2FWLB

The cytochrome c552/cua complex from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
134
structure length
134
Chain Sequence
b'YTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c-552
publication title The electron transfer complex between cytochrome c552 and the CuA domain of the Thermus thermophilus ba3 oxidase - a combined NMR and computational approach
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport/oxidoreductase
total genus 30
structure length 134
sequence length 134
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2006-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2fwlB02
1QNIA 2YAPA 3PXLA 2QDVA 2HRGA 3V9EA 1NZRA 2IAAC 5B7MA 1F56A 2Q9OA 3MBWB 4HCGA 1L9OA 1VLXA 2NRDA 2P80D 3T6ZA 1AZUA 4E9VA 4G7QB 1KBVA 2H47C 2VN3A 5I6PA 1N70A 1WS7A 4YSPA 5B1BB 2WSDA 5F7BA 3FQ2A 3NJNA 3KW7A 4RH4A 1HFUA 2UXGA 2IDUA 3NJKA 3ASNB 3H56A 1SDDA 2IDFA 1A4CA 4DP6X 1J5CA 1KGYE 2AANA 1BYOA 4DPBX 2BP8B 2IDSA 4AKPA 4FA7B 3FQYA 2AVFA 3NT0A 2XUWA 1JXDA 2GC7C 4KNTA 2PPFA 3BVDB 1IUZA 2R7EA 1OE3A 2EINB 1JZFA 2VM3A 4YSRA 2HRHA 3TASA 4UAHA 1WA0X 4EF3A 4YSTA 1AZRA 2QT6A 2I85A 2CAKA 1BXUA 3FU9A 1AQ8A 3BQVA 1NWOA 1W6WA 2ZOOA 1SDDB 2J57A 2VMJA 2IWEA 2HX7A 4G72B 2DYRB 2J5WA 3AG1B 1JZHA 1SJMA 3G5WA 1BXVA 1OCOB 3UAEA 3X2QB 4KNSA 5I6LA 2UXFA 4PCYA 1QHQA 2N0MA 1BYPA 2GIMA 1NINA 2R7EB 2W8CA 4BWTA 2BZ7A 1KCWA 1JVLA 2BP0A 5B1AB 1MG3C 2IH8A 4E9RA 4YSOA 3TA4D 4JHUA 5ANHA 4HCIA 1SF3A 3ABMB 1OE1A 4JKNA 3X1BA 2BW4A 2GB2A 4DP7X 2BW5A 4TXVB 1OF0A 5E9NA 1V10A 5D4IA 2BZCA 5F7AA 3S3CB 4E9TA 2XLLA 2GC4C 4DP9X 4A2GA 2QPEB 1IC0A 1N68A 1QLEB 3FYIB 2JXMA 5PAZA 1PZCA 2MRYA 2BP0B 2VM4A 2TSBA 3NSCA 2UXTA 1OCRB 1FFTB 4WKXA 3NJMA 1PAZA 4BWWA 1HAUA 5D4JA 3OMNB 3AG3B 1L9QA 4DP5X 3TU6A 2ZONA 1AIZA 5B1JC 3FPYA 3FSZA 1ZDSA 4FAAB 4GXFA 4DP0X 3PLYA 3GYRA 4KO6A 1TU2A 1OCCB 1L9PA 1A8ZA 4KO5A 1BAWA 2PPAA 3MX0B 1GYCA 2FJSA 3WI9A 1CUOA 2BWDA 2PCYA 4HIPA 3IBOA 1GS8A 2TSAA 2YAMA 3T6WA 5I5MA 3X1GA 7PAZA 1J9TA 1J9SA 1MZZA 1ET8A 3NSYA 2CBPA 4Q89A 5AKRA 1TKWA 3WNIA 3X1FA 4BDVB 3EHBB 3IN0A 1NDTA 3CG8A 3OMAB 4X4KA 3FYEB 2OV0A 4KO7A 4KOBA 5TK4A 2ZXWB 2QDWA 1SHWA 3PAUA 4W9ZA 4HAKA 3H4FA 2BP8A 2DYSB 3NJJA 2FTAA 2PPDA 2E86A 3KW8A 2H3XC 2DWSA 4CSPA 2DV6A 4YSAA 1AOZA 4BXVA 4QKTA 3EH5B 1SFHA 2AFNA 2CALA 3NJHA 4DPAX 3S3DB 2CUAA 1ADWA 3CZUB 4CSZA 2YAQA 4DP1X 4G7RB 4WTQA 3C75A 1RZQA 3T6XA 3U25A 2FQEA 2B08A 3NJIA 3X1NA 1CYXA 4F7KA 4A2HA 1MDAA 3WG7B 2YARA 5B3SB 1ET5A 1BQ5A 1JZIA 2FQDA 2YAOA 4E9XA 2IWFA 1A65A 2PLTA 1V55B 2XYBA 4M4RB 1URIA 6PCYA 2W88A 1AR1B 4GP5B 1A4AA 1DYZA 4ZK8A 3NP3A 1NPJA 1AZBA 2P80A 1NIEA 2GSMB 3RYMA 1WA1X 2HZHA 1I53A 1EZLA 1NPNA 2FT6A 3EH4B 2HXAA 1ZDQA 4G70B 3QJVB 1SFDA 4BWUA 3ZIYA 1NIAA 3IE9A 4E9YA 4HHWA 4ENZA 1OCZB 1JOIA 4YSCA 1CURA 4F2EA 3FU7A 2IDQA 3ERXA 1W6LA 3FSWA 3CVBA 3HEIB 2EIKB 1PLAA 4GY4A 1M56B 1IBYA 1AAJA 4E9SA 3FT0A 1KDJA 4UF7C 3SBRA 4A2FA 4N4YB 3QQXA 1ASPA 5I28A 1TEFA 1ASQA 2OJ1A 3ABKB 3UAAA 2IDTA 3QJUB 1GR7A 3CDZB 4NB7A 1NIDA 2FWLB 4HZ1A 3UADA 1TEGA 3DKHA 2I7SA 4P5RA 2DY2A 3FU7B 7PCYA 2WO3B 2AZAA 2FNWA 4GP4B 4YSQA 3ZDWA 1ZIAA 1ILUA 1AG0A 1KBWA 4A68A 4Q8BA 1OV8A 2CJ3A 1J9QA 1PNCA 1WS8A 4BDVA 2PCFA 4NERA 2EIMB 2HLEB 4A2DA 3N2JA 1AS8A 2Y1AA 5EHFA 3CVDA 2GI0A 1NIFA 3NJFA 4GYBA 1KYAA 1AACA 1NWPA 2FT8A 2XX0A 1BEXA 4A66A 1GW0A 2GBAA 2CCWA 2IWKA 4GP8B 4KNUA 8PAZA 1BXAA 1PCSA 1PLCA 1PY0A 1FA4A 3PAVA 2DWTA 1SNRA 2FT7A 1B3IA 3WNJA 2B3IA 1WAEA 3FPXA 2BHFA 1E67A 3TBCA 4BXSV 1JZGA 4DPCX 1JZJA 4BK5C 2PP7A 4QLWA 1L9RA 3FSVA 6PAZA 3PCYA 1X9UA 3ABLB 2BO0A 2XU9A 3D12B 2UXVA 4AKQA 3PPSA 1XB6A 1JERA 1DZ0A 1E5YA 5I6OA 3AG2B 4N8UA 1IBZA 1RZPA 3AY2A 2XV0A 5TK2A 3S8FB 4PAZA 2PP9A 3FSAA 1PMYA 1RCYA 3PAZA 2UX7A 2PP8A 5LDUA 2AZUA 2WO2B 2X87A 3H4HA 2YAFA 1KDIA 5D4HA 3FU8A 1AS6A 2XXFA 3QJRB 2H5UA 3OMIB 3SBPA 2YQBA 1NIBA 1NICA 4HALA 4AZUA 2GHZA 2EILB 1A3ZA 2UX6A 1BQKA 1AS7A 3UGEA 4MFHA 1FWXA 2JFCA 1XB3A 2XV3A 3SQRA 4YVNA 3WKQA 2EIJB 2I7OA 1MZYA 4G7SB 1YLBB 2YXVA 4UANA 3UABA 1V54B 3X1EA 4AKOA 4W1TA 1OE2A 1ZPUA 1GY1A 2MTAA 1NTDA 3ABGA 1IKOP 1E30A 2VW7A 3N55A 3NSFA 4YSUA 4DP2X 1ZIBA 1ZV2A 1X9RA 4M3HA 5B7EA 1JZEA 3NSDA 2XV2A 3CDZA 3DIVA 3T9WA 1BQRA 2BWIA 3JT2A 3CVCA 4YSDA 5I26A 3FQ1A 1ET7A 1CYWA 4K9JA 1AANA 2X88A 1JVOA 4E9WA 2J56A 2XXGA 1J5DA 1GSKA 3AG4B 3QJSB 5B7FA 3S3BB 1KV7A 1GY2A 3SBQA 3JTBA 1PLBA 2Y69B 1E65A 2PPEA 3S8GB 5AZUA 1J9RA 4YL4A 1SF5A 2YXWA 5I5IA 1L9TA 1HAWA 1CC3A 5FC9A 4E9QA 1A4BA 5IY5B 4DP8X 4A2EA 5A7EA 3IEAA 2HX9A 5B1KA 3QJTB 4G71B 3NJLA 1UATA 3QJQB 3WIAA 2A3TA 3QPKA 1ILSA 1M9WA 3GXUB 1L9SA 3NJGA 3AZUA 3FS9A 3WKPA 1R1CA 2FQFA 3NP4A 1MG2C 4L0PB 3UACA 3L45A 1T5KA 2J55A 4F2FA 1PNDA 2XVBA 2ZWNA 2Q5BA 2LLNA 2YAEA 1E5ZA 1GS6X 5I6KA 1PZAA 1XB8A 3NYKA 3OM3B 5I6NA 1SHXA 5B1JA 1XMEB 4KOCA 5I6MA 4A67A 3EH3B 1AG6A 1GS7A 2VW4A 4AX3A 2OCCB 3OD3A 2RACA 1ID2A 3AW5A 2HX8A 4HHGA 2IH9A 4YVUA 3DTUB 3GDCA 3HB3B 3IN2A 3T6VA 2VSKB 2VSMB 2XX1A 5AFAA 1PZBA 1AZNA 3OQRA 1M57B 1OOWA 2FQGA 3EF4A 2YAHA 2XWZA 2QPDB 1KCBA 4KO9A 9PCYA 3T71A 4NAJA 2JKWA 4YSEA 2PPCA 3V9CA 1ETJA 4P5SA 3TBBA 4DP4X 1RKRA 1JXGA 1AZCA 2VW6A 4JHVA 4YSSA 5I5JA 1ASOA 3ASOB 3ZBMA 4AI7A 1WA2X 4HCFA 1EHKB 5PCYA 3ZX1A 1PF3A 1W8EA 1JXFA
chains in the Genus database with same CATH superfamily
4QXVA 3GPSA 5B7MA 4H0HB 2VMCA 1U2CA 4HJ0C 4LHUB 4YHKH 3KLHC 1AZZC 4FRWA 3V4PH 1L6PA 1SXCA 1UM6L 3WY2A 4I3SH 1P9MC 2F58H 3O4LE 2HT3C 3NFNB 4ISVB 4HUCA 4RH4A 4TQPA 1IGJA 3BHBB 3IYLW 4UT9A 4JO2L 2IDFA 2CDFA 4Z7WF 1KGYE 3BSHA 2IAMB 3MLYL 2XQYK 1BYOA 1MRCL 12E8H 2BP8B 3MLSL 4FXKA 2E8ZA 2Q76A 4MWFA 1HINH 4YUEL 3V0AC 4AENA 2VAJA 3OWEA 3BVDB 3CH1B 3HZVA 3MPCA 4K3DL 1CFBA 1FCGA 1UVQB 1JZFA 3OR6A 1J0KA 4WI6A 4XWOD 1J5IA 2WNXA 1BF8A 1QPPA 4HWEL 4CU7A 1BXUA 3UGUA 4GUCA 3NRQA 3OXSA 4Y5VA 5SX5H 4BKSC 2OAAA 1GTNA 3GKWH 4QY8B 2WTPA 3VO0A 1VACA 1W6WA 2C7FA 3NDYE 4I5BA 4YR6A 2VMJA 3ZKND 3DLQR 4L3CB 3CFDA 3HG1B 1QUNA 4KJYA 3SBWC 1OCOB 4F33B 4NUPA 1J5OH 1HQ4A 2OP4H 1OK0A 1U21A 4OIFA 3MCLL 1EDYA 3WJLC 1A47A 4L3FA 2C9QA 2HG5B 1F90H 2MQ0A 3C60B 5LGJA 1Y07A 4Y0GA 4YFDB 1MG3C 5T3ZL 1J7VR 1G7MA 3MCYA 3TA4D 4L29A 1MCPH 3FUJA 4HCIA 2AABL 2QADD 4NP4H 4IU3A 5DMGD 4Z7VA 1BD2E 1Z66A 2D73A 4M3KB 4QXTA 4MSWB 1XGUB 3CDFA 5GZOD 5HPOA 3VJ6B 1T22B 3QNZA 4ODVL 4MZRA 3NFSH 2G2RB 4KK5D 4V2CB 4XPTH 4JEGB 1KB5B 3S7GA 1DSFH 1IC0A 4KQ3L 3FQTA 5CP7B 3BZEA 2KDGA 5I5RA 1A5FL 1IGFL 3UJJH 1ESOA 3SO3B 1T1XA 2XRAL 2ZAHA 4RAHA 3QE5A 5CGYD 1FFTB 3ZYOA 3CFJA 3OMNB 43CAB 4OJCA 1KTLB 2BSTB 3KL3A 3U7WH 4XN1A 3DUSB 3UCRA 1WWBX 4GKNB 2MPVA 4GRWE 2CHDA 3EJPA 1RPQA 2OMTB 2WCPA 2J88H 4OJFL 2DJMA 1JE6A 1BFTA 2CMRH 2AK4B 1UH3A 4R5TA 1OCCB 4HULB 2ENPA 3DJZA 4YHMH 1CXHA 2VQTA 2WN3A 2G3XA 3ULVC 3QQ9C 4XP5H 4AW7A 1GYCA 1TTUA 3O6FB 4K23L 2D0GA 3UTSD 5F3FA 4D0DB 1A22B 3UYRH 4H25A 3AT0A 2X6VA 2K70A 3FDWA 2HPOA 3WNIA 4O2CA 1LM8V 2ZWSA 4YN3A 5I18L 1T66D 1UH2A 3V6ZA 3VFPB 4F7CB 3P3TA 2D8KA 5B3JE 2ZOKB 2PW1B 3HW7A 2Z65C 3PQYE 3FCSB 1Q9WA 5B38G 1I8MB 1S78D 2FR4B 4G1EA 2ILLA 3CBJB 3GJEA 1RZGB 3LOWA 4CSPA 1F11B 2NQDA 3OLGA 4XO3A 1KBGH 5I74B 4FLHA 4KVPA 4Y19D 1JFQL 3LRMA 4JRXD 4BXVA 4F15B 4ZS7H 1SFHA 4CBZA 3DI2B 3FB5B 4DP1X 5IQOA 4K15A 4OCWH 4WK2B 3QCUH 3C75A 3SKOA 4PD4K 3SE8L 4CC4C 3HCVB 3PV7A 5ICYB 1TQWA 4WTZA 1OGTA 2XN0A 4LP8A 4M1DL 4WGKA 1BQ5A 2IADA 1FDLH 4KRNA 2Q3AA 2Y7SA 3T8VA 1IC7H 3UBXB 4FQHA 4FYRA 3ET9F 3SHSA 4Z76A 1FPTL 1XCWA 1LTXA 4P59H 2ICWA 4HKXA 5JA9A 3RPIA 4GS7B 3TPUB 5CCGE 3SDDA 1MFBH 3LX9A 3WNNA 5ITFA 3V5HB 2AEIT 4H1LA 4YHNB 1AZBA 1P2CB 4NN6B 5EZJA 3B5TA 5IB1B 3M8OL 2HA1A 5C0AD 2FT6A 4W9IC 1KGCE 3V0WH 4QWWD 1JPST 4BGDA 3GSUB 5KS9A 5GIRB 5ITBH 1D7DA 2AXGB 3QAQA 1QFHA 2K4WA 3HA0A 3FC8A 4JKPH 4M43H 4YNYA 4Y16D 4N86A 1TETL 1BLIA 3D69A 1MNNA 3BUTA 3BPCA 1MCCA 2C1OA 3KGRA 4MJ2A 4A7QA 3GEWB 3VXMD 4YHLL 1CTOA 1IC1A 3ETSA 4NN5C 3ERXA 4WW2F 2J1WA 3N1QC 4GKOA 1UADC 4NPJA 4WUUE 4FZ8H 4UCFA 1YY9C 1RIVH 1QKZH 4ZMZA 3BLPX 3SDCD 5F1OB 3VGGA 4AL8L 4AMKL 4UTBL 3T0ED 5CSBA 3ZT7A 3U6RB 1R3IH 2F8XC 1IC5L 2NY5H 3HS8A 4I0KA 1MCDA 2P8LA 3BIAX 4F57L 5EZOH 1DVSA 5HI5C 4BZ2H 3OXRB 2C4FU 3GI9H 1I85C 3QUKB 2WXKA 1F42A 4K5PA 2Z91A 1D5BA 2GJZA 7PCYA 2J12B 1G7JB 2KBGA 4IK6A 2QPUA 1IJNA 4L8BB 4LDCA 4WSGA 2J6EA 3L54A 2W59A 4JVWA 5D7KE 5IM7B 1KLUA 3V4PB 5FB8A 3HG4A 3P3UA 1AG0A 5AB0A 4GNKB 5F1SA 5AYUH 3RB7A 3VD9A 1C1EH 2DMBA 2Z35B 4JPIA 4MCYA 1MFMA 5MEOB 5EU3A 4ZTOH 5JOPD 1P1VA 1AS8A 2BXZA 3FSOA 3MJ8B 1MCWM 2CO3A 1EXUB 2F7QA 1NL0L 2X7LB 1WDAA 4G7VH 4HCRA 4OSUH 3RNKB 4EIGB 1U42A 1SXZA 3K3QA 4NZUH 4YXKH 2K1MA 3V7AE 1RUPL 4P23D 1SMDA 2FX8H 4Q9RH 1ZPLA 4IRJD 2DYPD 2CCWA 1NCBH 2Y6SD 2YPLA 1PCSA 5HGAB 1T5XA 4ONHA 1IQDA 4W6XB 2QMJA 5AVTB 2FT7A 4GQRA 4P2AA 3AQZA 2DTML 5KW9L 4NOBA 3QJHA 4XAWL 3L3OA 3TIDA 4WV1C 2OLDA 1DANT 2N59A 5I6XC 3QYMA 2QADB 5KG9B 2IG2H 4LLYA 2XC8A 4Q6IA 3L3KB 2XNAA 3VXPB 6PAZA 4X5QA 4BE6A 3IGKA 3IJ7A 1EGJH 2EH7L 3WV0A 5FUOL 1JERA 1LO0H 2W65A 4NO5A 5D7IB 2XQ0A 2VN5A 4H1LH 3QAZC 5IBUG 5D2LB 1DVFC 4W70A 4QCIB 2K7QA 3AXIA 3JWNH 2WWNA 4D9LH 1H3UA 3PAZA 5FHBL 4QRPA 1YJDL 3HZKA 3CLFH 4XPBL 3TXAA 3SDDD 1TO5A 3H7BA 3FTZA 1AS6A 5C0DA 4LVEA 3QIBC 1L9MA 1YO4A 4N20A 5B8CA 2YQBA 1NFDA 3FQRA 3ZSTA 2WVSA 3P0GB 3UTTA 4BSVA 1BQKA 2ZSWB 2K9UA 1ICTA 3ARWA 3HUJE 4PJEB 5LCVL 2JIXD 3D0VA 1A1OB 4ZPVA 1MQKH 3C5SA 1KB9J 1HXKA 2CJTA 2R9HD 4G7SB 3UABA 1V54B 3UTSB 2KL6A 3QORA 4AKOA 3MFFA 4JKWA 4W1TA 1ZPUA 3WEBA 2APXA 3BP4A 5DURD 2R4RH 5E5UB 4YSUA 2W5PA 1PX8A 2EDQA 3OHXB 3K81A 2VITA 4I89A 5SWZE 2EXWD 4LNRA 5KJRL 4JCLA 5D1ZC 4UOW1 3EDJA 3NOIA 2P5WA 3VVVA 4LU5H 2Z1KA 2H8PA 2J6EH 3BE1L 3OKMB 4PW9A 1AXSA 3VWKC 2IANA 2P24B 2XQBH 3BWAB 4NUJB 4OFYD 4M62L 1LWRA 4PLOB 1I9EA 4MJ4A 3TURA 3WO4C 3AG4B 4WFED 2CDFB 4Y19B 3X3GH 4JRXB 1ZXQA 3GLAA 2ZCZA 5T1KA 4CVWA 2DPKA 4AGPA 3JTBA 1MJ8L 2F5BH 3QI9A 1UT2A 1ZHNA 4HCRH 1VERA 1AP2A 4AENB 5DK2A 3OLEA 1ZSHA 3MV7D 1SF5A 2B1AH 2HCZX 4PBXA 5BUAA 3VQLA 4FKEA 1KCUH 4RFOL 1W9XA 2ESVA 4P5KB 5E8PB 4ELMA 5MENE 1A4BA 5C8JA 4DO5A 2HX9A 5K59E 1FZMB 4XVSL 1S7QB 1FZKB 4Y5YB 4N8VA 2D7OA 2MQGA 1VACB 3CMOL 1GIGH 2YQ3A 4GBXC 1JGEB 5IB4A 2AJ3B 1T04A 2FQFA 4I1RA 3D3VE 2CD0A 3FH8A 5C0AB 2J55A 1ADQH 2X4UA 4BELD 1HQ4B 5KSAD 1JNNH 2YPLD 3QIUC 5FO9A 3WLWC 4NQDE 2ZX6A 3RNQA 4PJXA 1JXJA 2K6ZA 1I4FB 1H3TA 4DK3A 5LGJB 1XF2A 4Y8DC 3FO9A 3LD8B 3CN4A 1CE6A 1B88A 1G7MB 3VXMB 2OMUB 1JV5B 2H32B 4WHCA 4IU3B 3RBSA 2JQAA 1HWWA 4RQQB 4K07A 4ZQKB 3MRMB 2V8LA 3WXVH 2YWZA 2XV6B 3G6JE 5JDSB 3KM2A 4MB1A 3N9GH 5ICUA 3OPZL 3L3HA 3T0EB 3VRIB 4F37K 1A7BA 3G5XA 3FQTB 1PZ5A 1YAIA 1OOWA 4FGMA 4N0UB 1T1XB 5KVFL 3TCTA 3ZE0B 5KVGE 4NNXA 3WNLA 2EYRA 3D0LB 4UT7H 4C55A 4N90E 2JKWA 4QXUH 4CVZB 1QR1A 1ETJA 3IDXH 1VFUA 2MOGA 2OJZL 1KYUA 2VOTA 4Z0BL 5DD5H 2GUOB 1A6TA 5D8JH 4HIEB 1OZTG 1WUNT 5I5JA 1CN4A 1HESA 2R0LH 3ASOB 2I07B 1XQ4A 4MNGE 4U1HB 2WINB 3UTTD 4YEFA 1HEZA 2YAPA 4PIBA 2IFGA 3U6XA 1IKNC 2E8YA 4LAQH 3W37A 1SDYA 1CD8A 3I50H 3G08A 3DYPA 3VRLF 4P23B 2CCVA 2Y07L 4O2CB 4IRJB 2DYPB 4F8LA 1ZHBA 4TQEH 1U8NA 4X8CA 2RQ8A 4A63A 5I1HH 1A4CA 2ZUTA 3ZN6A 1DBMH 1CLOH 1V8HA 4J3OG 4HIHB 3BP7B 4YX2H 1Q9WB 5BVJA 3T77B 4ZUVB 1IAOA 1S8DB 3FJTA 4KNTA 3P4OA 3O6MH 2PPFA 4PWKA 1B6UA 4GOSA 1YHPA 5HGHA 5T1KD 3RWFB 4EN3A 4HIQA 3ORJA 4KK6D 4LZKA 4PREA 2AQ2A 4UU9A 3QI9D 3HS0A 4CSTA 3C08H 5BS0E 5L4FA 1VKXA 5B38A 4KKLD 2NY0C 5FEBA 4AIZA 1VRSA 1X7QA 1R5IA 2ESVD 2IADB 3ZL4L 1MEXL 1DQLL 4FYQA 1SJMA 4NZTH 3VWJA 3RWIB 1M05A 3AB0C 4UILH 4MB4A 1VENA 4I0PD 4PMEA 4X6FA 4AEHH 2ICWB 1HNYA 4HKXB 1QP1A 3RPIB 3GIZH 4GPVA 4JFDE 5EF2A 1OTTD 3Q44A 4NWTH 3SDDB 2X70A 4U7MA 3Q8BA 4PUBH 4WWPA 5AVSB 3LS5H 4MZIA 4H1LB 4RIRA 1JGIA 1KCWA 5EZJB 4WUKH 2CA3A 1JTPA 4X7SH 4TUJA 3TEWA 2XZQL 2HFEA 2NX5A 4YK4B 1Z0MA 1A6PA 2X42A 3MREA 3OAZK 5DJ0A 4RGMB 5J06A 4CBPA 2JIXB 4FXLA 5KSVB 1OTUD 3X17A 3UO1L 4ZSOB 1MFEL 5IROA 1MOEA 2NYKA 3F7PC 2C1OB 1R3LA 4G42A 4ZDHB 3CCHA 4GUOA 5AZEL 3RKDD 3S3PA 1KMGA 5DURB 3EO9L 3QQ4B 1QLEB 3ILPB 1JPTL 1MW1A 1BIIA 4J8QA 4KHTH 2PR4L 4EZKA 1ED3A 1WIPA 4MJ5A 2TSBA 3L9RA 3LKSB 3A6BH 5D4JA 1IL1A 4I7ZC 1VCBC 3TZVA 1JRHL 1P84J 3JTSB 4P9HL 4QKXB 3QDJA 2UZPA 4HBQA 4JUTA 2BNRA 2P8LB 5CJBA 3AGVA 3WAKA 4GLRH 3GYRA 5C08A 4YHYB 5SWQB 3H3KA 1EEUA 3U9PH 5JO5A 1L9PA 2HT2C 4R8WH 3HR5B 3LQZA 4Y1AE 5K1JA 2ZYIA 3UYPB 3U36A 1XWVA 3BX7C 1MJUL 3GBMH 2V5RA 5H35B 3WTSA 4GG8A 4MD0A 2CDEB 5IW1A 4Q6IC 3SJVA 2QPSA 4LSRH 3U2SA 1CI5A 4JPIB 2VDLL 5AAWC 4FULA 2K4AA 3AS2A 1CDHA 4JFPA 4O4YL 2FB4L 2JJTA 5DUPL 3KLAA 3V4UL 3VXTB 4BIKA 2UY7A 3AMKA 3VSTA 1TQBC 3NCYP 1U3NA 5MHSD 1FV1B 5BW7C 2QFPA 4ES9A 5GZNC 3CFEB 4PW4A 5F9WC 2C1PA 1U8IA 4ZS6D 2ATPB 5E2VH 2V8MA 3WFCL 1FVCA 4FFVD 2H3XC 3LDBB 5BV7L 3LVTA 4F37F 1YQVL 4QRQB 5KSAB 1UZ8A 2XXCB 4U1JB 2A2QT 2YPLB 1T5XB 3MUGA 1HHIA 2YR3A 4PJ8C 2EVGA 2CALA 3O3BA 3PWPD 2YMXL 3QJHB 5L9DL 4Z23A 1K4CA 3ISYA 3R1GH 2AI0L 4MA7H 2B08A 4JFFE 5IVNA 1LMKA 1FG2A 2ADJB 2ZZUT 3TF4A 1SUHA 4UQAA 4PJ5A 4ZUSA 4N2MA 5ESVA 3IGUA 3QORC 5KSBF 1JIBA 1T89A 4UNUA 1V55B 2Q7YB 2WXIA 2BDNL 4NO5B 5TDNB 3RTQD 4TLUA 4NAMA 3TBTA 3X14A 3RGVD 4ORZC 4AQEB 1KIUB 3I3BA 1TZIB 4KROC 4TSBL 4Q14A 3CN0A 4KX9A 3VWJD 5FYJU 1JGVH 2IV8A 3MZGB 4K7FA 2VR4A 3DPBA 4Y2NA 1RZJC 3GLZA 1D2OA 1MHPL 3K0WA 1HIML 5EBMA 3H7BB 4E9YA 5C0DB 4TV3A 3B5HA 1UQSA 3QUXA 2O26U 3ZTCC 1M7XA 4WGVB 5B8CB 4FCAA 2RR3A 4JPKL 3AU1B 1YEHL 5GRZA 3UTTB 4BSVB 4NQQA 3EJZC 2NX5D 5BRZA 3UTPD 3D0VB 2BSED 4R3SA 4U0RB 2WYZA 5I1GH 4GY4A 1LWJA 4RMSA 3REVA 1D5ZA 4HZLA 4Q52A 5EUKB 5JXEC 3P11L 1SLUA 2VITB 3K0YA 3KNBA 4LNRB 4K9EL 2IVFC 5SX4I 3S98A 1C12B 4OGQC 2FWLB 3GLDA 3RY6A 1R3KA 5AUMA 3VFSB 2P5WB 1YN6B 4JDVA 4PB0L 5INCA 1XIWA 2DY2A 5KYUB 1E4XL 1AXSB 2Q8AH 3GZQA 1ILUA 5GRUH 1N4XH 1U3YA 3QDJD 4BZ1A 2W0PA 3BAIA 2OMVA 2QKIC 2CJUL 3MYZA 1FVEA 5K9JH 4PB9L 4Q0XL 3N6YA 1KFAL 5T1KB 1L3WA 1B4RA 1Z9LA 4XNMA 4M8QB 3N2JA 2BMKA 3QI9B 2FEDC 1ZHNB 4PRPD 4F58L 5ACLA 5CJ5A 1X5JA 3LNDA 5KVDH 5DK2B 3QDAA 2R69L 3IMUA 5GRYA 5I1JL 3SJVD 3HFMH 1NWPA 1UKTA 5LNGA 2ESVB 1S7XA 1PG7W 4FTVE 1XH0A 2H0FA 4S1RH 4I0PB 5MEQA 4XOEA 4Z7NF 3F7VA 4N8VB 2GY5A 1VFAA 1JTOA 4UI2A 4WWKD 4GRLC 4CJ1A 4ODUA 5E7BA 4OD1H 3ZOAA 2JQZA 1B3IA 4NM4L 1ZLVK 1CXKA 2WN2A 3MR9A 3NIFE 4M56A 4POZD 2H45A 1NFIB 4OF5A 1DQML 3EFDH 5AVXB 2X4UB 1R5VA 3CSYB 3GMPB 2WKOF 2WYTA 2WBJC 1TJHL 1YSOA 5FO9B 3K1KC 2IXQA 1U8HA 2XU9A 1YPZF 2UXVA 4Y2DD 4YIQB 5DO8A 5EDXA 3VUAA 1A1NB 5CD3B 3DSNA 2C7UA 1FC1A 2QV4A 3K74B 4HPOH 2V5YA 1CE6B 5CHNA 4DZ8A 2HG0A 1IGTA 3SDXA 4BH7B 5EOQH 4IGBC 2ARJA 3Q13A 5FGCB 3F7YA 4OFKA 3LIZL 1BDYA 1ZJBA 1BREA 1QYGH 4KXZH 3LS4H 1U8JB 1TMQA 1BBDH 1PKQA 1RH8A 1Q0EA 3TBSA 1AGEB 1DLHA 1RP9A 1RFDH 3G5XB 1E6JH 3FU8A 3HI5H 3O3DB 4HWBH 2ED7A 5J11B 2YA1A 3MJGX 3W39A 3IPFA 2EYRB 3QS3A 4RCAA 2PETA 2CRMA 3UGEA 1E3FA 3WHE1 4ABVA 2XV3A 5JNYB 2N1KA 4O51A 2EIJB 4JB9H 2DM3A 5AOKA 4O2EA 4DF9A 1XGRA 4YBQC 1EV2E 5HGBB 4RFEB 4OM1L 3T8XB 4XO5A 3QUXD 1G7QA 1I3GL 1GPOH 4JHAH 2VW7A 3NSFA 4URKA 2CRYA 3MA9L 4LEXL 5BRZD 2OL3L 1HEZB 4ZNEA 3T9WA 4WO4C 5EBWB 1MFCH 5CGTA 2BSRA 1U0QA 1IO4C 2A0LC 5IOPA 3MRCA 2G4EA 3KGUA 4MA1C 3G08B 4MJ6A 2FSDA 3F84A 4BZ1H 2WKLA 4E41D 1FHNA 4FKHA 5C0IB 3OKEB 3VSQA 1T03H 2GSIA 5A7BA 1U36A 1WT5A 5HDBB 2VCOA 1CFSB 3UC2A 2WYHA 2WYIA 3BGFB 4RAVB 3IFOA 3PWPB 3GMRA 3MFGB 3MGTB 5BVJB 3MTRA 3BN9C 1H6EA 1U2YA 3CQQA 4ZTPL 2WUBH 1IAOB 3S8WA 1ZE3H 3BSZH 5B21A 4OV5A 3DGGB 3VXSA 1CC3A 3C5ZA 5FC9A 3WIHH 2DQUL 3NPSB 4MXQD 4AWJC 5HGHB 4P04A 2FBJL 1MW2A 3UROR 3G3LA 5KN5A 1GC1C 4UM8B 4Z7VE 1GJWA 1BAFH 3JYBA 4TUUA 2MCPL 5E8EA 1U8QA 5EEVA 4FQIH 1ORQB 1M9WA 4KKAD 3RGVB 3FS9A 4S1QL 3H2WA 3RVVC 3K6FA 3VI4F 3AREA 3PE9A 1MG2C 1NAMB 5D70H 1M05B 3U30C 3VWJB 4F2FA 1PNDA 2XVBA 2ZWNA 3WDJA 4LEOA 2K9FB 2K8QA 4X6FB 1FJ1B 2YEZA 5DTFA 2OTWB 4PJHF 5L2KE 4FQ2L 2DL9A 3RL1B 4I4WA 4JGNA 1NM4A 5CEZE 5GS0H 2A5UA 1A8JH 1ZT4A 3GHPA 1VFMA 1XR8A 4TUJB 5KSBE 1SHXA 4Z7QF 3VAEA 4YBLB 2HFEB 2NX5B 2W38A 3ZTEA 1EZUA 3M1BB 1H6UA 1WWAX 3I2CL 4NKDB 4G8GA 3CXDL 2G60H 3V8OA 2IGFL 4GMSL 3KXFA 3O2WH 4L48A 4MYWB 3AADB 5DZVA 1K8DA 1OAZL 2R8SH 2VXUL 3H53A 1R3LB 1KCRL 3APMA 3CCHB 3G6AA 4G42B 4Q2ZA 5KBPA 2AXWA 3ZKQD 5I2IA 3JV5A 5GS0D 3OQRA 5C07A 1OAYH 2V2XA 4GAYA 1AHKA 1DBBH 1UB6B 4MJ5B 5J6HA 2FBRA 1AQDA 1GZHA 4LK4A 3BD5A 3E38A 3MQIA 4DVRL 4H20H 4OW6A 3VX0A 1N59A 3QDJB 4MJHA 5GISH 5CN3A 4IDLA 3PWUA 1CGUA 2AMUA 2X40A 2AEQH 5EO9A 5FYJH 1HHGB 5C08B 5CJOL 1W80A 5JO5B 5SWZD 1JXFA 4WF7A 5I16A 2HRGA 3FQWA 2EXYD 4PRPB 3CZLA 4P3CL 5E6ID 3CC1A 4D2NA 5HSFA 1D7CA 5IJVA 2EADA 5IW1B 3SJVB 1KBVA 3U2SB 1W8OA 4YO0A 5HHMD 3LN4B 4XAKD 2P26A 3KLAB 4OLVL 5FYJD 3SE4A 2UY7B 2YKKA 2ED6A 4FADA 1WZKA 4LASH 3ASNB 4WWKB 2A83A 2B39A 4XCYB 5EC1A 1NBZA 3I6KA 4UUJA 3EDKA 5CINH 1NC4A 4JMXA 5I66B 2O5ZH 2IH1A 1CZ8H 1Q94A 1RU9H 2IOOA 3FCGA 4GSDL 3L4UA 2VQ1B 4GKSA 2XG4B 4OI7A 3MOBH 2ZF9A 5CU9A 4WK0B 2F5AL 5AAPA 1OAKL 3HMXA 1NPUA 2WQ8A 1DVYA 1VFOA 1N5AA 3FH5A 3MUGB 4K2UH 4Y2DB 5ALBL 5IGXH 4DKFH 4G6KL 2VLMD 4B9ZA 4D8PB 1DL7L 4XP6L 3BUDA 3JWNE 4CKVX 2EEXA 2NY6C 3KR3H 5KS9E 4QO1A 4Z7NE 1K4CB 3J7HA 1S6NA 3SGKC 2BNQE 4IOFD 1RXLA 1TLMA 1TQVA 2FBOJ 1GGBH 3H3BC 3PHOB 3NJVA 2DD8H 4MMXC 1QW9A 3VSVA 1X5MA 4QTHA 3VXSD 3C5ZD 2JJVA 3G5WA 5T33H 4RX4A 4DSYA 3VCLA 4DGUA 5D72H 4FQXA 5DJZB 4JRYE 3SPGA 4KNQA 3T0DA 5D93C 1CDIA 1CD1B 3UC0L 4BWTA 4ERSH 4LVHC 4HGKC 3QIWC 3X14B 4GXVL 5ICZA 1N9PA 2DQGL 3CZJA 2G5BB 4FQ1H 2XN1A 3ZYJA 3K7UA 4MYPA 2X4OB 4HH9A 4NUGL 1XIWC 1BFSA 1ZHLA 3MRDA 4JKNA 2XWEA 1REIA 2BW5A 2JKTM 4WFFD 3ULUC 5EBMB 1WC7B 5HGDA 3DX8B 3GFUA 3U4EA 2DWEA 3QUXB 1UQSB 3FCTA 5IBUB 3IFLH 3P73A 1KCSH 4DGYL 1UENA 5F89A 3WTXA 1QW8A 3ZDYF 1JDCA 4KZCA 4QXGH 1OP9A 3W82A 5E1QA 4CKQA 1QFUH 5BRZB 5I1AA 5IESL 2W9DL 4JZOB 3ME0B 1PDKB 3ZT5A 1QWUA 3ARFD 3KXFD 3M07A 4PJBA 2IC2A 4WKXA 4LMQE 5E5MB 3REVB 4LXFA 1J0HA 1EJOH 2WC7A 1RULL 4HZLB 1BZ8A 2N0KA 3QO1A 1L9QA 1TCMA 1PY9A 4E41B 5I0VA 5DS8A 3TT3H 3CFBB 4M6NH 5T1MB 3CD4A 4BINA 3DBXA 2IFFH 3DV4B 4G9DB 5LBSA 4Y4FA 3HTLX 3SGEI 3WFBH 1NAKL 1QLRB 1XR9A 1JYVA 1TZAA 1Z5HA 4PWGA 1C5CL 3T1FA 3FN9A 4Z7WB 2DI8A 3UBFA 2IBZY 4NLAA 4YHOH 1GS8A 4B9JA 4ZJ9A 3QUZC 1WG3A 3EYVB 4OCSL 3KLHD 1ET8A 3FB6B 4ODBD 3X1FA 3C6EA 1AGBA 5IKCB 2BHUA 4C4KT 1AD0B 4XNMB 1UWEL 4KRPD 1Y18B 4UAOC 5SV3A 2D03H 2OULB 2ZXWB 1OCWL 3CUPA 1IRAY 2RFXA 3QNYA 4B97A 2F7IA 1MCNA 3BN3B 1WUZA 3HNVH 3KW8A 3HMXH 4M4RA 4L1TA 4LGRB 3DOIA 4PGCB 5EU6A 3WUWB 4XBPA 4ODUB 1AJ7H 4JN1L 5E6SB 3WY1A 2LU7A 1SQMA 4QRPE 5JZ7C 1NC4D 2K3TA 3FT4A 4WQOA 3T6XA 1R5VB 2NOYA 5TFSL 4AT6A 4ODHH 1FYHB 1NFDE 4XB8A 3VI4E 3DSNB 1DUYA 2GTQA 2QV2A 3V5KA 2PLTA 1AC6A 3ULAB 3SDXB 1YEIL 3BCFA 5I19L 1C8PA 4PJHE 2AQRA 2NT1A 3I9GH 4D9QD 4B9GA 4PHZA 3F7YB 1U8MA 1F6FB 3ETBF 5K1NA 4TULL 5AZ2H 3FK3A 4FFZL 4V1DA 1AI1H 1KLGA 4IBTA 1I8LC 3FUDA 4Z95L 1HZLA 4FQXD 3SGDI 2BOCB 2VRQA 3PV6A 1QO3A 2RBLA 5CGBA 1DDTA 5HBBA 5IBLC 1YAZA 3O0RL 2NQ3A 3GZKA 2G30A 3CWGA 1IGCH 5BCAA 1OPOA 1WT5C 2IANE 4FYTA 3C8KB 1L7IL 4NQEA 4PG9A 3EZJB 4DO4A 1PGRB 1B6DA 2AK1L 3QBTB 4LRIC 4M6ML 3IJYA 4FXGC 4OD2A 5E6IB 3VU2A 3MU3A 4MCNA 4NNPH 4O2EB 1FGVL 1GYVA 1MNUH 1XGRB 4S10A 3W9EA 1F18A 1G7QB 1KDJA 1CF1A 5HHMB 5T1DH 2MPAL 1ASPA 5I28A 5D6DA 5CWSA 2AEPL 1D6VL 5A2AA 2KS0A 4PWEA 4ELME 1RZKL 3KS0H 4NO0A 1TEGA 2BSRB 3TO4A 5IHWA 1F00I 4LQ1A 4H8WC 4YHIB 1XCQA 2FNWA 1M4KA 5KJ7E 1QBML 4O2FB 3GHEH 1HYRC 3VTTA 4N8CH 3H9SA 2ZCHL 4J4PC 3TJPA 3DJRA 5DVLA 5LDSA 1W0VA 1KBBA 4LPWA 3QQ9D 4OF8A 4HXAL 1PNCA 2D4FA 3HRZA 1G9ML 3IFOB 3QDMA 4Y4FD 3GMRB 1DE4B 3BH9A 4LVOC 3SPIA 3R8QA 1WBYA 4HUVA 4FLQA 4TSCL 4IHOB 3EYSH 3IJSA 3CVDA 5EBLA 1RVFL 4NJAH 4PJXE 2CCLA 1SJHA 4OCYH 1AACA 3V6OC 4H2AA 2X1XR 1OO2A 3C5ZB 5DR5H 4LP4A 5LNEA 2R2HA 3VXSB 5HYSB 1GW0A 5KN5B 2I9LA 2A6KA 3CPUA 1RK0B 1CDCA 1DBAH 3RAJL 1MI5A 2YHGA 5I1EL 3JWDL 4HD9A 2DWTA 1E2WA 2EUZA 1IX2A 1SNRA 5I1KH 3DVNB 3S34H 1CS6A 4KK8D 1XGQB 3O2VL 1ACZA 1AD9B 4OVVA 5GGSA 4BXSV 1KCVL 4P05A 1NSNL 4YDVB 2DICA 4OTXL 1GZHC 3PREA 4F3FA 4IEFA 2EXSA 4PLJD 3VXRE 2APWA 2ZCKH 2V3DA 3CQPA 2F53A 2BO0A 1EFXD 4I4WB 1RLWA 3D6GA 4OM0L 5C3LD 5HYQA 1IQWH 2I5YL 2YD9A 1X5HA 3Q2VA 3LKPA 4YPJA 3GBLA 5IUCA 2CDGA 3CC5B 2H1LM 5JORB 4L8CB 3R7RA 3W38A 3KJ6H 1JZ3A 1IAIL 1YNKL 3ARFB 3KXFB 3I9IA 1JVKA 1RCYA 3B9KA 2HH0L 5DD1H 3EDEA 4JFSA 4MQTB 1K8DB 3B8SA 1OP3K 5ABZA 5FR3A 5I0ZA 4JZJA 4Q2ZB 3ULUF 4LPUA 3RLSA 3V0EA 4CDHA 4E42A 1QOKA 3D05A 4GIAA 1PTZA 3SCMA 1JS4A 2V2XB 3E6FA 4XC1L 4MQ7A 1ZOXA 1ETZB 4ODSL 3US1A 1AQDB 4FYSA 3ZDYE 1F3JA 1FWXA 2IH3A 4M1GH 1MZYA 4HMEA 1N59B 4HAGA 1OB0A 2W94A 1SQ2N 4G2AA 3MROA 1NTDA 1Q0XL 1YY9D 2V17L 3OVUB 2QQLL 3VQ1C 2GIYA 4GUPA 4DZBA 5I16B 2Q8BH 1MPAH 2J4WL 1N7MH 3CVHL 2MNWA 3DIVA 3GWJA 2UVFA 3N0AA 4KRPB 2DI7A 3RURA 4F8OA 1LE5A 5BO1L 4JBSA 5FFLA 2P5EE 3I6SA 5HI5D 4W9GC 5C2BL 4YO0B 5A16A 4H5SA 3FQ1A 1T0MA 3DHMA 4MNQE 4MS8C 3EJRA 3LN5B 4CN6A 5C6WH 5EUOF 1JGUL 5T5NG 4OI8A 1LNUA 3RRQA 3IDNA 2A83B 4PVBA 3WKML 4NO0D 1FNSH 3B2VH 2SEBA 3I6KB 1GL4B 1NC4B 1LE9A 4HSCX 4DUWA 1A6UL 1HX0A 4P4KA 3ATBA 3FT2A 4GKSB 4EJ1C 3H9SD 2JCCF 2ZG2A 1I9JL 1RZFH 5MI0C 3Q2WA 5IBTL 1U8OA 3Q7JA 2V4LA 1BLNA 4QO1B 2DQMA 2QHRL 1ES0B 5BZZA 1XCTA 2Z1PA 3BP5A 4ZX3A 4GKZA 2DIAA 3Q0HA 2H6OA 5CIPA 2AV1A 2Q5BA 3LRLA 4FQXB 4U1NA 1TTAA 1J05B 1PPIA 1FF5A 1T1ZB 1AC0A 2DDQH 3MJ9A 1Z3RA 3EGDB 2NY4D 3O6KH 4J6RL 4DEPC 1JPGA 3S35H 1T0OA 5KANI 4K4KA 4IKKA 2GEQA 5KVGL 1SMOA 2RGSA 2Z93A 4YZFE 4CMHC 1HNGA 1A2YA 3DRQB 4HH9B 3LPOA 4FP8H 2BNRE 2IMMA 4HBCL 1QSVA 3MRDB 1KWKA 5CMAB 3OD3A 3JXAA 4J3VA 3CFTA 4R4NC 4ENED 2F53D 5HGDB 1DVFD 4NQCA 5A2FA 3MLXL 3SY6A 2FEEL 1X4ZA 2NR6C 3FCTB 3BVNB 2QQKH 4MVBC 5HJGA 5F89B 5K9KA 1RZ7H 4WU5A 4M7JL 5I1AB 2YJQA 4WK4B 4M9PA 4PGBB 4UOW0 3VB9A 4RMRA 1SXSA 4OQTA 4FQJH 4GI8A 4AEEA 1DJZA 2BS71 2ZICA 3LKNA 4ALAC 1UWGH 3V9CA 3QO1B 1A9EB 2DAVA 3QK0A 4NO2B 3J07A 3GS0A 4L1DA 4L5FE 2E27H 2VAAB 1R3HA 3SCMD 1AR1C 2VDRL 3NIGE 1JGDB 2GPZA 3A6OA 3IDMB 4FQLH 2ADFL 1FP5A 1T6WA 2FAUA 3DBXB 2OSWA 3WDHA 5D71H 3V6BR 1ZMYA 4X5LA 2YRLA 1MLBA 3QPQC 4Y4FB 1ZEAL 1W8EA 3WIIH 3GUTA 4OLYL 2IAAC 3QRGH 3FT3A 3PGDB 3OR7A 2NZ9C 3T1FB 2P80D 3SDAA 1BFOA 3UZVA 2MOQA 1IJ9A 1A7OH 2XZAH 4WEMB 3KYNB 1FE8L 4OZGF 2FCBA 2WM0A 1N70A 1OKEA 4TRPH 2QKSA 5B1BB 4XMPL 4YXHH 1PZUB 1NCWL 3WD5L 3K91A 4AVIA 3U48A 1AGBB 1DLFH 3VWKD 3OKOB 3NJKA 3D30A 1FIGL 4XBMA 3VI3E 3KPPA 4IIQC 4DP6X 5C0EA 3GTVA 4PJ5E 1YEDA 2IMNA 1RUQL 2RFXB 1TCRB 3POCA 2IDSA 5BXFA 3FQYA 4HJEA 3GXPA 5D5ME 3ZKMD 4NEHB 3IGAB 2OA9A 4PYHA 4L0ZA 2IBGA 2ZUSA 3AFLA 4QUOA 3IF1A 1HILA 3DO3A 3HHMA 3NABH 2DQHL 5F7DA 4XBPB 1F3DH 5B39B 5C7XH 3SZKC 1UA6L 1BG9A 2QTEA 2WLHA 3QDGE 1EFXB 4AIOA 4YSTA 5T5FH 2ICEB 5E5RB 2ZUYA 1HKFA 2LTQC 4GMTL 3VXRD 1MIEH 4TNFA 4P4KD 1KTCA 3NIDE 1Y6MR 4NHCH 1LYQA 1NWOA 2ODIA 1AH1A 3DHPA 1SDDB 3ZTJG 3L4CA 4X80L 4LSTL 4WI0A 5DHEA 2N7SA 4K94H 3FZUC 5D55A 3AG1B 4GBXD 1BF5A 5KYXA 3S37H 3QHZL 3FQNB 4K8RH 4AV4A 3MJ9H 2AP2A 3V5KB 4B9CA 1A3RL 3C6LA 2YMTA 4HFUL 3LHAA 43C9B 4RSYA 4ZTEA 4B0MB 1OIOA 1JD7A 4XRCA 3T5WA 4IK7A 3VFGL 5C0FA 5I9QB 1JZ8A 1RURL 3EUDA 3T3ME 2E9BA 5L88H 2YUZA 1HZHL 4N0RA 2HTKC 4V1DB 4GXUM 2Z0BA 3GRWL 1JHKL 4IBZA 1SF3A 4HF5L 4D0CA 2YQGA 3ABMB 2YIHA 1QO3B 4DP7X 1X5GA 2KQNA 4JM0A 4NN5B 5E9NA 1OD7A 1LEGA 5IEHB 1HWHB 1KELL 3MLVH 4XZUB 4JFWA 1XXDC 4XCCH 1LP9F 2BPBA 4O9HL 2BSSA 1FZOB 2A77L 3SKJH 1KJMA 4JPQA 2Z8RA 4MNHA 1YG9A 2ALAA 4P4RA 1CU4H 2WSPA 1PAMA 3OWRA 4OD2B 3CSPA 4MS6A 3KHOA 1IB5A 4NQCD 3AVEA 1LO4L 1FN4A 1HAUA 3IGFA 3V5DA 2OSLB 4LCIL 5TF1H 3ULVL 4Y4HC 4IJ3C 1A14H 1QSZA 5EULV 4QD2E 2NZ1A 2W60A 3BW9A 5CWSB 4FS0A 5E08H 2PWDA 4JO1L 1GHFL 5LAXA 3WSQL 1D3CA 4P2CG 4NJ9H 4NO0B 2YLHA 3HHSA 3ECBB 2BWQA 4KMQA 2AJYH 3BYYA 3BUIA 4AK2A 4DEUA 2B77A 2DQIH 3NQIA 1T2QH 2CJSA 3H9SB 4EAEA 1M3IA 1AO7A 1E5UI 4I1PA 4PJ9C 5I5MA 1RUAH 4WJG3 3ETTA 4AGNA 7PAZA 3HRZB 4HFWB 3ULSA 2YC1B 2WOYA 1UA7A 1HDMB 1T21A 1WBYB 2YGQA 3IJSB 1T83A 5GGVH 4JANA 3RPKA 1LO3H 3SDAD 1SJHB 4I2XE 2F54A 3EGSB 4FFYL 4X5RA 2R0KH 5IT2H 4Q9CA 4KTDH 4FF9A 3ARRA 2G3NA 1I1YB 3VYPA 1EEYA 2DWSA 1B9ZA 2I9LB 4JZJC 2A6KB 4R90H 4UZSA 5HY9A 2JCCE 1A1MA 3WXWL 1AOZA 1YEJH 2NY4B 2OQJA 3TNNA 3INOA 1A6ZA 1PKQE 5IF0B 3WNMA 4UTAL 2BNQD 3TWYA 2H9GA 4XP4L 5BOPA 3AWEA 2EZ0C 3MV8A 1CYXA 3AUWB 4IEFB 2XWDA 4XC3H 5C6TL 3WMQA 2F53B 1KEML 1DVFB 3QWRA 5F7KC 5I8CB 2IWFA 1DFBL 2ZXAA 5JYMA 1MWAB 2DTSA 4HKBA 4HS6A 5HYQB 1NCCL 5D1XD 4YFEA 3LKPB 2J43A 2CIKA 5ANMA 1DYZA 1FFPB 2F58L 2X05A 1NPJA 5AOMA 4PLKD 2F1EA 2DH3A 5DFVC 3LQAH 2IIJA 3IPEA 2R0WL 3S4SA 4KTGA 3SCMB 3E6FB 1CK0H 5GHWL 4UIKL 1BZDA 2XWJB 2WBXA 4Z7OE 2RHEA 4MQ7B 3B43A 3F5WA 3DK2A 2IDQA 4TVPE 2NNFA 3P02A 2NXZC 5EIIB 3HMWL 3GHBH 3CIAA 1AGDA 1TG8A 2CLVB 2WQSA 3RY5A 3O81A 3VXUA 5LUMA 3GKWL 1QNZH 1N8OE 2EDWA 4OLWH 3ZDZF 3FQUA 3DIDA 1AAJA 3NH7L 3MROB 3DURA 4G80A 4NXKA 1FORH 3ABKB 4JFZH 4D7BA 1N67A 4GUPB 4N9GA 1UZ6F 3VWKB 4DZBB 2OP4L 3HE7A 3H7LA 4HZ1A 3DOHA 2VIRA 1LE5B 3VNZA 4F9LC 1DTUA 3WO4B 1OTSC 1F90L 2A9AA 2VN6A 2Z0UA 2L4OA 4H5SB 5A16B 3MX0A 1ZIAA 1R4XA 5DD3L 2IPKA 4MAYA 2WTOA 3FHEA 1MCPL 3ZZLA 1LNUB 3AXLA 4XP9H 5F1IA 3IDNB 1DCEA 4A7UA 2P8MA 2XKNA 4BCZA 4OZGE 3TYFA 4K7PH 1INEL 3VXRB 3B2XA 3PP3K 2GJ6D 4P4KB 4ZMWA 2YK1H 2E9JA 4FHBD 1U4EA 5D2NA 5GGRA 4JDEA 4J3XA 1OQXA 2CK2A 4AYEC 1RUMH 5E94A 1OP5K 1EO5A 3O0LA 4KHXL 4M5YL 4GBXB 4MXWH 4OUUA 4YFLI 3AY4C 1M7IA 5D7JA 5GZND 3EOTH 5LXVA 1ZRUA 2VLRA 3GF8A 4G8GE 4KUZH 1BLNB 3V6OE 2X6CA 4JR9L 3DVFA 3U7WL 1XCTB 3LH9A 2WLMA 1UUNA 3KLQA 4S0SD 4ZX6A 5KBLA 1INDL 1I9IH 4PJ8D 3U0PB 2PP7A 3BP6A 5C07E 1I7TA 2CMRL 1L9RA 3BD4A 2A6IB 1E0OB 2JLLA 3D9AH 3H42H 4R26H 4PJCA 2OSYA 5TQ2L 4J12A 4M02A 4AKQA 3ECQA 1A7PH 4HK3N 3SE3A 5EZIL 1XB6A 2EKSA 3BFQG 1E5YA 3WFEH 1TTGA 4N8UA 5GS1A 5C0RH 4X0KA 3FOLB 3HPJA 1RZJH 3UYRL 2EP6A 1RZPA 5FCSH 4AC2A 3SQBA 4UT9L 1UXWB 5TE7L 5DFAA 2DQFA 2DEWX 5JPMA 2WGNB 3QWRD 4NQCB 4UIMA 4NPKA 2LOEA 4NFBA 5F88A 2YA2A 5I15H 3MRNB 2V3FA 3GB7B 4NRXB 3DDGA 3VGHA 3K46A 4LQFL 1JZ4A 4PW3A 3JWOL 1K9TA 4QRTA 1F4WH 1EJ6A 1KBGL 4OZHF 4AZUA 5GJSH 3VFRB 3VMOA 4MMYA 3JBG7 3OB0K 1LP9E 4MFHA 4ZS7L 3TVMA 5IREA 3V4VH 1MRDL 4XNUH 5DJ2A 3N43F 1MN4A 1R3HB 4N3UA 5AKVA 5F96H 2XVLA 3S96B 1UG9A 2BFVH 3ABGA 1J18A 1U6AH 2Q6WA 1EBAA 3N55A 1BZOA 3S2AA 4XVUD 1FDLL 5AAMA 1X5IA 1AFVL 4EVNA 5TJWK 1X9RA 4N2EA 1JZEA 2OYPA 4AM0Q 4LVNC 4HUWA 1WBZA 3FT3B 3EJYC 5JXED 3OR7B 4NQSA 1FCCA 1ZVNA 3SDAB 2HFGH 4AGQA 2A6DA 1UEMA 1ZANH 4L18A 1MFBL 4ZXBA 2VZTA 1NCDL 2WLKA 5IHHA 3OC5A 4Z7IA 2WUCH 3KPSD 1OB1B 2JTDA 4I3RH 2J56A 3WTWA 2CO4A 2GIXA 2NSQA 2FH6A 2C9XA 2NNRA 3F3HA 3HE7D 3KPPB 4W9CC 1OM9A 4JCMA 2F68X 4FQPA 4LGSB 4Y88A 3S3BB 3VE0A 1K4DA 4YLCA 3D25B 4O02A 5CEYB 4U6YB 4OGYH 4U6XA 5AVQB 3PJSA 3QEGH 3ARBC 5HVHB 3KGTA 3BAEL 1AZVA 2JJWA 4W93A 1IMHC 5IR1A 1TZ8A 1YEKH 1BXXA 4JHZA 3PG2A 1MCRA 1RUKL 3IKKA 4BRJA 3ALXA 5CEZL 5D1XB 1RIVL 1QKZL 2MKLC 4UM9A 5CLTA 3WHXA 5JIPA 3KYAA 3AB0B 1NCOA 3SKUD 1YPZB 1J11A 1R3IL 3KYOA 4BKLB 3LZNA 1IGIH 1BZ9A 3H55A 4GRLD 2VUOA 2DMCA 5EZOL 3D34A 2ZXBA 3GI9L 1TF4A 2VLRD 1JWUB 4XWGH 2X4QA 3N1PC 2EDYA 2G0LA 4XRCB 4GFXA 4PJBE 4CUCA 1RY7B 5C0FB 1G1KA 1UD6A 3GZPA 4Y4KA 5DYOA 2FX9L 4LCWD 1EHLH 1X5KA 4ZOBA 1NOAA 2UZXA 4KXDA 1CDYA 2FATH 5HHOA 1JF5A 4ZTOL 2Y5TA 4IGBD 5JHAA 1LEGB 3JV4B 3L4TA 2WZPD 1EXGA 4M61A 3RX8A 1FLRH 5CKGA 5BVPH 1Z9SA 4DCQA 2YOAA 5C09D 5DJAA 4N2OA 3CXHJ 1MIML 4QYOA 3FMGH 4MNHB 4P4RB 2FX8L 5K9OA 4R97B 5E9DD 1CDGA 2AGJH 1S7RA 3GI8H 3BT2H 5F8RC 3UZQA 2ORBL 1FN4B 3T71A 1U8PB 3MRHB 4ZPTB 2YPVL 3KBPA 5L4MA 4M7ZC 2W60B 3EFFA 1T1WA 5C9KA 4AEIH 2O61B 1ASOA 2IG2L 5AG9A 2F9BT 3HLAA 3R8BB 3HHSB 1N6VA 3FB7B 4LKXA 3CTTA 1MRFH 1AE6L 1BIHA 2GJ6B 3GXIA 3PXLA 5EU6E 3VFTA 3LRGA 2A4EA 4MD5B 4CILA 1UZ6E 2ARWA 1LO0L 1XCXA 1L9OA 3GGWB 5T3XE 4UYQA 1TQBB 3HAEG 5FO2A 3KWVA 4UINH 3PPEA 5F9WB 3MOAH 2FECL 5L4IA 4MNQD 2ISDA 4PJIF 5EN3A 3BVUA 4QOKE 2A0LD 2R15A 2V0AA 3ULSB 4BFEA 1CLYL 1PS3A 5DQDH 2X10A 1T3FA 4OZFA 5J9PA 3BZ4A 1T21B 4LLQB 3L3GA 1YMMD 5HPMB 2BY1A 4JANB 1BQHG 4YQXH 3F6JA 1VADB 2R29H 1MCKA 1CPUA 4JDTH 3KDPB 3NAAL 1JXDA 3O4OC 4PJ8B 5E95B 2R23B 1E42A 3QR0A 3RI5K 3SKNA 3EO0B 2XTLA 4JY5H 1OE3A 4DVBB 3SDYH 3D4ZA 4JGMA 4WENB 1AZRA 1MQKL 3RFZC 2OQJB 3TNNB 3BRFA 5IIEB 2Y1ZA 4HVBA 1U8CA 2H9GB 3MRPB 5DGQA 3K72A 5C1MB 1VPOH 1YC7A 3HZYB 2PXYA 2J5WA 1TJIH 3VMNA 4XXCA 3MGOB 3NCJL 1BXVA 1CL7L 3ZE2E 4NQEE 1UXLA 5DJ6B 4Z7QB 3CX2A 1NEZB 4IS6A 1Q0YH 4ZMOA 2O6PA 5IP4A 1DVXA 1DP0A 1T7ZA 1EWHA 4MAUH 4F2MA 2JJSA 4NCC2 2CIKB 1ZVSA 4GEJA 2QVTA 1DR9A 1JVLA 4Y5XA 4AYMC 4LOEA 1JRHI 1N26A 4GAAA 3S36X 3TJEH 3O8XA 3STZA 3T3PF 4KMTL 3WE6B 1NCUA 2WQUA 3FT9A 4PGDA 3VD1A 2VC2L 2C9SA 4X4XA 3X3GL 2F8OA 1YMHB 5DMIL 4OF6A 1FNAA 4TXVB 3S4SB 5G5DA 5FUCC 3F01A 4HCRL 2ITCB 3QRLA 2QFRA 3ZUCA 2ICCA 1NGZA 4F7EA 4A2GA 4ZFGH 2KLSA 1UD8A 3F5WB 3NFPB 3Q8FA 1O6VA 3DX0A 4DKEH 4EQ3A 3PU7A 1BOYA 2MRYA 1FH2A 2WZ0A 4LCCA 1AGDB 1YUKB 2Q2EB 5HHVL 2CZNA 3V4VB 3QDME 1GIGL 3FQUB 4OZHE 1BWWA 5LJYH 1ZLUH 2WZAA 3EYUL 4G80B 4G83A 1Y1DA 2DQTH 3SPJA 1A64A 1P6WA 4KUCF 3KPSB 4LHJB 2H6PB 3HIZA 1ZDSA 2EDNA 3WL9A 1E4JA 3HE7B 3ILEA 4L8SA 2VDOB 5ELIA 3DIFB 4F8NA 2QKIB 4KAQH 3U83A 5E1AA 1W8NA 4FNPA 4UOQA 1IAKA 4JQVC 4HU8A 5JHLA 1N8ZA 1ECYA 2PPAA 3MX0B 1MI5E 4TOYH 4OIIH 3CFKB 2PCYA 2W95A 1GRWA 2TSAA 5L8LB 1YDPA 3AXLB 5F1IB 4NQUA 2FVNA 2F18A 3GSOA 2WQXA 4OZFH 3TYFB 3BUPA 4O58L 4JM4H 4PVLA 1L5GA 4DTGH 4UT6A 1NGWA 2DBLH 5F0JB 1IC4L 2BRRH 1QX1A 4JG0L 2YKLL 4L4TA 4AH2A 1KULA 4PRIE 2VB5A 3QA3B 1ETA1 4GRLB 3MNMA 1XF3A 3QG7H 4ONFL 5BZXA 1G9EA 4JO3H 1QAWA 4G5ZH 5I1IL 3K71B 3K5RA 2VLRB 4BUQA 4DOHE 4HWZB 3MYJA 3UJTL 2D4DA 4H4NA 4ZFOL 4QXUL 1EVUA 1WZMA 2XYCA 4LSSH 5EOTB 4GG6A 4WY7L 2A9MH 4OVUA 2AFNA 4EI5A 4GO6B 5AD0B 1NEUA 5CLWA 4LCWB 2BX5A 2LABA 5CU5A 4PRHE 5E2TH 3UDWA 4J3BA 1EAPA 2R0LL 2O5NA 3BP6B 2VKWA 3NN8A 5CZXC 4F7KA 2NY6D 4FA6A 1MW3A 3ZTNH 3L5JA 1HHKA 2NNAA 2BIMA 4P5TA 4IGBB 4OT1H 5A40E 4UDTB 4LAQL 3RWCB 3G5YA 3ECVA 2WXGA 5I23A 3QC5X 4J27A 3O41A 5GS1B 3I50L 5C09B 1TR7A 5AVYB 3NZSA 4CL7A 3KLKA 3SQBB 1YJDC 4XNYH 5E9DB 2AXJA 3W11C 4TQEL 1ZS8A 1H0DB 1BVLB 1HQRB 2IGLA 3QIWD 5I1HL 3R4RA 3Q3GA 5F70A 1ZDQA 3B9DA 3D50A 2OR9H 2ZWZA 1CLOL 1J8HE 3AU0A 2APTA 4JJ5A 4PJAA 4DT2A 1HXMA 3JSSA 5GRXG 1UH4A 3VGAB 1IGMH 3IE9A 1XFPA 2DLTA 3VGFA 3O6ML 3ULUD 4M6AA 3FU7A 3SQOH 4MMYB 2QZ5A 4AQ1A 4P46C 3PDDA 2NTFB 3CN2A 3BH4A 3OZLA 4NNYA 3FSWA 1KLFA 3FAWA 3A47A 4RISL 2D9CA 1ACXA 4IU2A 4PS3A 2DM4A 2IWGA 3QPXL 4S1SL 2COQA 4MA1B 1CFMA 1DO6A 4LAJH 5CJQH 1GR7A 5LNDA 4FL4C 4AEHL 1OAXH 1YMMB 3HC3L 1E28A 2XPGA 4H26B 4HUWB 4IOIA 4E9LA 5E4AA 3L3JA 2A6DB 4PS4L 1KGWA 2PTVA 2GAZB 5M95B 4GP4B 4G43A 4M1CC 5SX4H 1ZHKA 2K45A 4C83A 4X4YB 2CNZA 1SZNA 3OKNB 5FKPB 3UOAB 1GKOA 1T5WB 5IK3B 3VFOA 2KYIA 3EOBB 5IJKC 4XXWA 4FG0A 3CMGA 4BDVA 1K4DB 1VIWA 4UT6H 3H1ZA 3K2KA 3QUZD 1GTFA 4GQ9H 1HSBA 1YN7A 4A2DA 2AERT 1CDBA 4U6XB 3PJSB 4HH8A 5HI4D 2NCMA 3EH1A 1E40A 1HHJB 4MJIA 4WRLA 4BBWA 2ZF8A 5F6IC 2IGTA 4JCWA 5TE4L 4KHTL 5CD5C 3SZ6A 4R6UA 1WYJA 4WTWA 2CHXA 3WHXB 3A6BL 2MHAB 3GK8L 4PSRA 4XMKL 1U8LB 2JLPA 2N3JA 3PIQA 1BZ9B 1LEIA 1E6OH 2ZCLL 4OCLC 5F3HA 4B60A 4EBQH 3L1FA 4M8VA 1QEWA 4ANUA 4XGZB 4QLWA 1JHLL 1TJGH 1GOGA 3ARXA 5D96B 3MXWL 1BX2A 1XSIA 1SHSA 3WJMA 3BZFB 2JKRM 1DN0A 3T2QA 4RRPG 2OZNA 5E5LA 4P2RD 5DYOB 3ZDXF 5DHYA 1DVUA 2CHWA 5GGSY 4XVJH 4Z0XB 4X5XB 2ZJSL 4H88L 3B8YA 4ZMQA 1Q72H 4NUMA 4DGIL 4YC2B 3FBKA 1J1OL 1HE7A 4PAZA 4FNUA 1RIHH 2G75A 2ADIB 1UACL 5EFIA 1GCFA 3SPVA 3MJWA 4M61B 4DW2H 3T3PE 3L2LA 2JMRA 3UO8B 5LDUA 1Z9SB 2BSBA 4DCQB 5FUZH 3TFKD 1HS6A 3VFVB 4QYOB 2HB0A 3RWJA 2V9TA 1BQLH 2XXFA 5EPMA 3JZYA 1MCOH 4F20A 5CBEB 1HKLL 4HALA 5IBLD 1S7RB 4TVPD 1A3ZA 3RUGF 4XXDB 1J8KA 3L7EA 1F02I 2LT9A 1Q8MA 3UIYA 3VX1A 2C9RA 4IQHA 4S1DD 4QJ3B 3QHFL 4NFDA 3V0GA 3HLKA 2PMZA 1E30A 5DJDB 4WI3A 4RGNE 2R1YB 1Z7JA 4FZEL 5B7EA 4EMZA 3KWUA 3FUKA 5ISZA 3CAFA 2H4EA 2BWIA 2GFBB 4Z77A 5CILH 5C9JB 1KN4H 1TFPA 2DLEA 3MMEB 2Y7MA 1YUHA 5L8KB 2APBA 2YD0A 3I85A 4KI1A 9CGTA 3B37A 1T3FB 4OZFB 5E8NA 5J9PB 2YBGA 5GRJL 5L0QB 3HG5A 3FULA 3TFBA 5TPWL 2R56H 2HKAA 2ZKHH 1OW0A 4WHTB 1BZQK 1GC1L 2WLIB 4LCYB 4YHZH 5KVMC 1E65A 4PJFA 3O8XC 4FMKA 1CE1H 3NCYS 3F05A 2NY6B 3T08A 4FQCL 4G59C 5FM5O 4Z7AA 1YNLH 3NG5A 1QACA 2VKXA 4QRBA 4AQZA 2BM3A 3IWVA 5I1GL 4E5XG 2HTLC 4MMXB 4PJDA 2EABA 2DF3A 3N41F 5I8KL 1UEYA 2YUWA 4KQ0A 2L3BA 1BQHA 3OSKA 2X6MA 1SY6A 3GS7A 1NUDA 1A6VL 4N2DA 3GXFA 4GI9A 4XCNA 3BXNA 4KPHH 5H2BA 5D93B 2PXYB 1PVHA 4HEPG 3Q8AA 3C2SA 1HNFA 3WS6A 4AQ8A 5DVKA 4LVHB 2FE0A 4NRYA 3QIWB 4PV9A 4IS6B 4YFLF 3PFQA 1M7UA 2OXGA 5KANG 3QFJE 3K2UH 4HIJB 1GS6X 1ZVSB 4X6BB 4ZAKA 3TT1L 1DJHA 2EE9A 4JFOA 4X50A 5GRUL 1LK2A 2JSFA 5J6GA 4DN3H 4EDXA 4XE5B 4U31A 3STZB 4ZO9A 1R46A 4G6AD 5E56A 1G9NH 1JWSA 1HVXA 3Q5TA 1OD9A 4X4XB 5FDWB 1IV8A 3MLZL 3EH3B 3P9LB 4JFQB 2CO6A 4X8XA 5ACZA 3ATEA 3DX4A 1KJ3H 2X4TA 2YBRB 4L5FL 3KGSA 3S36L 4YVUA 2B2XH 3DXAE 5EBGA 3SGJC 5KVDL 1EFQA 5CCHE 4D94A 3T6VA 5E2UL 1NGZB 1CF8H 4ZOAA 2YGNA 3HFML 4AK1A 4HJ1A 4NGHL 1AO7E 3UYOD 1R17A 4NIYE 4AYFA 4LCCB 3W0WA 4S1RL 5IV2A 4P9HC 5DRXB 1ZA6A 4M5ZH 1GYAA 3CFMA 5E8DH 1C7SA 1JF6A 4NOFA 3I74A 1UYWH 3ARDA 3P77A 4N5EC 2QGCA 2ROYA 4LSPH 4XODA 1B2WH 2F54E 4KI5D 3UJIH 2FJGB 3PAYA 5AENA 2HVKB 3ZX1A 6TAAA 5JW3H 1B3JA 3OF6A 5G4NA 1V05A 1IAKB 5EUOB 1P7BA 4HLZH 3H9HB 4OZIF 4FXTA 3G5VA 3UDWC 1CBVL 1QSFA 4HGMA 4HPOL 2Q9OA 3CE1A 4ZFZA 1VLXA 5E99H 4WAFA 3BQUA 1T4KB 3ZZ1A 5EEZA 3B34A 4M4PA 4P5TC 3A6CH 4H8HA 2WSDA 1NCAH 2O5YH 4PRDB 5EH1A 1WD8A 1MHHA 3KW7A 3MV8E 1H6TA 5JW5B 2X38A 2Z31C 2NY2C 2X6AA 3J2PA 5ISZD 1BMWA 5BV7C 1NGWB 4QGYA 3NA9H 1JPFB 2XCMC 4X5WA 2VJ0A 4DN4L 4FA7B 2XUWA 3VYNA 2DQCL 3GT6A 5ANME 3WFDH 1KEGL 3S6CA 1AQMA 2R83A 2FUQA 3FFCA 4TNVK 5DRWA 1DVQA 1LK3L 4GG6B 1M1XA 1WTGT 2XVGA 4P2RB 5H35A 1N0XH 1SY6H 3B7UX 1A21A 2OTUB 4HDIB 3AWFA 4APQC 1BZ7B 2HJKA 2Y2YA 1GPOL 4C8XA 3OJMB 3KWWA 1LEKB 1SM3L 1HHKB 4A6YL 3RVXD 4M7KL 2RCSH 1ML0A 4Q6YA 1UA3A 3H8NA 2GSGB 1H3PL 2X3AA 3O41B 2GIMA 5I8EA 1NINA 2EEAA 2WXFA 4NM8L 3VXUE 1SBSH 3MLTA 2A7BA 4BZ1L 3DA0A 3HNSL 4QHMA 3BVWA 1XGTB 1ZS8B 4LHUG 3BLKA 5A2KH 3SD5A 3Q3GB 1AY1L 4LPXA 2BW4A 2GB2A 4PJAB 1KENH 1HXMB 3OAYH 4OGXH 1ND0B 1ERNA 4I3GA 5EWIL 4EOWH 1YYLH 2GC4C 4FXGB 4WWNA 4R4ND 4GSXA 1F3RB 3V9FA 3PWLA 4BZYA 3D18B 2E4TA 1A7NL 2CUIA 5FUCE 2PTTA 3T0XA 2NR6D 4IRSC 4CW1B 3KYKH 5SWSA 4NNYB 4MVBD 4H8PA 1KLFB 4B7LA 4BQ9A 4EN2A 2ZWYA 3E6HA 2GK2A 1GXEA 5FM5M 4P5MA 1K5WA 3IAQA 4BHUA 4RFNC 2OJEB 4C56D 1IFGA 3RUGE 2R2EB 3AG3B 4IU2B 3QJFB 5D2NE 5F21B 4DP5X 3GXTA 1SJXA 4M7LH 1NGYA 1KB3A 5F7FA 5GJTH 5D70L 3PABA 1AIZA 2WIIA 4RWYH 4NKIL 5T1LA 4ZG1A 3W0WD 2XPGB 2AQTA 1TU2A 1I8KA 1AR1D 1S9XB 2B4CC 4P9MH 1U91B 5CUSL 1UGKA 4QHKJ 3ARGD 4G43B 3S3SA 3QPQD 2D31A 4JX0A 4P2OA 3A4DA 2XHNA 4GEIA 1CIUA 4LVOB 5CLXA 3V0DA 1DQVA 2GJJA 4NZ8A 5E2JA 3SGEH 3X1GA 2GG1A 3VFOB 1OF2A 2NZ9D 4BDVB 1OQOA 2CR0A 3QXDA 4I18C 3WFHA 2JTYA 3IFNH 4XN4A 1HSBB 1HH9A 1YN7B 2EDRA 1PYWA 2VRKA 4PJCE 3UBGA 4YDKL 4BSWB 1NBQA 3DPDA 4PVMA 4HJGA 4L9LB 5AWNL 2QR0A 1OAYL 2VZUA 1DBBL 4EIZC 1B90A 3I75B 2J3SA 4Q97A 2Y6TE 4OFDA 5F3BB 2WXOA 1IM9A 3HPLA 1E50A 1QRNA 2I32A 3RDTC 4HEMA 3WJJA 1DQDL 5GISL 2WXNA 5ENWA 3RL2A 2YAQA 4F80A 3MRRB 4WTQA 2NUTA 3GO1H 5EU4A 2DM2A 2AEQL 3NJIA 1AIFA 4DGVH 2RB8A 2WV3A 4H2CA 4XMLH 2DEYX 4JL2A 4ADIA 3WG7B 1N12A 2ZYSA 4IDJL 3UG3A 3UTZB 1EAJA 1GGIL 3CPLA 4JQIH 5D1QC 3T2LA 1B0IA 2N4IA 4X7FC 5I17A 1PU0A 2APSA 2VXSL 5DHYB 3TOPA 3Q6FB 4J3SA 4KKZA 1F4YH 4HUMB 3WEAA 3V52H 3BPLC 2J1XA 4N6RB 5EB9A 1ACYH 1LQSR 3F58H 4GAJL 3NP3A 3LPGA 2YUVA 2G75B 3ZMNA 2QLYA 3SPVB 4APXA 4BRVA 4RBPK 3BKCH 3KAAA 3B6SA 3HVNA 4RRPA 1RQ5A 5I30H 1GJUA 1RU9L 3P2TA 4JM2A 1CXIA 3FOMA 2FJHA 5E6YA 3MOBL 1I75A 3SGDH 1CURA 1NC2D 3BD3A 1HOCA 3MBEC 3FCUB 5DEGB 1HXYB 4HGWA 3BEWB 4J1UA 1JG9A 3KR3L 4GW4A 4TNVF 1IBYA 4FG6C 4H8WL 2X6UA 3FUNA 2PYED 2EIDA 3MVSA 1SEBB 1I1FA 4WI7A 3ARZA 1KC5H 3KPRA 5C3TA 5T33L 5E2WL 2VL5A 5ISZB 3RB5A 1RJCA 3U6XS 4ODXB 4F7TB 2W9EL 3O3EA 2OCFD 35C8L 3LJ3A 4XI5C 1WFJA 1CFVH 3WS6C 4YSQA 1RMFH 5I71C 1YUHB 4OZIE 4M93C 4PGJA 3UBXG 4FQ1L 3KPNB 3QW9A 3L2NA 5E8NB 4K5NA 1BBJA 2B1HH 2JK5B 2ITDA 1OV8A 1U58A 4FN0A 1J9QA 1I3RA 3DARA 4Z7UF 2R0ZH 2VDNH 1E9OB 3ZHLA 1WS8A 4UV7H 2PCFA 4PJ9D 2EIMB 3KPTA 4RNRB 3CN3A 2Y1AA 4PJFB 2Q20A 2X09A 3D4CA 4X6DA 4XN8A 4P2OD 1KCSL 4GYBA 1NGXA 1CXEA 2CRZA 4RZCA 2B1OA 5AYTA 1MXGA 2UV3A 2FWOA 1NMAH 2BH0A 4WSJA 4PJDB 1IAII 4MD4B 5HHOE 1B0WA 3HOGA 2EC9U 4GP8B 1BQHB 2R2CA 3PAVA 3TA3A 5GS3A 4FNTA 2WJ7A 4XCNB 4AUYA 2ODHA 4KKCC 5H2BB 3A3YB 5C0BA 1NCHA 4DJMA 2WCGA 2CBOA 2LV4A 5BPPA 2UWEE 4EPSA 4UDUB 3BIBX 2GTWA 2IFFL 5HHXH 3KZ8A 1FYTE 1TLKA 4E5XA 3PHQA 4LLDB 2DS4A 3L3IB 3S2CA 1AMXA 1QRND 3V0VB 1HCVA 2YWYA 4JFOB 1LK2B 3F7RA 1KGJA 3MLWH 1G5GA 5I6OA 2A99A 5HI3C 3JTTB 2IPTH 4HEPA 1MUJA 3OLDA 1NMBH 2DLFL 2X0WA 2CIIA 3P30H 4RAUA 15C8L 1J10A 1TMCB 1XGYH 1OM3L 1EXHA 3R06B 4O00A 1F0LA 3D85D 5L7XH 5CM1A 1C5BH 1J8HD 2XDHA 5FKAA 2JH2A 4C56B 1FNHA 1CT8A 5FYLE 3RWHB 4UOZA 2PTUA 1KGXA 2X3BA 3FRUB 2VISB 1DDHB 3WKYA 5DVNA 1MFDH 1YNTF 1P5VA 4JN2A 3ZDZB 4XHJC 3HNVL 4AYFB 4L4JA 4QLRA 3W0WB 4ES8A 5IV2B 4CGTA 5IJDC 4K71B 1F41A 1BPVA 4B5ZA 2EILB 4B6ZA 1RSFA 2YQ2A 3ARDB 3ARGB 5MP6H 3PL6A 5EEWA 3S88L 2I7OA 2BP3A 3HI6L 3S37X 2DQ6A 2NXZD 2EIEA 4JM2D 3VVWA 4YS4A 5E70A 1UJ3C 1WIOA 1R19A 1K2DA 2G3MA 1KG0B 1A6WL 4MMZA 25C8L 1WAPA 4BK4A 5KTEH 4I87A 1EO8L 1ZXKA 5JQHC 4XTRC 2E75C 1QSFB 1A3LH 5CBAA 2HN7A 1XH3A 2BLFA 1F6AA 3LPFA 5JIMA 4IIQB 5AKSA 4FNQA 2P7TA 4I48A 4K9JA 3CLWA 1RK7A 1MHHB 1F8TH 3ILQC 1ACCA 4J3UA 3F6IA 1G84A 1AANA 3PHSA 4GIOA 3HC0A 1LO5A 2XXGA 6FABH 3N91A 1J87A 3FUEA 4OLUL 2BVUA 3NACL 5JQIB 5I0WA 4F2ME 1A7RH 3UXFA 8FABA 1KTKE 4IKNA 5DDHA 4U1LA 1XGPA 1UM4H 3E9TA 4L37A 2ED8A 4RDQG 1XXFC 4X6CF 4V11A 3ZQ9A 3Q5OA 1M1XB 1YECH 1OGAA 4PY7B 4U33A 1RHFA 1A7QH 1EANA 3QRBA 4I9WE 3WMPA 4BUHA 4B9IA 4B95C 1NBYA 1PX3A 1ZV5A 3NSJA 2FEEI 1I7ZA 2HJKB 3QEQA 1P1ZB 1VSCA 3CHSA 3DV6A 2R59A 2EYTA 3NP4A 3MN8A 4JFXA 5LBSL 1TQUA 5I1CH 4ELKB 3HJEA 1S7WB 4K55A 4U1SB 3L3DA 3PP4L 3RZCC 4FLOA 2IPUG 1SN5A 5IEKB 1J1PL 3MLTB 3NYKA 4ZODA 2JWYA 2X2JA 2VLKD 1NC2B 3B7YA 4HSAC 4PU2A 3MOQA 2W81C 4R4BA 2E6JA 2P47B 4JY4A 2Y7OA 3GM8A 2HX8A 4UQIM 4BH8B 1NBCA 4L4VE 3EYSL 3L5WA 4ZMLA 4ALAL 1YEGH 2PYEB 4UQ3A 4NBXB 4ZMVA 3O6LL 3MRIA 3QO0A 4OCYL 1G7PA 2HJLB 5J12C 4YXLH 2X0UA 4X8JA 2YS4A 5IVXA 2Y36L 2VXTL 2XWTB 3NRPA 2MTPA 1M57B 2PTTB 4DWHA 6CGTA 3N43B 2FQGA 1CICC 3CFCH 5DQJB 2BK8A 4X7TB 2FX7L 5B4MC 1G4RA 4LHUA 4IJ3B 2YSSB 5T3XL 5GS2H 1NLDL 4P5MB 4JO4L 5C0CE 3D5OF 2I60L 5I1KL 1UM6H 3S34L 1JN6A 4ISVA 1AZCA 4B9PA 2QGEA 4L4TE 2ZKYA 4P48A 1TVDA 2G0KA 3KDMB 4CMMB 2IAMA 4LOUD 4HCFA 1TU2B 2KPNA 4J23A 1I8KB 1PF3A 4KUCD 1UWXH 2NY1D 4PJ9B 1MRCH 1QNIA 3MLSH 3KWXA 3VQMA 1IQWL 1UASA 1F56A 4LF3B 4W6YB 1PEWA 2D31B 5AOZA 4P2OB 5AW2B 3T6ZA 3L9EA 3K6DA 4G7QB 4JFHD 1PJ9A 1FAIL 1ULVA 1D7FA 4LE8A 3KJ6L 4S2SB 4LOFA 4HWEH 4QY8A 4G8FB 1G0DA 1B4JL 2VDNB 2RTTA 2G3ZA 4S0TD 4RVBA 1PYWB 5HHQB 5F7LB 4PRAB 3V10A 1WEJL 2JELL 4L3CA 3HG1A 1I1AC 1VAHA 4Z7UE 5DO2D 2QR0B 3UAJC 4KGLA 5DYFA 3OTTA 4F33A 3D4GA 5TQ0H 3WAJA 2E76C 4X7CC 1G7HB 3U1PA 2JQMA 4OCMC 3SIKA 1R3JB 1Z2KA 1E8WA 1IUZA 1K3IA 1V3JA 2YXMA 4HPYL 1JZ6A 3O3UN 3ARBD 4MRBA 1QRNB 2WXLA 4M1GL 4H8QA 3RL2B 3ZR6A 1XL4A 3AJ7A 5T3ZH 4LFHD 5F7UA 5IMKB 7CGTA 4GI6A 2NUPA 2YFNA 3DJ9A 4KJPD 1A9VA 4ZD3H 3E3QC 1XGUA 1ETB1 2I24N 3QXAB 4B9FA 3VJ6A 1T22A 4HKZB 2QSCL 2VDML 3D85B 5JHMA 2VDPB 2Q8BL 1NOLA 1UFUA 3CPLB 4ETYA 5JHBA 5FFGA 1UKQA 1KB5A 4ELDA 2P52A 5CP7A 2L0DA 3C8HA 1OSZB 5GQBA 5E1HB 3QEQD 3EYOA 4KDTC 2FGWH 5T3ZD 1IGFH 1K6QL 3QFGA 1Q1PA 4YSOA 3ZXAC 2XRAH 2JKJA 3BKJH 1JNLH 5J13C 3TNMA 3DUSA 1KXQA 4Z78B 2E7LC 4DKDC 1R33A 5E7FA 1OF0A 3ATDA 1RJZB 1R0AL 2G2PA 2NXZB 2OMTA 3AT9A 4JM2B 4UTBA 3FOMB 1CLZL 2EH8L 2FJHB 4U1IB 5BZDB 2AK4A 4OJFH 3ML9A 5M94B 4KXAA 4EXPX 3PXJA 1C9SA 2PWFA 1YA5A 3O2DA 4FLSA 1YCSA 5MEPA 2BP0B 2J5LB 4HGWB 2E56A 4GW4B 2UXTA 4X4MA 4K23H 4D0DA 1QSED 1RERA 1RZKC 4WEEA 3BPNC 5DF0A 1CLVA 1ROWA 3BDYL 2J8OA 1G6RB 1I1FB 3VFPA 3X13A 3AC0A 4TM9A 3P4LA 4AEFA 4F7CA 5JXAH 4IBVA 4MJIE 1UD5A 5I18H 1IBHA 3FSZA 4YDMA 3R4DA 5EO1B 2ZOKA 1R75A 3K4DA 3UG4A 4PJIB 3REWA 3O3EB 2FR4A 2RMNA 4WTZG 4XVOA 1G9MC 3QQNA 1F11A 4IOSA 1D5RA 4G3YL 4FNLL 4RRPM 5CJXC 1H15B 3T6WA 1BBJB 4FP8L 2ITDB 3TP4A 1JFQH 3FB5A 1IM3D 5BRQA 4UNVA 2PCFB 1PEZA 1FH5H 4W9JC 4X5PA 4X4KA 3MNZB 2EDOA 4AXWB 2DLIA 3GMQB 3P4NA 3HCVA 2BP5M 2QQKL 3WEXB 5ICYA 2XKSA 5HHPB 3SE8H 1NGXB 1RZ7L 3U9UB 4M1DH 3JWDC 1KXTB 3VH8B 3GSVA 3UBXA 2V6HA 3GXDA 4JFEA 3WNKA 1FPTH 3TPUA 3W9DA 1UWGL 4PGEB 5HDLA 4YHNA 2XY1A 3IBEA 4X6CE 2QQNH 4FJ6A 4CVXA 2HLAB 4DPAX 4EZMA 2E27L 2JKSA 5IB1A 4OD3L 2NDFA 2VLKB 1VDGA 3CXFA 1BAGA 2GTWB 1TOXA 3GSUA 3KM1A 5D71L 5GIRA 1S46A 4J39A 4RGOH 2CBMA 3WIIL 3PHQB 3IKCA 2YAOA 1GVIA 1ZLDA 1KB5H 5F3BA 1TETH 3QRGL 2OMZB 3WY4A 5C86A 3ETBJ 3LXCA 5F0LB 1DQQB 2AQNA 2ZUQB 1O7DE 4YXHL 5JHDD 2CIIB 4GRWF 4RAUB 3R7QA 4XR8C 1NLBL 3QCTL 3NEOA 1NPNA 3DOSA 3E9UA 4HIXH 4JKLA 5G55A 1MFVA 4XPHL 4B9YA 2HXAA 2WPGA 5FKAB 5EU7C 1CT8B 4CN1A 2NW2B 5ADPL 1F58L 2VERA 4AL8H 4UTBH 1SFDA 4AMKH 1ZLWK 3T4AC 5JW4N 1IC5H 4CU8A 3UP6A 4ZMXA 1P5VB 4NKMB 3BVTA 5C0JB 3NA4A 4OGAD 2XTJD 4ENZA 5DLLA 4TTDC 3VDCA 4PP2A 4PJGF 2GCYB 3GRGA 1NGPL 3O2DH 2UY6B 2BC4B 5F9AC 2NY1B 2O6FA 4L8BA 3D48R 4RSVA 4JKMA 1KYOK 3V4PA