1N8OE

Crystal structure of a complex between bovine chymotrypsin and ecotin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
138
structure length
136
Chain Sequence
QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin A, A chain
publication title Crystal Structure of a Complex Between Bovine Chymotrypsin and Ecotin at 2.0 A Resolution
rcsb
total genus 19
structure length 136
sequence length 138
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1n8oE00
1IFGA 1AZZC 1XXDC 1SLVA 1EZUA 1FI8C 1XX9C 2Y6TE 1XXFC 1SLXA 1SLWA 1ECZA 1SLUA 1N8OE 1ECYA 1ID5I 4IW4C 1P0SE 1EZSA 4NIYE
chains in the Genus database with same CATH superfamily
3UL4A 4Y19D 1NEZG 2A5UA 2WXJA 5T5NF 5ESVA 5T1MB 1PW3A 1JRHL 2UX7A 5AL0A 5I18H 3FN0L 4FJ6A 4W4NA 4IGBA 4HIIA 4ORGB 2CWRA 1XB3A 2OMXB 2H2SD 1G6RH 1B3IA 3EJQA 5D6DC 2VLLB 3W57A 1FFPB 1S9YA 4O9HL 1UB5A 3V4UH 2BP8A 5ELIA 2EKJA 4I9WD 2Q8AH 2IDUA 1W72L 5I74B 1RUML 3FQNB 2HFGH 3GQFA 3CZKA 2UZXB 2OV0A 2ITCA 3T3PB 2YR3A 3QUZC 4NNXA 1IM9B 1FG2B 2CIIA 2WO4A 1XGQB 3A6BH 4I0PA 5AWNL 1IILE 3L9YA 4WI4A 3VU1A 1J0IA 1RZPA 3KAAA 3OG6B 2OAAA 2W0LA 2EE2A 4MJ2A 2WLKA 5TK4A 5I1JL 2VMCA 1WBXB 5C0EB 3F7YB 3L3HA 1ASOA 3U4BH 3NN8B 4X6EB 4FXGB 5DQ9A 1H3PL 5ECGA 4FA7B 4NQUA 4K2UL 4G8EB 2HX8A 2IBZX 5C0BA 5DUPH 4ZFFB 1YEFL 3OKLB 5LWYH 1NAKL 3DROB 4PRPE 3PAVA 1OK8A 3MBXL 3CPLB 5GRVK 3RRQA 3DDFA 1IAKA 1JNNH 4F33B 4KGJA 1EAOA 1BJ1H 3CCHA 4NO0B 1T0MB 1SYSB 5GSVA 3U30C 1A9EB 3ROOA 3T1FB 4JCLA 3EGSA 3A3YB 4MNGB 1CT8A 2NZIA 3O0RH 3VXOB 3G6JE 3X11A 1BVNT 4O02L 1HHKB 2FRGP 1XX9C 3EFFB 3N3EA 5FGSA 5ILTL 2QPSA 4X7TB 1E4XI 1JTTA 3DUSB 3TT3H 2QKIA 4YS4A 2EKSB 5EO0A 2NYYC 1ZY9A 2A6KB 4RQQB 3VM7A 5HHOD 5KG9B 4X99B 4HDIB 1CTNA 2FGWL 2BSSA 4FNUA 3OHXC 1NPJA 3LH2L 1JPFA 2X40A 5E24E 4G7VH 3WUWG 2RD0A 2UZPA 1JV2A 4X6CF 1BVKA 5IQ9A 1XH1A 2AXHA 2C3GA 2HVJB 2WO2B 3MLUL 4OIIL 4YHZL 5C2UB 3FRUA 5IMKB 5C09B 3UTOA 3QIBC 3NSJA 2DBJA 1HKFA 3G5VA 1U91B 1BAGA 3DBSA 4HKJB 2AI0H 3JVFC 4OAWA 4F8QA 3TN0D 1J5DA 4GAYB 1U58B 4YSRA 1I85C 4G80A 1WP6A 4E36A 5AVRB 3DIVA 4OM1H 4JHZA 5IV2B 4D9QE 1FNEA 1WZ1H 1JCKA 2GPZA 2CR3A 3BQUB 3P3SA 2WLZA 4CW1A 2ZG3A 4HK0B 5ICYB 5KBNC 4RX4D 4KOCA 4BXSV 4IGBC 2EIEA 1GZQA 5H94B 1RHHB 5EA0L 2AQQA 2H7WA 1J0ZA 4J4PD 3C5ZB 3U48A 3HPLA 5EORH 3T04D 5KVGE 3CVBA 3OKOB 4FFZA 1ZVSA 4PY8I 3PUCA 4I77L 1TJHL 3VRIA 4UTAL 4LSPL 4RGMC 1C1EH 3RKDD 1OF2A 1ASQA 4I0PC 3DOIA 4LLAA 1T89C 3KBHE 1CGYA 5CZVL 4KUCF 4KFZC 5EC2A 4HCFA 4HBCH 1DTUA 1EWHA 4HIJB 4UV4H 2EVJA 3DKHA 5KVGH 3KLAB 3IWUA 3S0PA 2FHFA 4Z5RB 3O6FD 3MRJA 1PS3A 4PUBH 1FZMB 1E4KA 2XQBL 3BUYB 4P9ML 4ZOAA 2IANE 5IEKB 1OAXH 4QJ4B 4KUZH 2XCMC 1PNCA 4JFQB 4RMSA 2XWJB 1DVFB 2R15A 2Y07L 3MREA 4E0RA 4YLBA 4XO5A 1MH5B 3GMOB 4O2EB 1K4DB 1DLFH 3RHWF 3TBTB 4WO4C 1YJDH 1JFQH 1MFNA 2EDOA 1X5HA 3H3BC 3BUQA 4GNKB 3IMRA 1FZKB 3BEVB 4JO2L 1QNZL 5SX4I 4WDIB 2E7MA 1XIWA 5DJXA 3BI9X 5ITBH 4OFPA 2M83A 1QZ1A 3IB4A 1QLEL 3PCYA 4K9JA 1UT9A 3G6AB 3R7QA 2DJMA 4QHLB 4JJ5B 3SPJA 5CM1A 2QKIC 3UACA 3CZNA 2NQDA 3VCLB 3IJHB 3WS3B 4L4VA 3MRHB 4DKEL 1DJHA 1QKZL 4W9HC 2VXVH 3ZZ1A 2FR4A 2VLJE 4WNQA 2CUIA 4G72B 3FUIA 1EANA 1GS8A 3MV8B 1ADQL 3FTYA 4OFDA 3SE8H 5CCGE 4FQHB 4QXTB 5ABDE 5KS9E 2H0EA 1G7MA 3A6CL 3UGXA 3UJTH 2C9SA 2FIRT 1T1ZB 4OKVB 4PPTA 3GB7B 1BZEA 1WJ3A 1MJ8H 3MNVA 4GB9A 3OD3A 3PUUA 5D1QA 4E9XA 1BBJA 2X9XA 3UJIL 2EIMB 3QXUA 4MMZA 3TEYA 5J1SC 2ZAHA 4L3EB 1EEZA 2FJFA 3QNYA 4OLYH 5JOEA 2OSLA 4ADJA 1XCXA 3FU3A 1DSWA 3CZUB 2I60L 2XDHA 3KZ8A 1UZ8A 3V0IA 5GGVH 2NR6D 1OP3K 2D73A 4PU2A 2HKFH 3BHBB 3P2DA 5EO1B 3CFBA 1NGZB 3B2PA 4PCTA 4Y2OA 1NGXB 3ULAB 1E6OH 3Q2WA 3RJOA 5GGRY 2FB4L 25C8L 1QUNA 3KGSA 5DD1L 3LKOA 5AZUA 4MQ7B 2QGDA 5E4EC 3SE6A 1BQLL 2PPAA 3FB6B 1QW8A 2DMKA 3NJKA 1TJGL 2K9UA 2PCPB 3P3RA 4QI3A 1JXJA 3B34A 3RJDA 3BO8A 5TE6H 3N50A 5E99L 1EJOL 3HZKA 1MWAB 2LLLA 1WHOA 3AUWB 1OALA 2J73A 3OVUB 4KKAD 4O5LH 1R3IH 5AOLA 4G6ML 5BS0D 4N9OB 2DIJA 1KIRB 2A7BA 3FSOA 4MDRA 4WW1A 3UADA 3MLSL 1UWYA 3C60B 1R17A 3S34L 3ABLB 1KCRH 4JY6A 4TUOB 1NAMB 4I4WB 2I24N 1AGDA 4LCWD 3LEXA 2BCKA 1I8MA 3N1FC 2ADJB 1FNSL 3S88L 4FFYL 1CXEA 2CUMA 4CN4A 4YBHA 1NDMA 2QFPA 2R83A 2UV3A 3O6MH 3HG1A 3HE6D 1I7UA 1TQCC 4QRRB 3BISA 3TIEA 1DO5A 5SWSA 4P57B 2CHDA 2HRHA 2RGSA 3GIZL 4UUJA 1E6JL 4Z3FA 4YK4C 5J8OA 4KJYA 1RK1A 3GTVA 3V0GA 3L6FB 4N9GB 2ZX7A 4IRJB 2FD6L 3RP1A 1WAAE 2RA1A 4PJ8B 5DFAA 3OC8A 4HX1B 4FHKA 4WEEA 4XMKH 5EZJB 3VWJB 1IM3A 4Z78B 2DLGA 3S8GB 2HLFD 3ULUF 3ALXA 4W81A 4WW2F 2O5ZL 2OMYA 2FX8H 3HR5A 1MFDH 4M62H 4M00A 4TPRL 4EKXA 1Z6JT 5KVEH 3VGEA 5JW3L 5F3BA 2EDEA 2ZCKH 1HT6A 3RVWC 5I2IB 4EVNA 2VLMD 4Z3HA 1F4XH 3GSUA 4LRNL 4B53A 1OCRB 5T33H 5LGYA 5I5RA 2WW8A 3DX9A 2ZCHL 3NESA 5I1LA 3IK2A 3KPQA 3RPKA 2YZ1A 1L9MA 1FORL 1I3GH 1MG2C 4YGAB 1ZSDB 5BV7L 2NTFA 1EH9A 3EADA 5C0JB 3OC5A 5CHNB 1U41A 5CN2A 5EU6A 5I0WA 2WXLA 1E42A 3DMMA 3HKZA 4MMZC 1I8UA 4RMRA 4P4RA 1XGYH 5CO1A 2XTJD 4I0CC 5DEFA 5HHPB 5IMLA 4H8WH 2R8SH 4HUKB 1GGUA 1QEWA 3PQYD 3KPSE 4LVNC 3FTGA 3QUYD 5E00A 4P2QD 1S9XB 3DV4B 5DJ0B 1TJIH 4PP2B 5DUJA 2A77H 1M1SA 1D5RA 3S35L 4F37K 3MRQA 8CGTA 3O45B 4M1DH 1ZKAA 1U8CB 2I9TA 5A3IC 2F9BT 1JSYA 2MHAB 2G4GA 3AVEA 2WKGA 2WQAA 2APXA 2EABA 4X7EC 1CBVL 2OBGA 3ZBMA 2FEEI 4U2YA 3L13A 2GTQA 4PJAE 3O3EA 4Q74A 4XVOA 5CD3B 3HI1A 3QCVL 1EGJL 3MGOA 5DK0A 3S36X 2DD8L 4L37B 2G5BA 3AMLA 3NACH 1HN1A 1ONQA 1N7MH 4Y4HA 4XZ4A 2Y7SA 5DRWA 1FN4B 5B39G 4PJHE 4PJ9A 1CL7H 1SDDB 5L2KA 2ESVA 5DVPA 4HMEA 2VR8A 2DYSB 4XVJL 5A2JH 5T3ZE 2ZP9A 1E9QB 1FAIL 1FHNA 1ANUA 3IDNB 4GP4B 3UC0L 5LG6A 3K91A 5KSUA 4B9JA 4AM0Q 4DK3A 5HJ3A 1MY7A 3IFLL 4TRPH 2CBMA 2MSPA 4NJAL 3QDGE 4NRYA 2ICWJ 5HGDB 5C0DA 3RNKB 3E8UH 2WLJA 3NMEA 1T3FB 1JP5A 1UACH 4LGRB 5T3ZH 1GGYA 1MN4A 3QQNA 4PWGA 5IKCA 3VXPB 2Y72A 1R33A 1PEWA 4GSDH 4IBWA 3WIIL 5T1KA 4Q9RL 2DEXX 2DQIH 1ZS8B 1D5BB 5IB4B 2VR9A 3BFQG 4AVHA 2YZ8A 4UU9A 4HC1L 3MOAH 4PWIA 1MCCA 1Z9OA 5CFHA 4EDWL 1PY9A 1A3LH 3EHBD 1A6WH 3C5SA 2FWUA 3O2WL 3K74B 2YKLL 3N42B 4N2LA 1OAZL 4KMQA 2X4SA 1ECYA 3TPUA 2V9QA 3IJYA 1FIGL 2X1XR 1JVKA 3MXWH 3QXAB 3T3MF 1NCIA 2BX5A 3QCUL 1GGCH 1OE3A 4JHAL 5DO2D 3GEWB 3RIKA 2OMBA 3UZVA 2GAZB 3TGXA 5DTFB 4KJQD 5B7FA 1CGSL 5JHLL 4HV8B 4NWUH 2PXYD 2XG4A 4IMLB 8PAZA 3RX5A 2VLKB 4PMFA 3DMMC 3KDMA 5MEQA 1JZIA 4WEBL 2GSMB 4YBLB 2B16A 3AREA 4YFDB 3CX2A 4QRPD 4NKIH 1MRCL 1XF3A 3VRLF 5C1MB 4P04A 3V7MA 3U46A 4POZC 5CGYC 1FVDA 4S1SL 3Q3GA 1EK3A 1PZ5A 3WNPA 4JRYA 2X4NB 3V4VB 1S7WA 5T1DL 2XXGA 4J3SA 5D9SB 2H9GA 2D4DA 3UH8A 2DWDA 3H9ZA 2XWTB 2VMFA 4ZUWB 2D4FA 2XRAH 3BD4A 1DR9A 1MHCA 2XVLA 3NCMA 4PJCA 5D4JA 4OLVL 4RMWA 1IBFA 3HZMA 3B1UA 1AI1L 3ZKXB 2V2WA 2H6PB 1V27A 2HRLA 5DT1L 3UABA 2YIHA 4I3RL 4MA3B 3SKJL 1F6AA 3MLVL 1LVEA 1DJGA 4FKKA 4PV8B 2FBRA 5DMIH 5IBUG 4OR1A 4YNYA 4HUUA 5CIPA 1L7TH 1W0YT 2JELH 1A4JA 3B6SB 4DP4X 1IGYB 1XCTA 3NCCB 5KYYB 5J3HD 2YMTA 2QGEA 1I3UA 1AP2A 4MJJA 3ZE2B 4G3YH 3BSGA 2XNAA 3MNWA 4ADIA 1H8NA 4AGPA 5D1XA 2JK5A 5HYFA 4LBEA 2N59A 2R7EA 4A6YH 4N86A 4PJFB 1S2EA 5DZAA 5LGKA 2VISB 3VFTB 4G70B 1KLFA 1S3KL 3FC8A 4M6OL 2H0FA 3IMUA 3RZWA 1QRKA 2J21A 1GCFA 4JMXA 3T2QA 4OJFL 4YOKA 4U1JB 1YMMD 1BZOA 2NYYD 2E27L 3P4NB 1MCBA 3ILQD 5E5LA 3QFDA 1SBSL 5AKTA 3U4EB 1IBYA 1OSZA 1UJ3B 3O4LE 4GFTB 1AJ7H 5J6GB 3WXVL 1LL1A 1KCVH 4QRUA 3L3KA 1K5NB 3WIFA 5JHDD 4S0HA 3BH8A 1R6VA 2IVFC 3JTSB 3QR1A 3FSZA 3NJJA 4BKTC 2CLRA 2IEPA 4B9FA 1IGJB 5IIEB 3WG7B 4G1EA 3MRGB 4XAKE 3ZGHA 2XZAH 1J18A 1QBLL 4HCGA 4F2MA 4PJIA 4U6YA 3ZN6A 4XPAH 1LM8V 1PCXA 1P2CA 4YHOL 1QATA 3K6IA 4GW1A 5D1ZC 1XXFC 5GGQH 2YPLE 3AREC 4KAQL 5DJAA 2A1WL 1G4RA 3ZGIA 1BD2E 4MXVE 4QPEA 1L5GA 2PNDA 3PL6D 1KV7A 4L29B 4XPFH 4UB0H 1KF9B 1Y1UA 3I9IA 4G9FB 4MCMA 4X5WA 5HYSB 2NX5B 1YEIL 1A4BA 2QGCA 3E80A 4AI7A 1JZFA 3WNNA 4RAHA 1R3JA 4AWJC 3KJ6L 5DD3L 3WNLA 3LZOA 4QOKB 1YN7A 1KBBA 1NMCC 3VXQB 5IW6A 4L3AA 5TDPA 2QR0B 1RVFH 3KL0A 3MV11 1OSPH 4LASH 1M53A 2FE0A 2MCPL 3ZE1F 2IQAA 1A1NB 3AG4B 5I9QC 1DANT 4KXAA 4JCMA 1X5GA 4LB8A 3P54A 2G4EA 5DMKA 1EJ8A 2C4XA 4K3JL 3S36L 2P24A 5PCYA 2BSEA 1V7NL 1F3JB 3NT0A 1RIUL 3WO3B 3UYPB 3FNKA 4GUCA 2ZKWA 3MV7E 4F15C 3DX4A 4M8QA 2KQMA 4MYPA 2WCGA 3AWFA 4M5TA 4RZCB 2F8VA 4UINL 1EFXA 1LP9A 2AEWA 1ZT1A 1QI3A 1OTSC 3RDTB 1YNLL 1UB6B 1EPFA 2E46A 2NYZA 5CBAA 2ICWB 4IHOA 4M5YL 4CL7A 3G5ZA 1SZNA 2JNZA 4UOQA 4B5ZA 3AQZA 3ILEA 2CO6B 2AK4D 3PP3H 1IAIL 5EC1B 2NW3A 3N0AA 2KI6A 5FO9B 4J28A 4FLOA 4NIKB 3ABZA 4M7JL 3PXHA 3L9EA 4YBQC 4U1KA 4ZTPL 4UM9B 3WEBA 3QEGL 4H88L 1J5IA 5ENWB 3T4AB 1J1OH 2BRRL 2XY2A 3P3YA 1BFOA 2WCPA 5AW0B 3W5NA 2BW5A 4AT6A 4ODWA 4HKZA 4G6JH 1HQ4B 1L9PA 1PYWB 4XBEH 4E9LA 4I85A 4U1MA 1VESA 3AXLB 5GRZA 2FYVA 4AX3A 2BWQA 3RIAF 1T0NB 4LLUA 4PY7A 4XCYB 2HFFA 1T2JA 3HFFA 3V55A 4BK4A 1KG0B 1UXLA 3B4NA 4JDEA 5CSZA 5JORA 3COOA 2OYLA 2DOCA 4YFLI 1CXFA 2AKRA 1U8HB 4RAUA 4DKAA 1CZ8H 1CTMA 2WTOA 3KGRA 4MD4A 4O51B 1V55B 4X8JB 3SEPA 3HB3D 2CM6A 2R0WH 2QGBA 1R5WB 3BH4A 2YEZB 2YGNA 1TEYA 2EUXA 1D6EB 3C2AL 4X6DB 4RIRB 2I25N 3F5WA 2B77A 5MHSE 4A7UA 3APDA 4LEXL 3VXMB 4HF5H 1A66A 1NEUA 3VFOA 3KGTA 1U2YA 1DQKA 2YD2A 4Z7WA 1C5BL 2EDBA 4BKLB 4N2OA 4FQPA 2ATAA 2JXMA 2VE6B 1HC1A 2IH3B 4WU5A 4K07A 4MCNA 1KB9K 3L1GA 5D2NE 3REWA 1NFIA 4G42A 1GY1A 3FH5A 3Q43A 5HTSA 2XIDA 1FVEA 2A6JA 1A21A 3A4EA 1SLXA 3SE4A 4E9SA 3US0A 1ZE3C 3FN0H 1T1WB 1H9VA 3L3OA 4MRCA 3VG0L 4I7ZC 3VI4E 2K6YA 1WFTA 4MSWA 5GGTL 2BNRE 4Y1TA 4Z7OF 4FQLL 4HWNA 4Z7VA 3HZVB 4O9HH 3OZ9L 3X12B 2DIAA 4GMSL 3GO1L 3RY6A 1EEYB 1H8SA 4W9EC 4CC4A 1W72H 3P9MB 1RUMH 4QHUB 1KIQA 1RUKL 1RZFL 1YPZA 5AW3B 1B0IA 2OCJA 3RBSA 2ZKMX 5IMOB 5JPMB 5AWNH 4AYID 5HXMA 4MZ2A 3BWUF 4JREC 2FZ3A 3PNWA 4KV5F 2YD5A 2MEJB 5FKAB 4MWFB 4PP1D 5G2NA 1FFTB 3TBYB 1JF6A 4F5CA 2LAAA 1H3PH 1XIWD 1IVTA 3K2UL 4K2UH 1X6LA 5F1IB 5C7ZA 5D5ME 2ENPA 1YEFH 3PGFL 4IIZA 1CU4L 1VFAB 2C7UA 3M07A 4Y5XA 1EHNA 3MRMA 3MBXH 1JMZA 4Y4KC 1BW8A 4OLZL 1ZOXA 4KKRA 4L4JA 1O9VA 4L4VD 3QEQE 1VFBA 5GGSB 3GBEA 4XCCL 3OKKA 4DUVA 2YQBA 4JKKA 1TQBC 2CBQA 3C5XA 5T1MA 4G6AC 1DBAL 1KLGB 2OW7A 3TF4A 1G1OA 4CILA 4GS7B 1JXDA 5AOMA 2VN6A 4O02H 4ORGA 2VRQA 2OMXA 3NPSC 4JG9A 4FE9A 1M57B 5JIQA 5ILTH 2DQMA 2F7IA 2VLLA 1FFPA 4IBZA 3P4MB 5D1QD 4N5UA 1ET5A 4KXDA 4KKPA 4LLVB 3PYCA 1HOEA 3EDKA 3KM2A 4QHKJ 4NAJA 1KACB 4XWGH 2UZXA 1IMHC 2FGWH 3SPVB 4XP1L 2X38A 1QHOA 3ABGA 4CVWA 5CJQL 1N18A 1IM9A 1FG2A 1XGQA 2NY0C 2JI2A 3ES6B 4UOZA 3GXPA 4N2DA 1AR1B 4HOXA 3U6XS 4KKQA 4YHZH 5JZ7C 4OIIH 3MLUH 3SDCB 2LHAA 4OCSL 4KH9A 3GMQB 1C12B 2AXGB 3NIFE 1WBXA 5C0EA 3AADB 3F7YA 4ONFL 4NQCB 1CYWA 3NN8A 4X6EA 3WY4A 5I6XC 3I50L 4FXGA 3CSFA 1R5IB 4H2CA 4NUGL 2JCCF 3DBXB 3WYRA 2R1XB 5FUCC 2X28A 4G8EA 4LSSL 1QTYT 1UCBL 4WV1B 2C9UA 3QG7L 4FFZL 2DQTL 5B22A 2ZXBA 2WY3B 3OKLA 4ZFFA 1TQSA 1L0QA 1WPCA 2BXYA 4M9PA 3DROA 1M56B 3CPLA 5SV4A 4CBPA 4XWOC 4F33A 1OLZA 4FCHA 3ZIYA 5IBLC 4XPGL 4XPBH 2B1HL 1OAYL 4NO0A 1T0MA 1SYSA 2ADFL 3L3OC 5C0NC 1A9EA 4U7SA 3P2TA 3H6JA 3T1FA 4XH2B 4Z7UF 4DGYL 4MNGA 3VXOA 3S4SG 2TRHA 2BNQE 2GG1A 5EA0H 3UAJA 1ZA3B 3KXFE 1GY2A 3ZE0F 2FHBA 1LEKB 2V8MA 1E0OB 5I1KL 1ODUA 1YEHL 1HHKA 3I84A 3EFFA 3RY6C 2R9HD 1U9KA 1CI5A 4X7TA 3DUSA 2EKSA 5E8NB 1WZLA 4J5VA 3ZYIA 4I77H 1TJHH 4UTAH 2A6KA 2DS4A 2WXHA 4LSPH 4RQQA 4U0RC 1ZVHA 5KG9A 4X99A 5CZVH 3CH1B 2YLKA 4HDIA 4IKIA 4P3CH 5JXAL 2XWEA 1NGYB 2V5TA 3KWVA 1PEZA 4JPVL 3RIFF 3VMPA 5J6SA 2VL4A 5HJBA 2HVJA 5E94B 5C08E 5KBLA 3CK0L 5IMKA 3BAYA 2XQBH 4PR5B 4P9MH 5C09A 1IM3D 4Z3IA 3WCYA 1U91A 2BZCA 2NY4B 4HKJA 3VI3B 4BQCA 1YSOA 4DCQB 3ZL4L 2BVUA 2Y07H 4LIQL 4Y5XC 4AJVA 1AG6A 3OR7B 1NUDA 2P26A 4PCSA 4GAYA 1JFHA 1U58A 3GKWL 4FXKB 4W9JC 5HPOA 4BZ1A 3HI5L 4GSQA 1OARH 12E8L 2VDRL 4NHCL 1FJ1B 4N1CA 4IU2B 2EO7A 5IV2A 2RH0A 1R75A 3BQUA 1A65A 2G5UA 2JB5L 5ICYA 4HK0A 4JO2H 2HUEA 1QNZH 2Y7MA 2W59A 5I73B 1MF2L 5H94A 3FUNA 1BFVH 1RHHA 1QLEH 4X7DC 4JFEB 1JGEB 3FO1B 4UZGA 3MLPA 3D08A 3C5ZA 3OAZK 1I8LA 1TTUA 3TX4A 5JYLA 5I74C 2VLRD 4DKEH 3QC6X 2IWEA 5IFHH 3KYOB 1QKZH 3OKOA 4Y0GA 5TQ2L 3ZU8A 2PABA 1FAKT 4OUOA 2XN2A 1ADQH 1LQSR 4FZEL 2WWMD 5T1JA 2WNGA 3I85A 2HN7B 5GS0C 4LHUG 3A6CH 3ASNB 4HIJA 4IBYA 1RHFA 3TBWB 5LLIC 5ICUA 3KLAA 4Z5RA 4L0PB 3UJIH 5DVKA 1WZAA 3QWNA 5EUOB 1T1YB 1FZMA 3BUYA 4A66A 2D7NA 5IEKA 4N2NA 1A8ZA 4JFQA 4PGZA 1IEHA 2XWJA 2X4OB 1DVFA 3DC0A 2I60H 5FK9B 4TVPD 1LHZA 1UD2A 2EIJB 2QVIA 3K8LA 1MH5A 2OJEB 3FU7B 3GMOA 1K4DA 3MJWA 4JRXB 4O2EA 3FAXA 5GRXG 4HJTA 4Y4HD 1QSFE 4NJ9L 3TBTA 1U93A 1SEBB 2R39A 2YN3A 4PJ9D 5HP5A 4PYGA 3S5ZA 5L2KD 2FB4H 25C8H 5DD1H 4RGNE 1FZKA 2NY6B 1PFCA 1TQTA 3BEVA 2CKBB 3QQ9D 3BDYL 1BQLH 2EE0A 3QJZA 4LOUD 3UAJC 5FHBL 4GSRA 1TJGH 4Q89A 1SM3H 1FNHA 1VKXB 4Q6KA 3G6AA 4QHLA 4JJ5A 4GT7A 4MASA 3ZHFA 5E99H 2BVOB 1EJOH 3VCLA 3IJHA 3SYOA 4XC3L 3WS3A 3MRHA 2DM2A 1F97A 4M3KB 4OZIB 1QHQA 4JRWA 4JLRB 4Z3TA 5HVHC 3PHSA 2DQGL 3MLSH 3MV8A 3S34H 4PVBA 2PTVA 3KE0A 3NZSA 4OFVA 4NZ8A 1XZ0B 4FQHA 4QXTA 2G2PA 2YMOA 4ANKA 1FNSH 1NANI 6PCYA 5T1KD 4BUQA 5G55A 3S88H 3KLSA 4FFYH 3N43F 2O5NA 1T1ZA 1M3IA 4OKVA 3GB7A 2LT9A 1AD0B 4YPJA 2YPLD 4YDIL 4L3EA 1U30A 2XZQL 3HHMA 4G59C 4H4NA 3GIZH 1L6XA 4JY5L 4N6QA 1E6JH 2Q3AA 3IDUA 1U2CA 5DFWH 1KYDA 4FHJA 5CCKL 2PP7A 5I6PA 5BRZA 1L9OA 3CZJA 5KVDL 5DHVB 2GIXA 4QKXB 1ACCA 1XL6A 2FD6H 2NDGA 3BHBA 3BQUC 2GSGB 3FXIC 5HHQB 3FKUS 5EO1A 1NGZA 1DBJL 4XTRC 1NGXA 1SOKA 2ZUUA 4XMWA 5DS8B 3WKQA 3D06A 1ZK9A 5MI0B 4P2RB 5AOJA 3ABKB 2O5ZH 4MQ7A 4ZODA 2CA4A 4TPRH 1ILSA 2A74B 2H4EA 2NSXA 1MAKA 3FB6A 3PDDA 2CH8A 5JW3H 2ERJB 1I8LC 2PCPA 2J25A 1DUZB 4CSTA 4LRNH 3V4PA 4XN9A 1WQVT 2ZCHH 4KI5E 4LEEA 2IJ0C 5KW9L 1MWAA 2WPGA 4GRLD 1IE4A 1EEUA 4GKZB 3Q8CA 2D3LA 1FORH 1QR1B 4GKSB 4U6HB 5DHXB 1PLBA 2FT8A 3GRGA 3DUUB 1KIRA 3MKKA 4JRYD 2B1OA 3DHMA 4TUOA 1NAMA 4I4WA 1ZRUA 4U4IA 2ADJA 2BFGA 2DKMA 2P42B 1J48A 1A02N 4TLTA 1RPQA 2ZD0A 4NFBA 2DLIA 1DVFC 4QRRA 4RWHA 1K5WA 4P57A 1MZZA 4ES9A 3T2PA 4GSUA 3OKMB 1R3LB 1OPGH 3CWGA 3S35H 1J5HA 2P5EB 5T3XL 3LH9A 1TT6A 3FQ4A 2FO1A 3L6FA 3D85B 4N9GA 4IRJA 4PS7A 3T5WA 2XQYG 2D2CC 4PJ8A 4HX1A 3VWJA 5EZJA 3GXDA 1CBVH 1RD6A 1ZHLB 4HCRA 4Z78A 4NQSB 1BMZA 1QA9B 1U95B 2XX1A 5T5FA 5MEND 3WIHA 3QCVH 3IMTA 5DC9B 3BGFB 1EGJH 3QEHB 3L9BA 1NZRA 2C9PA 2FNBA 5D1XD 5I2IA 4L3FA 4BH8B 4GAFB 3ARDD 2P80A 2QHLA 5C0CE 1VA9A 4P07A 5DU7A 3WE6B 4XO4A 4ZSOB 1DVZA 1ZTXL 4OLUL 1AGEB 4W6WB 4ENZA 4YHKL 1JF1B 4XBMA 5HYIA 2O6FA 2VMDA 3QDME 1EVTC 1FAIH 1SXSA 2WBWB 1ZSDA 5LB1A 1KYAA 2ICEC 3UC0H 2V7NB 5JW4R 5C0JA 1UC6A 1FHGA 2EE9A 3ECBB 5CHNA 2BY0A 3ZTNL 3IFLH 1XBDA 4NJAH 1CGWA 4JM2D 5HHPA 1UH3A 3Q13A 2FH8A 4PV9B 4BINA 2ZYSA 5E5UB 4JDTL 1S9XA 5JW4Q 1U4FA 1PLCA 2IOIA 2H1LM 3UZEA 3WIIH 5L0QB 3WU1A 3MGTB 4PW9A 3O45A 4WO0A 5DQDL 1ID5I 1U8CA 5FYKU 1MREL 4NBXB 5DZOA 2MHAA 4HC1H 2IWFA 3H6AA 3LPFA 3LNDA 2ZWSA 3IS0X 4EDWH 2UZYB 2KLRA 4N0RA 4UNIA 1VADB 3O2WH 1QBAA 4N2KA 2YKLH 5CD3A 1RKRA 1OAZH 1A4AA 1A25A 2CRZA 3OB8A 1FIGH 4KJPC 4L37A 1MFBL 4XP6H 4KVNL 3QCUH 4ZXBB 3ZT7A 2F8OA 3KM1A 1PNDA 1FN4A 4JHAH 1E4HA 1AQKL 4FKHA 1DL7L 4H0IA 5C07B 1SDDA 5I8KL 5FYJL 4GKLA 1CGSH 1IEAB 2J44A 2YARA 4FG6C 5JHLH 2CDFB 4JFHD 5CU9A 1E9QA 4P4KB 3IDNA 1LYQA 2KC0A 3UTSA 4PB9L 4CC0A 2CJ3A 4WEBH 5F9JB 5L7XL 1XZWA 4HJ1A 3SQOL 3CXFA 3DECA 2WAHA 5JW4M 2E6QA 1JGDB 1MRCH 1XEUA 5D7LE 3LV3B 1FDLL 3EYFB 4PG2A 4L05A 3GWJA 5HGDA 3P1VA 3Q2VA 3RNKA 4J39A 1T3FA 2QHRL 5TGBB 4YSDA 1CLVA 4ELDA 4S1SH 5CD5C 1ZA6B 3LRSB 2RBLA 1NMAL 3S3DB 1WZKA 4K7PX 5FA3B 2WZAA 5T1DH 4HP5A 3T4YB 3VXPA 5JW4N 4GY4A 4IRJC 2E4FA 3KS0J 1THCA 5D2LB 3ZDZB 5L4MA 1PLAA 2WWNA 4OLVH 4P5SA 1ZS8A 2VH5L 1D5BA 5IB4A 5H4ZA 4ODSL 3TZVC 5DT1H 3O9WC 2O5YL 1AGFB 3SKJH 3RWIB 4R0LB 5L4IA 2JCCE 3MLVH 4K4KA 3UTQB 2F15A 4QJ3B 1A3QA 2ROXA 3D4YA 3WTVA 3QXAA 4M7LL 3SGDI 1GGIL 2KERA 3CN1A 4BSWB 4ODHL 3LH8A 1IGIL 3CZEA 3MVSA 4BHUI 2GAZA 3C6EA 5DTFA 1ZS2A 3CFNA 1OOAA 3IT8D 3HJEA 5C9KA 3LS5L 4PYHA 3GINA 1AKJD 5HGBB 4HV8A 2FNWA 3G6DH 4IMLA 4FL4B 1J05B 5LDUA 2VLKA 4P5TC 4MJID 5DURD 1UOWA 4NX0A 1XAUA 4M9OA 1EZLA 5FGCE 4OV5B 1KCKA 4YXLL 4YFEA 5SV3A 4PJDF 2ZX8A 1S3KH 1ZANL 3OKEB 4KOBA 2DMBA 4HIQA 4M6OH 4F2FA 5CBEB 2XWRA 1NBVL 2NPLX 1TVBB 1YEWA 4OJFH 2X4NA 2GT9B 2JLLA 3V4VA 3LXAA 5D9SA 4N8CL 4QRFA 1NIDA 2E27H 2XWTA 4NPYB 4ZUWA 4KGLA 5FDYA 2HVBA 4K9EC 4AIEA 1SBSH 3WMSA 2MCG1 4N25A 1W0WB 2H6PA 1NCCL 1UFGA 4E41B 4KFMA 4MA3A 1FYTA 2J7LA 4HEMA 3RVTC 3QYCA 3WXVH 3QJSB 5JPNB 4G8GE 4PV8A 1YY9C 1DJXA 5JZ7D 3L54A 2VDLB 3B8SA 3E3QC 3LPOA 4A68A 4KK9D 5TF0A 3C6SB 1X5MA 3NCJL 1B0GB 1U8IB 3B6SA 3MV9B 5EMYA 1QBLH 1IGYA 2WBJB 1D9KB 5KYYA 5LJYH 2P49B 1IBHA 4Q56A 4YHOH 4HUWB 2A3TA 2IF7A 4OVUA 4KAQH 1BQRA 2A1WH 2VRAA 3PWPB 4QKTA 2IWGA 4RSYA 2ZWNA 4PG2C 1H0DA 2BIMA 3UCRA 3DYMA 1CD0A 2ZUTA 4PJFA 2EH7L 2VISA 3HRPA 3VFTA 1FUNA 3BVUA 1YEIH 1W8EA 3E0GA 3U2IA 3CN4A 1TVDA 3Q6FB 1I3RA 3MV01 2H41A 5FA4B 3KJ6H 4OZFH 5DD3H 4R96B 1KJ2B 3TURA 1RFDL 4PGBB 3DUHA 4U1JA 2Z4TA 3P4NA 4ZW8A 2MCPH 3HE7D 4X83A 3U4EA 1ZPUA 2GB2A 3MZTA 3DO4A 2CO2A 4DEUA 4R97B 3GUFA 1W8NA 4J3BA 4PWKA 3RVUD 4K3JH 1UJ3A 4F7CB 4LOFA 3KPOB 1WISA 3N40F 3S36H 2LAGB 4P5RA 5J6GA 1QI4A 1V7NH 4KZEL 1K5NA 1MVUB 4LHUD 1RIUH 4KROB 3JTSA 4HIPA 1NICA 4KY1L 2W1NA 1IGJA 4UINH 2SEBB 5IIEA 3MRGA 3PWLB 3T9WA 2X6CA 5AAWA 5INCB 1ACXA 3QUMB 1JZGA 4Y16D 2DL9A 1UGNA 1YNLH 1MFCL 4L8SB 4TQHA 5K9QG 4RNRB 1WF5A 4M5YH 3V79C 3SO5A 4YBLC 1KTKE 4JNXA 2GUYA 4TS6A 5F71A 3PGCB 2XTLA 1IAIH 1PX8A 5EH1A 4G6KL 4LGSB 4M7JH 3EDEA 2EZ0D 3I9AA 3MXVL 4L29A 5LBGA 4OCXL 3DX1A 4CUCA 3LHPH 4ZTPH 4G9FA 3QEGH 3UTTE 2ZUQB 4H88H 4FQXC 3HNVL 3ESMA 5HDLA 5HYSA 2NX5A 4ANXA 3TU6A 4PHXA 1RP9A 1K3ZA 3I6GB 2BRRH 2O5XL 3BKJL 1JGVL 3AM8A 5KSAB 1J10A 4QOKA 1GOFA 5FOJA 1FFOB 5E6IB 3VXQA 4P9HL 2QR0A 3BZFB 4LLWB 3ZKQD 3ZKXC 2HX7A 3LN4B 2ENSA 1ULVA 1IM9D 1A9VA 3WLWD 1A1NA 2Q3XA 2X53A 1ASPA 1ZD6A 5EOTB 1TZAA 2XWBB 4CGTA 3HC2A 4WUKL 2FHCA 2X1OA 4XOEA 1QRNB 4KKZA 4ACTA 4ZS6C 4KVCL 4X80L 3U6RA 1OZUA 2WLMA 5TK2A 1F3JA 4HPYL 3UYPA 2R0LL 2DMHA 1Q8MA 4G43B 2X70B 4DZBB 4RZCA 1P4BL 1VJSA 2KPNA 1LE5B 1O9WA 2CDGB 1M3JA 3HMWL 3RDTA 1UB6A 2ZONA 3SSGA 3C2AH 3C09C 2ICWA 4KJWD 2VC2B 5JMOC 3DJZA 4LEXH 1SQ2N 2CO6A 2J2ZB 5EC1A 3P0YL 3GGWB 5FO9A 1HL4A 4I8DA 1N2RB 4XXWA 5HD8C 1ZGLA 1TCMA 3DURB 3UAJD 1KEML 1YA5A 1JWMB 2EXWC 3SO3B 2PYEB 4TOYL 4UM9A 5K39B 2A0LC 3VGAB 3KL5A 3J7HA 3CVDA 4K7PL 2PPDA 5ENWA 4MMYB 1EDYA 2X88A 3LZNA 3T4AA 1YEDB 2GJ6D 3VACA 2Y4SA 4G7SB 4R2GB 5I17B 3U1QA 3RL2B 2A9BA 3WDIA 3MTXA 1PX4A 1HQ4A 3NJLA 2NNCA 4UQ9A 1PYWA 3L48A 4XR8C 2Z6FA 3VG0H 3AXLA 4JPWL 3FU6A 1TG8A 3H2PA 2UX6A 1UJ3C 2BS9A 5GGTH 1AYRA 4X6CB 1T0NA 1ZLEA 3EH3B 1ETA1 4XCYA 4FQLH 4XN1A 4EIZC 3QJQB 4BGLA 2OP4H 3OZ9H 1NUFA 1KG0A 4GMSH 3O11B 3GO1H 1MEXL 1P5UB 2OM5A 2NY5C 3BJ91 1JDCA 4J2XA 1RUKH 1RZFH 1U8HA 2W8CA 4B9GA 2FLBT 2WP3O 2CALA 4OIAA 4QF1B 4AGQA 3UO1L 3ZX1A 2BIIA 1H3VA 4O51A 4X8JA 1IFGA 1HHGB 3TA3B 4HSAC 1R5WA 2B0SL 2YEZA 4UCFA 3BMWA 1D6EA 4X6DA 3QDJE 3BQUD 4RIRA 5C3LD 4QWWC 3B2VH 3VXMA 3LN9A 3DDGA 4OD1L 3K2UH 3LJ3A 2EXYD 4BZ2L 5T1LD 3QCTL 4N8PA 4BKLA 4UTBL 2ZWYA 1GJUA 4AMWA 1K8IB 5KANI 2VE6A 3C5ZD 2IH3A 3AM8C 5IVXE 3BAKA 5HPMB 3SDXF 1WHPA 4ZQKA 2CO4A 2ZUYA 2P5WD 4PJ5E 4XCCH 5DFVD 2Y25A 4WK2B 4IRZL 5F7MC 1TNMA 1UA6L 1DBAH 3MROB 2PN5A 1T1WA 4DPCX 1ML0A 5ADOL 2VW4A 3SOTA 3I9GL 4P3WA 4HLZH 2N4IA 4HLZG 1U2HA 2CAKA 1B3JA 1IE5A 1VZHA 2JKXA 2NNAB 5F7FA 3UZQB 4Z7AA 3ULVC 3HZVA 1WFJA 3X12A 2BOCB 1OAKL 1EEYA 1OM3L 3HG0A 1YYLL 3P9MA 1QI5A 4NFCA 3C9NB 1MI5B 4QHUA 2AQTA 4Q4IA 3TC9A 1XB8A 3KYMB 2E7DA 1I8IB 4EIBA 4LFHG 2MOGA 4XP1H 3GFUA 3EG9B 5CZRA 3VFUB 4C54A 5CJQH 5IMOA 3ARBD 3GSXB 1A64A 4HWEL 4DP6X 1B2WL 4N2CA 1Q72L 2D9QB 3ULSB 1N26A 4KKNA 1SF3A 4GXUM 4OCSH 4DKTA 2OSYA 4GXFA 4ONFH 4XXWC 2Z4QB 5FKAA 2E3VA 3QIUC 4GI6A 1JRHI 4MWFA 3I50H 3TBYA 5HYSG 3TM6A 5CUSL 4NUGH 4BKSC 5EV7A 4LSSH 1UCBH 4U31A 5F1IA 5IROA 3QG7H 4CBZA 2DQTH 5K9KA 1VFAA 3DYPA 1J9CT 3WY1A 4C56D 3GEFA 4GXUN 5GZNA 2FX9L 4XPGH 1OAYH 3MA7B 4N2GA 5GGSA 3VO0A 2ADFH 2NDFA 4JFTA 1C9SA 2RCSL 1W0VB 1VSCA 5IK3B 1DVUA 4DGYH 1KYOK 1LEGB 1KLGA 5GGUB 2WXFA 1K72A 4Y9FA 2YGQA 3EZ8A 4WSJA 5IQMA 5I1KH 1DQJB 4PJIF 1YEHH 2VR7A 3QS2A 3CFTA 1TU2B 5K59F 1UFUA 1BJMA 5H37A 4MA8L 2V0AA 4YSPA 3P4MA 2QL1A 2P46B 3EJTA 4LLVA 4TQ8A 4YDKL 4QAWA 2K0RA 5EU4B 1OTTC 4LIQE 3BLPX 5JXAH 2XJKA 3QUXB 3SPVA 1OM9A 5I1AA 3CVHB 1KZQA 3ES6A 3QJRB 4IJTA 4TLSA 3F12B 4YC2B 4Z1PA 3LNIA 3NIDF 2EIDA 4RAVB 5D93B 5LNGA 3RWDB 3AB0C 4RMUA 2X3CA 5HHXL 3SDCA 2IMMA 3GMQA 1C12A 3CK0H 2AXGA 4L0ZA 4Z23A 1Q9LB 3TV8A 4NQCA 3BXNB 2VZ3A 1IKFL 2R59A 2QVTA 4N2AA 3ZL4H 1R5IA 4H7VA 4LIQH 3DBXA 4U3XA 2ZXGA 5AW8B 2R1XA 3GKWH 1I1RA 1QVOB 5EF0A 2LVCA 3HI5H 1BCIA 4QTIL 5E1IA 4A04A 12E8H 2VDRH 5A16B 1KBVA 1UWGL 5C8JB 3FOMB 3JV5A 4U1GB 4M8UA 3Q2LA 3V9FA 1DCEA 1N3NB 2MWCA 4AK2A 1EHKB 2CXKA 1MF2H 1SN2A 2VKWA 4O00A 4XH2A 4XNQB 5DRXB 5CAYB 5HBBA 3C60D 2YAOA 1YNKL 1X5YA 3CGTA 3OKYA 1LP9F 1ZA3A 3DX3A 3HS0B 4ZG1A 1LEKA 1XT5A 4LPUA 4KK6D 4UV7L 4OM0H 4AG4L 4BIKA 4TUKL 3W9DB 5IB3B 4AUJA 4DERA 3UYRL 5E8NA 5TQ2H 4XNBA 4M6AA 5BUAA 3VGFA 3FZUC 4QRRD 5JPMC 2C9VA 4FZEH 4YUEL 4JCWA 4MMXB 3CH1A 4QY8B 3WFEL 3RGHA 1TENA 1LDSA 1NGYA 2BSTB 2KZBA 2XY1A 3B9VA 5HDBB 1TLMA 4NWTH 4FQ2L 4TSCL 4PJ8D 1Q0YL 5E94A 1DJSA 1YHPA 3VWJD 4K73A 4PR5A 5HJDA 3VI3A 4OSUL 4DCQA 3OR7A 3RI5K 3QPKA 3HG1E 4YDVB 4FXKA 5GZNC 4LDLB 4G8IB 1R0AH 4TUJB 1WVZA 3GD1C 4NJ9H 3ZT6A 4KO5A 5SWSE 3NIGB 1FJ1A 4AIXA 2P80D 4IU2A 4B7LA 3ZT5A 4EZMA 2VTFA 1B4JH 3CE1A 1TQVA 4RFOH 1L0XA 4B0MB 5DD5L 5FCUH 4CAGA 3BDYH 5F7DB 3MRDB 5FHBH 3AT0A 2EEBA 2WOYA 4MXWL 2B9BA 2BVTA 1X7QB 2DJSA 3L5IA 4JFEA 1JGEA 3FO1A 1BOGB 2CO3A 4PTUB 5IFAH 1M7DB 2BCMA 4XC3H 1UWXH 4YPGB 4UDTB 4YHNB 2R27A 1WITA 4R5XA 2ALAA 1M6UA 3KYOA 4QTFA 3DJRA 9PCYA 2DQGH 4ZMQA 2Y36H 1XH3B 3VQ2C 3D39E 3CZGA 4Z7WF 1OGAD 2OSWA 4YJZL 1SDAB 2HN7A 1JPTL 3SDCC 5KVDE 1OCCB 4NXSA 5FM8A 4HJSA 3TBWA 2X6MA 4Y1AB 2H5UA 4A7TA 4ENED 5M94B 4YDIH 2CNYA 5EUOA 2XZQH 1T1YA 5HI5C 2NQCA 4WNSA 2M1KA 3V4PL 1A3RL 4JY5H 5JR1L 1QBBA 1MWAL 2X4OA 3BN9C 5D7KD 5FK9A 4D2NA 5CCKH 5LXVA 3DIDA 4XOCA 2OJEA 3FU7A 4JRXA 3GPSA 5BZZA 5ID1B 5KVDH 2NSQA 2PWFA 3EYVB 1SEBA 5LNDA 2XV6B 3BD5A 1DBJH 4U3HA 3MBED 1NFAA 2XA3A 4GIPD 4LP8A 1KN4L 2Z35B 2CKBA 1J8SA 3QZBA 3P30L 1YPZF 4BUGA 3QZOA 1BQUA 1R3HB 3FF8A 4E42B 1LMIA 4UAHA 1VKXA 1OP3H 4LZKA 3FN9A 3H53A 4YHML 3F7LA 2BVOA 4X7FC 3TPKA 3P4OB 1TSRA 5KW9H 3O8XC 3ARGB 1BQHG 2KH2B 4O2FB 1MKFA 4TNVK 4NQDB 2OJ1A 3LSOB 4O4YL 4OZIA 4JLRA 3EYQC 5F1OB 4NM8L 3VE0B 3NJGA 4TVUA 5AKVA 5E9DE 1XZ0A 2ESVE 4JR9L 1O75A 5T3XE 1AZVA 5HYJB 1UXMA 5T5FL 2YAHA 3VMOA 3F3HA 5BNXD 2H1PL 1AD0A 4Y19B 2VM3A 2X5PA 1KCUL 2WKLA 3RY5A 1OIOA 3UBHA 4FXKC 5DEZA 3Q06A 2Q86B 1X4XA 4U3SB 3BZ4B 1YQVL 4JE4B 4JKMA 3AS3A 1OB0A 4HMDA 5T3XH 5HHME 5K5YA 3D33A 5DHVA 3IE9A 4W9KC 5HHQA 2GSGA 4X50A 1QTSA 1ZTXE 5TD4A 5DS8A 5I73C 2DAVA 3STZA 4P2RA 5DJDB 3V5KB 3IDIB 1WAEA 2VDKL 1D3CA 1SJHB 2A74A 3SD5A 5FV1L 1JN6B 3OV6A 4YSOA 5LKNA 1OT1A 1DUZA 4YE4L 3JT0A 1E9PB 2H0PA 2X0VA 1A4CA 1G5GA 1IU1A 1LGVA 3MMEB 3PHQB 3W0WE 3UCQA 1ZTXH 4MLSA 4OLUH 4TXVB 4YHKH 4GUPB 2W0FB 4GKZA 1QR1A 4GKSA 4U6HA 2J8UE 4UQIM 4WJKB 2DN7A 3DUUA 2O6EA 2B3RA 1CDHA 1CI3M 4K0OA 1U3YA 5TE7H 4L2YA 1GR7A 2YRBA 3PAZA 3ZTNH 4A2MA 1SNRA 3LRMA 4LHQB 3BDXA 2HFTA 1Z9MA 3DNKA 4U1IB 2Z93B 3SY0A 1FSKB 2UXTA 3GK8L 2D7OA 5E6RB 2BHFA 5JDSB 4FZ8L 4DGVL 1KJVB 3V5DB 5LBVA 4JDTH 2AXFB 3ZR6A 5GZOA 3RB5A 1REIA 4MB3A 3NCEB 2VUKA 3OKMA 4K3DL 1Q0XL 3K7UA 1WDAA 1R3LA 1S7SB 2P5EA 5DQDH 1JZ3A 1B88A 4MDIB 1MREH 3D85A 4OD2B 2NY6C 2HG5B 1A6TB 2CLVB 2WLHA 4NCC2 1ES0B 3MFFB 4P23A 1ZHLA 5HHOB 3FB5B 4NQSA 4PJCE 1U95A 1QA9A 3LKQB 1CDCA 4FS0A 2WBKA 4XN8A 1TXKA 4AMKH 4K94L 3QEHA 3KH4A 3TJPA 3VH8B 43C9B 2WNWA 1MG3C 1MFBH 4B6ZA 4KVNH 2HT3D 1TYJA 1PG7W 4XMLL 4NS0A 4HG4K 4BH8A 3K6DA 1AQKH 4P3DB 1DL7H 3WE6A 4ZSOA 5I8KH 5FYJH 1AGEA 4PBXA 1JF1A 2WM0A 2XFXB 5B7EA 3TN0B 3FUHA 1HEZB 1OHZA 2V7NA 5L7XH 3ECBA 1MIEL 3SQOH 2NY2B 1UD4A 2XN9E 3HC4L 3EJZC 3WELA 2UWEB 1FDLH 1KYOJ 3VWKB 1MDTA 2MMXA 2QHRH 4TNFA 5DFTA 4PV9A 1OP5K 1QP1A 1W6LA 2X89D 2P45B 2OTWB 1NMAH 1OY3B 4HEPA 5BVPL 4HS3B 4KMTH 2F54E 3O3UN 2D03L 4BQ9A 5BV7H 5ALCH 2YAEA 5C86A 4JN1L 1HSBB 2YEVB 3MGTA 2MFNA 4DVRL 4JAMB 4Z7NE 5MI0C 4P2YA 4YHIB 4ODSH 5ESAB 1RUPL 5FUZL 2VWEE 2O5YH 1RK0B 2A74C 2UZYA 3JVGA 4YDJB 2NXYD 1Q9WB 1ZDQA 2ERJC 1VADA 2J5LB 4LFHD 3MCLL 2Y06L 5KYXA 4M7LH 1GGIH 4ZXBA 2KZKA 3MLWL 2O4EA 2AANA 4ODHH 3O6FB 5J56B 3EXJA 2UYLB 3ZDWA 4B9KC 2X0WA 2X2HA 3V4VL 2W5PA 5C07A 2GKIA 1UTDA 4CMHC 3T8MA 5CINL 1IEAA 5H2BB 3LS5H 5IT2H 2CDFA 4D7BA 2WB7A 4P4KA 3IWVA 5F9JA 4A38A 5EDXA 4IMKA 4UANA 2BP0B 3F8UB 1JGDA 1OTUD 4YXLH 1FBIL 4Z3EA 2HSIA 3LV3A 2HPTA 4JO8A 3EYFA 4B7IA 1ZANH 4KKLD 3CLFL 5GZOC 2DBLL 4ODUB 1NBVH 5TGBA 4PRAB 1ZA6A 3LRSA 2Q1EA 3I6LE 4DOHB 4DKFL 3KPTA 4J6RL 5L88L 3MTRA 5FA3A 3QBTB 1WT5A 5JDJA 3T4YA 4N8CH 2AITA 3E6FB 3INUL 1E3ZA 1S8DB 5D2LA 4ICXA 4P23C 5E70A 4JKLA 4KKBC 1A7NL 5DJ2B 3D4GA 4HVBA 2HXAA 3ETBJ 3FT1A 4B50A 5BQ7B 1NCCH 4L1LA 4DEWA 1EERB 1AGFA 3BGFC 4NO2B 3RDTD 2Q7NA 3RWIA 4R0LA 5ID0B 5ITFB 5KJRL 1OV8A 4PJBE 1MXDA 1UKSA 1ITCA 1XF4B 4WWID 5FM4A 3UTQA 2M26A 4U0QB 2F7OA 4JN2B 4Q7DA 1J8HB 3HA0A 1RZKC 3NCJH 1I9JL 4RWYL 4BSWA 2LTQB 3RURA 4Z77B 1J5CA 3EYSH 3DSFL 3PY9A 3AGWA 1SFDA 2JJWA 5HGBA 4YQXL 1ZE3H 1J05A 1BJ1J 1OE1A 1F8TL 3JWNC 5DZLA 1M05B 2G9KA 15C8L 4OV5A 2QJDA 2A6IB 2EH7H 3ATEA 5DEJA 1MCLA 3HAEB 3I75B 2CXGA 2FL5B 2QV4A 3OKEA 1GSMA 2KLTA 1GPOH 2Q6WB 2AJSH 5CBEA 2B4CC 1TVBA 1IB5A 4RVBA 4H1LB 2B08A 4OIFA 2G3XA 3PNRB 1RFDH 5L0QC 2GT9A 3FMGL 3ARPA 3T0BA 3JVGC 4WFED 3ZKND 1W0WA 2EVHA 3RWHB 4E41A 2G3NA 5JIIA 1FWXA 5JPNA 4TF4A 3K2KA 2ARJQ 1JK9B 1I9RL 3EJSA 1AAJA 5FWQA 4KY1H 3ZDXB 3FO2B 3QC5X 4X4YB 5DZPA 3C6SA 3CBKB 3LIUA 1B0GA 1U8IA 3EDJA 3MV9A 3UTPE 2WBJA 1D9KA 1UENA 3HE6B 1P1VA 5CR8A 1MFCH 4P4KC 3FHEA 5ANMB 4IK7A 4J3WA 1VGEL 1DJZA 4HUWA 3CSTA 3CH8A 4IMKC 5ES4B 4DP2X 3PWPA 2E47A 5E23A 1RL1A 1AO7B 1KDJA 2DICA 2YGOA 4G6KH 3ROLB 2VM4A 1QSZA 1YAZA 5JQHC 5J11B 1F2QA 4OCXH 1YCSA 3ERXA 2O6CA 2MJWA 3V0AC 4EOWL 3V6FB 1H9DA 3HNVH 3ALWA 4P59L 3IE4A 3S37X 1YECL 2AV1B 4Z7OB 3Q6FA 1WT5C 5E6ZA 5FA4A 2KT6A 4NUPA 3BKJH 1JGVH 4R96A 2GTZB 2HMIC 1KJ2A 1Q9OB 2IADB 2QVMA 1BHGA 5CEXB 5FUCE 6TAAA 4BELD 5C2BL 2IGFL 4P9HH 5DVMA 4U1NB 1T5WB 1T7WA 5GXBB 3UPRB 3LPPA 3HVDA 4R0LC 2N1TE 1DO6A 4JMNA 4Q4EA 4HWBA 4MFHA 4WUKH 4IRSB 3FBQA 3F7KA 2Y24A 4Y2DD 2FEDD 4F7CA 1HX0A 3KPOA 1Y07A 4BDVB 4KVCH 3IGLA 4X80H 2M8XA 1NOAA 5JNYB 1MVUA 4HPYH 2R0LH 4Z7VE 1Q38A 2CCLA 1IGML 4ZX3A 1CD9B 4IBVA 2XTJB 2W88A 1CFBA 5IROD 2SEBA 4C4KO 1GJWA 3PWLA 3UGUA 4MDJB 3A23A 3QUYB 4J27A 3QUMA 4Y5YB 5INCA 4Q9CA 1EDHA 3HMWH 4P2QB 4F24A 3BVNB 4FL4C 2XXMB 4RNRA 4GW4B 3BRFA 2JSFA 4OCLC 1OAJA 5F21B 3PGCA 1KGJA 3P0YH 4UNVA 2VR6A 4KQ0A 5GGVY 1TF4A 2R0ZL 1KEMH 1Z66A 3U79A 4OF0A 3NJVA 3WFDL 1KFGA 4TOYH 5IQOA 2V5SA 2OL3B 5DC0A 3WAKA 1IARB 4W6YB 4K7PH 3B7UX 2J6EL 3I6GA 3Q44A 5BW7C 5KSAA 2YUXA 4L5FL 1W15A 5EZOL 1FFOA 1JPSL 3QHZL 5E6IA 2V6HA 1F00I 4P46B 3BZFA 4LLWA 4DP7X 2PLTA 2J57A 3LN4A 4IOFC 4JPWH 1R5VB 4WK0B 1AR1D 2ZOLB 1G9HA 1KN2L 5EOTA 2XWBA 3ORJA 1RERA 1XCQB 4J1UB 1MEXH 1QRNA 1RZJL 2HTLC 3W9EB 2VDOL 3QEUB 3TYGL 1NBYB 4NQCD 1BXUA 1N6VA 2VL5B 5AFAA 2OR8A 1JZJA 4X4ME 1JJUA 4GQ9L 4NN5B 5AAMC 3UO1H 5JYMA 1CC3A 4G43A 2X70A 2Q5BA 1NEZB 3H56A 4NOBA 5E8DH 4DZBA 1LE5A 1GC1C 1F6FB 2CDGA 2B0SH 1HZLA 3DGGB 3T3PE 3GDCA 3BE1L 4ORZC 3O41B 3NRFA 1O6VA 1UZ6F 1E4WL 2N7BA 5E9DD 4X5LA 4X8CA 1E2WA 5J13B 1G6RB 1R34A 2J2ZA 4OD1H 1CXKA 3GGWA 4Z7UB 1HEJC 4BZ2H 3SYCA 3QCTH 5E56A 4FNTA 5JOFB 4UTBH 3DURA 1JWMA 2LW3A 4YN3A 2PYEA 5K39A 4J8QA 1NCBL 5DLLA 2CPUA 2B14A 4BFJA 3N42F 1FIEA 1EAJA 3HMXA 1BZQK 4MMYA 3WMQA 1EAQA 1YEDA 4FI7A 4IRZH 1H3WM 1S9WB 4EIGB 1VFMA 1TPXB 4YLQT 5I17A 2H8PB 2UXGA 1FV1A 1UA6H 2XKUA 1KNOB 3RL2A 6PAZA 1MVFA 5DVOA 5ADOH 4NO5B 1N8ZB 4R97C 1QBML 2QSCL 1Z5YD 2COVD 5BO0D 4GMTL 4YGVB 3IDMB 4LXFA 4X6CA 1ZGLM 4MNGE 2PXYB 1Z9PA 1K9TA 1OAKH 3O11A 4Q6YA 4YMPA 1P5UA 1JPGB 3IJ9A 1OM3H 1YYLH 1JWUB 2E9WA 5I0YA 1IC1A 2XX0A 1UJTA 4QRPB 5DMGC 2NY4D 5EF1A 2NY1B 1PD0A 4QF1A 4HWEH 1B2WH 1Q72H 2WXRA 3BPCB 3Q2CA 4QUOA 5DO8A 1HHGA 2E7HA 3TA3A 5F7KC 3D69B 2BWDA 1P0SE 5D6CB 3R0MA 3VFNB 4ZW7A 3NTCL 3RTLA 5I1DB 5CUSH 2Z92B 3QZMA 1I9EA 1QD0A 3C12A 2D31B 5JOPE 3VQ1C 1I1AD 2IPKB 1RIVL 2ZX6A 5C09E 5E5MB 3D5OF 1H6TA 1EBAA 1K8IA 3QARA 4JFED 1AQMA 2UUDH 3GTTA 4FLQA 4NT6B 4JY4A 4CVZB 1OT4A 5HPMA 1CK0L 1CURA 4B96A 1F3DH 2FX9H 5B3SB 1IIKA 3G6JB 5E6IC 4BUHA 1Q1JL 4FABL 5CKGA 2C5DC 3IMSA 1MRFL 4P2OD 2YKKA 3MROA 3AAZB 3U4AA 5A7EA 5IB5B 1GGBL 3GSRB 4NKMB 4R5TA 3VGDA 5FYJD 1BECA 1GYWA 3V0WL 2NNAA 2JMRA 4AVJA 3UZQA 5I76A 4MA8H 3T6QC 3B5GA 1LDPH 2LU7A 2X2JA 4JQIH 2BOCA 3ZE2F 5JIPA 3CXDL 5LCVA 2HJFB 4HWUA 4NM4L 3C9NA 1MI5A 3RPIB 4YDKH 4LOVA 3KYMA 5FYKL 1I8IA 1U92B 2KZWA 4LPVA 3V52L 4I3GA 5HI4D 3EG9A 3VFUA 3U9WA 1SN5A 4K8RL 5I8CA 3GSXA 3C87A 3OJVC 3ULSA 1J9TA 4N90E 4JRXD 3FFCD 3WN6A 3HS8A 5HHXH 2JTYA 2MQ0A 4PJ7F 3S3JA 1T7YA 2D9CA 2ZXQA 3VFMB 2Z4QA 1YMMB 1KBGL 1IKFH 5A2CA 2E8ZA 3SO3C 3GLEA 2P8PB 1DSFL 2IH1B 3VGAC 3QYMA 3G5YB 3H9HB 4QTIH 3S37L 3VXSE 1G0DA 1URLA 4WWKD 3L3DB 3IF1B 1I8AA 3MLZH 5I71B 1AZBA 4R2GC 2F7RA 2E75C 4LSUL 3NEOA 3Q9QA 5K1NA 1TMQA 2X1WL 3MA7A 2ZF8A 3EO9L 3F7VA 1W0VA 1W2KT 3MUJA 5IK3A 4MJ6B 1LEGA 4UMGA 2HP4A 3MLTB 5GGUA 4XB8A 1YNKH 1E30A 3QAZC 4YL9A 1FLRL 1X7TA 4HJ0C 1G43A 1DQJA 4UV7H 4AG4H 3WFBL 1P5UC 4TUKH 3O6KL 1UA7A 4A7GF 3UYRH 3ARQA 1JWSB 3ARZA 4FLHA 2HG0A 5I8OL 1TSHA 5C6PB 1AXTL 4LSDA 2J43A 1F45A 3PL6B 3AY4C 4XHJC 5AVWB 4YUEH 5EU4A 2AZAA 3REVB 3WFEH 3QUXA 2PYFB 3TA3C 3CHXA 3CVHA 4FQ1L 1YYCA 3L4UA 4ANUA 2CG9X 2IANB 3F12A 3EKCA 2QZQA 4FQ2H 4AUUA 2O6PA 1PKOA 4RAVA 4A2FA 3MV8E 3Q1SL 3RWDA 4TSCH 1G7PB 1Q0YH 2BC4B 3KYAA 1TVHB 5EB9A 1Q9LA 3CAFA 3BXNA 4P2RD 4RESB 3ELQA 3TH4T 3BAIA 1U0QA 4B9CA 4OSUH 1FNLA 2EO9A 2IC2A 3FHAA 4ABUA 4NSKB 5L8KB 5AW5B 4L3EE 1GMIA 1HCFX 5JHAA 4ZPTB 3FT9A 4HIEB 4HU8A 5A16A 2BDNH 5C8JA 3FOMA 3PFQA 5DVNA 4NDMB 2X41A 1WA0X 3H55A 4H8HA 5DD5H 5DGRA 2WKOF 3MJ6A 4CADA 1N3NA 3ULVF 2CRIA 5BRZE 5F6IB 2BIOA 35C8L 2F0CA 4MXWH 3AS0A 4LQ1A 4NUMA 4FLSA 4XNQA 5DRXA 1QUPA 4G71B 3Q05A 4PAZA 1O7DC 3ZLQC 3HS0A 2XACC 3PRZA 4PS8A 1VCBC 4WFFD 2EADA 5L8JB 4QR7A 3CDCA 1TLKA 3W9DA 1THAA 4UILL 5IB3A 1EZUA 2N0KA 1DDHB 4UF7C 1BBDL 5KS9B 1IC0A 2AK4B 3S8WA 4WWNA 5TJWK 4N2EA 3WNIA 1TFPA 3BWSA 1L9QA 1XO8A 3OJDB 4LLQB 3FUDA 3OF6D 4HIHB 3LS4L 4GRWF 4MMXA 1JHLL 2B9AA 1JPTH 2IOOA 2BSTA 1SOQA 1V7ML 3LB6D 2CKBL 3OAZH 2YAPA 3P11L 3D85D 5FO7A 3NSYA 1TZHB 1QWUA 4E9TA 3SDDB 3WJLA 3WTSA 2RQ8A 4YZFF 3UAAA 3IFNL 3LEYL 5IW1B 3V4PH 1A3RH 2VSDA 5JR1H 3FTXA 2XYBA 1MWAH 2ID5A 4KK8C 3EGDB 3IN2A 5IJDC 1F2XK 1QX1A 4YDVA 2PPFA 4G8IA 4PW4A 4TUJA 5CEZL 1OP4A 2OR7A 4OZGE 3RUGB 4DNLA 1ILUA 2F6AA 1T6VN 3TCXA 4GBXD 1VPOL 1P4LB 1UQSB 3TV3L 4KO6A 3FQYA 1JOIA 5F7DA 3MRDA 1T2QH 2CZNA 3T6VA 1PAMA 3O2VL 5DZ9A 3HB3B 2E59A 1X7QA 3HRZB 4YHMH 5HDRA 4HOMA 1BOGA 4PTUA 5IM7B 1M7DA 2HH0L 2B5IC 1G7HB 2V9RA 4YHNA 4YPGA 4UDTA 4JFVA 3PHOB 1KXQE 4O4YH 4R4NC 3SJVE 5D7SL 4NM8H 3QUXC 1ETZB 3L1OL 1XH3A 3U0WL 3GLZA 4YC2C 3RGVD 3SODB 4JR9H 1N0XL 5KZCB 1A7OL 1TMCB 1VDGA 1WFMA 2H1PH 2YRZA 1Z5LB 3AITA 4Y1AA 2NT1A 4BFRA 1KCUH 2GEQA 2ZWKA 5EZPA 3BVWA 2W9DL 1NC2B 2HTKD 1CICD 3GBDA 4JFDE 3GJFK 2ZWLT 5SX4H 4AV5A 2VQ4A 3B9EA 3MNMA 3QA3B 1G87A 3NG5A 4NQTA 1ETJA 4N1HB 3NZ8B 2EDNA 4QJ5B 4ZXBD 5ID1A 4QO1B 3BLKA 2WZPA 1PDKB 2EDDA 3EYVA 1KCSL 5C07D 4EZKA 1H8LA 2BLFA 3QFJD 2Z35A 5AW9B 2R2HB 2PO6C 2VDKH 2CRYA 1R3HA 5DZNA 5E4AA 3AROA 5HI3C 4IIQC 3V0VB 4YE4H 1JAEA 1CF1A 5F0MB 3P4OA 5DS1A 2F53D 3GDBA 3ARGA 5DD6B 1U8LB 4NZJA 3GJEB 4O2FA 2FUQA 4CSZA 3H8NA 1CO1A 3HEIB 1R3KB 4NQDA 3LSOA 1ND0B 2Z1KA 1LWHA 3DXAD 3NA9L 4JFZL 4MMXC 3MYZA 3VE0A 3E3QE 3VNZA 2W92A 4HJJL 5EEWA 2AFNA 2FWLB 3RX7A 4Q9QL 3IDYB 3WJLC 5HYJA 4HU2A 1K6QL 3L5XL 2F5BL 3UTSE 3GK8H 3ULUC 3IPFA 4FZ8H 4Y19A 4DGVH 5ISZD 3DK0A 2D0FA 5EPMB 1NWOA 4K3DH 2Q86A 1Q0XH 5BO1L 5I75B 4U3SA 3BZ4A 5BOPA 1KFAL 5I66B 3U2SB 4PJAB 2JKRM 2YBRB 1UWEL 3AS1A 4TQEL 1U4EA 3TJEL 2E5EA 3DO7B 1OD9A 4IEFB 2K3TA 2OZ4L 2WOBA 3U7WL 3S5LG 2R69A 4AH2B 3V5KA 5DJDA 2VDQL 2OYKA 3IDIA 1SJHA 1T04B 4K94H 5ERWB 1UOKA 2DY2A 1JN6A 2FQDA 2VERA 3M46A 4DGWC 4XMLH 5B8CB 3VD0A 4X4KA 1E9PA 2BXZA 3NYKA 3SDAB 3MMEA 3ZMEA 4CN6A 3PHQA 4PJDB 4JG5A 2B4CL 5IHWA 3V10A 4GUPA 2W0FA 4KO7A 1SFHA 3ARFD 3LZRA 3G04B 2BSRB 4NPKA 3QDGB 3KPRE 1MIEH 5K93A 5LBSA 5BVJB 3HC4H 3D30A 3CIAA 4EBQL 1SY6A 4Z95H 4MNQE 2Z93A 1ITBB 2VLKE 5EEXA 1XVSA 4JPQA 4PVMA 5JDSA 1KJVA 4ZJ9A 1CTOA 3EJUA 3V5DA 4E41D 2AXFA 3T2OA 1NCUA 4FERA 2GC7C 2FUTA 2CSPA 2D03H 3T0DA 4JN1H 1S7SA 2V5MA 3K6SB 4OKDA 3RPBA 4MDIA 4OD2A 1F4YL 1RUPH 5FUZH 3MV9D 2E8YA 5GS1C 2WBJD 1A6TA 1D9KD 2CLVA 2IAMD 1ES0A 3MFFA 4NGHL 3OAWA 4N8VG 5HHOA 3V9CA 3DJ9A 1HWWA 3W2DL 3FB5A 4PS4L 3LKQA 3D6GA 3MCLH 4XVTL 3ZJAA 3TESA 2Y06H 1QSEE 43C9A 3PWPD 1FYTE 4HEME 3MLWH 4W9GC 5E08H 5DRNB 1OLLA 3EGXB 1XH0A 3TVMC 3FTWA 2EDMA 1MFMA 3V4VH 4P3DA 2F8IA 2V33A 1IGFL 1UD5A 5CINH 4F7PB 1T7XA 2JJVA 1R47A 2XFXA 1RPKA 2H47C 4TTDC 1HEZA 3TN0A 3VI3F 5A40E 5EOCJ 1CDGA 4LOEA 2VDPL 4KHXL 5KYNA 3WTUA 3H42L 2W38A 5D4HA 1GCYA 1J11A 1KYUA 1S7XB 2W65B 1FBIH 1UT1A 2UWEA 4D94A 3VWKA 4WI7A 4RRPA 5IBUB 1P9MA 3CLFH 2DBLH 2YD8A 4RX4A 3M1BB 2EDYA 3D3VE 1QFHA 4U33A 1MSPA 3VG9C 4DKFH 1HWHB 1ZK5A 4HPOL 1XDTT 2H2SC 4PJFE 4HS3A 4LP5A 2BJML 3Q8EA 4P2CG 5D4IA 1KTJA 4QXVA 4I5BB 2C3XA 3D18B 4J4PA 3INUH 4KROD 1HSBA 4X0KB 1MHPL 2VLRB 4OGQC 4X7SL 1A7NH 4TYUA 2G3ZA 4YHIA 5ESAA 3JTTB 3ZO9A 4DPBX 1KBPA 2B59B 1HE8A 4L2LA 1RK0A 4F37F 2CK0L 1CVRA 4YDJA 4ZS7L 1Q9WA 4A6YB 3QPXL 5EBGA 3SBWA 3EAKA 1JPEA 1QFOA 3SBQA 3J8F7 4PJEE 2FYYB 5KSBF 2F5AL 3BRGC 3V9EA 1I9JH 4RWYH 4EUPH 4EUPG 3O6FA 2UYLA 3MGAA 3DSFH 5HHVL 5EUOF 2XICA 1MFEL 2XA8L 4LMQE 2R29L 2CJSA 2DLTA 4NCC1 1JI2A 4AGOA 4I13B 4YQXH 4I1RA 3QUKB 3VJ6B 3LKRA 3LQZB 1F8TH 5KSAD 4HJEA 1MW0A 2CR0A 1IGTB 5B3JF 1KIPA 2BP0A 1GAFH 1I7RB 3CFUA 3KPPB 3KJ4B 3QHFL 5IZ7A 1AMXA 1NPUA 4ODUA 2LOEA 4PRAA 3GI8L 2QMKA 5I5MA 4NC0B 4F9LA 4PBDA 5DWUL 3UG4A 2XKSA 4KPHL 3OQRA 4HHWA 3VXSD 3E6FA 4CDGC 3FMGH 4MVBD 5JPMA 4W6XB 3F6IA 1S8DA 1Z9LA 3N5AA 2YPVL 2IH9A 4HT1L 1YNTB 1I1YB 1ZLUH 4QOKE 4LVOC 5DJ2A 4YEFA 1Y7VA 2VQ1B 3QRLA 4WWPA 5BQ7A 4Y7OC 4NO2A 5ID0A 2OMTB 3IBEA 5ITFA 1XF4A 4WCYL 1I9RH 4JN2A 3OPUA 5I0XA 4RDQG 1INEL 5EUKB 4GEIA 2YPLB 3H54A 3ME0B 3UROR 4Z77A 1B6DA 4PGCB 2JKTM 3TN0C 4BEIA 1BD2B 2YLHA 3ECQA 5I6NA 1CWVA 1FLTX 1VGEH 3NQKA 3GS4A 2YD9A 2NY2C 2J71A 4GO9A 1ADWA 1N67A 2HFEB 5EZLB 1BG9A 2NR6A 4R2GD 4HWBL 1M05A 5TDNB 3B9KB 4P49A 4J6IA 1AQ8A 5E8PB 2BZ7A 4XPHH 3UBFA 1P9MC 1SOXA 1NCTA 1G9EA 1BMGA 2A6IA 1JI1A 1OCWL 3HAEA 3UMNA 3I75A 4EOWH 1TEFA 4OTXL 2FL5A 4P59H 5EEYA 3MYJB 1YECH 2Q6WA 1RZIB 2IH8A 4XX1G 1HU8A 2C9AA 2RIKA 5F7EL 4ZMLA 1Z3GL 5JXED 4J4PC 2AXWA 3QRGL 4H1LA 1EZSA 2H26B 4FQQB 2QKSA 2VAAB 3FTSA 1IEBB 2B2XL 2IGFH 3GSOB 2DTSA 3QUML 5C2BH 3W5MA 4BFIB 1DUYB 1RXLA 1HXMB 2V7HB 4GRLB 3VH8G 3RKDC 4M4PA 3VD5A 2EE6A 5BS0A 2K78A 3BUIA 4LNVA 3TO4B 3RWHA 3SBWC 4FXTA 2NQ3A 2WWKO 3UBXI 5HVFB 2FSEA 3PAUA 3BT0A 4WUUD 3TFKD 3SGEI 1JK9A 3O6FC 1JGLL 3CZLA 5D7JD 1YDPB 2JI3A 1T7ZA 3HHSB 3K4AA 5F6HI 1AZRA 3FO2A 4XNYL 1Q90A 4X4YA 3K46A 3VX0A 3L5WB 3HE6A 4JFFE 3V0FA 4XP4L 4WI3A 3C8KB 3IVKA 3KL3A 5ANMA 1AS6A 3NJXA 1H5BB 4L5FE 3B2MA 4OCMC 3BN3B 3MJ9A 2Y7LA 1AH1A 1BPVA 1AO7A 3ROLA 4HXAL 4AJYV 2R0ZH 1MELA 1X3DA 4X6DE 3WFDH 4NBYB 3SBRA 3CDZB 2OJZL 2QLYA 3DGDA 3V6FA 3VXME 4F9LC 3UFIA 1UD8A 2WWOA 2VZUA 4E9QA 2AV1A 2X3BA 2HB0A 5FDWB 1XGPB 1UATA 1R19A 5JUEL 2J6EH 1YEJL 3K5RA 2GTZA 1Q9OA 2IADA 3AXHA 3MRPB 4L5FH 5EZOH 3KVPA 4UT6A 1JPSH 3QHZH 2GABA 3IU4L 2ETWA 5IP4A 4B9PA 3ARDB 2GCYB 4U1NA 2KBGA 3QWQB 1T5WA 4RFNB 3FUMA 5C0AE 5L9DH 3US1A 3UPRA 1TJMA 2Y6SD 1EJFA 1KN2H 3BP7B 3DGCR 3KVQA 4KX9A 4YHYC 3V0JA 4IRSA 3LNGA 3VSTA 5GRJL 1RZJH 1WEJL 1RQ5A 1N4XL 2VDOH 3K6NA 4BDVA 3TYGH 4XC1L 4DGIL 2WINB 5FYLL 1MAML 2WXGA 5JNYA 4D9RE 3IFPA 4GQ9H 4IW4C 2LTQC 2Q87A 2ZPKL 4LSVL 4UIMB 4GI9A 4GQRA 4JM2B 1LILA 4MAZA 4G82A 1WGVA 4GIAA 5AYUL 4MDJA 1CFTB 3QUYA 4Y5YA 4OUUB 1NFDE 4P2QA 4UOJA 4H0LC 3BVNA 3CPUA 3QJOA 3BE1H 4YZWA 2NR6C 4XVSL 5LG1A 4GW4A 1OSEA 1Z0NA 4IJ3B 1E4WH 2IBZY 1NCDL 1WFUA 3TLRA 1H15B 4WSKA 3C6LD 5EHFA 4QHNB 1O7VA 4AQ1B 5IY5B 5D2NB 2YN5A 3JXAA 3MHZA 1W72B 1NCBH 2OL3A 3GM0A 2ZG2A 3IRCA 2RACA 5IFJB 2E9IA 4U6XB 4WFHD 2E7LA 1MUJB 1MCKA 5D96C 4B41A 5DUBB 4DETA 1SXZA 2BNRB 4O2CB 4PRIE 4KKAC 4P46A 1UH2A 3LZLA 1QBMH 3BUTA 5KVFL 2QADB 1R5VA 1IQWL 2ZOLA 4JZJB 4QHMB 4P5MB 3I6KB 4ACPA 1UASA 1QNIA 4GFXA 1NOFA 4J1UA 3IBOA 2PW2B 3CSYB 2BVPB 4YDNA 3W9EA 2I07B 3QEUA 4FCAA 3B3IB 1NBYA 3EH4B 2VL5A 5GJSL 1ICTA 4H5SB 3HE6C 5EIQA 4N26A 1NEZA 4GUQA 5AG9A 2XWZA 4N2HA 3CFCL 4DO6A 5F0LB 3DGGA 4WI2A 1MCEA 5D71L 2ZOWA 4OF6A 5AL8A 4ZRGA 3NTCH 3HAEG 4HWZB 3O41A 4O02B 5D5MB 1OGSA 3MLYL 3GSWB 4FDWA 5J11C 1G6RA 1CXHA 2GBTA 3Q9PA 4QGYA 4DP0X 4Z7UA 4X5QA 5D2LF 3ZDZF 3MAWA 5D7EA 5MEPB 4F2EA 2HLFC 1RIVH 5JOFA 3Q7JA 1AHMA 3R19A 4JKPL 3UP6A 2OI9B 2Z91B 3LDBB 5FGRA 2AXJA 3ZSSA 3SPHA 1CK0H 4XN2A 3ZW3A 3NCXA 5EF2A 2A9CA 4FABH 1Q1JH 1PX3A 3IXTB 1XMEB 1CLOL 1S9WA 3W1ZA 1MRFH 3ZMRA 2H8PA 2AJXL 3WGUB 5FYKE 1KNOA 2OA9A 2YJQA 3BWUC 4NO5A 4R9HA 1N8ZA 1GGBH 2JH2A 1GW0A 2J56A 3EYOB 3HG4A 3N55A 5D8JL 3P77B 5B1BB 4YGVA 3IDMA 3V0WH 1TDQA 1AKJB 1NJ9B 3F7QA 2PXYA 5J89A 1T5XB 3CXDH 4MJIB 1JPGA 4HW6A 1JWUA 1PZCA 1SUHA 1U3HD 2XTJC 4NM4H 4WHYH 4WHYG 4QRPA 1RZQA 2CGRL 1ESOA 3V52H 3RTQB 3TA4D 3QUYC 2FEJA 4K8RH 2DQJL 4X2UA 4J3OG 3BIKB 3BPCA 4WFGD 4ELME 1F4HA 32C2B 2XU9A 4JB9H 5TE4L 3D69A 4FMKA 3S4SB 4FNRA 3CZFB 3G9AB 3QJHB 5D6CA 3VFNA 4S0TD 5I1DA 2WJ5A 1JZ8A 2GFBB 2Z92A 2VR3A 4ZMNA 1DSFH 2CKNA 5E2VL 3IPEA 3GBML 2D31A 2IPKA 1ZV5A 5E5MA 2C3WA 4RGOL 4XMXA 4ZZFA 1XEDA 4CVZA 4NT6A 2E7LC 1NUGA 1AGBB 1R1CA 4PMEA 3BESR 1QFWL 3QE5A 4LSUH 3G6JA 3CVHL 3MUGB 2P7TB 3EO9H 2BPBA 2WYZA 3MI6A 3PXLA 4LCYB 2PTTB 2ZT9C 1WIOA 3GYRA 1PY0A 2EVFA 3CMOL 3AAZA 3B9DA 1DVTA 1FLRH 5IB5A 1E8YA 3GSRA 4NKMA 3WFBH 2BY1A 1HK6A 3O6KH 1S78D 4ANVA 3VX1A 4A7QA 3EJRA 5I19L 5CZXD 5I8OH 1AXTH 3ISWA 1QSED 1S5IL 5PAZA 2HJFA 2JQAA 4NN5C 4Z18A 2LFGA 3ZHKA 3FO9B 2X0UA 3A47A 4XMZA 3RPIA 4AEIL 3D09A 1U92A 1XH2A 2Z7WA 4FQ1H 1CFVL 5G5DB 1KGCE 3WUZA 1UEMA 2A4EA 3BSZL 2P1YA 5DHMC 3AZUA 1S5HB 3Q1SH 2WZPD 1JHKL 3ARXA 2VITB 2V9TA 3GLAA 5J13C 3B43A 1QLEB 3UX9B 1IKOP 3V0DA 3VFMA 1YMMA 1O0VA 1VZIA 5I26A 2E4TA 1A7RL 4KI1A 1R24A 4JBSA 2P8PA 2IH1A 2NCEA 5ECJE 1VCAA 3EHBC 3SOBL 3G5YA 3H9HA 4ATWA 4Y9BA 1YG9A 3D3VD 3L3DA 1EBPA 3IF1A 1PJWA 4KRNA 3TJHD 1TPXC 3ARGD 4FOMA 5IREA 4LHUB 3UERA 3HNTH 1AS8A 4NQDD 5DO2C 3WD5L 3B83A 35C8H 3DX0A 4CN1A 2AEPL 3G08B 4MJ6A 3MUUA 4KJQC 3MLTA 3O3AB 5B1KA 5K69A 4U0RB 4DSYA 2V2TA 4W70A 1TJXA 4Y16B 2ADIB 2PXYC 3ULUL 4AENB 3W37A 4JVUA 1M4KA 1I8KB 4UILH 4FKEA 1SEQL 4MCZB 4KRLB 1BBDH 1JWSA 5IJCC 2ZCLL 4HGWB 4RBPH 1PU0A 1Q0EA 3PL6A 5D7IF 4U1LB 3W39B 3REVA 3LS4H 4UQ2B 1JHLH 2QZ5A 2PYFA 2PUQT 2FH6A 5I5IA 3FSWA 2WGXA 4OZIE 1V7MH 5I5JA 5CEZE 3AG1B 3S3SA 3P11H 3WTXA 1AHWB 3TBVB 1G7PA 2ZOUA 4E2OA 2BC4A 1JD9A 1TVHA 4DP8X 5SWZE 3IFNH 4S10A 3LEYH 5BCAA 1VACB 3LIZH 3F64A 3LVEA 1QSFB 4R5VA 4O58H 2WXOA 4NSKA 3KEHA 4RGNB 5AB2A 5CEZH 1NM4A 1QFWM 2ZIDA 3JV4B 4DQOL 4ZPTA 1CD1B 3Q5TA 4HIEA 3ECVA 4PD4K 4NDMA 1VPOH 1VRSA 3ASWA 5L6YL 4PG9B 4LGPB 2CHWA 2R4SL 1JG9A 1ERNA 2HVKB 3L95B 1M6OB 4GPVA 4WI0B 1QLRB 4XNUL 5J3HC 3O2VH 3TASA 3J2PA 1N6UA 2VN5A 4LVEA 4XMTA 2J6WA 3WN5B 1PY4A 5G4OA 1BZ9B 2HH0H 4H8VA 2WVUA 2R4RL 3H85A 4JFXB 2YAMA 3M1CA 4M43H 4ONOA 1Q9KB 1DDHA 3CIQA 3QH3B 2AK4A 5D7SH 1NIBA 3L1OH 4POYA 1WTLA 2X2UA 4MZIA 3U0WH 3OJDA 1ZPLA 3MDJA 4LLQA 4TVSa 4HIHA 1N0XH 4RFEB 3FS9A 5IVNA 2J55A 4XXCA 1A7OH 1RURL 1TZHA 2GJ6B 3SDDA 4GQPH 1COBA 2W9DH 2XPYA 1ZEAL 3ILQC 1D2PA 2F1EA 1CE6B 5IW1A 1M9SA 5F9DC 4ZAKD 1WV7T 3EGDA 5EIVA 2TRYA 5I71C 1QLFB 4ZNEE 2NUTB 4AM0B 5B38B 2BH0A 4PFEA 2J1XA 3K1DA 2DJUA 5CZKA 1A1OB 5CJ5A 3RUGA 1KCSH 3VNYA 1CPUA 3EOBB 2GITB 1P4LA 1UQSA 2P5EE 4HK3N 5IOKA 1W16A 3QORD 4LSTL 1D2OA 3PU7A 4IK6A 3LRLA 4Y5VC 3HRZA 2NY2D 5DS2A 3H9SD 5IM7A 1OAQL 1TZOA 1G7HA 3VWKD 3ZZSA 5I24A 3PL6C 2O61B 3ZUCA 2ENQA 3PHOA 3U9UB 2G60L 3NA9H 4JFZH 5DUMH 1P4IL 3AG2B 1E8WA 1ETZA 3HUJE 1ZIAA 4B0MM 4HJJH 5T1LB 2BVYA 4ZSOE 3JSSA 4JDZB 2APFA 3FOLB 3AT9A 2GHZA 3LQAL 4Q9QH 4JVWA 1T7VA 3TIDB 4BFFA 4C4UA 4TV3A 4ICWA 1CMOA 2CA3A 3WS6A 1K6QH 3L5XH 2F5BH 2P5WB 5D70L 1Z5LA 1BVZA 2NT0A 3KGUA 5LGJB 2RALA 2OX5A 3GPEA 2IFFL 4ODTL 1OE2A 5BXFB 1ZXQA 4PGEB 1I82A 4N0UE 2XWDA 3ESUF 3QA3A 3L3IB 5BO1H 1WAAA 4HZLB 2ZF9A 2R51A 1KFAH 3I2CL 3NZ8A 3WDJA 1EZVY 2VT0A 1UWEH 4MZ3A 4QO1A 4XNZB 4ZUTB 3UPCA 1PDKA 3TJEH 4PJXE 3FDWA 2OZ4H 3U7WH 1WLHA 5LBSL 5E9NA 1VEPA 4MRBA 4OZHB 4PRHD 2VDQH 3PHAA 2HLEB 4R83A 3MRLB 2R2HA 4HKBB 4R7LA 1IBZA 1G4MA 4JVPA 3ARBB 5C0AD 2E9GA 1UT2A 3RA7L 1EXHA 3IETB 1N70A 4M1GL 1NANH 4X5XB 3V0VA 2R56L 4I0KA 3K71B 3QDMB 1UWXK 2Z3FA 2ZXEB 4M7ZC 5KOMC 3T0EE 2B4CH 4FEIA 5DD6A 1U8LA 5GJTL 3GJEA 1QWHA 4KTEL 1R3KA 3SGKA 1ND0A 5D72L 2DTMH 1ZHNB 4MJ5B 1HHJB 4XXCC 1PBYA 4MXQD 2MQGA 4EXKA 5E1GA 2FX7L 3FRPB 4C56B 4EBQH 5DD0L 1X5XA 4R26L 4QDGA 4XP5L 3HHRB 4UZUA 2AJZB 4L8BB 3FQWB 2GQHA 3DETD 1SVCP 3LRHA 3EJYD 4LDOB 2Z1PA