 3FF7A 1IBDA 4KNTA 1FGNL 3N1PC 4AT6A 5DD1H 4YDVB 5DT1H 4NAQA 4PBWD 4PGZA 3AREC 1CZ8L 1TZIB 4GQ9L 1ID2A 2B4CL 1ZHNA 5I1GL 2DQ6A 4B9IA 2Q3ZA 3GSRA 3SDAB 1R5VB 5KJ4A 5LKNA 2JKLA 5I73B 3AXIA 1WCQA 2WUCH 5B1BB 4KITB 1TLMA 5C0DB 2AFNA 5ICYB 4OZFH 4IEFA 4PS4H 5K39B 2EIZB 2WCGA 4P23D 3BYTA 1QBBA 3OF6D 2EUZA 1JBJA 1IBGH 3HC4H 4FYTA 5SWZB 1N0LA 4G42A 1NMBH 4XPFH 3RWDB 1H6UA 3FB8A 4FHBD 1I3RA 2X1OA 4Y1AD 4AW7A 2JFCA 4WK2B 3O3UN 4NRXB 2CZNA 1W2KT 1XD1A 5AAPA 2Y5QA 4F7TB 5K9OA 1A7PL 3FU5A 3GIZL 3Q5OA 3OZKA 3CH1A 1VGEH 4KTDH 1LNUA 2E4TA 3HZKA 4X6DA 5AVQB 5L2JB 1FSKB 1ZLWK 5BQ7A 5TPWL 1XDTT 4WUUA 3NSXA 1NCIA 3F04A 3GJFH 2ROYA 4JRWA 2IQ9L 4PB9H 4XXWA 2IBGA 4OGXL 1OP5K 4GG8A 4MJIA 3OX8A 1E9OA 4B9YA 1FNHA 4GMSL 5CZXD 4R7DA 3TA4D 1DO5A 4PJEF 3L9EA 3D18A 3L9YA 4XNBA 3IB4A 3VD3A 2UX7A 2XFGB 4JCWA 3QFDA 4GSDL 1O6SA 1B3IA 4ZW7A 2XWXA 5SWSA 3WJMB 3MU3A 1UA6H 3G3LA 1B4JL 2LV4A 4HT1H 2IAAC 4TM9A 5D8JL 5DK0B 1NEUA 3MNDA 3ZMEA 3LVEA 2XQYG 2YARA 1HHJA 4ZW3A 3O11B 4MMYB 4KXDA 1CCZA 4PS8A 1OQXA 1PPIA 1XSKA 1U8MB 1YO4A 1IGFL 3X13A 1R5WB 3UO8B 1FCCA 1ETB1 1NWOA 3BXNA 1MCEA 1FYTA 4I1RA 4HD5A 4U2YA 2BSED 5E6RB 1YEFH 2WLZA 3EF7A 4UAHA 2W0FA 1J10A 5BV7H 3ZUNC 1RCYA 3ARTA 3PAZA 2W0PA 4Z7QE 4JREC 3QI9D 3SPVA 4NI3A 1MHPH 1EGJA 3BPCA 3WFZA 3MV9A 1QRND 4OCXL 5KSAB 3RWIB 3ATBA 2ZXBA 1OAUH 3I6KA 3ATAA 3MZTA 5H37H 4NQDB 4PRAB 2W5PA 1BX2A 1CE6B 3M45A 2DZEA 4WU7A 3OC8A 4CMHC 4KQ0A 1NANI 1QNIA 3D07A 3ZBMA 1QSED 5FO8B 2F7IA 4HLZG 5I82A 5KANI 3GRWH 1E4JA 1G9HA 1UD6A 2EDKA 5EUOA 1FNEA 4E41E 3QHFH 3K6SA 5EMYA 1T66C 1TU2A 1M56B 4UOQA 2BM3A 4I3SH 4R3SA 4YBLC 3NUKA 4LGPB 1GH7A 2D31B 4M6AA 5KS9F 5DHEA 4X9BA 1KLFA 2BSTA 5DHYB 3TCXA 1QFWM 3O2WL 4QI3A 3CFJA 4NQEA 1U2CA 2FO1A 3DRTA 3NCJH 2JTYA 3BAEL 5EUKA 1FRGL 1NGQL 2PCFB 3N41F 2ZUVA 3FT2A 1T4KB 2CUIA 3KBHE 3P30H 4W93A 4H2CA 4G8EA 2Y7MA 4CDGC 2BY1A 1LE5B 4YHZL 1DEEA 3Q8BA 5IW1A 5EO1B 2OR8A 3FFDA 4BSJA 4EN3D 1UYWL 3B5GA 4M9OA 5EA0L 5FA4A 3VXSD 3WHE1 2ED6A 2XBTA 1UH3A 1IM9D 3X1EA 4R97B 3CMGA 5I2IB 1JZ6A 1PKQB 2AEQL 4K7PY 4BSWA 2HJFB 1LK3L 2XY1A 4QHMB 2GC7C 4LOFA 4PJ5B 3V0AC 3GEFA 1IBYA 1IO4C 1E67A 1FG9C 2AXFB 4HIXL 4P9ML 4LVHC 4POYA 4K7FB 5J12B 4AQZA 1EMTL 2JKTM 1T6WA 2W60A 3FO2B 3A6OA 4ODVH 4OU3A 4HUUB 1FP5A 4ES8A 3S3CB 3GI8H 1SYSA 5E1IA 3CU1A 4U0QB 5LXVA 1AHKA 4AYEC 4YHML 1YEHH 3MNWA 4MX7A 3RVXC 4QHNB 3I75A 5IKCA 3H3BC 2WTOA 3M1BB 3US1A 3CLEH 4CN1A 1JYNA 1RJLB 2EYSB 5M95B 4GXUN 3X1BA 2DQGL 3V0IA 4HZAA 4E5XB 5C6TL 3O81A 5DJDB 1NQBA 3ULSA 4QYOB 4XODA 2Z92B 3QQ9C 2YEQA 2BOCA 2FR4B 15C8L 1V7NH 1U3HD 1JPSH 1EZUA 4I2XB 4KKAD 3DARA 4WWKD 4N5EC 1CFNB 1JS4A 4O02H 3SKMA 2JJTA 5J8OA 4TNVK 1E42A 1KB5H 1KIRB 1VZHA 1DANT 3G6JF 1XEUA 3QT2A 4JGMA 4NBYB 3TEUA 2BNQE 3V0HA 1LEIB 5ELIA 1NDMA 4FFWC 5DMIH 3RY5A 2GBUA 4ZO6A 3WS6C 5BMFL 2B5IC 3IDIB 2ADJA 3LRHA 1RK0A 4MB1A 4YK4B 4WW1A 2HCZX 2AKRA 2LU3A 3PL6D 4UBDD 1M6OB 2VC2L 1UZ6F 4MA3B 4MXWH 2Y6SC 3ETTA 2IFFH 4XVJH 3QYNA 2NY7H 3HJEA 3ECVA 1OGPA 1QHPA 2Y2YA 4OZFG 1MG3C 1K8DB 3MA7A 1RMFH 3QZWG 4P59L 3QUZC 5CP3H 3ROOA 3SZ6A 4KK6D 3TH4T 2WBJA 2OL3B 4QJ3B 3OKMB 2J12B 4PD4J 5F9OH 2OKMA 1SEQL 2J8UA 3OKNB 4X4ZA 3W37A 2CCVA 3QHTC 4JE0A 5ANMA 3OKYA 2JQAA 1RK1A 5E6YA 3LNGA 5AENA 4OTXH 4ZTPL 3KR3H 1IC0A 3TFKD 4Y9CA 3B7SA 2IBBA 4S1QL 4GH7B 5GGUB 1OP3K 1DVXA 1D7BA 3VSTA 3WFBH 1KCWA 5IBLC 2P49B 5F8RC 4G8IA 2W88A 4MNQD 4I3GA 1XF2B 3FUFA 4XP9L 3O3BA 5B8CA 1T0NA 1EXHA 4QTHB 3C5SB 4UTBA 2FJHB 3QDGE 3QXUA 5GJTL 4MAUL 3WXWH 1NLBL 1JZJA 2FEDC 5LCVA 1QKZH 1NPNA 3HMXA 4AQ8A 4HC1A 5I1EH 1QLFA 1WA0X 3IBOA 3KPLB 5LXGL 2F58H 3RL1A 4L9DA 3CHXA 1AXIB 4FLSA 1E9PA 1GYVA 5FHAL 4F8NA 2BP8B 1PNDA 1H8NA 5C0CD 4N24A 1HYRC 3FCTB 4AUYA 4HKJA 4KMTL 5I6PA 3OAUH 3HS0A 4JFHE 1B90A 1XB8A 1R24B 3MR9B 4G8GB 2YXVA 3EJQA 1F0LA 3ULVD 3EXLA 4PV9A 4FQQB 4NUPA 1AS6A 4L4TA 1N6UA 4FG0A 5F89B 4V1DE 2V5RA 4F2MB 5IVZA 1CR9H 3CZGA 2EIJB 3OJ2C 5CINH 5DWUH 5C0ND 4XWOC 3FCBA 1KGWA 3N1GC 4A2HA 3WLBB 1A7NL 4ZUUA 1NFDA 5D71L 1U8HA 2K78A 2LABA 1CXKA 3BOVA 2W9EL 5GRXG 2FNBA 3GUTA 2ESVE 5IB1B 2C9AA 3CFBA 3VQLA 4KJWC 5I8EA 3QFJD 2D73A 1OZUA 2ZJSL 5B7FA 1DTUA 3OPUA 3IE9A 4PJIA 5AD0B 2Q5BA 2VERA 4OFQA 4DK5A 2A9AA 3UJTH 1VFOA 5EU7E 1J5OL 4QXVA 4U6HB 1NUDA 4RISH 4Y5YA 1BJMA 3ZGIA 4G83A 1DBJH 3WIIL 4MVBD 4YHPA 5DFVC 1MIEL 4BDVA 1GKOA 3EGSA 4RGMB 5ALBL 2IGLA 2ZX5A 4YSAA 4JN2A 2R69H 3TP4A 1KLGA 3RY6A 1IU1A 4JO2L 2YKLH 3MJ9A 5CEZE 4RAVA 3AGWA 5CEYA 4EI5D 4XVSL 3K74B 1RP9A 2Y7LA 4BWWA 3GK8H 3MBED 2YXFA 4IHOB 5L2KA 1K9TA 1RHFA 3EH1A 2VXTH 5DZJA 5JMRA 2E76C 5F7YC 5FUZH 3ABGA 2XY2A 1F4XL 3CPLB 3PQYD 1WGVA 4Y16A 4JRXA 4WI3A 4Y2DA 2KL6A 1CYGA 1RZ8B 3MACL 3L5WA 4QRPB 3U2JA 1TNMA 1ZJAA 3L1EA 4HU8A 4NUJA 4MWFA 3FU9A 3BHBA 1KEML 2VNCA 1UM6H 4ZNEA 3S4SB 1UB5B 4G82A 3UTTE 3P9MB 2H2SD 4YHOH 2DQFA 2R0LH 2WW8A 2ZCLH 4YJZL 4KKCD 4DVRH 2EE6A 5HI4D 3QW9A 4JO8A 1IBGL 1AXSB 1K5NB 2ZUQB 3DPBA 3ZU8A 1IL1B 2OTUA 3IAPA 1XCTA 4JO3L 3U0TA 1CVSC 3RGVB 5EF2A 3MZGB 4PVBA 2XV2A 2B59B 5AYQA 2NXZD 5J1TC 1DJGA 4NO5B 1NCHA 5IREA 5J5EA 1SGKA 3MNZA 1KJMB 1PZ5B 5SWQA 1A0QH 5CCHE 5BNXD 4WCYH 4O51B 5FO7A 2AAVA 5AKVA 4K94L 2ADIA 4LEEA 2HJLB 2WSDA 1MFNA 2A4ZA 2ICWI 3EHBD 2IADB 1GYAA 3KNBB 1G7LB 5KW9L 1G9EA 1DE4B 1H0DA 1LMIA 2JJWA 3QEQD 5DTFB 3NFPA 3V0DA 3APMA 3T0EB 3DX7B 4Y4FD 1F4AA 2DQIH 2W92A 4GKSA 3WN5B 4H8WH 1KENH 1C1EH 3K46A 2CJ3A 3G5YA 2OSLA 2CGYA 5ALCL 5I1CH 1G4RA 1CJYA 4M9PA 3MOBL 4ZYKA 4XXDA 4MAYD 2JLPA 1RH8A 2WXFA 3CZSA 4Z3JA 3KWVA 5JLZB 2XQYK 3NIFB 5D6CB 1OAZL 3P4NA 1WFOA 1VFMA 4TVPE 2ETWA 4Z7UE 3C5JA 4Y4HB 3TCTA 2MOGA 3MRRA 5BQDA 5JW4N 1VZIA 4HCRH 4PVLA 4LAQH 3MRKA 5DFTA 3ZTCC 4HOMA 3MLTA 5E2UL 4FNLH 4XP5H 3U30C 4DCQA 2VXVH 4MGXA 4ZQTA 1JRHH 4HAGA 3FSAA 3BAXA 3MLRH 4BFBD 1OF2A 1XEDA 3BPLC 2XN0A 3DTXB 5F7EL 2IV8A 1M2VB 3B9VA 3U9UA 1TFPA 3IT8D 1HJCA 4LHUB 3TYFB 5EC1A 2EAEA 2X4TA 3S36L 1DVTA 1FPTL 2GKIA 1O75A 4HCFA 1ZWIB 5DJ8A 2XTSA 2YPLD 3BFWA 4DO6A 5I8CB 1WK0A 3U48A 2XVLA 3C2AH 4DKEL 4J4PD 4I85A 3QXDA 1NCCH 4XN8A 3WOVA 5I24A 2BX5A 5DGRA 3T0DA 5DRZB 3D0LA 3FQWB 3BW9A 1SOSA 3HZVB 5H2BB 3QIWC 3SDAD 4CNIB 1LO4L 3V9EA 4ZTOL 4AXWA 5D1XE 2ZOWA 2MPAL 3LMJL 4ISVA 4P2OC 3HNSH 3AC0A 4PW3A 3K4AA 3ZE0F 3HHRB 3UBXI 2ZNWA 4DW2H 5CEZH 3H9HB 4YH6A 2FWSA 4KXBA 1MEXH 4ZZKA 3TJHC 2IDTA 1N3NA 1MIMH 2WAHA 3IF1B 3OJDA 3F8UB 1JMXA 3T65A 3MFFA 3VGFA 1P2CB 3DROA 1Z66A 2OMNA 4U1IA 4PJHA 2V2WB 4D9QE 2V5SA 3IXAB 1XFPA 3DK0A 4OVUA 1WAAA 1GJWA 4TQ8A 1ROCA 3Q1EA 3NYKA 2EDXA 2GJ6A 1LDPH 3Q06A 2OMTB 4CC4C 3MOAL 4AEHL 4JHAL 2R2EB 2PP7A 4UV4H 2IPTH 5KBDA 3REWB 3ECBB 4B60A 4HMDA 2JK5B 3I9IA 3RUGF 3B3IA 3ARDA 4AZUA 2P80A 5E1AB 2L7UA 4GBXC 3GLZA 3NJXA 3ZDWA 3GZQA 4LPWA 1J8HB 1EZVX 3TVMA 1AGFB 1A4KA 3MV8D 3D12B 1MQKH 3NH7H 1KJ2A 3HMWH 2ZKWA 4OZGB 3EOAA 5A2KH 1SDDA 1YEKL 1OCOB 4M61A 4ODUB 1NMAH 3ZDYB 4WY7H 5HVGB 2DV6A 5FYJE 3NG5A 3TPUB 1YEHL 4BKLA 4LSQH 1REIA 2FQEA 2CBOA 4Y1TA 2RAMA 1AGBA 1CDGA 4P3DA 3NIDB 3OLEA 1CPUA 3O6ML 2Z1PA 2P5WE 2FX7H 2XZZA 3GJEB 4KOCA 2HT4D 4NWTL 4FQLH 3C6LB 4FTVE 4DP8X 5LGJA 5DYFA 5J9PA 2YQGA 1KCRL 2JKXA 4LB8A 3X1NA 3DJTA 4WW2B 2CQVA 1AHWA 1E40A 1WD9A 2I9LA 2R15A 1W9XA 3AM8A 3ABKB 1KB5L 3LH2H 4QDGA 4YC2C 3SJVE 5I26A 1QLEH 3RI5K 4BKTC 3H3PL 4NUQA 1JV5A 3KLAA 2F53A 5KSAD 4Y2LA 5BVJA 3WIHL 4YMPA 5KYNA 4DKFH 4TF4A 3WUWB 3F84A 2F6AA 4HUKB 4HUVB 3BEVA 1Y6NR 1CFSA 4TVPH 4WI4A 2HKFH 5C0GB 4O5LL 2GSMB 3BEWA 2JB6A 2NY7L 4E36A 3OKLA 4L3EB 3SDXA 3B2MA 3EGDB 4CSPA 1CK0H 2C1OB 1L0XA 4MQ7A 2XRAL 3KW8A 3QZBA 1AGEB 5FXCH 2CKBB 5LBSL 2VL4A 4HX1A 4NENA 4U6XB 1S9VB 4B5EA 4QTFA 4OB5L 2R0WL 4XPTH 4K7PH 3TA3A 4X6CF 4F37K 2Z31C 1GOHA 4Q6KA 3VD4A 4Q2ZA 4PM1A 3VX1A 3D30A 4LCUB 1YNLH 5HDRA 2A0LC 2MJWA 5ISZE 3SSGA 2V9RA 3MLWH 3N40P 4K07A 5JHDD 5DMJB 3RG1C 4HIIB 4HGWB 2DWDA 1R1CA 4IOSA 4GI6A 3WHXB 3WXWL 3GJFK 1AO7A 1T04B 4I13B 5JQ6H 4XN7A 1FG2B 3D39E 4F7CA 4FXGB 4JPWL 2DJSA 4G59C 2NY5C 3G5ZA 4NKMA 4FQ2L 2HYMA 2VLRA 1WAPA 3F00A 4WKXA 1E8YA 2YXWA 4PJ5D 1FV1B 2X6VA 1EV2E 2DWTA 1BYNA 2NNAA 4H0IA 1BAFL 1MXDA 2Q7AA 3K91A 1I3VA 5JUEH 4FX5A 4Y5VB 4YWGH 1GCFA 3MV7B 1UJTA 1NGZB 2H6UA 3SCMA 2V8LA 3VYOA 1DDTA 2XQYA 1FDLH 2ZIDA 4GAFB 4UANA 3C87A 1KIPA 2R0KL 2E7LA 1UT1A 3DX9B 3EZ8A 1DQMH 2KLSA 2EC9U 5ITFB 1BFTA 3ASWA 4S1DC 2VR4A 3NDYE 1L7TL 4RMWA 2BOBA 3KPMA 4YNYA 4JFQB 3DURB 5AAWA 4H1LG 2Z34A 1QBAA 3FQXA 5AW7B 1IM3A 5DVPA 4PJFB 1IZJA 3MAWA 4JAMA 2EICA 2D7NA 3SY0B 4PHXA 2YPVL 4XMPL 4I0PA 3UJIH 1WA1X 5D70L 5F3BB 5T3XE 1HSBB 5FDWA 2EZ0C 1OVZA 4ELME 4GSUA 2FNWA 5DUBA 4FQ1L 1UJ3A 5KVEL 5FYJH 3RIFF 1V8HA 3S37L 5F96H 2W07B 3VJ6B 1E90A 4JFFE 1TIUA 3ARBD 4URKA 3WNNA 3VD1A 5KYYA 1QSFD 3CGTA 4UQCA 1U93B 5AOJA 1P9MA 4YX2H 4QO1A 1LE9B 1E5ZA 3RWHA 4QTIL 3O4LE 2WK2A 4L5FL 3KDPB 4J3OC 4OAWA 2IFGA 3FSZA 3QIBD 4FQXD 2ISDA 2AS5M 2J73A 1EFXD 2ZWZA 2DB8A 3P11L 1CGVA 5TF0A 4FFYA 3ELAT 4AIEA 2YXMA 2X3CA 5CWSA 3V4PL 5D7JA 4CVUA 1W15A 1ORSA 5E6UB 3GTVA 4JB9H 2BLFA 2OTWA 1YJDC 3GBDA 3ZYJA 4YXLH 5K93A 5HPMA 4GAYB 3QA3B 4FFZL 3LRLA 1E7UA 4HMEA 4HJ1A 2P43B 2ZSWB 4UQ2A 3ILPA 3P4MB 3RYMA 5HHXL 3UXFA 4P99A 1M1XB 4N2DA 3STLA 3AAZA 1GZPA 4PUBH 2DQDL 3B37A 2VIRA 4QXGL 4Z6AT 6FABH 2CDEB 3NABL 4K3DL 3K4DA 4PRPE 3LNEA 4IJ3B 3PXHA 4Y7MA 2VDML 4AH2A 4AQ1B 1XH2A 1U8PB 2E7CA 2VW6A 3UROR 3ZUCA 2VDPH 4AGPA 2IH8A 2YD3A 3RU8H 5E9NA 4M43H 2HTLD 4KHTH 4AENB 5C0EB 1B3JA 4GEJA 5JDSA 3CVHA 5KSVB 3FC8A 1JOIA 4OT1H 1S9XB 4ZD3L 2OR7A 1F3DJ 2YO3A 4QGTA 2DWYA 5DC2A 2ZG3A 2CLRA 4RZKA 3B1UA 1DDHA 3IJ7A 4POUB 4AV4A 1NBZA 1FVDA 3RL2A 4GNKB 3IJHB 2E74C 1C8PA 5FK9B 2YMXL 1LO5B 4HBCH 4XMWA 3QEHA 2I9TA 2XWJA 4TXVB 4RFEA 1IQWH 4J3OF 2QMKA 2CJUH 5BO1H 2C5DC 4M5ZH 1N26A 5IUCA 1CLZH 1G7PB 4WUKH 1BBJB 1UOWA 1R0AH 4X7DC 4X6FA 3TC9A 5D7EA 2DM2A 4NM8H 5J12C 1L3NA 3LQMA 5HYJA 1XAUA 4BH7B 5D7HA 3U0PB 4A2FA 1JZGA 4PWJA 1NGWA 1UB6A 3K81A 4OJYA 3K2MC 4WSJA 4DT2A 4L0PB 4M5YH 1XGRA 4JNXA 1FF5A 3MUY1 4GG6B 4F8PA 4JLRB 1UVQA 4QRRE 4YDZA 1G5AA 1RUPL 3APDA 2EIMB 4OZFA 2FJFB 2ARJQ 3MLRL 1HKLL 2Z8WC 3HAEG 3QZWA 4HJGB 2OLDA 4ZPVA 3WIFB 1JFQL 1MJUH 2OP4H 5EF0A 4D7BA 2J4WL 5TDOB 2G9HB 1KN2H 3LQZB 4KV5F 2WSPA 3MV9D 1CL7L 1ML0A 1CXEA 1QW9A 3ML8A 5ICXA 4A7TA 2OJZL 1BLNA 4OZIB 4HPYH 1MW3A 4DOHB 3NEEA 4HMCA 4YXKH 5KVGL 4PG9B 5I75C 2YBRA 5HHOB 1IAKB 5GRYA 3F7QA 3HE6B 3BJLA 4XNUL 3U2SB 3LV3B 1D7CA 2SEBA 1UATA 4W4OC 3O0LA 3W3BA 3B2DC 1QHQA 4DEPB 5ITBH 5GRVK 5JOFA 3GJFA 4AYGA 4AEEA 3HI5H 3HNSL 3CDZB 3SE8L 1G6VK 1CD8A 3KPSA 2E3VA 4R4FL 4O9HL 2PPEA 4FAAB 2NW2B 3KYMA 3PWPD 5CLZA 3A23A 4M8QB 1XZ0A 5B38G 1UFGA 2AJVH 1P7HL 4NQED 3NPSB 1AGDB 1ADQL 1XMEB 5F1IA 4DQOH 4PJXA 3RGVD 1X5IA 5BPPA 2VWEC 2ENSA 4HAFA 5AKRA 3GSQA 2COVD 2OMBA 2WP3O 4DZ8B 5A40E 3ZL4H 3BVDB 5CBAB 5C08A 4XBEH 2A73A 1E5AA 2XSKA 1DQTA 1SHXA 4P2QA 4PWGA 4UTAL 3DECA 2WQ8A 3R4RA 4IBTA 1ZD6A 3B8YA 4IMLB 2NY1B 4UM9A 4Y19B 2BSSA 1E4XI 2FRGP 4DVBB 3L45A 3BI9X 2CK0H 5GSRB 1UC6A 3TBVA 2YBGA 5DJCA 2QSVA 1G7MB 2JWYA 5ADOL 1ODAA 2ZKHH 3ZIYA 1OF0A 5I5MA 3A6BH 1CFVH 2X44D 1INEL 4H88H 2EH7L 3DWTA 4QCIB 4QRFA 4XAKD 4YLQT 5E7BA 3CLFL 4UDTB 3SKOA 3T4YB 1D5BA 2X10A 4JPIA 3TO2B 1QTPA 3VFUA 4XXCC 3H2PA 3VGDA 4F15B 3JWNE 3MRNB 3BZ4B 4N2FA 3QXAA 1NMAL 2QQNL 3W9DB 5KSBA 3RTQB 2BJML 4PEEA 5H37A 2R4RL 3HZMB 5JNYB 3X11B 4TQEH 3AROA 1RIUH 3SYOA 4L4VE 4JG5A 3GRWA 5EU3B 2Z4QA 1G9NC 2EE2A 4N8CH 1IAII 3RTLA 1CD1B 2IANB 4RETB 3BZFB 4YDLB 1CU4H 4XC3L 3LH2L 3FFOA 3WI9A 1D9KB 1BZ7B 7PAZA 2PABA 3VFPA 4ACPA 1QLEL 3VNYA 5MI0C 5T1KD 2EDYA 2OPCA 1PZBA 4HWEL 5K69A 4ZFQA 4U1MB 2ITEA 3CD4A 2VSMB 2MNWA 4N2EA 4OM1H 1C16B 1ANUA 4XB3A 5EZLB 4N1HB 1FNGB 1MI5B 1RQ5A 4QRQB 1SLVA 2ZAGA 3QUKB 1ONQA 3QJQB 3QORB 1WZ1L 2E75C 4KFMA 2OW7A 3ZGHA 3SDDB 3D1MC 4ODSL 1OWWA 1MREH 5J56B 2VISA 4MCZB 3B7TA 4ZS6D 3RBSA 3RPIB 3VB8A 5EBMB 3W11D 4O58H 1LP9A 3NAAH 1KY6A 2JE8A 2YGQA 4RGMC 3ZZSA 1YEIL 1MHHA 5JR1L 4K5NA 5F88B 1T7YA 3RVWC 1HL5A 1OD9A 1UT2A 2GJZB 2QVKA 4MMXB 4XX5A 3NJLA 1IC1A 2AK1L 3B2UD 1FIGH 5A43C 1XQ4A 3ESVF 5E2TL 1Y18B 2D7QA 4F2FA 5HI3C 1HHKA 1P6AB 3FMGH 1CFTA 3QRGL 4OZ4A 1D5XB 3WGVB 4NKQB 3M8OH 5INCB 5L0QC 1WC7B 3K6IA 2E6QA 1QA9A 5B1JA 1E27A 3U0WH 3DA0A 3HZYA 3NZHL 1SDAB 1CGSH 4LNRB 4Z3GA 1B2WH 4WFGE 3NZUA 4TUOA 1IGCH 2PPDA 4AJVA 3KHQA 5C2BL 5I17A 1J8HD 4NDMB 3AUWB 2XA3A 4O02A 4QRSB 5TDPA 4BWTA 2HVBA 3NQIA 1KB5A 2VLME 5D7IB 3PCYA 5FF6B 3CQFA 3TOPA 1T21A 3FCSB 1L9PA 3L2NA 4L4TD 3VWKC 3QARA 3US0A 1G6RH 3KH4A 3QUYB 4NQUA 4NC1E 4P9HL 1I7TB 1ZTMA 2P24B 3T1WA 1BVOA 4FQJL 4Z18A 1F6AA 3KVQA 4KRNA 3HG3A 4BH8B 3EJZD 5HHNB 3K3QA 1A14H 2G30A 1NGPL 2YA2A 2K4WA 4YGAB 4C8XA 2Y7QB 4GRMA 1ZVHA 5IFJA 1H9VA 1XGUB 4LL1A 2EXWD 1ZT4A 3G5VB 1NDGA 5EIQA 2YAMA 4I4WA 4L8SB 4JFEE 5CP3A 4LF3B 4P48A 2G9KA 4NQCA 5KVFL 3MRFB 4XTRD 3UOAB 2OMVB 2VDLH 4LEXH 4LIQH 1I1FB 1RZJH 2MKLC 3KL5A 3T8VA 4L0YA 3WN5C 5AVVB 1BQHA 3JWNH 4JRYE 4M7ZB 4XMXA 1AQKL 1SFHA 4KZEH 4M6NH 4OGQC 1I8LA 1LEGB 1PAMA 3MNMA 5EU6E 5BUGA 1TQCC 5BW7A 4F9LA 3KLHC 2B1AH 4OIIL 3EOBB 3Q2WA 4QWWD 4G6AC 1ZHBB 4CMMB 1BQLH 4MNHA 4TPRL 3RVTC 3QUXA 3DLQR 4ODWA 1JK9A 1YN6A 4BRVA 2IH3A 3D9AH 2CO6B 4PIBA 3MX0A 4L3ED 1TQUA 4Y4HC 1NIBA 1G43A 3NACH 4XB7A 4HIEA 4NGHH 5EZOH 1UEMA 5G5DA 2DH2A 3GF8A 3MRJA 3N2JA 4U1JB 2I60L 1U8JB 2FQFA 4ZFGH 2WQRA 1MY5A 4KROC 5L2KD 3D08A 5ENWB 1GOFA 5KBMA 4RX4A 1VPOL 2DQUL 3HG1B 5JUEL 2HLFC 5T5FL 4BYHA 2ZOUA 3AACA 4FQHB 3KS0J 4E9TA 2DWEA 1MF2H 2BVQA 4HQQH 1HE8A 2I07B 1NEZG 4K8RC 3TNMB 3ZRSA 3P0YL 2L8AA 3BDYL 1DSYA 1JHLH 1R3HB 4AYFB 4D0BA 3KJ4C 1AKJB 3S35X 5IQ9A 5F71A 5HYFA 2CALA 4DGUA 3EO0B 2XA8L 3ARGB 1CLVA 4PGBA 4KPHL 1UWEH 4U31A 4ZUWB 1KYFA 32C2B 1MHEA 4XNDA 2Y6TE 2G3ZA 4Z7WB 1YAIA 1UQSB 4NPJA 4A37A 4GRWB 1RFDH 2A9MH 2VDPL 1BVNP 2A9NL 1CDYA 3VGAB 1QI4A 3VRLE 3CSGA 2VJXA 1KBPA 2KBGA 4OJAA 3L3DB 1NFIA 4A2GA 4GP5B 5C1MB 5IB3A 1JPTL 1SF5A 2JVUA 3RWJA 2K3HA 4LHQB 1NPUA 1HQRA 1WEJL 4PGEA 1BXUA 5CBEA 4DTGH 2HFGH 4NJAH 5CZVH 4QRUB 4HH9B 2K6YA 5AW5B 2NY0C 3SBQA 3L3IB 1HNGA 1TITA 2ZPKL 1LEKB 3GGWB 1A7RL 4M56A 2R69A 3M88A 1F45A 4Q97A 2F61A 2A83B 1D6VL 3DVGB 4OF8A 3ZYOA 2CLVA 2NMSA 3UC0H 3BP6B 4U1KB 2JKJA 4M5ZL 4OR1A 5T3ZE 5D2NE 2V5YA 4W9GC 2V8MA 4A67A 4FNQA 3FQTA 2HKHL 1J1PH 1VF5C 4X7SL 4U33A 1P5UA 3LDBB 1DN0A 1N2RA 3MRBA 2BNQA 1NTDA 4WJ5B 4WTXA 3HKZA 3HPLB 1AJ7H 2Y22A 4GUPA 3OKKB 5G4MA 4M5YL 3BVXA 2CXGA 5E9DB 3VQMA 3DX3A 1WH0A 3OMZA 4TUUA 3BUDA 3TH2T 3EYFB 3GLDA 4WI9A 5GGSY 4NQSA 4CSSA 5A3IC 1WZMA 2GC4C 3ZYIA 3C6LC 4TOYL 3CMOL 4P5MB 5IQNA 4OUUB 4C56B 1MQ8A 2YEVB 4G9FB 2VXSH 3AW5A 3FHAA 1SBSH 4HPYL 2PYED 4WW2C 4XI5D 1SLUA 1AG6A 3F12A 1AZBA 3TESA 3DSNB 2CA3A 4HHWA 1G0DA 1MVUB 2XWBB 1KULA 4L37B 3DBXB 4Y5XB 3TM6A 1ASQA 4N90E 1OGSA 4YLBA 3W57A 2BCMA 3M1CA 2PP9A 3SPJA 2CKNA 3HS9A 5GGRB 3DUSA 4WTZA 5DRXA 2LGNA 2Q8AL 3VXTB 1EERB 1QVOB 3TJPA 3QDGA 4HPOL 1IT9L 1G7JA 4N0FA 4LLAA 3QO0A 2AQSA 4XNQA 6PAZA 2GUOA 2COQA 1FJ1A 5E8PB 1UACL 5AB9A 3LY6A 4PWFA 4CVXB 2WVUA 2BHFA 5F0PB 4UOW1 4XO4A 9PCYA 1Y1UA 2R4SL 2W95A 2ZCHH 5FYKL 4MAZA 3ESMA 1B0RB 1CYWA 3ARSA 1NBYA 3MUHL 2XWDA 3KWWA 1GC1H 3TNNA 1A7QH 3KPRD 1OGAE 3FXIC 4V1DA 4ZX3A 1B6DA 2AJXH 3TWCL 4OZGF 4HCRA 1BVNT 3EO9L 2WO2B 2YOCA 3F7VB 4X2UA 1CFVL 3ZDYF 4I5BA 2MCPL 4A6YH 2QSTA 3HLAA 1HHGA 3G5XA 3V4UH 2J5WA 4L8CB 4FXGC 3TVMD 2BSRB 2ESVA 3NIDF 3RHWF 2OXGA 4LXFA 3L7EA 1J5IA 1S7RB 1JNLL 1ULVA 5HSFA 4XAWH 2ZSVA 3UZQB 2ORBH 3DYMA 5IW6B 1JZDC 3EYSH 3DKHA 1MUJA 2FB4L 4OZHB 3X12A 1JXJA 1U2YA 4L9LC 4WW2F 4P3WA 1QPKA 2EVHA 3FUJA 1PZAA 4Y5VC 1XMWA 3EJPA 5F21B 5FW6A 3RWGB 1JGUL 2BRRH 5FKPA 3KLSA 4OH2A 1MJ8H 3A4FA 1SJHB 1SM3H 4CL7A 3OQ3B 4I88A 1J05B 3GZKA 4OLWH 3KZ8A 1DLHA 4NFCA 4C47A 1KN4L 1T2JA 3FZUD 1H5BA 3GYRA 1I9EA 1G7IB 4R96A 4CGTA 5JHLL 4JDEA 3DO7B 3HW7A 4WWPA 4EIZC 2XUWA 1EA9C 5E4EB 1R46A 5T3ZH 4YSDA 3CE1A 4OM1L 5CF3A 2NNCA 1JIBA 1E4KA 3DGDA 5GZNA 1NLDH 1W0VA 2EJ1A 4FZ8L 5HXMA 4JO4L 4Y8AA 5AVZB 4OGAD 3HE6D 4PJGB 1S78C 5EBWA 4XN9A 3SDYH 1VACB 4LSRL 4LLUA 3AY4C 3UP1A 2IAMA 3P0VL 1GGBH 5D7KD 3BUPA 4EDXB 1KCLA 1FC2D 3TN0A 4FOMA 4HIJB 3MV01 3H6AA 2FUQA 4MXQD 4YHIB 2AK4B 1Z3GH 2FT6A 4PJ9B 1PG7H 1HCZA 3CFKA 3CHSA 1E65A 2X4PB 4AY0A 3TA3D 3R18A 4JR9H 4YDMA 4KX8A 4X5WB 4HIQA 2F5AH 2QKIB 5T5NG 2APSA 2RMNA 3JSSA 5JPMB 1DQIA 5E2WH 1JGDB 1ILUA 1HHHB 3QPXL 3S3PA 2UXFA 2WTRB 3K71A 2A74B 2A3TA 3H9ZA 4IGBB 2HN7A 3CFDA 4LCCC 2HT3C 5IROA 3BSZL 4IOSD 5I8OH 4TUKH 4MJ5B 2XFXA 4LVOB 1UXMA 2DD8H 5GGTH 4AIXA 4E9LA 2HUHA 2R29L 3F6JA 1KXTA 5J3HC 4L3FA 5LVEA 3IFLL 2Q7YB 4ODXB 5DLML 5GS1A 1S4IA 4A7QA 2WUBH 4FFVC 4NNXA 1EJ8A 4HPHA 3BGAA 5AW8B 3C08L 3C60B 4IRSB 2H3KA 4F3FA 1KTKE 3B9EA 1JPGB 1NCDH 1Z9SB 3IKKA 3VMPA 4E9VA 2A9BA 3E6FB 3FUEA 4IJ3C 3BKCL 4LOVA 4OJEH 1YDPA 2BWIA 2E8ZA 4AQ1C 3SCMD 4DF9A 3GZPA 1IC4L 3L5XH 4PJFF 3FF8A 2AXGA 4BM7A 4G70B 3H55A 2N1TE 1S7XB 1BP3B 3PGFH 3MDJA 3VFGL 1A14L 2DI9A 4Z7UA 4EI6A 4BBWA 3HR5B 4IDLA 1KLUB 4KXAA 1AYOA 4AUUA 3KJ6H 3GNMH 2EUWA 2VE6B 1RUML 3GRGA 5EB9A 5MP6H 1LWJA 2P3YA 1YUHB 5CHNB 3JV4B 4KXCA 4G7SB 4ZT1A 5ESVA 5LHDA 1V27A 4FEIA 3STBA 1D9KD 3PDOB 2BSCA 3FRPG 4G80A 4I0PD 3N1MC 4LEXL 4LIQL 3WL9A 3PS6A 2YFNA 3FULA 4Y1AE 1UCBL 1GGIL 2VR3A 4MD4B 4PRNA 1CI3M 4PV8A 3V4PB 2B1AL 3VXPB 5EO0A 1IFRA 3VNZA 3WO4B 2BZDA 4XNYL 1P7KB 3DGGB 4GW5B 4F7MA 4Y4KA 3S97C 3E8UH 4WEMB 1HDMA 2PMZA 2Z3FA 3MRHB 3QJZA 4NGHL 4EUPB 5EZOL 2ZOTA 3F7YB 4HHAB 4XPBL 2NUPB 4RMUA 5EZPA 5IMMB 2E59A 4IRJB 1NBVL 4ONOA 5T1KA 3VD7A 4ZMNA 2YMTA 1O7DE 1C7SA 1AZRA 5BXFA 4BQ9A 2XN9B 2VDMB 5E8EA 3Q13A 3SKUD 5D7JD 4ELKA 2OCJA 4F2EA 4AT6B 1A02N 1OM3L 1JHKL 3ULUD 2MQGA 5DUMH 5MERA 1FWXA 3QIUB 1MF2L 3OR6B 4IKIA 2DI8A 4ZAKB 5J06A 2Y7SA 3R19A 4RSYA 5TQ0H 5JZ7D 3KH3A 2FSEB 3A67H 1KJ3H 5E56A 3QVAA 1HZLA 3GSRB 1U8LA 1A4AA 3U2IA 5JTWA 3SYQA 5JORA 5M94B 1A6TA 3SBPA 3AJ7A 3CDGB 3ZTNL 2QTEA 3GI9H 4CADB 3OKEA 1UA7A 2XYCA 5JOEA 4IEFB 4XCEB 4DEPC 2BC4B 3OKOB 4F2ME 4RGOL 3HNTH 9CGTA 2APVA 2YRZA 4AQOA 3ESNA 2VDQL 4KGJA 1JWSB 1N0LB 1Y07A 2GHWB 4G42B 5E4AA 4KI5C 1KG0A 3IPFA 3RZCB 4AE1A 3FB8B 5I1JH 3Q9QA 4QAWA 1DCEA 1QRNE 1VCAA 2M26A 1AR1B 4HHGA 1TPXB 1XF5A 1N4XL 2QPEB 4JO5A 1VA9A 2FH6A 3QUYD 3CH1B 3T6WA 3Q05A 3P9LB 4R2GC 5TDNA 5DEGB 3BKYL 4BRJA 1Z9LA 4TNWF 1PD6A 1XSJA 1N64H 5HJBA 3O4OB 1FL6B 2NY1C 3EYUH 4FJZA 4GG8B 4MJIB 3OX8B 4P46B 5ERWB 2O61A 2APBA 5JHAA 4OCYH 2XWEA 2P5WA 2YK1L 3L5JA 2XPGA 3FONB 4H1LB 3D18B 4PJ8C 3MGTB 2PF6A 2F5BH 3MXVH 3RJOA 4OFYD 5DS8A 1MFBH 3LZFH 4GG6F 5SWSB 5AW6B 2X89A 4PSPA 3H0TA 2GSGB 1OTTD 3HI1B 1KFGA 3QDMD 3SJVA 5HYJD 4HJ0C 4XE5B 1WRFA 1R3JA 4U6TA 4LFHD 5J11B 5CD3B 5I1LA 1NKOA 3U6RB 2E7DA 2R83A 2PR4H 3BGFB 1UXSA 4W6XB 3RTQC 3NT0A 1CBJA 2VH5H 4N2BA 2XNAB 4OFPA 3X13B 3NJVA 1OE1A 4MDRA 1CGWA 3G6AB 3P02A 3DVNB 4UUJB 4OZIF 3BXNB 2AQ2A 4DHLA 3SIKA 4F9PA 3TASA 5SV4A 4B7LA 3NN8A 4ETQA 3N42B 3AT9A 5HVFB 5I1HH 1NH6A 4JRLA 3K1DA 4P2YA 5I0XA 5JYMA 4L18A 3HN8A 1CD0A 1CB4A 2XZCL 3BPCB 4G6FD 2LHAA 1E4XH 3HG1D 5KYWB 3PWNA 1THCA 1UTDA 5CILL 3GSWA 2VW7A 5E0QA 5I1IL 2VM3A 4KI5F 1ETJA 2NOYA 3I6KB 5IHLB 1H3WM 4JM2B 1WFUA 3GM8A 4WU7B 5F1NA 1S9YB 2ICWJ 3H7BA 1AKJD 4HISA 1DJIA 1OTUD 2VB5A 2OXHA 4CILA 1AY1H 3S8FB 1TU2B 1A8JH 3KPSD 3ARGD 4YL4A 2HRLA 4BGLA 4AE0A 5ACMA 5FECA 2M8XA 3D39A 1T5XA 3SDDC 2VKXA 2JQMA 4ZDHA 4X99A 2CUAA 2Z91A 12E8L 2BSTB 3JWDH 3B1TA 4I1NB 4B50A 1EUUA 3QCUL 2VTFA 4KKLD 3T3PB 1PTZA 2IDSA 3CFJB 3CN3A 2KZ1B 2FECL 4NCC2 1NCGA 4IM8A 4J8RB 4XMZA 2DJUA 3TX4A 4HGMA 1JZIA 1OT2A 1QFWI 1UH4A 3L8QA 3TCLB 3FT2B 4BZ2H 4UM9D 1GMIA 1IAIH 4U7KA 4NUGL 2ICEA 3EW3B 2MSPA 5JYLA 3UG3A 1NCAH 4Y8DC 4ADIA 1FVEB 4PVMA 3S96A 2I25N 2R1XA 3KE0A 3VXNA 3AABA 4UT9H 3OXSA 3CSTA 4HKZB 1DL7H 2Z7WA 1YLBB 3MLYL 3APFA 2FATL 2AMUA 3H54A 1MAKA 1NC4A 3KYOB 3KYNA 3IRZA 2W8CA 2DMBA 2Z93B 1EO8L 1NIDA 4GQPH 4XAWL 5DO2D 3K8LA 4F5CE 5J4MA 4PRDB 4Q4IA 5IBUG 3BAIA 5AZEL 3ET9F 2P8MA 2G5BA 4KO5A 1G1CA 4TLTA 3SE3C 1SYSB 2QFPA 1X4XA 4ELMA 4A2LA 1HWHB 4MNQE 1HCFX 3PPSA 3MREA 4MX7B 4NSKA 1BAGA 2MQCA 5KVDE 1MFUA 3D69A 1AI1H 2DYSB 2EDOA 1DVFA 5DQDH 4JFFA 5LQBL 3WFDL 2YD5A 5E9DD 1OAYH 3HN5A 1J0ZA 1VFBB 2ZXAA 2R2BB 4L2LA 2B2XL 5HGDA 4PY7A 3HAEB 1X4YA 3RY4A 2Y7NA 1HILB 3O4LA 4AZ8A 4KTYA 4LU5H 5DJZA 4ODHH 2UZYB 3PAYA 3IGFA 1R19A 4L8SC 7FABH 4EN2A 2KZBA 2WNGA 4F57H 1E4WL 4DQAA 5F0MB 2MEJB 4PG2A 3IGAA 1WYJA 1C5DB 4FNUA 2J7LA 4X83A 3FO0L 3ARRA 2APWA 3FT0A 3ULVE 1RSYA 4BK5A 2BPBA 2R56H 4BV1A 4APQC 3CTTA 1Q9WB 3MBXL 4NQVB 3T6VA 4M7ZC 5IB5A 4XR8C 4Z77B 4PJDE 1S7QA 1RI8A 3FN0H 3W82A 5FA3B 8FABB 2X6MA 2KI6A 3ROLA 2PYFA 3TTYA 4B9KC 3C5ZC 1P7QA 1FE8L 3NCYS 3ROOB 1E43A 2QDWA 1JPST 3LPOA 5FOJA 2QQQA 3QFJE 3DV6B 1VZGA 2BVOA 2LOEA 5ANMB 4A39A 3TO4D 5FOBB 1TTAA 1RK1B 4HKBA 3PV6B 5EORH 4PRPA 5DURB 4B9FA 5DDHA 1KYAA 2BW5A 2V5MA 5FKAB 1TZGL 2XZQH 1WITA 4S1RH 5KG9B 1VGKA 2BNRA 5DHVH 3H2WA 5I8OL 2X1PA 3Q6GL 3VVVA 5JIQA 3E3QC 2H6OA 1EEZB 1T0NB 3IMSA 3L2MA 3ZT5A 5HVHC 1MW1A 3BPNC 4ZSOE 1A6VH 1UKQA 2AEOA 3DTDA 4GSQA 3PLYA 3U36A 5C3LD 4CBZA 2GT9B 3BAYA 1D6EA 2WMPA 5I1DB 1ZJBA 5EIVA 3QUGA 3NP4A 1CI5A 2QVFB 2NNXA 2H2SC 2VLJD 1RU9H 1UT9A 4R0LA 1E9PB 4GT0A 4MJJA 4KAQH 3ZJAA 3CXDH 3I9PA 3KPPA 4DK3A 4HV8B 1GGCL 5C0JB 3I6GB 2WWNA 4HKJB 2XXFA 3EAKA 3PQYE 3GBNH 1MFAL 4C4KO 2FJUB 4GW4A 2FSDA 2O6FA 5C0RL 3VGAC 3CHQA 3BVNA 4IKKA 4Q9QL 1SHSA 4G3YH 5IVZB 5JO5B 2NXZC 1MCLA 2F74B 2FIKB 2VAAA 3KCPA 1P53A 1T1WB 2WLKA 4H26B 2E56A 4OGYH 3E9UA 3W2DH 2FBJH 2X53A 4K3HA 3KPOB 1VEOA 2BNUA 3FTWA 4QJ5B 5HP5A 4KDTA 2XKNA 3JUZA 3NJJA 4PRIE 3ZVVA 3HI6L 2P5EA 3CSBA 3NESA 4QRRA 4NQCD 5AAMA 1NCBH 4MMZB 2MHAA 4WO4B 2OYKA 4FZEH 4Y9FA 1X7QB 5DK2B 3F5WB 3K8MA 4R26H 4KZDL 5C0AE 1NPJA 1I8KB 2AV1A 4MQTB 4MYPA 2RFXA 1UWFA 1G1YA 2XXGA 5TQ2H 5HYSA 3VW3H 5LN4A 5MEQA 4OLVH 2DKMA 4X4XB 1JZFA 1S7WB 2R7EA 2PO6A 3CC5A 1EJFA 1UFUA 4OLZL 2HLAB 3LDBC 3G9AB 5KVDH 3R1GL 1L7IH 2IPUK 3RPKA 5DZOA 2QV4A 4RIRA 4TNEA 1HSAA 2OJEB 3QDAA 1MRFL 3QEQE 4AM0A 2XWTA 2NYZA 2NW3B 1NSNH 4ENZA 2OMZB 4Z76B 4K4KA 2VMFA 4PJ9D 4GKZA 1NJ9A 2NYKA 4HWBH 5IHUH 2G4EA 2PW1A 4CSTA 1WGOA 4RX4D 4BFIA 4ECNA 4FLHA 1U9KA 5MENA 4K2UL 3FQ4A 1AQHA 4U1LA 1KXVA 3P4OB 4Y16B 3D50A 2B15A 3ULVH 1G6RA 4UQ9A 1CICA 1QO3A 4GRWF 3GI9L 5B4MC 4JRFA 4OI7A 4F8LA 1G87A 4PB0H 1K2DA 4YPGA 3UYOD 3X3GL 4CN4A 1EFQA 4U6VH 3F7PC 3OV6A 1I3GL 1TVHA 4HS6A 4WHYH 2W81C 3GSNH 2IWGA 3FBQA 4N0YH 3EDKA 3VFTB 1BAWA 2DQEL 2OMUA 2OTUB 4P57B 1XCTB 5F9DC 3VFMA 2O30A 3E6HA 3C60D 4YDIH 4M4PA 4OIFA 3DX4A 1XVSA 4D9LL 2JTDA 1YCSA 2IIJA 1I9JH 4Z0BH 3CHOA 4EIBA 1JI2A 1A2YA 1AE6L 1INQA 2IC2A 3T3ME 3HKFA 5FO7B 1MFMA 4P5KA 1CLOH 1TTRA 3MA9L 5HHPB 1N64L 3CN0A 4HXBL 3IFOB 4MCYA 1KCVH 3FT9A 3OAWA 4HETA 5KN5A 3E1ZA 3ES6B 4BSVA 5JOPD 4FYSA 5C07B 1DSFL 3Q43A 1U8OA 4L4VA 2EIEA 4UIMA 4R84A 1F3JB 1KBWA 1KWGA 5KJRL 3MXVL 4DGYL 1XF4B 4LSVH 3QNFA 4GKSB 2BIOA 1JPFA 3L4ZA 3NZ8A 3V7MA 2XCMC 2VERN 1X4ZA 3ALPA 3G5YB 2DWXA 2VW4A 4WI8A 4IS6A 3WU1A 2F54B 5BS0B 1TTGA 1A65A 4Y1SA 1A6ZA 4LQFL 4PJ7B 3T6QC 3MLZL 3P4NB 2O5ZH 3I9AA 4R90H 1MFCL 4IU3B 1X9LA 2PWHA 5ID1A 4LRNH 4K3EH 4XVUC 1SJMA 3MRRB 5I8KL 2IWEA 3L4XA 2Y3AA 4LMQI 3MRKB 4W9EC 1HX0A 4YXHL 2WYZA 2FYYB 1J5DA 3BIBX 4KDVA 2CHDA 4DCQB 3BP4B 1XH3A 5IOKA 3ULAB 4PRHB 3JTTA 1IB5A 2AJZA 1JZ5A 3BWAA 4UNUA 3MV8E 1RD6A 4DERA 1Q4NX 5FB8A 4Q89A 3SDCA 1QYGH 5DRNA 2G60H 3TZVA 2IG2L 5DJ8B 2D9CA 3QIUD 2LU7A 4MBOA 4ZAKD 5L4MA 5SV3A 1LM8V 1NEZB 3K1KC 3ZQWA 3V5HA 3ZW3A 2D7OA 2YD6A 4PLJD 1IAOA 1HYSD 2MQ0A 5H94A 3D0LB 2JELH 3QZOA 5E6ID 2J88H 5AUMA 2HH0H 4KO9A 1U8IA 4AV5A 1SHMA 1YY8A 3VG9B 1W72L 1TJIL 4FADA 1C5BH 4AYBA 5G4NA 5TE7L 1XSIA 2H3NB 2PW2B 2NY3D 3HFML 4X7TB 3SZKC 3MJ7A 4AGLA 3VXMB 4G6ML 4QHUA 4JANA 3GXDA 3LQAH 3VI3E 1AXTH 1JG9A 1PZ2A 5JXEC 1N0XL 2QPFA 4HUNB 5E70A 4DKAA 1IBHA 3QUML 4CVZB 4ILDA 5HGHA 5KYXB 4F24A 3DX2A 4JPKL 1CFMA 1MAJA 5HJGA 1I8IB 1TEFA 2NZ9C 1JXDA 4BCZA 1XSOA 1PSKL 2FIRT 4AVHA 2GJ6B 4JY5H 3WEMA 1OZTG 4U1SB 4P5SA 2ARJB 2IOMA 5EN3A 2QHRL 1UD2A 4KV5E 1HEHC 3TBWB 1RZIB 2DYPA 2XPYA 2QT6A 4IGBC 3C09B 1XBRA 3AFLA 5E8OA 4JFPA 3U4AA 3TT1L 4NT6A 3T08A 3DSFL