1N8OE

Crystal structure of a complex between bovine chymotrypsin and ecotin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
138
structure length
136
Chain Sequence
QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Complex Between Bovine Chymotrypsin and Ecotin at 2.0 A Resolution
rcsb
molecule tags Hydrolase
molecule keywords Chymotrypsin A, A chain
total genus 19
structure length 136
sequence length 138
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1n8oE00
1N8OE 1AZZC 1EZSA 1P0SE 1IFGA 1SLXA 1ECYA 1SLUA 1SLWA 1XXFC 2Y6TE 1ID5I 1XXDC 1ECZA 1EZUA 1XX9C 4NIYE 1SLVA 4IW4C 1FI8C
chains in the Genus database with same CATH superfamily
1T20A 1VACA 4MQTB 5K9QI 5E6IB 2YPKA 2FWOB 2EH8H 3MNZA 3BN9C 3HNSH 3SPVB 3ZTJG 2FTAA 3SE3C 1IC4H 3OC5A 1GOGA 2ENYA 1KCBA 2R2EB 4MAZA 2AQQA 3CN2A 1RJYA 3WXWL 2YD6A 3NCFB 5SX4I 4JVPA 4NBXB 1WUZA 4AQAB 4XVSH 4M6OL 1AR1C 3MAWA 3P4OA 4MJ4A 2OMZB 2Q86A 4ODUA 5DUPH 5L2JA 3KS0H 5DJYB 1T0MB 5K1JA 1ZA3B 3VXQA 5HVHB 2MJWA 4XOAA 5ESQA 3ZE0F 4DVBB 2WQVA 4IMKA 3N04A 3GMQB 3KNBB 1L4IA 1O7DC 1UQSB 1YLBB 1I9IL 2F2HA 3SJVA 2XRAL 3T2LA 4DHLA 1E90A 4C57C 1OY3B 2LLLA 2VXSH 1P5UA 4JAMB 3UTZA 2E8YA 3ZDYF 4P5TA 4IRJC 2OMNA 4NUGH 2MCPH 4X0KA 2Y5TB 3O41B 4DIXA 1NFIA 4YXLL 3NPSC 3VFMB 1T0MA 5DWPA 4UNVA 4M5ZH 1XF3B 3WO3B 3AWGA 2OZ4L 6TAAA 4ZT1A 4GKSB 3QZPA 2W07A 2LAAA 3HG0A 3M88A 3L4WA 5K39B 3TA3D 3ZKXC 1J8HD 4Y16B 4YBQC 4OFIA 2X3BA 8FABA 2HRHA 3MNWA 4PSPA 2D7QA 5IWLC 2W95A 2B1AL 3V4VH 2P8MB 2X70A 4HPYH 4M6NL 4PG9B 3P11L 1E2WA 1YDPB 1P7BA 2WSDA 1HKFA 1JUFA 3CDGA 2B1AH 3C8HA 1UEYA 4FL4B 3CFKA 3S96B 5AUMB 4Z3JA 1WG3A 2YD1A 5C07B 4B9YA 3DETD 1BGXL 1JGIA 3VI3B 1Y18B 2QQLL 2G2NA 1UB5A 4XNZC 3ZT7A 2ERJC 1NANH 3QIWA 2DLTA 3B2UD 4G6FD 5F7AA 2VDPH 3GIVA 4FFWD 2VLJA 4BEIA 4K73A 2YPLB 4ICWA 3FT1A 1JV5B 3BVNA 4NQEB 4R3SB 3PHOB 2YS4A 4JQIL 1YZZA 5T5NF 4LSSL 3CPLA 2E8ZA 4Z7QB 4A68A 2ICWB 2P4AB 2HXAA 5GJSL 3VFGH 1YEFH 4QHKJ 1L0XA 4NNXA 4ZUWA 4XPGH 3ALWA 3T0EE 4Q2ZB 4LCYA 1M7DA 5DSCB 3L3OB 3U1QA 3H7LA 4FQLH 3P0VL 1LEGA 2F53B 1MJ8H 4JKPH 3GTVA 5I18H 4M6OH 3VXMB 1QBML 5LHDA 4G1EA 3NK4A 3OZKA 5ENWB 4WHCA 4GXVL 4M4RB 1JZ2A 3CZNA 3TCLB 4CNIA 4H8WH 3KWTA 2EH7H 4L3FA 2WQAA 2V2WB 2YJLA 1C9SA 2NSQA 1NJ9B 3HFFA 3QNXB 4OUUA 2DLFH 2IO5A 2FE0A 3CFIC 4LEOB 4M6MH 5JHDE 1OWRM 2VDLB 5FV1L 5J12B 1R0AH 1HHKA 1JXKA 3EFDL 1VGKA 2WIMA 4LSSH 3UPCA 2F7IA 2OMVB 4QRTB 1RERA 1HAWA 2BP0A 3SY0B 5M95B 4ZUVA 3PRZA 1ZOXA 4HH8A 3VG9C 4LKXA 2C9QA 3UADA 1IT9H 4BM7A 5CEZD 4ZG1A 3LNFA 3GRWL 4NO0D 1NEPA 1JV5A 3BVNB 4NQEA 1T66D 3RWIA 2Y6TE 4ELME 5C6TL 1BGXH 2A6DA 1H8NA 3UGXA 4K3EL 4OFDA 3O3EA 4FZEH 4CVZA 5HBBA 3O3AB 3O6FA 1HVXA 4FXGC 1KY7A 1JFQH 1OF2A 2Y23A 4IOIA 5IM7B 2NY3B 4EZJA 5L8LB 5DEFB 1PZ5B 1E5CA 2K7PA 3TP4A 4OQTH 1F13A 4YBQD 1J0ZA 5IQ7H 5FM5M 4HUUA 5I66B 2FEDD 1NGWA 2XWXA 4FQPA 5DJCB 4XNUL 1NINA 5FFLA 2C8NA 1PKQB 3AABA 3LH9A 4QOKA 4UQAA 5F7EL 3RUGF 5BQ7A 3OKMB 5IJBC 2ATAA 3I6SA 3PP4H 3ZSTA 1F45A 2ZKXA 3NSJA 3C9NA 1FH2A 1AY1H 4HQQL 2WZ6A 2Z65C 1J18A 1A7RH 4L9LC 4ONFL 4FFWC 3RTLA 4WTZG 4UINL 5DEFA 2Q9OA 2DV6A 3H2PA 1OIOA 3MRCA 4PGBA 5HTSA 1PMYA 1GKOA 4R0LB 3UTPE 1JYVA 3U9UA 1EDQA 1UM6H 2O30A 3O0RL 2BERA 5EUOF 4WKZB 1AKJD 1KBGL 4HETA 2DTSA 3D4YA 5FUCE 1A1MA 3D07A 3FO2B 4GAAA 5EFIA 5JW3L 1A1OA 1Z3RA 3V52L 3D51A 4ISVB 1FNHA 1YN7A 4PWHA 4JKNA 4ZSOE 1G7PA 2IFFL 3HI6L 1YJDH 4ZQKB 5E1QA 4UTBA 1URZA 4MNQA 5BZDB 3SQOL 2ZOWA 1PTZA 3DX8A 2QV4A 1OAJA 4YHIA 2KDGA 1AANA 3BFOA 1FO0A 1KLFB 5FCUL 1EHLL 3VM7A 1U8QA 1QBBA 4R8WL 4XCYB 3WSQL 1CI5A 3EF4A 4KKAC 1HOCB 5C0CD 3MFFB 2WGNB 2XV0A 2DBJA 1CR9H 2N4IA 1EGJA 3PJSB 4BCZA 3SE4C 3T6VA 2XG4A 4PWGA 5KS9E 2Q8BH 2FR4A 2XTJB 4XN4A 4PJIA 1TQCB 5DD0L 5E2TH 4W9ZA 4F5CE 3M6DA 1M42A 2X87A 3QORD 2VZVA 4XGZB 4LDLB 3J27A 3T9WA 3S35L 1VFAB 4G6AD 3CVHL 3AZUA 4FFYH 3ZDXF 3T1FA 3A24A 4P2YA 1QQDB 2BOBB 4YDJA 1CURA 1QLFA 2HFGH 5D1QC 1A8ZA 2CJTA 1Q1PA 3DHJA 1DE4A 4MD0A 4RSYA 4AL8L 5J1SC 3QJUB 4JX0A 5INCA 3S48A 4CC4C 1LDPH 1YMHB 4JFDB 5CP3H 3ZE2E 1CT8B 4P9MH 3L3HA 3QHZL 3B7RL 3CC5A 3PV6B 5E6IC 5HI5C 5I15H 3TIDB 4X7EC 4KKZA 4PJ7F 3QFJD 3F83A 4PMFA 1TDQA 1AR2A 4RZCB 4P59L 4G8IB 4W70A 5DZPA 3RZWA 3ZMEA 1G9ML 3GSRA 3RTQA 4U6YB 4UWQB 2BSCA 2VDLL 3QUGA 2XN1A 1DJWA 5DTFB 1WTLA 2JJSA 4KMTL 5EUOA 4MAUL 1KOAA 2YPLD 5DQ9A 3MRQB 4FTVB 1N8OE 3B9VA 2PXYC 1AHWC 3QUXD 5ITFA 5A2IH 5KG9A 1QAWA 3X12A 3CXFA 3RWJA 1MEXL 1JP5A 3IDMB 4FQXB 5I1KL 4Y19D 5ISZE 2ZYIA 3U48A 2EEFA 3LS4H 3OBAA 3AQYA 4QYAA 4PJIB 2BNRB 4QPEA 4FA6A 1YEJH 1F4XL 3IDXH 4WSKA 1CTNA 4JFQB 4UMGA 4M48H 4YZWA 2FDBP 2XVGA 1T03H 2CMRH 3UC0H 3ARDA 1K8DA 4Z7QF 3UTZB 2GY7B 2EXSA 2Q20A 3ZTDC 2LGNA 1MIML 4ATTA 3BMVA 3ECQA 4IBTA 4NHCL 3CZSA 1CO1A 3LNGA 4TQHA 1A1NB 4ODWB 1AOHA 2DAVA 2OMXB 3FF8A 3HPJB 3L48A 4ZFOB 4KO9A 4XP9L 4L3CA 1UKTA 3QQDB 2J8UB 2RA1A 3A4DA 5EN3A 1JWSB 4ZD3H 1Q4NX 1CZ8H 1QASA 4QYOA 1M71A 3V0FA 1D5MA 1F90L 4ISVA 5C3TA 4YX2L 4E42B 5E0FA 2GUYA 3QO1B 4WKXA 5AOKA 4BFRA 3OGCA 4P9HH 4PJBF 3BEWA 4XT1C 5AYUH 3VGBA 4LSQL 5F89A 3CFNA 5HDBF 4WWKA 1A3LH 3QPQD 3X3FL 2RALA 1DANU 4B95C 5I24A 5GRJL 1Q0YL 3FTXA 3UGUA 4ONHA 5HJ3A 4RRPG 3GB7B 1ZANL 5E2VH 4KO7A 3WS6C 3NSXA 3FFDB 3G5YA 3EO9H 4NZUL 4K71C 5I5IA 1DUYB 5FC9A 2HKFL 5DR5L 5E2JA 1UC6A 3QJFB 4I0PB 4MS6A 5F7WC 5FW6A 4PVBA 1TO4A 2BIQA 5E1AB 2Z0UA 1A3RL 3HN8A 2QFPA 3NJVA 5KN5A 2QQNL 5F7FA 4X6EA 4BINA 3BZDA 1FZOA 1MVUB 1T1WB 3NYKA 4U1HA 1FZKA 5A2BA 4XMTA 4HCGA 3AXLB 5D4JA 4O02L 1E3XA 4GSUA 3N1PC 3PWNB 3VXUD 2G4EA 2XA3A 3CLWA 3F12B 3MV9D 4JZOA 4NNYA 4FJZA 1QWUA 5D2LA 5F3HB 3ARSA 2VM3A 4L4VA 3QULA 3F6JA 2HX7A 2XX1A 3NOIA 3QXUA 3GJEA 4FNSA 3ZL1A 2GSGB 4UM9D 4TPRH 5AYTA 2NYKA 3FTGB 4LL1A 4I18C 2GVYA 1EZLA 1G7IA 1FO0L 3GSNH 4TUJB 5ITBL 4MXQD 5JR1L 3BQUD 5HHME 1E5YA 3QIBA 1U8MB 4XC1H 1YJDC 3EZJB 2Z91A 1IC7L 1U8CA 4XC1L 5AVTB 2JF1A 5IHBA 2VDKL 5EZIL 1OK8A 3LPOA 1BM3L 1IGJB 4X7DC 4Z7WE 5F89B 2A6KA 2AV7B 2H26B 3FQNB 1JPFB 5AW5B 1HXMB 5LBSL 3BSZH 4BKSC 3RHWF 4AEIL 4J3SA 4AVKA 1A6AB 3I6LE 4KJYB 4WO0A 2YD0A 4UUJB 3CBKB 1TZIA 3M07A 5E70A 4JZNB 3FUIA 3S2CA 3UPRB 3F00A 1FVDA 5LAPA 4NKDB 1UVQB 4YH6A 5C07E 5HJGA 2APSA 4YZFE 1QATA 2VDRB 3NAAL 4NYLA 5F8QC 3L9YA 4Z7QE 1KB5B 3HC4H 4LEEA 4DKDC 2F1BA 1CLZL 4H13C 3LZNA 4OJEH 4DKTA 4JFQA 5C0RL 3MA9H 3OKEA 4JKWA 1UZ6F 4RFOL 3BKML 4U2ZA 1MXGA 3ULVD 1Q0YH 5T3XD 1Z66A 4LBEB 3BUBA 3GEWB 4JG0H 5GGUA 5DYOB 1I7RB 1N0XH 2GTWA 1N8ZB 2GJ6B 3BGFB 4CW1B 3MC0A 3OMZA 4UM8B 4QJ5B 4N90D 3WNLA 1AQDB 3ME0B 1KCRH 2H32B 3IWVA 2XPYA 2ZQKA 2WOBA 4LPXA 4NO0A 2VJ8A 3CBJB 5I75B 5HHMB 3KM2A 3PGFH 1T2QH 3QDJE 4AEEA 3AG3B 2XZCL 4PY8I 1GOHA 1ZANH 3CDZA 4G6JH 4ZPVB 2G60L 1HK6A 5I6PA 1RZPA 2JI3A 3UMNA 3DURA 4XHJC 5IMMA 3TVMB 2XV2A 2XICA 3C5ZB 2YA1A 1RJYB 4RRPM 1CUOA 1W8OA 4OI8A 1NUNB 1FLRH 3G5VA 4ODXA 3FN3A 1NCDH 2QPUA 4WUUB 2Z0BA 2IADA 2XX0A 3L1FA 2VDOL 4Y4KA 4YFLF 5E08L 1PFCA 1X5ZA 3FHEA 4KWUA 2AMGA 4XNDA 4WFFD 4X4XB 5I0DA 5E2UH 1GGBL 1PCXA 1CGWA 1ZT4A 4ZK8A 3SJVB 5HY9B 8PAZA 2V17L 2OTUB 4R4BB 4JMNA 5MEPB 4JM4L 5D7JA 2CDEA 4OBRA 3PAYA 2R8SH 2IMMA 2VL5A 2Y5TA 1GZQB 2R2HA 2F74B 2ZSVA 2WXFA 3GMPB 4U3SB 2K6WA 1QA9B 3W9EA 1ZLEA 2DWXA 1SYVA 4OD3H 4JFWA 4L8SB 3ULUC 4K7FA 2R2EA 3F58H 3P9MB 5I6KA 2ESVD 3BPLC 1T7XA 2FECI 4DEUA 3VXSD 3OF6D 2OBGA 3R8BB 2FWUA 2XV6B 2FWLB 1UJ3A 1PLGL 1LWHA 1VACB 3IMSA 1SXNA 4NQUA 4HULB 5EEZA 1A66A 5FO9B 5CEZH 4FABL 3NFNB 1DCEA 5HP5A 5E6UB 3VFUA 1ZHKB 4AIZA 2BSTB 2X4QA 1BD2B 2XKNA 2A38A 4G8GA 3O8XB 4FFYL 1XCWA 4G8FA 2PCFB 4XVUC 1RPQA 4JCWA 1S9KC 2VN4A 2A9NH 2C3WA 4G9FB 3QDGE 4KNUA 4U0RC 4R7DA 5K33A 3W38A 3B9KB 4YSEA 2KERA 3DHUA 4G8IA 4JFZL 3SGDI 3JWNC 4YO0A 5ICZA 5DS8B 4PRPB 1BLIA 3K5RA 3L9RB 1MFEL 5EDXA 1HI6A 2GSIA 2Z4TA 3M1OA 1I3UA 3NBNA 4ZOEA 2YA0A 1LVEA 1MRCH 4ZMAT 2ZUSA 4KJPD 4UAOC 4R97C 4AH2A 1WFJA 3C9NB 3S88H 2AGJL 3RUGE 5FKAA 2YN5A 1KTLA 3HZYB 1UOKA 3A23A 3MBEB 2D7OA 2VLME 3AW5A 4AZUA 4XP6L 4MLIA 4BIKA 4GQPH 5E1HB 4Z7UF 2Q7NA 2ZPKH 3W0WA 1KGUA 3H85A 3Q43A 4IBYA 3R19A 3HRZC 3S8GB 4NZRH 3QE5A 2LU4A 4HMDA 5C2UB 5JW3H 3NRQA 3CZEA 4ELMF 5LNGA 1HZHL 1I7TA 1VFBB 5ANMB 1NICA 1WD9A 4DT2A 4CMMB 4MCYA 5BQDA 5EULV 5EC2A 4ODWA 3T3ME 1KCUH 1KPUB 4LLDB 1K6QL 5IQOA 1AFVL 1P5UC 2E9IA 5KSAC 4YHIB 5DQJB 5HJBA 4WFED 3D69B 1B0RB 1B3JA 1I7TB 1VFBA 3A5VA 1JAEA 3SDYH 3WFEL 3ZE2B 1FFNB 4N5ED 5L7XH 1JDAA 3ZTCC 5F3BA 1A6UH 4HUWB 4LHUG 1ZLUK 3STBA 2EXWC 4KXBA 3L1EA 3ZZLA 3GRGA 3RPIB 4OQTL 5GGSB 4NO5A 3BVUA 3O45A 5EBMA 1ITBB 3RGVA 4UM9B 1J5HA 3K72A 3SJVE 4OU3A 1MHCA 1N0LB 5HSFA 4ABQA 1ZV2A 3MXVH 1G7LA 4XX1G 3HR5A 4AQ8A 3BMWA 2BSEA 3FFCA 2R0WH 3I6GA 3SCMB 1E5BA 5E5MA 4ERSH 5LGJB 3HB3B 2H47C 2DL9A 3AQDA 1BF8A 4X7SH 3RUGA 2CM5A 4JPKL 2JCCB 3NSDA 2IH3A 4AW4A 1UATA 3OB0H 3GDCA 4PWFA 2JELL 1EEYA 1NMAH 4I18B 3D2UA 2DYPB 2YMTA 3IJSB 2KLRA 2XZQH 3RL1B 2DIBA 2ITCB 1UM4H 3VXMA 4FYRA 4EN3B 2J8UE 4F9PC 2R2BA 3TM6A 1CXEA 4PJDE 4YAQB 4QF1B 5D1QD 5I5MA 4X4MA 2J1XA 5DQJA 4H8QA 1IIIA 1KB3A 3PQYE 3RWIB 2X4OB 1E3ZA 1QFUH 2B8OT 2FYYB 5DVKA 3DC0A 3P0VH 1CDIA 3P02A 1DUZA 3HE6A 1T22A 3AC0A 3M46A 2BP0B 1U3HD 2QZ5A 3QUYB 4JFOB 3UP6A 1AE6L 1LD9A 1AS6A 1IUZA 2QVKA 4KK5C 4NZTH 3BP6B 4YHML 2XFGB 3N41F 2X28A 5ECJE 3GTTA 4AVHA 3HG1D 1HAUA 2X89A 4WFHD 4CSPA 5I1AA 5FB8A 1WUNT 2FQEA 3RZCA 1Q9LB 2AQNA 4WI6A 3IMVA 1RZGA 4GBXD 1XSKA 5IVZB 5EIVA 4NQCA 3S3BB 3WS3B 4E9YA 5KYNA 1LJMA 3LNDA 4MSWB 5C9JA 5DEZA 3BAYA 3QJHB 4IOSA 4KVCL 3UAJC 4MJHA 3K2KA 3QEQB 3SOBL 1PKOA 4DQOL 3I02B 4J3TA 4DGWC 1KXTA 1OK0A 4X6BA 3SBPA 1LHZA 1KELL 1HHIA 4JRYA 1BZQK 4Q4IA 4U1LA 3LPFA 1S7SA 4QR7A 3BXNA 3AWEA 2EXWD 3SDCC 1NBVL 2DWYA 2EEBA 2YLHA 5GRVK 3ESNA 4OIAA 2PYEB 3W11C 4DVRL 5L9DL 1FZMB 1ZE3C 3HHSA 4JEGB 4BUQA 1CC3A 1LNUA 1MJ7H 1AVAA 5B1JC 2GTWB 3CZUB 4PRPD 1PG7X 1QVOB 1OB0A 3EDJA 4ODXB 1ZWIB 2PWFA 4L1LA 4CKQA 2VSCA 1M1SA 2AANA 4FG6D 4KPHL 4EKXA 5DMIL 4Y7MA 1LGVA 4IK6A 1XFPA 5IQ9A 1TCRA 2F54E 5HPMA 5DEGA 3JZ7A 4OZHB 4LVOC 3VW3H 2G5BA 3JUYA 4P05A 4Q74A 5JYLA 3ZDXB 4I9WD 5D4QA 3KNBA 5GRUL 4Z1PA 1XGYH 2EDXA 3AWFA 4JPIA 1X4XA 4B5EA 1YNLL 2CNYA 4QRPD 2QHRL 2DQCH 3EJQA 5JW4N 4L8CB 1I85A 1EWHA 4I87A 4OF5A 1VGEL 2VDNH 4QHKI 5IMKA 1MLCB 5C08B 1I9IH 2CBMA 1FORL 2F68X 5DJXB 5DFAA 5JW5A 3VU1A 3BAKA 5DDHA 1MWOA 3PREA 3U4AA 4RGOL 4C56E 2IALB 4HBCL 1UYWH 5L0QB 2A99A 4ELMB 3VD2A 4TSAL 5K39A 2WO2B 5C0EA 2CBOA 1COBA 1T20B 2BVPB 1UACH 2HJFB 5KOVC 3BP4A 1S7VA 1ZGLA 3S36X 4C59B 1H0DA 4N2AA 2VL5B 3RRQA 4ZW6A 1S7RA 4GG6A 3QR2A 3GI9L 1YAZA 3BDXA 2C7FA 3VB9A 3WFCL 5B3JF 2NCEA 3HE6C 4H88H 4BBWA 4GUPB 3BUPA 2XTJE 4OLYL 5T1LA 5DWUH 4PJ9D 4BGDA 3FT9A 4PGDA 2DEXX 5GS2D 4G43B 4CJ1A 3KZ8A 1EFQA 5AOIA 5LG1A 1QSEA 3HMWH 4Y4FA 3OKOA 3H8NA 2J1WA 3EW3B 3QIUC 4PRIA 4AIEA 5I16A 5DZAA 3H3KA 5IZ7A 4FFVD 5ACZA 1XGRA 3VRJB 4BZ1H 2FLMA 1H15A 4E0RA 4ZMQA 3ISWA 3QNYA 4LLQB 3JWNE 3VGAC 4AQAA 5BJTB 3LKSA 2ICEA 4LLMB 4LCVA 4M7LT 3IDYC 3WXVH 5JW4Q 4U3CA 4GBXC 3ZPDA 4G43A 1OGAB 3RBSA 3BUDA 4H26B 3GXMA 5TH2B 2K9UA 1J5CA 3WKNA 3FFDA 1DDHA 1VERA 2F54A 3ISRA 1IAIH 2C34A 3UAJD 3FCSA 2QHLA 3O4LB 4XNQB 1TYEB 4P5MB 1DLFL 3DMMB 4PJ5A 1UZ8A 1IKNC 2ESVA 4F91B 1SEQH 3WLWD 1UH4A 2EYSB 5DFWH 2VLJD 1JRHI 1EJOH 2DQJL 2Y07L 4X6DB 3GSVB 2VDQL 2CBTA 1Q9OB 2DD8H 2WYHA 4GINA 1S3KH 2ZP8A 4Y19E 5ISZD 3WY1A 1KJ3H 4DKEH 3QDJA 3MXVL 3SODB 2KZ1B 1T7ZA 3ZDZB 4PP1C 4PJGF 4PJHB 1B6DA 3PHQB 1RJZA 4XOCA 1R3JA 4ZFOA 5AUMA 4RAUA 3N44F 3MLRH 3HI1A 1ACXA 3D50A 3F7KA 4NC2B 2NY2C 2PYFB 1BVNP 2R56H 1KXVA 2CUIA 3MLUH 1YDPA 4CAGA 5HJ3B 2WXIA 4PRIB 5G5DA 3GMRA 2NX5D 4WI8A 1LE5A 2XN9D 4Q0XH 3FO0L 1N70A 4F8OA 1JHLH 4J1UA 5IP4A 3ARBA 2WLJA 2GHZA 4HIEA 2X2HA 5AYQA 4FQ2H 1KCUL 3CQFA 2C9AA 3KJ6H 4OSUL 4URKA 1LDSA 2ZXCA 3R06B 4GMTL 1JWSA 1R47A 2BNUA 1FH5H 1F3DH 3Q2NA 2EQDA 3MJ9L 2RFXA 1HXYA 1HZHH 5CJBA 4ZNEA 2R2CA 1USZA 4JK0D 4XB7A 4PV9B 4J8QA 3LXBA 4DN3H 3VSVA 4QHLB 2QSTA 2A83B 4UZUA 1TJXA 3BUTA 3ZYZA 1NFDF 3UJIH 3V4VA 1D5IL 4LSDA 2E7DA 3MHZA 5HGBA 5FYLH 2VSKB 3T8XB 4CBPA 4AX3A 1XV8A 1DBKL 5F9JB 2UUDK 3VD3A 4D0BA 1AQKH 1TF4A 3U6RB 3JT0A 3PGDA 5D70H 1XGQA 4L3AA 3W9DA 4N9GA 3K46A 1KSRA 1R3IL 2DQEH 5E4EC 1W8EA 3T6WA 2DI8A 3HPLB 3EJYC 3E8VA 4Q4EA 3VMPA 4QOKD 1YEKL 3U0WH 1ZHNB 1ED3B 1NCWH 4OCYL 4W93A 5ICYB 1LP9A 5E6IA 2HT3D 2WBJA 4PGDB 2EO9A 3TBYB 3QUXC 2MCG1 4RFEA 4YHLH 1NAMB 1OGPA 5B38B 4Y1AA 3MNDA 4TYUA 1ILUA 1F2XK 1S3RA 3KPOB 2ICWA 4KK6D 4HKXA 4URTB 3KPRD 1HZKA 5KTEL 5HHPA 3RVVC 5D71L 1XMEB 3A3YB 3D48R 1U3NA 4LLYB 2HT4D 4FJ6A 4LAQH 2EE9A 4R96B 1BFVL 4YSUA 4DEPB 4XE0A 1T1XB 5FDWA 3K6DA 4E41D 2YXFA 5B4MC 3N3EA 4W9JC 5DYOA 4RIRA 4ZODA 3ES6B 4H1LA 2DBLL 4M02A 2ISDA 3TA3B 4TF4A 4I0KA 3GMOA 5DO8A 4OFQA 2XFXA 4OD3L 3A47A 4ZFFA 1JZFA 4TMPA 1XCQB 3NABH 3FQTB 3SZ6A 3CHXA 3OAYH 3PGCB 2CK0L 3KJ6L 4OSUH 3DGCR 1RAMA 3D5OF 3T1FB 3DPDA 4XCEB 3QISA 3ARWA 5SWZB 3JVGA 1HILB 2YGPA 5I8KH 5FO8B 2BM3A 3HI1B 2B08A 4GKSA 1JJUA 1M56B 1PNDA 3QK0A 4PJ9B 1CBVL 4DO4A 4KVPA 1FFPA 3ARGC 4OZFB 5FUZH 3HE6D 4XP9H 2K4WA 3B2VL 2AK1H 3UYPA 3IGLA 1TETL 5JPNC 3RJOA 4GO6B 3BKCH 3FONB 1CQYA 4HT1H 1YQVL 3PWJA 4XCYA 1QFPA 5EUOB 4NO0B 3RGVD 2JKSA 3D08A 1CDYA 1KIPA 2CCVA 1H3GA 1MCNA 2WQSA 3D3VA 4PJBA 1BQHB 4ESKA 2VDKB 5K59F 3REVB 3ETBJ 4BDVB 2XWDA 1F6FB 3IKCA 2OMZA 2WP3T 4ODUB 4Y9BA 5DK2B 2P1YA 4ELDA 4GSQA 3SGJC 1CDHA 1DLHA 4ZFOL 1T2QL 4LPYA 1OF0A 2A9ML 5D5MA 1X5GA 3DYPA 5JOFB 1KCRL 2F7QA 5IOPB 3AAZB 4D0CA 1M9WA 1AQ8A 1WVZA 1CGUA 4P3CH 3C87A 3WEXA 4MYPA 1U41A 1Z2KA 1DBAH 2NZ9D 3IAQA 3ZW3A 1ZHBA 3Q7JA 2VRQA 2MPVA 1O7DE 3MRBB 3O2WL 1ADWA 3SKJH 2A74B 4G1EB 5KYXA 5EH1A 3TURA 5TQ2H 2F53D 5AZEL 5JA9A 3HG2A 3VI4F 4PJXE 5I75C 4BKLA 3QUZC 5J3HC 1RSFA 4UF7C 1GIGH 2CG9X 4YFLI 4OFYA 2LVCA 3BPNB 4GAGL 1MI5B 1HHJB 4PV1C 3KLHC 4NHUB 3G9VA 1TJHL 3M17A 3COOA 1IU1A 1ASQA 4EN3A 1A6TA 3U25A 1H0DB 4B9GA 3CFDA 3PAZA 5EU4B 4D94A 3FBKA 3GI9H 3ZDYB 2AKRA 4AL8H 1T1YA 1BW8A 4NJ9H 3E9UA 4AVJA 3IYLW 4AJWA 4MQ7B 3G9AB 3HG1A 4IKIA 3V6FB 3G6DH 2P9RA 1G9NC 3SDCB 1SOSA 4Y2DB 1I4FB 3UJTH 5DK2A 1CVSC 1Z3GL 1P7KA 1KGCE 5FK9B 2BVEA 2HX8A 2Q3ZA 4K7PY 4Y5YA 1KLUA 2D31A 2AKRB 3MJ8A 4GXUN 2CIKA 3BZFB 4I2XE 5HYIA 3A6BL 1MWAB 2J6EL 3QQNA 1BD2E 4RWHA 2NW2A 2ZOLA 4DGVL 5DJ6A 3AXLA 4YHZL 3MLXL 5CAYB 5GGSA 3C8KA 3RKDC 3MV9B 4H26A 1CWVA 1SBSH 3NZHL 3IFNL 1FN4B 2XU9A 5FO2A 5J11C 1S78D 2KPNA 2YXMA 3TO4C 3OR6A 1MRDL 3VW3L 2FQDA 4PRPA 4NWUL 1J88A 4WW2A 1D5IH 5FFOA 3UO1L 4FI8A 2QQQA 1MNUL 5I16B 1WISA 4Y5YC 3B37A 3MBWB 1PKQA 2YAFA 2NY7L 3OLIA 2AQTA 4QOKB 5DJAB 3TCTA 3ARFB 4ZZFA 3GSXB 4F7MB 4IS6B 1OARH 2G5UA 4PSRA 5IVXB 5FYKD 2W80C 3DSNA 5C0IB 1KTCA 4FTVA 1Z9LA 5FYKU 4ZDHA 4FKKA 4XPTL 3MR9A 4YBHA 5TQ0H 1P6FA 1OZUA 4FMFA 3K6NA 3V4UL 3TBVB 2MTPA 5KSUA 3MRHA 2YC1A 3CLEL 3SE3A 2VLJE 4GW5B 3ZBMA 4QRPA 3ZJAA 5EO0A 1UXMA 1RI8A 3MLZH 3FO1B 3CVHA 3KJ4B 4OD2A 3UZVA 1N68A 1ORSA 1MFMA 3OXSB 5T1DL 4K71B 1FG2A 1FZKB 2LABA 4TLSA 3MLUL 3ZX1A 5JYMA 2I7OA 3UEQA 1U30A 3DBXA 1A3QA 1VKXB 3VWJD 5F72S 1CDUA 1KJ2A 4YNYA 5AW0B 1WBYB 3BZ5A 1KGXA 1ULVA 4AYGA 2YUXA 4P23C 3TU6A 3UCQA 2C9PA 3TJHC 4Y4HC 5BV7C 4MAYB 4HXBH 3D25A 1V05A 2WBXA 3HS0B 3CFUA 4JNXA 3EYQC 3LNHA 2XWZA 1ED3A 4OZIE 1FNSL 2QSQA 1X9UA 1HOCA 2E46A 5CCKL 3QHFL 4M1GH 1C12B 3P9LA 1SEQL 2ORBL 1P5VA 1B9KA 4R26H 2PO6A 1DLFH 2H0JA 1HCVA 4BRJA 1WE5A 4OLWH 5LXVA 3TN0A 4N2MA 3PWPA 4ICXA 1QPKA 2WLLB 2YPVL 4NOFA 5AOMA 3RUGB 4S0TD 3US1A 3THMH 2GTQA 5I76A 4RBPH 3MO1A 4JO1L 1P84J 4PJHE 2N56A 4ZPTA 4PV8B 3QH3B 2B14A 5D8JL 1A9BB 1FG2B 1RCYA 2PTTA 4NIYE 3VFSB 4WUUA 3ZHLA 4HIIB 4FYSA 4LEBA 3V79C 2YPKB 1WDAA 2WK2A 4Y1AB 5E51A 1JCVA 5DGQA 4C4BA 1PZSA 2XQYG 3OLDA 3EYUL 2UYLA 2MKLC 4ZXBC 4DAGL 3MLPA 3MRLB 1MW2A 5H2BA 1Z9MA 4A6YB 2P52A 5I1AB 4L9LB 3GUTA 2EYRB 4GO9A 4MXWL 5F9WC 1VCAA 4ORGA 3EG9A 1GZHA 2G75A 3OAYK 3G6JF 1X7TA 4BFEA 1YAIA 3OMAB 3NH7L 2CRMA 1OSZB 4A67A 2DJUA 1CFVH 3WN5C 1ADQH 3KLDA 2EXYD 5KVDH 1G6RL 3V5HB 5E9AA 5B8CA 2QVIA 1UYWL 4DTGL 1QHPA 3QRGL 3MLZL 4E9XA 4UOW0 3QXAB 5IHLB 1WZ1L 3Q13A 2VL4A 2TAAA 5D7JD 1NKGA 5C0GA 3SDDC 2ZXDA 3CFEA 1RIUH 2H2SD 4JO4L 4PY7B 4H20H 4W6WB 3S5LB 3VFPA 4ABUA 4QO1B 2YAOA 3MR9B 5D1XC 4YDLB 3MFGB 4WI9A 1PQZA 2ZICA 1KTJA 1ZK5A 1IFGA 1U8HB 5F1IA 2XTJC 2FX8L 1KB5L 5CMAA 5D1ZB 5IEKB 3QEUB 2B77A 4FE9A 4WCYL 4ZMNA 5AVWB 3VJ6A 2E7BA 3LTVA 3VXSA 4WCYH 3EJZD 5EF3A 4LPCA 5F93C 5FYKH 3ML8A 3SKMA 1DQDL 5C09A 4D9RE 3B9KC 3PS6A 1ZTXH 2VITB 3BWSA 2DMCA 2ICEB 3ZE1B 5B1CA 3HZKA 5K5YA 5PCYA 4C56A 4LVHB 2DKMA 1U2HA 1CG9A 4OM1H 1H5BA 3HBZA 1S5IL 5D7KE 3B34A 3RDTD 4BH8B 1RZJL 4P2OB 3B8SA 4JE0A 1URIA 2DQTH 3KWUA 5H37H 3A67H 1PG7H 4ACPA 2CLRB 2BFVL 3KAAA 4RDQG 3VG0H 3BW9A 4PRBA 1QI4A 4OF6A 1S9XB 5BUPA 5B1AB 3D52A 1MI5A 4PW4A 2K8QA 2CLZA 2NX5E 2AEIT 3SPHA 1AY1L 3ZN6A 4J3OD 1YSOA 4HPOL 3V0WL 5I17A 2E9JA 3FRPA 1DZBA 4WY7L 3K2UL 4XXCA 1CF1A 3IFPB 5HYQB 4N2EA 3TA3C 2ICES 3KPRA 3LH2H 3NIDE 3T4AB 5ACLA 5JIDA 4FQXC 1L0YA 4P23A 2NY2D 5ADPL 2HJLA 3LHAA 4LDCA 4NZTL 3PIQA 3BOVA 5HYJD 4L3EA 2MQCA 1AI1H 3K2MC 3QP3A 4NDMB 1K4CA 5TDPA 1NBYB 5AW7B 1JI1A 3NJKA 1QUPA 1INEL 4N0CD 4PWKA 3UCRA 5L4JA 1A7NH 4MA3B 4GAGH 2C4FT 4AJ0A 3ASWA 3ZZQA 5EO1A 1J8KA 4O51A 1IRAY 1QACA 3B7UX 3KL5A 4TULH 1EK3A 1CD0A 5D6DC 5BJTA 1UA6L 1XR9A 1TXKA 4L5FL 4HS3A 1HH9A 4QHUB 4LHUA 2P3YA 4APQA 1IJ9A 1XWVA 3SN6N 1LO0H 2OI9B 4A7GF 3RVUC 4OLWL 4X6FA 3V0AC 4PJCB 3DRQA 3NJMA 1KZQA 4H2AA 1GMEA 1GZPB 1RULH 2BINA 2DQGL 2ORBH 2A9AA 4N0FB 5IBTL 3RY6A 1UUSA 1YN6B 4X8XA 1ZK9A 2AJUH 4IRSD 3ZRFC 3MCLH 1XEUA 4L3CB 3C5SB 4WSGA 3V6ZB 4LSVL 5DVNA 4KNQA 3NFNA 2FBJH 7TAAA 3GIZH 4BZ1A 4AQEA 2C1PA 2G9KA 3KH4A 4FNLL 1FG9C 4GKLA 1W16A 4XTRC 5GGVY 4ENED 1U6AH 2A9DA 3TO2B 4F37F 3LZQA 1NDGB 4D2NA 3EO0B 6PAZA 5HVHC 1PD0A 1TETH 2IH8A 1BF2A 2J4WH 2P80A 3LZFH 5ICXA 1URLA 2J20A 1IAKB 1Y18A 2GTZB 3QJZA 2OPCA 4EI5D 1MI5E 2YA2A 1FFPB 3BAEH 4G9FE 4UTAA 3M1BB 3TCXA 4Z7NF 3CVHB 1KXVC 4O2CA 4P2RB 1AGFB 5J7CC 5T1DH 2YD3A 5CXPA 3PU7A 2JJTC 4K23L 5C07D 4D9QD 1R24A 3FB5A 4PJXB 4R2GB 5EA0L 1IGTB 2GFBB 1CLCA 3LKOA 4XMWA 2W88A 5D7IB 4G8GE 5DMJB 3OTTA 3B2XA 5T1MA 3MODL 2DZEA 2A83A 1RIHL 2OSXA 5BRZE 1D5ZA 3RDJA 4LNVA 2XZZA 4M7ZC 3VVVA 4ZUWB 1LO3H 3FU8A 1A1OB 1OTTC 2KH2B 3QCUL 1MCHA 4Y4KB 3UBXA 4HG4J 3B5GA 1P53A 2D3JA 2EZ0D 3LKOB 1KNOA 2OSLB 5E0QA 3FT4B 3N44B 4U1IB 4WNJA 3POCA 1M6OA 3EF7A 1FIGH 2BOLA 1I8KB 3N40P 3PWLA 3QA3A 5JPMA 5E1IA 4RMVA 1C12A 3P9LB 3VE0B 1S5HB 1F8TL 3P0YH 3W3BA 3RL2B 4UT9L 3VNZA 1CDJA 2DOCA 1QRKA 3V7AE 3CTTA 1ERNA 1DVZA 4LGPB 4X50A 1PZBA 3ABMB 5LBGA 3KPOA 4K3JH 3UTSB 3Q8EA 1JZHA 1CPUA 2H7WA 3CH8A 1NWPA 3SGKA 1CS6A 5MENE 3SDCD 2G2RA 4WWOA 3QZWG 5FAAA 3CMOH 4XMKL 4AM0Q 5DUPL 1EO5A 3RWFA 2CCWA 1F18A 7CGTA 4LCIH 3CZFB 1U8OB 3G6DL 2KLTA 4NRXB 3CCHB 2K8MA 4QY8A 5EOCH 3FPYA 3KPLB 5IJKA 1AQKL 7PAZA 5C0BD 4KI5E 1UURA 1D7FA 4MAYA 3C5ZA 3CC1A 3HS9A 3LRHA 2EH8L 4RFEB 2G30A 2VR4A 3HAEB 3B9KD 4NKQB 5F7HA 1BMGA 1PJ9A 4HUCA 5CCGE 4PD4J 3Q5YA 4M5TA 5CEXA 2Y36L 2F58H 1BREA 1YEDB 2P5WA 3DVGA 4OUUB 1NCIA 1K3ZA 2JI2A 3FUKA 1SY6L 3D2UB 3QEQA 3RHWK 3C8KB 3CHQA 4MD4A 4IW4C 1RUKH 2O5YH 3V4PH 5TQ2L 3NIFE 3BESR 3WEXB 4C4KO 4NN6C 2EIKB 5LG6A 2VXQH 4PG2A 1I7RA 2TSAA 2G9HB 1A3LL 3TNMB 5H35B 3U82B 1OPOA 4U1MA 1UA3A 1IAOA 2CKBA 4HHGA 3P4NA 3EO0A 4DGIL 3E80A 5I8CA 3RVXC 3LXCA 4EIZC 2VO8A 2GI0A 4LCWE 1XF5B 2AXJA 1HT6A 4ZDHB 4NB7A 3L4UA 2OMYB 4HZAA 4OCSL 4NLHA 1A6TB 5K9JL 2VGLM 3O8XD 3LB6D 3ZSSA 1DO6A 2O6EA 1EZSA 5F7YC 3AITA 2ZF8A 4M8VA 1PLBA 1UCBL 3HI5L 3MLSH 4NM4H 3RNQB 1UUNA 5T3ZD 3ZUNC 3V10A 2IBZX 3WIHA 4Z3FA 4YE4H 1HSAB 2A6JA 4KRPD 4YR6A 1IM3D 3BD4A 2WTOA 1QD0A 4FOMA 5ID1A 4Y1AE 4FQ1L 4JPIB 3U79A 4DKFH 1CBVH 5E99L 5C0CB 1KBKA 2GC7C 2XZAH 5E5LA 1AYOA 4WO4D 4WWKB 1A65A 3VD4A 4HEPG 3UG3A 1DVSA 1TZHB 5F88B 4O58L 1KG0A 4I5BA 3PP3K 5GS3A 3ATEA 4JREC 3CPUA 1UWYA 4RGNE 2IGFL 3PWPD 2E74C 4MCMA 5EU6D 5EIIG 2OL3B 3B6SA 3DUSB 2PNDA 4L3EB 2BX5A 1N2RA 2F54D 2X40A 5D1ZA 4XAKD 1KTRL 4F1SA 5AAPA 1G9MH 3ATFA 4HJGA 4RX4A 1XGPB 4PI2A 5GRXG 2Y4SA 1INDL 2IH9A 1WEJH 4JPWH 2HRPL 3GSWA 4OZHE 5JW4M 1C7TA 5I17B 1KLGB 1XL6A 4Q14A 2ZTBA 2AJXH 3VYNA 2R9HD 4PJ5E 1JNNL 2I60H 2OMWB 2PKDA 3TH2T 3SSGA 4AK1A 4K9EH 1OP9A 1W9XA 1OE3A 5LCVA 1NUDA 4BSWB 5LBSH 3VXPB 4NO3A 4FQCL 5DRNA 3LKPA 4YL4A 2WXHA 5GRVL 4Z0BH 5J6GA 1OAYH 2G3MA 4JZJA 1YUHA 5E2TL 1QP1A 3ZIMA 2OMTA 4RGOH 1SJEA 4CC1A 3PXJA 4G70B 2Q8BL 2QV2A 4L0YA 2W60A 2UZXB 3MV7A 3MRLA 3NZSA 5DJ8A 2NY4C 1YEHL 5C0JB 2OR9H 3EYOB 3MGOB 3VXPA 1I1AD 1BPLB 3MBEC 4F93B 2CBQA 2H4EA 4L8SC 1WIPA 1SQMA 3PWVA 1HHGB 1I9RH 2OJZL 4OAWB 3UTQB 3QYMA 3MRRA 4UQ3B 4Y5VA 2QMJA 4X99A 4QLRA 3BPCB 4IMLB 1SXSA 2QKIA 3WEAA 3V0VB 1DBKH 4HA1A 2IQAB 3BC9A 4YJZL 1SMOA 3I02A 1WLHA 4AEHL 2GHWB 4J4PD 4NKOB 3AXIA 3E2HB 1LYQA 5MERA 3PWVB 1R24B 4PJXA 1FJ1B 2HFFA 3FQYA 4ZMVA 1KWKA 1EEYB 4LARL 4MKMA 2F7PA 1E28A 2H1XA 4G42B 4HJSA 1MJ7L 1QI5A 4CN4A 3EO9L 4NZUH 3QCUH 3U4EA 4LPVA 4A37A 1BXVA 4R6UA 1DVFD 1BFTA 3VXNB 1PF3A 5HI3D 3GSXA 3BWAA 3OVUB 4WI4A 3EOAA 4U6VL 4I0CC 4OZHA 2DWTA 4LRNH 1HCZA 1JL8A 1ZT7B 2IANE 1CXKA 2YKKA 3B56A 2FH6A 3BHBA 4Q0XL 3UX9B 1KIRB 1W6LA 2YRPA 5KBNC 4QNPF 3DOIA 3VUAA 1BOGB 3GGWA 1AO7D 4KK5D 4E41B 4CSSA 4A55A 1XSOA 4S1DC 4YNYB 5ADOH 2MH4A 5L2KA 1QNZL 4O2FA 3WLBA 2MSPA 5DO2C 4OZIA 1XVSA 4I2XA 3BP6A 1CYXA 2HTLD 4JFXA 5F7MC 3RWDB 2R1YA 4MGXA 4DZ8B 5BOZG 4MKTA 2VAAA 3H2QA 1UEMA 1LQBC 4EI5A 2FATH 4D0BB 3A4AA 2Z1PA 3GRWH 1N2RB 2JCCA 5F7UA 3N85L 5KYWB 5T8IA 3LH8A 2QVFB 4WI5A 1ONQA 1ZT4B 4YSDA 4OZGB 1DJGA 3MUY1 1ZPLA 1TNMA 1E7VA 3P4LA 1G6RB 1N4XL 4V2BA 3DPBA 3IXTB 4EUPG 4Z23A 3EDKA 3QUZB 3FB8A 5I74B 1INEH 3O9WD 1I8MA 1JXJA 2AJ3B 3KPSA 2W0PA 3MCKA 1PYWA 1A6ZA 2EO1A 5CIPH 4CGTA 3FU7A 4JN2A 5FA3A 3SBQA 4AY0A 2FT7A 2AQ3A 1KV7A 3WS6A 1Z9SB 1AR1B 5IR1B 4JZNA 5KN5B 1HE8A 4S1SL 1O6TA 3EHBC 2HMID 1XF4B 1B4RA 1FA4A 3V0EA 3EO1B 1A6AA 2D7TH 3EGDA 3DX8B 3B2MA 4FFZA 3CQPA 5IFAL 2JKTM 2ZOTA 1TFPA 3EYSH 2DMHA 3L3KA 4KDTC 2ITDB 1ID5I 3HNTH 5FHAL 3P3RA 5IF0B 3VDBA 3CDYA 3SYAA 4C8XA 4P9ML 3PY9A 4B9IA 4H88L 1C1EL 4HZLB 5EF0A 5DHVA 1YMMA 2OR8A 4F92B 4FQIH 5IQMA 3QEHA 1ZDQA 2OXHA 3KPNB 3DX4A 3AGWA 2Q7YB 1PNCA 3SQBB 1RZJH 2HLEB 4D7BA 5GGUB 2PWEA 3M45A 3D09A 3V4PB 5CJQL 4WY7H 1FFTB 1IAOB 3TBSB 4JB9H 4D0DB 5IG7A 2G2RB 1W80A 4S0SD 4L8DA 4OIFA 1E50A 4FP8H 4N2LA 4YXHH 3QQ4B 5IEKA 4NQCE 1XSJA 5KSBF 2EIBA 5CFAA 3TJEH 2X4SB 3G6AA 4YHOL 4DGYH 4GRWH 4OM1L 4FL4C 4ATWA 5F0JB 3HUJE 4HS8L 2X0WA 4O9HH 5EUKB 3MLWL 3L54A 4APQC 3V4VL 2Q8AL 3HAEA 1FIEA 1BFSA 4NZRL 4PS8A 3DX3A 4PJHA 4ZMYA 3GHEH 3CX5K 2V2TA 4TM9A 3V0DA 2DTML 4ZX4A 3DOHA 5DLMH 2CO1A 3Q1SH 1N3NA 3WY2A 1I53A 4EI6B 4NN5C 4H8HA 4B97A 5EU6E 2NYYC 4XVUD 3STLA 1F97A 3QXVA 5IKCA 1KZYA 4JRLA 3WAJA 2ZWNA 1M7DB 5DSCA 4KFZC 3MRQA 4X6CB 2K0RA 2P49B 2XWJB 3N43F 2JE8A 1SRDA 5B38G 2MEJB 3HIZA 3KLAA 3BLBA 3BE1L 4H20L 1HEHC 5KS9A 2GJRA 3T0EC 2OYPA 1HYRC 1HI6B 3GUFA 3KWWA 1DVFB 2APFA 2FEEI 3PP3H 3APNA 5SX5K 1DBBH 2UXTA 4Q6KA 3SDAD 2G2PA 2PP8A 4FQIL 5ESQB 4JKKA 3U30C 3MRIB 2VUYA 3MV01 1BAWA 2W5PA 5CEZE 5JW5B 3CV5A 5I1EL 1JWMB 4KXZH 1IEAA 2EDNA 5DZLA 1KT2A 1X44A 3ZT6A 4ONFH 4JRFA 2ZWKA 7PCYA 2DYSB 4OJAA 4CKVX 3VMNA 1X5KA 2DEWX 5EZLB 1NZRA 3RVXD 3FONA 4JO5A 1SYVB 4PYHA 5CZXD 3MRGB 4BXSV 3MACH 1GOFA 2OK0H 2VN3A 4CMHC 4LCYB 3AXHA 4FXKB 3GMMA 4NSKA 4YPGB 4P06A 1IQDB 2HN7B 1RZJC 2NUPA 43C9B 1E6OL 1HCFX 2B9BA 2QGBA 3NJLA 2HPOA 2I32A 1ZVYA 3QUKA 1FNAA 3B9KA 2OMTB 5I1JL 3OSKA 4LVEA 1BEXA 3IJ9A 4QHPA 3LSOB 1TQTA 3Q9PA 4UCFA 4KDVA 1ICTA 4PAZA 4HYTB 3L13A 5ALCL 1F3JA 1Q8MA 4IU2B 3TN0D 5DQ9B 3M86A 4JQVA 1GGIH 4O2EA 5I1GL 3LPGA 1BF5A 4KZDH 2MQ3A 1GYCA 1CFNB 3H7BB 3B4NA 4N3UA 5EU6A 1BYPA 3I50H 4L9DA 4XPAL 1D5XB 2M8XA 4JN1L 3LY6A 2BIOA 5LXGL 5B7MA 4YSPA 4U1SB 1AC0A 4M6ML 5MENA 4TQIA 4FG2A 3SDDA 3RWGB 1P4UA 5D1ZI 2I07B 2Z64C 5EPMA 2EH7L 2NY6B 1G7JB 2W8CA 3PLYA 4BQBA 5AD0B 1T83A 1AXTL 4MBOA 5KJRL 3ZMNA 3WHXA 1A7PL 3MNZB 5A6MA 1IAIM 4RGNB 3QUYA 4PS4L 1FAIH 2GJ6A 3V5KB 2NY5C 2KI6A 5I26A 5AOLA 3T77A 3O2VH 5GRWA 1E0OB 4HLZG 3EADA 5TTRA 2N01B 3F65A 1AD0B 1KBVA 4XC3L 5KSUB 4LLVB 1G7IB 2WW8A 2E27H 4PUBH 5J6GB 3NFPA 1S4IA 1RIVH 4CSZA 1BVOA 2H1PH 3LZPA 1A6UL 2Y7LA 3C6LD 2YGQA 2H3NB 3OQRA 5HGAB 3ESUF 1SJHA 3C09C 1O5DT 3CSGA 5ABDE 5K93A 3ME0A 2UVFA 3B2PA 1OAQH 1NLBH 2M26A 2JKNA 2CWRA 2IPKB 2DQFA 1N0XL 1W72A 4ONOA 1MY5A 4PJEF 2N1TE 3MLVH 2UWEB 1OAKH 3QPXH 2YEZB 3MV9E 2VERA 3O3EB 1GYUA 3LEVH 2GITB 5I30L 4TTGA 3QNZB 4WV1B 2WUBH 1TYRA 4QTFA 5DMGD 3BDBA 1HJCA 5E5MB 5LGJA 4OLUH 4ZUSB 2ZCLH 4YHOH 3CXHK 3QI9A 5T3XH 3QHTC 4PGEB 4AQ1C 3SDXA 2VMEA 4WGWB 3I3BA 3SGJA 4PJIF 2XWBB 1MHCB 2ADIB 4WTZA 2UZYB 4BFIB 3QS3A 4NWUH 2I24N 1I8AA 4JFFD 4PBWD 4W9EC 4AT6B 5DC0A 3OSVA 1NSNL 3CN0A 1D7BA 1SDDB 4YDKL 4Z0BL 3P3YA 3RDTA 5HI4C 5EU3A 3OKMA 5I0WA 2BVQB 3QXTA 5FW7A 2R2BB 2VDQB 2FD6H 1H6EA 4GRWE 3L3JB 3UERA 4NKIH 4P99A 3VRIB 2N7BA 2LW3A 1WJ3A 2V6HA 4PJ8B 1U8CB 1U8KB 1TU2A 3LQAH 2W9DL 3BAIA 3GJFB 3QRLA 4M1DH 4WAFA 5F3BB 2DEYX 1L6PA 3BO8A 4P2CG 3EYSL 5JZ7C 2ZAIA 1GYWA 4KJWD 5DC9B 1R9FA 1IBBA 1FYHB 4WUUE 1XB6A 2JKLA 2YD7A 5GSVB 4KKCC 4F58H 1FL5B 2BP8B 5IIEB 3RIFK 1GGYA 1EAPB 1PLAA 3IJ8A 3LNEA 1H6UA 2CIIB 1CD9B 1I9EA 3L4CA 4JRXB 4MDIB 4TL5A 5ESAB 1MREL 3OPUA 1AD9A 2RGSA 2XN9E 2Z31D 2ZXWB 5C08A 4HWUA 2HB0A 1MY7A 3F7LA 1JNHA 2AVFA 2XZAL 4QTIH 5A2LH 4F37K 5IHWA 3C6SA 4XBEH 3OG4B 4GYBA 4ZFGH 1L3NA 2H6UA 4PBVC 2CDEB 1EEQA 5DFVD 3ARXA 5FA3B 5LAXA 1AR1D 3TV3L 4UQIM 4YBLC 1GC1L 2JLPA 4OCWL 5GGQH 5B22A 4ZRGA 4A04A 1E9QA 1TKWB 4G3YH 3VSUA 5D7LB 4RESB 1K5NB 1CICD 4GRWB 1MCOL 3HBQA 2L0DA 4OCSH 3NFPB 4A6YL 2VTFA 4OZFA 3BN9D 3TYGH 4BXVA 4ILDA 1DQIA 2XWTB 3POHA 4HMCA 1VFMA 5IV2A 3KGRA 1TVBA 3T2PA 4YHPA 3DX6B 4FA7B 3QEUA 4LRNL 2ATPB 4EBQL 4G8AC 4HP5A 5B21A 1EVTC 2AXWA 3DYMA 3EHBB 1G9NL 2FNBA 3V0IA 5IB2A 2FJSA 2XY2A 2CK0H 3AG2B 2A9CA 4TQEL 4AIXA 1V55B 2EDFA 3IXAB 5DJXA 4NZFA 4ODTL 5B1JA 4HGMA 1NAMH 2PPFA 4GG6E 1M71B 5C07A 4BQ6A 3JWDH 3Q5TA 4KTYA 5HI3C 2HLFD 3X3GH 4FTVE 3QIUD 4QT5A 2MTAA 4TOYH 5GZOC 1EJ8A 5DJ8B 1CXIA 3ZE1F 3PDOA 4ZO6A 3ZHFA 5SX5H 3D4ZA 3INOA 3WNKA 4Z76B 3TF7C 5AW3B 3U46B 3NN8A 3L6FA 3KLAB 1VPOL 4LGRB 1A9EB 3MRFB 4DH2A 3DX7B 1FI8C 3MRRB 1HU8A 1QSFD 2BMKB 4GW4B 3TT1L 1OE1A 3CBRA 4W9LC 2JTYA 1B2WH 1BVZA 5ALBH 5LQBL 5K9QG 2BSDA 4YLCA 1MVYA 2NXZB 1L3WA 1JIBA 1MLBA 3BRGC 5CUSH 1MCCA 3VXUA 3VXME 1R75A 3QARA 3T3MB 3QJSB 1RUML 1CVRA 1JYWA 2OXGA 2QR0B 1JHTB 2QPEB 2EVHA 5D2NE 1CT8A 2CHWA 2VDRL 3TVMC 3FT3A 4AZ8A 3DDGA 1ES0B 4MRBA 4OI9A 4YHNA 1WZLA 1NGPH 5BO1L 4KH2A 5MHSE 2QPDB 4F8TA 5KSAD 4EQ3A 4Z7NB 2NSMA 4N8CL 1Q94A 1Q1JH 2ZSWB 4PG2C 4ZMXA 2IDUA 3BEVB 5DTFA 3HZVA 5EO0B 5C92A 2CRZA 1KT2B 4UT9H 1J1PH 4AG4L 1T4KA 2W59A 4LP4A 2OP4L 4FA8A 1QLRA 2UZXA 3MV7B 3QR0A 4HCRL 1U0QA 3RGHA 4QJ4B 2JB6A 5DT1H 2WXMA 5HJDA 3L17A 4DPRA 2VLKD 3PWPE 5T5FH 1EO8L 1NLDH 4EJ1C 1AAJA 1AKJB 1CFSB 1TFHA 3GSQB 4TPRL 3BH9B 3ARFA 4PRPE 1CGSL 2FLRT 3BP7B 4U6XB 3ARFC 2HG5A 1UH2A 1Z5LA 2O4EA 2WZ0A 3CVBA 1FYTB 3BI9X 4Y9EA 2FRGP 2IDSA 4O02H 2B3RA 4KKRA 1SBBA 4UDUA 4N0YL 5DD3L 2DRUA 3O3BB 4GIOA 3S2AA 1U8NB 4NYLB 4LRIC 2BVTA 4U1LB 2VLRB 2WMPB 3FPXA 4WNSA 4Z0XB 3WEBA 3EYVB 3TTYA 1MCBA 3SBWC 1FVCB 3TFKC 4B0MM 5JHBA 5CJXA 3I9AA 4U33A 1SOQA 5I73B 4QRBA 3ULUF 1SHSA 3I84A 4Q58C 3FOLB 1RPUA 2R23B 4U3HA 3MJ9H 3ETSA 4WWPA 1IGCH 2R4SH 4MZIA 5TFSL 2AJ3A 3KPSB 3MCKB 1SUJA 4QXWA 2XNAB 4WFHE 4NGHH 1ZLSL 1QSEE 4QRPB 2ARJB 1IFRA 1KBPA 1U8MA 4L1SA 4ZI8A 1FPTL 1PSKL 2AK4D 3QQ3A 3ELQA 4PCKA 4Q8BA 1KDIA 2Y7OA 4JLRA 4FLRA 3U2SB 2X4RB 4BZ2A 4CMHB 1DJSA 3CFCH 4KKNA 2OR7A 2OMUA 3ZL2A 2D3NA 3SDXB 1QKZL 3WN6A 2DD8L 3J7HA 3P73B 5C0AE 4JDZB 4M6AA 2EUXA 4AGMA 1T0NA 2VDQH 4RMUA 1DUZB 4X42A 4L4TE 4YWGH 5FKPB 1J11A 4X9FA 5CIPA 1MCOH 3ZR6A 4OFPA 4LL9A 1RK7A 4A2GA 1R3JB 4DGIH 2UZIH 3GS7A 3UC2A 4S1QH 1TVHA 2BSSB 1IX2A 4Y16C 5EU3B 5E8PB 4EDXA 1MG2C 2YBRA 4DKEL 2ZP0T 3I50L 1BVNT 3VX0A 3NZ8B 1U8PB 3KPMB 4UIMB 7FABH 1PW3A 4K7PX 3G5WA 5A43C 1AKPA 4LCUA 3WXVL 5I1GH 4MNGA 3SGEI 2X6CA 1XGZA 4M3HA 2V5TA 2O5YL 5IROA 3V4PL 4XBEL 1ZV5A 4M4RA 3QEQD 1X9RA 1F56A 4G8GB 1TITA 3IDIA 1VADA 5DMYA 3QXDB 5F6HI 2Q2EB 4Z7VF 4AKQA 1XGTA 1HHKB 4N9OB 3G5YB 4I3SL 1A2YB 5KYXB 3CUPA 2CU9A 3F62A 2RB8A 5KYWA 1G0XA 1V7NH 4EUPA 4DO5A 1QR1A 1RY7B 4F8LA 4AWJC 1UM5H 3UDWC 3WJJA 4DESA 1NCAL 2K1MA 5DS8A 4BZ1L 2SEBB 5D93B 1H3WM 1NIBA 1XGRB 3D3VB 3DMMD 4NRXA 1A9BA 1CB4A 2J5LC 2PPDA 2Q7YA 2R29H 2WSKA 4OJCA 5INDA 3REVA 3WBDA 1HSAA 4YR6B 1VRSA 4X98A 4LCIL 3IF1A 2EIEA 1BJ1J 1F1GA 4OCNC 3AMLA 4NM8H 3L3OC 3PPSA 2IH1B 4J8RA 4UNIA 1YC7A 4FHJA 2ZUQC 3A67L 3QDJD 3TJPA 1S9VA 4WWNA 3UTSA 1JV2A 4M93B 3KDMB 4U0QB 4Y89A 4Z3IA 2PPEA 1CK0H 3RU8H 3H3PL 1NCJA 1D2OA 3MKGA 4XNXL 4M03A 4G7RB 3FTZA 2H2PC 3FFOA 1U8IB 2XLLA 3CH1A 4N5UA 3ARZA 2CJSA 2MOVA 1WHPA 4IHOB 2KLSA 2MNWA 4QRSB 3T4YA 3LRKA 4PP2B 1JBJA 5H35A 3IT8D 4W9FC 1GGTA 2KT6A 4CVXB 4WU7B 4HJ0D 1JPSH 1ZT1B 4HCRA 1FZJA 3QDGA 2HA1A 4AYID 3CMGA 2NMSA 4ZQTA 3IAPA 2APBA 3ARGA 3P9MA 3BPLB 3FOMA 5AENA 4KV5F 5IB2B 2LU3A 1MVFA 1NDGA 2BY2A 4JDVA 4NRYA 1J10A 2Y1ZA 3VXTB 8FABB 1BXUA 1MHPL 2COVD 2Z31A 2F53E 3BGAA 3DJTA 3LAFA 1JDDA 4WFGE 3MUGA 2BNQB 2NY3C 5EG6C 3VYPA 1R1CA 2YEZA 1RSYA 3H9HA 5BS0B 5HHNB 4P5KA 2OZ4H 3N1GC 2MWCA 2WBWB 3DOSB 3ML9A 4HGKC 4N1CA 3X1FA 2NCMA 1J0JA 1I1RA 2JCWA 3KD4A 2CZNA 4K15A 2P8LB 1FVEA 1U8JB 1UZGA 1W0VB 4H8VA 2YEQA 4IGBA 3BFWA 5ILTL 5L9DH 1UXSA 1PIGA 3ZY7A 4P5TB 4X8GA 3DX7A 3FMGH 2XDHA 1BFOB 4S1RL 3GKWL 2OJ1A 3HMXA 3IPBA 5J0BA 5JORB 5FYLD 1CICB 3V95A 4DSYA 3FKUS 1A8JH 3PJSA 2MQ0A 4E5XB 3OJMB 4XR8C 3DUUB 2AABH 5E8EA 2PPCA 1BECA 1CFTA 3NA9L 2EJ1A 4Y88A 2X53A 4IGBB 5AB0A 4P3WA 3QFJB 1Q9WB 2HVKB 1I1AA 1RLWA 2ARWA 3CHRA 3QDMB 4MYWB 4Y5XA 4BZ2L 2FLBT 1KYUA 4WDIB 4AE1A 3PL6A 4Y2DD 5IB3A 5KAQG 4XN1A 5C3IA 1TTUA 5ERWA 1F4WL 5BUGA 2EDWA 5BNXD 2XN2A 5GIRB 3L7EA 2FBRA 5BZWA 1M7XA 3T3PF 1EO7A 4FKHA 3KM1A 1EXUB 4K3EH 4BWWA 4R84A 5AVYB 2D03L 2M83A 3KBFA 2WAHA 1F4YL 1MLBB 2CJ3A 2XOTA 5I1LB 4RFNB 4GAFB 1YPZF 3EAKA 3DX0A 2ENSA 4R4BA 4K3HA 3CSTA 4B50A 1HEZB 3M1CA 4EVNB 3K8KA 3EUUA 3VTAA 1GZPA 2NY0C 4TUOA 2HCZX 4JE4B 1WICA 2J43A 4HIEB 3SO3B 4JDEA 2CO2A 5EIIA 3VWKC 5DS2A 3STZA 4HVBA 1S7WA 3JUZA 1LP9E 2IWEA 3AUVA 1MF2H 3GSUA 4M61B 2MMXA 4MJ5A 4XXWA 4MZ2A 3KPPA 4ANKA 3K1KC 2W0FA 2Y24A 2EACA 3FQ4A 4UU9B 4G82A 3DV4A 3V7MA 1Y0LB 1TNNA 4YDMA 5E4AA 3LZRA 4XE5B 1PX8A 35C8H 1D3CA 1C8QA 4M43H 2R1XA 3EJYD 1AXSB 1MCJA 1JD9A 1G6VK 3E2HC 2EO7A 2QFRA 4POUB 2DDQH 4GBXA 1G1OA 4NWTH 3U4BL 1VESA 4CSTA 5IFJB 4V11A 1JK9A 4OTXL 4XXWC 1WGVA 3EYQD 2Z35A 2AEPH 2KBGA 4YLBA 3SKNB 3L4VA 4J23A 2J12B 2VXTH 2CKBB 4Q9RL 3SJVD 4XXDB 3KEHA 3CFJA 3QCTL 5K69A 5CJXC 1UD4A 4GBXB 1B6UA 4YPJA 4F2MB 5LGHL 4L8CA 3A21A 1BQSA 1GW0A 4OLVH 3LEYH 4QIRA 5F21B 4UYQA 4XP5H 3DJRA 1ZEAH 2ITDA 1PDKA 3EHBD 4DZ8A 1IM9B 5BPPA 1KGIA 3INUH 1N7MH 5F9OL 4PB0L 2DWEA 5F6HJ 2XETA 3BVDB 3T0AA 5JA8B 4IKLA 1HINL 1FDLH 1QRND 4YHZH 3WGUB 4YFEA 3P77A 3CN4A 5C9KA 5IOPA 2Y7QB 1XH3B 4LASL 1CLYL 1I8KA 1LK3H 5JPMB 4L4VE 4R7VA 4XP6H 5LNEA 4CVZB 5L2KE 3NJIA 4JFYB 4Q6IA 4WO4B 3MSPA 4BFIA 1GAFL 5FB8B 1PDKB 3E7JA 1MJUL 4J6RH 1KN4H 4JFZH 2VLLB 3IJEA 3L5WA 4LEXL 3HC3L 5E8OB 3W5MA 2L8AA 3LXUX 5AG8A 1NEZG 5E1GA 3ZTJH 3MRJA 2X3AA 4H8WC 4DFHA 4HKJA 1G7QA 1AJ7H 4FFTA 4P5SA 4YXLH 4G83A 5JIPA 1CK0L 1ONQB 1KTDB 3L81A 3WIAA 1E4WH 2YBGA 2YSSA 3BUIA 4K5OA 5LWYL 2XRAH 3KEDA 4NQTA 2ROXA 2VYRE 4FF9A 4NFDA 2JQMA 1I3RA 2PCPA 2O6DA 1SOXA 4RVBA 4V2CB 4X6CF 4QLWA 2VJ0A 4PJFE 2EIZA 1BOGA 3CFDB 2V33A 3HMXL 4FXKC 3MRMB 4TVPE 4YC2C 5I8EB 1B4JH 4CN6A 1GS8A 1QBLL 4Q97A 2AFNA 3J2PA 1B2WL 2ZWYA 4MX7B 4I88A 4XPBL 2MRYA 2P5WB 3K4ZA 4KFMA 4PIBA 3WE1A 1IVTA 2HFTA 2WANA 2W91A 4Z3TA 2ATPA 1XH2A 3WUZA 3IJ7A 4HW6A 5HGGS 15C8L 2EE0A 2VR5A 3GF8A 1HWGB 2P24B 3GSOB 4MJIE 5I1CH 1KPVA 4WI2A 4DCQB 5EEXA 4NN6B 3TA3A 4NENA 2C9UA 2D9QB 2XQBL 4NO2A 4D9QE 2ALAA 3VB8A 4G6FB 3EDDA 3AAZA 1G94A 5F9AC 3D18B 3QR1A 4JFPB 5C0GB 2ZT9C 3W37A 4GAJH 4XMLH 1OSEA 2LOEA 4QRQA 4RCAA 3VG9B 4HX1A 5JUEH 4LOUC 3QO0B 2EEDA 3ARPA 1OVZA 2Q6WA 1E4XH 1UENA 4LSTL 5GSRB 3F3HA 4FXKA 4X80H 1YMHA 5AW8B 1XAUA 4KGLA 2BRRL 3EYFA 2VMJA 4NQED 2QKIB 3ZDZE 4OKVB 5LLIC 1HESA 2WNXA 1B9ZA 2X6MA 2ZZUT 3ULVF 4MA3A 5F7KC 2WVVA 4OGYL 3C6EA 1NM4A 4DVBA 3MBED 5EFIB 3PNWB 4IRZH 4J3OC 1L6ZA 4KI5D 4L37A 4OBSA 2CJUH 4YSQA 5I0XA 3NFSH 4MA7H 3VCLB 2XA8L 3L2NA 3AG4B 2NQ3A 2P8LA 3EOBB 3RWCA 1MCLA 2DWDB 5F1NA 1NDTA 3CFTA 1ID2A 1FCGA 3KGUA 2FECL 4I5BB 1HS6A 1DSFL 5L88H 3PNWA 5L4FA 1L0PA 1IGCL 4YDNA 3VXNA 3PAVA 4I7ZC 1EUTA 2D2CC 4QTHB 5TQ0L 4GT0A 4GKNA 2J2ZA 3T0EB 3O6LH 4HUKB 3SDDB 3AY4C 5TF0A 1XGQB 3QQ4A 4CC4A 5IROD 1ANUA 4JY5L 4PJAB 1QPXA 1KCWA 3IMUA 3OZ9L 1EPFA 3FU3A 1XF2B 1NFDB 1OB1B 2X9ZA 4UANA 2ERJB 3NZ8A 3BGMB 4IKNA 1I1FA 1JZ4A 1D7CA 1KLGA 1KGJA 3B6SB 4LB8A 3VRLE 1DBMH 5C0RH 4LSPH 2HWZL 3DTXB 3EGXA 1K8IB 4X6DE 3LIUA 4KTGA 5CGYC 2GABA 1SPDA 1XGPA 2FZ3A 4S2SB 4JDTL 4KXDA 2XWEA 4HEMA 3VXSB 5TPWH 1IKOP 4DGVH 3MRDA 2NY4B 4D9RD 4U6HA 2J6EH 1ZLUH 3GO1H 4P23B 3CXDL 3K5SA 2OTWA 5GRYA 1D9KD 1NC2D 2IMNA 3JTTB 4F9PA 1J9CT 4FNQA 5EC1B 3MA7A 4PRNA 1L7TH 4UUJA 1MNNA 3G04A 3NESA 3OKKA 3DSFH 2BHZA 3F7RA 3FZUC 4J1UB 1EAOA 2W60B 3FCUB 1U92A 3FT0A 4LEOA 2QZQA 1D6EA 4AQ1B 2FJGA 1ZLWK 2BW5A 1KDJA 1N5AB 1WFTA 3CLFL 3HG5A 3RIAF 1KUMA 4GJTB 4BQCA 4Z95H 1IEBA 1MI5D 5AKSA 4JO3H 5FGBC 2V2XB 2EKSA 2VDRH 3RJDA 1HL4A 4V1DA 1OCOB 2ZYSA 2FNWA 5J1AB 3ZQ9A 2FJGB 5CN2A 1PY4A 4JY5H 5TE7L 4JY4B 1TO5A 2DQUH 2QADB 3FT2A 3U0TB 1MHEA 3DXAB 4M9OA 1SQ2N 2TRYA 3IE4A 2EKSB 3G08B 4NXSA 4TUUA 4PGCA 1GHFH 1HEJC 1ZJBA 3EKCA 3T0BA 4QRTA 1UH3A 4XCFL 1QEXA 4F24A 3DGGA 4KI5C 2XY1A 3IDGA 3FTSA 2F5BH 2C7UB 3K2IA 2ZKYA 1XR8B 5EBGA 4ZMWA 3ULSA 4JZJC 3SKUD 3N9GL 1SM3L 4UOJA 2BCKB 1X7QA 2IANB 1DVUA 4P4KC 4B9JA 4C55A 2FEDC 2AXGA 1KYOJ 2J4WL 3LZFL 5D72L 4XC3H 1MFCL 1S7WB 4JN2B 2ZX9A 1JZ5A 4JY6B 1SDYA 1GXEA 2PCYA 32C2A 2P7TA 4FQHA 3HBPA 1S7UA 2IBZY 1IVLA 3UFIA 1A6VH 3HC0A 5JPNB 4OF3A 4LK4A 1F90H 5LB1A 3GS0A 4EDXB 4E36A 5ETUB 4GAJL 1E42A 2XN0A 1IGIL 4G7YH 1ZIBA 3X13A 4W6XB 2Y07H 2PYEE 5SWZD 2DQ6A 4Y8AA 1RUAH 1P6WA 1MUJB 4GQRA 3TVMA 1HFUA 1E43A 1L5GA 1C5CL 4X80L 2E47A 3GXIA 3KCWA 3QG6B 5DHVB 4IJ3C 3QZNA 1U4EA 2PYED 5FYJH 2UWEE 4GUQA 4JFDD 5I6LA 3S36L 3IJYA 3FO9B 3EJZC 1YVLA 1OCWH 1F6AB 5KSBB 3DUHA 4H8PA 1AQDA 1OTSC 1SLWA 4OR1A 4I8DA 1TEFA 2C4XA 5HD8C 1UOVA 3W11D 2UWEA 1X5JA 5FUOL 3TN0B 1BBJA 1QX1A 1S7TB 2NNXA 3QIWC 1A7NL 4LBEA 5D1XD 1ZSDA 4Y5XC 1PYWB 1WFNA 3ZR5A 4PCYA 2AXFB 1BX2A 4G9FA 1BFVH 3DX9A 1KIUB 2R0ZL 1I7ZB 4Y2DC 3T04D 3ZDZF 4U1IA 3GJFK 4TTDC 3PDDA 1CYWA 4AJYV 3SBRA 5HHPB 3CVHH 1RH8A 4M9PA 1FYTD 4N2OA 1NFIB 3T8XA 1IQWL 5GISH 1KMGA 3HMXH 3IEAA 2OCCB 5A16A 3H4FA 2W9DH 4OGQC 3D18A 3RTQC 4QHNB 4YDIL 1NCTA 3SDXF 4K5MA 5EF2A 1U91B 2CXGA 2D4DA 2W9LA 2R15A 4XH2B 2RAMA 1QLFB 4K3JL 4KX9A 1OGAE 1L9TA 3D3VE 1S7QA 2B3IA 3IBEA 4APXA 4NQCB 3WS3A 1ZCRA 5DJYA 3BQUA 2AC0A 2IWFA 1W72L 1N7ML 5F9OH 1F6AA 5KSBA 4Y5YB 2EUZA 2WNWA 5LN4A 3T8VA 1P9MC 1UCTA 2WWNA 2VLKA 5MEPA 3GLZA 2FX7L 2A73A 2EDKA 4UQEA 5DMKB 4XCEA 1DQLH 5T1KB 2B0SL 4GRLC 4BRVA 4LSUH 4YGVA 2AHIA 3FK3A 1J1XL 2JKJA 1OP3H 1E4XI 1K5NA 1X9LA 2VXVH 3A22A 1JHTA 1IBYA 3FQRA 1FDLL 4OZFG 1DJIA 4MAYD 2AEPL 4QXTB 1KTKE 5I5JA 2E7MA 4UT7H 3FTYA 2UXVA 3TBWA 1E8XA 4PJFF 4WW2B 4YSOA 43C9A 4X6CE 4A7UA 1WZKA 1I9JH 4NKOA 2APWA 3P2DA 2P5WD 2I9TB 1UWFA 4MCZB 4AUJA 4FP8L 2O5NA 4AIOA 1S7UB 1WBYA 1YA5A 1KF9B 1HSBB 5KVGL 3LHPL 1MQ8A 4GRLA 1ECZA 4N8VA 1J9RA 4FQQB 5E6YA 4LE8A 4W9CC 1F42A 1L7IL 1M05B 3NTCH 1HCYA 4WTQA 1NIFA 4P57A 5JIKA 3HR5B 4NCC1 3AGVA 3KVPA 3S7GA 1MWAA 1EJ6A 2WQ8A 4S11A 3OWRA 4ZFQA 5I1IH 1RIVL 4GB9A 4HUUB 5I66A 3O0RH 2WTRA 1QG3A 1T4WA 5B3SB 1L5GB 2CNZA 5JHMA 4GSDL 2CALA 4BFGA 2Y1YA 5FFGA 3WO4C 1B0IA 4L1BA 1FV1A 2A0LD 4A2DA 1P4BL 2JIXD 3E6HA 3WJJC 1CXHA 1CXFA 1HE7A 1XZ0B 1U95B 3QCVL 2BJML 4PS4H 4KHTH 4ANUA 2VDPB 2E9GA 2WTPA 4HQQH 1CGXA 1KTBA 1UD3A 1IL1A 1QSZA 1FUNA 1HDMB 2VR9A 4PLKC 2VUKA 2C26A 4GG8B 3CN1A 4TL4A 2C3XA 2NY5L 4AH2B 3RVTD 3ZKSD 4WGVB 2VKXA 3OAUH 1LK2B 3SB3A 3OGOE 5F9JA 5GIRA 3ZTNH 4GUPA 5T1LB 1G1CA 1SOKA 2EZ0C 4NHUA 2NRDA 1YEEH 4I1PA 3FQ2A 5D7IE 1IC5H 1I1AB 3QDMA 4HIPA 4A2HA 2X42A 4JR9H 4ODSL 2V2WA 4IK7A 3TLRA 4F9LA 2ZUVA 4TQ8A 2DYPA 3IJSA 5ANMA 5G4MA 1K85A 3LQZA 5B7FA 1FGVH 2IFGA 2Y6SD 2IVFC 4EIUA 4AV5A 4I48B 4N1HB 3VD0A 1KYFA 1TEYA 2ESVE 4BSVA 1DFBL 2GW5A 3KVDD 1IFHH 2YD2A 4QRFA 1J5OL 5CP7B 2ZJSL 1BLNA 1X5YA 4JG5A 3KPPB 3WN5B 4F7CB 3LQZB 5FV2A 3MRDB 1HNYA 1BQ5A 5IIEA 4QUOA 1MSPA 2V2XA 4JQIH 1SXAA 4M5YH 4OVUA 4ZMLA 4U7KA 1UFUA 4F3FB 3RPIA 5LDSA 1WZMA 2JNZA 5F9WB 1S5HA 3OAZH 4JFHE 3RY5A 4ZO8A 5IESH 1MW1A 1L9OA 4DJMA 4Q2ZA 1EZUA 3QDJB 4UT6A 1UXWA 4UDUB 1D6EB 4AQ1A 4XVJL 3NJFA 4NUJA 4FMKA 5IWLA 5KYYA 1A1NA 3PWPB 3DV4B 4XNYL 1YPZE 1MFNA 3BE1H 4HHAA 5DUMH 1BQUA 3ZTNL 4ETYA 1ZT7A 4PVLA 1XGYL 1BDYA 5IW1A 4JFTA 4OB5L 2W9EH 5HDRA 3T3PE 3VA6A 4ZOCA 5HHOE 3VCLA 3LS5H 5DD5H 1N6UA 5I8CB 2VZOA 3VYOA 3PCYA 1A5FH 2X09A 3BEWB 3QH3A 3FU0A 3TV8A 4P2RE 1C16A 3GD1C 5DLML 4LLAA 3MMEB 3S3PA 2DWDA 5JHDA 2G3NA 2ICWJ 4AGPA 3ZXAC 1WP6A 1A5FL 2FO4A 2VLMD 3ZUCA 4AQ8C 3SD2A 4KNSA 9PCYA 3RWJB 2A4CA 3FSWA 1I9RL 5M7QA 3D39B 3GC3A 4OGAD 3BH8A 5ACMA 4PJGB 4ZUSA 4E9WA 2Y5QA 1TZAA 4GQ9H 2YMXH 1P5UB 4JAMA 4PHXA 3ULUH 4N2HA 1OP4A 2VZUA 2WMPA 4RX4D 3QPKA 4XZ4A 2O6PA 5KBKA 1F6LL 5E8OA 4FLOA 3D39A 4GIAA 1T83C 4JBSA 4IU3A 4RQQA 3UJTL 4IKKA 4XMPH 4G11A 1V3KA 4XBGB 5HY9A 1ZLWH 1RZGB 2P5EE 3NJGA 1R3KB 2CA4A 3K3QA 4A2MA 1KIUA 1YEGL 3X1BA 2L7JA 1I7ZA 4K9EL 5LKNA 3PWUA 1BIIB 3SZKC 1TCMA 1OXYA 1VADB 1UWEH 1P4IL 4HCFA 5KBLA 3VFVA 2AJXL 3X14B 4IDLA 4HS3B 5J89A 1U3JA 2D0FA 4XGZA 3QQ9D 5EZLA 4N25A 1H8OA 1R5WA 5DZJA 2P24A 3TWYA 4LSUL 1VSCA 4P9HC 5IFAH 1ML0A 4Z7UB 5FUOH 1WEJL 1WF5A 1N67A 1RMFH 1TR7A 2KS0A 1G87A 4OW6A 1O6SB 4JHAL 2FO4B 3VQLA 1JGEA 2L4OA 3Q44A 4PRAB 4XP1H 2EDQA 2P26A 2YBRB 3K74B 4HFUL 3RB5A 4LLWA 4W1TA 5HPOA 3PABA 3LKNA 5EU5A 1HX0A 2YPVH 3GFUA 3FZUD 4R96A 3VGDA 2Y2WA 5HPMB 3CSPA 1T04A 3OMIB 2L7EA 4HWBH 1P2CB 4QRRB 1IBGL 5IMOA 4AQEB 1YMMB 2V17H 3CU1A 3MRIA 2YK1H 3WE6B 3N1FC 4YQXL 3WN5A 4NOBA 5FGBA 1CFQB 5DLLA 2IDTA 4R26L 4H5SB 4RMRA 2HPTA 2HVJB 5GISL 3JV6A 4PBDA 4X7CC 4NQDE 4Z8FL 4LGSB 5CCKH 4WU7A 2QADD 4KU1A 1OP5H 3U36A 4UIKL 4CBZA 3QW9A 4PIRF 1DSWA 4U1GC 1ZS8B 4WHTB 1J0HA 3DX9B 1WRFA 2R27A 4MJID 4AGNA 5C70A 3CAFA 4JQIA 3C5XA 5EOTA 3UPAA 2HJLB 2ZYRA 2XQYA 1ZLSH 1NGZA 5D72H 4RAVA 2MNJB 1D5RA 1IQDA 3PUUA 3D87B 3Q2VA 3GK8L 4LU5H 4U4BA 4G8EA 5HYQA 2PP9A 3MV8E 4LMQE 2A1WH 2IAMA 1N10A 5I74C 1HSBA 4EKJA 5AB1A 3DLQR 3IXAA 4TSBL 4NS0A 5I0VA 5L6YL 4QRAA 1U2YA 1A6WL 2Q5BA 2DLGA 4FTDA 5KSAB 3NCJL 4DZBA 2AV1B 4Z7VE 5SWSE 2F1AA 1Q0XL 5I19L 1A6PA 1K4CB 3HB3D 3F7VA 4KAQL 5TE6H 3OPZH 3V4PA 1W15A 3HZ3A 4HC1H 3B9DA 3ROLA 3Q5OA 1I9JL 3RFZB 2D9CA 5D7SL 5TF1L 3TH4T 3BN3B 1OP5K 2PO6C 3I9IA 4XN8A 2YO3A 2ZUWA 1KXQA 1QI3A 1TQWA 1XZ0A 3FS9A 4XNQA 4LARH 3QQ3B 4O2FB 4OQ1A 3WLBB 1PIFA 1LWRA 1YMME 1ZSHA 3NJXA 4E5XG 4PLKD 3RVUD 4KK8D 5IMKB 1XF2A 2DF3A 2ENJA 3RGBA 1P6AB 4H0IA 2OI9C 4APQB 1N5YH 2ZOUA 4PRBB 3PWNA 5JTWA 1DVTA 3D0LB 2PR9A 2HX9A 1W0WB 2DIEA 1BG1A 5E8EB 2VABB 3TWCL 2DYRB 3MRBA 4KUCD 1U8HA 2QMKA 1ACYH 1MFAL 4MA8L 5AL0A 4AYDC 3D85B 5E6RB 1MCSA 5BOJA 4YHNB 4L29B 5D71H 4WEEA 4WGKA 1T3FA 3QZBA 1TJIH 4HOMA 2I9TA 4RWYH 1TSHA 1HWHB 3B83A 2AF2A 1BCIA 5HYSA 3QNXA 4IJ3B 1S9YB 1WA2X 4C54A 4D3CL 3JTTA 5IB5B 1HEZA 1OPGL 2FSDA 3N50A 2EC9U 1NCWL 3HCVA 4OCYH 2X12A 3ECVA 3JV4A 4X9YA 2OMXA 2FZ3B 4S2SA 5FGCB 4HOWA 5CSBA 2B9AA 1OT4A 2ENPA 1G6RA 4LL4A 4ZUVB 5ABZA 4G8FB 4TUJA 5C8JA 2X3CA 2KZWA 2RR3A 3QIBD 3VXSE 2AS5M 4U1SA 4AENB 3SDCA 3GINA 4MMZA 4LSPL 4FYTA 3MNMA 1DBML 4WZ9A 1G5AA 2BFGA 4NQCD 5I6NA 4K94H 3WG7B 1LEIA 1OGAA 2YQGA 4UU9A 1IEHA 2WQUA 4WW2C 4IOSD 4XPFL 1ZGLM 3CSYB 1PLGH 2H1LM 3H0TB 5SWSD 5CUSL 5DMGC 2VC2H 2ZX5A 4XH2A 4C83B 4PP1D 2BY3A 1DJZA 3PDGA 5D4IA 5F2FA 2HKFH 3AREB 4UTBL 5DR5H 3IRPX 3W9EB 1G7HA 1NAKL 3NQIA 4NRZB 4PJ9A 3SKJL 3KYOB 3FF7A 1LO2H 5BRZD 3RE0A 1XGUB 1E4HA 1F86A 1R5VB 1XD1A 3GKZA 4HC1L 5D7HA 3UZQA 3FQUA 3DVNB 5TE6L 1HQRB 4MLSA 2XA8H 3O81A 5AKTA 2LU7A 5T5NG 4J5VA 1KGWA 1ZA6A 3I74A 2UY6B 4LQ1A 5I6XC 3IJHB 1WK0A 3FQTA 5CZKA 2I5YH 3DPBB 3IXTA 4RGND 2WWMC 3MLYH 5I8OL 2FVNA 3RWFB 3UTSE 4DK5A 3TNNA 4RWYL 1KXTB 3SYOA 4A6YH 4ALAH 1EHKB 4PW9A 4XN2A 3ECWA 2MKWA 2BRQA 1CI3M 4TTDD 4CW1A 3ULAB 2HLFC 3O0LA 3LN4A 1WBXB 5IEHA 4NHCH 5KEZA 4BYHA 4EBQH 3GLEA 4EDWH 1RK0B 2OAAA 1YQVH 3HC2A 1ACZA 4G6KL 4N28A 1JUFB 5B38A 4NQEE 3MREB 2KZBA 3QJOA 5DVOA 3GPSA 3MCLL 4GY4A 4CGUB 1EMTL 3GHBL 4NENB 1OQXA 1YEJL 5C1MB 2B7DT 3L5WB 2P42B 1BFOA 1MH5A 1P4LB 4DN4L 1PS3A 3U9UB 1DQML 3ZE1E 2ID5A 1QTYT 2FJFA 1YY9D 5A6IA 4P46B 5K1VA 4QD2E 5BUAA 4JGNA 2VXUH 2XACC 3GMNA 4G80A 1VEPA 2JV6A 4N2NA 1TENA 4GG6F 1NGYA 3C08H 3KCPB 1CIUA 1J87A 3JTBA 4N2CA 4L8SA 1RP9A 5IBLC 2R69A 4AMWA 1G1KA 3D4CA 2W0KA 1B90A 3FCBA 4ZQKA 4JHAH 5I8EA 2IPTH 2JKWA 4L3EE 1RMFL 5T1MB 5EMYA 5B1KA 2VO5A 4F2EA 4HFWA 3IVKB 3P4MA 3BKJH 1UD2A 1EH9A 2B59A 5IVXF 3RL1A 1JZIA 2BRRH 4FMVA 4CMMA 4LOVA 4HF5L 1IKNA 1JHKL 2CXKA 5F7DB 1QUNB 3VD1A 3PV6A 4EUPB 1CD1A 1Z9NA 2ZKMX 5C97A 1HL5A 2YRBA 3V0GA 1BZ7A 4AV4A 2DQHH 5HVWA 1J8HE 2ADGA 2VSDA 4W4OC 1ITCA 1BBDH 2JWYA 2X1QA 3UAJA 1K2DA 1JZ3A 2F5AL 5HGDA 1AJ7L 4ALAL 2IDQA 5I28A 1ZS2A 1NBYA 5JQIB 1N18A 5DJ6B