2FWLB

The cytochrome c552/cua complex from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
YTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The electron transfer complex between cytochrome c552 and the CuA domain of the Thermus thermophilus ba3 oxidase - a combined NMR and computational approach
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport/oxidoreductase
molecule keywords Cytochrome c-552
total genus 30
structure length 134
sequence length 134
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fwlB02
2NRDA 2FT7A 3NSDA 2A3TA 3ERXA 9PCYA 3S8FB 1NPJA 4HALA 1RKRA 2YQBA 4F2FA 1BYOA 2HRHA 3NJHA 2Q5BA 3UADA 3X1NA 2HX9A 5I6OA 3FU8A 2BZ7A 4FA7B 1A8ZA 4YSQA 3WNJA 4UAHA 3ABKB 1L9OA 1XB8A 3KW7A 1OOWA 3PAVA 3EHBB 3DIVA 4YVNA 1ETJA 1ZPUA 2IDUA 1PZAA 2IDTA 3ABMB 2VN3A 1SFDA 1IC0A 1KV7A 1JZGA 2B08A 1QLEB 1AS8A 3G5WA 3NSFA 3FPXA 3ABLB 5D4JA 3FQ2A 2EILB 4BK5C 1CYXA 1XB6A 2IDQA 2XX1A 4JKNA 4BDVA 1PZCA 4DPBX 3PLYA 1E65A 2EIMB 4A68A 5I5MA 1V55B 1KBVA 1NWOA 3UAEA 3UABA 2IWKA 2B3IA 1E30A 1SNRA 2FQDA 2R7EB 4A67A 2BP0B 2PPAA 5I6NA 3HEIB 3X1FA 2RACA 1PLBA 1PNDA 4PCYA 4N4YB 1ADWA 4DP8X 1QNIA 2XWZA 1AZUA 2BP8A 7PCYA 2HLEB 3D12B 1KGYE 5PCYA 1WA1X 1PF3A 2EIJB 4E9RA 4Q8BA 1BQRA 1CYWA 5B7EA 6PCYA 4G72B 3EH5B 1ILSA 7PAZA 1JXFA 2DYRB 2XU9A 1V54B 3WG7B 1ZDSA 3T6WA 5B1AB 4AI7A 3PXLA 1OCOB 2OV0A 2IH8A 4DP9X 4CSZA 4DP4X 2GIMA 3NP4A 3KW8A 4QKTA 3ZX1A 2YAHA 1RZQA 3CVCA 3OMAB 1GW0A 3MBWB 1SFHA 4A2FA 2FT8A 1W6LA 2X87A 2BZCA 3FYIB 1NZRA 3L45A 5I6MA 3MX0B 2H47C 4NAJA 1E5ZA 2PPFA 2X88A 1NIEA 1AR1B 1F56A 5AZUA 2HX7A 4HCFA 3UACA 3NP3A 2PLTA 2VSMB 4YSRA 2JFCA 3EF4A 3S3CB 2TSAA 2FQGA 3FU7B 3V9EA 2CALA 3X1BA 3NSYA 4G70B 2J57A 4G71B 4YSPA 2GB2A 2GC4C 4JHVA 5D4HA 4A2HA 2PPCA 1ASOA 1BXAA 2VW6A 3H4FA 1J9SA 2GBAA 2CBPA 5I6PA 3WNIA 3FT0A 4AKOA 1SF5A 3OM3B 4GY4A 3QJUB 2IWEA 2YAMA 3ABGA 1AACA 1NIFA 3FSWA 3N55A 1X9RA 3PPSA 5EHFA 2UX6A 5LDUA 2QDWA 3IBOA 2XVBA 5ANHA 6PAZA 1N70A 2IWFA 1OV8A 1OE3A 3NJLA 1KDIA 2XXFA 4G7SB 3ZBMA 4L0PB 2GHZA 2XYBA 3CVDA 2WO2B 1WA0X 4A66A 1BXUA 1L9PA 1FFTB 2QT6A 1BQKA 1CUOA 4M3HA 3FPYA 1XMEB 4DP5X 4DPAX 3WKQA 2BP8B 3UGEA 1NINA 1RCYA 2J55A 2ZXWB 4MFHA 1OE2A 3V9CA 4A2EA 1WS7A 4E9VA 1MDAA 1QHQA 2MRYA 2P80D 2ZOOA 3JTBA 3WKPA 1CURA 2YAQA 1SHWA 4TXVB 2XXGA 2GSMB 1IUZA 4GP5B 2BP0A 1PMYA 4Q89A 3QPKA 4YSEA 3AG2B 4KO7A 1AQ8A 3NJGA 5FC9A 2FTAA 2YXWA 5TK2A 3AW5A 4AKQA 4BXVA 1GY1A 3IEAA 2ZONA 5B1KA 2UXVA 3U25A 4AZUA 4HAKA 1NIDA 1NICA 2CJ3A 3WI9A 2IAAC 1L9QA 3PAZA 1A65A 3PCYA 2FQFA 5I28A 3NJKA 4HHWA 3OMIB 1AAJA 1NTDA 2BHFA 5A7EA 1T5KA 2UX7A 1ASQA 3IE9A 3T9WA 4GP4B 4YSUA 1PZBA 2FQEA 1L9SA 2CAKA 2QDVA 2BW5A 1BXVA 4HCGA 3GDCA 2DV6A 4G7QB 2PCFA 3TBCA 1A4CA 3AG4B 4ZK8A 3CDZA 3QJSB 4YSCA 3AG3B 3AY2A 2DWSA 1I53A 2MTAA 2ZWNA 1PY0A 1J5DA 5PAZA 4E9XA 1HAWA 1ID2A 4W9ZA 1MZYA 1AZRA 5B1JC 2PCYA 5B7FA 2TSBA 3FQYA 5B1JA 3OD3A 2WO3B 2EIKB 1OCZB 2DY2A 2CUAA 2W8CA 1L9RA 2YAOA 3IN0A 2UXTA 1BQ5A 2QPEB 1B3IA 2J56A 1DZ0A 2YARA 4QLWA 4BXSV 1JZHA 3SBPA 2QPDB 2FWLB 2VM3A 4X4KA 1MG2C 5F7BA 1GYCA 3QJQB 4KOCA 1MZZA 2OJ1A 2IH9A 4NERA 3ZDWA 1JERA 4A2GA 3T6VA 2DYSB 2OCCB 3X1GA 2H5UA 4HCIA 2PP7A 1PLAA 5D4IA 2E86A 2YAPA 1CC3A 1JXDA 3AG1B 1W6WA 1ZV2A 1PCSA 1SF3A 5I5IA 4EF3A 5I5JA 5B3SB 3QQXA 3NJNA 4F7KA 3NJFA 2PPEA 1NDTA 1UATA 4K9JA 3TBBA 1J9QA 1SJMA 3IN2A 1AS6A 2I7SA 3FSVA 4KNTA 1AANA 1AZCA 1ZDQA 1N68A 1BYPA 3X2QB 3FU7A 3NJJA 1M9WA 3SBRA 3CVBA 3ASNB 5I6LA 4BWWA 5TK4A 4WKXA 3T6ZA 4DP2X 2BWIA 3AZUA 1RZPA 1NIBA 2H3XC 1FA4A 3HB3B 1AS7A 4BDVB 2VSKB 1GS6X 3S3DB 1YLBB 2P80A 3NYKA 4YSOA 1X9UA 4DP7X 2N0MA 3FSAA 4KNUA 2BWDA 1ET8A 3H56A 2WSDA 4E9TA 1GS8A 4PAZA 4KO5A 4YSDA 1JVOA 2HRGA 3GYRA 2EINB 5AFAA 4DPCX 4P5SA 1A3ZA 2YAEA 3CZUB 1J9TA 4GXFA 1TEGA 3C75A 3S8GB 1BAWA 2FT6A 1TKWA 2XLLA 1A4AA 4M4RB 2PP8A 4BWUA 1KCBA 3FU9A 1IBYA 4YSSA 2HXAA 4YL4A 2R7EA 4AKPA 5E9NA 4HIPA 4KOBA 4WTQA 4E9SA 2JKWA 1MG3C 4P5RA 1M56B 3WIAA 2Y69B 1NIAA 1ILUA 3NSCA 2HZHA 4HZ1A 1GY2A 5I6KA 3SBQA 2LLNA 1XB3A 3ZIYA 4GYBA 1AIZA 1AOZA 2W88A 1J5CA 1JZIA 1TEFA 3H4HA 3FQ1A 2AZUA 2IDSA 1GSKA 4N8UA 1KYAA 3X1EA 1R1CA 2YAFA 5F7AA 2XUWA 1HAUA 1WA2X 3JT2A 1HFUA 1BEXA 3FYEB 2XX0A 1OCCB 1JZJA 2Y1AA 2AVFA 1A4BA 4YVUA 5B7MA 1KCWA 3CG8A 3FS9A 2FNWA 1KDJA 2FJSA 3ASOB 2VM4A 1PNCA 3TASA 3DKHA 1GR7A 1KBWA 1AZBA 1EHKB 3BVDB 1FWXA 3EH4B 1V10A 1ZIBA 1VLXA 1GS7A 1JZFA 4NB7A 3PAUA 3NJIA 4YSAA 2UXGA 4KNSA 2YXVA 1M57B 3GXUB 1ASPA 3T6XA 3CDZB 3TU6A 1E67A 4A2DA 3FSZA 4BWTA 4ENZA 1SHXA 4YSTA 5I26A 2XV0A 3TA4D 3NJMA 1JVLA 4E9WA 1IBZA 1OCRB 1WS8A 5B1BB 3SQRA 3RYMA 1EZLA 3QJRB 3QJTB 2CCWA 2XV3A 1W8EA 2IDFA 3S3BB 2AANA 1PAZA 4KO9A 1L9TA 1ZIAA 1E5YA 4HHGA 4CSPA 1OF0A 2AFNA 2PPDA 5AKRA 1SDDB 1JOIA 1ET5A 4DP6X 2Q9OA 4RH4A 1AG6A 1DYZA 2BO0A 2BW4A 2DWTA 4JHUA 4UANA 1WAEA 1PLCA 1J9RA 4F2EA 2VW4A 3DTUB 1OE1A 5IY5B 1IKOP 2XV2A 1SDDA 3OMNB 2VMJA 4G7RB 4DP1X 4AX3A 3N2JA 8PAZA 3T71A 3EH3B 1NWPA 2JXMA 4W1TA 1AG0A 2AZAA 2VW7A 2PP9A 4E9YA 4KO6A 2I85A 3NT0A 1NPNA 2I7OA 1ET7A 1JXGA 3OQRA 1URIA 3UAAA 4DP0X 2UXFA 4GP8B 4UF7C 2HX8A 2GI0A 4FAAB 2J5WA 3BQVA 1TU2A 4E9QA 1AZNA 2GC7C 1JZEA 3QJVB
chains in the Genus database with same CATH superfamily
1JN6B 1YEFH 3BGMA 3D4GA 1WZAA 2UY7B 1EPFA 1TTBA 2BCMA 1F4YL 4Y4FB 5FK9A 2WNWA 3IETA 1RIHL 5KVFH 1RURL 5CKAA 5H35A 1GSMA 3UO8B 2QLVB 3U79A 1L9OA 4AEFA 2H3NA 1WBYA 3JZYA 1XEUA 2YWYA 4OLZH 1R75A 2IAMA 1ZKAA 3BEWA 3ZZ1A 4X4YA 3ABMB 4IS6B 5HJGA 2VN3A 3V4UL 5C0IA 1Q0XL 2B2XH 3Q01A 4ZDHA 1WD8A 4R4ND 3UC0H 2ZUQC 2XWEA 4X5WA 2Z7ZA 1FO0A 1D2PA 5HVHC 4ZMAT 4ZFGL 4JFYA 9CGTA 4MJ4A 5C0BA 4WU7B 1URZA 1TQTA 3PLYA 3POHA 4A68A 2ICEA 1ZVSB 3O0RL 2BHYA 3UAEA 4DETA 4AQEB 5DXWA 4YHPB 4PH8A 4LXFA 3WO4C 5ETUA 4XB3A 5L9DL 4B3EA 2IPKB 4JRYE 2HB0A 2R29H 1C12B 1A4KA 3B5TA 5G4MA 4KPHH 1O6SB 3MYZA 3F83A 4L3EB 4IM8A 3FOMA 4PHZA 2RBLA 5ID1A 1HCZA 4PY8J 3RI5F 1V3KA 4MAUL 4IBVA 1VPOL 3QXAB 4MNQE 3D69B 2XRAL 3LAFA 4M9PA 4WEEA 2P52A 1S78D 3QWOA 4K3GA 3N40P 5DZAA 3O2DA 2EYTA 1KFAL 5E7FA 1Q72H 3FQUB 2CHWA 2I9LB 2UWEE 3I2CL 2VDKH 1ZLVK 5BCAA 2NCMA 4OZIF 2Y7MA 3RUGF 1MFVA 4XX1E 3RNKB 5A2FA 4UNVA 4G8FB 2WXFA 3PXHA 3KHOA 5ANME 4PVMA 4CC4A 5JW3H 4LL1A 3N85L 3KW8A 3M1BA 1R3IH 1IX2A 5AAMA 4F1ZA 1KTLA 3U36A 5EFIB 4IGBD 4XPGL 2X4RA 5KS9E 5L4MA 4K94H 1H0DB 4TNEA 4K94C 4APXA 2HTKC 3D33A 2X88A 4MXVF 3FTXA 1QA9B 1F56A 2OMWA 3L5WA 3P2DA 3TT3L 1DDHB 3WTVA 4NT6A 5G4NA 3EG9A 1GAFH 2JKLA 2OTWB 2AV1A 2CALA 1K8IB 2CRYA 1OIOA 1LP9F 4IRZL 4ZMXA 4YSPA 1AD0B 3MLWH 4LVNC 3S37L 2R0ZH 3O0LA 5E00A 1BLNA 1RPKA 4YHML 2WXQA 1NUDA 4KFMA 1GA2A 4KHXH 4D0DA 1YO4A 4PJFA 3EOTL 4XNDA 3BUBA 1U3YA 2R9HD 5DURD 3T3PB 4DGYH 4OZIA 4RZKA 5BRZD 2AK4B 2CXKA 3STLB 1NBZA 1JK8A 4WNJA 1WIUA 4KTDL 5F96L 1BVNP 2DLTA 3TWCH 4IRJA 3GSXB 1BLNB 2R9HC 4GAAA 2RALA 4MJ6B 4DEWA 2BXZA 1ADQA 5DHVB 4OLXH 2DQDL 2IALA 5AWNL 4IBWA 2L4OA 2NY2B 4I0KA 1W0VB 4NUJA 4PGCA 1OVZA 2F19L 1OT2A 2VR6A 3QNYA 1E5BA 1BG1A 4Z7IA 3QA3A 5EEUA 4NNYB 5K9OA 4JFED 3FQUA 4WFFE 3W56A 5A7BA 1A1MA 3LN5A 1YPZA 2E3VA 3KGUA 2QTEA 1ZHLB 5EA0L 2V2WB 2L7UA 1JV2B 4P59L 3DVGB 3Q13A 4IBYA 5LN8A 5LHDA 3TXAA 3BVNB 5F9JB 3NN8A 4P2OB 2F7IA 2GTWB 4OJFH 3M1BB 5DEFA 1HHHA 1AXIB 1KCVH 1A6AA 1B0WA 1CGTA 3LKPA 1HZHH 5D93C 4LOVA 5KAQF 1AJ7H 1G7IA 1U8QB 5E99H 5T3ZH 3V6FA 3WFBH 4AQZA 3OVUB 1EEYA 1XGTA 3EYUH 3VDCA 3GKWL 2ZKWA 2YBRB 3L2NA 2IOMA 1EEQA 5IIEB 2Y2YA 4KMTL 3SKMA 2M2DA 3MJ9L 4UZGA 1OANA 3PYCA 4W9FC 3IGLA 3H85A 2YEQA 4JFYB 2WQRA 5L88H 1GIGL 5DJXA 5EOCJ 3SY0A 3WL9B 2GSIA 4L9LC 1DUYB 1I8UA 4UQEA 3Q05A 2QELA 2WIIA 3GXDA 4JDZB 3GNMH 4U1IB 2CNYA 3ARWA 4FFVD 4OIIL 3QUYC 3FQNB 3FU3A 4LP8A 4GAJH 5CCJA 1J0ZA 5FGCE 2D0HA 5C8JB 4P48A 3MV7D 2N3JA 5D1XE 3UC2A 2J4WH 4L4TE 3FO0L 4ALAL 5T3XL 5J3HD 1LE5A 3ZL4L 5AVUB 2X89A 3RNQB 2VZOA 2BNUA 1RJLB 3OKEA 2NTFB 1SZNA 4N0FB 4OZ4B 2BNRB 3JV6B 4XNUH 2V3EA 1IAKB 2XWCA 5KVEH 43CAA 1JWUA 4FG6C 3QHFH 5HGDA 4U1MB 2CLRA 5DMJB 4UDUB 4EN2A 1IGMH 5GGSY 1Z3GL 4Z7VA 2FX8L 2VIRB 5HDBB 3LPPA 4GW5A 1R6VA 5H35B 1G5AA 5GS1B 1W0WB 4IBTA 4QAMB 1KLUB 1J8HD 4E5XG 4K15A 4H8WH 4AV0A 2PYED 4B9IA 1M1XB 1EQWA 5EIVA 3NIGF 3TIEA 2QQLL 2OR9H 5EIIA 1IGCH 2XWTB 2ALAA 1L9RA 2R8SH 5EU3B 2BSSB 3MGTB 4Z6AT 4RAVA 1N6QL 3BJLA 4XAKD 5EBWA 3WIFA 2X09A 1GZQA 2I07B 4QKXB 2K7QA 4OGAD 3KLAB 5BZWB 4F5CA 4WUUE 5FR3A 5EF0A 3VGEA 3BVXA 4LVOC 2YQGA 5C07B 4UZUA 2PP7A 5DSCA 4PGJA 4U3SA 5EF2A 4AENA 1EO5A 4HXBL 3CQQA 4QJ5B 3KPOB 2FDBP 4X6CA 4DEUA 4CSTA 1D5XA 5CN1A 2LE9A 3QQXA 3VI4F 1DBAH 3NJNA 3NJFA 3BQUC 3HPJA 4QHMB 1KJ3L 2A77H 3BZ4B 4BUHA 4CMMA 2JQMA 3DI3B 3TBBA 2P5WD 4MNQA 1AANA 4BCZA 1CFSB 2B8OT 4HKXB 1WCBA 2VGLM 1V8HA 1WBXB 3FU7A 2ICEC 4KRPB 3P4MB 4NOFA 3CVBA 5ICZA 4KJQD 5I1EH 2VO8A 2H3XC 1FNLA 3SPJA 5FV1L 4YX2H 4K3JH 4MJIA 4CADA 3S7GA 5K1JA 2VQ4A 3RTQA 1DQQA 4HA1A 5GISH 3CMOH 1C08A 3B9KC 5KYXB 3VGDA 2NCEA 4PJBB 3NYKA 4M9OA 4P46B 1FIGL 5EBLB 1UWXH 2Q3AA 3QNZA 1X9UA 3RPBA 2OMTA 2QR0B 4G6ML 1MWAB 4JM4L 2PTUA 1MNNA 4XI5C 2B1HL 3GDBA 4YR6A 1TSRA 4OY9A 3T3MB 5A6MA 2YD6A 3GBEA 3A4AA 2A83B 1NCHA 3EHBD 5F6HJ 1QABA 4LKCA 2ZKHL 4JRXA 4DPCX 3UZQB 4WWKC 1QRND 5L2JA 1WWBX 2C7FA 2C9RA 2CO2A 3CVHH 4D9LL 1KMGA 5CAYB 4IGBB 3SD2A 2NDFA 2FT6A 2NY4B 3OHMB 3UMNA 1LO3H 1J10A 1GKOA 1HDMB 1Z1WA 3A5VA 3GSNA 3DETC 4QJ4B 5F3BA 3DK2A 4M6OH 4OLUH 2HXAA 4YDKH 4OBSA 4X8JA 2GUOB 3U4EB 4L18A 2SEBA 1UKTA 4UQIM 2R1WA 1PZUB 1HL9A 1TKWB 1A14L 2JKWA 3QCUL 2WQ8A 3KM2A 1NIAA 3QDGE 3ARDB 3OKOA 3NZHH 4HZ1A 2X10A 3DIDA 1OOAA 2WP3T 4NGHL 4UM9D 2NXYB 2VLRA 3MBWA 4ZMPA 1W80A 2OZ4H 4OT1L 3ZN6A 1G1CA 2EDJA 2GJJA 4E41D 1TEFA 1J5CA 3P0VL 5BW7C 1LK2A 3CN2A 4NENB 1QFWI 3A6CH 4TUOB 3K74B 1F11A 4JY4A 5E1HB 3QHTC 1WA2X 4U6VL 3MZGB 3WTWA 2NW2A 2V2XB 2BSRB 2J6WA 1QYGH 3CU7A 1TQCC 2IO5A 2IEPA 3UCRA 4XPAH 3UTZB 1J18A 3QORC 4LDOB 3GXMA 3J07A 3IXTA 1I1CA 3P3RA 1SRDA 1OGPA 2ILLA 1J1OH 4JZJC 2J6EL 4Q56A 3D39E 3NK4A 3FZUD 5DJ0B 5C0CE 3CH8A 3WY2A 4PJ9B 2X3BA 3P77B 3QQ9C 1YQVL 1HKLH 3MUZ1 1PU0A 2A6DB 5HI4C 1BZ7B 4ISVA 4HH9A 5ITFB 4DZ8B 2PO6A 3LZOA 4KNSA 1VGKA 1OAUH 2VUKA 1RK7A 5A2BA 1XH0A 2IXQB 4YDKL 2Q6WA 2YLHA 4FQXA 1MFMA 2J8OA 3JTTB 4YSTA 4B7IA 4J3BA 4H8UA 1MHPL 1AO7B 2ZKXA 4Z3IA 4JO2L 1OCRB 4JO4H 1YEGL 4B7LA 1I1RA 5DUMH 1HSAA 2CBQA 3VUAA 4X9YA 1YEDA 3O41B 3NFSH 4MSWA 3T65A 5CMAB 4E68A 5I19L 5I82A 3K81A 4DN4H 3G5XA 1DQJB 2WCPA 3ZO0A 2G2NA 1AO7A 1ZXKA 3OG6B 4MGXA 2QHLA 2WXLA 3S4SG 1OF0A 1CE6A 2DQGL 4DVRL 5E2VL 1MLBB 2LV4A 3IDGA 2AK4D 1A6WH 1DR9A 5AKRA 4J4PC 3SDCA 3UFIA 2Q9OA 3FQTA 4HH9B 4J4PA 3G5XB 5C0DB 5FAAA 4RMRA 1NOFA 3MV9D 1MVYA 3CK0H 4AUUA 3STBA 3LPWA 4J2QA 4ZMOA 2EICA 3QZMA 1HL5A 2DMGA 2E59A 4WHCA 3T0AA 1BZ8A 2EDOA 4HDIA 3EH3B 2BVEA 1T2QL 4LFHG 3RJOA 4AC2A 2V2TB 1MHPH 1AY1L 2AZAA 3HE6C 2QKIB 4ZD3L 1DTUA 2V2XA 3EFFB 5CJBA 2X2HA 3RGVD 5K9QI 1DZBA 4QIRA 3UTQB 4L1DA 3ETTA 3V4PB 1U95B 2GCYA 3N0AA 3N06B 3SKJL 3RWIA 2CD0A 3IJEB 4GIAA 5TE6H 3VFWA 3KCWA 2VDRH 3BC9A 1OW0C 4UF7C 3NUKA 4I0PA 5DJ0A 3R06A 3OC8A 5DHEA 3IXTB 4ZNEE 4UTAL 2FWOB 12E8L 1R3JB 4H40A 4E9QA 2Z4QA 1U8KB 1I9EA 3DNKA 4CSSA 4ZMWA 3I3DA 4WWKB 9PCYA 5I6XC 1MOEA 1ZAGA 1T1XA 3K72B 5HGHA 1CICB 1L0PA 3FK3A 4UQBA 3E8UL 4FQIL 5I6OA 4FA7B 4N0UE 3A6CL 3H6AA 4TRPL 3DIFB 3BCFA 4R7LA 3GWJA 3DIVA 1UOKA 3CVHB 2YLKA 1ZPUA 1UH3A 3U6XS 1PVHA 1U2YA 2YD3A 3CPLA 4I48B 4I85A 4P46C 1PZAA 3PWNA 4FP8H 3TN0D 4WEBH 4Y8AA 3HNTL 3FQ2A 1C5CL 4LEXL 3FDWA 2R0ZL 1XGZA 3H9SB 3M1CA 5DLMH 3QQDA 1TETH 5FFGA 1XR9B 4RFEA 1ZTXE 2BRRL 4PJDA 5KS9B 2GJ6A 3UTOA 5CBEB 2R7EB 1L5GB 1XVSA 2R0KH 4JJ5A 2PPAA 4G7YL 2Q3ZA 2EXSA 5DJ8A 1P53A 1DCLA 4ZX3A 3FCTA 4GW4B 4PJHB 3BVTA 3ZE2B 4WCYH 1E4XI 4IEFB 1DQLH 4HKJB 1E90A 1IMHC 2NZIA 1AZUA 2KYIA 4OF3A 5AVWB 1JTPA 5FF6A 5ESVB 1R3IL 4FFWC 4G8GA 5SX5K 3ZO9A 1V7NH 1E27A 4LHQB 4HUXA 4PTTB 5CEYB 3WDIA 5FGCB 4ANKA 3JXAA 1CFSA 4HKXA 2HTLD 1XSJA 4LAJH 4PJ5E 3VXSA 1OXYA 4LNVA 3MGAA 1OT4A 1UM4L 1KT2B 4H1LB 2AK4E 2XTLA 3H2WA 4G8IB 2ZZUT 4PRPE 3RTQB 3S37X 1TTRA 3PS6A 1KFAH 2XXMB 1TYEB 3HUJB 3JTSB 4K3JL 3RVXC 4W9IC 1MXDA 3X14A 5IUCA 3PDOB 4OCYL 1LK3H 1RZQA 1XF2B 3BZ5A 4CRPA 3WS6C 1XAKA 3O2WL 5FUCE 4ZQKB 1LEGA 3C8KB 1WC7B 3RWHA 1NZRA 3LKNB 5CN2A 4NAJA 2A9DA 3D4YA 4XZUA 3FB6A 2I25N 2WXJA 5C0BE 3HPJB 5ESVA 5JIIA 5CD3A 4ZBJA 1LMIA 1SOXA 4R5VA 4WJG3 4D0CA 1GZPB 2X05A 5ISZB 2P5WA 4YSRA 1H3TA 3GRWL 3II3A 1G6VK 1ZT1A 2NSMA 2HT4C 4RDQG 3X1BA 3IGKA 3HC2A 1IC5L 1IZJA 3U7AA 4FD0A 4JHVA 4S10A 5FCSH 4XMVA 3ZDZE 5C6TH 4ELMB 2O61B 3L95A 3UC0L 1UH2A 4PJDB 1XCTA 5M94B 1XF5A 1BYNA 3P1VA 3QR1A 5IEHB 1I8AA 1JXJA 3RVTC 1HT6A 3CBJB 4TS6A 3W37A 5JLZB 3SB3A 3TEYA 2Y06H 4LRIA 1BAGA 3RTQC 3ZXAC 4LHUB 4AEHH 3CZNA 2PMZA 4LRIC 1ZGLM 2YQ3A 1DBMH 2BNRA 3JV6A 2ZSVB 2XPZA 5TQ0H 1M1XA 4P3CL 1T6VN 1X4ZA 1QEXA 4PLKC 4ADIA 3QXDA 2QDWA 3CZFB 4QRUA 4ZI8A 1FBIH 5C0JA 2KC0A 4TUUA 3UZVA 5KJRL 1WTGT 4G9FA 1AQDA 1YNTF 2LU5A 2X0WA 2JB5H 3TZVB 1H3VA 3A21A 1CDUA 1J8HA 1M1SA 2XV6B 1ZPLA 2YC1B 5HJ3A 3GI9L 1CD0A 3NIGE 4IU2A 1EWHA 5JHDD 4PJ9D 1R5VB 4A66A 4I9WE 1L9PA 4TSAL 4AH2A 5HYQA 3S9DB 1BQKA 4PJXB 3VA6A 2BP8B 2C7UB 5GRWA 2FIKA 2XIIA 4Z78B 5BXFB 5LAXA 4W70A 3GS4A 4FFYA 5CZKA 3RIAF 3IFLH 4WVRA 5DD5H 3F00A 2WXNA 4U0RC 1HTYA 2FB4L 3QPKA 4Y89A 4LLDB 3MXWH 1EO8L 3N85H 5C0AA 3T0EA 3AW5A 1OT1A 3MV7A 1DUYA 1EMTL 1F6AA 3PL6B 1GY1A 1U36A 2FBJH 3T0EC 1JV5A 4JDVB 3V4VL 4HS8L 5L8JB 3SPCA 3V4VB 2P26A 2GT9A 2DQ6A 4X6BA 4H13C 1KEGL 5CLTA 2ETWA 1GGCH 4FYQA 1IL1B 1XIWA 2DS4A 1PY4A 5HD8C 5FO7B 5KYWB 1G1OA 4W81A 3TEWA 2GKIA 3GMLB 1JP5A 4O2EA 1NSNL 1EGJL 1PEWA 2FB4H 5GRZA 4PYHA 4M7LL 1AC0A 3ISRA 1J0JA 5DQJB 3U9PH 1TQSA 4GP4B 2YFOA 4U0QB 1LQSR 2X1OA 3QO0B 1TOXA 1D9KA 3WNKA 1KBPA 1QO3B 4P06A 3QQ9D 1CT8A 4R26H 2EDKA 4M1CD 4YBLB 5EU6A 1NLBL 1G87A 5L2KA 3EGXB 3QZLA 1OSPH 3OAUH 5IB1B 4CU6A 2VMCA 3JTTA 1JK8B 1NMCC 5A3ID 2ZYRA 4PRID 5AB2A 5JTWA 3UGUA 4J1UA 4KZ0A 1P7KA 4PRNB 3DMMD 1DJZA 1SHMA 3MLRL 4LEOA 4QXVA 3CGTA 5MENE 2MOQA 2K4WA 4A55A 4JQVC 3SCMA 1OCZB 3O3DB 2WINA 3DMMC 1HVXA 3VW3L 3TNMA 1A5FL 4WY7L 5FM8A 4C8XA 4EUPG 1P9MC 4TKWA 2CG9X 3L5WB 3TWCL 1TTFA 3Q3GA 5J1TC 1NFDF 1R3KB 4LCWB 4XVUC 1TZOA 2NY0C 1JZHA 2VZSA 2ZP8A 1IGJB 4CVZA 1IIIA 1LD9A 2DM7A 3QJQB 3FB8A 5C0NC 3JWNG 3HI5L 5KUKA 4PRPB 3LDBC 2DQTL 3QDGD 4GRLD 1AO7E 3F2LA 3ZHDA 2A4ZA 4LPTA 3UTPD 4L4TA 5FHBL 3HZMB 3NIFB 3VXUB 2YUZA 2ZUUA 3LPFA 2Z91A 5B3SB 2RH0A 1BVLA 1H3GA 1T2JA 5IQ7L 5C09E 3IU4H 1FHNA 4NFDA 1BGXL 3H42L 4PJBE 4P23B 4LK4A 1H0DA 3ULUH 4MA8L 4U1HA 3VFRA 4MNGB 4HIXH 1M9WA 1NL0L 5AVZB 4ZYKA 1KTLB 2KMWA 2ENJA 3ASNB 1PDKA 4QRQB 5H94A 2X3AA 3QIWA 5LBSA 4BWWA 3LHPH 5D7KD 2Y6SC 5TK4A 2ZOKB 1UWEH 3QUXA 4LF3B 1L7TH 2H32A 2X70A 3ISYA 3QORD 4XVTL 5EUKA 3RVWC 3RWDB 1YQ2A 3TIDA 3APMA 5I15H 3FHEA 2K4AA 1KFGA 2WK2A 4LKCB 4J5VA 3P4LA 4WWKD 5IJVA 4F15C 4JO5A 2MCMA 3NBNA 3HAEB 2OSYA 2AJXL 1VSCA 2KI6A 2ZG3A 2DJ4A 3SYOA 3MO1A 1GS8A 2OZ4A 4RDQF 4YS4A 1YJDC 1AR1C 2J8UE 2YMXH 4X7EC 3PP3K 3LHPL 1KB5H 3HG1B 4B5ZA 1QACA 4IHOB 1NGQH 2YAEA 3CZUB 3GI8H 3DARA 4IKKA 2K8MA 5DD5L 1JNNH 1R5VA 5TTRA 1ZLVH 1BVOA 1RUMH 3QJFA 4OCWL 5GGSA 5HJ3B 4ORZC 1NGZB 3C08H 3AREC 4HCRH 4P3DB 5ECGA 5E9NA 4HJ0C 5CGBA 4Y5VA 3D2UA 4Y16B 1F6LL 1SJVA 3KNBB 5JHDE 3L7EB 5D2LE 2NY4C 2MKWA 3LD8C 1YN7B 4PCKA 4X8XA 2J8UF 4NS0A 2W60B 3ULVF 1ES0A 5DO2D 4Y2LA 3ESPA 4WNQB 4UILL 1OCWH 2LLLA 4UV4L 1DLFH 4NQDA 5BMFH 3NPZB 3K2IA 4L8SA 2OMXA 3O6MH 2ICWI 2HVKB 1LEIA 4DOHB 2WTRB 5KTEL 2JJSC 4TOYH 3OLDA 1KYFA 1P5UC 3BYYA 1A9EA 4XVJL 2QQKH 1I8IB 1OP3H 3SYPA 2EUVA 5FK9B 3ULSB 5JW4N 1KCWA 2OMXB 3QCVH 4E42A 4YDJB 4MD5A 4ZMYA 2OMZB 1T3FA 4KITB 2XN9B 2MQ0A 1QLEL 3CZSA 1IAOA 1FGVL 3OPZH 4WFGE 1E7UA 3WS6A 1MW3A 1I1YB 2BSCA 2HKHL 4HFWA 4G43A 3C2SA 5DYOB 3P0GB 4WO4B 3C09B 5K9JL 5DK3A 1NMBL 4AWJC 2XG5A 4Y8DC 4DGIH 4WI4A 2HT3D 2QPUA 1AQKL 4HLJA 1CIDA 1QR4A 4ONOA 5E6SB 4QWWD 3X14B 2XFXB 3L5HA 3MNWB 4YDMA 4YXKH 4PS7A 3UP1A 1G7PA 3EO9L 4U6HB 3O3EB 1RZGB 3RUGB 2J6EA 3B6SB 2CCWA 3PABA 2HRLA 2IANA 5DD0L 1G6RA 4I88A 5FDWA 1LWHA 3KXFA 4DERA 2J1WA 5HDWA 4DJMA 4YHYB 1MJUL 5BV7L 1ZIAA 4L1LA 5MI0B 1QKZL 2VLJB 2VDOB 3WHXB 4X5LA 3TJEH 2WCSA 3AXIA 4P3DA 1OWWA 1XR8A 2PCPA 4MMXB 4NZTL 3MGOA 5CCHE 5M7QA 3FQNA 5IVZB 1MCOH 2WQVA 4YGVA 3QISA 1KLGB 1UGKA 2APWA 4UQ2B 5I19H 2ALWA 2VDQL 2WTPA 3VACA 1OM3L 2KH2B 5IY5B 3MJ8B 4MHHI 3VFGH 3S88H 4C57C 4BZ1A 3FNKA 3QT2A 4Z7NE 4BHUI 5IMKB 4XNYH 5J7CC 4AM0A 4EEEA 2AVGA 4MJJA 5HVFB 2NQDA 4PJ8A 5GGVY 2I85A 4BRVA 1FYTA 5JZ7C 1NPNA 5ACMA 5EC1B 3A24A 4GUPB 4QF1A 4BK5A 1URIA 1HZLA 5E8EA 4K3DH 3ET9F 4FLQA 4OZFH 4CVXB 2CO3A 4YZFF 2QADC 2WNKA 1S5HA 4M7KH 1G9ML 4QY8B 5DI8B 4R4FL 2GJPA 1F02I 1H6EA 3AS2A 3QNXA 2NNAB 3SKNA 3OJ2C 4KK8D 3T0WA 3B2MA 1C16B 4WI9A 3QUYB 3T0XA 2L0DA 2XKNB 4PV9A 4NQXA 4Q9RL 4JUSA 1PD1A 1TENA 4F2FA 1BX2B 3EIFA 2QFRA 2BZ7A 4ZFFB 3L7FA 4AUJA 1LILA 1G0DA 5EZJA 1QOKA 3T77A 3AWEA 4JCLA 4O2FA 4YVNA 2HJKB 3K1DA 3P0VH 3UMTA 1AGBA 2UVEA 5BOPA 4F7PA 1N2RB 1MI5A 1EFXD 2RHEA 4R97B 4KI5F 4R5XA 3SEPA 1KZYA 4N6RB 5KN5B 4XBMA 5KVDE 3RVVD 4JKNA 1LTXA 1PZCA 1B6DA 2GK2A 5FM5M 4BBWA 1YMHA 5DHYA 2JJVA 2FLRT 5I66B 1EANA 1F3DH 2JI1A 2V7HA 3GSWA 1SNRA 4B3VA 3VFSB 5CD5C 4ODTH 1I7UA 3QIBB 5HDBF 3MCKA 3LMJH 2P45B 4HHAA 2F54E 1MRDL 4NAQA 5K5YA 3QJHB 3RFZA 4LLAA 4NO2A 1WP6A 2OTWA 1ADWA 4JY5H 4OH2A 3H9SE 1Z5HA 3L3IB 4AM0Q 3ML8A 2GBUA 4XXDA 1F3DJ 4P23D 1SEQH 1TSHA 3EUDA 4Y7MA 3AABA 3GBNL 5D72L 3QQ3A 2HVJA 2HH0L 4PRAB 4OUOA 2NZ9D 4E9RA 4JFPB 5IGXH 1U92A 4E0RA 3MCLH 2F5BH 2YD9A 2AJVL 4PRPD 5FO7A 2ZCHL 4NM4H 3H3BC 3NCCB 1WZLA 2IH1B 1FDLH 4LCCA 5FUZH 3P3TA 1PZDA 2YS4A 3MV8D 2PABA 3PXLA 4TVSa 5B38A 2XQBH 1R19A 4M62L 3MJ7A 2W1NA 4KTEH 4IK7A 3TA3A 4TQEL 2GPZA 4EOWH 3GBNH 2YD5A 1KPUA 4UIMA 3BKJH 1RK0B 1MJ8L 4P57A 1FCCA 5JYLA 4V2BA 3I50L 1VFMA 5AL8A 1ZEAL 2Y6TE 3N42F 4FTVE 1KXTB 4JY5L 4FNLL 3F8UB 4Y9EA 5I23A 3WFHA 3BUIA 4P9HC 4GRLB 4Y4KA 3PNWB 4S1QH 1Q1JL 4OCMC 3W2DH 1NANH 3I9GL 3M46A 5C0EB 2O6FA 2P42B 5DUBA 4CMHB 1O6SA 5I5RA 1YDPB 5GS3A 2J57A 3QAZB 3FFDB 1IVLA 2IPTH 2OJZH 2YGNA 3VSQA 4OFIA 3LXUX 5DZPA 3QG7L 3BWZA 5ANMB 1JTTA 3ZE0E 4A6YA 5FECA 1FL5A 3EYOA 3KWUA 3QUXC 4MDJB 1G7HA 1MH5A 2IWEA 1W8OA 1OP5H 3QPXL 2OW6A 4Y7OC 3VXME 3NZ8B 5FS5A 3NEOA 1NIFA 2WLLB 1KGCD 3L3DA 2YD4A 2AXFB 3DHMA 2X6UA 5EF1A 4Y2DC 3F01A 4IRSC 4YPGA 4JRXD 5HYSB 1B4TA 2X6MA 2ZX9A 2HUEA 4H0IA 1JPSH 2Y24A 2XZAL 1FV1B 5IG7A 5F9WC 1R33A 3EO0A 1LO2L 3SGJC 2VQ1B 2X12A 2B4CH 4XCNA 1RUKH 1S7VA 3QO1A 1HI6A 1MI5D 1FPTL 1BXUA 5AD0A 5HVWA 5D2NC 3D3VA 1ZLUK 1CUOA 4OLUL 4PIRF 4NZ8A 2RQ8A 1AR2A 3GF8A 3POCA 3UGEA 2Z9TA 2C3XA 4WWOA 5DZNA 3V9CA 1JMZA 1IQDB 1QHQA 2FEJA 2P80D 3CXHJ 5HDQH 4Z3HA 1K5NB 1FAIL 4OCLC 4RFNB 4DKEL 5J13C 1NGWA 3CX5K 4XCYB 3G6JF 5DO8A 3NSXA 2B59A 4ZQKA 5E9DB 1VGEL 1G4MA 3SGKC 1S9KC 5F7YC 3DVNB 5FC9A 2YXWA 2ARJQ 4X6FB 5JIHA 5IEKA 2CIKA 4P46D 2BSTB 4P2YA 5DU7A 5ICXB 1KCRL 4KK5D 3NA9L 5JOFA 1NICA 2CKBB 3ZKQD 3LKNA 1BZOA 2P8MA 5DZVA 4YEEA 4XHQA 4OB5L 5FYKH 3MXVL 4DN4L 5I28A 1LEGB 2ORBH 4OQ1A 2MHAB 1NOAA 3Q1EA 2PETA 4RA3A 3GO1H 4K07A 4UOW1 4R3SA 2WZAA 4JDEB 4PLJC 1I31A 4OZGF 4ETQA 2CKBL 4FQCH 2KUTA 4G6FB 5L7XL 1QQDB 1SBSL 3Q1SH 4UTCA 1T0PB 5F8QC 2W07A 5FYLD 1DSYA 2Z92B 3V7AE 2AS5M 3WJLA 4CGUB 5IQLA 3UBGA 3QFGA 3TTSA 1FH2A 4ZJ9A 1I1FA 3GPSA 4JPIB 3HFML 1AGEA 4JN2A 5CCGE 3JWDH 1JNHA 5I1DA 1E40A 1OTSC 2J5LB 3MRPB 2H0FA 4HD5A 3DUUB 1N26A 1T04B 1SYSB 1TVDA 3PGCB 4W6WB 4KUZL 1CFBA 2EIKB 4PY7A 1FZMA 4HUCA 4U2YA 3HG3A 1N3NB 5J13B 1E8YA 4A38A 1BQ5A 3FKUS 3D52A 1XZWA 2JCCE 5F96H 4KH2A 1EZSA 5IB4A 2R1XA 4KOCA 1JPTH 1RXLA 2QQNL 2QSCL 4PRHB 3V0HA 5DJAA 5GGTL 4KKQA 4P9MH 2V9RA 1FVEB 1KGXA 2G5BB 2YD2A 3RWJA 4I0PB 5H2BA 2JELL 5TQ2L 5I1CH 1CXFA 4IYKA 5IMMA 1FL5B 3NCMA 2VQ1A 3VWJA 1R46A 2TAAA 1PCSA 3X17A 1SF3A 1X5LA 2EACA 5CIPB 1WFTA 2DICA 4PR5B 4P4RB 2ARJA 3CPUA 5B39G 1MF2L 2OA9A 4WSGA 1JNNL 1EZVY 4KKPA 1FZOA 4Y4HD 1FE8H 1RU9H 5IW1B 1LMKA 4HJTA 2V6HA 1LLAA 4FKKA 4R9HA 4M7LT 2D31B 2PF6A 5FYLH 1MH5B 2OMBA 1K4CB 2V9UA 3MBEB 3QZBA 1ONQB 4AQAB 2IGTA 5HHOE 4JFQA 4BA8A 4Z9KB 2OX5A 3RWIB 1JZ8A 4X80L 4OAWA 4HW6A 4OZHF 2BSBA 2YXMA 4JY6A 4CMHC 1KPUB 2IGFL 3D2UD 3MJ9H 4YXHL 5TE4H 1XFPA 4PUBL 4U1SA 1GMIA 1UYWH 3D48R 4KQ0A 3MV8B 2BM3A 2Q1EA 4H88H 2ED9A 2X4SB 2HUHA 3VVVA 1HH6A 3SCMD 3THML 4HV8B 4JG1H 4KBPA 1A3ZA 5JHDB 4XGZB 2P24B 3VJ6A 4G5AA 4X7CC 4MMYB 1AHWB 1G7MA 1OPGL 3VXRB 3IMWA 4HZAA 3P4OB 1YPZB 2RIKA 3P3SA 3CSBA 4K7FB 2WBJA 4M4RB 1OKEA 2BDNL 2NYYC 1RK0A 4PJFF 4U7MA 2CCLA 3RKDC 1G1YA 1CE6B 4EI5A 2A2QT 4QI3A 3H7BB 5A2AA 1B4LA 3RKPA 2R2HA 4U1GC 4L1SA 4XXDB 3AQXA 3L3IA 1I85A 1YN6B 3KPQA 3L3GB 4AYDC 2Y69B 1T66C 2XN0A 2VZUA 5AW1B 1U4EA 2KL6A 3O41A 5EB9A 4GXVH 4K71B 1HH6B 1X9QA 2Q86A 2N01B 3LZPA 4KRMB 3NDYE 3QUXD 4EI0A 3C6SA 1ZVYA 4QHUA 4W4OC 2ADYA 4E0RB 3JV5A 1MFDH 3Q8AA 3PWPE 1B90A 2IFGA 5AWNH 5J5EA 1RULL 4AL8H 4L23A 8FABB 3L4CA 2QQKL 3CDGA 4HPYL 4HIHB 2XUWA 2XTJD 1RURH 2OR9L 1ICTA 3IRPX 1KGJA 2XX0A 4RWHA 1KJMB 1WFIA 3DXAA 2P5PA 1YUKB 1KDJA 4PQXA 4UNUA 4JRYA 4BFGA 2IBBA 3FRUB 5D7EA 4N1CA 2IFFH 2FZ3B 3QUKA 1Z2KA 3HMXA 4YBQC 3OPUA 2YPLD 2ZAGA 5LXVA 5ESAA 1J88A 5FLUA 4K3DL 3T8XA 3W9EA 3MBXL 1FRGL 3M17A 2WBJD 1SMOA 3LKRA 3PIQB 2BFVL 3M7OA 3VMOA 3QXUA 4OLVL 4HKZA 3VWJB 2HLAB 2HKFL 3JWNH 1Q9OA 1X6NA 1HHKB 2B15A 2PKDA 5LNGA 1JVLA 5F9OH 1E2WA 5SX4H 5B1BB 1KTJA 2B9AA 3SQRA 1PD6A 3X3FH 1QPPA 3ZHFA 1WICA 1SQMA 1EJ6A 4WWNA 2PYFB 3OKOB 5IV2A 1RUQL 2VDQH 2VAAA 1D7DA 3QUYA 4UT7L 4G2AA 1NEPA 4UI2A 3WCYA 2H6UA 3DSNB 1CGUA 3FAWA 1U8NA 3HHSA 3CZGA 2X1XR 1S3KH 1NPUA 3B9EA 3KPMB 5FLVA 1MIMH 5FB8A 3FT2A 4H2CA 2IOOA 4Q52A 4MXWH 1SJEA 3NIFF 5HPMB 3U6RA 4M7JL 4ODVH 2XPGA 1MEXH 1J9RA 4HEPG 4L3EA 4NO0B 2EP6A 2GW5A 2WKLA 3L1OL 2XV2A 1FYTB 1ND0B 1Z5LA 3I85A 5FGBC 2OP4L 4G7VL 6FABH 3QH3A 1NWPA 3ULUL 2JXMA 4W1TA 5E1AB 1AG0A 3WAJA 1OP3K 1N10A 3DI2B 2G2RA 4GJTB 5FDWB 3IDJB 4KU1A 4NDMB 1SMAA 4FMKA 3QRLA 4XMXA 3BZDA 4OZIE 1ET7A 2ZJSH 5EULV 2PXYB 3O4OC 3FO1B 5D1XB 5C0IB 4BHUA 2CCVA 4YGVB 3LQZA 3VXNA 5HGBB 1XGQB 3KYKL 4OKVA 4GI9A 2JB5L 3HOGA 2P4AB 3OMZA 2J5WA 1QLEH 2GC7C 1UKQA 1RZKC 2FJHA 2WVVA 3VFTB 2BJMH 2FECL 3NSDA 1BAFH 4DO4A 2BY2A 4H5SA 5IFJA 3IDNB 1GZQB 1SDYA 1HXYB 4FZEL 3KXFE 3PDGA 3A4EA 2YQBA 4K7PH 2BSTA 2R1YB 4FZEH 1T3FB 1JF1B 1H9VA 1RJZA 3WLBA 5KSAB 2UV3A 5DSCB 5DS2A 4YDVA 3CFKB 3WJMA 4KTYA 2OYLA 5D7KE 1DVXA 1SFDA 4PG2C 4QT5B 3VE0B 1QLEB 1ZT7B 2WNXA 5F3HB 3UO1H 3L3HB 3MTRA 4X9FA 2XX1A 8CGTA 4L3FA 1BZQK 1BQHB 4HD9A 4M00A 4MQSB 3EFDL 3CFKA 3WJMB 5EOTB 2BOBB 4OI7A 4H1LG 4RMVA 4DEPB 1DQML 2C9XA 2BHZA 4KQ3L 1REIA 3I9IA 4HMDA 4AVIA 4AV5A 4B53A 1R0AH 4UIKL 5GIRA 1I3VA 3SN6N 4Z0BL 3WN5B 5TH2B 4Y1AB 1I3GL 2GJ6D 3WSQH 1NUFA 1SGKA 5E4EC 3EFOB 4PWJA 4KHTH 1I1AC 3HZKB 2X4QA 4WUUD 4X6CF 2O6EA 1I3RA 4DFHA 4G9DB 4PJ6A 3QXTA 4HX1A 5D1XA 3HB3D 4JO3H 3SDDD 3SSGA 2DYPD 4RGOL 2ICWA 3D0VB 4WTXA 4IHOA 2XU9A 3RWFA 4AMWA 1UJ3A 4NZDA 5F9WB 5GS2D 3KNBA 4U1NA 3IMRA 3P11L 4QRPB 2AI0H 3ZX1A 1QRKA 3HAEA 1U91B 1BQHG 3EOYG 4IDJL 4KGJA 4IOSA 2X38A 5IJVB 1B0GB 3CXHK 1YNLL 2CJTA 2FT8A 3MLUH 1JPST 1RZJH 1GJWA 3FU0A 3MU3A 3OKDB 3MZTA 1A3RH 5E8NA 4D9RE 5LJYH 3VXRD 3KJ4B 3PHQA 5IQ7H 2EIBA 1LQBC 2D03H 3HG1A 1MFNA 3LEYH 3VXOB 4CJ0A 1R3LB 3GSUB 5D1QE 2W91A 2YKKA 4MA3A 2CRMA 1CDCA 1TMQA 1FNEB 3DGGA 5LO7A 5JHLL 2NUTB 1NFIA 4G70B 2X9ZA 4N8CH 3E80A 4QRRD 4NNYA 2GB2A 1O9WA 2VAAB 5IREA 1UWGH 3PUUA 3QNYB 2VW6A 3DJ9A 1JPTL 4H26B 1O7DE 5EZPA 2PW1B 2CBPA 2B39A 3NIDB 5E6RB 3V4UH 3ZHLA 2GAZA 4LL4A 3S34H 4OLZL 2HRPL 1SY6L 2VN7A 1LNUA 3IS0X 4K0OA 2VOTA 5F1IA 4LCCB 3BVNA 3ULUD 2RB8A 1MVUB 1EDHA 5ENWA 3RA7L 5LXGL 2ADJA 2FGZA 1CFNA 3W82A 4P2RB 3G5YB 2PO6C 4PB9H 2HVJB 5FKPA 1G5GA 1T6BX 1TVBA 2IWFA 4APQC 1E7VA 5C6TL 2EDRA 3T0BA 3JWDL 4JQIA 3QE5A 4JDTL 5E4IA 4NZUH 4NO2B 3DROA 4PV8B 3K3QA 4L8DB 2GHZA 4Z7WB 5FO8B 1JZ5A 1FHGA 3BW9A 3SO5A 1N7ML 3WKML 5HHPA 2WQSA 2WUCL 3MFGB 4Z3EA 5IB2B 1CI3M 4NNPH 3QG6A 4ESKA 2P1YA 1MJ7L 3LXAA 4FQXD 1BVNT 4HQQL 5AZEL 3K0WA 4LCWA 4MCYB 4CN6A 4LLQB 5AAWA 4P2RA 1T2QH 3ZR5A 3PWLB 1ETA1 5IB2A 5CJOH 2XTJB 4PBWD 5DZLA 1SHWA 3H3PL 2XXGA 3N0PB 3NMEA 4HSQA 2DQHH 5E00B 3QEQE 1N2RA 4QRFA 4O9HH 2IIJA 4YSEA 1LO0L 3CLEH 1NCDH 4B9CA 4M7JH 3EG9B 4ZTEA 4ZW3A 1WQVT 2ZONA 2R2HB 5L0QB 2EIDA 3LV3B 4ODXA 1GJIA 3HR5A 1QW8A 2ENQA 5ABZA 4JQIL 3PWPB 4Z7UE 1KEML 4S2SA 2R2BB 4UT7H 3PAZA 4UOZA 2NNAA 4LZKA 3BUYB 1RUQH 1UURA 1YEHL 2Z65C 1S5HB 4CNIB 2PWDA 4I3RL 4PJ5A 3QJOA 1PKOA 4MCMA 1NAKL 1Q9KA 4RAUA 4CW1B 5DR5L 3K71B 3GRBA 4JKPH 3SDAD 4JG0L 1P6FA 4IOIB 4Z7QE 4LSVL 5DQJA 4AZ8A 3IU3A 5IWLA 4TLUA 4AV4A 2YRZA 4AGNA 4XHJD 3RHWK 4P5TA 1NC2B 2VCOA 4Y2OA 1F42A 1PEZA 1A8JH 4OGYH 4LIQE 4M5TA 4J28A 4XN5A 4ZK8A 3US0A 4OCSL 4ATWA 1N59B 1K4CA 3HNTH 1J5DA 4J3OH 1ID2A 4HX1B 3BXNB 3H9ZA 5C0AB 1MFUA 1PZ5A 2WO3B 4H8WC 3SQBA 2WQWA 2IPKA 1N5AA 5KW9L 4QWWC 4A7VA 4HS3A 4KXAA 3V4PL 3MSPA 3PRZA 2Y3AA 1B3IA 3ZT6A 4ELMF 2NTSP 4ZW8A 3ELQA 2AJZA 1X5JA 2PWGA 4YDZA 4PWHA 2FSEB 4WU7A 3IWUA 5IMMB 2WQAA 5E6ID 3T08A 1MG2C 4LEBA 1AGFA 5EF3A 4NKIH 2JVUA 3B6SA 2N0KA 2BIPA 4PJAA 1RH8A 2DYSB 4ZFZB 4IS6A 3V55A 2WANA 3UTTD 5A16A 1E4WL 3RB5A 1M42A 2ESVE 1KSRA 5FOBA 3H9SD 5MI0C 2H8PA 4JFXB 5I5IA 2DAVA 2ZWZA 2D8KA 2DQIL 3BO8B 3C5XA 2CGZA 3AM8A 3KHQA 4OM1H 1VIWA 4N2FA 5DO2C 2X4OB 4WO4A 5DYOA 2XETA 5GRUL 3DRTA 4WO4C 3VXMB 5D1ZC 4R0LC 3GXNA 3QPQD 7FABH 1JNLL 3HNSH 1PD0A 2NW3A 1HIMH 4Z8FH 1JNHB 3RU8L 4UT6A 4MKMA 4FQ2H 2B20A 4W9HC 4X8CA 2JCCB 3B9KA 1XCTB 3FXIC 2F7OA 4I13B 4AYGA 1GCFA 2CNZA 2FATL 4GAFB 4MKTA 3D0AA 2Z92A 2BIMA 2YEZA 3E1ZA 3WTSA 4HBCH 3PDOA 4NUGH 4JCWA 4OF0A 5KSAA 4L3CB 4HLZG 1N0XH 5K1NA 3B2DC 1JDAA 4JDEA 1HIML 2EINB 2X53A 5CD3B 1TT6A 2EE3A 1U8IA 5JQ6L 5HDQL 1AE6H 2OR7A 4WLCA 3T3MF 4HUUA 1BBDH 4MNGE 4TLTA 1I9JH 1V27A 1MRDH 3RILA 2Z8WC 3GSQB 5LB1A 3M86A 1TFPA 5LBSL 5I17B 5J11C 2DQIH 4ODTL 4FA6A 5KSBF 3S5ZA 3TFKD 3B83A 1ZGLB 3LN4A 3CV5A 1N4XH 1LGVA 2WWKT 4BE6A 2WW8A 1YEKH 3U1SL 3BRDA 3TBVA 5J0BA 2HZHA 1L9NA 4MMZB 3RTQD 1HEJC 1T89A 2BY3A 1N0LB 3U48A 2WMPB 3HVDA 3ZIYA 5JW4M 1OSEA 5AW2B 5IFHH 2XZCH 1QLRB 3ZY7A 3DX9A 3VB8A 2FD6L 2BINA 2QV4A 3BZFB 4Z7UB 1VENA 1OF2B 3IDIA 4LRNL 4HUMB 5HHOA 2GABA 1NCCL 3IU3B 1KWGA 1KTKE 1ZSHA 2NX5A 4HOMA 5J8OA 4G59C 1TTUA 4UDTB 4YXLH 3PWNB 3IPBA 4Q2ZA 4PJDE 4HOWA 3H9YA 1ZY9A 5ADOH 1PJ9A 4EIZC 3TWYA 3ASOB 4JKLA 1FFPB 4JUTA 2W0PA 3F7VB 4KUCF 3NZHL 2VSCA 1Z3GH 5LCVL 4GBXB 1YEKL 5DEZA 4FFYH 2YOAA 1YNKH 2P5EE 1MXGA 2DL2A 3HR5B 3LIZL 1GYUA 2VDOH 2JJWA 2VMEA 5CIPH 2MPAH 4M6OL 2OR8A 4BV1A 2CBOA 2HT2D 4PWFA 3NRQA 3RX7A 3HZMA 5F7EH 3TO4A 1JGEA 2CLVA 5E8PA 2JKTM 3KLSA 3GJFA 4E9WA 3ATBA 1BQLH 2E7DA 5DJCA 4HEME 4JFOB 1A47A 1T83C 3OKMA 1MFEL 3L9EA 1MJ8H 4RX4D 1G7QB 3HUJE 4IDJH 5ITBH 3PWLA 1H6FA 3WOVA 4OSUH 5C0ND 3ME0A 3FHAA 2E7CA 3Q7JA 4GOSA 2QKIA 3ZHKA 4FFWD 1L9TA 1ORSB 3HG1E 4HPOL 1RV6X 4XX5A 3MUJA 1QFUL 4AMKL 3IKKA 3AUWB 4JL1A 3QUHA 1TZGH 5DC2A 3SDAC 5HPOA 1J1XL 4RGOH 2DQMA 5SWZA 1TJMA 2EECA 3U7WL 2CA3A 1XWVA 1XCXA 4JEGB 3LDBB 1KJMA 2Q0ZX 3QIWD 5C97A 1INDH 1DBBH 4X5RA 4DCQB 4KZDL 1LO0H 2NY0B 1Y07A 1DJIA 2VXQL 1BMZA 4YHKH 2UZYA 2Y1VA 1TVBB 1RZFH 1WUZA 2NR6C 2FRGP 1UM6L 3H7BA 4UTAA 1CE1H 4J8RB 1XTLA 3MMEA 3QUMA 3ENEA 1DO5A 3PJNA 2VKXA 1WZ1L 2DD8H 4PLOB 3O4LE 5DC9B 1C1EH 3T65B 5DD3L 3V4LA 3TC9A 5F2FA 2AQ3A 2I7OA 4WHTB 4MS8D 1O75A 3BFQG 3C5ZA 4JM2F 2IMMA 4U6TA 4PVLA 3OAYH 3EXLA 3B8SA 1TPXB 2K9UA 3VGFA 4RSYA 5KBKA 3IGAB 4R90L 3CSPA 1RJYA 1XHHA 3FTGA 4G5ZH 1NCUA 1NFIB 4BFRA 3MLZL 4M5YH 4DKFH 4ES9A 4N2EA 1QYGL 3K6SB 1AHWA 4NKQB 1NPJA 5JHDA 2AMGA 2FSDA 1CLYL 4PGEA 2HX9A 3SDAB 1TZ8A 3T4YB 1F6AB 4UAHA 1SXBA 1LP9A 4LKXA 4PV1C 3CFDB 2J2ZA 4LLUA 3VM7A 1U58B 4NHUB 5H4YA 1ETJA 4K5PA 4EBQL 32C2B 3EYFB 1BM3H 2D4FA 4QD2E 2OXHA 5DHYB 1THAA 5HHOD 1IC0A 3TYGH 1JZGA 2F9BT 2FWSA 3VGGA 1YMMD 4H2AA 4JY4B 3GKZA 3CZJA 1KC5L 4M03A 5L2KD 1MI5B 2NY6B 4DPBX 3EOAB 3GHPA 5D7IA 3OXRA 5I71B 2GITB 1WYJA 3QCUH 5CZRA 3UTTB 4UYPA 5FX3A 2C7UA 2ZJSL 1J8SA 2I69A 3ESUF 3LEXB 3LNEA 2OL3H 3M07A 2A6KA 4MD4A 4PW3A 1TTCA 2TRHA 5CEZD 1H8NA 4U0RB 4PCYA 4FNLH 4PGZA 2RFXB 1H6UA 5C3TA 3T1FB 1WRFA 2H1LM 4GRMA 1SN5A 2OPCA 3VU1A 7PCYA 1RMFH 4HC1H 1YEHH 3MRDA 2OZNA 1OM3H 1MCEA 2JB6A 1A25A 3FUFA 4M61B 3LKQB 1HDMA 2EIJB 4POZC 3DRQB 4XAKE 5EZIL 2MOVA 1SYSA 2VRQA 3H1ZA 3I74A 4N86A 4ZXBB 3V8CA 4OM0H 3N5AA 4XNMA 4AIZA 4M8QB 4ZS6C 4QAWA 3WY1A 5BRPA 1K5WA 3GXTA 4OZGB 4FXLA 4WTZG 5E23A 5ILTL 1ZVHA 5G2NA 1JIBA 3US9A 3HS0B 4ERSL 2X4PA 3E7JA 4GSDH 5I9QB 4OFVA 1UWEL 1RI8A 5D72H 3TH4T 1M53A 4A37A 4UT9H 3TNNA 4LDLB 1A3LL 1N12A 2JSFA 1MCLA 4X42A 3FFOA 4UT9A 1T04A 4P04A 3FB5A 4MX7B 3B43A 1NIEA 1O5DT 3BD3A 5J11B 4N8PA 5DD6A 3EH1A 4BIKA 4YLBA 3CH1A 5JORA 4OQTA 4MLSA 4I7ZC 4OFQA 3EF4A 3S3CB 4I77H 3FU7B 2VLRE 5FEBA 3APNA 5CZVH 1XF3A 3BPOC 1QSFE 3VFTA 3MA7A 3OAZH 4FNTA 4GB9A 1RUPH 4HJGB 3CH1B 1U8LA 1J9SA 4KY2A 2GBAA 5D71H 2LFEA 3IFOB 1RZGA 2XIDA 4R7NA 1X5ZA 4F9PC 4FG6D 3SPVB 2VLMD 1CPUA 4JN1L 3VSVA 4XVJH 5AVVB 4O00A 5IM7A 1CYGA 2YEZB 1UVQA 1MY7A 3EBHA 3K6NA 2BC4A 2BSDA 4NDMA 4ONHA 1BM7A 4NKDA 4MNHB 2FECI 3WDHA 3CHSA 3E6HB 1YEJL 3G7TA 5I9QC 3O3UN 3LNIA 1MCIA 1ZJBA 4HFWB 5HDLA 5JDSB 2NPLX 2GBVA 1C8PA 2XWJB 4AYFA 2QGCA 1A6UH 2YQ2A 3NJLA 4ZS7H 5IHZB 2P7TA 3ZYJA 5T1LA 4ZX4A 2KQNA 5DT1L 4KVPA 3VI3B 3OAUL 4HJIA 2FLMA 5DJZA 3SDXF 2P3YA 2VDNB 4ACTA 5FB8B 4UMGA 4GQ9L 1NGWB 3G5ZA 3OXSA 2H7WA 3C08L 5A1AA 4NHCL 1OQXA 3F6IA 4FGMA 2ZP0T 4D8PA 4F57L 5EEVA 5IV2B 1YNLH 4W9LC 3OJMB 3FO9A 3K8MA 3E9TA 2X6CA 3QZPA 4NM8H 1A3LH 4WNQA 4Q89A 5E6IC 5INDB 2O30A 1YYMH 3NAAH 3ILPA 4MDJA 5CNHA 4JQXC 5E2WH 3V0GA 4ZNCD 5C92A 4UINL 4JGUA 1GGCL 1BIHA 4K3HA 5ILTH 5IHBA 3IWVA 1IEBB 4JFZL 3RQ3A 4BZ1H 3MNDA 4HS8H 5DZ9A 4ZPVB 4HAKA 4PBXA 3QFDB 2ZAHA 5BNXD 1EAQA 4XMPH 4PJCA 4UINH 5C8JA 1Z3RA 5HYSA 3QEQB 4HWZA 43C9B 3CUPA 3QJFB 3MHZA 1X4YA 3IFPB 4JPKH 2WOBA 3OJDB 4X7SH 2M1KA 2E6JA 3B3IA 1DO6A 4B0MB 2BVOB 4HJJL 5F44A 3NCWA 1BWWA 1RJLA 1FJ1B 3IE9A 5E99L 4YSUA 4JRLA 3GTNA 3KPSE 2UZXA 5SV4A 3IJEA 3BIBX 1FUNA 3F64A 3II1A 3MO1B 1PZBA 3ZL1A 5KYUB 4ODWB 3C60D 2VR5A 1GHFH 3D09A 3BI9X 5MEOA 3AWFA 4PYGA 5L9DH 4OW6A 3FFDA 4JGJA 4TSAH 5JHBA 1OLLA 1UD2A 4OKDA 1CU4L 4X0KB 5KBNC 4YAQA 1VFOA 2P5EB 1BECA 1AMYA 2ZXDA 3LKPB 4L9DA 2DQTH 1ZS8B 4L1BA 1T83A 1IBBA 3GMOA 3VXPB 2OSLA 3O6LH 1Q0XH 1PSKL 1YA5A 4CNIA 4CKQA 5HI5D 5K69A 1YN6A 3KPQB 1FZJB 1G1KA 3L3GA 3BP7B 4GKSA 5IIEA 1CMOA 1MCRA 3LN5B 5B8CB 3BAXA 2ZUTA 3ESOA 3U0WH 2AV7B 1RJYB 2YAOA 2ZF8A 2VXTH 2Z0UA 5KVFE 1ETZB 4OD2A 2Y06L 5D93B 5DA0B 1NC4A 4BSJA 4LOEA 5CGYD 5C0FA 4TUKL 4XGZA 1BIIA 1JPEA 2ZD0A 1R17A 4IBZA 3EO1A 3G6JE 1DCEA 1K3ZA 2IH9A 5FCUL 4MJ6A 5I16B 1VFAA 2PTTB 1I7UB 2A6IB 3OKKA 1T1ZB 3FB8B 2V7HB 3PREA 4MHHG 1KBGH 1NQBA 2BK8A 3IRCA 4LLQA 2F54D 1TEYA 3G04A 1IGIH 1HN1A 4QRRA 2NY2C 2EC8A 1QSZA 4PGCB 2CHXA 5I1LB 5E0FA 4BH8B 2KLTA 2CO6B 4LOFA 1JD7A 1J9QA 2WINB 4GAYB 1S9VB 4P2OD 5KSUA 3MN8A 1ONQA 1AGCA 4OGQC 4XWOD 1QRNE 3E2HB 2VXQA 4O2FB 2NOYA 1L3NA 4LCCC 4RRPG 5GGUB 4Y9GA 3WV0A 1YY9D 3ULUC 5F88B 1P9MA 4HJJH 5HHVH 5E9AA 2VXQH 3NPSB 1JZDC 2E27L 1H3UA 1NSNH 4PJAF 3VRLE 1H5BC 5D7JC 1FA4A 4BSWB 3ILEA 1NJ9B 2ZCLH 5TE4L 1TF4A 4GBXA 2DF3A 2NLJB 5L2KB 2HJFA 1KCRH 3MRQB 3I2CH 1AD0A 1QNZH 2VTFA 3FSAA 2OTUA 2BVUA 1QFUH 4JZJB 4KNUA 5D9SB 1K8IA 1VHPA 1UWXK 5IQ9A 4NQEA 1ACXA 1E8WA 5EZJB 3MXWL 4Q2ZB 1TQCB 5FYLL 1CF1A 3L4YA 2QTVA 3LH2H 4UT6L 2DQCL 1X3DA 3Q2VA 4WCYL 4M5ZL 3FN9A 3GMLA 1BP3B 2FBOJ 1TKWA 3O2DL 2KS0A 4LSRH 5BUPA 4CAGA 1QZ1A 1WT5C 3KLKA 3WXVL 1MHHB 2H32H 4QY8A 4YL4A 1HXMA 4F8LA 1WT5A 2OL3A 1FGNL 1EDQA 2WMPA 4HIPA 4GKOA 4KOBA 3I6SA 4OV5B 3O0RH 1VFBA 2B5IB 3GI9H 3US1A 1WH0A 1M56B 1KLGA 3ARFA 4FQPA 3SZ6A 3VVWA 1QFPA 5CD5D 5DA4A 3IDIB 1F58L 1OD7A 4FP8L 5EWIH 1NEZB 2Y1YA 3OHXA 2ADIB 2DB8A 3QWOB 1KYOK 1F1DA 1I3UA 4M5SA 4EDWH 1ED3A 5IUSA 4LSQH 4PVNA 4W6XB 1FG2B 2ICWB 3D0VA 1LE9A 4NRYA 5ID1B 4OUUA 4UM9A 4DH2A 2AVFA 1J8HE 2DQUL 1M9SA 2DTMH 4TYUA 1IZKA 3CFBA 3QDAA 5IK3B 4LVEA 1GR7A 3AQYA 3K1KC 3LB6D 3QEHB 3BVDB 3OX8A 3EH4B 2XG5B 4X8GA 4S1RL 1UUNA 5C0JB 3L2MA 4RQQB 2JCCA 3B9KB 2X28A 4ONGH 4Y4FA 1U8IB 3QC6X 4I77L 2E0PA 2YSSB 3BWAA 1IU1A 3I9GH 3KYMB 1IKFH 3BQUB 4NNXA 1FLRH 2P28B 1IAOB 2HFEA 2Z31A 4S1QL 4U6HA 3T6XA 2G5UA 4PWGA 1FFNB 3EBIA 4KK6D 4WIQA 3M88A 2BOBA 3VA2C 4RGNB 1MWOA 3BSZL 3RIFF 4ZNEA 3KR3H 4N2BA 3MVSA 1MQKL 4Z7QB 3QUMH 2V8LA 3MV7E 2ZYHA 1V05A 2XTSA 4QHLB 5F3HA 4UT9L 1LK3L 2WAQA 2O61A 2AANA 5GRXG 5B4MC 2F7PA 2HPOA 1TCRB 1UYWL 4G43B 2F53D 1RHFA 5FOBB 1UC6A 4CSPA 1FFRA 4TNFA 4PTUB 3G5VA 3M7FB 3FU6A 4KXZI 4FTVA 4NNXB 2ZCHH 2FBJL 5HP5A 3FTYA 3MKKA 2CR0A 2DWTA 1YN7A 2JI3A 1X4XA 1GOFA 4F24A 3EF7A 1ROCA 3QEQD 3IJHA 1W0WA 2NY7L 5D2NE 1P7BA 1F8TL 3IM1A 5IKCA 4LCUB 1FFOA 3OMNB 3WUWG 2CRZA 4O4YH 1MFCL 3N2JA 4DGWC 4JO2H 1JL8A 2GJ6E 3IAPA 3SQBB 1D5BB 1WFMA 3CFJA 3RE0A 3MCG1 5T5NG 1UXWA 2EC9U 4QDGA 1I4FA 1FG2A 1LE9B 4P4KA 1UB6B 3LIZH 1FPTH 1NDGB 2IBZX 1N59A 3A3YB 2HFFB 3SE9H 3F65A 3RNQA 1VACA 1D5IL 2UXFA 4GG8A 2LHAA 4K8RD 5ACZA 4GSXA 4HBQA 2HN7B 2IGLA 4TQ8A 1EJFA 2ZOLB 1FZKA 1TR7A 1QP1A 2G3ZA 1FL3A 4ZO6A 3MREB 3TYGL 2P47B 1JZ4A 1U8HA 5DFAA 3EYVA 2Y5TB 4N25A 3U46A 5IMLA 5JYMA 4R7DA 4N0CD 3RZCC 2R56H 4LHUD 1T0NB 4NFCA 4X7TA 2EEAA 2GSIB 4HALA 4E41B 2X2IA 4TRPH 5HPMA 1MRFH 1BYOA 2XICA 3AWGA 3A22A 4JAMA 4JFEA 4LBEB 4Y4KB 3FT2B 4CC0A 4OBRA 5C6PB 3WD5H 5JHMA 1JXKA 3PAVA 1E8ZA 2XA8L 2IPUG 4H0GA 3SBWA 3OHXB 4AG4L 1QHPA 4CILA 2R39A 4Y5XA 4HUVB 3WU1A 3V79C 1PX3A 2LABA 4EI6A 1ZK5A 4R4FH 1CD1A 2R2EB 1MCWM 3ABLB 2F74A 3DO4A 4O02B 2Z91B 3L1EA 1E9PB 4L9LB 2LAAA 2J1KA 1D5IH 1XO8A 3FZUC 3KLQA 2JK5B 2JWYA 3WFEL 1HHKA 1F1GA 3BDYH 3E3QC 5JNYA 1BD2D 2Y9RT 3D25B 3SJVE 4IRSD 2OTUB 1JCVA 3E0GA 1W72H 2BP0B 4Q0XL 3LVEA 1AQMA 1MW1A 1ZHLA 3VXRE 3LX9A 1NMAL 2Z1KA 4FF9A 4KZCA 4EI5D 1AE6L 4NEHB 2XTJC 4XPBL 3BEVB 2VERN 3UTTE 3W1ZA 1RHHB 3F7RA 4WO0A 3P30H 4DKDC 5BO0D 4B96A 3BH4A 4OLWL 3MXVH 5BO1H 5AW8B 3S6CA 1F4WL 3SKUD 5DWUL 1BQRA 4PV8A 4Y9CA 5I1HH 1OHZA 4ZT1A 4POZD 1FI8C 1KGWA 3GSXA 3R0MA 4OFPA 4W6YB 4LLWA 5GSRB 5ABAA 1F3JB 3V4PA 3UAJC 4APQD 2L04A 2E7HA 4LVHB 1MJUH 2Y72A 3TT1L 4BSWA 1R3KA 4ZUSB 5C6WH 2WLZA 1VCBC 4GLRI 5BO1L 1Z7JA 4N6RA 1GZHA 2BS9A 3O9WD 5C9JB 3L4UA 3Q6GL 4KK8C 1E9OB 3NACL 4WV1C 3C5ZD 1NKGA 4F3FB 3EO1B 5DJYB 3FYIB 1LNUB 2E6QA 5KSBB 3BUDA 4R2GD 2F1AA 3HG5A 1CZ8L 5AZEH 4M1GL 1KENH 4JRYD 2OK0L 5K9QG 4GG6F 5GRVL 2C9VA 2ZXEB 3DV4A 3IDGB 2CMRH 1YZZA 1HCFX 1YECH 5EU7E 4APQA 3LZFH 3AQDA 3DJTA 4WEUD 1DQKA 4I1PA 4JS7A 5T1KA 3VD5A 2D0GA 3HR6A 1SVCP 4JDTH 2WN3A 2D7TH 1BFVL 1A7NL 2YPLE 2J6EH 3PHAA 2WYTA 4QOKA 2V7NB 4R4BA 2PPCA 4WENB 5T1MB 5F1IB 1GYWA 5JNYB 3QHZH 1DANT 3QIWC 2DTML 3RY6C 4I2XB 1GVIA 2XVKA 1T80A 1A0QH 1DJWA 1IB5A 4B9FA 2XOTA 3KJ4C 4P2CG 1NEUA 3HC4H 3GEFA 1IJNA 4XT1C 1C5BH 3PPSA 2AJYL 5I2IA 2C5DC 3L1GA 5CS7A 5CHNB 4TSCH 1MCFA 1BZDA 1UASA 4OAWB 5KYWA 4P2QB 4RX4A 1CDBA 4OZHA 4LOUC 4ZPTA 1OCWL 3QZWA 3ULVE 3F62A 3L5XH 1UWGL 2G4EA 3DGCR 2D7NA 5AOKA 3OKLB 4PGDA 2VDMB 5CSGA 2X1PA 3K6OA 4LU5L 5TE7H 2JQZA 2BLFA 2QT6A 5JPMC 2UZIH 1MY5A 3ZKMD 5FA4B 4ODWA 1I7TB 1NINA 2JCCF 1DJGA 3PU7A 4W9GC 4I0PC 3LNHA 5LKNA 4IDLA 5JMOC 1WD9A 1MLCA 5T3XH 2DQCH 5F7WC 3ZMEA 2DKUA 5MENA 3VFGL 3S88L 3VXTA 2L7EA 4FQLL 5IBTL 4HWUA 3W0WB 5FFOA 4EOWL 2RTTA 3GSRB 4HWZB 2XVGA 2CIIB 4N24A 2XQBL 2XACC 4JM4H 3DX7B 1OAKL 2FGWL 3G6JB 4LT7A 1QUNA 1P4LA 5DRXA 1GOGA 2XFGB 4NZTH 3LXBA 1OO2A 2GJRA 5T5NF 1WFUA 3UGXA 3VGBA 4HIJB 3L9RB 2GYSA 1CFVL 2DEWX 1SOSA 4TNGA 4AW7A 3QXDB 4DOHE 2F5BL 3LTVA 3CBKB 2BNRE 4ORGB 4CDGC 4XVTH 4TTDD 2O5YH 3B7YA 3DUUA 4MQ7B 3OGOE 3WLBB 2VRKA 4F92B 1WIPA 4GKNA 1TXKA 3B37A 5I1JH 3FUNA 3IJSA 5JLZA 5I24A 5EOTA 1UTDA 2UX7A 2A83A 3UG3A 4LMQE 1YEIH 3L4ZA 3STZA 3BYTA 2D2CC 1OGAB 4Y4FC 1DBAL 1K3IA 3L95B 1FLRL 3QIUC 4DW2L 3GDCA 4XMWA 3DA0A 4KVCH 5MEPA 4JREB 4EQ2A 1EV2E 3HB3C 1HKLL 1N64H 4FTVD 4OF5A 1UZ8A 3DETD 4NQDB 3S5YA 1C9SA 3AG3B 2MTAA 3HN5A 1TJIL 1CIUA 1O7SA 4JFVA 2QVMA 1F2XK 5CILH 3O4OB 4P2QE 4YMPA 5ICZB 3L4VA 1HAWA 3MR9B 1Z9OA 4XPAL 2H1XA 3KWVA 4XPTL 3PV6A 5AKSA 3WEOA 2NNRA 3GSOA 4IU3B 3NQKA 3AU1B 3UBHA 2PNDA 1KELL 2XZQH 3BZ4A 4CMMB 2NY5C 3OGCB 3RP1A 1SUHA 4ZUWB 4MBRA 1NGZA 1TITA 1IGCL 4AGLA 1SY6H 1OAZL 1T7WA 1W0YT 4PJ5D 3O45A 5E56A 3SBPA 4DGYL 2BJML 3EKCA 2NYZA 3F04A 3Q8FA 2QKSA 2WKOF 4JHWL 1IM3D 5KBLA 3MA7B 4RFNC 2XKUA 4WO4D 5GXBB 3OG4B 1XF3B 5GZND 4U33A 2WLKA 1JZ7A 2D0FA 1IGML 3S5LB 5JHLH 3TZVD 2VE6B 2KDYA 3AG1B 4CKVX 2VJXA 1DVFD 3B3BA 5CN3A 1GHFL 1A2YA 2X2YA 2WLYA 5JW4R 1ZDQA 1AZCA 3RWDA 1NBVL 5BOZG 1K2DA 3L8QA 3GTVA 2PTVA 5LGJA 4OI8A 4O4YL 1KLUA 3QBTB 3F7KA 2FJFB 3WNPA 4WKXA 1DEEA 2HCZX 3P9MA 2VIRA 1PFOA 2IVFC 4NN6B 4JMNA 1CB4A 4J8QA 3SYCA 3RWEB 4YWGH 5ESAB 4P2RE 2P80A 1QR1B 5F0PB 1UCBH 2Q8BH 2QL1A 4IKLA 2AABH 1ET8A 4NBYB 1HHGA 2HLAA 1KCUH 5BV7C 1KXQA 4NP9A 4PRPA 3ZDZF 4QRPD 1OY3B 4NM8L 1SMDA 1CICA 3OJVC 3K2UH 3X12B 3TEZA 4MA8H 1KB9J 5IR1B 4PJXE 8FABA 1B2YA 4KROD 3U6XA 4KPHL 2HKFH 1U58A 1IBYA 3GMPB 3TNMB 1LP9B 1VKXB 3LEXA 4XH2A 4FXKB 2CM5A 3TONA 3VGAB 3O4LD 4A7GA 3PNWA 4FULA 3CE1A 4PI2A 2IADB 2X4NB 5C0DA 2HKHH 1MRCL 2CJUL 1J8KA 2IFFL 1ODUA 4WV1B 5I8OH 3HZYB 1Z9PA 5KJRH 1A7QL 4AC4A 3LYRA 4NXSA 3ZE1F 2V2TA 1EFXA 4A2MA 4N0RA 2I9TA 1XT5A 5F7AA 3V0WL 25C8H 3FT9A 2V8MA 3FRPG 5KTEH 3MNVB 4FXTA 4J23A 2FO4B 4YVUA 5GHWH 4KV5E 3MJGX 1A1MB 3FS9A 3MLRH 2Z1PA 4MA7H 1JZ2A 3NZUA 2VM4A 3IGAA 5E5MB 3R8QA 1M7XA 3OLGA 1EA9C 4YHMH 1KBWA 4XN8A 1AZBA 3RJQB 4U1KB 2P43B 3BPLC 3EJRA 4GXVL 3WFDL 1I85C 5D7LD 2RGSA 3VH8G 5DC4B 1A7OL 4XCFL 5CWSA 4GKSB 4FL4B 3PHSA 1HOCB 1OSPL 3VXPA 4FKEA 3ARSA 1DFBL 3BAKA 4X5XA 1FGNH 3EOBB 1U41A 1S8DB 5D1ZI 2COVD 2P5ED 1O7DC 3QULA 1JK9A 4MRCA 4LNRA 3ZKND 1XGRB 4BWTA 1SHXA 2KZWA 3OSKA 4RMSA 5E6UB 3FO2B 1D5RA 4DVBA 2YJQA 4K94L 3RYMA 4Z77A 1A6ZA 2VLKA 4PJFB 3LH2L 3OZKA 5AVYB 3QJTB 4PBVC 4XP6H 3RURA 3TJHD 5SWSB 5DS1A 2OMUB 2UZXB 1KY7A 3GJFB 4X98B 4PUBH 5CGYC 4QMEA 3BJ91 1O9VA 3WGVB 4XMPL 4K2UL 4FXKA 2L7QA 2N7BA 1VKXA 1QG3A 4IJ3C 3KWWA 3V4VH 1AI1H 5KSBE 4YEFA 2MNUA 2XQYA 1AD9B 4DP6X 4JHBA 5L88L 1GMEA 2UUDH 3TV3H 3OKNB 3B9VA 2R1XB 3L3KA 3BSZA 1M6OB 3HRZB 3J2PA 4UANA 1NANI 2C4FT 4E41E 4HOXA 2QV2A 5DFTA 3UBXA 3PWPD 3QZNA 4A7TA 2VW4A 3PXJA 4UTBH 4YHNB 1IAIM 4XP6L 1HEZB 4G9FB 5JZ7D 2P8LA 1SDDA 5CR1A 3VGAC 4WK4B 1UD3A 4UTBA 2H0JA 8PAZA 1JMXA 3B1TA 3C8DA 4QRTB 5T3ZL 5F3BB 4XXCC 5LGJB 3Q0HA 2V5MA 5CCKH 5H2BB 3NCBB 2ZSVA 2PP9A 1R0AL 4JFDD 4XO5A 1E28B 3ZMRA 2C3GA 5CEZE 4F8PA 4W68A 5I1DB 2Z6FA 4XCCL 3MRLA 5IB4B 3KJ6L 2GQHA 3LZQA 1WFJA 4LARL 5D6DA 1KBGL 4YHLH 4K7PX 4L5FL 3VFMB 1OB0A 4X8JB 1UFGA 3TBSA 4M48L 4RMUA 1UM5H 7CGTA 3QUZB 1AZNA 2NXZD 2D7OA 4OZFA 5J12B 1BLIA 1XTMA 4DQOL 1AMXA 2FT7A 4EZLA 4AITA 4MS6A 5DZJA 1DUZA 3MRPA 2HRHA 2Q5BA 5TDPA 3MGOB 3FU8A 25C8L 2Y7QB 4EUPA 1XB8A 2DDQH 1ZLWH 5JQIB 4IU3A 5AENA 1O9ZA 1WCBB 1ZVSA 2E6PA 2DTSA 2OMTB 1FSKC 1G6RB 4PJ8D 4PCTA 3S2CA 3EOTH 2FO8A 2MJWA 2VLLB 5G5DA 5IB5B 3PABB 5SV3A 4WI6A 2MIZA 4GG6B 3ZE0F 2HAZA 4RGNC 4HT1H 1D5BA 3CZKA 4Q97A 1GAFL 1UWYA 4H1LA 4LIQH 5T1DL 1KIPA 3BN9D 4TULL 1XGUB 3P4MA 1FYTE 4RISH 5LG1A 2KQMA 1RPUA 1OGAA 5L7XH 4NQUA 1NKOA 3IBEA 3T09A 4NQCA 1PNDA 4WFHD 4PJDF 5JIKA 4LQFH 3TVMD 4UU9B 3U9PL 2GK0B 3V0JA 3EUUA 5ICXA 2WB7A 3GIZL 2V37A 3BKYH 4P5KA 1H3PH 2MTPA 2AJSH 1INDL 1DBBL 4N0UB 4Q8BA 3R1GH 5EBGA 3TIEB 2X40A 4PFEA 4EO5A 5E9DA 1ILSA 2HT4D 3ARDD 1X5KA 2YJLA 2YO3A 5JIPA 3IPEA 1S3KL 2BS71 4L37B 1U93A 4X80H 1XZ0B 2FGWH 2R2CA 1YY8B 3GRWA 1Q72L 4KRNA 4QJ3B 3T6WA 1DDTA 2NXYD 3GB7B 3FH8A 4DP4X 1DVFB 2WB1A 3G6DH 1VEOA 1M71B 3PQYE 2DPKA 3DXAD 1LM8V 5DMKB 2WCGA 4Z7OE 2Y2WA 2NY4D 2NUPB 1HKFA 1JGUH 1JPGA 4U6YB 1A7PL 3MJWA 5F9OL 4XCNB 2B5IC 3L7EA 1DN2A 4I3GA 4Y16C 3VQMA 4AJ0A 2AJZB 4NQVA 1A9BB 1CDGA 4RNRB 5AZUA 1AR1B 1H9DA 4JVWA 4JFHE 4Y1AE 1QUNB 3WXWL 3T1FA 2BRRH 1HX0A 5K39B 1OAYH 5DLML 1NOLA 3FH7A 2B4CL 2Z4QB 4YBHA 3VXTB 3ZIMA 1KB5B 5J6HB 5J1SC 1UH4A 3PJSA 2WLLA 1WLHA 2P46B 3MV01 3HG4A 5EORL 5F7NC 3NZ8A 1BXAA 2VZ1A 1NA8A 2J88L 2X4TA 2A9NH 2OJEA 3FQRB 4XXWA 3HAEH 3QQ4B 5AG8A 1T7YA 4H8QA 3T4AC 5AW5B 2LTQB 1NEZA 3MRKA 4AK2A 5T3ZD 2GHWB 3EGSA 3NABH 2ESVA 3OR7A 4G8EB 2QEJA 5J56B 3OKLA 2VN6A 3SGDH 3IBOA 5D6CA 5IVXF 2XZCL 1ACYH 2XVBA 5C0EA 5D71L 3ZRFC 1U8OB 2M83A 4A7SA 5I1KL 2Y1ZA 2H6PA 2C9PA 3IAQA 1JHKL 4JHAH 3SKMB 1OAXH 4G3YL 4UBDC 5H37H 1LDPL 1A14H 3FOLB 4KGLA 3U0TA 2QPSA 4QHKJ 2CMRL 3GQFA 3WLWC 1XGTB 1RK1A 4JPQA 1J8RA 5A2CA 3TA3B 5LGYA 3WKQA 3RDTB 1PTZA 4BELD 1E5AA 1RCYA 5GZOA 3APFA 5AAWC 1DJXA 1YEIL 1DQJA 1WS7A 3IJ9A 1HHHB 2YAQA 4Z23A 3K2UL 4E36A 5DHVA 2IH1A 4GSQA 2ZG1A 2EABA 3DVFA 3NACH 3NG5A 3MCKB 4H25B 3ZKSD 5ES4B 2RR3A 4NKOA 3CK0L 1XQ4A 4KTEL 2YUWA 2R2BA 1AZZC 1T5XA 2Q3XA 5J9PB 1YMHB 1BJ8A 4ZFOL 3IEAA 1N19A 2UZYB 4FRWA 4S1DD 5A3IC 3OB0K 1NIDA 5HHPB 1XIWD 2FATH 4XN2A 4N6QA 1S7UA 2CGRL 2F7QA 1L9QA 4PP1C 2YPKB 2G9KA 5IGXL 4MB3A 1UENA 4HHWA 4F3FA 3ETBF 3SQOL 2W9EH 2ARWA 4PRDA 3VXSE 4FX5A 3OAYK 1G9MC 3T9WA 3S0PA 3BEVA 3QDGA 3QEGL 4M6AA 4NQXB 1CXLA 1M2VA 2D73A 2XKNA 1HK6A 1M6UA 3CSTA 4YBLC 3UG5A 2QDVA 1D9KC 3BW9B 4YBQD 1BXVA 2GTZB 5DI8A 3QDJE 2DV6A 3BDYL 2PCFA 3A4FA 2HJKA 4O58L 1S7UB 1YQVH 1H3XA 4FJ6A 1O6TA 4QNPE 4PS3A 4NZFA 3VFPB 3IXAA 1MZYA 4FXGC 4TSBL 3FQYA 3S97C 2NXZB 2ZX8A 4NO5B 3QI9B 5I8EB 5LUMA 3A4DA 3FTVA 4G9FD 35C8H 2WM0A 2X1WL 5I8KH 4ZUVA 3KL3A 1F86A