1N8OE

Crystal structure of a complex between bovine chymotrypsin and ecotin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
138
structure length
136
Chain Sequence
QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin A, A chain
publication title Crystal Structure of a Complex Between Bovine Chymotrypsin and Ecotin at 2.0 A Resolution
rcsb
molecule tags Hydrolase
total genus 19
structure length 136
sequence length 138
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1n8oE00
1P0SE 1XX9C 1ECYA 1SLWA 1ID5I 4IW4C 1XXDC 1IFGA 1SLUA 1SLXA 1EZUA 1AZZC 1SLVA 1N8OE 1EZSA 2Y6TE 1XXFC 4NIYE 1FI8C 1ECZA
chains in the Genus database with same CATH superfamily
2ZOLA 1J9QA 3GJFA 5C3TA 4Z0BL 4P2RE 4X8XA 4IBQA 2UYLB 4ENEC 3L3GA 5JUEH 2PXYA 3DX1A 1MHEB 4QJ3B 4Z9KB 1H5BA 1UA7A 5DO2D 1OAQH 3FT4B 2D3LA 5DVLA 5FXCH 1KJ2B 5CJ8A 3UC0H 4QEGA 3VMPA 4JRYE 2AQ3A 2XA8H 4JVPA 5EOCH 2CLVA 3BYTA 3VD0A 5AW8B 2GJRA 1UB6B 2I85A 4RRPG 2P52A 3TH2T 2Y25A 4X4ME 3VG0L 1B2YA 5H4YA 2PO6D 2X4NA 4NQCD 2A0LC 4I1NB 1V5JA 3SCMA 1HX0A 2CM5A 4X83A 5IKCA 3IDUA 4N25A 1MCOH 2P4AB 5HI3C 3SE3A 3UH8A 4YHNB 3T1FA 2J71A 1G7QA 5C07B 4UM8B 3WIHL 2A74B 1OAXL 2CBPA 4ZTPL 2AI0L 2HJLA 2YC1B 1IT9L 3GDBA 1T1XB 5L2JA 2W9LA 3C08L 2NX5E 2XA3A 3GBMH 3KWUA 4BFIA 4HDIB 5KG9B 1QSED 5IOPA 3ULUL 1M9SA 4PJ9C 4Y89A 1CK0L 1X7SA 1OTUD 1RCYA 3TO2B 2ZXWB 5DZAA 4PRHA 1R3KA 2BHFA 4NUQA 1M05B 5DHVA 1TQCC 3A4EA 2I60H 5AAMA 1SEQL 1T2JA 1MOEA 3UJJL 3H6JA 5EN2A 5K9QG 1BV8A 1NH6A 3KXFD 3QDGB 1UOVA 2M83A 3TXAA 4RFNB 1NCCL 2R0KL 1EJ8A 1R3IH 2VLLB 1JF6A 1SXBA 4K7PY 4NC1C 3VXPA 3WLBA 4XCFH 2QKSA 2ED6A 3GMNB 3U46A 3V5HA 4HUWB 4K7FB 4PJGB 5D8JH 5AZEH 1BG1A 5I66A 5D1XA 5A16B 3Q8EA 1NCAH 2OW7A 4MAYC 1WICA 1GGBL 3OKDB 3ZHNA 2IQ9H 2ARJA 3QVAA 4L4TD 2DQFA 1DUZB 4FG0A 4O00A 3IDYC 4IMKC 5DJ6B 5ECGA 1ODUA 2VQUA 3WN5A 4X4ZA 5K1NA 2XZZA 3HCVA 5I1HH 2YD0A 4U4IA 4WDIA 1IL1A 1P4IL 1TJXA 5FUZL 4N9GA 1TSHA 3ECWA 4AKOA 4C56B 2EILB 3BAEH 4ZNEE 5HHMD 1WP6A 1L9PA 3P0YH 5AB1A 2I9LA 1I75A 1XGUB 2VM4A 2E7BA 3DHPA 3GUTA 1N64L 2ZKHH 1QG3A 1UJ3B 1RIUH 3BKCL 1CFTB 1S78D 1Q0XH 1CGSH 2KLRA 2F8VA 3LQMA 4RAVB 1D6VL 1S7SB 3DJ9A 2XV2A 4MD0B 1D5XA 5SX4H 2DICA 2VM3A 3O3AA 2ZUVA 2LE9A 1ADQL 4PB9H 2V2TA 4WTXA 5C86A 3D9AH 2DBJA 5JNYB 3BXNA 1IBGL 3VU1A 4WEBH 3EHBC 1WFJA 4MYPA 3HC3L 3QG7L 4U1MA 3IFNL 1JNNL 4JFQB 4UOZA 3CSFA 1YAIA 2GTZB 2XVGA 3BN3B 5FOBA 2BSED 3RZCA 1G1YA 1ZT1B 3BPNC 3B9KD 5DMGC 5DA0B 4AH2B 1WS8A 4AI7A 2WLHA 2ZXCA 1P1ZA 3ZTJH 3L3IA 2APXA 1CL7H 4ZOCA 4QRSB 2B2XL 5EOTB 3W2DL 3QBTB 2IDCA 2G3ZA 3S34L 5ILTL 3L5HA 1SJXA 4J3OG 4I0PA 4DP2X 3DX9B 1RUKL 1A6AB 2G9HA 5L2KD 1RULH 2C4XA 3BN9C 3V4PL 2XJLA 4L1HA 1J9RA 1EMTH 3QAZC 3RVUD 4JFSA 3B1UA 1GTNA 3TBSA 2E27L 2A83A 3I3BA 1THAA 1XZWA 3FCUB 3RVWD 2CM6A 3G6DL 1T6WA 1R6VA 1UASA 3STLA 2XUWA 1Z9PA 1D3CA 3NRQA 3LXAA 4K71C 2VLKA 2UVFA 1ZLDA 2Y3NA 4FZ8L 2PF6A 1ZE3C 4GH7B 4WJ5A 3WD5H 3B2DC 3O4LE 3TJHC 1NANH 2V8LA 2XPGB 5E51A 3UBXA 4UOW0 3WUWB 5C0FB 3QIWC 4UQ3B 1F00I 2XV6B 3FC8A 1TENA 1TQWA 2G3MA 3KPQA 4OQ1A 3VGBA 1NCJA 3QUXC 5KBKA 1GZPB 1N18A 2K70A 4F57L 2R9HC 2EEXA 1TZIA 2ZG1A 3IXAB 4XAWL 3RUGE 4OLUH 5F0JB 3SQOL 3KYOA 4Q74A 3HNSL 1HU8A 2I7OA 3JTSB 2ESVB 5GSVB 1OP3K 1J11A 4R4BB 3T0VA 2YBRA 3IGKA 2RTTA 3IXTB 4BSVB 3GMQA 5HJDA 2VH5H 2JLPA 3W1ZA 2N4IA 3AG3B 4LPUA 2HA1A 3UZVA 4R7NA 1CXKA 4ZX4A 2E7MA 4KHTL 2X4QB 2C26A 1FUNA 1HL5A 4DGUA 4RBPH 3EFFA 1ACCA 1S7UA 3UTSA 1JZIA 3ULVH 3CFJB 1QRKA 1YUKB 3ZY7A 2XACC 4MS6A 3U7YH 2I9TB 1ZTXE 4ZS6C 2DH2A 4PRAA 1TXKA 4LIQE 5EDXA 3IU3A 1S3RA 4Z3TA 3B6SA 5HTSA 1RMFL 3WYRA 2OQJB 3S3PA 1AS8A 2VTFA 4M4PA 5EIIG 4CMHC 3EJYD 4AT6A 2AQSA 4FAAB 3RDTA 3AU1A 2IALA 5JHLA 3QZWG 2YRZA 4LESA 1C1EH 5D1QB 5C2BH 4GXFA 3ECBB 3QULA 4ODVL 5CGYD 4E9WA 2FHBA 1WGOA 5DWUL 2YMXH 4PFEA 1AZCA 3MUZ1 1N4XH 2XZAH 1X5ZA 2Y06L 2PR4H 2B0SL 2WLYA 3D87B 1RUAH 1YEWA 3TCTA 4L3EB 4DQOH 3L1OL 2WQ8A 1G7MB 5KTEH 1RURH 4XVTL 3P3RA 4MA3B 4FFVD 3RWGA 4DTGL 5ECJE 1CLZL 3T2NL 3K4AA 1AZRA 1TKWA 3ZX1A 5IEHB 4Y0GA 3US1A 1PLGH 3EH4B 1DQTA 1I8LA 4QRFA 4AGMA 3VJ6A 5FO7B 2N3JA 4F9LA 4U3SA 1XEUA 1FZKB 4LLAA 4OKVB 2L04A 1VKXB 2E76C 1E50A 4U1KB 4RDQG 2ZX7A 2FGZA 4XMWA 2F54A 3LOWA 4PRPA 4XPTL 3ZR6A 3FQXA 4CW1B 1FL5A 1NGQL 1OQXA 3ZSSA 4AEHL 1EBPA 2WZAA 3G5WA 4U05A 1QHQA 5F9JB 5J1SC 5JHDD 2Y36H 3I6GA 4FQJL 1FLRH 4HIIA 3GS0A 1QNZL 1BLNA 1MCDA 1YCSA 3O2DH 4NQSB 5B7MA 1KWGA 3FU5A 4TRPL 2HRHA 2N0MA 1E4JA 3TA4D 4OLEA 2WYHA 3LAFA 1LO4L 5B8CA 3E6HA 3L3KB 4KPHL 4AIEA 4C4KT 3KL3A 5I75B 1K3ZA 4M7KH 3DUUB 4PJHB 3FUIA 5EO9A 3U1QA 2IAMA 2ICEC 2ZOUA 4OT1L 4XMKL 4G7SB 3MDJA 2OR9L 3QFJB 4HZLA 4AQEB 4FZEL 4GRLD 4EE2A 1CDGA 4YSPA 3RNQA 5EBGA 4PGCA 5DZPA 2F5AL 3D34A 1YUHB 3DX0A 4MNGE 2GIXA 4F7CA 2Z1PA 3D3VE 4FGMA 5FHBH 1I8MB 2FX7L 5DQDH 2NY1B 4P3DA 4F7KA 3F7QA 4KXZH 3DURA 3TT3H 1UD3A 4Z7OB 4X0NA 5A3ID 1R3HA 4D0BB 5J9PB 1ETB1 3KPPA 2XX0A 4F1ZA 3IWUA 3QCTL 1JWSB 1INEH 4Y2LA 1TCRA 3VFUB 2J1XA 4YXKL 4M7LL 4HIHA 2YPLB 1PVHA 2EC9T 2DQTL 2OV0A 3LKOA 3ZTNL 1A7PL 3QWRD 3UCRA 1YY8A 4BCXA 2BP8A 5HGDA 3S8WA 4LLVB 2A1WL 2GT9B 1JTOA 3IBOA 2DLHA 1VRSA 4R0LB 3NN8B 3QQDA 1Q9WB 4GINA 2IIJA 5KYXB 1MCPH 1MFEL 1QBMH 3B9AA 4Z7UA 4HV8A 5IMMB 3ZDXB 1FV1A 2VAAB 3A21A 3CH1B 3H1ZA 5D70L 5I1DA 5C0AA 4QRUA 1FN4A 1MDTA 2AQ1A 2Y7LA 4JFXB 2MHAB 1HINL 4YDZA 3EXLA 3N85H 2V4LA 4M8QA 1ED3A 3IF1A 4WGVB 4ODHH 1KCUH 4FP8H 3MUHL 4IOIA 4B96A 3LNGA 4X8CA 2X87A 2VRKA 1WLHA 5D2LF 3TCLB 1HZLA 2VRAA 3KLAA 3P73A 5CFHA 3V6OC 1EX0A 4XC3L 4B5ZA 4U1NA 2DLGA 2WBWB 4JRXE 5DO2C 5JDJA 3ARQA 4JG0H 1YDPB 4HEME 3SGJC 1OK8A 2XWDA 4EN2A 2A4EA 3K5SA 4JDZA 2XYBA 3DX8B 4TOYH 1NLBL 5B4MD 2YQGA 4R96A 4FFYH 43CAB 5A2FA 4ZG1A 2GJ6B 2CZNA 1BXUA 1R0AL 5EZIH 5F8RC 5CEYB 4ANXA 2BOBB 3ELQA 2J44A 3HUJA 4FQ1H 5IW1A 2HT2D 5JHAA 4ZXBA 1CGVA 1I1YB 4FULA 1KN4L 2CNZA 2YQ3A 3DYPA 3B2UD 5J12C 5HP5A 3BFQG 2NXZB 2AQPA 3JTBA 4KZEL 3HI6L 3T1WA 4V1DD 3L4CA 2CIIB 1MHCA 3AB0B 3V5DB 5FYLE 3RBSA 3QDMD 4JEGB 1CS6A 1PQZA 2HYMA 5A1AA 2BVPB 5SWSA 1NBQA 3IFLL 1I1AD 4BFFA 2SODB 4QHKI 7FABH 4HD5A 1YEHL 3KYKL 3E3QE 3B4NA 5E8PB 3ZPDA 4MX7A 1DQLL 3ESPA 2EVHA 4FYRA 3T4AB 3BPCB 4WFGD 4ZJ9A 2I07B 3MNZB 2X4OA 2YPVA 3CXFA 4S1QL 4ANWA 4HIEA 1RZKL 1WA2X 1K72A 4XGZA 2FRGP 1HSBB 3T0EA 4YSAA 1FFPB 3GHBH 4KKPA 4XN2A 4ZO6A 2AEQL 2CK2A 1HIMH 3ME0A 3F6LA 3BVNB 1SHWA 3L08A 4NM4H 5I30L 5E9NA 2AHIA 3ARDD 2CWRA 4U6HA 2LOEA 1I7RA 3TO4A 2UXVA 4LLYA 3II3A 1GOFA 2AEIT 2AEPH 4TNGA 4XMLH 5LBSH 3WEXB 2ICCA 4CJ1A 1JK9A 3D85B 1IFRA 3QWOB 4ZAKA 4W9EC 2FBOJ 2VR6A 4KROD 3OF6A 5DGRA 4G80B 4ZQTA 2EACA 4UZUA 2ARWA 5JIHA 3HS0A 5F7NC 2B9BA 1TF4A 2PWEA 4JPQA 3MOAH 5EUKB 2MEJB 4GT7A 3MCKB 4J3OD 1MFAL 4HWBH 4JAMB 2X6VA 1DSWA 4CN6A 1IX2A 1EXHA 4Y5VA 2EDLA 1EJOL 1QRNA 3RGBA 1MRDH 1ASQA 5CIPH 3WTXA 2R69A 3MX0A 4WUUE 1BVNT 2K4WA 2KMWA 4NN7C 5JHDA 2GBAA 1AH1A 5LAXA 2AMUA 4GB9A 4HPYL 1DL7L 5KYUA 1BAFH 3GIVB 3IWVA 4WFED 2HT4D 1CGXA 3SE8L 1MY5A 1Q9OB 2BFGA 2EDYA 3B2XA 1NGYA 4LP4A 4E41E 5JLZB 4MCYB 3GI8H 5GISL 3BX7C 1AYRA 3OAWA 1RZJL 2J8UF 3FRUA 4KI1A 5GXBB 3CMOL 3VD5A 1YMMD 3HRZA 1S2EA 3KVPA 4UUJB 3QZOA 3JSSA 3SBRA 3ILDA 4Z8FL 4HD9A 1I7ZA 1IEHA 2QSVA 2B3IA 1JN6B 4JDVB 3B9VA 5JHLL 3MREB 3TN0D 1TTGA 2V2XA 1TMQA 3RVUC 1XEDA 3R7RA 1KG0A 2QQLH 3NCJL 3POCA 2MWCA 5EU4B 3CZFB 1M7DB 3X14B 1GCYA 5DD1H 4WGWB 2IOOA 4JPIB 5D7JD 3UGXA 4QGYA 2D7MA 1CXLA 4FNPA 4N2AA 3RWCB 2DMCA 2OW6A 4RZKA 3DOIA 3TX4A 2G2RA 1NMBL 3PWUB 1DLFH 3QO1B 3FO9A 1CDBA 4X50A 1P2CB 3N5AA 3EHBB 1JD7A 5E56A 4NJAL 1S6NA 2OYLA 3BSGA 1P6FA 4WO4C 5E70A 3IBEA 1DJXA 4OB5H 3DMMD 3GXUB 4YUEL 2FSDA 1TJHH 3V0DA 3BPNB 1Y18A 2UXGA 4ABQA 3SJVE 3TFKC 3BDYH 1OTTD 2RIKA 1XH2A 4MBRA 1FO0H 4HCGA 4N2MA 5FV2A 1YEIH 1GIGH 5AOMA 1G9HA 2A2QT 2APTA 1RJLA 3ILQD 3M1BB 3EOYG 5DRNA 3CN4A 1NC4B 3ETBF 4AYSA 2LT9A 1QFWH 1KPRA 1RZ8B 1U2CA 4TVUA 3LKNB 2FX9H 2GI0A 4PQXA 3HZMA 3QAZB 5FFOA 1DVTA 4MMXA 4N85A 4KO6A 2ZOTA 3L1GA 4YSDA 1L9SA 4PR5B 5ELIA 1JYVA 5IESL 5EA0L 2JXMB 1F02I 3WSQL 3R0MA 2OTUA 1G1KA 1NCHA 1UM6L 3DHMA 3HBZA 5D93B 3RHWK 3U6XA 4RAUB 4X6DE 4L3CB 3STZA 3DOSA 1IM3D 1S8DA 3EJYC 2XN9B 1I9IH 2R51A 3BKMH 5DDHA 5GS0H 1HVXA 1KPUA 2Q7YA 2XIDA 1E65A 1F3DJ 2AAAA 3OKKA 3QIWB 3WKPA 1L9MA 1U3HD 4G8GA 5JZ7C 4Z5RA 2WK2A 3MRBB 2WLJA 3GRGA 1B4TA 5B39A 3AS2A 5F1IA 1HXYA 1DUYA 2CBQA 2YXWA 3IGAB 4FQIL 2B8OT 4QAMB 4FFVC 1MXGA 4IRJB 1EUTA 3UOAB 5AYTA 3NFNB 3VI3E 1MJUH 1FDLH 2OL3A 3TBYA 3MRNA 2JSFA 2V17H 5HGBB 3DJZA 3KPSA 1I3GL 3CFNA 4P4KB 4R90H 2EH8L 2OYMA 3O6FA 1EO8L 2EE3A 5ESQA 3MGTA 3B7SA 1I1AA 4UIMB 2ITCB 4OFQA 5BJTB 1JYWA 4GYBA 3QPQC 1SHXA 1N19A 4XP1H 3H9SE 5DZNA 1MH5A 4JO2H 3FU3A 4Z7VE 5HHVL 1IEBB 5CP3H 3L3OB 4U1GB 1GZHC 3OAYK 4KTDH 3T3PE 3N55A 4JCLA 2GAZB 5CN1A 1HAUA 4HHWA 2IXQB 4RDBA 3SSGA 2P47B 4JHZA 3VXSE 2UYLA 3P4LA 4ZPTB 3VH8G 3WO4C 1MHEA 1KOAA 2B59B 3BQUC 1HFUA 1N68A 3MXVL 1NUNB 3DBXB 3NCYP 4OCRL 3RI5F 1KCRH 3FT4A 1A0QH 1KJ2A 3PDDA 1E7UA 2DL2A 4KFZC 4YIQB 2G5UA 1UB6A 2BNQE 5GRJH 3HE7D 4GAGH 1NC2B 1ULVA 3BD3A 4HXAH 4ONGH 1A6PA 2CPUA 2X40A 5KAQG 2C9VA 3K74B 1TG8A 4KUCD 4R5VA 2N0KA 2P80D 5AFAA 3GBDA 4YZWA 1X9RA 5AKRA 4L3ED 4YHNA 4FTVE 4K3DH 5C07A 4UM8A 4UINL 3UTTE 4RWYL 4HEPG 4X5XA 2A74A 4F8QA 3ZR5A 2NMSA 5IVNA 2YC1A 2WKGA 1A6VL 1WTLA 1CE1L 2KDYA 2DQCL 1A7BA 5ANHA 4OZHF 2NY2D 1T1XA 1U4EA 3VFGL 4LL9A 3LTVA 2WTRB 4LOUD 3N1MC 5D2NE 4HDIA 5KG9A 4NO5B 2X09A 2IG2L 3MRKB 3TO2A 1DBMH 2V33A 3A6CL 4X7CC 3ISRA 3CFKB 2VL5B 4YDNA 1UB5B 2VW4A 2ZKMX 4L4VB 3QDGA 2DM3A 1VLXA 2JQMA 2VLLA 4PJAF 3ML9A 1NDMB 2YPVL 5EOCJ 1FG9C 2DRUA 3LZLA 2VN4A 3GMNA 4GI6A 4HUWA 4K7FA 5D5MF 2W92A 1XQ4A 4MB4A 5A16A 2NY5H 4NAMA 1AGDB 4QRRB 3W39B 3MV9D 3OKDA 4DZ8B 5DJ6A 1DUZA 1UH2A 3NIDF 5F1SA 2VDNL 2VMFA 3GRBA 3CDZB 3NIFF 3X12B 4P2AA 2BZDA 4C56A 2DBLL 1N0XH 1RK0B 2VLJB 2ADFL 5C09E 4N20A 4O51B 1NCWL 1IBYA 2QGBA 1RH8A 3T0AA 3DIVA 4YGVB 3VXOB 3D2TA 2KLSA 3U0WL 1B0RB 3CHSA 1XGUA 3HG2A 1E9OB 2R0LL 2ROYA 3GK8L 2VABB 4QIRA 1J1PH 1N8ZB 1UJ3A 4AG4L 1A6TB 5TQ2H 2NY1D 4MD5A 1CFTA 2XQYG 1MAML 4H7VA 4RAVA 1YC8A 3OL2A 1S7SA 3B2UC 2X42A 3OKMB 4MD0A 5C6TL 1SBSL 4G9FB 1I9JH 1DQML 3SPVB 4JLRB 2VLRB 5KYWB 4KXDA 3QUZD 2R69L 4U0QB 1AHKA 2DW5A 2OCJA 2FZ3B 3A4DA 3EYSL 1H3PL 2KERA 4L3FA 4BQ6A 3AS3A 5CEZE 5J89A 1EHNA 3QIUD 3NA4A 4PS4H 1M7IA 4JFQA 5FGRA 2GTZA 1A66A 3WKNA 1E2ZA 2VE6B 4JFHE 3QJOA 4PRHE 1ZT1A 2IWEA 3CN1A 4UT9A 3ZZ1A 2Y0SA 5FR3A 4AH2A 1ACYH 4AC2A 5INDB 4U7SA 1WIOA 1NFKA 4QRSA 5FLUA 3UO1H 3DSNB 3ZLQC 5EOTA 3ZE1B 2BPBA 5HJ3B 3CU7A 3DV6B 4ZTOH 1EWHA 3P2TA 4KJQD 1JZ3A 2FWUA 2NY0D 4B9GA 2QADD 4HLEA 3BP5B 2VDOB 5D1XE 3UMTA 4WFHD 2YHGA 2HUHA 3F01A 3QDJD 4M43H 2L7JA 4GQPH 1RV6X 1PY4A 4C4KO 4I3SH 3CFQA 1BM3L 3RQ3A 3V6BR 2YJLA 3N9GL 2WANA 4EZLA 3MBXL 2XTSA 5KYNA 4XP6L 2A73B 4MNHB 4WTWA 3SE9L 4MJ2A 4DP6X 4KROC 1SOXA 3LVEA 3FFOA 3Q43A 3SOBH 2NYKA 3MROB 4PJBE 3SDAC 2XPGA 3KHOA 2WD0A 1PLBA 3WUWA 5C0FA 4UQ3A 2RALA 2X4PB 5CUSH 1J88A 2HRPH 1GZPA 4YFLF 5DK3A 4J3OC 1ZY9A 2IJ0C 3HR5B 4PJGF 3K0WA 3CDGB 3CSBA 3IXAA 5JXED 3PV6B 4WQOA 1T1YB 2OS7A 5GQBA 3JTSA 2CUAA 2ESVA 2JJSC 5GSVA 1KBGL 3HLAA 1LQBC 4R4BA 2GK0B 4WV1B 3K2UL 4XMPH 1V10A 3IXTA 4GQ9L 4IU2B 4BSVA 2DYRB 1U8CB 1Q1JH 1X7QB 4P5TD 2X4QA 4ANVA 1G9NH 3D4GA 2ZCLL 3ATEA 1E67A 1AGFB 3MA7B 3CFJA 4M6AA 1N5YH 2FO1A 4EKJA 4XWOC 2A38A 2J8HA 2E9JA 3G7TA 1XB6A 1CI5A 3F85A 3G3LA 1S9VB 1QEXA 3EYUH 4JVUA 2OQJA 1CPUA 2WOBA 3MBED 4AV4A 4P0DA 1TIUA 5ACLA 4PJCA 1OAUL 3SDYL 2WWOA 3U4BH 3ZKSD 5L88L 4U1HB 5E6IC 5PCYA 2BS71 1X9QA 4WHTA 4EQ2A 4JCMA 4P2OD 3ECBA 4E42B 1KB9J 4LP5A 1U33A 2P80A 2AXWA 4AEEA 3R8QA 4L3EA 1HQRB 5D7JC 1RSFA 2GSMB 1G7MA 3JT0A 4G6KH 4MA3A 1SQMA 2DQEL 4B3EA 2VLKE 3VGEA 4UIKH 5IEHA 2OL3L 4K3EH 1BDYA 4NN7B 4W9DC 2YAMA 4UM9D 3E8UH 3GXIA 1UACH 4I9XA 3HA0A 4N0CC 5FO7A 3DMMC 1JCKA 1MEXH 4XBEL 43C9B 4NHCL 4KO5A 3FB7B 1FZKA 4OKVA 1VKXA 4QXUH 4U1KA 4KNUA 4KBPA 3GLDA 1GTFA 1UH4A 4CW1A 1FI8C 3PJSB 3GKZA 4DKFL 5F9JA 1L4IA 3IGFA 3C8KB 4PU2A 2G4EA 1OAYL 1KTJA 2WKLA 3H4HA 1WAAA 4LSPL 4OBSA 4X7DC 5CJXC 3WKYA 3CVDA 4LSVH 1UWGL 5E2VH 4N1CA 4D8OA 4IEFB 4NQSA 3THML 2EEAA 4H8HA 3VFTB 4OV6F 1IC5H 1SGKA 4G6JL 4N3UA 3A67H 2RMNA 3SYQA 2WMPB 1Y1UA 3IFOB 4GRWE 1LE9B 3AT9A 3ZKMD 3L3KA 4GUCA 1KJ2L 4YHKH 5C0DB 1TEYA 2ZJSL 1M7XA 2VM9A 5F21B 5LQBL 4PJHA 4GG8B 4K3JH 4EQ3A 2EIMB 4YE0A 3WJJA 1N5AB 4OCYL 2BLFA 3DX2A 3QFJA 2DQJL 3N43B 3D39D 3UL4A 1ZXQA 4XVOA 2O26U 3V79C 1YUHA 4NQCE 1I8MA 3LS4L 2BHYA 1BM7A 1J5HA 4WO4B 3VDCA 4Z7QB 2F6AA 3ZDWA 4NO0B 1OW0C 3N91A 5IJKA 2ZNWA 4LSSH 3QFDB 4WHCA 3PXHA 4K94L 5J9PA 3QXDB 4R26L 4P9HL 3QUKB 4RMWA 2Z0BA 2VDPH 5F7DB 4RLDA 1ZEAH 2MFNA 5E08L 4XVJL 3AWEA 1JWSA 4ZFGL 5FM5O 5AUMA 4R84A 3VFUA 5I1GH 3QIUA 5KVMC 1Y6MR 1S3KH 4LLVA 1GGIH 3MRPB 4F8PA 2GT9A 3KPOA 1WGVA 1HTYA 4U6XB 3ETSA 1SVCP 3LV3B 4R0LA 3H3KA 3NN8A 1HZKA 1Q9WA 1NM9A 1SOSA 1UURA 5KYXA 2EXSA 1DJWA 2EO7A 1D7DA 1KV7A 2W5PA 2W9EH 2P9RA 5IMMA 4YHOL 2F54E 4JM2D 4PRPE 1FYHB 2CGZA 2VAAA 3CH1A 4KMTH 5GS0C 3BWUC 1TT6A 4JFXA 2MHAA 5DD6B 5DZ9A 2NNRA 2E8ZA 2R56L 2RCSL 1FIGL 5CILH 5GRUH 1E90A 4KWUA 2JIXD 1S7WB 1W15A 2H6PA 3TCLA 5I76B 4WWID 4AZUA 3GSOB 2ICES 3S37H 1LTXA 1WZKA 1ET8A 4R7VA 1YSOA 5DK2B 3T0BA 3QEGH 1YDPA 3HG3A 2AJVL 4L18A 1NCTA 3MLXL 1PAZA 1I3RB 3DX8A 2ZKWA 3PPSA 4CU8A 4ZDHB 4PCSA 5HYSB 43CAA 4K07A 2GJ6A 3IAQA 4OGQC 2EYSB 2QQNL 3F5WB 4XE5B 4JM4H 5CEYA 2BOBA 3HEIB 2VN5A 3O81A 4QRTB 4XMZA 4R3SB 5I1IH 1I1YA 2YUVA 2YKLH 3N06B 2IFGA 3VO0A 4I1PA 1FPTH 1T2XA 3BPOC 1RL1A 1CU4L 4BQCA 1JXKA 3MLVH 4NPKA 3ZQ9A 3F12B 2CIIA 2NY2C 2X89A 4RMQA 4LOUC 2ZTBA 3V5DA 4DGIH 2F74B 3DUSB 4EXPX 4XNDA 1UT2A 3BGFC 2BVPA 5DI8B 3OLDA 1E8ZA 1UTDA 3EH3B 2Z8WC 3T2LA 3KJ6L 4UT9L 3CLFH 3UZQB 4XN8A 1SXAA 2D0GA 3QHZL 3U25A 4O2EB 1LP9B 4Z7UE 3WO4B 5E8PA 3LIZA 5JQ6H 1G1CA 1OGAB 5AW2B 3BQUB 2F08A 4C55A 4Z7OF 5IVXB 2DIJA 5C0AE 4PYHA 1I7TB 4RQQA 3T4AA 3BPCA 4TVPL 4DVRL 1KENL 2CO2A 2I07A 3MNZA 1J9SA 2X5PA 5D7SL 3MV7D 1JPTH 1RFDH 2HWZH 5FW8A 4KVNH 4PS3A 1VEOA 2ZKXA 2EDEA 3MV8D 1I8AA 1IGIH 3ZYOA 2GJJA 1CD8A 5KVFE 4ABWA 1FFPA 4I3GA 1C8QA 5GZNC 3EFDH 3BVNA 1LO2H 3CNKA 3K6OA 2DQ6A 1V27A 1MIEL 1S7XB 3FTUA 12E8L 3ARVA 2BVYA 4H8WL 2O6EA 4U0RC 2VR7A 5E5UB 5IHHA 3CUPA 3WEXA 4G7VH 4EDWL 1IGYB 4K5OA 3D85A 3QWOA 5FYJU 4ATWA 4FABL 3AG2B 3T6ZA 4G80A 5CJQL 3QXAB 4HH8A 1O6SB 3N6YA 4JO1H 4EN3D 4YHPB 3ZE0B 4XPFH 3W0WB 1I8IB 3HUJE 4HWZB 1UG9A 2WVSA 5EUKA 3SE4A 1BZOA 2EE0A 1GW0A 4KOCA 2YRBA 1W72B 4QTIL 2WVUA 5E5RB 1JZ4A 4TS6A 5F3HB 4RX4D 4NJ9H 5FM8A 2FD6L 3HN5A 1NDGB 4G2AA 4Y5YB 1IKNA 3QUZC 3QCUL 3VFNB 1A4JB 4PJXF 2DEWX 4XMTA 4AYID 5E0FA 1JZ7A 3G5VB 4F8OA 4A1RA 2Q10A 4H88H 1P1VA 3GIVA 2AJXL 3FUKA 3L5IA 4ABUA 1S5IL 1L6PA 5FO2A 4DUWA 1Q9OA 4JHWL 1A4BA 1F1DA 3V0HA 3VTTA 5FGBC 5JLZA 4MCYA 1V55B 2DM7A 4N9OB 4JGUA 5C7XL 1RJYB 1T3FB 4F8TA 3C60C 4G6AD 4AMXA 1HESA 5IHUH 1GYCA 3L4YA 3ET9F 4MFHA 4UUJA 5CCKH 1QSVA 3LPFA 2FWLB 5JIPA 4AJVA 4N5EC 1ERNA 4H20H 1JN6A 4JDVA 3V4VH 1DSFH 3MREA 4Y8AA 2WBJD 4CU7A 4PGJA 1J1XH 1HNFA 5EU4A 4EKXA 4F92B 5EEZA 4C59B 3CZFA 1M7DA 1Z66A 5MEPB 3X14A 4AYDC 4KJPD 1CD1B 1D9KD 4JPIA 1A6WL 1P53A 1UM5H 3RWCA 2VT0A 1I1FB 1AMXA 3PWUA 4NO3B 3VWKD 3QO1A 3UBXI 4BZYA 3V0WL 1P2CA 1TQBC 1WFIA 5EORL 5DUPH 3BUIA 1H9VA 4MWFB 2XN2A 15C8L 5TPWL 5BVPH 4MNQD 3MRJB 4FQLL 4AUUA 2ZCHL 3VW3H 4JZJC 3APFA 4PBWD 4XTRD 1I85C 3L1FA 5JXEC 2K6YA 2IH1B 1JWUB 3EF7A 3HVNA 1MREL 5HI4D 4MB3A 1IBFA 4M6MH 5I19L 1QRNE 2HG0A 5KWYC 4JMXA 3KBHE 4X7SL 4POUB 1LWRA 2F1EA 2YD4A 3M1BA 1XDTT 5JHDE 3EO0B 3PCYA 3R0NA 4NP4H 1NC4A 3M7FB 2ENJA 1EHAA 3L4XA 5KVGE 2G4GA 3CN2A 4KTYA 1RZ8A 1DTUA 3L3JB 2RR3A 5E8DH 3BCFA 5EUOB 5BNXD 3LKNA 4GXVL 3T9WA 5DR5L 2D4DA 1ZVYA 1IKFL 5A2KH 1MVFA 1KXQA 1E3FA 1ZT4B 1TLMA 3G04B 4PR5A 2XBTA 2JXMA 2K8QA 1NA8A 3WDIA 5I1EH 2KC0A 5CLYA 1JZ8A 4NIKB 2C9PA 4C4UA 4YHIB 4RAUA 4L3CA 5FWRA 3T5WA 2XN9A 3CZGA 5BV7L 5I16B 2NCEA 1IAIM 1MPAH 1TPXC 4WGKA 2AQTA 1TTRA 2JJTC 2XKNB 3SDAB 3W82A 1EEQA 3FRPG 4MLIA 4P2OC 3QIWA 3MOBH 4OLZH 3GXTA 3STBA 1M7UA 2IPKB 1WCQA 3MRBA 5CSBA 5A2CA 5MP6L 3DOHA 5IQ7H 1NQBA 3NSJA 3PE9A 4LOEA 4XOAA 2VLMD 4YHZH 3K4ZA 3IGAA 4UTBH 4GUQA 5AAPA 2VXTL 4KKRA 1D7BA 4IRJA 1JFHA 5KVEH 5T3ZL 1KB9K 4F58H 1BQHG 4WY7L 3MRHA 3GMLB 5HGBA 4Q4IA 5I0YA 1DQQB 4P4KA 5T1LD 3LPPA 3FAWA 2CGYA 3GXNA 3I9GL 1WH0A 5JIDA 1GY2A 1OHQA 4I3RL 4L29B 4UIMA 3LS5H 2OMVB 5BJTA 1ZGLP 2JI2A 3FPXA 3GS4A 3H53A 4Y2DD 2Z9TA 3U4EA 4D3CL 3S0PA 1SLXA 1IEBA 4FYTA 1IGJB 4FXKA 4WEMB 5DZJA 1EZLA 1HEHC 3L3OA 4RGOL 1D2OA 1SJEB 2R0WH 4OF8A 5A7EA 5LGJB 4RBPK 3MLUH 2GAZA 4PMFA 5EO0B 4LSRH 3Q9PA 2IXQA 2HKAA 5E6IB 1JMXA 1G7IB 4GUOA 4ZPTA 3APDA 5DA4A 2ZUQB 4PJFE 5DF0A 5CIPB 3VI4B 5I6MA 1KC5L 3TZVC 2B59A 4Z77A 4IOSD 1NEUA 5KJRL 3DBXA 3LN9A 2BMKB 4MKTA 4HU8A 3PAVA 5IBLD 2HLEB 1S7QB 2ZYSA 4OFKA 4DEWA 4YIQA 4FJZA 4GW4A 4N24A 1RZ7L 1NC2A 4NZJA 2JLLA 3GB7B 4JFDB 4P46D 2WYIA 4UDUB 5C1MB 5DMKB 3X3FL 6FABL 3BESR 4G8GE 3CQQA 2YPKB 2EXYC 3FN0H 4FNTA 5HVHC 3S5ZA 5I5JA 5ADOL 4RETB 5C0BB 2Q3AA 4TQHA 1MFDL 4R8WL 4X8JB 4XXWC 4RGNB 4K7PX 4IK7A 1WEJL 4XNBA 2M1KA 4Q9CA 2EIZB 5KUMA 1FH5H 1A1NB 2WTRA 3I50L 4RFEB 3KPSE 3VNZA 4NO5A 2K4AA 4Z0BH 5E8EB 3MRKA 4OKDA 4KKAD 3RFZC 1ZSDB 4K8RH 3DDFA 1UD6A 4Z3GA 3CFKA 3LIZL 4ZS7H 2VL5A 4YMPA 3LB6C 1UB5A 1AKJB 4L4VA 5CJOH 1F4HA 4U3CA 2R29H 3P30L 1Y1DA 4IU3B 4YO0B 3DXAB 4XO3A 1NDMA 5K93A 5J1TC 1OSPH 4G6FD 5FLVA 3K1DA 2PYFB 3UABA 3Q44A 3DV4B 1AGDA 3W39A 4QRRA 3QWQB 2XTJD 1FO0B 3EJTA 2OMZB 3AREB 3W3BA 4MXQC 2FYYB 1JNLH 4F7PB 3EBGA 3IVKB 1AHMA 1T4KB 3CDZA 4ZTPH 3MODL 1MCWW 1PX3A 5C9JB 2JKJA 3AGVA 3NSYA 3QUYB 3X12A 3FQNB 3IMWA 5JIIA 5T8IA 1RK0A 3SKOB 1FF5A 4PBDA 3MLWL 2E6QA 4YGVA 1U8HB 5TE7L 3VXOA 2Y5TB 3SO3B 5HVFB 2P5EB 1B0RA 4QTFA 3ULUH 1E9OA 4KMQA 2VABA 1ZPUA 1N8ZA 4XO9A 2VMDA 1DFBH 1A6TA 1TZGH 2NQDA 4B53A 2UZYB 4PHZA 1RZFH 3UJJH 4FMKA 3WFHB 2Q8AH 3VXUD 1ETA1 1P84J 4AMKH 3OKMA 5C07E 4OVVA 4G9FA 1NCCH 2YAEA 3SPVA 4JLRA 1C5BH 4RFOH 4XB3A 2VLRA 5KYWA 5FW7A 4PJ8D 2FZ3A 5FYJL 1UZGA 2ZAHA 1NGPL 2CRYA 2BCKB 1GGBH 3ILEA 3MOQA 5K9JL 3FCSB 2NY4B 3GTTA 1DJHA 3NABL 2VE6A 2PWDA 1SRDA 2CA4A 4PJBF 1F8TL 3UPRB 4UV7H 3CXDH 3CDCA 2GITB 5F1NB 4IBVA 3V6OA 4GAJH 3TBTB 2PW1B 4CNIB 2ZXQA 4XH2B 3DSNA 1YMME 4K23L 4N2LA 1UZ8B 5HJ3A 3DV6A 5ACMA 4XP4H 1B0GB 1NEZB 1Q0YL 1XAKA 3BGAA 4OU3A 2MQ0A 3RYMA 1ESOA 3S4SG 1P6WA 2Y7QB 3BP5A 1VGEL 1VHPA 2ZWLT 5H35B 1ZK5A 3IFPA 4ZW8A 3UG5A 3ZZQA 3RIKA 1ADQH 1K4CB 4WFFD 3ERXA 1Z9MA 3FT3B 4JFZL 5LNEA 1RI8A 2D7TL 4KKCC 5F0PB 4OFDA 3BPOB 4C56E 2EVFA 1IBGH 2OXHB 2YSTA 2A73A 4MNHA 3G6JA 3HC3H 2D3VA 1KLUA 2WAQA 3IFNH 3N1PC 3QG7H 2EAEA 4CGUB 3MROA 3EDKA 1LQSR 3V52H 5T1DL 2X05A 2HTLD 2X4PA 3NACL 3D1MC 1KZYA 1ZJAA 5I8KH 1IBBA 3HR5A 3IDIB 4U1LB 3CDGA 5GGTH 2B2XH 2ZX9A 3W2DH 3I2CL 2B1AL 3FBQA 7CGTA 3MLSL 4PIRF 4UQAA 5GGQH 1J8HB 1RUKH 1VFUA 3MNDA 1IM9B 3DJSA 2GK0A 5IB2B 3BUTA 4WV1A 1WJ3A 3TM6A 1A3ZA 4IU2A 3DX6B 5KSBB 1O0VA 1WITA 3QXTA 5GHWH 3RWFB 2E7LA 1X7QA 4K4KA 3Q8FA 5A6IA 1GAFH 2E27H 1R24B 4LDOB 3G6DH 1JZ6A 1AGFA 3MA7A 3RWHA 3LXBA 5E4IA 1D6EB 5DLML 1GPOL 4NKIL 2BVUA 1QSFB 3C6SB 4G6AC 2X4TB 1TQUA 4FZ8H 5I74C 1S9VA 4QHUA 4HISA 4ETYA 4TVPE 5A2JH 4YLCA 1JPFB 1TMCB 1TJGL 1QWHA 3ILPB 5F9OH 5D7LD 5I71B 1WT5C 2WBJC 4U1HA 1MFCL 5JOPE 2FO4B 3CK0L 3VQLA 4TLKA 1AQKH 2QPDB 4D7BA 4E42A 3CG8A 4XAWH 3S35H 3PWPB 3VYNA 3BP6B 3SDCD 1OPOA 4NQXB 1DBBH 4KJPC 4ADJA 4I13B 2I69A 5FEBA 3D0LB 5T1JA 3QIBB 1JGLL 4GRWF 4LSTH 1E28B 3VA2C 4MCZA 4F7EB 2L8AA 3VWKC 5JW4M 4KHTH 1F11B 5GS1C 1PZDA 2G0LA 1YYMH 3HTLX 3M88A 4HSCX 3O3EB 4XTRC 3IJ8A 3FB7A 1W6WA 3CBKB 4ZUSB 1CDYA 4Y5XB 1JXFA 1GW6A 2FSEB 5HI4C 4H40A 4UQBA 3ZDYE 3C60B 2ESVE 1CG9B 3Q8BA 3PJSA 4OIIL 1DCLA 3DLQR 2B4CH 3C8KA 1AI1L 4FFZL 4BZ2H 1GYUA 4FKEA 3IMSA 4NUPA 4OUUB 2J25A 2WZPA 4IEFA 1CLOL 4XPBL 1E0OB 3LD8C 3VFTA 1U95B 3FBKA 5JO5B 4W4OA 3IGLA 1W8NA 4LT7A 2D3NA 2WMPA 2WNWA 4XRCB 3IFOA 3IAGC 5AB9A 2GEQA 1LE9A 3ATDA 4JPKH 4DKDC 4HOZA 2X7LB 5C0DA 4HKXB 4PVMA 4GSXA 4MLSA 2IDFA 4GG8A 5AVTB 1ZV5A 1ZCRA 3KH4A 3MN8A 1DDTA 5JPNB 1N5AA 4QNPE 2R39A 4PJCE 1MHPH 2F53D 1OIOA 4WENB 1AQMA 3I9AA 3GNML 1TQBB 5D96C 4OTXL 3VU2A 4L1DA 4UILL 2IGTA 4Z7NE 4NO0A 4JZJB 5AVSB 1QI5A 3KYNA 3QFDA 3ZDZF 3X3GH 3VXMB 1V3MA 4NYLB 3QXDA 4ODTL 4L3EE 3QUKA 5F7DA 1NGQH 5D1ZD 4E5XB 4JS7A 5GRXG 3TH4T 3N1FC 2NNFA 1B3IA 2L7QA 2J1ZA 4J4PD 2TSBA 1JERA 3HNTL 3FONB 1QNZH 2BNRB 2XOTA 3GJFH 3S88H 1JYNA 4WW1B 2IGFL 1PU0A 3MRPA 1XZ0B 3PP4H 1AVAA 4TRPH 3ULSA 3DI3B 3NA9H 3TESA 3LV3A 5KVDH 1LO4H 4LASL 2BHUA 4KPHH 4ELKB 3QYNA 5JXAL 3P02A 3P69A 4Y2DC 1BAWA 1IILE 2ZXDA 3VSTA 1O7VA 2PP8A 3GPEA 3T77B 4OT1H 4XMKH 5DD6A 4CVZB 1BZ7B 3BIBX 5JR1L 2OR9H 3EJQA 2EH7H 3NVQA 4LHUG 4KXAA 5FDWB 4AY0A 4RGMC 2P44B 3TJEL 2F5AH 3C6LC 1WAAE 1BD2B 2R2HB 2I24N 3CFTA 3WKML 1TPXB 2FX7H 1OE3A 3OX8B 1S7WA 4TN9A 4HJJL 4WRLA 4RH4A 2NLJB 3SDDD 1FC2D 1A9EB 1B0IA 3GSOA 5K59E 4XX1E 3U1SL 3TV3H 3CCHB 5HYJB 2NY6C 1JNJA 5DK2A 1JGDA 1LK3L 4M7LH 1CTNA 3S96B 1I3RA 2B5IC 2JMRA 2ZZUT 2DQTH 2JKWA 3PP3H 4GY4A 2R1WA 5FDYA 1A7PH 4ZDHA 5HYSA 3O6LL 2A1WH 3QFJE 1X5AA 3ARFD 6PAZA 2W0FB 4HQQL 4P46C 2GQHA 3HFML 1UYWH 2DYPB 2EYSA 3F5WA 2HMID 3UAJA 3RTQD 5IJBC 3M8OH 4QRTA 4R3SA 4XCNB 1JGVH 3KPRD 2G60H 5D70H 4NM8L 3L48A 3QRGL 5DMJB 3BMWA 1PG7W 3B5TA 1NCDL 2PP7A 1G6RB 3F12A 1FBIL 4HSQA 4LKXB 5T3ZE 1L0QA 1MQ8A 3C8DA 1AFVL 5B1AB 1GZHA 2F74A 4FXLA 3KJ4C 5I1KL 3DUSA 5FA3B 3RVTC 3WXVL 1I9RL 2XWCA 1G1OA 5DI8A 1BQLL 1SY6H 2WLLB 2WJ5A 3K81A 3OKNB 1XB8A 2E86A 2DIBA 3UZQA 2RA1A 2PCFB 3WY4A 3OZ9H 4O2EA 1LP9A 5D7IF 2VW7A 1OGAA 3ZDXE 1GRWA 3BQUA 3HC2A 3TZVB 4KX8A 3TA3B 3PHQB 5IVXA 3UADA 2YGPA 5AVZB 1I7TA 1JHKL 4HETA 4YFLI 5LKNA 1R0AH 1CXHA 2MMXA 4B0MM 1JTTA 3QEQD 2VR3A 5DQJB 1QFUL 2W9DL 2VDOL 4B27A 3NJKA 4OZIF 3ARBD 4OH2A 3PIQB 3LZRA 1GXEA 2AV1A 2VUOA 3QDJE 4XPHH 2CO7B 4QHKJ 3ZGHA 1UATA 4GJTB 2WWKT 1CLYH 4KZEH 1S7XA 1SLUA 1GKEA 2XX1A 4F15C 5HVHB 4NBYB 3QPXL 2B3RA 4N2OA 3OLGA 1IGYA 3BFOA 3VXRB 4UMSA 1TSRA 4X6CF 3O2DA 3CFDB 4K8RC 3VH8B 2GJ6E 1FJ1B 1AGCB 3QXAA 1O6SA 2NY7L 4L48A 4YHPA 3KYKH 3UC0L 3W0WA 1I8IA 1QZNA 3WOVA 4HWZA 4UNVA 1T5KA 1Z0MA 2X9ZA 2XA8L 1MCWM 1W72A 1ZAGA 4TQPA 5F3HA 3LPWA 4RRPA 1NDGA 4Y5YA 2YD7A 3GYRA 1TZ8A 1RZKH 1FZJB 3DIDA 3VFNA 4PJ8C 1A4JA 5IW6B 3FO2B 4JL2A 1MCOL 2UY7B 4MJ4A 5JPMB 3G5VA 2AEQH 2FLBT 2VOTA 4RVBA 4LCUB 4N2IA 2VDPB 5I30H 2V9TA 4KOBA 4GO6B 4J39A 4OZGA 2K8MA 3JZ7A 1I8KB 4TSAL 4OY9A 5LCVH 1JBJA 3VG9B 1RJYA 1T3FA 1FWXA 1MFBH 3GBML 3VYPA 3KAAA 3HHRB 5TFSL 4H0HB 5LVEA 4FXGB 2NCMA 3F65A 5TDNB 2C9UA 3S36L 3QJZA 4AW4A 3V10A 4DCQB 3WELA 2I60L 1GGCL 2YGOA 1MFAH 1TZAA 2AKRB 2CD0A 1E9PB 4IKKA 3PRZA 1INDH 1HQ4B 4YN3A 1XGYL 4C54A 2ALAA 1RHHB 5IBUG 5MEPA 1WV7T 1EJOH 1CD1A 1G7JB 3F3HA 1ZSHA 3CMGA 1B6DA 5IQOA 2WLNA 5D1ZA 5D8JL 4DEPC 4AQZA 1I1FA 2C5DC 1NCAL 5CD3B 4LVNC 4LRIC 4NO3A 3SGKA 4MJIB 2WWNA 3K72B 2K78A 3SE8H 1S4IA 2P49B 4FCHA 4MWFA 2HTLC 1J5DA 2CHWA 3MRJA 5J0BA 2JKRM 5D4QA 5GISH 1NIDA 3BAEL 3EH1A 3KPNB 4KH2A 1UXLA 2IH1A 1JWUA 4QXTB 2PWFA 2ITEA 3CMOH 4JCWA 3P0YL 4F9PA 1HYSD 1CICC 4FFYA 3DETD 1E4XI 4NKOB 2ZKHL 3EDDA 5AW7B 1RIUL 1INQB 2N56A 4EUPH 5JHLH 5KZCD 1LHZA 1Q0XL 1CGSL 3EO0A 5E6UB 3N44F 3ZHDA 4AYFB 1X5HA 4FTDA 4HKZB 4P2YA 3L3JA 5PAZA 5EUOA 4LE8A 3FTSA 2E59A 4PB9L 1EZVY 1WD9A 3D9AL 1HK6A 2UWEB 1ZT4A 3G04A 4WEBL 1CMOA 4LGSB 4BKLB 2XWJB 3OAZH 2Q2LA 4YHIA 2XSKA 3EGXA 1OLLA 2Z7ZA 1B2WL 5I16A 1BBDH 1BFOB 2IADB 3NSXA 4EF3A 2HJKA 2XKNA 3ABMB 4Z7AA 4EIZC 3Q6GL 3WDHA 1CL7L 4EVNB 4ZBJA 4L0ZA 4M62L 2KHAA 5CZVL 2IPKA 1PAMA 4JG9A 1FG2B 4LQFL 4S1SH 5IHBA 4ADGA 4PJFF 3FNKA 3LRMA 4UYPA 4Y9GA 1EMTL 2VJ8A 2EDNA 5DRXB 4PMEA 1X6NA 4A67A 4JRFA 4LL4A 3CHQA 5EIQA 3GMLA 1DQQA 5LLIC 1U0QA 2IFFL 2OMTB 1J0YA 5SX5H 2QQQA 4QHPA 4L29A 4AGPA 5GJSH 5LBSA 2OMVA 2A7BA 2XICA 4IGBD 5IFHL 5HXMA 3B1TA 3LPGA 1UM6H 3VFVB 3AXIA 2VXVH 1DDHB 1CDIA 5CP7B 1IGJA 1KTRL 5IWLC 4UF7C 4XWGL 3O9WD 3WS3B 2VDQH 3CQFA 1SJEA 3ENEA 2GKIA 5LGJA 3GZPA 1RU9H 3KH3A 3PQYB 4HWBA 3NRPA 1XCTB 4Y4KB 4GFXA 5EO0A 1OKEA 4OLUL 1GYVA 2WW8A 1DVFB 3UDWC 3R1GL 1G7IA 4ZMOA 5DD3H 1XTMA 2D7OA 3VI4A 3Q05A 1WIUA 2WCPA 2AK1L 5CIPA 4AW7A 3H3BC 2FECL 1MY7A 1FNFA 2VH5L 2BMKA 2VGLM 1S7QA 3DNKA 4HJSA 5ALCH 2B16A 4BFRA 5ADPH 3UJTH 1UVQB 2XN9E 3UTQA 5J11C 4NPJA 4F80A 5AAWC 1HCYA 4YHYC 3GB7A 4JFDA 5DMKA 2E7DA 1TEFA 1OP5H 3OHXC 2OCCB 2DQMA 3INOA 1FVDB 1MAKA 4IIZA 2WP3O 4I77H 4L23A 2F8OA 3FQYA 2NY3D 2YPKA 3QXUA 4LHUD 3IYLW 2ZWNA 5HHVH 3O0LA 3VWJC 4CVXB 3OMNB 1AR1B 4WSKA 1OXYA 3V4VB 4QXGH 1PTZA 4X8JA 2H1XA 5C2BL 4AGLA 2EIZA 1ONQB 2BIOA 2QGEA 1E4HA 1N4XL 1P6AB 2XZAL 4RFEA 1YEJH 2PR4L 1RUAL 5E8EA 3QK0A 3N42F 3C2SA 3TVMD 1RURL 1GGUA 1ZSDA 5D4JA 3GSNB 3MXVH 4OCRH 2PPAA 4Q7DA 1O5DT 5E9AA 1PLGL 3MJ7B 1AKJA 2P5PA 4HOMA 1E2WA 2CCWA 4EOWH 4J3OF 4YO0A 1A9VA 3DXAA 1UJTA 5FUCE 3K71B 4HMCA 3MV7E 1IQWH 3PDOB 3HG4A 4ETQB 2PYFA 5HHXH 3DV4A 4TUJA 2I27N 2ZUYA 5AW0B 3SDDC 2A6IB 2Y72A 1FO0A 4F7PA 1U8KA 2OMZA 3AREA 4FMFA 1MLCB 2FYYA 3EUDA 5IZ7A 5K69A 3IVKA 4UINH 3MRQB 5E7FA 2Y7NA 4NQEB 3ARGD 4ZODA 4D9LL 2NXYB 2Y36L 5C9JA 3E7JA 5DZVA 3QUYA 3FQNA 2Z7YA 1VADB 1KXTB 3VFGH 2GHWB 3NSFA 1R46A 1EZUA 3SKOA 1I82A 2KH2B 1F6FB 3O2DL 5DHYB 1U8HA 2H0EA 2P8LB 3RIFK 5L8KB 1E40A 1YNLL 2Y5TA 2IG2H 2P5EA 3ARFC 5DK0B 3X1BA 4X4YB 3IRPX 4TF4A 3SPIA 3VVWA 3RTQC 4B9IA 4ZMLA 2UZYA 5E94B 5CMAB 1YJDH 5E6ZA 5HDQL 5EO1A 2WB7A 2Z31D 4M7KL 3WFHA 1W72L 1E8WA 1GCFA 2WKOA 4U6TA 3VXMD 5LAPA 4JHAH 4ZO9A 2QLYA 3HMWL 1Y07A 3CPUA 1OP9A 1QHPA 3V0EA 2CPCA 1YEKL 3MCG1 2AXJA 5FHBL 4KKBD 3HFFA 4GKZB 3DECA 5DQDL 5A2LH 1L9TA 1BGXH 3TT3L 2B20A 3QHTC 2BCKA 4RGMB 3C6LB 3FCSA 4HJEA 4I88A 2WB1A 4AJ0A 2Y9RT 4WEEA 2VDNH 3N41B 5CS7A 3VNYA 1P9MA 4MD4B 3UPRA 4WU7B 2NZ9D 2GITA 5F1NA 5DEFB 3Q8AA 2D03H 3TBTA 2PW1A 3MXWL 4CNIA 2DIAA 4XH2A 3GBLA 2ADFH 1FVCB 2NY6B 4KAQL 2JTYA 1VPOL 4FL4B 1UZ8A 2LU4A 2P46B 3Q01A 1AG6A 1B0GA 1NEZA 4HXBH 4UBDD 4IBYA 1Z9SB 3PNRB 3CZNA 1MCPL 1SMDA 3BWAB 5I5MA 2Y7QA 3VXTB 2CCVA 3C5ZD 4RMBA 2EXTA 3ARBC 5H35A 1MAMH 2O61B 1EFXD 4UQ2B 2QDWA 5CP3A 5HHOB 3MLTB 5C6TH 4M5YH 5ICXB 3UPCA 1K4CA 4ODHL 1KCUL 3FT3A 5FYKH 5EC1B 2MRYA 4ZOEA 5IY5B 1CF8L 1MCIA 3W81A 1NFAA 1BXXA 2OXHA 1IVLA 2VDML 2Z91B 4WI8A 3MJ8B 1H8SA 2QV2A 2OK0H 2Y24A 3B9EA 3MUUA 2ERJC 4JG0L 2IH9A 3K2KA 5LHDA 2FNBA 1SOQA 4KK9D 3RTLA 2AXFB 5EU6D 1VZGA 4TOYL 3IDIA 4U1LA 4OD1L 3MYZA 4LPXA 4JHVA 1NWPA 3NK4A 4XVUD 5EU5B 4AZ8B 3II1A 1KIRB 1BEYH 2VQ1B 2AK4B 2VLRE 1J8HA 1BF5A 1TJIH 5EZIL 5DUML 1IM9A 4F27A 2NT1A 5IB2A 4FQ1L 4XHJD 3SQBB 1U6AH 4W9CC 3DX6A 1QUPA 2G9KA 5KSBA 3RWFA 3VD9A 4ATTA 2LFGA 4KZ0A 1BREA 1XGZA 1R24A 4HT1H 5ANMB 4IS6B 3GGWB 5CN3A 5GZNA 1BM3H 4F5CA 1AACA 1VENA 3NSCA 1U93A 3ZZLA 4M7LT 4J2XA 2WXNA 1QSFA 3C6SA 4NOBA 2X4TA 1T1ZB 4XP6H 3GBNL 2XYCA 4P2RD 3SE9H 4QHNB 5DEZA 3DVIA 5JOFB 3NH7H 4NZFA 5FO9B 2ODIA 1JPFA 2ZOWA 3LRGA 3ZDYF 1WFTA 3ILPA 1T03H 7FABL 4Z3EA 4JRYD 2JCCB 1EK3A 2FO4A 4WI9A 1PZAA 2C3XA 5EH1A 3MMEB 4XNAA 3PWPA 1A7QL 3BP6A 4NQXA 2BZCA 2CRMA 4PJDA 4TQIA 3RGVD 3N04A 3D0LA 4Z7WB 1VSCA 5L0QC 3QIBA 2CUIA 3FL7A 4HALA 4GQ9H 3WJMB 4FA6A 1NMAL 1O75A 1E28A 3QC5X 4F7EA 4NGHL 3G6JE 2MKLC 4LMQI 1IIIA 1UKQA 1F11A 1IC7H 2ZCLH 4DVBB 1CN4A 5LBSL 1G9MC 3O3EA 2NX5D 4QRPD 3EH5B 1HJBC 4ZUSA 1HYSC 2R59A 3C75A 3FU0A 4Y5XA 2FSEA 1WIPA 3QR0A 4LLQB 4EZMA 3LQAC 4KUCF 4Z7NF 3C60A 1O7DC 3JUZA 2N7BA 2H41A 3LNDA 4KXCA 5IROD 4PTUB 3MOAL 4G43B 4L8BB 1L5GB 1ZIAA 2GBVA 4OUUA 4P5KB 3BZDA 4BRJA 3J7HA 3KR3H 1BFSA 5JO5A 4PJIB 1LO0H 4NXSA 4FLOA 4XRCA 3L3DB 5EU3B 3BJ91 4UYQA 2F19H 1FL6B 1J05B 3L4ZA 5GZOA 2X7LA 3ATAA 4HKXA 5BRZB 1H8OA 5DJZB 2OL3H 3F64A 2YFOA 2AEOA 2LVEA 2Q9OA 1VCAA 5JPNA 4LVNB 2QVMA 4DUVA 2YUZA 4ALAC 1JZ5A 5G4MA 3GI8L 4CN4A 5HD8D 3II2A 4B9ZA 1A65A 3OPUA 2Q5BA 2WWKO 4JR9L 3ZQXA 4I0KA 3IU4L 4JZJA 1YQ2A 3W5NA 1JSYA 2AV7B 3VXMA 2X88A 1KSRA 4NYLA 3FTWA 4OI9A 4LCWD 2A9NH 4PW3A 4BFEA 1VACB 4E5XA 1CICB 2CE6A 4WTZA 2H0JA 3OKOB 3IE9A 4Y4FB 5IGXH 2QQLL 4P2QB 3FONA 4AQ1B 2BNRA 1UWGH 3VGHA 3T4YB 1AXSB 3QORC 4WW1A 3OV6A 4UNTA 1IE5A 5DD1L 1XZ0A 1J5IA 5C97A 4G6JH 3O41B 5E2UL 4BA8A 3IDXH 4J7RA 5IQ9B 2BY1A 4L8SC 3ZMRA 2E75C 3QA3B 2V3DA 1FFTB 3A5VA 3ZVVA 3QYMA 5LQBH 3CAFA 5AKVA 5KSVB 2OJEB 4I18C 3T77A 3K8MA 4OCYH 4CVZA 1BZ7A 3PAUA 2DQJH 5FDWA 3HB3D 4Z3IA 5B1JA 1FQ9C 3KGRA 1D5BB 1WFMA 2GTWB 3B3BA 1T5XB 1BD2A 2R2HA 3BLBA 3OX8A 4MS8D 3C5ZA 2NLJA 5F72S 4TNWK 1GC1C 3IMRA 1FO0L 1A9EA 2XTJE 4XCYB 1YEIL 1GIGL 3BD5A 1RLBA 4K94H 3MLPA 4P9HH 4GOSA 1ILSA 3AM8C 3CCHA 4JQXC 4XNQB 4AQAB 5E08H 1V8HA 4FQHB 1UGNA 3SY0B 3L5XL 4QYAA 4QRQA 2VWEC 1C16B 3B7TA 3S96A 2IDUA 2UX7A 3MCLH 1QUNB 2FX9L 4UQIM 2AQNA 1ORSB 3VFPA 2W0FA 4A2FA 2DYPA 5IT2L 1NFDB 1X9LA 3IT8D 5J6HB 2NY3C 4Z7QE 4L3AA 1FC1A 4XCNA 4F7MB 1XO8A 3UTPE 1O6TA 3CZJA 4M03A 5IJDC 4JO3L 5GS0L 4ODWB 4Q89A 3H9YA 1P7BA 1HC1A 4Y9CA 2WVVB 3FRPB 1G6RA 5L9DH 2R56H 2RCSH 1FIGH 4LKXA 1AOHA 3I6LE 4GRMB 2I5YL 3JTTA 2F2HA 4M29A 5T1KB 3V55A 2YIHA 2AVFA 5FA3A 3JWNH 4A6YH 3CHOA 1HSAB 4N86A 2WLLA 3OKNA 5F1OB 3SODB 4WIQA 2PCFA 2IMNA 4ZMTA 1N7ML 3TZVA 1BQHB 2YARA 1JXJA 4P57B 3ZHLA 2QKIB 2QELA 2V17L 4M8UA 3PHQA 3TA3A 4DPRA 2X6UA 2GY5A 4R90L 3JWDH 1UD4A 5I1AB 3Q2VA 4Y4HC 4X6EB 3RWEB 1LXMA 1QABA 4XBPB 4DUXA 2OKMA 4AENA 4P23D 5DQJA 1S7RB 1KIQB 3MRMA 1A7OL 5HGAB 5J11B 4FRWA 1OE2A 4YHYB 3P9WB 4JO2L 2DLIA 3PIQA 2VSKB 4IMLB 1MW2A 3EOBB 2VJXA 5AOJA 2CO7A 3SBWC 1OOWA 1X5LA 1ZIBA 5DC9B 2H32B 3ARGC 1CU4H 1BQSA 4HCFA 5ABZA 5HDBF 4KTDL 4WFFE 4ZRGA 1IZKA 3VWJB 2QSTA 3FMGH 4HUUA 4GKSB 5F6IB 5BMFH 1TZOA 3OSKA 3V4UL 3VXRA 3LNEA 3CFDA 2J5LC 3VH8A 1F42A 3ULVE 1FJ1A 1AGCA 1VIWA 4OFYA 2E4FA 3KJ6H 1IBHA 2E0PA 3P1VA 1KCRL 3D18B 3QHZH 1R47A 4KITB 3QI9C 3AXHA 2C1PB 4R2GC 3FSVA 5GRJL 4GAGL 3BUQA 3HI1B 2Q8BL 1DBJH 5I26A 1FZJA 1CYWA 4H8QA 5IW6A 3FO2A 1LMKA 1F5WA 5IROA 2KZKA 4MXVE 1T83C 1R4XA 2UY7A 5EEWA 5JPMA 3UAAA 4X6BB 4AL8C 4NQDB 3W37A 4K3DL 4YDIL 4LCUA 4HEPA 4LRNH 3CHRA 4JKNA 4IYKA 2EDWA 3EJSA 2NZ9C 1XBRA 4OFPA 1I8KA 1OHZA 1LP9E 2ZUSA 4JFFD 5FAAA 4AJWA 2FEJA 3BJLA 5CR8A 1OGAE 1G4RA 1VZHA 4KU1A 3AQYA 4YZFE 5BRQA 1FNSL 4EDWH 4OD3H 1JV2B 3F05A 4LEBA 5IVXE 1VAHA 3HKZA 4NPYB 4GP5B 4WSGA 4FXGA 4UBDC 5TDNA 2PP9A 1DBML 1F6AB 4K9EH 1ZV2A 4DCQA 1X5YA 1R33A 4IJ3C 4NKDB 2ZF9A 4NWUH 2AKRA 1E9PA 1KLGB 4QTIH 4LFHG 1HQ4A 1JI2A 1MCSA 2ENQA 3TONA 2FD6H 1OWWA 1I4FB 1RHHA 1CCZA 1G7JA 1E4XH 3M1CA 4NT6B 3QCUH 2OMYB 2ICWI 3D3VD 3BVDB 4UAOB 2ENPA 1U36A 3NMEA 3AFLA 4A2LA 5CD3A 3CVIL 4X5QA 3V0FA 4MJIA 3K72A 5H4ZA 2H6UA 2JKSA 2QPEB 1JXGA 1S5IH 3ZE0E 1E27B 3TF7C 1HHKB 1E30A 3W0WE 3QJQB 5HBBA 4PY7B 4J23A 3JVFC 2DJUA 2V9UA 4B9YA 4ZQKA 3LNFA 5I28A 3KPNA 2RQEA 4QXTA 4XVUC 1BFVH 1P7KB 4N0FB 4AIOA 4NKOA 5I0VA 4K3HA 1J1PL 3BKYH 4RSYA 4HLZH 1INQA 5TQ2L 4B50A 1NM4A 1UKSA 4XHJC 1HE7A 2J6EL 2BVTA 1QTYT 5ITFB 4AYFA 1QI3A 5DD0H 2HFGL 4HKZA 3K6SB 1XIWC 1I9JL 1PCSA 4EZJA 1JUFB 1UM4H 4OZGE 1QPPA 2Z8RA 1A6WH 2Y7SA 5BXFA 2UWEA 4PEEA 4XXCA 3NCYS 4N4YB 4NNPH 1Z3GH 4TUOB 2XWJA 4BKLA 4PS4L 2X9YA 4MVBD 4FQXC 4PBVC 5HJBA 1BJMA 4IIQB 2OM5A 1OPGH 2H2PC 4JM2F 4JRXD 4BQBA 3E6FB 4W6XB 1BFOA 1DANU 2IADA 3JYBA 5KAQF 1ACYL 3QJFB 4FQLH 2LW3A 4Y1SA 5MEQB 5IP4A 3UO1L 4EVNA 4BZ1H 1PBYA 3PXLA 1MREH 1JHLL 3C87A 3WFCH 2J5WA 1FG2A 5I19H 2EDQA 3AMLA 3RGVC 2BP5M 3T6VA 1AO7D 3D2UB 1FYTB 5KSAD 5L8LB 5FUOL 3SEPA 4WWOA 2FEEI 3PGFH 3GT6A 3HZKB 2CBMA 5DRXA 3PL6D 4M43L 1HL4A 1Q4NX 4HULB 1QW9A 1AZVA 3NZUA 2OMTA 5E2JA 3ARYA 4GXVH 3D0VB 1EDYA 4KJWD 2CKBH 5DFAA 1IKFH 3ZE2E 2R23B 3P0GB 4YVNA 3IGUA 2B77A 5FYLD 3LKPB 3AG1B 4ISVA 4LVEA 4FNLL 4FJ6A 3VFVA 1P7QD 1KEMH 2BDNH 2BM3A 2OCFD 3ZTDC 4E9RA 1DDHA 2EZ0D 4XO4A 3H2QA 5BV7H 4NKQB 5CUSL 2HRPL 1KGUA 3TEZA 3CIQA 1SYVB 3PQYA 1ZVHA 3KBPA 4Y4KA 3UEQA 3WFZA 4APQC 4ZT1A 1WT5A 5DEJA 1DVFA 5EUOE 5KW9H 3E2HC 1ICTA 3HG0A 2AJZB 4A66A 3SYPA 3HLKA 5TJWK 4XMPL 4MJ5B 3MJWA 3PYCA 4PW4A 5F44A 2JKLA 1UC6A 1EXUB 5L0QB 2HVJB 4F20A 3QP3A 2HN7B 1UVQA 1FGNL 1PKQE 1QYGH 3FQWB 4Y16D 1BYNA 3CZLA 5HD8C 1N5YL 5AZ2H 4I3RH 1NL0H 2ADIA 2DB8A 3F7LA 4U1SB 3AT8A 1FVDA 3MRCB 2XXFA 2XY2A 3ABZA 2DKUA 4NZRH 2OZNA 4FYQA 3TNNB 3EYUL 5KBMA 1ROWA 3H85A 2XFGB 4CVXA 4BFKA 3NEOA 4PS8A 4RGOH 3SBPA 3U4BL 3V4VA 1AZBA 1KF9B 1G6RL 4GUPB 3RB7A 1ONQA 4ZFOB 3VTMA 2DKSA 2AMGA 4RA0C 1DO5A 2JB5H 2PLTA 3OZLA 3RNKA 3EFOB 5B3JF 4HFWB 4FG6D 1JL8A 25C8L 4WUUD 3QQ3B 2JVUA 4FC3E 5SV3A 4DP5X 4L4JA 2V2WB 5KJRH 1WWBX 3NJIA 4WJG3 4X9FA 1CXFA 3ULUD 2XN1A 3MJ7A 4TNVF 4K3EL 4KY1L 2HRLA 4XO5A 1KULA 5BS0B 2WOYA 3E8UL 3BPLC 1UACL 1N6UA 5TDOB 2LGNA 4NQQA 4E41D 1RZ7H 5GS2H 2D9QB 1UH3A 3K71A 3BZEB 4W6YB 1MEXL 4YSUA 4ELMF 4Q58C 3PDOA 4ETQA 4AM0Q 5TH2B 3QEQE 6FABH 4QXUL 4MS8C 4OF6A 1SJMA 2A6IA 5KANI 1XXDC 2R7EB 1MLCA 4JB9H 1Z9NA 3VI4E 2FECI 3MRQA 3NZ8B 1ZHNB 4NQEA 4EUPB 4IRSD 3GM0A 3KEHA 3TURA 5BRZD 1VADA 1KXTA 1WEJH 4LLWB 3ZT5A 4OAWB 2EO9A 2OMBA 3I50H 5E2VL 2B7DT 5DHYA 3T2PA 2YD3A 1IC5L 2P8LA 3EGSB 1NPUA 1C08B 4WWKD 2NR6D 2HKFL 4X9GA 1CVSC 3BOVA 3A67L 3DGGB 5DK0A 4X4YA 2X12A 2OXGB 4FMVA 4JFDE 4F2EA 5T33H 1LD9B 3NJVA 3QORB 5E94A 4P9MH 5CMAA 4N8VG 3LIZH 1BP3B 4JFWA 4K3JL 1MVUB 4EZKA 1DVZA 2IV9A 4L8SB 1IEAB 3RL1B 2DWSA 3U36B 1BSIA 1Y7VA 3FT2B 5DJAB 4WTQA 3GJFK 4LHQB 4RGNE 2Q0ZX 4QJ5B 1LEKB 3OJ2C 4GKZA 3SJVD 1FZMB 3E1F1 1CZ8H 1T7WA 1H9DA 2XJKA 1QQDB 3UCQA 3EO1B 3C6LA 2QLVB 4JN1L 2VDPL 2C9RA 1ZEAL 4UTBA 1Z6JT 3MODH 4MD4A 4WU7A 4BFJA 3LDBC 4F37K 5DEFA 2MH4A 4AKPA 5I1GL 1F41A 2LLNA 3R18A 1ZTMA 1FVCA 5GRVL 1S3KL 3MLWH 1GGIL 3DXAE 3O4OC 1IVTA 4P23C 1TNMA 4JFTA 3BWAA 3O6ML 4QR7A 3VXTA 1B6UA 2BSSB 3AAZB 5H94B 2O61A 1A14L 3KW7A 4KMTL 4UQ2A 4ONOA 5F71A 2WSKA 5F96H 3MLTA 1VDGA 1PS3A 5HHOA 4DGYL 2VDQB 5ICXA 2PCYA 3ZK0A 3PP3K 1M3IA 5CILL 1LDPL 5GRUL 4HUMB 4OR1A 1KXVC 2BP0B 5EC1A 3U9PH 4JKMA 1KEGH 4URTB 5FYJH 2Y07H 3L7FB 3LH8A 3RY4A 4OJCA 1EHLH 1NGPH 4JE0A 3KLHD 2EVGA 2Z91A 3S37L 4N26A 1E6JH 3MJ8A 4GIOA 4WNSA 3SOTA 1CTMA 3NABH 3S7GA 3TWCL 4B9PA 2X9XA 4JL1A 1E43A 2BRRH 1YLBB 2XZCL 3NOIA 3QEGL 2AXFA 1GGTA 3RY6C 4HJ0D 2AABL 2QVKA 3TASA 3UPAA 5EU5A 3E0GA 4AZ8A 4YSEA 4RIRB 1KBKA 1Y6KR 1KIRA 2K3TA 3S3CB 1SLWA 1UGKA 1Q0YH 3ETBJ 2VQ1A 2EP6A 2AK4A 2MJWA 4V2BA 2PPCA 5A2AA 3V7AG 4LFHD 5IQMA 5LN8A 4JANB 3SQBA 4Y4HB 1Q72L 3H9SD 2YKLL 2BIHA 2K45A 2WSPA 3DTDA 3R19A 1FPTL 4M5ZL 1BVZA 4Y19D 5ANMA 2Y1YA 4IS6A 3RBGA 3GGWA 2ED7A 1PIFA 4DSYA 5CBAA 5CZRA 1CFBA 4JFZH 1FFNB 3TYFB 1TO5A 3RKDC 4DGIL 2IBBA 1Y0LB 4ESKA 1T1ZA 1NCBL 2EIBA 1UEMA 3OXRB 4M7ZB 3VXSD 4QHNA 1JGUH 4A7GF 3C8HA 5JOFA 3UG3A 2HT3D 5FO9A 4XC1H 4XVSH 1GH7A 5KEZA 1BQRA 4LAJH 3AZUA 3CLFL 2J5LB 2PTVA 3ECUA 3NFPB 5K9QI 2C9SA 2I7SA 3NACH 1K8DB 1KGWA 1I7UB 1I3UA 3FUNA 3B37A 3OPZH 1EEYB 2R29A 2IV8A 5BRPA 4BUQA 3TH3T 3MMEA 4AVKA 3I2CH 1BAGA 2OI9C 3QI9B 1ZS8B 3MCYA 1WAEA 1JPTL 2HWZL 3AY4A 1EVUA 1SDYA 1Q38A 3N41F 4KVNL 4R2GB 5F7KC 2X3BA 2O72A 5B22A 4Z7WA 4HC1A 3P3YA 2WWMC 3HPLB 1IGIL 4QOKB 5CSGA 5E4EB 4B6ZA 3WJMA 2J8UB 5JYLA 3T3ME 3E38A 4FTVD 5FPIA 1LO2L 2JNZA 3UTTD 4M5SA 1YZZA 2RQ8A 4H1LH 3VMOA 4MQXD 5TF1H 1GVIA 2DDQH 4ZUVB 3ABKB 1HKFA 5DLMH 3QJHB 1GPOH 4G7VL 4QCIB 1BZ8A 4NKIH 4HUVB 4EIUA 3WE1A 4J3UA 3DX7B 4K9EC 4LLQA 1HCFX 4DPBX 3H8NA 3KLDA 3GEFA 4JO1L 3L54A 1TJGH 2X0WA 4K73A 1ZE3H 4AM0B 4PTUA 1CO1A 1S5HB 1BMGA 1MFCH 2DZEA 1L5GA 4G43A 3FO1B 4L8BA 5KSBE 3CK0H 2PPEA 4DFHA 4OGZA 4P5KA 4D0CB 1ZXKA 4GKOA 4IJ3B 4AK2A 3MHZA 2A9BA 5E7BA 2CH8A 4EIGB 4GAFB 4F1SA 1XH3B 4QRAA 2Q2EB 1KCLA 3L3DA 5EU3A 1UQSB 4RA3A 2VIRB 1QSFE 3QE5A 1M71B 2I32A 1FL6A 1J05A 1U91B 2E46A 4H88L 4WHYG 5BRZA 5DJZA 2JQZA 1QLRB 4ZD3H 1QFPA 2PXYD 4OSUH 1E4KA 3LEYL 1A4CA 4WWKA 4AIZB 4F2FA 4NN6C 1G43A 4OLWL 2WINB 4E9TA 2AJSL 4GI9A 4NNXB 1MJ8H 5IHUL 1U8JB 2FJUB 3PWPE 5F7UA 4S0HA 2AV7A 3T2OA 2FCBA 4PJDE 1MG3C 4NHUB 5KSAC 4H20L 1VACA 1CICA 3V4VL 3M6DA 3VVVA 1AI1H 4WI3A 2WY3B 4FFZH 1ADWA 3OKOA 2IGLA 3PL6C 1QFWM 3EOAB 4Y4FA 3V5KB 4ZW5A 2BHZA 4P2QA 4AQ1A 3QNFA 1J1XL 1HNYA 1RAMA 4ZYKB 1E4WL 1EEUA 3T4YA 1AXSA 1UZ6F 3NZHL 1ADQA 1HJCA 1W16A 2DLEA 3O41A 1XIWB 3ASWA 2VMEA 3PGDB 5IQ9A 1IFGA 5JA8B 3GSNL 6CGTA 5CZXD 3BVXA 4BFBD 1OSEA 2XTLA 2JCCF 3NPSB 1JZHA 4CSPA 4I2XB 3LRHA 1CFSB 1ZJBA 5KSVA 2OJEA 1HXMB 4IDJH 4PRHD 5DUPL 5BVPL 2MIZA 2Y4SA 4FQXB 3NT0A 4LVHC 1Q0EA 4NI6A 3VW3L 3GNMH 5DJ8B 1D5BA 4F33B 4FG2A 4OTXH 1J1OL 1UT1A 1T5XA 3BT0A 4BSWB 4DQAA 5GGTA 3O2VL 2NNAB 3WNKA 1DCEA 5CGMA 3SO5A 1BOGB 4L0PB 4M6ML 1MJ7H 3OAZK 4XCYA 1GR7A 3VUAA 1G0XA 2A6KA 4XNQA 3IDGB 3JQOB 4FQHA 4CILA 3SY0A 5IVOA 4WWPA 5ALBL 1C16A 3T8XB 5HYQB 1QUNA 1NUFA 3MJ9H 1PD1A 2J57A 4LPCA 1IU1A 2IGFH 3HAEG 1ORSA 3FTYA 3MGOB 4OJFH 4Y16C 3T08A 3K6IA 3FU6A 4DKEH 2YA0A 1BXAA 3A24A 1NFDA 2H9GB 4YL4A 3LNIA 4DGVL 5I1EL 4PWJA 5J6HA 3I6KB 4JO4L 5HDOA 3SQRA 2HKHH 2J3SA 4H2AA 3OG4B 4F7MA 3VXME 4HJGB 1Y6NR 2A4CA 3ATBA 1C9SA 1MPAL 4PJIF 5JR1H 4R4NC 4X99B 4ODWA 3GPSA 3RRQA 2WVVA 3FRPA 1F18A 3G08B 3OVUB 4NCC2 4OD2B 3TJEH 1G0DA 3MOBL 5SX5K 4D9RE 5JHMA 4K2UL 4GRMA 3WKMH 3DPBB 5T1KA 2GSGB 3BKJH 1HSAA 2YRLA 3Q3GB 4YHZL 1HEJC 5KANG 3U1SH 4FG6C 4APQB 4BKTC 2BK8A 2BSCA 2W88A 4UTBL 4Y9EA 2A6DA 3UDWA 1EAJA 4KRLB 3OKEB 3GIZL 3H0TB 2KUTA 3OJVC 4ZI8A 1LK3H 1BQHA 4P57A 3FHEA 2QKIA 3WLWD 4CSSA 3J07A 3NQIA 4GAYB 5I1AA 3P3UA 4X6EA 4Q4EA 3RWEA 1KGYE 4HQQH 4XBPA 3LS5L 5T3XH 4PVNA 4OZHB 1S7RA 1KIQA 3EYQD 5HGAA 1BD2E 4MA1B 4HJUA 3UEZA 4PY8I 5AAWA 1CYXA 4OJYA 1N6QH 4MXVF 4I0PD 4IMLA 3ZL2A 4BHUI 2WQSA 3EOBA 3ZN6A 5ID0B 2QTVA 2XFXA 3CDFA 2A9MH 2HX7A 3CQPA 5GGVY 3CX5J 2WXMA 4IRSC 3MLUL 1LO5B 1FBIH 4GKSA 4BZ2A 5LJYH 4IOFC 5GGSB 4LSRL 5A43C 5DURB 4N68A 5I1KH 3D07A 3BSZH 2JK5A 1KBPA 3WXVH 5JQHC 3P4NB 1I9RH 4Y8DC 1BQLH 4X7FC 1UA3A 3KGSA 5F2FA 3TEUA 2VLKD 3JVGC 3D18A 5D5MB 4DNLA 3NGBB 2YAQA 4CAGA 2C1PA 3HBPA 3TJPA 2ED9A 3NIDB 4AQ8C 1SN5A 3OWEA 4NRYB 2KPNA 4OLVL 1F58H 3HI1A 4X42A 3NIFB 5CKAA 4KY2A 4JRLA 1ZK9A 5HI5D 1QFUH 1CDUA 1YNTF 3EYVB 1G7PB 3L17A 2X2IA 3FN0L 3V8CA 4X6BA 4M1DH 4NQDA 3UZEC 5CGBA 4YBQD 2BOLA 1DVXA 1KELH 3QJUB 1OTSD 4LBEB 3KS0H 3N2JA 5A6MA 4O58L 4LLMB 1R5VB 4HHAB 3QPXH 4GNKB 4JDEB 4S1RL 5BZWB 4BBWA 3D6GA 3EJUA 4L0YA 2IMMA 5G4NA 5BZXA 2K3HA 1K5NB 1JV2A 3QXVA 4D8PB 3CPLB 4NPYA 4UZSA 3DO7B 3UTSD 2YD6A 2YOAA 3CGTA 1F6AA 1KY7A 2WXKA 2NY7H 5EWIH 4FN0A 4K8RL 1A3QA 3P3SA 4NKDA 3KCPB 4ZS7L 3LN4B 4HCRH 5C08B 5CJOL 3CFEB 1KLGA 2R29L 2XQBL 5I5IA 1QWUA 2A4ZA 3RDTD 1I4FA 5E1IA 1OD9A 3O4LB 4XE0A 1MUJB 3OTTA 4NDMB 3HBQA 1OSPL 2R1XB 1W2KT 3CH8A 2WLKA 2OMYA 4NT6A 5DO8A 4YPJA 4HC1L 1JWMB 2XIBA 5INCB 1BJ8A 3VXRE 4WW2F 3KLHC 2CK0H 2WCSA 1XSKA 3BAXA 1JNLL 3RUGB 3T2QA 3D52A 3HOGA 1NAKL 4M6OH 1E27A 1AGEB 1HHKA 1HOCB 2VR8A 3LRSB 1DP0A 1UXWB 1EZVX 4PY7A 4HJ0C 4TSAH 4G11A 1CR9H 1QTPA 2NOYA 3GSQB 3L2NA 3P2BA 4QRPE 4UQEA 1QOKA 3APMA 4GBXC 2M8XA 5IIEB 4GI8A 2FEDD 3WEBA 5TFSH 4U4BA 1OZTG 1P7KA 4N0FA 5AQ0A 4YDLB 2MSPA 4X5RA 3KD4A 2VSDA 3S36H 2ORBH 1TZGL 1DFBL 3MLZH 3O4OB 1RZFL 1YPZF 1GGCH 1F2QA 3ARTA 3LMJL 3SKJH 4ZMVA 5ITFA 2F54D 4KK8D 4PRPD 2Q8AL 1K6QL 1U8QB 2UZIH 2ZE0A 4AMKL 1ZGLM 3K6SA 3HE6B 1XGYH 1HHIB 3DI2B 3WHXB 4HUNB 1JUFA 1AS7A 1C5BL 4RFOL 3OAUH 2V5SA 2BS8A 3EYOB 1QNIA 1BZQK 3LPOA 3ABLB 1YA5A 2FJHB 2X3AA 1IC4L 2KKQA 4S1DC 4TUOA 1S7TB 1EZSA 3REWB 3WJLA 4B7LA 4JGMA 2XRAH 1DVQA 4WHYH 3M45A 4A6YB 1PNCA 2HT3C 1YVLA 4IIQA 3OB0K 3BUBA 4PJ7F 2HH0L 1SY6A 4PRIB 4LCCC 2ZPKH 3E6FA 3BO8B 3OJMB 4UV7L 1F2XK 3CXDL 4NI3A 3MO1B 3QJFA 1P4UA 4GAJL 5I2IB 5MEQA 5TF0A 2ZOKB 3IPEA 3FU8A 2IAMD 1LWHA 3FQ4A 1W8EA 2Q76B 3MRDB 1EUUA 4XP4L 1ZD6A 4KRPC 4KNQA 1ITCA 1J0JA 4QPEA 1FSKB 2CLZB 3D2UA 4LCWE 4PJEF 1FYTA 4OV5B 2WXOA 4N0UE 1W6LA 5C0IB 4DIXA 4ERSH 3HZKA 1FVEB 3IJEB 4MJIE 4A7VA 1L9RA 4ANKA 5D6DA 4KTEH 3VSUA 4G8EB 3JV4B 3VQ1C 4MQXC 3D0VA 4Q6IC 4WU5A 4I87A 1XVSA 3VGGA 2R23A 3D05A 3F6JA 4X5WB 4HCIA 4ZZFA 3HJEA 4JE4B 1TVBB 3LKPA 1R3LB 3GXDA 5D2NC 2CO3A 1E7VA 1L9OA 5CCGE 1PMYA 1YEEH 3V52L 1B2WH 1CXEA 2CXGA 4L9DA 2APBA 1FRGH 1OANA 5I8KL 4PN6A 1SYVA 3WU1A 3RY5A 3Q6GH 4NCC1 5GGTL 5C0AD 2EVIA 1ZVSB 2CDGB 4I89A 4M62H 5CZVH 9PCYA 3PHOB 2W60B 3PUUA 3ZKQD 2I26N 1TZHB 2AJZA 1NMCC 4S0SD 5EZJB 5GGQL 4ODUB 2ZUWA 5DRWB 4YR6A 4XMXA 4LQFH 4EI5D 2UWEE 4MJ5A 4ZO7A 2BCMA 2Z64C 5GHWL 4MNGB 1AC6A 1EXUA 1AXTH 1GAFL 3RI5K 2PXYC 2HVJA 2J6WA 2HN7A 1H5BC 4NNYB 1X5GA 2IFFH 2UY6B 3FQWA 2MNWA 3HAEH 3BZ5A 1DQKA 5LCVA 2Y6TE 2EECA 1GMIA 4U1SA 3WDJA 5CJ5A 5IFHH 4NQVB 2OZ4H 4NUJB 4KI5E 3EJCA 3MRCA 5IR1B 5IUSA 3DJRA 4TULL 3CWGA 4CSZA 4MMZB 2FQEA 2DS4A 3TNNA 3L45A 2VXSH 4LCIH 2YZ8A 4KV5F 3S5LG 2ZAGA 2PPFA 2Z35B 4XWGH 3EJPA 5F9OL 3WIIH 3QJTB 2WUBL 3SCMC 4DH2A 1PG7X 5C0CB 3EJZD 4ZXBD 2KL6A 4GUPA 3MRLB 4JO5A 1AQKL 3SE3C 2SEBB 4B97A 2TRYA 4ZFOA 4JGJA 3S35L 4PGBB 3UFIA 3QCVH 1DBBL 1XSIA 3R1GH 4TYUA 5JHBA 3EFOA 1H3GA 1WQVT 1OWRM 3OR6B 4HFWA 1MKFA 2AK1H 3QQ3A 4Q9QH 5AW1B 1ML0A 1EV2E 2V2WA 4LSTL 5F7EL 5KUKA 4E9YA 5EF0A 5SWSD 1ORQB 4NB7A 4JQIL 5BS0A 4M00A 1T89A 2GJZA 3KDPB 3P9LB 2EUXA 5TDOA 1H0DB 1YYML 3Q9QA 5AAMC 3DBSA 3BZEA 2PW2B 1KN2H 3TTSA 2VR9A 5TH2A 2VSCA 1II4E 2FLRT 2UXFA 4PGZA 3MFGB 4LSUL 2FVNA 4PJ6A 5LNGA 2R7EA 1RVFH 4X7TA 1I1CA 3NZ8A 1ZHNA 3T0ED 2B4CL 3D5OF 4EUPA 5D1XC 1BZ9B 4BZ2L 4KK5D 4OAWA 5HHPB 1D2PA 4HH9B 4EI0A 2CMRL 3W57A 2F58L 5JOEA 3IJHB 3TO4D 3L4UA 1C7SA 3DGGA 3LSOB 2OXGA 3K2MC 2IO5A 3U48A 2HAZA 4JPKL 1LD9A 3QORA 2DQDH 4ZAKD 4OLXL 1T2QL 1XMWA 2WXFA 4WI7A 4FFWD 3RIAF 1MVUA 3NAAH 3OF6D 1K2DB 5D2LA 3VGFA 4L8SA