2FWLB

The cytochrome c552/cua complex from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
YTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The electron transfer complex between cytochrome c552 and the CuA domain of the Thermus thermophilus ba3 oxidase - a combined NMR and computational approach
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport/oxidoreductase
molecule keywords Cytochrome c-552
total genus 30
structure length 134
sequence length 134
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fwlB02
2MTAA 1TKWA 1WA1X 4HCGA 3T6WA 1AS6A 2CCWA 1SF3A 3UADA 2X87A 5A7EA 2QDVA 4E9YA 2DYSB 1PMYA 1MG2C 2FWLB 2HX9A 1A65A 7PAZA 3CZUB 4A2EA 1J9QA 1CURA 1L9SA 4M3HA 3NJKA 1PF3A 3AW5A 2YQBA 4G7SB 1JXDA 1ET7A 3H4FA 2QT6A 7PCYA 4NB7A 2PCYA 1B3IA 1SDDA 2YAPA 5FC9A 4KOBA 4DP5X 2FQDA 1FWXA 3OD3A 1R1CA 1ZIBA 3NJFA 3V9EA 4YSUA 1KGYE 1W6LA 2PPDA 2FQEA 3WKQA 4DP2X 6PAZA 3QJVB 4JHVA 3QJRB 3IE9A 4GY4A 4FAAB 1OOWA 2BP8B 3DKHA 4F2EA 2GC4C 3IEAA 1A3ZA 2P80D 3X1GA 4AZUA 2IWKA 1HAUA 1OF0A 2FTAA 2J5WA 1NPNA 3UACA 4BWTA 1NIEA 2ZXWB 2H47C 2I7SA 5LDUA 4HHGA 4F2FA 4BDVA 1NIBA 1XB8A 3AZUA 1BXVA 2YAEA 3AG4B 4E9QA 2IDQA 1BXUA 1NPJA 1AG6A 2YAHA 3T6XA 2JFCA 5I5MA 2CBPA 2IDFA 2FT6A 4KO9A 1WA0X 4Q8BA 4DP6X 5B3SB 1ZDSA 2HZHA 4YSPA 2BWIA 3TA4D 4HAKA 1NZRA 4K9JA 4E9RA 2XU9A 1J5CA 4DP9X 1KCBA 2BO0A 3UABA 3FPYA 1QHQA 2JXMA 3EF4A 4HZ1A 3FQ1A 1ID2A 3FYIB 1ETJA 1PY0A 3QQXA 3UGEA 4FA7B 3X1NA 4WKXA 3QJUB 1AZBA 1SNRA 1J5DA 1N68A 1TEFA 1XB3A 1PLCA 2VW6A 3FS9A 3S3CB 3ERXA 4CSZA 3S8FB 4HALA 4DP0X 1M57B 1ADWA 1GS6X 4P5RA 2QPEB 3EHBB 2P80A 3PAUA 2A3TA 4KO5A 3PCYA 3EH4B 1AIZA 3T6VA 1JXGA 1OE2A 4DP8X 1AZRA 1ASQA 1GS8A 1A4BA 2DV6A 3X1FA 2NRDA 1EZLA 5I5IA 3FSZA 2YXWA 1JXFA 3NT0A 3SBPA 2OJ1A 2WSDA 1L9OA 5ANHA 3CVDA 4G7QB 2GI0A 4AKOA 1NINA 2VSKB 2IH9A 1SFDA 1GYCA 2XYBA 3UAEA 5I28A 1FFTB 4DP1X 1NIAA 2AFNA 4YSRA 1AS8A 1CUOA 3U25A 1ASPA 1ET5A 3MBWB 4QLWA 4QKTA 3SQRA 4A67A 1BEXA 4BDVB 1XB6A 1AZNA 2ZOOA 2OV0A 3IBOA 1L9PA 5IY5B 3NJIA 1PLBA 2BP0A 3T71A 2EINB 1TEGA 2HXAA 5AKRA 4YVUA 2AZAA 4UF7C 1BYPA 1ET8A 2XX0A 3OMIB 1ILSA 2J57A 2YAFA 1PLAA 1BQKA 1GY2A 1WAEA 3HEIB 4GP5B 2YAQA 3MX0B 5B1JA 1IUZA 3JT2A 2HRHA 1E5YA 3OMNB 4YSOA 2UXTA 1J9TA 1MDAA 1ZDQA 1AZUA 3QPKA 4N4YB 1KBVA 3FU9A 1L9TA 4G71B 3TASA 4ENZA 1IBZA 1L9RA 4KNTA 5PCYA 1AOZA 3EH3B 5I26A 2R7EB 3RYMA 2BP0B 1HFUA 2HX7A 1JOIA 3FSVA 1AAJA 2FQFA 2EIJB 1BAWA 1PCSA 1QLEB 3S3DB 1AZCA 3ABKB 1SFHA 2CALA 1NTDA 4CSPA 1ZPUA 2XV0A 4A68A 1E65A 3CG8A 5B1JC 3H56A 3FU7B 3WNIA 4N8UA 4P5SA 5B7MA 5I6MA 3NJJA 2UXVA 1JVOA 2PLTA 2TSBA 1OE3A 4HIPA 1AR1B 1URIA 4HCFA 2W8CA 4BWUA 3NJLA 2FT7A 4YVNA 2RACA 2XV2A 1RKRA 1OCZB 3NSYA 9PCYA 1PZBA 8PAZA 3PLYA 5I6NA 2GB2A 4Q89A 4DPAX 4DPBX 1SHWA 4A2HA 4PAZA 3PAVA 2B08A 1JZEA 4E9SA 3AG3B 1WS8A 2UXGA 2BW4A 3DIVA 1BQRA 2I7OA 5I6KA 2VM3A 3ZIYA 5F7BA 5PAZA 4YL4A 2YAOA 2BW5A 1NIDA 4M4RB 1DZ0A 2PPCA 1GS7A 5I6LA 1AG0A 1F56A 5TK2A 5B7EA 2PPFA 2AZUA 3IN2A 1N70A 2BZCA 3NSCA 3OQRA 3NP3A 3OMAB 3S8GB 4UANA 1CYXA 1MZYA 1PZCA 5AFAA 4BWWA 3NJNA 1ZV2A 4G7RB 3ZBMA 1E67A 1IBYA 2ZONA 3PPSA 1ASOA 4RH4A 2GIMA 2AVFA 4JKNA 2AANA 2I85A 1J9RA 3ASOB 2B3IA 3D12B 4YSDA 1NIFA 4DP4X 2VMJA 2GSMB 3EH5B 3ABMB 2Q5BA 4EF3A 2VW7A 4JHUA 3PXLA 4KNSA 2HX8A 1JVLA 3NJGA 1V10A 2GHZA 4YSTA 4YSEA 5F7AA 1JZFA 2MRYA 3NJMA 1BQ5A 5E9NA 2UX6A 3NP4A 4AKPA 2XWZA 3TBBA 2DWSA 3ZX1A 4YSAA 3GYRA 2HRGA 5B1AB 1GY1A 1PNDA 2IDSA 2XX1A 3FPXA 3S3BB 4X4KA 5B7FA 1WS7A 1A4CA 3SBQA 1HAWA 2VSMB 3GXUB 2EIKB 4KNUA 1RZQA 1J9SA 1X9UA 3L45A 2VW4A 3FQ2A 3T6ZA 3T9WA 1AS7A 3FSAA 2YXVA 4AI7A 4TXVB 1TU2A 1KDJA 3NJHA 1SHXA 1JZHA 3QJTB 3OM3B 3KW7A 4E9TA 1GR7A 2IH8A 5D4IA 4GP4B 2DWTA 2WO2B 5EHFA 2TSAA 5D4HA 1E30A 1V55B 2XXFA 2XVBA 1NWPA 2PP8A 3WKPA 3ASNB 1EHKB 3CDZB 1KYAA 1OCOB 3BVDB 4W1TA 3WG7B 1JZIA 5AZUA 1I53A 1PNCA 2QDWA 4MFHA 4W9ZA 3WI9A 2XLLA 2LLNA 2N0MA 2ZWNA 5D4JA 2CUAA 4BXVA 3X1BA 1PAZA 2UXFA 2Y1AA 2PP9A 4DPCX 4A66A 5B1BB 1L9QA 3C75A 3SBRA 3N2JA 3DTUB 3H4HA 4E9WA 3X1EA 1M9WA 4YSSA 2IWEA 2FJSA 2E86A 2IDTA 2IDUA 5TK4A 1BYOA 4A2DA 2HLEB 1SJMA 2BP8A 4GYBA 3CVCA 3ABLB 4WTQA 4AKQA 3ABGA 2EIMB 1PZAA 2GBAA 3FYEB 3AG2B 1CYWA 3TBCA 1VLXA 3WIAA 3NSDA 2VM4A 1DYZA 4G72B 5I6OA 2VN3A 4BXSV 3IN0A 2CAKA 4KO7A 1A4AA 1KV7A 1RCYA 2XV3A 3N55A 2PCFA 4YSQA 1SF5A 4YSCA 3HB3B 1T5KA 1OCRB 3KW8A 4HHWA 2PPAA 1AACA 1AANA 3BQVA 1WA2X 2Q9OA 2XXGA 2H5UA 4DP7X 1AQ8A 1M56B 3CVBA 1XMEB 1GW0A 2WO3B 5I5JA 1BXAA 4L0PB 3G5WA 2FQGA 2PPEA 3QJQB 1ILUA 3QJSB 4E9VA 4UAHA 3PAZA 1E5ZA 3FT0A 2DYRB 2BWDA 4E9XA 1YLBB 3FQYA 1RZPA 1IKOP 3X2QB 3ZDWA 2PP7A 1NICA 4ZK8A 1JZGA 1V54B 2BHFA 2J55A 2OCCB 4A2GA 2UX7A 2FT8A 3FU8A 1W8EA 3NYKA 2EILB 2XUWA 2IWFA 4PCYA 4HCIA 1X9RA 1GSKA 1IC0A 1OV8A 1JERA 1FA4A 1SDDB 2JKWA 1MG3C 4GXFA 3FU7A 1KDIA 1OE1A 1OCCB 1A8ZA 4A2FA 2J56A 2Y69B 1KBWA 6PCYA 4KO6A 3UAAA 3GDCA 1ZIAA 2CJ3A 4BK5C 4NERA 2R7EA 2FNWA 2YARA 3WNJA 3FSWA 2IAAC 3AY2A 1KCWA 4G70B 2H3XC 3CDZA 4NAJA 3TU6A 4F7KA 4KOCA 1W6WA 2BZ7A 2YAMA 3V9CA 1UATA 2DY2A 3AG1B 1NDTA 4AX3A 2QPDB 5I6PA 2W88A 1CC3A 3NSFA 4GP8B 1NWOA 5B1KA 2GC7C 1JZJA 1QNIA 3JTBA 2X88A 1MZZA
chains in the Genus database with same CATH superfamily
1LEKA 5IFAL 5FB8A 5GS0C 5SX4I 5GS1A 4DIXA 4UT9H 1QX1A 5F0PB 3UP1A 1YQVH 5KYYA 5HBBA 5AZEL 3ZY7A 5TE7L 2R4SL 1TJXA 2GAZA 2YD0A 1NLDL 4KMQA 5DD6B 1SDYA 4Y9CA 4C59B 4CRPA 2QGBA 4NRZB 1MKFA 2R23A 1J9QA 4UQ2B 3CFEB 4Y9FA 2X0WA 5B1CA 3OKDB 1EZSA 1KEMH 4H8PA 4TMPA 4G6KL 2FYYB 1FFOA 2EH7L 2W9LA 1JXDA 2YQBA 3E9UA 4BE5A 5I1EH 2WSKA 4N2GA 3ZTNH 5FHAL 3FH7A 4M6ML 3C60C 3LSOB 4GKNA 1SGKA 1LDPH 5IQ7L 3U6XA 2FGWL 3HE6A 3I2CH 5JIPA 3V4UH 3MV7D 1CZ8H 4BZ1A 3IDXH 5E2JA 4ZBJA 4Z6AT 2CDEB 4G5ZH 1S5HB 2V17L 1JTOA 2ZD0A 1OOWA 3ZR6A 1TNMA 3ZUNC 4JPQA 5AVSB 1A3ZA 2NY2C 4IKJA 5J1SC 4TSBH 3CSYA 4OGXL 3TBTB 1I1FA 3EG9B 4FXLA 4F9PC 4Y7MA 4KUZL 2WO4A 3KPLB 1DQQB 5HHOD 5C0CB 3CVIL 3QORA 2V7NA 3H53A 1HL9A 3F12A 43C9B 2HPOA 4MTMA 1BIHA 2NR6D 3ARGA 3KLHD 1OQOA 4YDKL 2BIPA 3CFCH 4ZXBB 1BCIA 3BQUD 5AW0B 1VEMA 1IC5H 3ARED 1ADQA 3TZVD 2H32H 3CDGA 4P5KB 5B3SB 1LK2A 2WW8A 2PXYA 4I2XE 4MB3A 1S9KC 2N56A 2BPBA 4NQDE 2W59A 3GMMB 2DEYX 2Y3NA 4ORGA 4XZ4A 5E6RB 4DT2A 4E41D 5LGJA 1F1DA 4PJFF 2N7BA 3BEVA 3UYRH 2BSDA 2FEJA 4IEFA 4XH2A 3WFBH 5LUMA 4NJ9H 3FUIA 1FNEB 1JZ3A 32C2B 3ECBB 2FSDA 4Y1AA 1QRNA 1U3HD 1DN2A 5D71H 5T5NG 2D3JA 2ITFA 5EH1A 4KK9D 3GNML 3ZDYE 3B7TA 4C83B 2HWZH 2VH5H 1BGXH 4UCFA 1AGEA 2EYRB 1N6QH 1AGBA 4YE4H 3LN5B 3OKKB 5KBPA 4XZUA 4XX1G 4DEWA 3CAFA 4P07A 1V05A 4MA7L 4W70A 5J56B 1A7PL 3D0LB 3LQAH 4TUJB 2BJML 1A7OH 2AQPA 2NY4C 4Y16A 1VZIA 4LK4A 2QPEB 4M7LH 3CDCA 3OTTA 3EO9H 3HC3H 3N50A 3S5ZA 4NPKA 5TQ2L 3OZ9H 1ZE3C 1CE1H 1MJ7H 2A3TA 3P4LA 5HD8D 4R5XA 4M43L 2D31B 1PX8A 1NGXA 3EH4B 5JHMA 4MNGA 1JXGA 1WFTA 4PBXA 1NOFA 4XXDB 3WELA 3N1PC 1O9WA 2DQGH 4KQ0A 1AO7B 3X1FA 4L37B 5TE7H 5L2JA 1L6ZA 4S1QH 3AT0A 3L4TA 2YA2A 4G6AD 5EBWB 2DKMA 5JW4N 1MPAH 4PRAA 3ZT7A 1KG0A 2VDQB 1F41A 3CQFA 4MJ5A 4Z3TA 1MFMA 2WKGA 4JDZB 1M7DA 1R3IL 2WXOA 2IH9A 3CCHA 1UM4L 2A9NH 2ARJB 4FQ1H 5J1TC 1OCWH 1RZIA 3MTRA 1Y07A 4AIOA 1F4XH 4KK5D 4RESB 1CBVL 1T83C 5E5MA 3IGAA 3BCDA 1BVKB 2XIDA 3O3AB 3X17A 2Q7YB 1WGVA 2HWZL 5H35B 2YA1A 1E5UI 4NQXB 5JHDD 1MJ8L 4QRPA 2OK0L 4XWGH 4OGQC 1EGJL 4P23C 4D0CA 1IM3D 5IHUL 1IQDA 2WWMD 1KCRL 3LZFH 1Q9WB 2VZTA 2EINB 1WAAE 5HDBB 5JW3H 4M5SA 3GINA 5J1AB 1J1XH 4MAUL 2D7PA 2YAFA 3UYRL 4H8VA 3WFBL 2MOGA 1X4XA 2YMXH 5CP7A 2E7MA 2YKLL 4JMNA 4X83A 3TO2A 5GJSL 1A3QA 2HRHA 3LZNA 2BVQA 1GZQB 5KSBF 15C8L 1IU1A 1S7TA 4Z0XA 3RB7A 4HU8A 1OT1A 3O3BB 4JFUA 4I13B 3PG2A 4N4YB 3LKQB 3SGKC 3QO1A 1O6SA 4PCKA 4HG4J 5I0DA 1TQSA 3HRPA 3QAZB 4R7LA 1H6FA 4HJ0D 3Q6FB 3FT1A 1Y18B 4F8PA 3GSQB 3BAEH 2H0FA 3ROOA 3CMOL 4N6QA 1JPTH 2XV0A 1TUPA 5CWSB 1TJMA 3KR3L 3FB5A 4HS6A 5HDOA 3RL2A 2ZNWA 3HS0B 5DLMH 4QRRE 3HRZA 43CAB 4GSDH 4HCFA 4U7MA 1CVRA 1KXVC 2NR6A 4PLKD 1LO5B 4RWYH 3ULUH 4Y4HB 5L2KB 1MFDH 4P2QD 4AENB 4MD5B 1ROWA 3BH8B 4F7EB 3RVTC 3LQZB 5EOCJ 4BUGA 5A3ID 1TCMA 5I73C 3ZDZE 4F7PA 4Y5XB 3VD2A 1MF2H 3QQDB 4KH2A 4UQBA 1DTUA 2HJKB 4GAFB 3LS4H 3CZEA 2CXKA 3HI6L 4E9SA 3FNKA 2DIEA 5HHVL 4HCRL 5D2NC 2VM3A 3WS3A 3TBVB 5K5YA 1EHXA 3JTSA 4M4RB 5KVDE 5HVHC 4L3EB 5GQBA 1F4XL 5KS9B 3OKLB 5JYLA 3JV4A 4JFEB 4PTUB 3IBEA 3RILA 3KBHE 4KKAD 4NQUA 4XP6H 4EI5A 2WN2A 5D7IA 3EO0B 5DRXB 1N70A 4AQ8A 3QEGL 1M7DB 1TVBA 4HJTA 1TKWB 4BIKA 3IXTA 3OKOA 3DVFA 2O5YH 3U9PL 1ZV2A 4I4WA 4JHWL 4OUOA 4W93A 5LCVH 5LGHL 5B38G 3GSNL 3WIIH 3WKMH 5FKPA 4XN1A 4HZLA 1HEHC 3S36H 2B77A 1QSZA 5GJSH 3BGAA 4OCSL 3N1QC 3CZNA 2QSCH 5F9DC 4YFEA 1ECZA 3ABMB 2Z31B 3V5HB 2P3YA 3K71B 5J1AA 3IKKA 1B2WH 4NRXA 1JVLA 1YEKL 3V2AR 3S88L 2WZ0A 2F7QA 3GBML 3UBHA 2V2TA 4LSTL 5GS2D 3RG1C 4YHZH 1U4EA 2CUIA 2XWCA 3UROR 3BVUA 4J2QA 2OX5A 3BIAX 5JYMA 2E6JA 4GIOA 1JPTL 2C3WA 2WP3O 3DXAD 4LHUA 4AH2A 1ZJAA 4AL8C 1N0LA 3MRCB 1I9RH 4RBPH 5JOFA 3TT3L 1FDLL 1MCOL 3AS1A 3MREA 3BDXA 4KXCA 2KC0A 2OP4L 4OFPA 5D8JH 4BFIA 4AW7A 2VJ8A 1FVEA 5KVDL 4XP1L 1FFNA 4L48A 1A9VA 3PDGA 4E9TA 1Q0YH 1CXLA 1YUHA 5D4HA 1IT9L 2EDHA 2PP8A 4PLOB 5C0EB 1BQLH 5C2UB 2ZUVA 2NXYB 1TDQA 3BVDB 4X8XA 2WTRB 5HGAA 3SYCA 4W68A 3X3FL 3N9GL 4BCYA 3GXDA 1A2YA 1TZGH 2HJFB 3FU5A 1P9MC 3MA9L 2SEBB 3K80A 3RWEA 1OW0A 2A6IB 5C09E 3LQAC 4PRPD 2CD0A 5B1BB 2F7RA 2MTPA 3OKNB 3H4HA 4AGLA 4YSSA 5C0CD 1MCPL 3GT6A 2H45A 4W9IC 3BIKB 2O93L 4JBSA 2YXMA 4P99A 3QZPA 3IETA 1UWXK 4AIEA 1T2JA 3MV01 3T65B 1U8PA 4C57C 5DRNA 5IW6B 3HI6H 1RZFL 1TJIL 2HVKB 3MX0A 3UXFA 3VW3H 1A22B 3VFTA 2WUCH 4IEFB 4XH2B 1E2WA 3WIHL 3VXME 1UJ3B 4G72B 3U0WL 4DKDC 3RJOA 1AHMA 2WD0A 2KERA 5EO9B 4IBWA 4BXSV 1UJ3C 1QA9A 4AGQA 5KJ7E 4QRUA 35C8L 3QEGH 1U2CA 3AU0A 5DUJA 4MQSB 1RPKA 1QZ1A 1TQBB 3LTVA 3HB3B 6TAAA 5F44A 1DBBL 7FABL 1YO4A 4ZXBA 3EYUL 3BWUF 1BFOB 3WL9B 1Q9OB 5IT2L 4ZAKB 3VXRE 2R0LL 3DX6A 4QXTB 5GGRB 4BSWA 4OZHA 1M56B 3NIDB 1XCQB 4HIJA 1U30A 4F57H 2IOOA 2GFBA 1ZSHA 3F2LA 5DRZA 4PD4J 1U41A 2WXKA 2IGTA 2ZOKB 5D1XA 2K9UA 3O0RH 1E5ZA 4DGWC 3GD1C 4KBPA 3U6XS 1DEEA 3EFFB 2YMXL 3C8DA 3WEAA 4LCWD 4Z78B 5A2LH 3P4NA 2O61B 2M2DA 2AEPL 3WY4A 2FT8A 3RZCB 4QT5B 3P4OA 3NYKA 1A0QH 1J12A 4GW5B 1IC0A 1TJGL 4LCYA 3U30C 1XGQA 1A7QH 4JN1L 1YEGL 1LWHA 1MG3C 1TCRA 3KPSE 4FMFA 2KI6A 4NC1C 3IGFA 4KZCA 3MLZH 2AK1L 4YX2L 3VXMD 4A2FA 3AU1B 4BZ2L 5HDQH 2AI0L 5BMFH 3GMPB 1WK0A 3QUMA 4GUPB 3VFWB 3IMSA 3DSNB 5CFAA 2O26U 3O81A 3GLZA 1FNSH 5AVYB 3TH3T 5BO0D 1UB6B 2Z4QA 1SOKA 2NZIA 1YEDA 4MD0B 1UA6H 2YBRA 3WNJA 1QLFB 2HRLA 3AY2A 4QTHA 2XG5A 3QWRD 3FT3A 1PIFA 1RXLA 5CIPH 4EN2A 1MVUA 5JW5B 2BZ7A 4XN7A 3ULVF 3HR5A 4HIQA 1JZ8A 3TH4T 4BZ1L 1CC3A 2BHUA 8FABB 4KUCF 3B7RL 2NYYD 3NFNB 4N3UA 2J44A 4EN3D 1IKNC 3ZZQA 5FIEA 4Z7UA 3F7VA 4J7RA 4WEBL 4O4YL 5IVNA 1JPFA 1KIQB 4XODA 3QARA 2EXTA 4KRNA 4N0UA 2YWZA 4HMCA 5FYLD 2VLMD 5L88H 3H8NA 3F6IA 3FQUB 4PJ7E 4FQXA 1MHCA 3BUQA 4LSUL 1MAML 3BKJH 5DUML 4ZFFA 3A67H 1R5WB 3U82B 2L8AA 1IO4C 4EUPA 1QVOB 4HJEA 5KYYB 5IJBC 3AT8A 3W5NA 2HKHL 3DV4B 3W82A 5CO1A 3NJKA 4CNIA 3LAFA 2Q3AA 4WJ5B 5D72L 2W5PA 5HVFB 4R7DA 3VWKD 3HAEA 2Y7OA 4UT9L 2GTWB 4C8XA 4KZEH 1CG9B 1XGUB 1DJSA 4KI1A 2N01B 1NFIB 3GIZL 5LGHH 5FDWB 2X6CA 3BWUC 1HQ4A 4MS8C 1NFAA 4YPGB 2W91A 1AQHA 3O9WD 4X98A 5DJ2B 1MCHA 3KPSA 3L4CA 2FQEA 1D5RA 4FQCH 4EN3C 1JYNA 1DFXA 4JZJA 5HI5D 3MLSH 3CGTA 4AV0A 1KTLA 4DTGH 4F2EA 1CLOH 2P80D 3WXWL 4XPTL 3DHUA 2A4CA 3GBMH 1JV5B 3PV7A 3INUH 4M7KH 4JO3L 2RR3A 5ICXB 2O6DA 1D7CA 1A47A 2AK1H 2DM4A 4R83A 1JVKA 1O9VA 1TSRA 2QELA 5DDHB 1B9KA 1EXUA 3AZUA 3VFUA 2HFFA 4NKOA 4F2ME 3HPLB 1WBYA 4TNGA 5IJKC 2FCBA 4EI5B 5I71C 2AXFA 5DHVH 1IRAY 1P1ZB 3PXHA 5BW7A 4FNQA 5HY9B 3TT3H 2YAHA 3AMKA 4WI9A 4S0TD 3SDYL 2BHZA 1IFRA 2IDFA 4KO9A 3PJNA 5DD1L 4URKA 3SGJA 3SOBL 1RK1B 3MLWH 5AVZB 1BVLA 1QEWA 2HFEA 5MEOA 5D2LB 1W72H 3GK8L 5F6HI 5FYKE 3CK0L 2F7OA 4YWGH 4C4BA 2IH3A 2VLKD 4YJZL 5E1AA 4NKIH 4UDUB 3CD4A 4QYOA 2VO5A 2CUMA 4UTBL 1SM3H 4LLVB 4GSXA 5IESL 2F54A 1JDAA 2DJMA 1RFDL 2JJWA 4OLXL 3LKNB 1IC5L 3ULVC 5KSUB 1S7UA 3GI9H 1IFGA 5F7EL 2HFGH 1BZOA 3SDXA 4ZRGA 2IADA 3D2UB 3M88A 1IBDA 3KPPA 4JZNA 3Q01A 4YGVB 2OULB 3SDCC 4NQEB 2QV2A 1PG7H 4HSCX 2HG0A 3EDFA 3MHZA 1UKQA 4G8FB 1XB3A 4X9FA 4DO6A 1OF2A 1B4JH 3QDGE 4FTVE 1HH6B 4LKXA 1BM7A 4ZOEA 1NAMA 1RP8A 4KRLB 2Q6WA 5DCCA 2B9BA 2R69H 2C4FU 4M3KB 5IB4B 3TNNA 1MWAA 3L2LA 1ADWA 3RNQB 3RWDA 2MFNA 1CK0L 4OCRL 1GC1H 3VXSE 4M8VA 3QGVA 4ADIA 3HMXH 3AS3A 2IQ9L 5DVPA 3PABA 4FG2A 3II1A 3SY6A 2VXSL 5HYQA 2F1EA 4LSQL 4NUQA 3HG2A 3US1A 2PWEA 4OM0H 2NRDA 1JV2B 1R6VA 5TF0A 5I5IA 2CA3A 3P3SA 3SE4C 2Y0SA 1GPOL 5ANHA 5F7NC 2ZCHH 3Q9QA 1MHPH 5JO5B 2A6JA 4S1SH 3KBEA 4PBVC 1L6XA 5FYKL 1S8DA 3O3DB 2G2NA 1SDAB 5E5UB 2DLTA 1WBYB 4IQHA 5JUEL 3RFZA 3GSVA 4LEBA 2ZOLA 2YQ2A 4OFQA 3GSOA 2C1PA 5L6YH 1G5GA 4PRDA 5IY5B 3BRGC 5B21A 3EH1A 2JELH 1G4MA 3L13A 1FFPA 4IK6A 3NEXA 5AUMA 4YWGL 4TL5A 1P6WA 2D2CC 5L4JA 5MEOB 2C1OA 1GY2A 4MNQE 3KGUA 3TEWA 2VJXA 2R1XA 1E4KA 2A74A 1L7IL 4GBXB 3JTTB 3ULVH 1AGFB 2YFOA 4EBQH 4AWJC 4NP4H 1AIFA 1KNOB 4CADA 4LBEB 4MLIA 1F4WL 1VZHA 3F85A 3KYKH 3CPLA 3OG4B 1IQDB 4H1LH 1J1XL 4Z23A 2F5AL 1TMCB 5C0AA 1X7QB 1NFKA 2YKLH 1MI5B 5KS9F 2NY5L 3QQ4A 1C5DA 5C0ND 4OVVA 4QJ4B 8CGTA 4AYEC 1QSVA 2PLTA 4JFDE 1XGQB 4WQOA 1UZ8B 4L1SA 4MAYB 3G5ZA 2IXQA 1NEZA 3CLEL 4PJCA 3CVHL 1UWEH 4YHKH 1JPFB 1NCAH 4HULB 2VN7A 2BSSA 4M56A 1YNLH 5I1IL 3KPRD 1KYUA 5IROD 5MP6H 2K6WA 2ZX7A 3X12B 3ZKMC 2XN9B 4Q89A 2GCYB 1VEPA 4UT9A 3T09A 4PWIA 2VR4A 4HMDA 1Q0XH 2FL5B 1JZ2A 3J27A 3JYBA 3U4BH 4Q9RH 1P84K 1OTUD 1TQVA 3PE9A 1JJUA 2ALAA 4K3EH 5I1DA 3ZE1B 2OCFD 2R69L 1JZ5A 4NN5C 3ZL4H 5EBLB 2NUPA 1MY5A 1N19A 2APXA 4LLWB 4MDIB 5HSFA 1MFEH 4Y2NA 3WMQA 3MRBB 3B5GA 3VI4E 4X2UA 3U7WL 1KIQA 5CEZH 5TDPB 4GT7A 3HAEH 1R34A 4XCNB 3FSOA 1DE4B 5BV7B 4NDMB 3TBTA 3O9WB 1F6AB 3QIUC 1RUKL 4LKCA 2BS9A 4HT1H 1T1XB 3D4CA 3R0NA 3D08A 3RZCA 3IMRA 3N3EA 4YSDA 3ARYA 4JGJA 3GLAA 4L3EE 4BE6A 2I27N 2EYTA 2O61A 1QI3A 1K8DA 1TOXA 4P9ML 2GEQA 3K1KC 2L7JA 3KEHA 2MPAL 3WTYA 2ED8A 5HYSG 5T3XE 2FZ3B 4HGKC 6FABL 4R2GD 4C55A 3N5AA 3H7BA 4LDOB 1PIGA 4JFXB 4N2EA 1JNLL 4F58H 2WAQA 3VFWA 3WUZA 3NP4A 2XWZA 4U7SA 1CXHA 2FX9H 1PG7X 5T3XH 1KACB 4W9CC 2FX8L 4JQXC 2KHAA 1E6JL 2D0GA 2HG5B 2QBWA 1FLRH 3O8XB 4P5TC 4YXHH 3HN8A 4H88L 5I66B 2JB5H 2VSMB 2VDLL 4KJYB 5C0EA 4J5VA 3DVIA 3HG5A 3S5LB 1I9JH 2NXZC 3C6LA 4WZ9A 2GK0B 3O6FD 3UTTD 2Z1PA 3SY0A 4NBYB 5CEZL 2GPZA 2NNXA 1TYEB 1JF5A 4U3SB 3EJYC 3VI3A 1MNUL 4AMXA 2GTZB 1ZTXE 1FJ1B 3NPSC 2QVFB 4XVTL 4PJ5E 3TEUA 5BJTB 1U8PB 5IW6A 2GFBB 3IJ9A 4H26A 4LHJB 4XAWH 4PRPB 3K6OA 4XP5L 4KZEL 4J8RA 3IT8D 4K3EL 1G9NC 3PWVB 4ETYA 5HTSA 5ICYA 4FP8H 1FG2A 2UZIL 3KLHC 3MUHL 5DWUL 1Q0YL 2J6EA 3MRPA 2E46A 2AEQL 4AE0A 4HBCH 3JZ7A 5J11C 5FYJD 2WUBL 3FB7A 5T5FL 4OLWL 3E6FA 4JJOA 1HEZB 2ZCLH 3INUL 1R3LA 1SOXA 1NSNH 4LRNL 1RUKH 4IRJD 2B39A 3VNYA 4HOXA 1SVCP 2FJSA 5BXFB 4X6FA 3DPDA 1Z6JT 3CSBA 5L7XH 1JDCA 2YLKA 1G9HA 3QXDB 2C9QA 3PFQA 1D9KC 3T65A 4ONHB 1NEUA 5B4MC 1I8UA 2CO6B 3BPOC 4U2ZA 3JWNC 3TBCA 4TSCH 3X12A 4ZI8A 5AL0A 4Y2DB 5IUSA 5DSCA 1KGCE 1DVXA 3O2WH 5F8QC 5JW4Q 1YZZA 4P2OC 1L7TL 1IEAA 3CFDB 3V52L 3L7EA 3ZZ1A 5KVGE 4HPOL 5A2BA 1G7IB 3RWEB 4FQJH 3N55A 3EIFA 4AE1A 4NQDA 5E56A 4ELMA 5HHQA 1CD1B 1LP9A 1SYSB 4G6ML 2J7LA 5EBLA 5A2JH 2AXHA 2WVSA 3BQVA 4JRLA 2XXGA 4YO0A 3SYAA 5CJBA 1A6AA 4ZS6D 3UBGA 4I7ZC 2K45A 3QG6A 2B16A 5I5JA 2Z0BA 3DV6B 4N9GB 4Y8AA 2X4SB 2EE0A 5KSAA 1B0GA 4L0PB 1FNGA 2BINA 2H2PD 4QO1B 5K59E 4ODXA 1ECYA 2ZUUA 1OSPL 4WLCA 3V7MA 5I74B 3BLBA 3FT0A 3GHPA 1FYHB 3EUDA 5CEYB 2BWDA 5FYJE 4R8WL 3TV3L 2ESVB 3GXPA 3OBAA 3QULB 4KHTL 4LESA 2BHFA 2OCCB 3VXOA 5FW6A 1YCSA 4I0PC 1KSRA 4U6VH 1QI5A 2VL5B 2IAMB 4AYFB 1X9RA 3ROLB 3L5WB 4FP8L 3OLGA 5AUMB 4Q58C 3KYMB 3ZSSA 1L4IA 4O51A 2GIXA 4QUOA 1DJIA 4LLUA 4MJID 1UGKA 3UH8A 3SDAC 1OZTG 2H3KA 5GHWL 2LLGA 4AVKA 4WO4B 2QKSA 3DHPA 5JPMB 3EO0A 5DRXA 3AM8A 4XOAA 1PFOA 4I2XA 3BAXA 1DBML 4U7KA 5FA4A 5K1JA 5MERA 2OMUA 1T89A 3F6JA 5BZWA 3TBVA 3VO0A 5I6XB 1T6VN 5CINH 3LIZL 3GPEA 1C8PA 3MMEA 1OSYA 1E5AA 3CFCL 4MGXA 4YQXL 3QB7C 4HUWB 4ORZC 1DLHB 2AQ1A 2BY1A 3OX8A 1NDTA 3QUXC 4KVCH 3S35L 4AX3A 3FULA 1HYRC 1KENL 4ZUWA 4AEHH 1RH8A 5EOQH 1A14L 2WMPB 1CR9H 3ATDA 4FXTA 2XY1A 4NC0B 5E4EC 1X7SA 4PS3A 1VFAB 1VPOH 1OAKL 5HHOE 3H9HA 3OKOB 5HYIA 4TYUA 2B5IC 1TLMA 4M4PA 4OLVH 1QFWI 4KMLB 4I18C 3LKOA 4UT6H 4ZD3H 3UCRA 3ZTJH 1MJUH 2FO1A 1P7QA 3ECVA 2EXWC 3BIBX 5EORL 2VC2L 3V0HA 4XNMA 1EX0A 5I8CA 5DC4B 3IGLA 3UPAA 1H3UA 4ZUUB 4PGBA 5A1AA 1LEGB 1ZANL 3TURA 4GAJL 5M94B 1JI1A 2HJLA 1GZPB 3MV8B 5ICXA 1AHWB 3ARVA 4OD2B 1KOAA 4JHZA 1B3IA 3PAYA 4MD4B 4RNRB 2XXCB 3F7LA 4AMKH 1PZ3A 4PJEF 1G9ML 1K4CB 1PS3A 3E2HB 5IIEB 1NANI 3NZ8A 1U92A 1GYAA 1EEQA 1DN0B 2X40A 3DX9B 3FCGA 4X42A 3TT1H 3QUYD 1SEBB 4UT6A 4YDIL 3PY9A 2ALWA 3CBJB 2WYIA 3B9KD 1KXQE 5F7HA 4UDUA 4B5ZA 4Y16B 1J86A 3LRMA 3RKDC 4D0CB 1GYUA 2GTWA 3EADA 3OHXC 3DO4A 3MGOB 2E0PA 4LPCA 4NQXA 4WJ5A 1Y18A 4F2FA 4BDVA 1WAPA 4IRSC 3F84A 4P3CH 4DETA 2CCLA 1E40A 3NA4A 5JXEA 5CU9A 5LBSL 1U8IB 4E9QA 3ZO9A 3CNKA 5FFGA 3CCHB 1ZHBA 4NKOB 1KGWA 2QQLH 5I5MA 1NCGA 3TJPA 4Q8BA 2CBOA 3IFOB 5E8PA 2Q87A 5HHNA 1IGFH 1O6TA 3FRUB 3WE6B 3U1PA 2XRAH 2XQ0A 5CMAB 4FFWD 5BQDA 3TCLA 1IIIA 1JV5A 3MCG1 4RZKA 4ZT1A 2X3AA 2DQIH 2FRGP 2ZYSA 1TF4A 3C8KA 5KOMC 4UAOB 3ISRA 4FXGA 4LVNB 3RKDD 5FYLE 2CMRL 1TZIB 1KB5A 3Q8FA 1K8IA 3X1NA 3U1QA 3UBXI 2CIIB 5F1KC 5AENA 3VD1A 1AZBA 1QW9A 4S2SA 2BSRB 3V4PL 2MJWA 3QZBA 3D0VA 5DGRA 2BP3A 5DK0B 4V2CB 1KN4H 4Z1PA 5AYUL 5GZNC 4L4TB 2Y5QA 3VFRB 2F8OA 3ARXA 4BKLB 3F7YB 2FIRT 4U1NB 1P69B 4AL8L 1E28B 3PWNA 1K8DB 4H2AA 4DOHE 3C5ZB 4PGCA 3S0PA 5GSVB 3REWA 1B4JL 2OMZB 2NY2B 3O11A 4AIZA 5K9KB 5D6DA 4YXKL 5BXFA 2BIIA 2G75B 5D5ME 3MVSA 1I1AD 1HEZA 3T2LA 1OANA 2B3RA 2DWDA 2NYZA 3LV3A 3GTTA 4W6XB 3SBPA 4RMSA 4HPYL 1XR8A 3B3IA 5DVNA 2XV6B 3KG5A 4ZTOL 1R4XA 3DLQR 5LQBH 4F7MB 1E9QB 1UD5A 3S3SA 3VE0B 4H5SB 1YY9D 3U2IA 3PDOA 5C0JB 3UAEA 5AOZA 2H6UA 5I66A 2XG5B 3S6CA 3RZCC 3OZKA 1LEIA 3B6SB 4UZGA 1AS8A 4LO9A 1UB6A 3FQUA 4MD0A 4BQ8A 3GM0A 3L3GB 4PWFA 2OTPA 4P46C 4QLWA 2K3TA 3T4AB 3MRKA 2WXFA 4HFWB 1A9EA 4PJAA 4A7GA 3EG9A 2C8NA 1U2YA 3MNZB 3NIGF 3I6SA 2FHCA 4NGHL 2OZ4A 1TCRB 2D3NA 3MLUL 3NFPA 4TULH 5K1NA 1RULH 5KBMA 3B4NA 2H26A 4L1LA 4NJ9L 4OZGA 4Z7OB 4UF7C 5F71A 4FI7A 4P57B 1OP5H 4JY4A 2OSWA 3SPIA 4H20L 4KRPC 4RCAA 1MQ8A 4KFMA 3CN4A 1S5HA 3LRSA 1SLXA 3CDGB 2YC1B 1RP9A 3B2UC 2G9HA 3MUJA 4D0BA 4QY8B 1TTBA 3Q9PA 4Y4HC 1J0HA 3QHFL 4P2QB 3LMJH 2G4EA 1L9RA 3MXVH 4ZODA 1AOZA 3WTUA 2WBJC 1C08B 4O2EA 3UJJL 2EIJB 1BAWA 2JJTA 3RVWC 1UQSA 4RSYA 1WTGT 2SEBA 5HHMB 4Y9BA 4P3WA 5C6WH 1P2CB 1PEZA 3ULUD 3FU7B 2JIXB 4N8VB 4P5SA 2FZ3A 3Q06A 2ADYA 1JVOA 2Z35A 3RDTA 4KHXL 2NCMA 4XNUH 5EZLA 3ETBF 4XWOD 4BK5A 4PWJA 3VE0A 2VDMH 5JOEA 4JUTA 2X70A 1CGVA 3LDBB 5FGBA 1KENH 3ARDB 4ZQKB 2ADIB 1BLNA 2CE6A 3K1DA 3AXLA 1SHWA 4A2HA 1C7TA 1DQLH 5D6CA 4HJUA 4ZS6C 1ED3B 3PS6A 4PS4L 4HV8A 2EDWA 3MLXH 4JM4H 3BP7B 2K7PA 1DHKA 3G5ZB 5DQDL 4E41B 2IEPA 4HJSA 4ZO9A 1BZ8A 4FGMA 4AM0Q 2VDOL 4CAGA 1NIDA 4UNTA 5LVEA 4ELKA 3ESVF 2OKMA 1FL3B 4PEEA 2VJ0A 1AGDB 5E2TL 2WLZA 3IN2A 3Q5YA 1FRGL 1R33A 3D0VB 1KELL 4LCCB 1I4FA 5FW7A 3QDJB 4DPRA 3A6OA 5K39B 5TD4A 3Q8CA 4QTIH 2EE3A 2O30A 4PJGE 4GQQA 1I1AA 2O72A 4ADGA 5ILTH 2V9UA 2ADGB 1YNTB 3MV8D 2BK8A 2X4OB 5D93C 4FQLH 3ARWA 1G1OA 2WSPA 4Q0XH 2MCMA 2CNZA 4ZMQA 2YPVL 1A1NB 1P53A 1QO3A 3MFFB 5GGUA 2ZYIA 4JFFA 1Z9MA 3KLAB 5DVLA 4YSTA 4M1DL 2IMNA 4BCZA 3QUYB 3PQYE 4LEXL 2QV4A 5IVXE 3TS8A 3MV8E 4KXAA 4Z7QB 2Q6WB 1FORL 3TBBA 3MRNB 4G80B 5A2FA 1UXSA 4DW2L 4Y4FC 1C7SA 4PLKC 1OF2B 2AJ3B 4HUXB 4HAFA 1NUDA 5I1CL 5JHLA 3S3BB 3VRJB 4K8RL 4PJIF 1JK9A 4JFDD 4WNJA 3T6QC 3TIDB 3QA3A 1FP5A 3DTXA 3D2UA 5DHMC 1WLHA 4ZDHB 1HAWA 1IAIH 4KHXH 4PR5A 1OGAB 2APSA 3EJYD 3P2BA 4HEPA 3BVVA 1T7ZA 1RJZA 5F6IC 4GG8A 4Y1SA 3ZDYF 1MCQA 2XFXB 3WOVA 1FO0H 3O6FC 4AQ1C 1KELH 3KLLA 4JG0L 5D7LB 4M93C 4HKXB 3QJTB 2Q20A 2IH8A 3L16A 5D4IA 1TZHB 3AY4C 1FFRA 2UUDK 4HUVA 4XB8A 1WAAF 3GXTA 3RDTC 1RZJC 3WKPA 2VLKB 2OJEA 1L0YA 5CJOL 2XPGB 2X89A 4JLRB 4UNIA 3H7LA 2D73A 3W0WE 3FBKA 1XQ4A 4K3JH 1NM9A 3TT1L 4MJ6B 1EEZB 2AI0H 3PWJB 4PJ7B 1IBGL 2Y1AA 3HNVL 1XH2A 1PQZB 4CUCA 5I1AB 3GSNH 3TVMD 1MIML 3C75A 1MJJB 1FNAA 3X1EA 1JMZA 3K4ZA 5CF3A 3T8XA 3GB7B 1BYOA 2Q0ZX 3NOIA 4WO4D 2XBTA 3UG4A 5B8CB 3OGCA 3G5VB 4IK7A 1I8AA 4NM8L 1U92B 3RVXC 4LL9A 4FNPA 1KPVA 2J8OA 1N0XL 1IGJB 5ITFB 2YKKA 3BH9A 4N26A 3BEWA 3LQZA 2OYLA 4FE9A 1AR2A 3LCYA 1NCCL 1G7LB 3QXAB 4QXUH 3CU1A 3UIYA 4L5FH 4HPYH 3SD2A 5C3LD 3IDJA 1MXGA 4JM2B 4JQVA 5HYSB 1RK0A 4XC3L 2A4EA 2EEBA 4JHBA 3WFEL 4X9BA 3WEBA 4L0ZA 2PTUA 4I0PD 4QAMB 2X5PA 2DQTH 3TYGL 3O4LD 4CN1A 2BNQB 5FGRA 1CIUA 4LLYA 4WW2B 1AACA 1CICC 2VDNL 2Q9OA 5LWYL 1NEPA 1XL4A 5IEHA 4QTFA 2VAAA 4GSRA 1I9EA 3NZUA 2OK0H 1WFNA 1J1OH 4Y5VA 4U1IB 3V6OA 3ABZA 2BVOB 2VIRB 3P0GB 5IHUH 2N1KA 3GC3A 4UAHA 5EBWA 1G7PA 2DYRB 3BT2L 4S1QL 4YBQD 5GGUB 2X9XA 3V4PH 1IKOP 1KPVB 3EDJA 1B88A 1UZ6F 2WLNA 3ULVD 2F5BL 3W1ZA 1UTDA 4PN6A 3DRTA 1WQVT 3HR5B 1L0PA 5BZDA 3ES6B 2EILB 3HC4L 1W0WB 4YR6B 4X98B 1UM4H 4DO4A 3PNWA 4TTDD 4P9HL 3LQMA 3RU8L 4JFHE 2DTMH 2JKWA 5T1KD 3FU7A 4N8VA 2J4WL 3C2AL 3UYPB 2XNAA 4R8WH 3PP3K 4MB4A 5JQHC 5GS2H 2OTWA 2A6DB 3W9EA 2OL3A 2VRAA 4YXKH 2OMTB 5BPPA 1MW2A 3QR2A 3M7FB 3VSTA 3QEQA 4WIQA 1K3ZA 2JTYA 3D52A 3O3BA 4JKLA 4KPHH 5GPRA 1JWMB 1JNNH 4ZQTA 1Q72H 1GCFA 5LB1A 1UKSA 3VFGL 4KV5F 5IQ9A 4FQHB 4ETQA 4FX5A 1ANUA 3GJFB 1NC4A 1MAKA 1HIML 4QR7A 4YBHA 3RY6C 2R15A 1DVFC 1MCWM 5SX5K 4H7VA 2GSIB 2IH1A 3H9SE 4LCWB 2BC4B 4J4PC 4XPHH 2ESVD 4R4BA 3WAJA 1DVZA 3VFSA 1FZKA 1YMHA 2BY3A 4XCYA 1J05A 2BNRD 3IGAB 4NJAL 4HJJL 4YEEA 2XVKA 2F53D 2VE6A 1T0MB 2RFXA 5KBLA 4QTHB 1MG2C 2HX9A 1A65A 4TM9A 4WHDA 4LOVA 1NCDH 4OTXL 1I8IB 1T1YA 4LLQA 4NQDD 1HN1A 4HV8B 2K8QA 4G1MA 5F9WC 4G7SB 4ZO7A 1X5AA 2QQQA 1HKLL 2MQ3A 4PY8I 1SLWA 2TRYA 5DMIH 4D9QE 4JHWH 4X7SH 7PCYA 4JFXA 5BQ7A 2XIBA 3AC0A 3NCMA 3QISA 4BV1A 1WSST 1ZIBA 3NJFA 4YDNA 5KUMA 1FAKT 1IE5A 2H4EA 4HIHA 2YPKB 2HVKA 1H3PH 3RWCA 1Q38A 4B9YA 2IBZX 2BP8B 3TFKD 1D5MB 5DHXB 2DI8A 4G8GD 1UKTA 3PL6C 4LF3A 4PJCE 3X1GA 4FD0A 1USZA 5FPIA 4IBUA 3MODL 1OF0A 3CVHB 4M7LT 4JE0A 2J5WA 3ILPA 1NPNA 1U8NB 2X0VA 5ACZB 3VWKC 1YMMA 5IQNA 4JHAH 3LJ3A 2OMYB 5I1HH 2E7BA 5FFLA 3GSWA 4FFZL 1I3RA 3QZWA 4KK8C 1RJCA 5FYLH 4BHUI 5E24E 1HZHH 3H6AA 4WFFE 4TOYL 3DI3B 4FNLL 2XG4B 4MVBD 5E0QA 3QE5A 4GG6E 3FONA 3KBPA 3SDCB 1C12A 1U0QA 3DIFA 4PVBA 4L1HA 4UNUA 1WWWX 5C07A 4GAGL 2FBRA 4NWUL 4RGNE 3LEVH 2X1QA 5IHZA 1XGTA 4L3ED 3AXLB 5DHVB 4JQIH 5IB5B 3ETTA 4X8CA 3A4FA 1QASA 5F9AC 4HWEH 3J7HA 3ISYA 5FYKU 2WXQA 1NCBH 1YUKB 1D5MA 3KPOA 2H0JA 1BVNP 3NQKA 4UQDA 4YDMA 3LPWA 4DGYH 4HFWA 3V7AE 1UWGL 4YZFF 3MUUA 4FJYA 3FK3A 2COVD 2FJHB 1S7WA 5F96L 4MAYA 2VRQA 3BSHA 3BE1H 2Z7UA 3NH7H 4FI8A 2YJQA 3KYOA 4JKWA 4XPAL 1MIEL 5IUCA 4NKMA 1UB5A 2UY6A 2ATAA 4A37A 2MHAB 1I8IA 4P2OA 1HKLH 1NKOA 1DBKL 2PCPB 4S2SB 5T1KA 1CO1A 2DRUA 1ZWIA 4GRWF 4L4VD 1GS6X 4P2QA 5E99L 5ELIA 5KJ4A 3D39B 3D51A 1ZCRA 5F3BB 4D9LH 5EIVA 4ELDA 1F4YH 1DQTA 2V0AA 3I85A 3DNKA 4J2XA 1URZA 3MPCA 5JHLL 5E6YA 1IT9H 4JR9H 5T1DH 4IIQB 3NAAL 3BP5B 3CJJA 3V79C 2A73A 1CTOA 2R2EA 5A40E 3IVKA 2PYFB 1A6WH 3NCBB 4N2BA 1IGCH 3EJJX 5T3ZE 4Z7WF 3U4BL 2GIYA 4HOWA 3MA9H 5HYJB 1Q0XL 3N44B 2HT3D 3FHEA 3ZYOA 1AE6L 1EERB 3KNBA 5F2FA 4O02H 1CICD 3HZYB 4OIIL 1ZLUK 1OAZL 4UOQA 5C9KA 2OSLA 1CB4A 4MJIA 3WY3A 1RZ8A 3DVNB 3QIBC 2IGFL 4X7TA 4QKTA 3RGVD 3T8VA 1SN2A 1BEXA 4LIQH 4LQ1A 2CWRA 3ZE0E 5K1VA 5HYSA 3SE4A 1IGTB 5I9QB 3JWDL 5JIDA 1FHGA 2KUTA 3DX8B 2R83A 4KKRA 2ARJQ 1VFAA 3L7FA 4G8IB 1F1AA 3KWXA 1KC5L 3A24A 2HT2C 1ILSA 3QQ9C 4L4TD 5M7QA 1F8TL 5BRZA 2Q2EB 2H0PA 1KN2H 3G6DH 4QHUA 5C6TH 1U8OB 4K7PH 4EAEA 2I60L 4LPVA 4MYWB 4ODTL 2WZ5A 5KSVA 3NH7L 1CDUA 4HC1L 1CDJA 4DUVA 3BC9A 3OGOE 3MNWA 1JOIA 4ZW7A 3P9LA 2FQFA 1RQ5A 1ACXA 2WQVA 4FG0A 5F3HA 2K0RA 2HFTA 1MFBL 4GINA 1WD9A 2BVYA 2Q8AH 1MLBA 3Q3GB 1MH5A 4HFUH 4L3EA 1AI1L 3GBEA 3VU1A 3HMXL 1AR1B 3QHFH 4POUB 4XNZC 2G60L 3LKOB 2A74B 4TQPA 3M1BA 1JGDB 1M1XB 3MRDA 4ZX6A 1FH5L 4DFIA 5AG9A 1RKRA 2DQTL 4V1DB 3BZ4A 3QUML 5FHAH 2ZPKL 3ECQA 1HTYA 1V7NL 4PJBA 4MJHA 1AHWA 3BH9B 4XMPH 1TG8A 2F6AA 3L4WA 4F3FA 2D9CA 2WOBA 4KK9C 2P4AB 3JUYA 3LRGA 5DFWH 2NY1B 2ATPB 3VFNA 2ZCKH 1M3JA 1AXIB 1EJ6A 1WD8A 1WS8A 4R3SA 4ZOCA 2HPTA 5DEZA 5AZEH 5F7BA 1B6DA 1MCFA 1S3KH 5AALA 3TNMA 1U8IA 5LNDA 4WHYH 4Z8FH 4P2OD 2AJYH 3I9PA 1XMWA 3RL2B 2DBJA 5E9DE 3HBQA 1LWRA 3RGVB 4OLUL 3BZFA 1UXSB 3ZDZF 3O45B 4GUCA 4TUOB 1T89C 5GIRB 4HK3J 4N90E 4HISA 3ZTNL 4TNWK 2ZG3A 4H0GA 5AB9A 3AB0C 4YDKH 4MNHA 5FLVA 4K5OA 4WGVB 4YC2B 2F8VA 3DVGA 3ASOB 3V6BR 1VF5C 2BS71 1RHFA 2DMCA 2VTFA 2Y06L 3PABB 5F7DA 3TF4A 2G60H 4XXWA 1MCKA 4HZAA 2JB6B 4BSJA 3C5SB 3IFLH 1J8HB 3L2NA 4H44C 4HIIB 5F1NA 5IKCA 2DICA 1BQHA 3NEEA 4OZFA 1R3LB 2VLLB 3MBXH 4MXVF 4QO1A 4GG8B 2N1TE 4AKPA 4OZGE 2NY6D 3VG0L 3BOVA 2IDCA 4JW3A 2G2PA 3K0WA 3MNWB 2CK2A 1GY1A 2KS0A 4X4YB 1IAOA 4MX7A 4OV5A 3ESNA 2WWMC 1JK9B 3V7AG 5LGYA 1S3KL 5LAPA 5DJ0B 5B7FA 3WNNA 5DGQA 4GRMA 2FECI 5GZNA 2XJKA 1HOCA 4KNUA 4PRHD 4WV1B 1NGZA 5DD1H 1MCEA 4W9EC 1G7IA 2BSED 3FQ2A 5FYKD 1A7OL 4PJ8D 1KYDA 4Q56A 2W9EL 2UZXA 4RGMB 3DYOA 2EIZA 5J0BA 5D7LA 1ZGLB 2BNRB 4JY6A 3S3PA 4GRWH 1U3HB 5DYFA 2FO4A 3FQ4A 4LDLB 2C7UA 2F54E 4LOUD 1KIPA 3NK3A 1KFAL 5HI3D 5EHFA 3FCSB 4JB9L 3QO0B 1ONQB 2X6UA 4NS0A 1ZS8B 2VM9A 2AQNA 1T7VA 1UC6A 2IPTL 4NSKB 1EGJH 5C08A 3LPOA 5EMYA 1OCOB 3UTPD 1TT6A 4AJVA 2E4FA 2CUHA 2XWJB 3O4OC 1MFUA 3KL5A 5KG9A 2QDWA 1TR7A 1A5FL 2Y1ZA 3D85B 3IJEB 3X3GH 4KRPB 3QUXD 3I3EA 1A1MB 2PNDA 3OPZL 2ORBL 4AEFA 2VZSA 1EFXA 3D07A 4XBEH 2P7TA 3L3JB 3N06B 5E4EB 1JNHA 1ZA3B 2PP9A 4XXCA 2ODIA 1OT2A 3CXHJ 3VJ6A 3EJTA 2AK4A 3PU7A 3ZE0B 3T3MB 2WAHA 3H9SA 2D7TL 1G7HB 2F61A 5TK4A 3CTTA 3LYRA 1MRFH 2P43B 1AJ7H 1E9OA 5L4FA 1IGML 1WZKA 2FGZA 4AGMA 5C70A 3B2DC 4JVWA 3FTVA 3O6FB 3UTTB 3VFVB 4PJGB 2GBAA 2ICEA 4QHLA 3F7RA 4JRYD 1U4FA 5DVKA 1RJLA 5I6OA 4JKKA 1F3JB 4K4KA 3Q05A 3ATBA 4M6NL 5E9DA 3K4AA 1EEUA 3HPJA 2JQAA 1WYJA 5ALCH 4KKBC 4YSQA 1XCQA 2EQDA 4UQ2A 3ENEA 1MCSA 2XTJC 1KB3A 4ZAKA 5I76B 3MTXA 1WA2X 3E3QE 2H5UA 5ICUA 3V4PB 3F7PC 3QORB 4Z0BL 5DD0L 4WAFA 4I89A 1CFSB 1J10A 2IQ9H 3GI8L 2Z31D 5F96H 4CMHC 4RIRA 1XSOA 1FJ1A 1KJ2A 1HSBA 3RNKA 3NIDF 1FCGA 4ORGB 3UL4A 5F88B 4N0UE 1OP4A 2CIKB 1JZ7A 1SPDA 1LK2B 2PR9A 2XQYA 2EVGA 5AW4B 4NFBA 4J28A 1HHKB 3FU8A 3IDXL 2HKAA 4KITB 1J8KA 3TYFA 3D9AL 1P7BA 1HWWA 5D7IE 4I0PA 5HI4C 4Z95H 5KN5A 3SGJC 3FF8A 3DMMD 3FB7B 4R26H 2V7NB 2A77L 3T0XA 3EOBB 3T1WA 4W6YB 5GZOC 4PGDA 4B97A 3QH3A 3CFEA 2CJ3A 4NQEE 4HA1A 4EZMA 3NCYP 4L8DB 4LOUC 4QIRA 1WIPA 2A6KB 4S1RH 5DS8A 3QG7H 4C4KT 1HXMA 4J8RB 1UACL 4FNRA 3EGSB 2AKRA 4I77H 2H6PB 2F8XC 1TVHA 5DC2A 3SJVD 2YAMA 4G6FB 2DWEB 3ARDD 4K5MA 2K78A 4JFEE 4D2NA 5E9DB 3QUMH 2PO6D 4PRHB 3WNMA 3FCTA 4OGAD 2C1OB 1NGQL 1NWOA 2F53E 2V2WB 4HOMA 1E4KC 5IG7A 2Z9TA 2P5WD 4R97C 2ENSA 1ORSA 1XZ0A 1MFVA 3T6WA 3WCYA 1AS6A 4Q9RL 2VUYA 5CZVL 3I6GB 4JZOB 1QRKA 2WXLA 4M61A 3VA6A 2KQNA 1IVLA 1NC2B 1XAUA 1JWSA 1L9SA 3TTSA 1R0AH 1SY6H 4YC2C 1U91A 2OMYA 5H37G 2P7TB 3L3JA 1PF3A 3B43A 4Z18A 1X7QA 3SPVA 2QR0A 1HZLA 4DAGL 3JWOC 2MH4A 3OXRA 4X9GA 2V7HB 2EEAA 3SEPA 3MACL 2PCYA 1NDGB 4LPWA 3DXAB 4KZ0A 2ICEB 4MMYB 1DP0A 1R1CA 5IKCB 3RA7L 1T2XA 3NCJL 1W6LA 4U6VL 1QABA 1R9FA 4DP2X 5MEQA 3ET9F 2QVTA 1M6OA 2LU5A 3O8XC 3EGDA 5B39G 2IXQB 2DOCA 3OZ9L 5CIPB 1T5XA 1A4JB 1OP5K 3DKHA 4CL7A 2JXMB 1U8HA 2WINA 3DJRA 4H8WL 3FT4A 1F2QA 4G11A 1BZ9A 4X7SL 3OLEA 4OF8A 4MNHB 1HILA 5HGBB 4IYKA 2DLFL 4IU2B 4UQAA 4YFDB 1HZKA 4K5LA 3E1F1 2MQCA 3N40P 2Y6TE 3EFDL 1DL7H 4IJ3B 5DA0B 1S7SB 1BOYA 4QHNA 4YGVA 1OCWL 4L0YA 2GHWB 3VD9A 5D1QA 1SLUA 2BOCA 5IVZB 2DH2A 1WFMA 2EACA 3Q2NA 2YLHA 4I0KA 1PLGH 1V8HA 2VR7A 4GAYA 1EZVX 4Z77B 3EFOB 3O2DL 3QXTA 3ARFB 4Z76B 4HH9B 1G7LA 1ZVHA 3BCFA 4H25A 3ESPA 4QYOB 5INDB 1J5CA 4NBXB 1VAHA 2BO0A 1W15A 2AC0A 5G5DB 3FPYA 2Z92B 2WLLB 4GW4B 4R0LB 3WXVH 1FH2A 3PGDB 3CE1A 3TJEL 3X11A 3OX8B 3AVEA 3ULUC 4FS0A 1VADB 4ALAH 3GSUA 2XN9E 3CZFA 4P46A 2VXVH 4PP1D 1PY0A 2Y7QB 3UGEA 4RZCB 1BZDA 2VQ1A 2V6HA 2MCAA 1VCBC 2AK4B 3VM5A 1H8OA 4HS6B 2BDNH 5FM5M 1N68A 4GAJH 1I8LA 1W72B 4PS8A 4FLRA 4UWQB 5E2WH 5T3ZH 3CFBB 3OL2A 3BUPA 4UZSA 3P69A 2IPKB 5GRVK 3RURA 2Y36L 2BXZA 2CO3A 3IJEA 4KK6D 4B60A 4JJ5A 3JV4B 1X5GA 2E6QA 4P5RA 1W0VA 2DQCL 2KDYA 5C0NC 3QO1B 3K6SB 3EYOB 4HU2A 5SWZB 5HGDA 1H5BA 1O5DT 4F58L 3SDXB 3HG3A 2J1XA 2OMVB 4ODWB 2P5PA 5GXBB 5E2VL 5HGGS 1YEIH 4C58B 5JPNA 3IB4A 1B90A 1MFCL 2HJKA 5AOMA 2FD6H 3EJQA 2QHLA 4D3CH 5EF3A 5TFSL 5DUBB 4WW2F 5CP7B 1AZRA 4G8EB 3TZVB 1KUMA 3WHE0 5HXMA 3RRQA 1BW8A 1UA7A 3BQUB 5D1QE 4OZ4B 2HJLB 1M71B 4AENA 4Y5VB 2R56L 2UWEF 4GQPH 1A1OA 1KWKA 1XZWA 4G7QB 1XH3A 3BKYL 3D3VD 1KEML 4IRSB 4Y8DC 1SJXA 2FJUB 1PZ5B 2E59A 2QGDA 3PWPB 4JFEA 3RWGA 2GITB 2KLTA 4GBXC 4RAVA 1NH6A 3H9ZA 4B9JA 4WTZA 1DQMH 4NQCD 3LN4A 5AW7B 1XO8A 4PMEA 5HJDA 5F3HB 4J3BA 5DD0H 1HJBC 4OZIE 3UBXA 1I7ZB 5DHDA 1E7UA 3LZQA 5F89A 4DEPB 1OAXL 4PW9A 2ZAIA 1X5MA 1KBBA 4Z3HA 4P06A 3TN0C 3AJ7A 3ILQC 3GHEL 4NNXA 4XCFL 2JCCF 3H1ZA 3COOA 2DD8L 4JPKL 4UB0H 3W9DA 2ROYA 4KDWA 4GAYB 4QKXB 1EAPB 2SODB 3V0EA 1MDAA 3GMLB 4XOBA 1K85A 1ZVNA 1QZNA 2ADGA 3I3DA 1XL6A 3SDAA 5FECA 1AZUA 1W0VB 2YPLD 3N43B 2QPSA 4EOWL 1IILE 5AVWB 5DD3H 1H19A 2R29A 3EH3B 4PG9B 4OJFH 4WEBH 2R0WL 5DDHA 1MCBA 2Y7MA 1FORH 1PU0A 4FXKC 1QLEB 1AZCA 4ODBD 4XN4A 5IMOB 1SFHA 1FVDA 5SWZD 5IV2B 2HAZA 3U6RA 3O2DH 4BRJA 1KLGB 5EU3A 1W16A 3DBSA 5B1JC 1R3IH 3A67L 5AWNL 2G3NA 4XPTH 3LPFA 3MFFA 4UV7L 4B9IA 4U1SB 3LEXB 3UTZA 4C56D 1VGKA 4XPGH 1RLBA 5AEAA 1UT1A 3NJLA 1J88A 4GW4A 4R0LA 1OCZB 1ORSB 32C2A 3ECBA 4G3YL 1X7TA 1KG0B 5GJTL 4M8QA 5KVFH 5F7KC 4PJIB 3D2UD 3MKKA 1E4JA 3HC0B 4PJHB 1C5CH 5K39A 4FQIH 2JKIS 5D2LA 5CHNA 3L5IA 3CU7A 1VIWA 2D31A 3V0VA 4AT6B 3AG3B 5AW9B 4PR5B 4BSVA 4TRPL 2EE9A 2HH0H 2BNUB 3G5YB 1A6AB 2W94A 1L5GA 4WO0A 4XR8C 5E6SB 2FATL 1JF1B 4G9FB 2AW2A 1GS7A 4OFVA 1AG0A 1CLVA 4P9HC 2YFNA 3SZ6A 2EZ0C 3T4AC 2PPFA 1PX3A 4D9RE 3GZKA 4LNRA 4X6CF 4AXWA 1N64H 5CD5D 2BZCA 5DMYA 3NSCA 1CE1L 2Q1EA 1XZ0B 2VC2B 4O2FA 2XWEA 2X7LB 2PKDA 1X44A 4DAGH 2CKBB 4JO5A 1SMDA 1H15A 2GIMA 1LO2H 2AVFA 5ABAA 3OXSA 2QZ5A 1NL0H 2YUVA 4OBSA 3TH2T 4EVNA 1OGSA 3D12B 4L1DA 4QRRA 1HHKA 1NIFA 3CZSA 2EDBA 2X10A 1BMWA 3TVMA 4HAGA 4JFYA 4Y16D 5C08E 1W72L 3GK8H 4MMYA 3BIKA 2Z35B 2HX8A 3DUUA 3RKPA 1GAFH 2H26B 3ZYJA 3VSQA 3LSOA 1CLYH 1EZUA 4CBZA 3KXFE 1UZ6E 2V9TA 3M45A 4OCRH 3NGBC 3QNYB 1XGPB 2P8MB 2NX5B 5AOKA 3SQBB 1FNLA 1HHGB 2P52A 5E23A 1CR9L 3M17B 1U8KB 5SWSB 1USQA 4G6JL 4XCEB 1PNDA 5DMGC 5DZVA 3ARPA 4X4KA 4EN3B 3TYGH 4D0BB 4OCNC 2EIKB 1G7QB 3VGFA 3QVAA 1DJWA 3QIBD 2VW4A 3P4NB 4QRUB 3VM7A 3GBDA 4GRLB 2R4RH 3T9WA 4XMXA 4TVPD 4JFZL 4C4KO 5IQLA 3V10A 5EORH 2VC2H 4OZGB 2W60B 4N90D 1SHXA 4RFNC 1G4RA 4E36A 1UOWA 3OM3B 3VFTB 1TITA 2WO2B 3ARBC 1X5HA 3BT2H 4V1DE 2ICWA 2QVKA 5DU7A 4ISVB 1J8HE 1OSEA 1B0IA 2A38A 3BUYB 1EHKB 1JI2A 5HHVH 2CU9A 5K9JL 1KB5H 3GSXB 4RVBA 1OT4A 2RGSA 2Z4QB 3MBEC 4JQVC 4UTBA 2DYPA 2V2XA 5E94B 3H54A 4KRMB 2CM5A 4MFHA 2CKBA 1U8KA 4PJ5D 5EPMA 2OSXA 2N0MA 2R2HB 5SWSA 2XA8L 43C9A 1JYWA 3QDMA 3IGUA 1LYQA 2DI7A 5T3ZL 3BD4A 5LKNA 5G2NA 4Y2OA 4Z7OF 2N7SA 3OJDA 3RX7A 4DQOL 2VDQH 4PJ8A 5D96B 1RZGB 1TETL 1JGVH 4UQIM 4S0HA 1ZAGA 5E4IA 1A02N 2D4FA 2LFEA 1J05B 4ERSL 4Y7OC 2WIIB 1IGIL 4XP4H 5I82A 4FG6C 4OZHF 4YFLF 4R4BB 4HIHB 2ZUTA 1WICA 4BGDA 2QGCA 3SE3C 3GSNB 4G6MH 3B1UA 4LSVH 1X4YA 2VZ1A 3OXSB 4R7VA 1CXEA 3NSDA 1T21A 2ZZUT 3QI9D 4JANA 1XGYH 4XP1H 2PW1A 1XSIA 2XQYG 4Z3EA 2VN3A 4K7FB 3GJFA 1Q9LB 1RV6X 2ZKWA 5GGVL 3IN0A 3UAFA 1T4WA 3V4VL 5C0BD 1MUJA 1N64L 1UVQA 4LNRB 3AWGA 5C1MB 1A7BA 2C1PB 3MUGA 3H55A 2YEQA 4YHKL 3GHBH 3LXUX 4AQOA 5F1OB 3NTCL 4XCEA 1RPQA 4WWKD 1CDYA 2DLEA 3L3HB 2O5ZL 1ZXKA 2NX5A 3N9GH 3G04A 4EZJA 2MQ0A 4ANVA 4YIQB 1CI5A 2OP4H 5H2BB 4XNDA 4OFKA 5DTFA 5AKVA 1B0RB 5DMIL 5GRJH 1F3JA 2X6AA 1TZOA 1T1ZA 3B37A 5DMKA 3BAIA 1Y0LB 3S88H 1YLBB 4ALAC 4NRXB 4ZMAT 1KNOA 1TO4A 2NXZD 4LNVA 3WJJC 5AVRB 3GIZH 4ODUA 3EYFA 3WMPA 3QDJD 1L7IH 4AC2A 5EG6C 2XUWA 1JN6B 2W65A 3EJZC 1M7IB 3QUXB 4W9HC 2NZ1A 3IDIB 4WNQB 3WIFA 1SDDB 3BJ91 3IPFA 4V2BA 3FB6B 1BBJB 4EI0A 3HI1A 3QK0A 4LT7A 2FEEI 1KBWA 4GQ9H 2DIAA 1TIUA 2RALA 5F9JA 4JFQA 4GKZA 1NKGA 3QIBA 4NERA 2Y07L 4NQEA 1Z5LA 3BPLC 3WD5L 3HMWH 2GJRA 2RFXB 4GPVA 3M6DA 1VCAA 2IAAC 4EZKA 1YMMD 2BCKA 4G70B 4BZ2A 5I0YA 3CDZA 2EEDA 2XPGA 1H3TA 4OH2A 4NN6B 1G9EA 2P5EB 2KZWA 3KYNB 5EBGA 3VD0A 3EDKA 1PZUB 2MMXA 1M7XA 3QWOB 2F54B 1JHTA 2J2ZA 2YRZA 3H9HB 5H37A 3NSFA 5MENA 2QVMA 4JPSA 5FUCC 4OZ4A 4QXUL 4EDWL 4MD4A 1JV2A 5EUOB 3WTTA 1E6JH 4D7PA 2K3HA 4JE4B 4U31A 3UEQA 2XSKA 3WFEH 3CLWA 5GIRA 4XE0A 4KKQA 5EOTA 4XGZB 5SWSD 3QJOA 2YA0A 3H42H 5D7IB 2LT9A 4JJHA 3HG1B 5FW8A 2GY5A 4YMPA 3HZKB 2OXHB 4LVNC 2WXGA 3IJYB 2KYIA 4IGBD 1FVDB 5AQ0A 1MY7A 3QIBB 2AHIA 1WIOA 2YPLB 1D6EB 2V17H 3L9RB 2GJ6E 3DOSB 4GB9A 3HCVB 3P0VL 4BGLA 4FYTA 4OZFB 1KPRA 3U46B 4PJ5A 1SDDA 2VQ1B 3IFNL 1LO2L 3KPPB 1F02I 5E95B 2ZOWA 1Y6MR 5MENB 5L2KA 5EO0B 4K3DL 2XZAH 1S7TB 3L4ZA 2GJZB 2P5WA 2AJZB 3DX9A 5IR1B 2AEPH 3UO8B 3P4MB 3VYPA 4FAAB 3OAUL 3TO2B 5DQ9A 4D9QD 3UZQA 3HJEA 3SJVE 3N42B 1QYGL 4JY5L 1NCWL 3CBKB 5IJVB 4XNQB 3J8F7 4OF0A 5ACMA 4A04A 1MWAB 3O3UN 2W38A 1RLWA 3MZGB 3SGEH 2J1WA 3P30H 2MKLC 4LCCA 2B15A 3FN9A 3N42F 1OSZA 4F57L 3LEYH 3UYOD 1UFGA 3HLKA 2B9AA 3APDA 4DN4H 3FU0A 1FL3A 3PGFL 2IF7A 4OJAA 4PGZA 3SKNA 3VFGH 4GG6A 1BXUA 1NMCC 2HTKD 3O6MH 1F5WA 3I02A 1ZHKA 2JKTM 1OP3K 1VADA 4TUUA 1KJMB 3E2HC 2BOBA 4KY2A 4TRPH 4MJ5B 1LHZA 3POCA 5HYEA 4YSPA 4P2RB 4UMSA 5KOVC 4YH6A 4M6OL 1UCBL 1EDHA 3A3YB 1JSYA 1BZ9B 3JWOH 4CU8A 2OQJA 3C9NA 3FO2A 5KANI 3D39D 3VVWA 1GGTA 2UY7B 3D2TA 4B9CA 4JG9A 2NY1D 2QADB 4QRPB 1D5XA 5J13B 5HVHB 1PJWA 4I0CC 5FUZL 4QHKJ 4KWUA 1Y1DA 3QFGA 1D5BA 3QA3B 4PVMA 1XHHA 5A43C 1NFIA 2YD5A 3D69A 1DVQA 1FL6B 1E7VA 4NQED 1YEDB 3FQTB 1HX0A 3V6FA 1NBVH 2HFFB 1ZA6A 4ELMB 1KTKE 4Q0XL 1W72A 2YRBA 4MAYD 4CSZA 4HLEA 3ORJA 3DRQA 4AW4A 5B39A 5E8EB 2A9AA 2EYRA 5CP3H 1KCKA 4LSPH 1GSMA 5JPNB 5E7FA 2V5SA 5DSCB 3CHSA 3LB6D 4ZZFA 1WF5A 1XCWA 2JJVA 4MCNA 2WQUA 3L3KB 5HHMD 2VN4A 4P46B 4WEMB 4PYHA 1MI5D 2L7QA 3E7JA 1KEGH 1KTDB 3GBNL 5DFTA 2P42B 3X11B 3O6ML 4KKZA 1LO4L 2LABA 4YPJA 4JX0A 5DJ2A 1U3JA 3EGXA 5L88L 2BSTA 3WU1A 1J8HD 3AREB 3S36X 25C8L 3T2QA 2Z34A 5HJGA 1ZGLP 4L5FL 1OIOA 3B9AA 2O6FA 3PHOA 1NGYA 1FGNH 1RJYB 2XCMC 1T66C 5IW1B 5I0ZA 2GI0A 2KLSA 4ZFOL 2NSXA 1NINA 5GRWA 1GYCA 4O2CA 3SPGA 3WJJA 4AQEA 2EXYC 4BFFA 3EJRA 1LGVA 4XCCH 3ZGHA 4DP1X 1BWWA 3MGTA 3B6SA 1JRHI 1EHLH 3AS0A 4XC1H 1IKFH 2EDXA 3L48A 1Z9NA 1ET5A 5JR1H 4LPUA 2JKSA 4PB0L 5HHOA 4MNQD 1WRFA 4GAGH 4NWUH 1ZTXL 3BVNB 2EC8A 3ARGD 2OV0A 3I6LE 4K7PY 4OD1L 2WNXA 2ICWJ 3ILPB 5ACZA 4FRWA 1KJ2H 5EIIG 4UT6L 3MXVL 4L37A 4HIEB 1UCTA 2HLAB 4YNYB 5GS1C 4ZTEA 1FV1B 4MZRA 4WCYH 4QY8A 2BRRH 3CSFA 1CPUA 1RY7B 4AK2A 4B9GA 2NY3C 4XC3H 1KMGA 3DX7B 2LVEA 2GUOA 1Z7JA 2Y06H 2QHRH 3WFCL 2CO4A 2B7DT 3FN3A 2AVGA 4F92B 1CBJA 5DS8B 1KBVA 4NFDA 5D7JD 1TTFA 1FBIH 2P8PB 2UWEA 4X6DB 4EVNB 5L2KD 4KNTA 5PCYA 4AYGA 2MPAH 2XKNA 3B56A 4NM8H 4NQCA 1NCOA 1PCSA 4MJIE 5GGTL 4YXLH 4JPKH 3S3DB 5IB3A 1N0XH 1IIKA 2ED7A 3SDDB 2JIXD 3BPOB 4OZHB 3NCXA 5T3XL 2NY1C 2WKOF 4IDJH 4R84A 3HFFA 5TF1L 4XCCL 1GC1L 2EH8H 2XT1B 3FO0L 2OZNA 1DJYA 2W8CA 4BWUA 3HNTH 5EA0H 2E8ZA 2ED9A 3A6CL 5KW9H 1Z9OA 5FAAA 1F90H 3EJZD 4FQ2H 2ITDB 3MLTA 4KMTH 1UD6A 4EXKA 3PNRB 3VI3B 1PZBA 2CO2A 4TUKH 3DIDA 4UU9A 5ES4B 3PLYA 1BLNB 3L08A 2ILLA 4TN9A 4Y9GA 3AQYA 4DOHB 4DPAX 4PJ9A 1AP2B 1MWOA 3MRQB 2GK0A 3RUGF 3VSUA 1UZGA 3DECA 2X4UA 3O0LA 4DGVH 4PWHA 1DSFL 3HR6A 3WLWD 5JIQA 3O6LL 3IAGC 2ZKHH 3P0YL 3F65A 4B27A 5I6KA 2Z93B 5JXAL 1VGKB 2OR8A 2I26N 2JKLA 4HWBL 1ZHBB 5IBLC 1UURA 4EI6A 1DZ0A 1QPXA 2X1PA 3OC5A 4JRWA 4LARH 1KB9J 2PPCA 4ZSOB 4DESA 3ARGB 1UFUA 1Z9SB 1ZPLA 2CRZA 5I2IA 4OTXH 1HL4A 1C5DB 2ORBH 2Z8VC 2ENQA 3FUHA 1D2OA 1UD2A 5ABZA 1A5FH 2CKNA 2VDRL 3SYPA 2J12B 4UILH 1NLBL 4OD1H 2X6BA 1WZAA 2CMRH 2ZKYA 2UWEB 1ASOA 4YHZL 2NXZB 4FLHA 1K5NA 4BH8A 4BINA 5IGXL 2BSSB 1S9WA 3PL6A 2ZCZA 4ETQB 5EIIB 4DW2H 1DANT 4F7CA 4G9FE 4LFHD 4O9HH 1O7VA 3V6OE 3BZ5A 5I1CH 4PP2A 4EF3A 1B9ZA 2AP2A 5EEWA 4YNYA 1K4CA 4HUMB 4PV8B 4DVBB 2VDLB 5JQ6H 1JGEA 1NUNB 4NHUA 3FC8A 2X7LA 3IDUA 1CGUA 2JI2A 2V3FA 5GRXG 2UX6A 3VRIB 4FOMA 3R4RA 4A6YB 3V0WL 1BJ1H 3GYRA 5ITBL 4LLWA 2DMHA 2UZPA 1PD0A 2AGJL 1QSEA 5LBSH 1BD2B 3PWPA 1HI6A 3QRGL 2QSQA 4FCHA 4TNEA 3AGVA 4XMLH 5JIMA 5KBNC 5CXPA 2CQVA 4LPTA 4M1GL 2E9GA 2IJ0C 2UWEE 4IGBB 4L2YA 5E8DL 3T1FA 3D4YA 4CGTA 1C8QA 2YXVA 1TU2A 2YD6A 5FK9A 1O7DE 2PF6A 1C1EL 1RHHB 2Z8SA 3B2UD 4ABWA 3JWOL 3PDDA 3G6AA 4X5LA 2YXFA 4NNYA 5K9OA 4AIZB 5LN4A 1T03L 4YZWA 3VMNA 3NDZE 5E08L 1HWGB 4N2MA 4HH8A 1PDKA 2BH0A 3F6LA 5KS9E 3W5MA 2BOBB 4X8JA 1XCTA 2PMZA 1PYWB 4XVJH 3IFPB 5ECJE 3QZMA 4G59C 5JXAH 1IAIM 3IMVA 3F5WA 4Y19B 2CLRB 4CSTA 1H5BB 2R4RL 3OB0K 3WDJA 3IXAB 2HT2D 3QQ9D 1AQKL 1MREL 4AQZA 3RWGB 1ETZB 1N2RA 2LAAA 4Z5RA 2Z1KA 1O0VA 3EF7A 5JORB 3JWDC 4B9ZA 2IAMD 4ZFGH 5LXVA 1RK0B 4Y19D 1M2VB 3F58L 1A1OB 1D6EA 3BVTA 3KH3A 5AAWC 1VENA 3ZJAA 5M95B 1I85C 2CIIA 4O51B 1I8KA 4U05A 1W8NA 3U0PB 3L5WA 3QFJA 3P30L 4I77L 1J0KA 2JB6A 1NCBL 1P6AB 3KCPA 5AVTB 4HCRA 4BFNA 2GY7B 4GYBA 3UZQB 3VG9B 4DGYL 4WEUD 5I8EA 4FI6A 3UJJH 3ZTCC 2AJZA 4M5YL 7FABH 2J71A 2W9DL 3NCFB 1MEXH 1MN4A 5EBMA 1CYWA 1KY6A 4KVCL 4XMUA 1WT5C 4YHOL 5AVUB 2ED6A 4QRRD 3MLPA 3D6GA 1U58B 5I1AA 2P48B 2WANA 2BNQD 4TQIA 3OWRA 3N43F 2O5NA 4BQCA 2GKIA 4HWNA 1T80A 1K6QH 3PWJA 5CN3A 3HZ3A 4FEMA 5K59F 3V0GA 5KSBB 5IEHB 4CC4A 4XNMB 2EKJA 2NTFB 1BFSA 1EHLL 1A6ZB 3PQYA 3VWKB 1X9QA 4KK6C 2CSPA 1M4KA 4JFFE 1D5IL 4X6DE 4OY9A 1QSFD 3HN3A 3INOA 1LVEA 4P5TA 1UYWH 4F1ZA 1TJHH 2HRPH 2NY0B 4ZJ9A 2HKFH 3QWNA 3RUGB 4M5ZL 4Z7VE 4V33A 5C08D 2ADFH 4MD5A 1TU2B 1MNUH 5HYQB 4BH7B 4LEEA 3X13A 5BUGA 2WQXA 4A38A 1RUML 2DQJH 4G5ZL 4RGNC 2JJUA 2OW7A 3DMMA 3QWOA 3MSPA 4HUNB 4ABUA 2WLHA 3DROB 5CILH 3QHTC 5D1QB 3GFUA 5FWQA 3AABA 3X3GL 5DURB 5E6IC 2UUDH 4KPHL 4PJ5B 5GRVL 4OD2A 1S7SA 4GUQA 2C5DC 1BJ1J 3OHMB 1MEXL 4Y0GA 1NDGA 1HQRB 4GXFA 3S8WA 3GRWA 4H8WH 3V4LA 1OCCB 3UERA 2OJZH 2V3EA 1T4KB 4LKXB 3V6OC 4ZZKA 4K7PX 5ICZB 2J56A 3GDBA 5MHSD 1SBSH 5HGBA 1A21A 1ZJBA 5T1LB 1NEZG 4WKZA 2MWCA 1DBAL 3ZUCA 1D2PA 1FG2B 3MJ9H 3PF2A 4U1JA 4HUUB 1QBML 1IGMH 3FSWA 5F6HJ 1GZHC 2DQFB 4JRYA 3GSUB 2DF3A 3AFLA 2AERT 4F7KA 4FZ8L 4EE2A 1VRSA 3CFIC 3BP7A 2DWYA 2DY2A 1KN2L 2KMWA 5D4QA 3LH9A 3C60A 3U30B 2OS7A 4WFGE 1QSED 3L7EB 2VZUA 5DK2A 4U1MB 5GGSB 4N5EC 3HVNA 4OJCA 1BECA 5DO2C 4N0YL 4NLHA 1X5XA 1ZHNA 3ARFA 2R1YB 4HC1H 5ILTL 1J0ZA 5D6DC 1OAJA 3HAEB 4KQ3H 1R17A 5D72H 2CKBH 2X4SA 3SQOL 4M43H 3SCMA 3MLXL 1HCVA 4JM4L 4F9LC 2C9AA 3QHZH 5FKAB 3D4GA 4KZDL 5T5FH 5J6GB 3R7QA 3MBWA 2DYSB 1T0NB 3DJSA 2Y25A 4LRNH 2IO5A 1F8TH 1U8CB 5SWQB 4LRIA 4A2EA 4BFJA 3LX9A 5FO9A 1RUQL 2EDKA 3EYSH 1FIGH 5D7JB 3CFTA 4IKNA 2DQEH 3JQOB 4IU2A 3AW5A 1FAIL 5I17A 5LG6A 4AG4H 5BV7C 1EEYB 2WV3A 3WJMB 3UTOA 3F7VB 4U2YA 3TA3A 4X9IA 3ZMEA 1ZEAL 1EO8L 4NN7B 2NSQA 4WWKA 3NFNA 1G6RL 2E7LA 5D7JC 4Z3JA 1A1NA 2IAMA 4QJ3B 3QCVL 1U6AL 2ITDA 3MLTB 4Y88A 3VMPA 4LAQH 4FQLL 3TV8A 1WT5A 3K6NA 3VCLB 3QULA 4Y2DD 5TE4L 1K5NB 2VH5L 5CEYA 4G7YL 2JLPA 5CU5A 2FD6L 4H4NA 4I48A 5CR8A 4O5LL 2ZXEB 1BFVL 2QGEA 3QUZD 2NT0A 4MXWH 1HAUA 4LKCB 5KBDA 4R2GC 4OLZH 4F27A 2R56H 1QKZH 1NIEA 2HLFC 4NQTA 3ZRSA 4XHJD 4CNIB 2D7NA 3RBGA 1CMOA 5EEYA 4OF6A 3WUWG 4UIKH 3S2AA 3QDMB 1SBSL 1J1PL 2EUZA 4GI8A 3VFMA 4X4ME 1YNTF 4UQ3A 2X1XR 3MO1A 2Q86B 5L8LB 3GSXA 4Y5VC 1XF1A 4NO0D 3TOPA 3LIZH 3PDOB 3BUYA 3D39E 4MA3A 1SXZA 3LS5L 2DQJL 4AUJA 4PLJC 4F7MA 5BJTA 3V6ZB 4YDJA 3ARUA 5D1ZC 2VQUA 4L8SB 1U8NA 2FNBA 2WYHA 4P57A 4Z7QE 4LARL 1ZANH 4HAKA 3CSYB 4UINL 4DN4L 4QCIA 4YHIB 5IZ7A 4JDEB 4AVJA 5K9KA 3MNZA 4GFTB 4L4VB 1ZVYA 2F74A 2FGWH 3EHBC 3ARGC 3ARSA 4EEEA 4OLVL 1HHJA 3NFSL 2WIIA 5GHWH 4NOBA 4DQAA 1LDSA 1RU9H 3IETB 1J1OL 1QWHA 1RZGA 1VHPA 4TPRH 3JV6A 2GJ6B 4OM1H 4WKXA 2NDGA 5EU4A 3E6FB 1A3RL 4IBTA 3MXWL 2WM0A 4K3JL 5C0JA 3VFMB 1RUQH 3EYSL 1NFDB 3V5KA 3ZDXB 1B4RA 1FSKC 1WTLA 4GO9A 2D0HA 3MUZ1 4U6YB 1AR1D 4FZEH 1FN4B 4OZIB 3WTWA 4MAUH 4UIKL 5D9SA 2D4DA 5TPWL 2ZKXA 3T0VA 3EHBB 4B9FA 1ZLSL 1O9ZA 2NX5D 3NZHL 5FUOL 1IC7H 2BNUA 3PAUA 2YRLA 5FV1L 1ZS8A 5DZLA 3GEFA 1FVCA 3FN0L 5HHPA 4EZLA 3EFFA 1I9IL 3PCYA 5D1XD 4G43B 4M5YH 3VQ1C 1TLKA 3QEUB 4L8SC 1KYFA 1GS8A 4OCWL 1A4BA 1VSCA 4GKNB 4G3YH 3FTSA 2UZXB 1DFBL 4PREA 4HK3N 3QPQD 3MJ7B 2YQ3A 4N2OA 4PJIA 5CUSH 5E8EA 5BRQA 4FA8A 2Y5TA 1ZA3A 5T1MB 4E68A 4XVSH 5E8DH 3W0WA 5E8PB 4ENED 2EVFA 2CNYA 2DQEL 4KDTC 5F72S 1XSJA 3AACA 3IPBA 4XT1C 4UV4L 3D85A 3T04D 3MGTB 1V3KA 3TA3D 3MJGX 1N5YH 4U3HA 1NA8A 5BVJA 4FNTA 2VDOH 1MAJA 3CH1A 5CNHA 2R59A 1S8DB 5MEPB 5CD3B 3A4EA 3S5LG 4BDVB 1MI5A 2X09A 4M9PA 5E4AA 3SYOA 3T3ME 3GWJA 2HCZX 5D7IF 3V0VB 3LKRB 4CW1A 1AXTL 1U3HA 4WTWA 4OZFG 2VN5A 4WU7A 1A7PH 3LQAL 4B96A 2VCOA 2HXAA 3PHQB 2BHYA 1CI3M 1E8XA 2TAAA 4Q9BA 3QCUH 4S0SD 3OMIB 2XX0A 3OPZH 2VXTH 2J57A 3ARTA 4NENB 1BQKA 5GSRB 4PV9B 1X5FA 3RWCB 2ICEC 1TO5A 3IFOA 1DQJB 1IM3A 1E4HA 1DSWA 2UXTA 4MQTB 4K0OA 3BPCB 2L04A 2W0KA 2F2HA 4HS8L