2FWLB

The cytochrome c552/cua complex from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
YTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport/oxidoreductase
molecule keywords Cytochrome c-552
publication title The electron transfer complex between cytochrome c552 and the CuA domain of the Thermus thermophilus ba3 oxidase - a combined NMR and computational approach
pubmed doi rcsb
source organism Thermus thermophilus
total genus 30
structure length 134
sequence length 134
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fwlB02
2UXFA 2IH9A 2WO3B 1M56B 4GP4B 2EIJB 2VSMB 1N68A 1NINA 2HRHA 4GY4A 2EIMB 4HALA 1ILSA 2DWSA 1JXDA 3PAZA 3NJNA 3QJVB 5B1AB 5PAZA 1ZIBA 4AX3A 4HHWA 3T6WA 1IUZA 2BO0A 3MBWB 3ZIYA 3CZUB 4ENZA 3NSDA 3ASOB 3ZBMA 1VLXA 1XMEB 2OV0A 4HAKA 4YVUA 2GC7C 1BQKA 1BAWA 3FSZA 3IN0A 3ERXA 1XB3A 3CVCA 4GYBA 3BVDB 2PPEA 1NZRA 3NP3A 2NRDA 1BXVA 5FC9A 1J5DA 2BW4A 1KBVA 3NJJA 1PLAA 3AG1B 1N70A 4E9SA 1KDJA 4WKXA 3T6XA 4YSQA 1AG6A 3NJMA 3RYMA 2BZ7A 2PP9A 2VM3A 4A2GA 2FNWA 5B3SB 1W6WA 4MFHA 1ASPA 4DP8X 2ZOOA 2GB2A 3SBPA 3EH5B 2I7OA 3DTUB 5B1JC 1J9QA 4A2FA 2JKWA 2VN3A 2XYBA 2XLLA 4AKQA 1NICA 3WKPA 2Y1AA 1JOIA 2YAMA 2YAFA 2IWEA 1PCSA 3FYEB 3OM3B 3QJQB 2X87A 1R1CA 1GR7A 2BHFA 2PPFA 1IBZA 1RKRA 3TBBA 1A8ZA 2R7EA 1J9SA 2YAEA 4NERA 2VW6A 3TU6A 1HAUA 3HEIB 1WS8A 2XX1A 1KV7A 3X1GA 4A67A 2VM4A 5F7BA 4G7SB 4KO9A 1QNIA 5IY5B 1E65A 1AZCA 2BWDA 2GHZA 3FU7A 4TXVB 3WIAA 5I6KA 3IEAA 2Y69B 3NJFA 2YXVA 1GSKA 4DP5X 1L9RA 1DZ0A 1OE2A 3FPYA 3KW8A 1NPJA 1KCBA 4UF7C 2YAQA 3H56A 3PPSA 2VW7A 4DP9X 2YARA 3FQ2A 3S8FB 3CDZB 1URIA 3OD3A 4HZ1A 3BQVA 4N4YB 4E9XA 1PF3A 4HCIA 1ID2A 4A2EA 3EH4B 3GYRA 4M4RB 4F2FA 1SJMA 2XV2A 4FA7B 2PP7A 3H4FA 3S3DB 4QLWA 3MX0B 4KNUA 4DP4X 2BWIA 4L0PB 4DPAX 3AG2B 4NB7A 1V54B 3X1FA 2QDVA 1HAWA 2B08A 1RZQA 3OMNB 1MG3C 3X1BA 1ET8A 3NYKA 5I6NA 1KCWA 1CYWA 9PCYA 2XV0A 3NJGA 1WAEA 1PAZA 4G7RB 3PAVA 1NDTA 4YSSA 1OCCB 1A65A 4P5SA 5B7MA 1AIZA 1M9WA 3C75A 2H3XC 1BQRA 2W88A 3SBRA 2AZAA 3AY2A 2FT8A 1J9TA 1AACA 2UXTA 1AZBA 1PLBA 1WS7A 1X9UA 2J57A 1V55B 1YLBB 2CALA 4YSOA 5I6MA 1BYOA 4DP1X 2HRGA 4W9ZA 1GS7A 3IE9A 5E9NA 4YSRA 8PAZA 1NTDA 3PCYA 1BXUA 1PMYA 2AANA 3FU8A 1WA1X 2QPDB 3NP4A 1KYAA 5I5IA 2A3TA 1SDDB 1IC0A 2FJSA 2X88A 4DP7X 4Q89A 2PPAA 1NPNA 1L9SA 4N8UA 3JT2A 3FSAA 3PAUA 1GYCA 2AVFA 2IAAC 3N2JA 3ZX1A 3D12B 3FYIB 3ABKB 3NSCA 1GW0A 4BDVB 1I53A 2EINB 4AI7A 2RACA 4YSUA 3PXLA 3ZDWA 1A4CA 1QLEB 3FSVA 4KO5A 2YAHA 2W8CA 2LLNA 4DP2X 5I28A 4X4KA 1OCOB 2MTAA 1AG0A 2FT7A 1MDAA 2E86A 1SHWA 2HZHA 1AANA 3TBCA 2Q5BA 1BYPA 2UX7A 4E9TA 2BP0B 1F56A 2ZWNA 3JTBA 1L9TA 2IWFA 4YSTA 1TEGA 4UANA 1AQ8A 4Q8BA 1CYXA 2IDUA 4E9QA 4BWTA 1L9OA 5D4IA 4E9WA 3CG8A 2BW5A 2B3IA 2YAPA 1PZBA 3NJHA 1TU2A 3T6VA 3AZUA 2IWKA 1A3ZA 2XX0A 4HIPA 1AS8A 3V9CA 1ZPUA 2H5UA 1JXFA 2DY2A 3S3CB 1X9RA 1IBYA 3UGEA 4DP6X 4BWWA 4KNTA 5I6LA 2GBAA 1OCZB 3NSFA 7PAZA 3N55A 2P80D 3X2QB 2HX8A 2DYSB 3UAEA 1OOWA 2BP8B 3OMIB 4A66A 2FQFA 1CUOA 2EIKB 3TASA 1JVLA 1A4BA 3FQYA 2XVBA 4YSCA 3GXUB 1SF5A 2AFNA 3TA4D 1B3IA 4DP0X 3FPXA 3FU7B 1NIBA 1PNDA 4KO7A 5B1JA 2PLTA 3ASNB 3SQRA 1ET7A 3UAAA 1EZLA 1WA0X 1QHQA 3ABLB 4M3HA 4KNSA 3CVDA 2OCCB 2JFCA 1OV8A 2XUWA 3IN2A 4G70B 1JZGA 1ZDSA 1RZPA 4PAZA 2PCFA 4K9JA 3WNJA 2CCWA 1JZHA 2QPEB 5B7EA 2WSDA 1E67A 2DYRB 2FT6A 3IBOA 1XB8A 2JXMA 2J5WA 2IDFA 4E9YA 5PCYA 2AZUA 1SHXA 5AFAA 1KBWA 4P5RA 5LDUA 3GDCA 2WO2B 5EHFA 2XV3A 5I26A 3WG7B 1MG2C 4BXSV 4KO6A 3EHBB 7PCYA 5I5MA 2EILB 3FS9A 4FAAB 4YVNA 3S8GB 1SFDA 3DKHA 3OMAB 1ASQA 1E5YA 2VW4A 4E9VA 2TSBA 2GI0A 2CJ3A 2P80A 2Q9OA 3X1NA 1KGYE 2H47C 3QJTB 2HX7A 3NJLA 4EF3A 1KDIA 2I7SA 1GS8A 4GP5B 3SBQA 6PAZA 4HCFA 4GXFA 2MRYA 3AG4B 2GSMB 3QJSB 3AG3B 3V9EA 4BK5C 1NWOA 2J56A 4GP8B 4BDVA 1T5KA 4YSDA 5TK4A 2IDSA 3FSWA 2FWLB 3DIVA 3FT0A 5AKRA 1AR1B 5D4HA 2GIMA 3QJUB 4YSEA 2PP8A 3G5WA 1JVOA 4KOBA 1L9PA 4YSAA 2FTAA 3QPKA 4F7KA 2J55A 2YQBA 1ZDQA 2QT6A 1SF3A 1AZNA 4G72B 1SNRA 4G7QB 4G71B 4JHVA 3L45A 1ASOA 3WI9A 4DPBX 1W6LA 4BXVA 4A2HA 2BP0A 2CUAA 1BEXA 4NAJA 1NIAA 1OF0A 2UXVA 3WNIA 2PPDA 1E30A 4ZK8A 1NIEA 3EF4A 1SFHA 3UACA 3FQ1A 1XB6A 1JZIA 2PCYA 1CURA 4YSPA 1A4AA 2IH8A 4JKNA 1JZFA 5I6PA 1HFUA 1TKWA 1AZUA 1PNCA 2FQEA 1ADWA 5A7EA 1ETJA 1JERA 3NJIA 2CBPA 6PCYA 1AS6A 2YXWA 2XXGA 4CSPA 1UATA 4CSZA 5B1BB 2YAOA 3CVBA 2TSAA 2QDWA 5AZUA 2GC4C 4A2DA 3WKQA 5F7AA 3ABGA 2FQGA 3X1EA 1BXAA 4QKTA 3T6ZA 5I5JA 3U25A 1OCRB 2BZCA 5I6OA 4BWUA 1CC3A 1V10A 1WA2X 2FQDA 2DWTA 3NSYA 2BP8A 5D4JA 4AKOA 2OJ1A 3AW5A 5B1KA 1MZZA 5ANHA 3CDZA 5B7FA 2UX6A 2HXAA 4RH4A 1GY1A 2R7EB 1FFTB 4F2EA 4WTQA 1AOZA 1OE3A 1AZRA 1DYZA 1BQ5A 2N0MA 3EH3B 1ILUA 3T9WA 2ZONA 1AS7A 1W8EA 1RCYA 4UAHA 2ZXWB 2VMJA 1EHKB 2UXGA 3NT0A 1E5ZA 1NWPA 1ZV2A 3PLYA 3T71A 4PCYA 1FA4A 1IKOP 4AZUA 4JHUA 3NJKA 1PY0A 1NIDA 2PPCA 2VSKB 2I85A 4KOCA 1MZYA 4HCGA 4E9RA 4DPCX 3FU9A 2DV6A 4A68A 1M57B 1J9RA 3H4HA 4HHGA 4AKPA 1OE1A 3OQRA 1NIFA 1TEFA 3KW7A 1PLCA 2XWZA 2IDQA 3QJRB 1PZCA 1PZAA 1ET5A 2CAKA 2HLEB 4YL4A 5TK2A 1JZEA 2HX9A 3S3BB 1GS6X 3UADA 1FWXA 3QQXA 2IDTA 1L9QA 4W1TA 1ZIAA 3HB3B 1JXGA 1SDDA 1GY2A 1J5CA 2XU9A 1AAJA 3ABMB 3UABA 2XXFA 1JZJA
chains in the Genus database with same CATH superfamily
4NQTA 4W93A 1QACA 3LJ3A 4Y2DC 5DSCA 1J1PL 3RHWF 3RDJA 1NINA 3HC3H 4ZTEA 3V7AE 2BNUA 4AIOA 3HKZA 1GYWA 1HILA 1JXDA 4U2YA 2JXMB 2QFPA 3L3KB 4XMWA 3ZDYE 1TLKA 5T1MB 4PLJC 1F3RB 2WHVA 5IVXF 3BH9A 3EYOB 4Z0BH 2XJKA 3NCYP 2IH3B 4IBQA 4JPIB 3IFOB 2LABA 1KIUB 4ONFH 1LNUA 2V7HB 5CBEB 5I19L 1YAZA 1OTSC 4KKPA 3CK0H 3LD8C 3JV6B 3QUZC 3WNLA 3ME0B 4JFDE 1FZOB 3U82B 1U3HB 3BN3B 4D3CL 5D1QC 5BVJA 2C9QA 2C3HA 1V8HA 1XF4A 2F8OA 3ZW3A 3MJ7A 2Y1ZA 2IDCA 3I2CH 3C5ZD 4RDQG 4U1JA 4HKJA 3LRHA 5BXFA 4WJKB 1KCVH 5ICYB 3CV5A 5B3JE 2BNRA 2OL3A 4UIKH 3QUYA 2P5ED 4WO4D 1VGKB 2Z93A 1AQDA 4WGVB 1B6DA 1DO6A 4AM0Q 3LIUA 1MAKA 2YKKA 1C5DB 3F7YB 4YC2B 5I1EL 1D5BB 4FLHA 5L0QB 5B38B 1LMIA 4XZUB 3VGAB 2P48B 1TTGA 1AQHA 2PYEB 2Y07H 1C12B 4EKJA 3QFJD 3HR6A 3MO1B 2AJXL 1BEYH 1T89A 4ODUA 4XWOC 1U6AH 1BQSA 4L9LA 4RBPK 1WSST 3ULUH 4W9LC 3G5VB 4FQ1L 4B27A 4Z3GA 3LS4L 1QKZH 4NERA 2WWNA 1INEL 1FAIH 1Y0LA 2CKBA 3FB7A 3UC0H 2J72A 1V27A 2ATPA 5B4MC 5IQ7L 1IGMH 3IU4H 2H8PA 5F7BA 1TQCC 1FYTA 3T0BA 2ENQA 1AY1H 2F2HA 3MRHB 3R1GL 5FGBC 2GHZA 3MU3A 1JSYA 3FU7A 3ZL2A 1Q38A 3WV0A 2BC4A 2XG5A 4FJYA 5C07A 3GMNB 4HETA 3AGVA 3BT2H 2WN3A 1TZIA 5T1KB 1RJLA 2DICA 1LP9E 1I8LA 1TIUA 2XBZA 2X0UA 4C4UA 3KPRA 4XP5H 5F97E 1UHVA 4M7LT 3ZKMC 3HC0B 3SE3C 1FNSL 1HZLA 1P84K 3CVHA 2EUVA 2HPTA 1USQA 3BFQG 4GBXD 4LCWB 1I8AA 3ZE0F 5E94A 2J6EH 4FYSA 1JZ5A 2CJUH 5D7IA 4DEWA 2DB8A 2F54E 3IDGA 1G7PA 3N40P 4LB8A 4YBQC 5LCVL 4HLEA 1W0WB 1BZEA 3HBGA 3EXJA 2P24B 3H42L 1DVZA 4LSTH 4TM9A 4U4IA 2OM5A 3VYPA 3CSTA 3APMA 4ZO7A 4ZFOL 1JNNH 1AJ7H 4LLVB 4UU9A 3TN0D 1J10A 1XZ0A 3ET9F 3I9GH 3KPSE 4K3DL 4MA3A 4R7DA 5IFAL 3FB5B 1HSBA 4NQXA 5CLTA 5DHYB 4QPEA 2ZUSA 1FO0A 2YPKB 5KTEL 1XT5A 3CFCH 4YSSA 3FOMA 4URKA 1F4YH 1MCHA 3ZTJG 3BQUC 1JWMB 1KULA 5GGSB 1FNHA 4JRXD 3QFDA 1SLUA 1PJ9A 2GSGA 3SIKA 1ZTXH 2F53A 3VAEA 2DW5A 2X4OB 3HNSL 2FJGB 3UZQA 4AEEA 3IDNB 1FH5H 4JLRB 2AEQL 4X9IA 5GISH 5SX5H 1PBYA 5IHWA 4OV5B 5E7FA 1GS7A 3O2DH 2PNDA 2DQTH 2E8YA 1XD0A 3MNVA 3D18B 2WXPA 4N0UE 1BXUA 4DEPC 4JG0L 1OT4A 5J6SA 4EDWH 5CN3A 1D5IL 4AY0A 1T1WA 4AV0A 1A1OA 4Y5XA 1WIOA 4FHBD 3K6SB 3JT2A 4LAQH 5KSAD 4PGZA 1JK8A 4XNYL 3VDAA 1K85A 2ZQKA 4IRJD 5C0DB 4JDZB 3FDWA 2B14A 4UQ3B 3Q01A 1WAAA 1XF5A 3HVDA 3NDYE 3O4OC 4LAJH 4BFIB 4PRBB 5L4JA 2B0SL 4HQQL 1OGTA 4K5MA 4HULB 4QF1B 4ZFOB 3OJDB 4M6NL 1PCXA 4HF5L 2HJLB 3BKCH 4NZDA 4B6ZA 3CFJB 4Z7UA 2F1AA 2VLMD 3MN8A 4NZRL 4R96A 3C5XA 1ZGLM 4JY4B 1H0DB 5FGRA 3VXQA 4LLDB 2GJJA 5HJ3A 4UQCA 4Z5RB 5AYTA 3EXLA 2G4GA 3GRWL 3RVTD 3CDFA 1KCKA 1E4KA 3G6AA 2HN7B 1B6UA 1EGJL 1TTRA 3R06A 2Y36H 2VDNB 4P5TD 2K8MA 5HDWA 3HZKB 1BLNA 4L8DA 4NCC2 5F3HA 1MF2H 1F42A 1F56A 3FUNA 2VXVH 3WY2A 1LVEA 4BKLB 3GGWA 3RNQB 4AJWA 1UVQB 4YDLB 4YH6A 2OJZL 4NM4H 4Z7QE 1RZGB 1S9YA 3GSOA 3ZXAC 1AQ8A 2VO8A 2IDUA 2Z31B 4XBGB 1JF6A 1VHPA 1IGIH 4P2QE 4D9QD 4DJMA 3QIBC 3A6OA 3IETB 1NH6A 2GIYA 1YNLH 3QO1B 3JWOH 5J56B 4NWTH 1ULVA 1IGTA 2C3VA 1H5BC 4GKNB 1LO3L 4UT9H 2EACA 3HPLA 4LLMA 2ZCLH 3JBG7 3ENEA 3PV6B 4XC1H 3T4YA 3FF8A 3T0AA 1TCRA 1FV1A 4AE0A 2JB6A 5I8OH 3N1QC 3EGXA 1DQVA 1U8HA 5AW8B 3WENA 5I76B 5TE4L 1L7IL 2G5BA 3ARQA 3C5ZA 2BP8B 4XBPB 5IBLC 4M56A 1HH6A 5KYWA 3K6IA 2VXQH 3GI9H 4OT1H 5HVWA 1MFNA 4H1LA 1HXYB 2X2YA 3PJSA 1AI1H 3FQYA 1TVBA 3CMGA 4WO4A 4FD0A 4HUXB 3TA4D 1SUHA 4PHZA 4ZMWA 5K9OB 2VR3A 3BX7C 1RZJL 2ZXBA 4XN4A 3LMJL 1H3VA 1KNOB 1KGXA 4XODA 4E41A 2N7SA 4JW3A 2QGDA 3STLA 1MRDH 4JJOA 3ZMEA 2MKWA 1TNNA 3KCPB 1BVKB 1ZA6B 2VDKL 5C0AD 4A7SA 4DERA 1TZHB 5EZLB 3F62A 5GQBA 3TIDA 1LTXA 3U46A 5KVDL 2PF6A 3V0AC 4AL8L 2PCFA 2KZBA 3WY1A 3D51A 3TCXA 2EDYA 1AHWA 5CZKA 5D7SH 3DJSA 4HBQA 4AQ1B 2W38A 5AD0A 1JNLH 5C6TH 4N2EA 4H0IA 3SKOA 2YIHA 3PWVA 3WLWD 4O9HL 3SQBB 4PYGA 1DQDH 4XMTA 4Y5VB 2D7TL 5AFAA 5IQ9A 3ZPDA 5HDRA 3WG7B 1KTBA 4CBZA 1PQZA 2VLKB 4KZDL 2A9MH 1JPFB 1NOAA 5CBAA 1F0LA 5IHLB 5BRQA 3RJQB 3TZVB 1U3YA 1YDPB 4CC4C 2GI0A 2Y6SC 1HYSD 4XMKL 4M5YH 2VITA 4AQ8C 5JMRA 1D7FA 5GGTL 4DGVL 5GRWA 2MTPA 3MLZL 1RU9L 2NX5E 3EYVA 3H3PH 4YQXL 1N8ZA 2F7QA 4LPUA 4BK5C 4FQXB 4UQAA 5ERWA 3WS6C 5HHME 5C7ZA 4CW1B 5TK4A 5KEZA 2NOYA 1WEJL 1GXEA 4FFYL 2ZX6A 2QQQA 4I0KA 4W9GC 1YY9C 3PU7A 4N90D 1D3CA 1N0LB 4RQQA 2FTAA 1G87A 5F7YC 2LU3A 3OVUB 2BHUA 3LKNA 1IFRA 3GSNA 5I17B 2BOBB 2VZVA 2VDKB 2COVD 1BQHB 1XGRB 1CD8A 1OAUL 4FTVA 3T04D 4PJBB 4M43L 3FCSA 4A63A 3TN0A 2WVTA 1D6EA 5DK0A 1FCCA 2D03H 4M62H 4F2MB 1AYOA 3UJIH 3ML9A 4F58H 1NIAA 4CL7A 1FJ1A 3KYKL 4QXGH 2BZDA 4PJGB 5HYFA 4DZBA 4XI5D 4R3SA 4HD5A 3V95A 5MENB 2XOTA 4PJFF 1GPOH 3DJ9A 3BVNB 5LNDA 1U8KA 4JRXA 2BIMA 5DZVA 3WMQA 5LJYH 5DD0H 3LKSB 1AGDB 5I1HH 2XXGA 3RGVC 2NY7H 4ZD3L 5AZUA 3EOTL 2GC4C 3FQWA 1HCYA 3OBAA 4OJYA 4Z3JA 4YGAB 4G6AC 2ZJSL 3MXVL 1UB5B 2FQGA 1FDLH 1CDYA 3HZYB 3L9YA 3QHZH 3BIAX 4MNGE 5J9PA 3WUZA 4W6XB 5IQOA 2BZCA 5I6OA 2YXFA 4FP8L 2DBLH 1V10A 4MXWL 5CEZL 3ULUD 1G7HA 2GT9B 5D4JA 2K78A 2Z92A 1YMMB 4EBQL 5IJVA 3QARA 3WFDL 5F89A 4YE0A 1F3JB 5KSAA 4AUJA 2ZSVA 2NSQA 1UXLA 3D39B 5GPRA 3BT0A 4NQDE 3GFUA 1ACZA 4UV7L 5AW3B 1NQBA 3PDOA 4XP1L 5FUOL 3QIWD 3W0WD 3BW9B 4KDWA 3HFMH 1FFTB 3TEUA 4GSDH 1SLWA 3EJSA 3O8XB 3BUTA 4WI9A 1AZRA 1IL1B 1SEQH 3U9PH 1YPZB 2JJVA 2WXOA 4JE0A 1H3WM 4RESB 1TTAA 1W8EA 4PRDA 1P4UA 1A7NL 5C7XL 5FDWA 1J0IA 5K1NA 5EORL 2DQUH 5GRYA 3RJDA 3T71A 1PSKL 1JIBA 1SJXA 4R4BA 5D1XD 1NFIA 4HEPG 3D30A 3O2WL 2OX5B 5HI3C 5CSGA 4P5TA 3LN4A 4OM1L 2WBJD 3H0TA 3FQNA 3KWVA 1JGVL 5F3BB 4TVPE 4ONHA 4QRPB 1J9RA 1MHEA 1OZTG 3F8UB 4FN0A 1YA5A 2EQDA 2X2UA 4AJYV 2NY0B 4JZJC 4YDZA 5JW4N 4I18B 2HH0L 3D50A 3QCTH 2J7LA 5LQBH 3NCJL 4KNQA 1I9RL 2HLEB 1KELH 1J86A 4YL4A 1PVHA 5EC2A 2HLFC 1TQWA 4X83A 3EG9A 2Z65C 3KLQA 4QXUL 4Z9KB 5LO7A 5CSBA 1J11A 1XXFC 4JCWA 3K6DA 4MDRA 1WZLA 1R33A 5EU7C 3LRMA 1CI3M 1OWWA 2R59A 2Q3AA 3SDDB 2JI2A 4ZPTA 3L2NA 1HZHL 3G7TA 5IW6A 3GIZL 4K71B 4XVOA 1S8DB 2DYPB 1HOCA 5AAMC 5IUCA 1FFPB 2EIMB 1MCBA 3ULVL 1UWEH 4I5BA 4JKMA 3SDXB 1BLIA 1UYWH 2DI7A 4CU7A 4RAUB 5LB1A 4HPHA 1G7QB 3MUGB 3NSDA 3CBKB 4QEGA 4FFTA 1KBPA 5FR3A 4LLUB 4LEOA 2JCCA 2VTFA 3OZKA 5C0AA 2WUCH 1E3XA 3J2PA 4H13C 5FYJE 4HVBA 4HGWB 3QULA 1KF9B 1X6NA 3NP3A 2ISDA 1KJ2H 4ADIA 4JANB 5DQDH 2DQEH 4CMMB 3BP4B 5FCSH 1Q94A 4WKXA 1OM9A 4X6EA 1N6QH 4MZ2A 2R2HB 5I9QB 3Q05A 1D2PA 1XF2B 3BN9D 4NQUA 3VFTA 5CD5C 3E3QC 3PGDB 2GG1A 5CJQH 3C2SA 3JVFC 3CN3A 4HT1H 3VSVA 5DUMH 4JDEA 4YFLF 5CFAA 4JFED 1UZ8A 1EZVX 1RHFA 1W0YT 5GHWL 1XTLA 2Y1YA 3DTUB 3Q9QA 1UASA 1MI5B 1AKJD 3QHFL 1EEZB 1J0JA 2MMXA 2P8LA 2Y1AA 4BH7B 2X0VA 2UZIH 4DEUA 1Q72H 3MNWB 1KIPB 4FCHA 2VQ4A 1T21B 1UKSA 3ARBC 3AWFA 4FYRA 1NDMA 4JHWL 1RZ8B 3KL0A 4L8SB 3CU1A 2J25A 3EDDA 2F18A 3MTRA 1J5IA 4PTUA 3VFVA 2X4TB 3RZCC 2DWDB 5IOKA 1RLBA 3O0LA 2R0LL 4S2SB 4TPRL 2QSVA 4MB1A 3ZZ1A 4YHLH 3K81A 1O75A 4Q7DA 4L4VE 1JP5A 3SKJL 2C9SA 5KG9B 4UTAL 1IZJA 1IFHL 3DO4A 1I7ZB 1XXDC 3VXSB 1YNKL 4YXKL 1NCBL 2Q8AL 2M8XA 3O6FD 3QWRD 4PW4A 4JZOA 4XE5B 3VB8A 2VMEA 1XL6A 5I0XA 3CBRA 4ODTH 1R5WB 1KB5B 2X53A 3TBYB 5ADOH 3LB6C 3RTQC 4AYDC 4IS6B 3VDCA 5KVEE 5IHUL 1W0VA 4NRXB 1YEFL 3DVNB 4ODSH 3QCVL 5C0GA 2ED9A 4H5SA 3ARDC 4QOKB 4GAYA 3EJPA 3SD5A 1R3LA 1SMAA 2EEDA 2EDLA 4R8WL 3BWZA 3O3DA 4EI5C 3BFWA 3U9UB 3BAEL 3EFDL 4X7EC 1PX8A 2Y7NA 15C8H 4LNRB 4A2EA 5KS9E 2FRGP 5SWQB 1A6PA 1NAML 1RK7A 1ZAGA 2WZAA 1K4DB 5ACZB 1KGJA 4M1DH 3N1MC 3VXNB 2IGTA 2XTJC 4LNVA 4OCYL 1T3FA 2ID5A 1XR8B 5GGQH 4PI2A 4XCYA 3DX7A 3VFMB 3AT0A 1RQ5A 3A6CH 2YD4A 4XPTL 2QQLL 4JJ5A 4EXPX 2DQHH 3ATAA 3GZQA 1DVFB 2H26A 3HR5B 1IEHA 4LCYB 3ZHDA 5HGBA 5EF2A 5MHSD 1TUPA 4JGMA 4IEFB 2EVJA 2C1PB 3VD3A 4X6DF 1Q9OA 3W0WA 5SX5K 3IS1X 2WYHA 3SDAD 1ZT7A 2RFXB 3EFOA 5HGHA 3U0WL 2RHEA 1HHIB 4ZUVB 5HGDB 2QVFB 1KZYA 2VR6A 2VUKA 1JPGB 2BVQA 5F44A 5J1AB 5ITBH 3HPJB 1HL4A 4M1CD 3CMOH 4FL4B 5EUOA 4MSWB 2HRGA 4GNKB 3C6LC 3PWJA 1URLA 3SPIA 1IGFH 1DLFL 1OGAD 4MLSA 1BA9A 3VXPA 4NRZA 4RFOL 4OLYH 1SDDB 3QDGD 2YD5A 2YFOA 2CMRH 5LDSA 1OAZH 3ZTNH 1HX0A 2XKUA 3PHQA 1GCYA 3DC0A 3E9TA 3AS1A 3THMH 3UTQB 4LKXA 4OU3A 2WBJA 5EO0B 3T1FB 3FFCB 3MRDB 3UTSE 1A3LH 1KBGL 3B7TA 2DLFH 2J6EA 5C3TA 1XGPB 1NAMB 4X8JA 4Q9CA 3FYIB 4UIMB 5HGAB 1BFOA 1GW0A 1M71A 3ILQD 4CDHA 4ZG1A 3MRJA 2AK4D 4M3KB 3DV4B 4DKDC 3U6RB 3IRPX 3VWKB 1DJYA 3OLIA 3P0GB 4JRYD 4NKQB 4Z7IA 5DZNA 3WY3A 2H3NA 2VWEC 4Y8AA 4H8UA 4Y0GA 1YYML 4F33B 1QATA 4XMLL 1MFEL 2EYSB 4GUQA 3AMKA 1AG0A 2FT7A 3L95A 2FL5B 1SHWA 5BO1H 2B4CH 2WOBA 4YO0B 2OZ4H 1A7OL 3AS2A 3EJYC 1F4AA 3UTPD 4Y16D 2ZP8A 3Q7JA 4WEEA 3GSVB 3MCKA 3GSUB 1II4E 2X4QB 3VUAA 3KNBA 2RCSH 1YEDB 2W94A 3FH5A 3O2DA 4FG6C 5ESAA 5F7MC 1HEHC 3UG3A 4PP1C 4PVBA 4HSAC 2YAPA 8FABB 5D5MB 5AVYB 3EDFA 1NLDL 3N1GC 3SOBH 3KE0A 4TUJB 4OI7A 1QI4A 32C2B 4OCWH 2FIKB 4RMSA 3ZYJA 2MPAL 4K55A 5I73B 3FT3B 2AV7B 2BNRE 3KBEA 5G4MA 3STZA 3WBDA 4PRIB 3DYOA 1MXGA 4RMBA 2ZXQA 2APTA 3SSGA 4BZYA 3MBXH 4APQA 1DVUA 3FU5A 4EZKA 3OKLB 4XCCL 1NCAL 3OMIB 2OFQA 3GXIA 3WFCL 1MHHA 4WO0A 1F6AB 5K69A 4MQXC 2PWGA 4JFPB 2YGNA 3OXSB 5JHDB 3T0EE 3B1UA 2AGJH 4G6ML 5IMMA 1SF5A 1UJTA 3AXLB 1HKLL 2QHRH 3TH4T 1ZWIB 3PWNB 5EZOH 4IRSB 3WHE0 3RWCA 1GGIH 3LKQB 1F86A 4Y19B 2O6PA 2PLTA 4XP6H 3QXDA 1ET7A 3CPLA 4Y4HC 1BQLH 4P57A 1HIMH 5CMAA 5H4ZA 1CE1L 3ABLB 5EOCJ 1FYTE 3MLPA 3CVDA 4MMYA 2LVCA 1ETA1 4KUZH 1IEAA 1BD2D 1MJJA 2Z7YA 1ZS8A 2Z64C 4FA6A 1VENA 3QJZA 1J1PH 1ICTA 3RBGA 3SO3C 1CBVL 4FG4A 1QSFB 3DUSB 4MD0A 4UAOB 5C07E 3NIDE 2J20A 1THCA 3FO1A 4AW7A 4XB3A 2FBOJ 3QZWA 4R9HA 1AR2A 4OFQA 3L5JA 4BSVA 3KPRE 3VFNB 1B88A 5ANMA 2WCPA 3EBIA 3FS9A 4Z7QF 5EBMB 3N40F 1Z5LA 5J0BA 3O6FA 3QWRA 5I19H 5FYJU 3MLRL 4MYPA 2QMKA 4AV5A 3DX9A 4OM0L 5HY9A 2WGXA 1MCFA 2XQYA 2H47C 3N43F 5HYJD 4D3CH 5ICZB 2R15A 3CQPA 4DQOL 4H88L 1Y1UA 1SZNA 1GS8A 3L2LA 3NEXA 1WCQA 3AUVA 2VXQA 5D7IE 1ZA3A 1FCGA 5K93A 4HCFA 3IYLW 3LX9A 3MRRB 5ALCH 3ZT6A 3RX8A 4LOFA 2WNWA 4PJ9B 1OM3H 3RFZA 3CVIL 4KQ0A 3IXTA 4YDNA 2XWXA 5K39A 4C57C 2I26N 4YDJA 3UJTL 3PE9A 5KYUA 3EYSH 3B7UX 4IKLA 4YSEA 4UTBL 2LOEA 2XXCB 3RNKB 3S3JA 2G5RA 4NC1E 2Y7SA 4G6FD 4I1PA 3ARED 3P9MA 2ZNXA 1BWWA 4HHAB 4LDEB 3ARVA 4KXZI 4JFOA 4H20L 5I1EH 2OMZA 4ZYKA 4LSSL 2PWDA 2AJ3B 4HZAA 3QEHB 4DVBA 1UXSA 4Y1AB 3UO8B 2H2SD 4P9HC 1V7NL 2CD0A 2NYYD 1U8MA 2AJXH 2F53E 4MS6A 3V0GA 1MCDA 2DH3A 2UXVA 1JN6B 4Z7OE 2ZCKL 2NNFA 1NIEA 2BIHA 4FQ1H 5DI8B 3LS4H 1KXVA 1QW8A 5I6PA 1INEH 1HFUA 2VCOA 4GEIA 4IHOA 3REVA 5EU3A 4FQLL 3SDAA 3H2QA 3FQXA 3QZPA 3G04B 3M17B 5K9KB 2H2PD 2R2BA 5I8EB 3EHBC 1Z9PA 3R1GH 3D9AL 1JGDB 2QDWA 3EFFB 2EYTA 3ZHFA 3WKQA 1NGWA 1M7DA 5CS7A 1DBBL 3E8VA 2JIXD 4KROC 3ARFD 4F1SA 1WAAE 5F7DB 5KAQG 4F7TB 2I9LB 5T5NF 1T7WA 4Q52A 4OD2B 3NSYA 5I6XB 4AKOA 2CPCA 5IJKA 4X6FB 4BBWA 2BK8A 1F90L 3OHXA 2K4AA 1FNSH 3EYQD 3EYFB 4RA0C 5DJ6A 3RVUD 4ZMVA 1F1GA 3V6FA 4L4TB 3PWLA 3B5TA 5HYSG 4WTQA 5LG6A 5HHPB 2CBTA 3D4CA 3BP7B 4JRYA 1AKPA 3MYZA 4TQPA 3SYCA 3I02A 3H42H 5IB4A 3GMPB 2GK2A 1R46A 4HWEL 1ETZB 4FLRA 3NT0A 1LWRA 5EOTA 1UWFA 2VKXA 5IFAH 1NC2B 2HKAA 4FXGC 2J1WA 5H2BA 4GW5B 4N85A 4ZUUA 3NCWA 5KTEH 1AHKA 2VSKB 3ESPA 3WGVB 2AKRB 2HKFL 1TR7A 3B2UC 4WU7B 2K1MA 3V5HA 4NBYB 5HDBF 3HRZB 5A6IA 4W6YB 3NCMA 4GIOA 3ZMNA 3ALXA 5FO8B 4EUPB 2CDEA 2R9HC 5I82A 2NYZA 1KJVA 4FABH 1PIFA 1YY8B 3GXFA 3W57A 1AGCB 3IDMB 1KYFA 3BSZA 4XAKD 4J3XA 4TULL 2CGYA 5FYLD 2AEQH 2J3SA 2VZTA 2IADA 1ZY9A 3QJRB 3DXAB 2VDML 1DQTA 3KL5A 4KKRA 3X13B 3BPLB 4PG2C 3T8VA 2WP3O 2A38A 5F21B 3JVGA 4JG0H 5GZNC 2B59A 4ZUSA 5EBLB 4WUKL 4QYOB 4HUVB 2Q2LA 4P59L 3TBTA 1DQML 1OAXL 1IC5L 2VLJD 2LTQB 4GG6F 1E5BA 3ARGD 2AQPA 2FZ3A 4R84A 2HKHL 2Z4QA 4XNYH 3QFGA 3L3IA 3RVXC 4BINA 1KB3A 4J3WA 5F6HJ 2JWYA 2WXFA 4E41E 1IRAY 1NCHA 1N68A 1O6TA 3NZ8A 3NZUA 4YR6B 3NRPA 3QQ4A 3KPOA 2B0SH 4HQQH 4WUUA 4M6NH 1KIQA 1ZLWH 4HF5H 3AM8A 3QJFB 2I27N 5DK3A 2O6DA 1IUZA 4NZRH 1Z3GL 1AXSB 2BCMA 1P5VA 4ENZA 1LLAA 4KJPD 2G0KA 1XMEB 2AJSL 2YPLD 3K4DA 4IBSA 4NN7B 4RGMB 4V1DA 5I16A 5E1QA 3D25B 3FSZA 3GRWH 3LVTA 2DWXA 3CXHJ 4H8WC 3FBKA 2ICWB 5I0ZA 1T66C 1A4KA 1EGJH 4IHBA 1DQLH 1J5DA 2QKSA 1UJ3B 1BD2A 1USZA 2D0GA 4XOCA 5IF0B 3T4AA 4WI0B 4PGBA 2OJZH 4OUOA 2BZ7A 4NPYB 3AITA 4LMQI 2N59A 3ECBB 3HJEA 5DTFB 3VI3B 2VDMB 3H9SB 4O2EB 1CG9B 2J12B 4ZZKA 3ZE1E 3CZNA 3W1ZA 1BBJB 1ZHLA 1F2XK 4MHHG 1MRCL 4I8DA 4UQIM 1PY4A 4UINL 5HYJA 4PJHB 3BWAA 1UACH 3BPOC 1S9WB 5TE4H 4X7TA 1L7IH 4X5WA 4ZUWB 1U93A 4XCFL 1JHKL 3U30B 3O0RL 4HIIA 4FTVE 2G75B 4JFFB 2XICA 4N22A 2F8VA 4RNRA 1AC0A 3TU6A 3B3IA 1WS8A 3QR1A 3RB5A 3KG5A 4P3CL 2ED6A 2W65A 1RJYA 5T1LD 3AREA 2G2RA 1AQKL 2G2PA 1RZJH 4QCIB 2WXMA 3GJFK 1BXXA 4TXVB 3LMJH 4WWKC 1NGPL 4PCSA 2PN5A 1KJ2A 2VJ8A 1KCSL 2ZWYA 4KVNL 2KDGA 4Z1PA 3B4NA 2VDKH 2SEBB 4JRXE 2NR6A 4X6CF 1U3HD 5GS1A 2YAQA 2NZ1A 5KVDH 2Y3AA 1BOGA 2DMGA 2P45B 4GMTH 5GGUB 3QG6A 4AL8H 1T1YB 1FVCA 1T1XA 4APXB 2WYIA 3I6KA 1RK1B 1WUNT 1FH2A 3NFSL 4EI6A 3WJJC 1I8UA 3H9YA 3MRGA 4OF3A 1URIA 4IU2B 4O00A 1C16B 4HWZA 3DRQA 2LVEA 3ORJA 4M4PA 2HRPL 2EYRB 3WN6A 3D87B 3KYMB 3GHPA 3JT0A 4O9HH 2D3LA 2WKOA 3RIFF 1J5OL 2AS5M 3PP3H 2ZX7A 1TVHA 2D7TH 3GYRA 3II3A 5B8CC 3K74B 3H4FA 1PDKA 3VTTA 4KZDH 5KJRL 5KSBB 1A25A 5IQNA 4BCZA 2VE6B 3O45B 2CQVA 4NZUL 2XWRA 2B08A 1OSYA 3ARFA 2WXNA 4F9LA 1ACXA 2AQNA 1A6ZB 4AQZA 1KLFA 3QYCA 5GGTH 5TQ0L 4AJVA 4HK3N 4RMUA 4XGZB 3QS2A 1UENA 3GXDA 1RJZA 4I0PA 4YQXH 3LZPA 2VLME 1JZ4A 1WEJH 4S0SD 3O11A 5FF6B 5AVQB 1M9WA 1G6VK 4FNQA 3NZHL 4HCRA 4P9ML 5HHVL 1JUFA 2YPVL 3BAJA 4BZ1A 1OK0A 3SQOL 1N10A 1LGVA 1NFDA 3HN8A 1OAUH 3NIFB 1A1NB 4PD4J 2RQEA 4Q6KA 3LEXA 4M43H 2HT4C 4MAYD 1RK0A 1U8JA 3PL6C 3T2LA 1YNTF 3NCBB 3CHRA 3GDBA 3NP4A 3LEYL 3UAFA 1SYSB 3KYKH 1IC0A 2G30A 1IE5A 3MZTA 4FXKC 4D9QE 1L9SA 1OAKL 3GC3A 4B41A 3M8OL 4U1IB 3BD5A 1CE6A 2DAVA 2H45A 4Q14A 4M93B 3B7YA 1MCWM 3HZ3A 1NBZB 1QBMH 2RACA 1K2DA 3R0MA 4G9DB 4ABQA 4D0DA 4ZD3H 2VZ1A 2D31A 4HWUA 2KHAA 2VIRB 5FFLA 4U0RB 1IBDA 4MYWB 1A4CA 3D8MA 3O4LB 4M6OL 1ZVHA 2ZJSH 3MXVH 5F9WC 3SHSA 4ELKA 2XY2A 3X12A 4X5XB 4XMUA 5KS9F 3GLEA 2NW2A 4FP8H 1OLZA 3NCCB 5EN2A 4MXWH 5CEZH 2LU5A 2WQ8A 4U6XB 2FCBA 1B3JA 3DGDA 4WSJA 4EBQH 4HEMA 5JMOC 2VLJA 3WFDH 4QT5B 3ARGA 3TBCA 1SMOA 3VDBA 4BA0A 2BP0B 4E9TA 3NFNB 2D7MA 3HNTL 4O2CB 5FUOH 4XP1H 1NMCB 2JCCE 2RTTA 3WNPA 2MHAB 5IBTL 1P2CB 5C0AE 3FU3A 2WJ7A 4P2OA 3ZRSA 2ZOWA 4YBLB 4WRLA 1JWSB 5CU9A 3TYFA 4EN3C 2ATAA 1CQYA 4P5KA 4BM7A 1G84A 3NJHA 3T6VA 1A7NH 2YPLA 1KPVB 2NTSP 2NXZB 3VWJD 4UM9B 5C7XH 3TF4A 5EORH 1MCRA 1PSKH 3OKOA 3NPSB 4K3EL 2OMYB 3EO1B 2B2XH 2LU4A 3O2WH 4CDGC 5I6LA 3UJJL 1MFUA 3RDTC 1KY6A 2G9HA 4X0KA 4QO1B 4ZPVB 5KUKA 4L8BA 4OM1H 1B4TA 5D6CA 4HKBA 2XVGA 3FUJA 1JGVH 2ZKHL 5JIHA 3MRKA 4L8CB 3DV6A 3QRGL 4MB3A 3QUXB 1YUKB 3P2TA 4JX0A 4PV9B 3SGDI 3HG1B 2WXQA 4R7VA 3WD5L 4PJCF 4WENB 2HH0H 1U8LB 3OSKA 4ZODA 4K5NA 3L6FB 3NCJH 4M1GL 1I9RH 4X80L 5DJCA 1QWUA 1UD4A 2WYTA 3OGOE 4Z23A 1UWXH 4C4BA 4JM2C 4WAFA 4XO9A 1MFDH 3GRBA 4QXUH 4FCAA 4M6AA 3VFGL 4F8PA 4LU5L 5FM5O 5K9QI 3BUQA 4KO7A 3ABZA 3M1OA 1RMFL 4UNVA 3DLQR 4JDTL 2DMKA 3L9RB 4IMLB 4OQTL 4N90E 2ZXAA 4M3HA 4ZI8A 3HTLX 1V05A 3N0AA 3OG6B 3ZT7A 2JFCA 2C9AA 3DUUB 2Y06L 1BG1A 3D52A 3VE0A 1MY7A 2IIJA 1RZPA 1HZHH 2GHWB 2OMNA 3AU0A 3GIZH 3GSQA 4F7CA 3UG5A 3BKJH 5B7EA 1JI1A 1W8OA 3RURA 4ELMB 3MYJB 3LDBB 2OAAA 2IPKA 4X7SL 4Y1SA 4DSYA 2JXMA 3NGBB 3ULVH 3TA3C 4N9GA 3SKMB 4GH7B 2MIZA 1WDAA 5T1LA 12E8L 3EOAA 5LDUA 3KXFB 5CGTA 3IDYB 4KO6A 1IJNA 2CDGB 1CPUA 2GJZB 4JPIA 4PV1C 3S8GB 3IFOA 3C60C 4IYKA 2X6BA 1KIUA 3FHAA 3ZLQC 3DKHA 4K8RH 4OAWA 5CBEA 2I32A 3T65A 4KXBA 4QRTB 2CUIA 1U3HA 4EOWL 5CJ5A 3NA9L 4U7SA 4MD4A 5D2NA 1L0PA 2IEPA 4MMXC 1KB5H 1N2RA 3SBQA 4YGVA 1VZIA 1I9IH 2HWZL 2XVLA 4OIBA 5DMGC 2WMPB 5ICYA 3FTYA 3MPCA 5F1IA 4LEBA 2BCKA 1Y6MR 4I2XA 3ULUE 1ERNA 1F6LL 3VD0A 1KGUA 1UADC 1NCTA 4OGYL 3W39B 1YCSA 5T1DL 1JZ7A 4YSAA 5D71L 4ZAKB 3GJEB 1XO8A 4ACPA 4IOIB 1C5DA 3F7YA 4QWWD 5GHWH 1S9VB 2NQ3A 2H6UA 3QHFH 2FECL 3MUHL 4XZUA 5IK3B 3W0WE 1C12A 4DETA 1UURA 4KXZH 3ETBF 1KTCA 5FDYA 4FULA 3W82A 3MROA 4C56A 5ACMA 3OX8B 2KZWA 3IPFA 4JHWH 4C58B 3E6FA 5K5YA 5DMJB 1OGPA 4J3TA 3G5VA 5JW5B 4PJEA 5EUOE 4F3FA 5E8NA 3FF7A 1LD9B 2IH8A 4WWOA 3L5HA 4KJWC 2R0LH 4TPRH 1G7JA 2E7LC 5ECJE 5JPNB 3RIKA 5DC9B 3HS0A 1ETJA 1OW0A 4OGXL 4X7DC 2NXYC 4JVPA 4PJIB 3SKJH 4B3EA 4UTAH 1P69B 1IFHH 5I0WA 4ISVA 1HEZB 1U0QA 1XVSA 1YNKH 2VLKD 4PWEA 5KYXA 2R1XB 1YEGL 2UWEE 2XDHA 4WI2A 4YXKH 1NCBH 4JR9L 2XRAL 2Q8AH 3O3BA 2V8MA 4YDMA 1BXAA 3MXWL 3MQIA 4MAYA 4MDJB 4LCUA 1OOAA 1VKXA 4NENA 4CVWA 1BFTA 3IJHB 4FQPA 4N3UA 2WQUA 1YEFH 1B9KA 1L5GA 2KC0A 1JD7A 3PWUB 2OP4L 3QCVH 4U3XA 1T4KA 2Q3XA 3HC0A 4FQXD 1MCKA 4R8WH 4OGAC 1ZSDB 4GRWB 1OD9A 1E5UI 3BAEH 4DCQB 4JRLA 3WLBA 3EFDH 4XN8A 1TYJA 4NSKB 4Y4FC 4YIQA 1ND0A 3K2IA 1NSNL 1AZVA 4K7PY 1NAMH 2P8MB 4KC3B 2O61A 5C9KA 4NPJA 4G1MB 1INQB 3FO2B 4Z8FL 3LNGA 4EQ2A 4OCYH 1ZTXE 1IQDA 1QBBA 4IKKA 2WXLA 3KVDD 5AEAA 2O30A 5LUMA 3QDMB 3ILEA 4JO1L 4NQQA 2QQLH 4XPTH 4Y5YB 4ZXBB 5B39B 2UYLB 3NJKA 1P1ZB 2MCMA 3KD4A 3UP6A 4Z3TA 1OQOA 4N0CD 3L3HB 3DTDA 2EO9A 3SPJA 1Q9KA 5MEND 1VFOA 2V5YA 3MA7B 3HMWL 1BIIA 4JG1H 5D96B 4A6YB 2Q7NA 4OZ4A 4NDMA 4Z7OF 4R7NB 4UDTB 2WIMA 5HHQA 3U0WH 2D8KA 3L9BA 5T5NG 2FJGA 3W9DA 3UROR 4MJ5B 2Z1PA 4JFSA 3KGUA 5AOIA 4HU8A 4OV5A 1PZCA 3NN8B 3K7UA 1VZGA 1JZEA 4XMPL 3BAWA 3VG9B 3MUJA 3RWGA 1LO0L 3VWJA 1XF3A 3VU1A 5A6LA 1KC5L 2CA4A 4QRRB 5M95B 1DLFH 3C6SB 3GMOA 4RFOH 2NNAB 2YQGA 3V0VA 1YMMD 3K6SA 5DHMC 1A6AB 2EDOA 4WIQA 1I1RA 1NKGA 2QADC 3EO9L 4XH2B 3RVVC 3D39D 2EVGA 2XG4A 2HCZX 2UXFA 3LQMA 2IH9A 1IAIM 1KBGH 1WAAF 4X99A 1ZLWK 4JDZA 4QRFA 2NPLX 4M5ZL 4MA7L 5C0RL 2A6IB 4M03A 3G5ZA 5LCVA 3AQZA 3UAJA 4PRBA 3ZKNC 2CK2A 3VVWA 4BFIA 5IV2B 4Z7UF 2DWSA 1FNEB 3A21A 4WCYL 4DKFL 4U4BA 2Z91B 3O8XD 5A1AA 5KSVA 4PV8A 3CFJA 3L5XL 3BVWA 3NTCL 5AW0B 2IMNA 4J8RB 4ZDHB 3V7MA 3DX4A 5FO7B 3DOIA 4YVUA 1YYMH 4YZFE 4XMLH 4Z5RA 4CU6A 1BQKA 2G4EA 4FLSA 1MFEH 3R8BB 1QP1A 1JXJA 3H6JA 4N8VA 1FZJB 3ZZQA 3BVDB 4AH2B 4OTXL 2PPEA 1N6UA 3BIKB 1CLZL 1I8KB 1UD8A 5E4EB 3L3JB 3NJJA 2J6WA 1XH1A 5ANME 3SDCA 4E9SA 3QWQB 4PJDB 1A7OH 3RNQA 2BPBA 4IJ3C 2RBLA 5DVPA 3H1ZA 3LNDA 4LLYB 1MSPA 2K9UA 2BSTA 2CLVB 1E4XL 1T5WB 3JYCA 1G7LB 2NY0D 1OXYA 3L5WB 3S5LA 5AAPA 4BZ2L 1HQ4B 2H0PA 4Q6IB 4ANUA 5DWUL 3R8QA 3ZSSA 1W6WA 2XA8L 3SGKA 2VQUA 3VU2A 3IETA 2BDNL 5CEZD 3DWTA 1NLDH 4UOW1 1WO2A 3C9NB 3WDIA 4HJUA 4UNUA 2VN3A 4EIGB 4QRQA 2DQ6A 2MPAH 4M7KL 5ETUA 3V10A 4IQHA 2YAMA 1KXQA 2YAFA 4IIQB 4LP8A 1OZUA 1IB5A 1BV8A 3DJTA 3QJQB 4XCCH 4Q9BA 1NCAH 1GR7A 1F11A 3WFCH 1UCBL 2J8HA 1A8ZA 2WLKA 4NKOA 3CLFL 2LLLA 3JV5A 1P9MA 6CGTA 1I1CA 1CLOL 3VM5A 4G6MH 2HVKB 4Y2DB 4KV5E 4HUXA 5K9OA 4KZEL 3APDA 1TG8A 2CU9A 2XACC 1HKLH 3Q2WA 1N0XL 1AZCA 3GRWA 5MHSE 1KNOA 1EGJA 1ZLEA 2JLLA 2GABA 3KCPA 1BVKA 5FLUA 3RQ3A 4WLCA 3CU7A 2YBRA 1RP8A 1TZHA 1U8NB 2QR0B 3T3PF 1CE1H 1KCBA 5AOMA 5JHLA 2WN2A 4QDGA 1DL7H 1CB4A 5ITFB 4MJIA 3T77B 2P43B 2BFGA 2LU7A 1DQQB 1RHHA 5CINL 3LD8B 4J4PC 3QUZB 2YARA 3W38A 3TEWA 1BZ7A 1CBVH 5IB5B 2VDOL 2C26A 3BQVA 5D1QB 4B9YA 1GAFL 4HX1B 4AYFB 2X70B 1JHTA 5DFAA 1A02N 3MGOA 4OY9A 4Y5VA 3OGCB 2LHAA 1TYRA 3L9EA 3LCYA 4HCIA 4ILDA 4M4RB 3EGDA 2CXKA 2XV2A 4EQ3A 2FWOA 5FECA 5D93B 2VLKA 1B4JH 3U7YL 4ENEC 1JPFA 4DPAX 2IQAB 3MV9B 1LE5A 1FBIL 3L48A 2NNRA 3I50L 3GLZA 1YDPA 3MLRH 3VQLA 4J5VA 2CHWA 3OMNB 3LN9A 4OM0H 1P0SE 3KYOA 1GHFL 2AK4E 1PW3A 4K4KA 2K45A 4H88H 3VI4A 3CXHK 4DQOH 3EJJX 1G7MB 1X5MA 1QFWI 2R39A 4JRYE 1AVAA 5LGYA 4LDCA 2J5LC 3RWHA 1NEUA 3ZO0A 2A6JA 2Z4TA 1OCCB 4QJ4B 1OHZA 1R3HB 3ULVD 4ZTPL 2ZSWA 3LV3B 3UJTH 3C75A 3UOAB 5C09B 3SBRA 1M42A 3TFKC 3H9HB 4UTBH 3K0WA 1N0LA 1E2VA 1OVZA 1Q8MA 3O6KH 4GQRA 1MNNA 2BOBA 4H20H 3F83A 2PTTA 1XGRA 1DCEA 4LSSH 4WEBL 3F04A 3PGCA 1MAML 2GUOA 4NHCL 1N8OE 4ZFGH 1SJHB 3UTPE 5I6MA 1BYOA 4KK9C 3DRTA 4JFTA 2ZWZA 3IE9A 3CHXA 2FBJL 4L23A 4ABUA 3PYCA 2ICEB 1V7NH 5I74B 4J27A 4GRLB 1A3RL 2IOMA 5DUPL 3FOLB 5DHVB 4G8IB 2BY0A 5MENA 2P7TB 2WQVA 4JPSA 2MQCA 3QNYB 1SXSA 1I9EA 5IB2A 4FQLH 4ORGB 4HBCL 2WLHA 2GK0B 1I53A 2NY2C 3QISA 4HS8L 4LCCA 2ZIDA 2O93L 3D9AH 1QSEB 5E2UL 4EUPH 2GTWB 5KZCB 3HAEA 4Q74A 2BINA 1UB5A 2VMCA 4YDKL 5GGTA 1DBBH 3US0A 2EUZA 3V0WL 1YEKL 4HOWA 5GJSL 2YOCA 1N64L 5F9JA 1B2WL 35C8L 1A7BA 1JYVA 3V4PL 3LKRB 1YMMA 4FFYA 3CFQA 1DVFD 4XPAL 1F90H 1F3JA 2ARJB 2NLJB 1XIWB 3D39A 1V5JA 5KBKA 1TVDA 3MRMA 2V9QA 2X4UB 3BW9A 1M7IA 4XT1C 1RPUA 4P48A 4ZSOB 4HMDA 4IIZA 3O8XA 2OW7A 3BQUB 1N26A 5AUMB 1YPZA 1BD2E 3VA2C 4K5PA 2OW6A 4HWEH 1EO5A 3TT1L 1H6UA 3ROLA 2J71A 2XKNB 2ZNWA 2DY2A 3LXUX 2E56A 1A64A 1MJ7L 2YA1A 3BGFC 3MRLB 4FI7A 2J1XA 4AC4A 3HHSB 3MRBA 3BZ4B 5K1JA 4JREB 2Y5QA 1KIRB 3QZNA 3KPLB 2HKFH 2DYSB 2HJFA 4MKTA 4DEPB 1ID5I 1WC7B 3Q48A 4AXWA 5F3BA 1B0RA 1UWXK 1WBXA 1EAPB 3A23A 5A3ID 1RFDL 1E50A 5K59E 5HYJE 4ZX4A 2GITA 4I18A 4TULH 1DN2A 4ZZFA 3VWKD 3RX9A 5J11C 3BEWB 4X4XB 4D7BA 4N2BA 2VDMH 2VT0A 3O4OB 3NFPB 3SGDH 3V4PB 4PD4K 1NIBA 5IB1B 5DR5L 5CGYD 4Y1TA 3ROOB 4WUKH 2EZ0C 2GFBA 4MBOA 4MLIA 4P59H 5EU5B 1DQMH 1OAXH 1IC5H 2X6AA 3QQ9D 4HIJB 4JFXB 4DK3A 1CL7L 2PCPB 2I60H 2HKHH 1UGKA 4G70B 1VFAA 4I4WA 3HA0A 3M86A 3O3AA 1WT5A 1ES0B 2DYRB 3KJ4C 3V0HA 4DKAA 2XPGB 3F00A 4IBUA 1XB8A 2WUBH 3QUYC 5H35A 2VDQL 3TYGL 3II1A 2XSKA 2O5XL 3STBA 1Z3GH 4BXSV 1G7QA 7CGTA 1IIKA 3CFDB 1EAOA 3PWPA 4LLUA 2AJSH 4HK0A 2ITCB 2HMIC 5DFWH 4XO8A 1Y1DA 1J7VR 4TLSA 4Y9BA 1HE8A 1EDYA 5AVRB 4E9VA 2DMCA 3QIBB 1FFNB 3FCUB 4EF3A 3E1ZA 4A55A 1T89C 4GUPB 2I7SA 2VXTL 3W5NA 5C08A 3RVWC 3V2AR 1DUYB 1I7RA 1Q0XL 1A22B 3R18A 2D4FA 5JHDD 3FSWA 3RZWA 4ERSL 2OMVA 3IJ7A 2PP8A 1L9PA 4QGYA 4QNPF 1OTUD 3EZ8A 5CCHE 1XSJA 4KKAD 3SO5A 4XVSL 5FCUL 2CO7B 2O26U 4Y19D 4R4FL 3M45A 3QJXA 1MRCH 3QPXL 1MHPL 3UFIA 4GPVA 4PWHA 4UINH 3WCYA 4B96A 2WZ6A 4E2OA 2EVIA 1I8LC 1ZK5A 3MNWA 1KIPA 2NY4C 4GW4A 5HDLA 5B3NA 5BZDB 4A2HA 1T21A 3IGAA 4MZ3A 3WNIA 1NFDE 2FLMA 1WZKA 1JHKH 3MV7D 3O3UN 3O0RH 4XCFH 3VD2A 3CXFA 3AQDA 4ZK8A 1GRWA 2CRIA 3BSHA 3UACA 1CGYA 1JZIA 2DKSA 2VDQB 3QWNA 4X8GA 3VXUB 4YAQA 1JZFA 2DWDA 5ECGA 1X4ZA 2HVJA 5EN3A 1AZUA 4P0DA 3ZDZB 1DTUA 4Z3IA 4P3CH 4X0NA 1ADWA 4FQHB 2A9DA 4B9IA 2DL9A 1AQKH 4AUUA 4CSZA 1UATA 4YN3A 5B1BB 1DFBL 5DZAA 3X11A 2UVEA 2X6VA 5LBVA 1J5HA 3L8QA 1NGPH 4JG9A 4C59B 3KS0J 5D7HA 2R2EA 5EC1A 5F96L 3TO2B 4KVNH 1KCSH 3EOYG 2IO5A 1K4CB 2C7UB 2IGLA 2X7LB 3HB3D 4FFWD 3WELA 4DF9A 4BGDA 1E9PB 3U25A 4UQBA 1UUNA 4QUOA 2ALAA 4HIHA 1ETB1 4IS6A 4L05A 5CEYB 3KL3A 1ZHNA 3QC6X 4NC1C 4NRXA 4XAKE 3DVNA 5FYLE 3AW5A 3NFSH 4LEXL 4KKQA 1DVTA 3E6HB 3OKNB 4PJ9D 5DCCA 5KJ7E 2EIEA 1WFMA 2HRPH 4LT7A 1J5OH 4HS3B 4L3FA 2YMTA 2C1OB 3KDMA 4MS8C 4I48A 2BOCB 4P4KA 4HEME 5DD6A 2VLJE 4HZLB 5G5DA 5ACZA 2DTSA 2ZTBA 2TRYA 2UZYA 4WNQB 5E70A 5KJRH 1I3RB 5DGQA 3IF1B 3MFGB 3MRNB 3TT3L 3DO7A 2ZOKA 2MQ0A 4G2AA 4NZUH 2H3KA 5D7KD 2NT1A 1S7QA 3Q44A 1XR8A 4Y1AD 4RAVA 4LHQB 3VFMA 2F7PA 2O72A 5TQ0H 3ISRA 5IHZA 1IAMA 4CADA 4PRAB 1XZWA 4UZSA 3HR5A 4Y5XC 1QFWM 1AOHA 3IMWA 2EEAA 2YPLE 3OJVC 4KKBC 2Z34A 4TF4A 3NZHH 4P9MH 3CFEB 1E6JL 1SEBB 3K1DA 4PUBL 2YPVH 1HHIA 4WU5B 4ZUVA 3SQOH 5EUOF 1YEHL 5IMLA 1RUQL 1TCMA 4UT6L 3HPJA 4YUEL 3MRPB 4MSWA 3R7QA 1T0NB 1RI8A 3ZQWA 2A0LC 4FQQB 3CSYA 4QTHA 3SPCA 2VAJA 1N5AB 1E4KC 3GXTA 1SDDA 3LEYH 5IG7B 3VCLA 2BS8A 1RZIA 3L4UA 4AEFA 1B4LA 2ADFL 4Y4KD 2EABA 2VSCA 1BF8A 3EW3B 1OAKH 1VEMA 1URZA 3T1FA 3MRDA 1R3KB 2HG5A 3M8OH 2JTDA 1M56B 3HC2A 1XGPA 2FHBA 2AC0A 5HGAA 3L17A 4L4TD 3GKZA 1RP9A 1IMHC 4OZGB 4P2RB 2YGQA 3DV4A 3S9DB 5DVMA 2FR4A 3F7QA 2NTFB 5GS3A 3VWKA 1KTLB 3UBXA 5D55A 2VABB 4M6OH 4U3CA 2WNKA 3FT2B 4MQSB 1PFCA 4R90L 2JSFA 3DPDA 2IGFL 1Z9NA 4F33A 2BX5A 4HDIB 2FATL 2X4SA 3RI5K 1JNHB 1X5GA 2QVIA 3WKNA 3FQTB 3VXOA 3P4MB 2FL5A 1S7TB 1XAKA 2PW2A 3AVEA 4BFKA 5EWIL 5CXPA 4JQIL 3WYRA 1HS6A 3KS0H 2V7NB 5D1ZA 1IX2A 1TJHH 4OIFA 3BD3A 4IOSA 3C5ZC 3HNTH 5JO5B 4HLJA 1MH5B 1RPQA 3L16A 3WEBA 1A21A 5FYKL 5IBTH 3Q8CA 3LQAC 1F45A 4KK5D 2XZZA 1CDIA 5A16B 3DIDA 4NZTL 2ADIB 4WO4C 3BP6B 5D2NE 3PABB 5B3SB 3IKKA 1R24A 4MFHA 8FABA 1HXKA 1YJDC 2BVOA 1WBYB 2H0EA 4TUJA 32C2A 3D3VB 2FIKA 4BFGA 4RVBA 4K3EH 1NICA 2P3YA 3FT3A 4AZ8B 4I2XE 5F9OL 1OP4A 2G0LA 3UJJH 2BMKB 5ISZB 2IWEA 3UZVB 5IVXB 3OKLA 2EDQA 3OQ3B 2BHFA 2FH8A 1SYVA 2J4WL 1AHWC 3QRGH 4JFQB 1OGSA 3BPNB 1WWAX 3F64A 3OXSA 5JHDA 2E46A 1HC1A 4CAGA 2Q86A 1MFBL 3WD5H 2DL2A 2RALA 3O2VL 4BIKA 2VM4A 3K4ZA 4M1GH 3VFRB 4XXWA 4X80H 1CTOA 2E7CA 3TJHD 3PWNA 3IVKB 3SEPA 3OKYA 1KPRA 2K3TA 2BWDA 4PVLA 4E0RB 4P46A 3TCTA 4HUCA 4PJEE 4LU5H 5IESL 3GHBL 1RMFH 2YSSB 2ZYSA 5JQHC 1VB9A 2YXVA 4JDTH 4OQTH 1AD9B 1U41A 5EFIB 3L7EA 2WVVB 2PXYA 3H56A 2DJSA 3AABA 3VVVA 3NIGF 1EJ6A 2Y06H 2EIZA 1TDQA 1C1EL 3MV7A 3C5JA 4YZFF 4BQBA 3DUSA 1P7BA 2RD0A 4GW1B 3SGJA 5HHOB 1A9EB 3IAPA 2R4RL 4X7SH 1VA9A 4MVBD 4AYGA 4EVNA 1FIGL 3WEXA 2NY5C 2IALB 2APWA 3V52L 4LVNC 4B95C 2E47A 3UTZB 3RX5A 3H9SD 1CR9L 3VRJA 4C83B 12E8H 1ZRUA 2EEBA 3LZFL 3EH4B 3RKDD 3VFNA 4NQSA 5FUZL 4JPQA 3BPCB 1UB6A 3D69B 5EBMA 4H8VA 4DP4X 3MOBL 4L0PB 3HI1B 3ZT5A 1XSOA 4H1LG 1NBCA 2AXHA 5EF3A 3TN0C 3BRGC 4EOWH 3ZK0A 5FB8B 3NA9H 5ICZA 4MNQD 3S35L 4F20A 4DUWA 2R0ZL 3AUWB 1HDMA 1CDCA 1L0XA 1OTTC 1P7QB 2VR8A 3E80A 2AP2A 1H15B 4CVXB 4P2AA 5J1TC 2OQJB 3PAVA 3FFOA 1N59B 2HWZH 3FQRB 4H26B 2A6DB 4JFFD 5ID1B 1P6AB 1WTGT 2XPZA 3BUPA 2H3XC 3KWUA 3ARBB 4XNMB 4J12A 4GRWH 2Z7ZA 3OKKA 3RPKA 5IJBC 1SDYA 5D71H 3RY4A 1L6ZA 4G9FB 1IBGL 3IU3A 2AJ3A 3LKPB 5C3IA 3ZRFC 5IFJA 4J3VA 4H4NA 1UGNA 4OZFG 3ZE0B 1CFVL 3K0YA 3CH1A 1F4XL 3DBSA 2D2OA 3P2DA 4D0BA 1I3GL 3PP4L 3FC8A 4X7FC 5HHXL 4TRPL 1T2JA 3VD7A 5DI8A 5KSAC 4PB0L 3TIEB 3AGWA 1UA7A 3WFHB 1Y07A 4M61A 3OB0K 4UQ2B 4YK4C 4R4ND 3U2JA 4OGXH 3WMPA 3ARDB 3MTXA 1TO5A 2EINB 4AI7A 3CZFA 4X4YB 1MHCA 3V4LA 3FB6B 1QRND 3PXLA 1YEGH 1TQVA 2DS4A 4HIEB 3BUDA 2XRAH 2VAAA 1XHHA 2LLGA 4K5LA 5DUJA 5J57B 3MXWH 2VKWA 4F7PA 3MBEB 2Q87A 4U33A 3GSWB 3HE7B 3IMTA 3CFMA 3ELAT 4OD2A 1SJVA 2E86A 2XTJB 2HZHA 4YPGB 2OP4H 4P5TC 1ZT4A 4Y4KA 1AANA 2Y2WA 5E9DB 4X5QA 2NSXA 1GGBH 4UTBA 1CDJA 1DVQA 4ES9A 2YJLA 4NUMA 5FGCE 4DO4A 4X9FA 1VFMA 1X4XA 1E5CA 4UANA 4NKDA 3GLAA 1NGXB 1ZPLA 1NSNH 3WIFB 2WGNB 1JHLL 3NEOA 2EECA 4G8EA 4QTFA 5I75C 3FCBA 1L0YA 4Z8FH 3GMPA 1I8MB 1CDGA 3UTTB 4EEEA 4FMKA 4NJ9L 5HVFB 4AIZB 3AZUA 1W2KT 2F19L 2IWKA 5C9JB 1ZPUA 3SYQA 7TAAA 4GQZA 9CGTA 3MKGA 4JO1H 4GW5A 5C0CD 5E9AA 2XN2A 1WBZA 4U7KA 4JDVB 4F5CA 3C6LB 4NN6C 2R1YB 2AKRA 2EXWD 3MV8B 4HUWB 4PYHA 4WU7A 3GMRA 2JF1A 5EZJB 4A66A 3HMWH 4OGQC 4TUKL 1CUOA 5AB2A 1R9FA 3ECQA 4LGPB 2B1HL 1N3NB 1ZE3H 4IDJL 4UQ9A 4AJ0A 3IDMA 5DJ8B 5HHNA 3NOIA 2EDKA 4PSRA 3O4LD 4F7EB 4EN2A 4XMPH 3X13A 3GMMB 1LO0H 3ILDA 1DUZB 1KC5H 4HUUA 4NI6A 1E8YA 4WW1B 1BZ9A 1WUZA 4KUCF 1UFGA 4BQ6A 4XXDB 3IMUA 3T09A 4ZS6C 5D9SA 1KPUB 4HS6B 1KYOJ 1MPAL 2HFFB 3D09A 4UMGA 5BMFH 2GTQA 2QVTA 2GBVA 2XQ0A 1JK9B 1FG2B 1XCTB 2XUWA 3EO9H 3TXAA 4K7PL 4LBEB 4TKWA 2M26A 2H1XA 2YD2A 4AYSA 5JIQA 4M5ZH 4MA7H 4P4RB 1DJXA 4YR6A 4MQTB 3PDDA 3WLWC 3HG2A 2WCSA 4DKFH 4WCYH 1EUTA 3UC2A 2AZUA 1E2WA 3L5XH 4WNJA 3NABL 5DLLA 4MJIE 4HMEA 4TL5A 2AQRA 4CNIA 2R1WB 2NXZD 1BMGA 3ESNA 4UM9D 5DEGB 4MXQD 1L6PA 3D25A 1PEWA 1HYSC 3L4WA 2ICWA 4N6RB 4OTXH 2V5RA 3KVQA 5I66A 3UZEA 2AJYL 1CLZH 2HX7A 1UJ3A 2DJMA 4H8QA 1VSCA 2R56L 2SODB 3DYPA 3CDGB 3IAGC 2VLKE 5CJ8A 4YDVB 2DBJA 5C71A 2VR7A 3QUXD 2J56A 3FN0L 3VACA 1WAPA 3HG1D 1RIUL 1X7TA 1E4XH 1MNUL 5DTFA 3VI3A 4YHNB 5GSVB 5AW7B 3VI4E 4YL9A 4ZQKB 4BZ2H 2CM5A 5DWUH 3MSPA 5A2AA 2XA8H 4NN5C 4U1KA 2BDNH 3SOTA 1EX0A 1DANU 4Z0XB 1BBJA 3DGGB 2M1KA 1BFSA 2RGSA 1ONQB 1SNRA 5K59F 4M7KH 4MNQA 1B0WA 4FNLL 4AW4A 1KFGA 4UUJA 4ZUWA 4Y4HB 1UCBH 3OAZK 4XI5C 2ALWA 3DSNB 3PS6A 4U6HA 4XRCA 1FZMA 3CLFH 3GQFA 4JFFA 4YSPA 4AGOA 2CRMA 3KH3A 1JI2A 3ZTJH 1TKWA 4ODHL 1CLOH 4PREA 3K72A 4P9HL 1PNCA 3AU1B 1KV3A 3JUYA 4F27A 1TQUA 4KZEH 3US1A 3BUIA 1N0XH 5FM5M 1HN1A 4KPHL 4XAWL 3N42F 3N41F 5MENE 3TM6A 3KMDA 1DBML 1FPTL 3NUKA 3QA3B 4NT6B 2SEBA 4AOFA 3WAJA 2K0RA 1OCRB 1AGBA 3MOAL 3NMEA 1DSYA 3QUMA 4PHXA 3P3RA 3SGEH 1TTBA 5GGUA 4APXA 1T1YA 4G82A 1VESA 1RK1A 3AADB 2JKJA 5HD8D 3S88L 2UVFA 5CINH 1S3KL 4IU2A 3MVSA 3OXRA 2WKOF 5C0FB 5KN5A 2UX6A 4LRIA 1A14L 1GAFH 3KYMA 5HYSB 4XCNA 5DHVH 2R7EB 1KACB 5IFHL 1LEKB 2H6PA 2NUTB 1YMME 1QRNA 3D05A 4NWUH 4L29A 4DWHA 2A1WH 3EH3B 1QR1B 3D39E 1P4IL 4PJFB 4WEUD 3DARA 4XO5A 4HV8A 5T8IA 4KX7A 2CJTA 1MCJA 3WN5B 4ETQA 1A6TB 1GHFH 1A6ZA 1DR9A 3DECA 4PCYA 3TP4A 1IBBA 1VFBB 4LSPL 4JN2B 1YPZE 2WBJC 1MJUL 4PWKA 3VXMA 5INCA 4AKPA 1NFDF 5FXCH 1I7UB 3HZVA 1NIFA 1QI3A 3KHOA 4HUNB 2HB0A 1JWUA 3B9KD 2F7IA 4P3WA 4WEBH 5F9AC 1MAMH 5BQ7B 3BZFA 4NHCH 1A1NA 3AWEA 2XV6B 1UD6A 4U1HA 1I3VA 4WW2A 3QO0A 2DRUA 4PBWD 3TC9A 5EO1B 2FBJH 1WH0A 1FWXA 3L4YA 3LAFA 1Z66A 1L9QA 2IDTA 5C0CA 5JOEA 2OMUB 1DN0A 5DUPH 4YDIL 3ZDXF 1JZ8A 3QH3B 2W9EL 4QY8A 5CEZE 3MRIB 2V4LA 1VJSA 2HUHA 4GS7C 1AXTL 4NKMA 4J28A 4HBCH 1WHOA 1IEBB 4GKLA 3LSOB 4GKSA 4G9DA 1NBZA 4HS8H 3RB7A 5BS0D 4D2NA 3PAZA 4RRPA 5E2UH 2AAAA 2EADA 5PAZA 5IKCB 3O4LA 3QWOA 5KWYC 4YDKH 1DJHA 4OZIA 5KVGL 3V0WH 5BOJA 1YEKH 2LR4A 5GJSH 1N64H 1B2WH 1Q0YL 35C8H 1NJ9B 3QDMD 3V4PH 3WE6A 1HEJC 4ZXBD 3FUFA 4Q4IA 1T1ZA 5EU6B 5J8OA 2H32B 1JV2B 4CMHC 3ZMRA 4APQC 3PQYB 4HKZA 1T22A 1SJEB 4PWJA 3BXNA 1CO1A 3NFNA 1LO5A 3D08A 4FXGB 2YPVA 4O2CA 2O4EA 3HKFA 3D0VB 4FOMA 4ABWA 3Q06A 3BN9C 3RYMA 2WB1A 5FHAL 4XBEL 3EUDA 4H8WL 5FFOA 4D8PB 3QDAA 3DUHA 4CC0A 2WXRA 3HIZA 1HL8A 1IM3B 3FULA 4U0QB 4BFEA 3F5WB 3TX4A 4B0MB 2MCPL 2AQ3A 1TSHA 5FOBB 4EIZC 3TT1H 3LZRA 5C08E 5KZCD 1GTFA 1ZVYA 4UM9A 4B9KC 2GAZB 1DEEB 4U1MA 1R75A 4L1HA 2OMYA 1MJ7H 3EO1A 2I5YL 4YEEA 2EDRA 3P30L 2V3EA 3MMEB 4X5LA 3C5SB 4ZPVA 4QO1A 5E1AB 2X87A 4IMKA 5JYMA 2YEZB 3IDJA 4L8CA 3QUXA 5LWYL 3WKYA 3Q6FB 3FT4B 2VLRA 1RFDH 2E7MA 3G6JF 3HEIB 4NQVB 1U8LA 3X1GA 4HOZA 3SGEI 4A67A 4ALAC 3KPQB 1EJ8A 1FSKC 4GSUA 2YGVA 4RSYA 3REWA 2IPTL 4J3OF 1PKQB 3CQFA 5E4IA 4FHJA 3ULVE 3HI5L 2OULB 3O6FC 3IEAA 4URTB 2HG0A 5DR5H 4D7PA 5CZVH 5HVGB 4BHUI 4IMLA 4DP5X 4Y2OB 1NUDA 4XPFH 1VACB 5TF0A 3NJXA 1YVLA 2WQAA 3DUUA 1CL7H 3PPSA 3WO4C 4Z7VA 1EJFA 1KT2A 3N50A 4XHJC 3RFZC 4XPHL 3HFFA 5BZXA 3SZ6A 3MYJA 1PX3A 5TGBA 1ZLUH 3QXVA 3SKMA 2VDQH 2X0WA 2OZNA 3TYGH 3APFA 5F7HA 3GS7A 2O5XH 3B5HA 4MCYB 4FA7B 4WDIA 4NCC1 3MX0B 2GJZA 4PS8A 4KNUA 5BV7C 2BWIA 3TBVB 2I9TA 2BHYA 3P40A 1CFQA 2BY2A 1RZQA 1KTKE 3B9AA 4Z7NF 3DOSA 1P5UA 4LOEA 4MNHB 2WZPA 6FABL 2WQSA 5E2TL 1I7TA 2KLTA 4LRNL 3SE8L 3GRGA 1DANT 2VXTH 4PGEA 4Y9GA 4HOXA 3LRSB 1D5XB 1UM6L 3EDJA 1MFVA 1OF2B 2BP3A 5DJDB 1JZDC 1KXVC 1BJ1J 4WV1A 1BECA 1Q0XH 4D8OA 2OXHB 3BPOB 2EDNA 1J0YA 4LLWB 4ERSH 3SDAC 3FUEA 3W39A 3FB8A 3GJEA 4NRYB 5C70A 1PLBA 4OQTA 4HGKC 2QBWA 5AL8A 1S9VA 4XVSH 5FCUH 4M1CC 4R4FH 1BF2A 1IV8A 2JV6A 1HE7A 3E2HB 3GSRB 4PLJD 4HG4J 3QPXH 1MHPH 3F05A 3F6LA 1KN4L 4WWKB 1HSAA 4NBZB 4XNDA 2IBZX 2QPDB 3J7HA 4MJ6A 1EHLL 5I5IA 4PJEF 4E42B 5IJKC 4ZJ9A 1T20B 2IAMA 2YFNA 3OHXC 3QUZD 5JW5A 2PPAA 4PW9A 1E9OB 2P4AB 1F4YL 1MRFL 1RIHL 1S4IA 5DMKB 1EANA 4NO3B 5I1CL 4L48A 4QRUA 1O0VA 3ILQC 4JEGB 4PJIA 2RH0A 2Y22A 3ECUA 1UT9A 5F88A 3S4SB 1E27A 3B9KA 1FF5A 1NUNB 4RMTA 2R1XA 3CPUA 5F96H 3MV9D 4G7VL 4X6DB 1MLCB 1Q9WA 3VFPB 2ZOUA 1PTZA 4P23A 3UCQA 5H94B 3RE0A 4BFFA 2AI0L 4UM8B 4LEXH 1BQUA 2Z7WA 3L3DA 5SWSD 2KMWA 1D7CA 1ZSDA 1T0OA 4TNWF 5MEPB 3IB4A 3U2SA 3BUBA 4XWOD 4DCQA 5C09D 3NA4A 3I6GA 3N04A 2E9BA 5BS0A 4KAQL 1JF1A 1LJMA 5F1NA 2VMFA 3WIHH 1L9OA 1INQA 1QLFA 4YHKL 3TT3H 4OD1L 1DSWA 1O6VA 3PV7A 4KTGA 1MEXL 2E27H 3NEEA 2H5UA 3JVGC 3IKCA 5KJ4A 1F58L 5CCJA 4Y5YA 3HMXL 1F00I 2UYLA 3GM0A 4GRLD 1P1ZA 1J0HA 4A7VA 5HYQB 7PAZA 3JQOB 2ADGB 2Y36L 2CG9X 3PL6B 1QBAA 4XO3A 3TTYA 2XTSA 5HJBA 3MA7A 2FQFA 2BJML 1C7TA 1FHNA 1P7KA 5TDPA 3LZQA 2F54B 3MNDA 4WFFD 4FXKB 3LIZL 3ZKMD 4UDTA 4PUBH 4XX1E 5JORA 4ODXB 3FHEA 1MKFA 2XVBA 1YEHH 3HBQA 1TTFA 3AM8C 4MHHI 4WFGD 2F8IA 1G1CA 1NBYB 4UOW0 1CGWA 2BSBA 4EO5A 2AFNA 2VISB 3NN8A 3KPSB 4YUEH 2EVHA 4YNYB 4BSWA 4KVCL 2OR9L 3JWOL 4IM8A 4LKCB 4WK0B 5JHDE 4NNXB 4RDBA 1N12A 4YBQD 3OSVA 3SQRA 2JI1A 5BQDA 3FONB 2YRZA 1WA0X 2NNAA 4TMPA 4BRJA 2ADFH 1A6AA 3DIFB 1XIWD 2NYKA 4O02L 2K70A 3PNWA 1WGVA 3T4AC 2D3JA 3UIZA 3SY0B 4HFUL 2A6IA 1HESA 2P49B 5AQ0A 2FT6A 4GINA 1EFQA 1EFXB 2Q76A 1S7UB 1WG3A 3QRFM 4FEMA 1ZV5A 4QHKI 4WGKA 2V2WA 1JD9A 1JGUL 2Z91A 1G94A 5IM7A 3TGXA 1SHXA 1DFXA 2KT6A 2A9BA 3GDCA 2XFXB 4J8RA 3MV7E 4R90H 2B15A 1JTTA 2EILB 2IGFH 1LO4L 1O6SA 2EKSA 3Q13A 4S1QL 2V9UA 4C54A 2FATH 5AZEL 3MA9L 4EN3B 1ASQA 4YFLI 5JQ6L 4HXBL 1BJ8A 3MRCA 4YHZH 1TJIL 1ZJBA 5EWIH 1OP5H 2P80A 3O41B 3QJTB 2W9DL 1I1AB 3NG5A 4R5VA 4LSDA 5CU5A 1XGUA 1FNGB 4QMEA 3BMVA 1B0GA 2Z35A 4O2FA 3V9EA 3QAQA 2KLSA 4Q9RL 1JNLL 5FYKH 2K7PA 4LLYA 4YSDA 3L5WA 5HI5C 2CO3A 3OKMA 2A83B 4NZTH 1HQ4A 1H6TA 4NOFA 1FL3A 5BOPA 3AREC 2XWTB 1Z5YD 5J6HB 3U0TA 4N8PA 5E1HB 2A9ML 2R8SL 3R4DA 1T04A 3BLPX 4G7QB 2FLBT 2OYPA 2H2SC 2NR6C 5F9OH 4JN1L 4O02B 5GS1C 4BXVA 3OHMB 1KTRL 25C8L 3DSFL 3S5YA 3ZOAA 4Z7QB 3KWXA 4QHUB 2J4WH 3H3PL 1UA3A 1XWVA 5D7KE 1CURA 3A4FA 3CWGA 3QEQD 3BD4A 4QRSA 1MFBH 4P2QB 3N43B 3O2VH 1QHOA 1K8DA 2H2PC 3MUZ1 2YXWA 3VYNA 4XVTH 2HYMA 1HXMA 1Y18A 1J8KA 1VCBC 2PWEA 3TA3B 4PI0A 3GHBH 4P5MA 5DS1A 2J88L 3X1EA 3ARFC 3VMNA 4GKZA 4F9LC 1KLUA 5ITFA 1CC3A 3C60B 3QPQD 5K9QG 1KYOK 1WWBX 3ZGIA 1C1EH 2OJ1A 4I0PC 4QXGL 5GGVL 1M1XB 2A2QT 4KK8D 4BZ2A 5JW3L 3RVUC 2R4RH 1RSYA 1FIGH 2WXJA 2X70A 3P9LA 3V52H 2AXFB 4N0FA 2YLHA 5BRZA 1CR9H 1WZ1L 3CFKB 3LZFH 3VMOA 3SE6A 3IJYA 4JFYA 5FUZH 1G7IB 4Y7MA 5FX3A 3L1GA 1HHKB 3MOBH 3PF2A 3PRZA 3MV9A 4MD5A 5IEKB 5AKSA 3VI4F 5MI0C 1NAKL 3UIYA 3TBWB 3I84A 3GBDA 4L4TE 4NUJB 3S35H 2R0ZH 5IMKB 5F71A 2LAGB 1UUSA 5SWSA 3S35X 1PS3A 1YSOA 3F12A 3OR6B 3VXUD 1U95A 3LV3A 2CR3A 4N1HB 5C09A 1BWMA 2WWMD 2OTWB 3UYPB 1NCOA 4BK4A 4U1NB 4YHYC 3QAZC 4F5CE 2R69A 3U9PL 3WJLA 2JI3A 1I85A 1K9TA 2BXZA 4LSRH 2W0KA 2V6HA 3TJPA 3TJEL 2DQFA 3O9WB 1J0KA 2BVPB 2YUVA 1CFVH 3UADA 2ICEA 1F4XH 3GKWL 4BH8B 3DX6A 4L1DA 1TZGL 4GRLA 1I3GH 2PO6A 3MCYA 3PP4H 4YZWA 5HHMB 3RTLA 4H0HB 5HHXH 4TRPH 5MEQA 5JLZB 3BGMB 2BIIA 3ARGC 5DHVA 2Y6SD 2Y7QA 2AITA 4PB0H 2P7TA 1GYUA 2CLRB 5DFVC 5E8OA 1AP2B 4ORGA 5DZLA 3RWIA 2GK0A 2HLAA 2VN7A 4P2OC 4F8TA 4V2BA 4POUB 3BCDA 2VL5A 3QJVB 5HVHC 1A6WL 2GTWA 2F6AA 1QFUL 5FV2A 4Y4FB 2X9XA 2BO0A 1SOKA 4JM4L 4GFTB 5HDBB 3TNMA 1UQSB 3ZBMA 1ZGLB 1OKEA 3CDYA 1VLXA 1KN2L 2R0WL 2XZAL 1X3DA 4DN4H 1U58B 3RWFA 5A7BA 4OKDA 4GYBA 3M7FB 5CR1A 1HJCA 1KXTB 1RSFA 5GRXG 4K94C 3F01A 5FA3B 5FC9A 2NLJA 1XIWA 2BNQA 2BW4A 3U7AA 3AG1B 3FO9A 1DE4B 2E75C 2GJ6A 4FKEA 4PJAA 5I71C 3I85A 1GW6A 4KY2A 1CF1A 4JQXA 5MERA 4N28A 4XOEA 4GG6B 1JHLH 3PHOB 1NCDL 4G3YL 4OVUA 5AUMA 4L0YA 3RFRA 1ASPA 2F19H 3K5SA 4N3TA 2PR4L 3L08A 4J3OC 3IWUA 5EO9A 4X6BB 3FU0A 2JKWA 4U3SA 2B4CC 3K6NA 1F18A 3MRLA 3VI3E 3H9SE 4GQ9L 3OMZA 4NQDB 5DZOA 2PWHA 2WB7A 5AB1A 1SN5A 1KIRA 2JQAA 4Z76B 2WLMA 1X5HA 1J87A 1JFQL 4LDOB 5I2IA 4PBDA 1U8CB 4TUKH 4G8FA 5DRWA 1ODAA 1R17A 1GC1C 5LAXB 1Q4NX 2B1HH 3AC0A 2ZAIA 4IDJH 4P2RD 2KQMA 4EE2A 4MNQE 1SY6L 4LPVA 2HA1A 4CRPA 1EA9C 1NGZA 4YPJA 4JGNA 3BEWA 5TF1L 4X4XA 1QNIA 3NFPA 1UH4A 3SPVA 3LQZB 4WK2B 3JV4B 3WIAA 4JFFE 5IB1A 1S78C 1T0MA 4JGJA 4ABVA 1GSKA 1WZMA 3FPYA 5FYJL 1TU2B 1U3HC 1WV7T 2C34A 3P2BA 3VFUB 1Q72L 1H8SA 2Z8SA 4JFXA 5E6YA 1ZLUK 3RPIA 5D2NC 4K7PH 3BWUF 2VW7A 5K9JL 3A0OA 3QEQA 1HTYA 2CO6B 5HI3D 4HZ1A 3K71B 2XPGA 2V2XB 2YD0A 1XH2A 4IJ3B 1K8IB 3NABH 3MNZA 1CT8B 2CIIA 1J05A 2ADJA 5DVKA 3LPPA 3V55A 1H3PL 3D3VD 5JOPD 3K1KC 4HSQA 2QDVA 4L1BA 5JXED 5EBGA 3V5DA 3BVTA 2A74B 5DHEA 3B34A 2AJYH 4UBDC 1YRKA 3J07A 5ISZD 1ET8A 1TETL 1GGTA 4OJFL 4YHIB 2R56H 1QRNE 2A5UA 2FO1A 5LBSA 5C0BA 2PETA 3OV6A 5KSUB 1DUYA 1SBBA 4J3OG 1S7XB 4HPOL 4L37A 1JTPA 3FN0H 5E2JA 1LL1A 2BSED 1RZKL 1RIUH 3D4ZA 1MNUH 2WLYA 4X6CB 2W88A 3IFPA 4FEIA 1LQBC 4V2CB 3HS0C 1T6BX 1OW0C 4LARL 4LF3B 4TLKA 1E28A 1EXUA 1U8PB 2PW1B 3FCTA 5DJZB 2B5IC 4CJ0A 2QVMA 5DURB 3RU8L 4M1DL 2VJXA 4DIXA 1CIDA 4BFNA 2YLKA 2ZXEB 4AGQA 3CN0A 4EDXB 4MAYC 2PKDA 3BCFA 3IDUA 2AJZB 4NPKA 3VXME 2E7DA 2B1AL 2YC1B 5INDB 1T03L 4L5FE 4FC3E 4MCZB 4FNLH 3P0VL 3BP5B 5GGRA 5FYKD 5LLIC 1BMWA 4MXVF 1GIGL 2P46B 5HHOD 3T8MA 4ODHH 4BUHA 2HVBA 2IAAC 1R5IB