1N8OE

Crystal structure of a complex between bovine chymotrypsin and ecotin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
138
structure length
136
Chain Sequence
QPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Complex Between Bovine Chymotrypsin and Ecotin at 2.0 A Resolution
rcsb
molecule tags Hydrolase
molecule keywords Chymotrypsin A, A chain
total genus 19
structure length 136
sequence length 138
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1n8oE00
1XXDC 1XX9C 1SLWA 4NIYE 2Y6TE 1EZUA 1XXFC 1ECZA 1AZZC 1IFGA 1SLUA 1SLXA 1SLVA 1ECYA 4IW4C 1EZSA 1FI8C 1P0SE 1ID5I 1N8OE
chains in the Genus database with same CATH superfamily
1D5BB 4ORGB 5IB2A 1IAII 3FZUC 2JLLA 1NDGB 5KJ7E 1RHHB 2IGFL 2X10A 1NM9A 1QBLL 2ZWLT 2YQGA 3LNGA 4G59C 2XY2A 3PWJA 2GSMB 4HKJA 4Z7UB 5HYSG 5IMKB 5DWUH 2X4TA 3KE0A 4U6YA 4PSPA 2WXQA 3ELAT 4TYUA 2CLVB 5IVXA 4G9FE 1NBYA 3U1PA 3L08A 3X1BA 5D7SH 2J71A 3OTTA 4TLUA 2B7DT 3QSKB 4GKOA 5BQ7B 1UT9A 4M8UA 3MV7E 3S5ZA 3BP6A 3IF1A 4XCFL 3WXVH 1HJBC 3JV6B 3HI6H 1QNZL 2ROXA 5LAPA 5FK9B 5F6IB 3PPEA 1QSEB 2OAAA 3C6EA 2RCSH 5INDA 1QYGH 2X89A 4FTDA 4OQ1A 1KTDB 2I27N 4Y2OA 3IGFA 1URLA 5C0GB 3VD4A 4TXVB 1WP6A 5IB5A 3MV01 4Y4FB 1OT1A 3OLIA 2QZ5A 4WZ9A 2Q9OA 1MVFA 2YFNA 4J27A 3IK2A 3FH8A 2FJFA 3MJ7B 3NSDA 2Y4SA 4N85A 4P9MH 2JQAA 4N2OA 2XQYG 3ZHKA 3K2UH 1A47A 3REWB 3IN0A 3QIBA 1E90A 5D2NC 3T0EB 4YHLL 1IJNA 2Y06H 1K2DB 3FTUA 5HHVH 1K8DB 3OMAB 3DA0A 4EBQH 3OMZA 5E8DH 2ADYA 4ZUTB 2EJ1A 4G6AC 4HGMA 3D06A 3P0VH 7FABL 2Z92B 4NUGH 1OGSA 1NDMA 2CU9A 5MEPA 4L0YA 4LLMA 3RX5A 1H6UA 4NFCA 3B9DA 5IQNA 1A7PL 3IGAA 4LP4A 5ANHA 3LN4B 3BUYA 1NLDL 4L4VA 4WWKA 1R0AL 3KPPA 1E4XH 2ZX9A 1PZAA 3G5WA 1J0ZA 3BQUA 2BNUA 2NY0D 5CKGA 2MSPA 3N50A 4TMPA 5E8PA 4XP1L 3DPBB 4OCMC 3FPXA 1KMGA 1DN0A 3NK4A 3QFJE 4QHNB 3D2UB 4YXKH 5JNYA 2J88H 1IKFH 3QPQD 2ZWYA 4BBWA 3IRCA 1U8IA 2CRYA 2BH0A 4FYSA 4IRJA 3MUZ1 5DYOB 3GIVB 1IBDA 3C2AL 1FC2D 5EF0A 3NDZE 3ULVH 4PWHA 3FU7A 3AXHA 1JXDA 4DVBA 1DJZA 3R8BB 2NDGA 3UL4A 1UXWB 3HC4H 2GK2A 3NIGE 1A02N 3Q7JA 1U2HA 1CLYL 1BXUA 4P59H 2UVEA 4FQHB 3AREC 4XZUB 3BHBB 2F53B 5E1GA 1QWHA 4YUEH 1GGCH 2N0KA 5DHEA 3BE1L 1CZ8H 1KELH 1DFBH 1S7TB 2EYTB 4G6AD 1S7VB 1R17A 2IANB 4XZ4A 1I7UA 3HPJB 4Z8FH 1I7RB 3D25A 4HEMA 2PETA 4PJXE 5B1BB 1F56A 3MV8D 2OJEB 2QELA 2Y6TE 3MV9B 3SE9L 4DP6X 4LBEA 4XXWA 1MDAA 4LSTL 1UA6L 3FT4A 1FLRH 1XBRA 4HCRL 3RNQA 4IMKA 1N68A 4XBGA 5ACMA 1MIML 4XNXH 5I1DB 3JVGC 4NQDE 4J8RA 1J0YA 3L3DA 3A24A 3BP4A 4YBLB 2WVVA 3EH5B 3SSGA 4MMYA 1GR7A 2OS7A 4P2RE 4UT9L 5JUEH 1WDAA 1MWAL 4FXLA 4NQXA 2XBDA 3TA3A 5I74C 1B4LA 3QZPA 1JZIA 3SPVA 5JOPD 2ZE0A 4DP2X 1PTZA 2LLGA 1DDHB 3V52L 4P3CL 2CJSA 1NOAA 4WFEE 4F2EA 1R5WB 3CFEB 5J6HA 4JFTA 3TZVD 5CBEB 2NY7L 3E9UA 1RZFH 3EG9B 1NKGA 1XEDA 1KWGA 2J3SA 4QJ3B 3VSTA 1RIHL 4DP0X 4QT5A 1I4FB 3CSYB 3P3YA 3C08H 2CR6A 4WV1C 3VB9A 2XG5B 4JEGB 1JF6A 2X2JA 1VEMA 2IXQB 4KKLC 2DZEA 3V0VA 1NBQA 2WPGA 3GC3A 1MREH 3WO3B 1EERB 2JI1A 2DQHL 1BD2E 2VMFA 3ZE1F 3C8KB 4XN1A 3SCMA 3WD5H 2ETWA 4Q89A 4YE4L 1IBYA 1SEBB 4XBEH 4HIEB 3QIBD 4MJ6B 1K4DB 4EXPX 5EWIL 2FE0A 3EDFA 4JFQB 4KNUA 3BPLC 2BNRB 1NAKH 1JWSB 3EDKA 2G2RA 3ZDWA 1Z6JT 4X5QA 3OC8A 4H4NA 4OIIL 4GQZA 3JYCA 3BVDB 2VLKD 4G8GB 1G87A 4R0LC 5DUML 4ZXBC 1SVZA 5AVSB 2VXQA 1E6JL 2WXGA 2EXWC 1TCRA 4A39A 4EVNB 4KOCA 2Y7OA 3OKOA 2FUTA 4FG6D 5FO8B 2I60H 1G6VK 1U8KA 5JR1H 4H8VA 5GS2H 3CFCL 5T3XE 1I85A 2PKDA 4PS4L 3H56A 5C09B 3TBWB 2A83B 3S5LG 4BXVA 3N1QC 1T21A 1TCMA 2DBJA 4IRZH 5F3HB 1W8NA 2HRPL 2Z4TA 2A4ZA 4ZO9A 2Z7YA 4HHGA 2WXFA 5H37A 5HBBA 2DWDB 2WTPA 4JG1H 5FGBC 2IIJA 5DUBB 4QRSA 1TLMA 1UXMA 2CA4A 2Z64C 4OIFA 4XHQA 3T2OA 4I1PA 3MOBL 1AFVH 3GUFA 2YSSB 4M4PA 4N5EC 2N3JA 2EDTA 4FGMA 5C6PB 4RA3A 5AW5B 1U8LB 4XCNA 1G43A 1FGVH 2CBOA 4NBXB 4Q6IC 3IF1B 1N2RA 5KS9A 3GI9L 4NZTL 3L4WA 1TO5A 3KBPA 4H1LA 4ZMXA 2X6AA 5HY9A 3MODL 4HQQH 3VG0L 4QXVA 3JWOH 1FFPA 3RFZB 5KSAA 4IRSD 3ZKND 1DCLA 2A74B 5CD5D 2IANA 4Z0BH 3VFOA 2DIJA 1HWGB 3IXTA 4Z18A 3U9WA 3WDIA 1RJYA 1RLBA 2AMGA 4FX5A 3ZZQA 3HS0B 1RZGA 2WBXA 4OLVH 3WV0A 2H1PH 1JZ4A 2J8UE 2HG5B 2W9EH 4GG8B 3WXWH 5HYQB 4APQC 4KJWC 3AXLB 2E7HA 5AD0A 2P80D 1KN4H 3ARBC 1DO6A 4LVOC 2P8PA 4M8VA 4XR8C 3AC0A 1ET5A 4I0PC 3VRJA 4DCQB 3MMEA 4RAUB 2ALAA 1S7UB 3VQ2C 2BRRH 3ISWA 1PG7X 4OZGE 3UZVB 5J9PB 4IEFB 4O2FA 3ZRSA 1ZSDA 3T8VA 2JJTC 3IMWA 3PJNA 1BMWA 4ZUWA 4EZLA 3LPPA 3V6BR 5JOPE 1OAJA 4KRPD 1J48A 3GMLA 3OAYH 4GAYB 3VUAA 4YAQB 5F8QC 4OLZL 3NQKA 4AYEC 4FLQA 4Y4KA 4JN2B 3C60D 1UKTA 4KMLB 2GY5A 3SPVB 1EHLL 5ACLA 2QGEA 1PLGH 1EDQA 3MRDB 7PCYA 1ZVYA 3NIFB 4WO4C 3GSRA 1J10A 3OPZL 2X9ZA 2IMNA 3T4AB 3P54A 3VDAA 4ELMF 1DQLH 3HMWH 1M71B 3L7EA 4O51B 3U4BH 4NJ9L 5J13B 1BD2D 5CZVL 4YZWA 2WBJC 3KMDA 4WLCA 3MBXL 2UUDK 3BAJA 4AE0A 1T0NB 2X6BA 3OKLB 1LDPL 4I3GA 5KUMA 5JYMA 3HI6L 1P7BA 4GFXA 1K8IB 2DQFA 4A2EA 3N42B 1FGNL 1IAIM 3MREA 2FJGB 2KH2B 4E9VA 3WTWA 1LD9B 3WL9B 1K8IA 3KS0H 1HHIA 4YBHA 2ZWZA 1TXKA 3AG4B 2QTVA 3BHBA 3C09B 4GS7C 3U79A 1IGFL 3RNKA 1EHKB 2VC2B 1AQDB 2CH8A 2A6KB 3NZSA 5F7WC 1FYTA 2MHAA 1A1MB 3MRGB 4M1GL 1S5IL 2C5DC 3QXTA 4AEIL 1I9IL 3JWNH 4BFKA 2ZOLA 2DMBA 3SDXA 3MV9E 1Q72L 1UD5A 1ZT1B 3ABMB 2AQ3A 4LO9A 4PJEB 4ZS7L 3ZTJH 5KBMA 2ZXAA 4NO5B 4DT2A 4BFGA 3V10A 1IFRA 2X7LB 3MV8B 5GRVK 2E7LC 2F19H 2IEPA 2N7BA 5L2JA 1PY0A 4ZMZA 4WHDA 1MHPL 2KKQA 2YRPA 2P7TB 3DGGA 4D3CL 1T21B 3D4ZA 4YAQA 3E8UL 2BP5M 3F2LA 1U8QA 1BQKA 3CU7A 3ZRCC 3UFIA 2ENJA 1KIUA 4KMQA 2ADJB 3ZDXF 2QSVA 1P5VB 2HTKD 5DJDB 3EYUL 1X7SA 3GS0A 3WO4B 1ZOXA 5T33L 2F1AA 1MN4A 2AI0L 5FYKL 5JA9A 1JGVL 4NGHH 2XPGA 4UF7C 5F93C 2VXTH 4N2GA 5BOZG 3JZYA 4Q9QL 2ZXQA 3RWFB 3GIZH 1OARH 1H9DA 2GHZA 2X0VA 1NEZA 2HA1A 2YBRB 4U6HB 3VD7A 4ZYKB 2BHFA 4HUNB 4MAYC 4O58L 1JGIA 2ZAHA 1XF2A 2IOIA 1FE8H 4ZO7A 3ULVL 1KCRL 4AMKL 1LVEA 5CXPA 1NCHA 2IDUA 3MR9A 1NL0L 4PCSA 1BQRA 3BUDA 4P4KD 4OU3A 4U7KA 4JHAL 2C3VA 5DRZA 3MBWB 1KLFB 1JUFB 4HZLA 1KJ3L 3T8XB 1ZHNA 2DF3A 4YSPA 3U82B 2ZYSA 1D5ZA 1T03L 2A0LC 1FIGH 2FIKA 1UQSB 4W9IC 3LYRA 4K94L 1AQMA 2ID5A 1OE1A 3EZJB 1T5WA 3ZQXA 3IDNA 1IGIL 3GBMH 5IQ7L 3MPCA 4ZTOH 1LDSA 4AK2A 1OHQA 3TT3H 4QRSB 5SWQB 1LO0H 1IAIL 4WENB 4ZX3A 4JRXE 1G0YR 1V7ML 1I9JH 2DLFL 3VGGA 3QZNA 5E23A 4B9PA 1WCBB 1IC4L 1N64H 3QUHA 3MRCB 1NGYB 2NT0A 2W0FA 2QQLH 4RFOH 1W91A 1XBDA 3KPRE 3SQBB 4X6CF 4BZYA 5L4JA 4KDWA 4QHLB 4HXAH 3Q3GA 5FIEA 2ZP8A 4EKXA 4PJ7B 1B0WA 2MKLC 5KUKA 1D9KB 1I7UB 3R18A 4XPFL 1JYWA 3LQMA 3L3JA 3O3DA 4F24A 2ARWA 2VZ1A 4NC0B 4IGBD 4K5MA 4XMKL 2YAQA 1HK6A 1RZFL 2VDRB 3SDCA 1S7XB 1CTNA 4FADA 4JGJA 5TGBA 5GGQL 4QTHB 4AQAA 4XZUA 5C86A 1RZJL 2BSTA 5DSCA 1AC6A 2OP4L 3C08L 4JZOB 5FM5O 1L9QA 2WWKT 4N2LA 2UWEA 4ODBD 4DGUA 4PU2A 3SKOA 3VI4E 2WINA 1Y0LB 4X99B 2X2UA 3H2WA 3DETD 1Q8MA 2AJVL 1BVNP 1PZBA 1DZ0A 2ATPB 3RB5A 4CVXB 2R0LH 3IU3B 3WD5L 1R1CA 2WXNA 1M1SA 1XAKA 1E5ZA 2FX8L 2JQMA 3L54A 5D70L 1NCCH 5A2AA 3HG3A 2JJVA 1CDGA 1SEQH 4KKBD 3ME0B 3PGFL 4Y4HC 4PJHB 3SKOB 2EDFA 4ZXBA 5F7DA 3I74A 4K5LA 2MOVA 4HUUA 4PWIA 2J8OA 5TQ2L 2MRYA 1TKWA 4XVUC 3ZX1A 1NDTA 4WK4B 4Y89A 3VYNA 1NFIA 4EZMA 2XWZA 1MCHA 5EN2B 3RPIA 3KPRB 3K91A 2FQDA 5JLZA 5EF3A 5JR1L 2ITCA 4UINL 1E5BA 4QHMB 4ZTPH 2OZNA 4RBPK 2WXKA 4EXKA 2X3CA 3UZQB 4ABWA 4XWGH 2QKIA 3RE0A 2XZQL 3EGSB 4WI0A 4UV7H 4X2UA 2VLMD 5A6MA 3LB6D 3MJ8B 5BMFH 2Q7AA 1U8CA 3B2VH 4XH2B 3CN4A 3KLAB 3HG1E 1NIEA 2AABL 2CO3A 4HOMA 1CBVH 4PRID 3LKOB 3DYOA 1OQXA 1DJXA 1UD4A 5DJ8B 4D0CB 4I48A 2PYEA 2X70A 4TUOB 3LKRA 4Y5YA 1AS6A 3HE7A 4KK8C 5KWYC 4LRIA 2YLKA 5GSRB 4OW6A 5EBWB 4M7LT 1U42A 2DJMA 2OA9A 3HG1B 5CUSH 1KC5L 2JK5A 2ED6A 1TOXA 3FU9A 3VFWB 5I0WA 1QSFD 4XN2A 5IMMA 4HX1A 4GW1A 3VQ1C 1BSIA 2BFVH 1M42A 4FJ6A 4TTDD 5AB1A 5IEHB 5DGRA 5IMMB 3WFHB 5C6TH 3CX5J 2CALA 5DZ9A 2C3VB 2JJSC 3DGDA 4XVUD 5IFHL 1JWMA 3F3HA 1HN1A 3NCWA 1MW2A 1DANT 1R3JB 4FMFA 3DJZA 2OTWA 3K46A 4NNPH 3UBFA 5T5FH 4FLSA 1IBHA 1KYFA 1FC1A 1AY1H 4Y2LA 1A6AB 3ETTA 3DJRA 1IB5A 2X89D 3FN0L 5EEXA 2QSCL 4R96B 3UX9B 1JGLL 1RU9H 4I3RL 4JFPB 2J1XA 4YSAA 4MA1B 2X4TB 4ZOBA 3EOBB 1QFOA 3EOAA 4D94A 4R5XA 4PHXA 1FORL 4XMUA 4MJ2A 3FO1A 2B14A 4XVJH 1JZ3A 4R4FH 4PGJA 5AB0A 3QEGL 1VERA 5FA4B 4PJGA 3FO9A 5I24A 5KVGL 1SFHA 2XVGA 4JFYA 4XOBA 2HWZL 3ELQA 1EAQA 3QIWA 5AAMC 5FYLL 4XB3A 4QXGH 2O6DA 2F54A 2Q3ZA 1WA1X 3EBIA 3V0VB 3EUUA 5IJKA 2I9LA 5LB1A 3NIDB 2LFGA 1U8OA 2VDQB 1C8PA 2FDBP 3E38A 2PUQT 5I15H 3BT0A 3FN9A 3U4BL 1M6OA 3MNVB 1OAQL 1CDYA 3MZGB 4HV8A 4MAZA 3L9RB 4YDIL 1WBYA 4TSAH 3UPCA 4F27A 5E4EB 5GGVH 2NX5E 5LQBH 4HD5A 1ERNA 2VXQL 4CVXA 3ZW3A 1LK2A 4XXCC 5FDWA 2ZOKA 4NJAL 1A9VA 1HKFA 3JUZA 3HJ0A 2EE2A 5EG6C 3KEHA 3CDZB 4OZFB 1Q0EA 4JHVA 4P07A 3S4SG 1FG2A 5G5DA 4NO0A 2EO9A 5I6XB 4L8DB 5EO1B 2FT6A 1MRFL 2C3XA 4KMTL 3MDJA 3PAVA 4NQCD 2C9SA 1F58H 2CKBH 3WCYA 3FUFA 3KGRA 1S5IH 2DKMA 3VA6A 4KITB 4HKXB 1UZ8B 5EUKB 1OK8A 1Q72H 5FW6A 5DQ9A 3MJ8A 3MA7B 5GGSY 2ICEA 5KS9B 5AOJA 1HQ4B 3NABH 2UYLA 3X3FH 1KTCA 1UCBH 2MMXA 4L3FA 3ZDYB 5A2KH 5DJ2A 1MFEL 3LEYH 5MERA 2PXYD 3W11C 3TN0D 3OHXB 5GSVB 1L7TH 4JL2A 1U3NA 3S3CB 3FFCE 2V5RA 2VN6A 5D2LA 3FH7A 2VL4A 3WHXA 4ELDA 3H3KA 2W9LA 3P30L 4FQIH 3HOGA 4B5ZA 5EF1A 2UZPA 1KZYA 5CMAA 3C8HA 1PX8A 3X12A 3T4YB 4FEIA 3ZDZF 4BFFA 4JVUA 5IKCA 3PWNB 4IDLA 1A7QH 5F7DB 2IMMA 1AHKA 3KXFA 3MJ9H 1UUSA 5DZOA 3MNVA 5E6IB 3PS6A 4XAKE 2Q3XA 5LBSA 4KO5A 4IEFA 1U9KA 4WUUE 4HU8A 1LHZA 4IS6B 2HT4D 3K7UA 1NCGA 2PR9A 4RAUA 3BEWB 4IKIA 1OB1A 1Y0LA 2OXHB 3GKWH 1ZE3C 3VI3F 2ZOUA 4NYLB 3ASWA 3P02A 3ZE1B 1ANUA 1AD0A 2WVSA 5KOMC 3WIHH 3REVA 3RWDA 3VXUA 1BIIA 4I88A 2D7PA 2VM9A 1NMCB 2GG1A 3LKNA 4NP4L 6TAAA 1KGCD 2DTML 3NZ8A 1JNHB 1R3IH 3HNVH 4FXTA 4PY7A 3SO3C 2XPGB 1AGCA 1RUKL 3RGVC 5SWZE 3JBG7 5F3FA 3QFGA 3IJSA 1G7HB 4YJZL 1GPOL 2EEDA 2EVJA 1UA7A 2ZUYA 4UQCA 5DD3H 4HK3J 1QRKA 3V5DA 4WNJA 4DVRL 1CVRA 1MNNA 4KK6C 1QHQA 1FVDA 1Q1JL 4R5TA 4XNUL 3RQ3A 5I17B 4KNQA 3RWCA 1DDTA 1P4LA 4Z3EA 4PLJD 4W1TA 4Y2DA 1MAKA 1DQML 3CDGA 5HHPA 2LLNA 3SBPA 3UOAB 3TV3H 1KENL 3L5WB 2YJLA 5KBDA 4UM8A 1BPVA 4GW1B 2JTDA 4NNXB 4YIQB 5CD3A 5GRZA 3WKYA 1E27B 5DK0B 4NQCA 2JI2A 1E9OB 4CL7A 1N4XL 1J8KA 4KVCH 3UH8A 5T1DL 3HE7B 1N67A 1IQWH 5K9KA 3WFDH 4I0PD 3R06A 1AQDA 4WI5A 4ZODA 3HKFA 1JUFA 2AJSL 4JM2F 4OJFL 4AK1A 5A3ID 2UZXA 1QRNA 2MJWA 2I7OA 4O2CB 3BRFA 1MFBH 3L6FA 3QORD 3G6DH 4TL5A 4FQXB 2Z0UA 1AAJA 4N8PA 2OM5A 1DUYB 4LMQE 4H8PA 2W60A 2X40A 1GH7A 2EIZA 2BVOA 1N3NA 4MKTA 3WEAA 2WLLA 3CBKB 4LCWE 1MY7A 1PKQB 3NCBB 3VXSB 4Y7MA 5CEXB 2JKLA 2X4OA 1ET7A 1SEQL 1FPTL 1OCOB 2H26A 5TF1H 2K7QA 1MCLA 4K9EC 5HPMB 2GSGA 1W6WA 2RH0A 2Z4QB 4MAUL 3GLZA 4XMLH 1SN0A 2R29L 4WWOA 1J9QA 4YHIB 2SEBA 4ODUA 3WU1A 1C16A 2FHBA 1SY6L 2QVFB 1KBVA 5JQ6H 3QIBC 3EYOB 4LVNC 1QBLH 4MB5A 3MJGX 1L9OA 1B0IA 2XWJB 3PAZA 4F15C 1DJGA 2H6OA 3STBA 4I5BA 3PWNA 4UINH 1MCKA 3HRZB 1T0MA 1SZNA 2AAVA 1I1AA 3F64A 1MNUL 3IU3A 5L8LB 4GG6A 2Z7ZA 2XWCA 1FNGB 1MCWM 1ZSDB 4UTAL 2BOCB 4NBZB 2D03L 1EO8H 5GRUH 4PJBA 1PCSA 4JFHE 3ZR5A 5K9QI 1KB5L 4K4KA 1INEL 1NCDH 5F7MC 2GC4C 5EZJA 5I0VA 4Y5YC 3G7TA 1OPOA 4F37F 1WBZA 1CBVL 5EOCL 1F4YL 3MRGA 4PBWD 2X4QB 1CGSL 1ZVSB 2FHFA 4HH8A 3CSFA 4NO0D 4PCYA 3SOBL 2DEXX 2WKOF 3NP4A 3BEVA 3VWJB 1NOLA 2CA3A 2RCSL 2FWLB 5HI5D 3VXRB 2X9YA 3ZHNA 1IVLA 2VABB 2L3BA 3I2CH 4NKOA 3RVVD 3ZT7A 5CUSL 4GAAA 1UWXK 5F44A 4BK8A 3SJVD 4KROD 4LE8A 4MHHG 2B0SH 3WKPA 4PP1D 3L48A 4Y88A 3QRLA 1G7IA 1IM3A 1SN2A 4OI7A 3NIGB 1Z5LB 1DQVA 3L5JA 4JO2H 1C1EL 3CUPB 4BWWA 4O9HL 1CK0H 1MWAB 1NGXA 4PB9H 4HOXA 5IW6B 2LAAA 2WUCL 3GBLA 3GPEA 1NFDF 2VTFA 5IM7A 5K1VA 2BNRD 4Z7QB 2HTKC 3ZKNC 3RX8A 2JI3A 1YJDH 5C08E 1ZA6A 3CFQA 3CDFA 3QUGA 4OLWH 5IW1B 3TBTB 1EDYA 5DJAB 4XO3A 3KNBB 1WITA 1I9RH 3FYEB 3V7AG 1P4IL 1DVZA 1VZGA 2WSPA 3WMQA 2APSA 2XTSA 3N9GH 5DJ8A 2VMCA 4C56E 4D0CA 3OBAA 3VO0A 1NLDH 1UXSB 2BSSB 2FB4H 3DRQB 3QW9A 2PCYA 1JGEA 1BEYH 1FSKC 3ARBD 4JJHA 2G4GA 3HN5A 3WO4C 4F8PA 2E59A 3N1FC 1HI6A 1KLFA 4P5MA 2Y2TA 4YXKL 3S4SA 3WJJA 1SJHA 3EF7A 3D39A 4Q9RH 5DS2A 4PS8A 2FJUB 4X50A 3OMIB 3P77B 1A2YB 1GCYA 5KN5A 2VIRB 1NDGA 2CR0A 3FT2A 1XH3A 5FECA 4IOSA 2P45B 3A5VA 5CN1A 9PCYA 4HUWA 4LB8A 3GXUB 2X87A 2NXYB 1FYTD 4GIOA 3BCFA 3O41A 5DDHB 3NGBC 1ZT7B 4B9GA 2RQEA 4FN0A 2IAMA 1RUAL 1JCKA 2LU7A 2GVYA 3DX8A 3QHZL 3W9EA 5TE4L 2VL5B 4P59L 4R96A 5HYIA 1S46A 3CVHH 4KY2A 4U2ZA 3WGUB 4PRPD 4HUUB 4JO1H 1CR9L 4RAVA 3G3LA 4NJAH 5I1GL 1ZTXH 5F9OL 1AANA 4L8BA 3ZYIA 4KUZL 1W0WB 1A66A 3NRPA 3BSHA 2BPBA 2V6HA 4ZDHA 1QNIA 4ODSH 4IJ3C 2EUVA 1BHGA 1E8XA 4TN9A 5INDB 1VLXA 2NTFA 3ALPA 2AEQL 3IXAA 4P2OB 2Q20A 3IS1X 3VD1A 5DS8A 3KLHD 1J9CT 1LO5A 4HBCH 4L0ZA 3IXAB 2BIPA 3K5RA 2C1OA 4PJ5D 4XO9A 3NDYE 1QBML 2IANE 3OAYK 3FB5B 1YEWA 2PNDA 5EUOE 1PLBA 1KEGL 3JTTB 4I9WE 2FVNA 4UB0H 2Y5EA 5E6ID 3WS3B 3GT6A 3LKOA 3CSGA 4J8QA 1YMME 3TCLB 1E9QB 3PGDA 3QDJA 4KC3B 4WWNA 4HKBA 5IMLB 4LOEA 2BK8A 4JM2C 5JDSB 2FH8A 2XLLA 2G75A 1MFUA 2FSEB 4GXUM 5AOKA 3B7UX 1UB5B 3LKQA 3IJ7A 3QYNA 4G82A 2XY1A 5E9DA 4EUPH 3CZUB 5FR3A 4R2GD 3F00A 4Z3HA 1MF2L 1KTBA 1FZMA 4P5KB 2JB5H 1RK0A 4KKBC 4YS4A 3HG2A 4LHUG 1M2OA 3LIUA 4M5YL 2VZ3A 1G9EA 1C08A 3PUCA 3RKDD 3R7QA 2WXOA 5AALA 3FQUA 4RETB 3HC0B 2YC1B 5JHLH 2VJ8A 1BQHB 4AZ8B 3KW7A 1J8HE 5KBKA 3OGOE 4X5WB 2JCWA 1GJUA 3LQZA 1HKLH 3STZB 5GS0L 2BC4B 2BNRE 2CNYA 1AZBA 3LVEA 3RAJL 1U21A 1MQKL 4NWTL 2VDOH 4KO7A 1F4HA 4MMZA 5CHNB 3WE1A 5JTWA 1H5BB 5KYUB 3K2MC 4JR9L 3WEOA 3G04B 3QA3B 1HWHB 4Y16D 1A4BA 3QQ9C 3LS5H 4XXDA 1CYWA 5LBGA 2W94A 4H26B 2A9ML 1ZRUA 1BZOA 5DUMH 1KJVB 5DZVA 4GB9A 2BC4A 2BSCA 3WE6B 1YVLA 1G9MC 5E6IC 3UACA 3TYGH 1CIDA 1YCSA 2EABA 2N4IA 1AO7A 4PH8A 2H1XA 4HMCA 4P4KC 5J6GB 5IGXH 3BIAX 4X6FA 1TZOA 3PWPE 1YEKH 3LKPB 4B9KC 3ZE2B 2XZZA 1JVKA 1AD9B 1OCCB 4X8JA 3QH3B 4CU7A 3QJOA 3ES6B 1JDAA 1PJ9A 5AOIA 5F7UA 3LZFH 1KCUL 3QO1A 1D6EA 1SDDB 2OCCB 4UNIA 1WZKA 2C4FU 3OR6A 3UAJA 2DDQL 2DEWX 1FYTE 3GGWA 3FT4B 5LXVA 2H2SC 3PL6B 3V55A 3I9AA 5LNDA 2VC2L 3GMRA 2OJEA 3MV9A 3LAFA 4UMSA 4KKAD 3ZL1A 3VXSD 4ZS6C 5IK3B 3FK3A 4JDZB 4FQ2L 1VPOH 2Y5QA 4FNQA 1CGYA 2X4QA 5CLYA 4H0LC 4Q6KA 1I3GH 3T2PA 3WUWA 2CM6A 3VQMA 3FFDA 3S96B 1TJXA 3V6OE 2VDKL 3KNBA 2OXGA 2X38A 4CU6A 2WLIA 3L45A 3N44B 4PJEA 2AJSH 4OJFH 1R3HB 2I85A 4OM0L 4OLXH 2P5EE 4G7VH 2PABA 4HIJB 4NKMA 4KH9A 1G1CA 5E51A 2B1HL 4M7ZB 1JG9A 5IJVB 2F53E 1T83A 2O72A 3K8MA 4TOYL 3TFBA 5M94B 3VDCA 3OHXC 3WEXB 5AVRB 4AXWA 5E1IA 1JV5A 2PO6D 1NFDA 1QFWI 3SDDA 3S8WA 2IDFA 1PDKA 4NEHB 2H32H 5IB4B 4EEEA 1SY6A 1MIEL 3BP7B 2NY5L 4MCMA 1HHIB 3QHFL 2QPDB 4JFEB 3VFRA 2R0WH 2DQGL 3HG0A 4NN7B 1A4JA 4M7JL 4F33B 1F11B 4KZDL 2MOGA 3APFA 4M8QA 4XVSL 3QQNA 3TS8A 4HUXB 3P4LA 4B0MB 1M56B 3P9WB 4IOSD 4AW7A 5ETUB 4PJFF 5MEPB 3WNKA 5CU5A 2W60B 2NDFA 1D7BA 4DW2H 3NJMA 4HIHB 1QSFA 4RGOL 5AW8B 3HUJF 1UTDA 2UZYB 3CVHA 4JFDA 3T2QA 1TVHB 2EIDA 2EIMB 4PEEA 1TJIL 3MLTA 1LMIA 4LNRB 1LEKA 2Q6WA 2DOCA 3MBEA 4Y4KB 3M1BA 4RDQF 3QXDA 4EOWH 1AZVA 1IGJA 4X6CA 1NEUA 4F7MB 5KVEH 5K9KB 1IGMH 3PL6D 3MRLB 4XCYB 3CFBA 4XP6L 5CSGA 4Z76B 1Z0NA 5CEYA 4PJCE 1DL7L 1UH4A 2CDGA 1P7HL 2MQCA 1MCOL 3EUDA 2ENSA 2WXMA 2PCPB 3LB6C 5IB5B 1CDCA 2XN2A 1U58A 3B3BA 4JY4A 5GJTH 3PWVB 4X8CA 3QUMB 1B6UA 1PMYA 5AYTA 3T08A 3ZTJG 5HVHC 5FO9A 1U93B 3SDAD 4PRPA 2B08A 3I6KA 3QC6X 2WJ7A 5FK9A 2B8OT 1FVDB 2CO2A 3BZ4A 3EGDB 3TF7C 1AGBB 5C9JB 3T3MF 1Q9OA 4H8HA 2M1KA 2OTUB 1RZGB 3RZCB 4WJ5A 2BHUA 1CGUA 4MDRA 1QEWB 2I24N 3VXRE 1IBZA 1L9SA 1YLBB 3UPRA 1HSAB 4GSUA 3LRHA 4NUPA 5IG7B 4S1QL 3UYRL 1NUDA 4HISA 3MCKA 2F19L 4UNTA 5I71B 3IDMA 1MZYA 4OLWL 4PTTB 1RQ5A 5J3HC 1BZEA 2P80A 5FUOH 2R8SL 1I9RL 3C60A 4TUKH 4OD3H 1CYGA 1XD0A 3NYKA 1I8IA 4U7SA 3FQ4A 1S9XA 1SBSL 1CGWA 3WOVA 5EZJB 4FNUA 4ZMAT 5IT2L 2ED8A 4XO4A 3IFOA 2HT4C 4BRVA 2OMVA 2YSTA 1H3WM 4W6XB 3ZUNC 5F1OB 4XNQB 2ZUQC 1YZZA 1A6UH 5TQ0H 4FTVA 3F7PC 2PWFA 2W38A 4FL4B 1BIHA 4FYQA 3L3OC 4F8OA 3O2WH 4FFVD 3CHPA 4GW5A 3BKJL 4UOW0 3UC2A 1LO2L 1ZLVK 3ZE2E 1Z1WA 2DBLH 2ICWI 3CC5B 2AXGB 2OCJA 1A7OH 5DFVC 3V0WL 5FAAA 4YHYB 4H88H 1AOHA 3BIKB 1S7SB 5BPPA 2H6UA 1ONQA 1VEPA 4GW4B 1LWJA 5KYXB 2V7NB 4CMHC 1TZHA 1AXTH 1JGUL 4IDJH 3Q8CA 2EP6A 2XRAL 4M62H 3PWLA 3K81A 4AT6B 2CQVA 4JZOA 4O02B 5D1XB 3S48A 2NYYD 1BFVL 4JFZL 5E6RB 4AQZA 3BQUD 4FG0A 4O02A 5EOQL 1M2VB 1QUNA 3ECBA 1BMGA 2Y72A 4C56B 2UX6A 4H2AA 5EORH 3D34A 2OXHA 3MV7A 2YUVA 5T5NF 1DQIA 1Y7VA 2O1AA 1LO0L 4IS6A 2WQSA 4AI7A 2JKNA 2F5BL 4EZKA 3OXRB 1BBJB 2W81C 1UG9A 1KIPA 4HXBH 1AZUA 1MEXH 2PWDA 3SBRA 1CICD 3QIUA 1VGKB 1F45A 1YMHB 2C1PB 4XPTL 3ILPB 3MN8A 5HHMD 4DO6A 2F18A 2NNAA 4RFOL 1G1OA 4U3XA 1IEBA 3OKNA 5EZPA 3WS6A 3VGEA 4NKIH 5EU5A 1PAMA 2IV8A 2OMXA 4NERA 3EDJA 4GOSA 2G9HA 3RPBA 4L9DA 4YSSA 4N20A 1NUNB 1TJGL 4TPRL 2Y6SD 4R26L 3SE8L 1A14L 4WWID 5BQDA 5GXBB 1XF3B 3SZ6A 1ORSB 4I1NB 4WTWA 5I19L 2XG4A 3S35L 2FATH 1UACL 4K9EH 4F58H 1EGJL 2QLYA 1VB9A 2ESVA 1X3DA 3TJEH 1IM9D 5LUMA 4N8UA 5FYJE 3DK0A 5AW4B 1ITBB 5HGAB 5SWSA 4X5XA 1BM3H 2KI6A 4WEMB 2G2RB 3GBNH 3TGXA 2ADIB 4OZIA 4IJTA 4X98B 1WAEA 1OXYA 1OM3H 5JYLA 5FUZH 1NCNA 1UHVA 4NIYE 4P0DA 1KEMH 5TDNB 4MMXC 1DVYA 2QV2A 4FXGB 3SCMB 4N86A 4PJ9D 1KB5B 5KVFE 3OKEA 4R7VA 1QQDB 1UB6A 5DZJA 3M8OH 3WBDA 3OGCB 3BVTA 1LK2B 2AW2A 4MXVE 1W6LA 5EBMA 3L4YA 1YY9C 3QUYD 3U2IA 5C0ND 1NGZB 2WANA 4P23B 3D39B 3RJQB 5CEYB 3SYAA 5GISL 2AERT 1XFPA 1HE8A 5CBAB 3GO1H 2YGQA 3MQIA 4GAJH 5L6YH 5HI5C 4HOWA 5GS0C 4B9IA 1ZT4B 2BNUB 4F7TB 1E4HA 5KS9F 2BVYA 4Y5XC 3DVFA 1TVHA 1CFQA 1F3DH 3VTAA 4XNQA 4OGXH 1T7ZA 3BUYB 1GHFL 3HN8A 3NJIA 4WTXA 4O2EA 3QIWC 5AAMA 4ELMB 4UAOC 5IW1A 1BM7A 1J05B 1PYWB 1TYRA 4W6YB 1KCSH 4FQ2H 5DJ2B 4XNYH 2B5IC 4PCTA 1KC5H 4FLRA 4MA1C 4RMWA 4TV3A 4PRDA 1ZDSA 3AVEA 2N59A 3PABA 4KBPA 2PYFB 5IESH 1ZHBB 2Z6FA 4QYAA 5LWYL 3HB3C 3KWWA 5F7EL 1QNZH 5FKPA 3ECVA 3EBHA 1CL7H 1T5KA 1M6UA 3GXNA 4H0GA 4C8XA 1WRFA 3MUJA 1P6FA 1E3FA 5TFSL 3QZWG 1LO4L 2E4TA 4A68A 1TMCB 4AC2A 4LCUA 4GUQA 4D9RE 4IIQA 5AYUL 4X9YA 1Q9WB 5I30L 3V4PA 2XZCH 4TQEL 4BKLA 4BE5A 4BYHA 3MJWA 2JKIS 4L3CA 4HWZA 4P2AA 4M7KH 1ZHLA 2R69L 1YQVH 1JD9A 3D9AL 1LJMA 3G5XB 1CI5A 4PRHE 4G8AC 4H7VA 3DX4A 5DEGB 3KDMB 2VM4A 1FRGL 1E4XI 2P47B 4OF3A 1XZWA 4U1IA 1I8UA 1PU0A 1DQJB 4IKJA 1NPNA 3O6ML 4UT6A 1I9EA 2R1XA 4DEPB 1FFOB 1DYZA 1XR9A 4M00A 3QZWB 3EFOB 5I1AB 4JRYE 4KI1A 2F54D 1F90H 1G4RA 2WN3A 2DLHA 4XRCA 3UTQA 1BFTA 1D5MA 3UTTA 3QNZB 1FL5B 5L2KA 4F2MA 4JG0H 1Y1UA 3R0NA 1FN4A 1IC7L 1QPPA 4XP1H 5C0DB 1BFOB 1CXIA 4U3SB 1MVYA 3VXQB 3TNMB 2I26N 4NT6A 3LNDA 2VLRA 3AMLA 5BNXD 5KVEL 2R2HA 1JRHL 4KQ3H 4UZGA 2L7EA 2PPFA 2KERA 2VXQH 4K23H 3QDMB 4RX4D 3UG5A 3TPUB 1N70A 1IFGA 2WYHA 4YLBA 1S9YA 5ESAA 3A47A 3DARA 5E0QA 3KYMA 3TTYA 1BXAA 2ZPKH 4JPKH 4OZHA 4I18A 4PUBL 4UQ2B 1CLYH 3G08A 3U4EA 5JW4N 1RLWA 3AQYA 4MJJA 2AK1H 4OJEH 3BP7A 3OZKA 4GI9A 5DRNA 3TCLA 6FABL 4WI8A 3UTSE 1CFTA 3QXUA 1A1NB 1NINA 3QBTB 5C07B 3CMOL 2ZKHL 2HUEA 2ZT9C 3RGVB 1JF5A 1XWVA 3CXFA 3JTSB 1KDJA 4OCXH 5I8CB 1ZJAA 3C60C 4TULL 3O11B 1E27A 2YGPA 3K2IA 5DK0A 4GMTL 4R2GC 1QRNE 4NQVA 2NY4D 1EHXA 1U91A 4YL9A 4DESA 3PFUA 1PVHA 3HI5L 2G9HB 5IVZA 1A5FH 1IGTA 1S3KH 3Q5TA 4PIBA 4LNVA 5H94A 1P7QD 3U2SB 3BUQA 4LSSH 3OSKA 3WNPA 4JE0A 3S88L 4KHTH 3A4FA 3RTQC 1IL1A 4V1DA 1ID2A 3AM8A 5E1AB 3TVMC 5JXEC 1RI8A 3ULUH 4ZFGH 3FQNB 2BCKB 2HLFC 4HJIA 3TIDB 1NGYA 2W0FB 5EEZA 1AKJB 4BKTC 1G7HA 1QSEE 2IOMA 4NN6C 1I7ZA 1TFPA 1IE5A 4OZGA 3CDYA 4FKHA 1BXVA 2BS71 2V37A 5D7LD 2F1BA 4J5VA 3BZFB 2NY7H 2ERJC 3TNNA 4LSPH 2P8LA 3FCUB 4D7PA 3MLSL 2JH2A 3OVUB 4PV9B 2Y36L 3A4DA 3TA3D 1CL7I 4JFQA 4RMBA 1I1YB 4DKDC 4PJ9A 1XCWA 3QUZB 2R2CA 1FZKA 3MNWB 3MNDA 4OTXL 5G4OA 1XH2A 4P2OD 4FP8H 1A3RH 2MPVA 3RP1A 3T71A 4PJBE 2GJJA 1M3JA 4FFWD 4FJYA 4HZLB 1BV8A 3PAYA 5L0QB 2XSKA 4PWGA 4TNWK 2VDPB 3EIFA 2X28A 2BFGA 3HVDA 1XO8A 3QEHA 1PEZA 2UWEF 4X0NA 5C3TA 3SCMD 1GPOH 3U46A 5F1NB 1IZKA 2ZUXA 3T3PE 4R3SB 5J6HB 4NQUA 1T3FA 2I69A 4ZW6A 4TLTA 3TVMD 2MPAH 3JTBA 5CINH 4ANKA 1GYVA 4P06A 4CC0A 1J0KA 1QA9B 3ARFD 4F8TA 4FQJH 1RURH 4U1GC 5MENA 4A2LA 5E08L 1YRKA 1HYRC 4QHLA 4CVWA 5J1TC 3HG5A 2R2BA 3UBXB 4AQ1A 1GS8A 4JM0A 1QFWL 2DQFB 2XNAA 1HCVA 5HDBF 3X1GA 2X44D 4NCDA 1PZCA 4JKMA 1RVFH 4G2AA 4LLDA 3SDXE 4DQOL 4BFBD 1A14H 1X5MA 35C8H 3GK8L 5FX3A 2XN9B 3CGTA 3FU6A 5FUCC 3QEUB 4LGSB 5DEFA 2VW6A 1BJMA 2WW8A 3PQYD 1A7PH 3GMPB 3GDCA 4CGTA 1YNTA 1GY2A 3QEQB 4YEFA 1ZLUH 3LEXB 3RZCA 1DBJH 3JWOL 3FQTA 3CSBA 4M9OA 5JIHA 5F9JA 4F7EA 1ZT1A 3RVTC 8FABA 3BFQG 2A0LD 2EILB 4Z0BL 1OTUD 1D5RA 2QLVB 1KCBA 2B4CC 1AZNA 2VW4A 2WAQA 4GLRI 4K3EL 4TSBL 3HFFA 4POZC 2HT3D 2PP7A 3DV6A 5DJZB 1HXYB 1Z2KA 4MMXA 4F7KA 4NI6A 1FPTH 1UM5L 4JE4B 5TF1L 5ANME 4WFHE 4J6RH 2EIKB 1FL6A 3NJGA 3N43B 1BAWA 1DUZA 2AS5M 3UIZA 1G7IB 1KN4L 1U95B 3BW9B 3V95A 2OMYA 4J3XA 1ZV2A 1YPZB 4K7PY 4OZHF 5D5MF 3F12A 4X4ME 5D1QE 4AIEA 1SHSA 3ZXAC 5CEZE 1Q9KB 1PG7L 3FB7A 2VCOA 4I3SH 4N9GA 1NPUA 5I0DA 1MI5B 4J3VA 4KX8A 4WSGA 2CDEA 4FLHA 1HH9B 2FT7A 3X1EA 5AWNL 3EAKA 4TS6A 2DQEH 5EPMB 1R19A 5D1ZD 1CB4A 3D33A 4B27A 4N8VA 1QLEL 4HF5H 5FWRA 4BFOA 2P42B 1BOGA 5B39B 5CZXD 2K9UA 2X1PA 3ZHLA 1SJEB 1EO8L 5GRUL 4D8OA 1LLAA 1GS6X 1GS7A 3IXTB 5ID1B 2OL3L 2PTTA 5SWSB 4AL8C 2JB6A 4PVNA 5I18L 3P73B 1H6TA 1HH6A 3WLWD 4XP5H 5J0BA 4XN7A 2WB1A 1A64A 4WSKA 1F1DA 2F2HA 1WFNA 5B3SB 2AANA 1KGYE 4LVNB 1JGEB 2BRQA 3C6LC 4J6IA 1SHMA 4UWQB 3EFFA 5CZVH 2NY3B 1OTUC 4HPOL 2CNZA 2D2OA 4GPVA 2IPKB 3FXIC 2YLHA 3VVVA 4BINA 1UWFA 4Z7VF 1KBKA 1LDPH 4GBXC 1WS8A 1WHPA 3X13B 4YPGB 1BYOA 3DO3A 5I23A 4TUUA 4IU3B 1MCEA 5HVGB 4DPCX 2BSRB 2ATKB 1WWAX 3WKQA 2DLIA 5DVLA 2G3ZA 2X5PA 4OCYL 5E9DE 4ICWA 1OV8A 2P48B 3QJVB 2DMCA 1RIHH 5J4MA 2IF7A 4XMVA 3IDXH 1L9TA 3FN3A 2OMBA 2WP3T 3OKOB 2V2TB 3DURB 5E5MB 5CGTA 1LWHA 2XKUA 4Y16B 5IVXB 4M3KB 1QRNB 1FO0B 2K6YA 2FZ3B 3KLKA 3VG9B 4ILDA 4XBEL 2KL6A 2UWEE 3GRWL 1CQKA 1JTOA 4U1JA 1BGXH 2J7LA 2N0MA 3EDDA 3GSNB 3H3PH 3VI4A 1S9KC 4Z3IA 1XF4B 1JVOA 5C0CE 5C3LD 3RIAF 1UM4H 3WLWC 4AW4A 1E65A 3TJHD 4L9LA 2JIXB 3KR3H 2E47A 5F0JB 3MV7D 2AI0H 4M3HA 1M05A 3L3HA 5BZDB 4JG0L 3WEBA 3C75A 3ZYJA 2VRAA 3B37A 4YOKA 5I17A 2PWHA 2VXTL 3D0LB 3FHQA 3VFVA 4ZMLA 1KGXA 4OB5L 1RJLA 4CSZA 3BVNA 3FONA 1BCIA 1JFQL 3NA9H 4QOKE 3NZUA 4LPCA 5D7LA 1J1PL 3WHE1 1MDTA 5K9JL 1P4BL 5D5ME 1KLGB 3FBQA 4Y8DC 1K4CB 4O58H 3SD2A 4AYMC 2NXYC 2ZNXA 3QDGD 5MP6L 2V4LA 4RRPA 4K94C 1JD7A 2J44A 1P7KB 2AXWA 5E6SB 4AKQA 2VGLM 5IOPB 3NCCB 3OG6B 3BP4B 3K6DA 1P7QB 1E5AA 5GS2D 4ACTA 3U30B 4I9XA 4ALAH 1EHNA 2YKLH 2KZBA 3MLZL 1WTLA 2J56A 3N04A 5TH2B 3WGVB 5ICZA 4NUJA 3ZIMA 1XTLA 3FQXB 4PLKC 2KQMA 1MJUH 2M2DA 1DUYA 2H0PA 3OB0K 4HMDA 3CMOH 32C2A 1QLRA 5IV2A 4LMQI 3LMJL 4NQEA 3VH8B 5IQ7H 4NDMA 4G8FB 4HSAC 3VXPA 4QT5B 5AB2A 1SF3A 4JKWA 3P9MB 5KAQG 4LK4A 4MCYA 4XE5B 2O4EA 3TU6A 2XCMC 1ZA3B 1UFGA 4TNVK 3VACA 1A6ZA 4K71B 2F53A 2V7HA 5JXEA 1TO4A 2HTLD 3EH3B 4GKNB 1MLCA 4I87A 2UY6B 5GHWH 4XMXA 4KHTL 2VO8A 5E95B 1A3LL 4FZEL 4RLDA 5J7CC 3DO7A 2ENPA 3ZDYF 3CDGB 2H2PC 2JB5L 2WXRA 3KLSA 5I6MA 3FDWA 1WV7T 2JELL 5LGJB 4Z7WA 3BAWA 1SN5A 2X4SB 4L3EE 5C09A 1N6VA 2B59A 2IDSA 3EFFB 4XMKH 5DFTA 5DZNA 3D85B 2DIEA 3V4UL 5E5LA 4FZ8L 2DICA 4QXUL 3GLAA 1OE2A 4CKVX 4GI6A 3MRQB 3FRUA 4B41A 4ZOAA 2GBVA 1PLGL 2Y24A 1MRDH 4LP8A 4IW4C 1JDCA 1SHWA 3BQUB 2ZF9A 3P0GB 1M53A 4ADJA 4UQ3B 1HSBB 1JHLL 4OF0A 4XODA 1PD0A 4J3OG 4L8SC 2YA0A 3NAAH 1OT4A 4NPJA 4TVSa 4JUSA 4X4XA 2P43B 3QJRB 1GRWA 2OX5B 1AGEB 4HJJH 3JWDH 5GZNC 5I1JH 4U1LA 3CLFL 5FFOA 4M29A 4XRCB 5L2KB 3IKCA 1NEZB 1RXLA 1YEKL 4GH7B 1Q9KA 3OD3A 5KAQF 1VFMA 3HE6D 4DN3L 3SBQA 5E1QA 3NIDF 4GQ9L 1PZ5B 1TYJA 4MDJB 2GEQA 5EC2B 1IFHL 5DHVB 3EHBD 1DJSA 4FFTA 3WTTA 1RZKL 2GEEA 3NJLA 2DY2A 2HPOA 1INQB 3BVNB 4HIXH 1IC5H 4YBQD 1KFGA 2VC2H 5E08H 5TE6L 3GMMB 4UV7L 4FFZA 2X42A 5KBNC 2LR4A 1EO5A 2XTJB 2ZYIA 3FTGA 3FSVA 3X14A 4W70A 4X7SH 1RKRA 2B3IA 1HU8A 5I1DA 3V6ZB 4ZFZB 2DLEA 1OF0A 4LDOB 1S7RA 4RWHA 5KSUA 3FCBA 4X8GA 1RPQA 3FUMA 1NKOA 5IROC 1Z3RA 4N0CC 5F72S 2ZXEB 3C60B 4JDZA 2C9AA 2YPVH 2PXYA 1HNFA 3MNZA 2BWQA 2UXTA 4LRNH 5DUPL 3LD8B 3F6IA 5F0PB 3FFCA 5FYKH 2R0ZH 1IM3B 3BAXA 5GZND 4HFWB 5CGYD 3AROA 4I0PB 1HZHH 5HHOB 4KKPA 3DURA 5KSAC 3P1VA 4MJIE 2C3HA 4XCCH 3RIAK 4BK5A 3GSXA 4N3UA 4UDUA 3U2JA 1BZ8A 2GITB 3L16A 1MH5A 4DKAA 2XQBH 1DVXA 2WO4A 1TU2B 1GGTA 4JCLA 5HI4D 4LEXL 3KXFD 3VDBA 3ISRA 2LT9A 4KK6D 4RISL 4F7PB 1T4WA 1MHHA 1AS8A 1L5GA 3O3EB 3ZY7A 1JGLH 5JW4Q 3MCG1 1OAUH 2F15A 4Z77A 5LBSH 3S37H 2BJML 4NN5B 5JA8B 2QR0B 5C0AB 1B6DA 2PYEB 2GJPA 2X70B 4WFED 5DFWH 4YMPA 1NCWH 1T89C 2VLKB 4FQCH 4G8GD 4BSWB 4ECNA 3MCLH 4MLIA 3H2QA 4LCWB 2O5YH 1EBPA 3NJJA 3QG7L 4JM2B 1YEEL 2XQ0A 1M7DB 3P2DA 4X99A 4LESA 2AEIT 1QLFB 4EOWL 4C4BA 4MJHA 3Q6FB 1NIFA 5DJ0B 4RAHA 2NSXA 2AV7A 3MX0B 4Y9CA 3CZLA 4ZTOL 1VHPA 1AZRA 4YH6A 3VI3E 4CJ0A 4XP6H 5EEWA 1MY5A 5INCB 1FNEA 1MVUB 4S2SB 1H8NA 4AV4A 5DJYB 1I9JL 5JLZB 4E41A 3PHQB 2YD1A 4HPOH 1F6LL 1N64L 5KYWB 2BP0B 1N12A 1KXTA 4BH8A 4EE2A 1AQHA 4UDTA 1I8KA 1OY3B 3RVUC 2DM2A 3DUUB 3GXIA 1YQ2A 5ESVA 5A40E 5I1LB 2P5WA 2ZSVA 1NJ9A 2YMXL 3ESUF 1VSCA 4PJHA 4LKCB 1RPKA 2J2ZA 5GGVY 1OAXH 4EUPA 1OVZA 4MCNA 1RSYA 1USZA 2J8UB 4FNTA 2Q86A 4NQCE 2AK4E 5L88L 3DVGB 1T1WA 1N59B 3E2HC 1B4JL 2XWXA 3NZHL 3JZ7A 5LDUA 3SPJA 5FM4A 2E46A 1OAKL 5C3IA 2UZIL 1N0LB 4EN3C 2C7UA 1IE4A 3B83A 1NPJA 5L9DL 2JK5B 1MUJA 2C7UB 2O6EA 3K6SB 5GJSL 3W0WA 2XWTB 5B22A 4RVBA 4BWTA 4MSWB 3ZTCC 1QOKA 4Z3FA 5GS1B 3D3VB 2WXJA 1WA0X 3HMXH 4BEIA 1KFAH 3QEUA 5KVDL 1ZGLB 3M07A 5FCUH 2Z31B 5TQ0L 2OJZH 4GRLA 1CXFA 3ESMA 5LAXA 5F70A 4Z7UA 4X6BA 1AXIB 1JZ8A 5FO8A 1BBDL 3WJLA 5FYJL 2NUPB 4AENA 4N2KA 1XIWB 1NANI 4QRRE 5EU6D 2VKWA 3W5MA 4F8QA 3AAZA 1AJ7L 1E7UA 2Q8BL 4KKCC 1COBA 1I1FA 4KROC 1T4KA 1UWXH 3K2KA 4H88L 1X9UA 4B3EA 5DQDL 5A16B 4C58B 1JTTA 4DN4L 1OSEA 4N2MA 1XH3B 4KV5E 1KTKE 4Z7NF 1DBAL 1YNTF 4EI6B 5MP6H 1KGJA 4XPBL 4EN2A 1JK8A 5EHFA 3LQAH 2YD5A 5CN3A 4N6QA 1MFDL 4IQHA 1KWKA 1P2CB 1BFVH 2D2CC 1JMZA 4UUJB 1KIUB 2HX9A 4QRPB 4UM9B 1ETZB 4QJ4B 4WO0A 3C9NA 3TO4D 2CO7B 1YHPA 1PKQE 3B43A 3E9TA 4H26A 4N0UA 4LIQE 1WZMA 2NY6C 3E6FA 5H94B 4JJOA 4FQXC 1M05B 1BVLB 2QQKL 3GXPA 4ZK8A 2OSLB 2R23B 1ADQA 4ZOEA 1W72A 1AIZA 1C5BH 2CJUH 4BCXA 1KXQA 1WA2X 3VXME 4ZMOA 3GXMA 1DBBL 2V8LA 1TSHA 5C6TL 2P8MB 2UXVA 5IVXE 4AQAB 4R2GB 2PP8A 1QTSA 1G7QB 1QR4A 2CHDA 3DUHA 2E8YA 3H2PA 3QPXH 3LV3A 4OJAA 4YGVB 4BZ1A 2BLFA 1DJHA 2Y3NA 5B8CA 4YSTA 3WFBL 3RVTD 4QRQA 1S6NA 3DVNA 1WYJA 4N2IA 3P9LB 1UWEH 2V0AA 5C08A 1B0RA 5DFAA 4L29B 4NZFA 5I1EH 2BIIA 7CGTA 5E8EB 3N6YA 4YXLL 5H35A 3GSQB 3EFDH 1T20B 1DHKA 3QI9C 4X6EA 3TBVB 3WAKA 1OCRB 2C9PA 1U8MA 3RWHA 5F3BB 2EDOA 2R83A 4PHZA 1UM6L 3T4AA 2AK4D 3QQ3A 3VSVA 4NO0B 2C4FT 3HAEA 3F85A 4F3FB 4HK0B 3MRPB 3G6DL 4UNVA 5F9WB 2DM4A 1CE1H 1T1YA 1FFTB 2J1ZA 3ARWA 2AEOA 3KLHC 2EDKA 1UASA 1V27A 2VXVH 4NENB 4WNQB 4ONHB 1RZKC 4WTZA 4WI2A 2C9XA 3MXWH 3O9WA 3OJMB 4YDIH 3AT0A 4U2YA 1HCYA 1X5GA 5IFJB 3TVMB 4S1RH 2IWKA 2NNXA 1Q90A 2WQRA 3FSAA 4MB1A 4J3OH 4LASH 5FM5M 3ZE0B 4MA3A 5I76B 5BS0E 2FJGA 3US1A 5BRZA 1SLUA 3GHBH 3MAWA 4ZFOB 2WUBH 2IDTA 3FULA 3LRKA 3GO1L 3VGHA 2W07A 4WNSA 5IMOB 5JQ6L 1EJOH 2YARA 3OJVC 2PMZA 3HR5B 2VSCA 2BP0A 1DBMH 3NIFF 4C83A 2OW7A 2JCCB 3O81A 4J1UB 3ZHDA 5JIPA 5DHYB 1MRFH 5IBTL 5DJYA 5C1MB 1ZGLM 3BDBA 4M8QB 4JRWA 2NY5C 3CFJA 1GHFH 4TSCL 5D93C 2CHWA 3SGDI 3TT1L 1OP9A 3MRBB 1O6TA 1E28B 3OQ3B 1T5XB 1QWNA 1WZLA 5IHZB 4OM1L 5FGSA 1Z3GL 3BD4A 1YC7A 2GYSA 2XFGB 5CJQL 1YA5A 1KPRB 3FRPB 2UZXB 2CO1A 4NOFA 5J1SC 1R9FA 1OSPL 4URTB 3HZKA 4PY8I 4OFVA 4AYFB 4JZNB 2JCCE 1G4MA 5ESQA 1JFHA 3PJSB 4UIMA 2AQRA 15C8H 3P4NB 4X4YB 2HFTA 3TH2T 4PP2A 4B7LA 5JORA 5IB3A 4XPGH 5AW1B 3RB7A 4V1DE 4QHUB 4P57B 3HEIB 3NUKA 3RZCC 5HHPB 4JPVL 1E5UI 1SVBA 1YYMH 1T0PB 3MRIB 5KSVB 2AEWA 4KRMB 4OQTL 2YQ2A 2EE0A 4JO2L 5I30H 1A9BB 4LFHG 4PGDA 4PREA 3AS3A 3NCXA 2GQHA 3TJHC 1KG0A 5DI8B 3L4CA 1IAOB 2HVJA 4M7KL 4NXSA 2BVEA 3AITA 4WDIB 2QVKA 1A6PA 4EVNA 2B1OA 4PJ8A 4EDXB 3BGMB 3SE4A 2WVTA 3HE6B 2YUXA 1CXEA 2A6IB 2CM5A 2WXIA 4GXVL 2J1KA 2XTLA 4JFOA 3WDHA 4YNYB 1AGFB 1JZ6A 3A6CH 3VFPA 3J27A 4AMWA 3KW8A 1J9RA 1P4IH 2V2XA 2X41A 5K9OB 3V4VB 3ULSB 1KB5A 1H3XA 1CWVA 2BNRA 2I25N 3U7YH 4ZNCD 3ZRFC 1E8WA 4OAWA 5CS7A 4G9FB 4NP4H 1T66C 4QRTB 5TD4A 1S7WA 3CZFB 1DEDA 5FO7A 5ACZB 3HUJE 3OMNB 5E8OB 4RGMB 1P84J 5KVGE 5AAWA 1BQLL 2E9WA 3S98A 1HSBA 4YDZA 2W80C 2ZKXA 5IZ7A 3KGTA 1LE5A 4GRLD 4HS3A 1JPGA 3UC0H 3G6AA 3CH1B 4DOHE 4BDVB 3U9UA 2CUHA 4YZFE 2VN7A 1EFXA 2ARJB 2YGNA 43CAB 4LGPB 5JHDA 3QQ4B 2V17L 4MQTB 4NQSB 2QADD 4TQPA 1G9NL 3TO4A 4QYOA 3PWPA 1ZLSL 1IT9H 4N25A 2F53D 4UUJA 1IKOP 4BA0A 2FWOA 4X7FC 5E0FA 1RUAH 3VTMA 2TRYA 3M1OA 5AVVB 1CLCA 5AZUA 2EVIA 3FAWA 5HHOD 1GGBH 1A9EA 4HIIB 2VN5A 5HYJB 3EH2A 1GTFA 2OR7A 4R5VA 3KL0A 2K7PA 4KI5E 4IBVA 3UBXI 2P8LB 5D96C 1WISA 4ZUSA 1WIPA 2UY6A 4QRPD 2YD7A 5D2LF 3AABA 4MTMA 2HLAB 1BQSA 2FECI 5LXGL 3IDGA 4OCXL 4EI5B 3VAEA 4QGYA 4ZMVA 4BZ1H 1DSYA 2BXZA 2R4SL 1FSKB 4OZIB 4HZ1A 1NSNL 2GUYA 5CLZA 3PGDB 3PYCA 1YO4A 1FNSH 1RZJC 4K71C 1AXSA 4OKVA 1A5FL 5IQ9A 2DKUA 4MS6A 1MHEB 4E5XG 4Y0GA 1QSVA 3ILEA 3NFPA 3ARYA 2AAAA 1D6VH 4LSSL 4DKTA 1EWHA 4HLJA 1UZGA 5FC9A 4GRLC 2M26A 4AOFA 5KEZA 3KS0J 2GK0B 1REIA 3FCSB 4HJUA 2C9RA 2HP4A 4TQIA 5MHSE 3E2HB 1I75A 4K3GA 5D6CB 5EZOL 3VJ6B 2H0FA 3CE1A 2NYZA 5EBLA 3SY0A 5FYJH 3GMNB 1KB3A 4KXCA 4X4MA 5D1QA 4N68A 2J8UA 4J8RB 4XWOD 3GIVA 1YECH 1AIFB 1AJ7H 3P4NA 1MLCB 4ZAKA 4E5XA 5EA0L 1KIQA 4PW9A 3R0MA 2XPZA 3OKKA 3DUUA 1RH8A 3L5XH 3P9MA 3V5HB 3FSOA 1V3LA 4K0OA 3HE6C 2A73A 2R9HC 3CFKB 4JY5L 2A9DA 2APWA 4UBDC 5E2JA 4XPBH 4MNGB 5FXCH 4F8LA 5ALBH 1II4E 3NZ8B 5E4AA 2E3VA 4TVPE 4YHMH 4ZW7A 5IBLD 1KUMA 4N24A 5I8KH 5F1IA 5D4JA 2G3XA 3B9KC 5B7MA 1A25A 1CT8B 4HIEA 4B9FA 2F5AL 4ZYKA 4RSVA 4AT6A 4S1SL 4R4BA 2A77L 4L5FH 3Q2NA 2CIIB 4PJCA 2H45A 2B0SL 2YPLB 2MKWA 1JPFA 2RGSA 1INDL 4AIOA 4LKXB 4K2UL 1FVCA 4KFZC 1DN2A 1ZE3H 3GXDA 2ZWSA 1CK0L 3WKNA 5EUOF 5FO2A 2DB8A 3HLAB 5AL8A 2WBKA 4IJ3B 3QPXL 1DLFL 2PPEA 1OGAD 4PLKD 4KDTC 2VH5H 4PJ7E 5CIPH 4CNIB 2OK0H 2VXSL 3DOHA 1IKNA 3IJHA 1YG9A 1DQDL 4M4RA 3M17B 3OB8A 1RVFL 1IM9B 2BMKB 3QJHB 4C59B 5I16A 5DFVD 2YHGA 35C8L 1KOAA 3CV5A 5L4IA 2E0PA 3DDGA 3FTVA 4GUPA 1MFNA 4WWKC 2Y2YA 4XB7A 5DT1L 1TZIB 4QHUA 1CLZH 1USQA 1R3HA 4ZUUB 3N9GL 3PQYE 4XAWH 2AQPA 12E8H 3FB8A 5DD0L 5K5YA 3FT3A 4AGQA 1MJ7H 4JQIL 2YQBA 2WQWA 2G9KA 4LLAA 3CLEH 1KJMB 1E8ZA 3GUTB 3U36B 1L9MA 1FO0L 3WFEL 3U1QA 1YJDC 5CP7B 5T1MA 3O3AA 3KPNB 4M03A 5ID0A 1KCLA 1NBZB 3BLBA 4HU2A 2VISB 2K70A 3UTPE 1U6AL 4XI5C 1P6WA 4EI5A 5HDQH 4ZFQA 5C07E 2RJMA 4QRQB 2X1WL 3CXDL 5FGCE 4DPRA 5ALCL 4WW1A 3CHRA 5JMRA 3V6FB 3Q1EA 3DIDA 3ROLB 3SKJL 3EGDA 3QH3A 2IG2H 4JFUA 3TM6A 2XFXA 4BK4A 3FFCD 4MDIA 1IEAB 4KJPD 3Q8AA 3GMMA 4XTRD 5E99L 1ZT4A 5AVXB 3X17A 5D5MA 4PJFB 3D51A 4MNQE 3GJEB 5HHME 3ZU8A 3FW6A 5EBGA 3F5WB 4XVSH 2DRUA 4ANUA 4LOVA 4NFDA 3LNHA 3NCFB 5FHAL 3HBZA 2Y2WA 2CKNA 3U6RB 3CK0L 4BCZA 4N1CA 3MRKA 4P23A 2FEDD 5DTFA 2B5IB 1EFXB 2NUTA 2AEQH 3F5WA 4G9FD 4XP5L 4ZUVA 4TSCH 4BZ2L 2F58L 1SGKA 1F6AB 3MGTA 2X4OB 1QBMH 2BM3A 4J28A 4XBPA 3B5GA 2OKMA 4NQEE 3L5IA 5JW4R 1LP9B 3HC0A 1MLBB 3HPLA 4ETQA 1P5UC 3EJJX 3UCQA 4FF9A 5EB9A 1FCGA 1WJ3A 4HAKA 2LTQC 3DBXB 3OF6D 5KVEE 3T1FB 3QUYA 2RBLA 4MNGA 4YGAB 1V3MA 4NRYB 1MCOH 4PMFA 2I32A 6PAZA 4AJVA 3MRFA 4G72B 1BOYA 1EJFA 3OV6A 4WV1A 1MRCL 3QAQA 4DZBA 5LHDA 1E2WA 5T1KB 4YDKL 2OMWA 3IGKA 1F11A 1NC2A 3IAGC 4G7YH 5E2VL 4JPVH 2GIYA 3IFLL 2FGWH 2IGLA 3KJ4C 3MA9H 4CMMA 3X1FA 1TTCA 2AJ3A 3FQRB 5ADPH 1WWBX 1J8RA 4I13B 3MLRH 3ZL4H 4L3EA 5C09E 2DYPD 2Y06L 5EIIA 3LKPA 5IEHA 3DO7B 5HHVL 1F8TL 1U8NA 2V3EA 4J12A 4RMTA 4JK0D 2IADA 2ESVE 1IM9A 5CGYC 5CZKA 5B39G 3ULUE 2NNAB 5D8JH 4UTBH 3WY4A 1JXGA 4UIMB 2EYSA 4JY6B 5TTRA 2ITFA 5KSAD 3KBHE 3O6KH 4XOAA 4TUKL 3S96A 1QUPA 1OGPA 4R90H 3ARDA 1F42A 3U6XA 1L9RA 2Q76B 1FFQA 3A0OA 4CUCA 4UU9B 4OZIE 2NNRA 3VXPB 2YD6A 2YJQA 1DJIA 5EMYA 1MAMH 3MNMA 2K4AA 3AY4A 3CQPA 3VH8A 1TF4A 3MI6A 3H6AA 1T0OA 4YE0A 1S7QB 1JXJA 4WKZB 3OG4B 4QD2E 4N6RB 1RFDL 3LPFA 4AGPA 1JFQH 3NA9L 4I18B 3UTSB 3TO4C 3ZKXB 3GXFA 2VL5A 4MXWL 1XF2B 1B9KA 2HFFB 2IPUG 3MRJA 4XCEB 4IBQA 4XNZB 2VMDA 1ZAGA 4ZX5A 4HEPA 3DX9A 3DBXA 4TVPL 5C07D 5E8NB 3P3UA 1ZLSH 1T04A 4ALAC 1OZTG 2APTA 2ICWA 1QZ1A 3B3IB 4MASA 1YDPB 4IRJD 4P5TB 1T22B 3PG2A 5HHXL 3LNEA 4U4IA 3ZN6A 4P5MB 3VFGH 1P1ZB 3E7JA 5EC1A 4M6NH 2OQJA 2XRAH 4M62L 4RA0C 5HXMA 5IKCB 3R7RA 1CZ8L 1TVBB 2XWBB 3UYPA 4K3JH 1S5HB 3D2UD 3UTZA 2OMZA 2XV2A 3KG5A 4PRHD 3OKYA 3UP6A 4IBLT 3L3KB 4AGLA 4WFFE 2AJZB 2CWRA 2V5SA 2EE9A 3CMGA 2DLGA 3LEVH 3PDDA 3SYPA 3TEXA 3TX4A 3AQDA 5SWZD 3D85D 5K39A 2ZQKA 3MUUA 5HHNB 4YC2C 5EU7E 4QLWA 3LIZL 4PJXB 2HN7B 2DEYX 5IHUL 3H9YA 2WHVA 4X9FA 4G9FA 1T20A 2XDHA 4QRTA 5HI3D 3UMNA 1CPUA 1GJIA 1KY6A 2BNQA 4AEHL 4JO8A 5IW6A 4G6KH 1MH5B 4UT9H 4MJIA 1HE7A 1G7MA 1DCEA 1RIVH 2A7BA 2A3TA 1OT2A 1A4AA 2P24A 1PZ2A 4EN3D 4P4RB 3OR7B 2UY7B 4MD5A 3V52H 4PRAB 3TZVC 2H8PB 3NIGF 4W93A 3LHPL 2HCZX 4R26H 1EHAA 3SE8H 4P8QA 3ZHFA 4PGDB 4PREB 3V4UH 4PLNC 1C7TA 3OWEA 3GSNH 1XL4A 4NRYA 3BWAA 1LGVA 4IRJC 3OX8A 4NO3A 1D7FA 3QUMA 5E2UH 2FATL 4K9EL 4F80A 1MAJA 5LGHL 1QTPA 3MU3A 1JPTH 3O4LD 2WBJA 5G4NA 3O45B 2BSDA 1W72B 1FIEA 3P3TA 2FD6H 3AUVA 1JZEA 3IRZA 4Q2ZB 3S36X 1W0VA 1WFIA 5C08D 2WWOA 3GSOB 3SO5A 3CPLB 4KHXH 3BT2H 4L1SA 5FW8A 5ALBL 2N56A 1TETH 2P26A 3BAIA 3CLFH 3UTTE 1OO2A 4F2ME 4QXTB 4ZUVB 1EIBA 3GM8A 5E2WH 5AB9A 3TZVB 2R1XB 3MBWA 1U3ZA 1HHHB 3HMXA 3MFFA 1F3JB 4OIIH 5DTFB 3ZZLA 1X6LA 4PJIA 4KY1L 3RA7L 2JJWA 1JPGB 2XYBA 4GQ9H 4AM0Q 2RA1A 3M8OL 3U6RA 1NMAL 3ZSTA 3S5LB 4UZUA 4RAVB 2F54E 2GHWB 4LLUA 5DMGD 4U6TA 1JXKA 1O7DE 4ONGL 3CFCH 4QO1B 4YHPB 3VYOA 4L3CB 3T8MA 4MNHB 1MHHB 1Z5HA 2VZUA 5GISH 2NCMA 3SDDD 2NY0B 4LCYB 3RWIB 5TE6H 5MEOA 1SHXA 3ATFA 4QRRD 3CUPA 3GB7B 1PZSA 3FTWA 2ZXCA 3UTSA 4ZFOA 3I9IA 2AK4A 1Q9LB 1JZGA 1NCJA 3TA3C 1T1XA 4QRUA 4G1EA 2F8VA 3BCDA 4Q14A 4X83A 3QZOA 1WK0A 4QRFA 2YQ3A 4AM0B 3I6LD 5CJBA 4OD3L 4F92B 5IFJA 4BKSC 3HUJB 4RMVA 1JV5B 1EZVX 3HZMB 4BSVA 4XAWL 5LGKA 1EXGA 1C8QA 3RIKA 2R4RL 3R1GH 5IT2H 1GIGL 4RWYL 5I1KH 2VXUL 3EKCA 4HWUA 2PF6A 4X6DA 4HEME 1XB3A 3O45A 5CJ8A 3ESPA 5HPOA 1CD8A 2J5WA 3Q44A 3ROOB 4XNZC 3WXWL 1BJ1J 3FS9A 3QEQD 4QRAA 3VI4F 1R34A 2DQDL 2MHAB 2DWDA 4I1RA 1EFXD 1OB0A 4CC1A 3H3BC 3NCJH 3PNWA 3KGUA 4LCVA 4M61B 5DMGC 5AZ2H 4KZCA 4I9WD 2QSQA 2HFGL 4E42B 1EPFA 5EZIH 1ES0A 4I89A 3FRPA 3TONA 3W2DH 1H6EA 3V8OA 4JO3L 4NLHA 4P2RA 3T3MB 3S37L 3D0AA 4HLZG 3SDDC 3QXWA 4NAMA 2DYPA 2VQ4A 3U0WH 2DM3A 2VDRH 1JNLH 4IU2B 2W0LA 4XNMA 1TZGL 1U4FA 4P23C 3O4LA 3BWUC 1FRGH 3VFMA 1VAHA 3S34L 3SKMA 4XN5A 3MC0A 2EACA 3I84A 3NN8A 3REVB 4L18A 3V8CA 1TQCC 5CJXC 3VXSA 5B3JE 1IU1A 3MGOA 1EHLH 4BFRA 2FWUA 3B1UA 2EUXA 1DBKL 4G6FB 4LZKA 3CH8A 4X0KA 3PXHA 1SXCA 1UA6H 2ADIA 2DMGA 2QVMA 1F02I 2E5EA 2NR6D 3C5JA 4PJIF 5KSBB 4L1LA 5C6WH 2E9IA 5C97A 1FNGA 3ABLB 5GGRB 4XNDA 1KXQE 4HEPG 4FAAB 4W9ZA 1I1AB 2WBJD 3L2NA 3QRFM 3IDYB 1OWRM 4Q97A 3MBXH 4ZFFA 4BWUA 5HYJE 1FZJA 1MJJB 4M9PA 1KJ2B 3QNFA 2GBUA 1OPGH 2UWEB 3BPOC 4ZFFB 4ZMQA 3WTVA 4HUVB 2FR4B 4PD4J 1FZOA 1FGNH 2ORBL 1GW0A 4ODHL 4JHUA 5CILH 4KX7A 5F7HA 1KT2A 4EIZC 3QCVL 4IBUA 4JMXA 5SWZA 2BXYA 3SJVB 4HS3B 2IWFA 5JW4M 4YDKH 1MCNA 1RZIA 4GP4B 2VAAB 2OMVB 2H26B 4UDUB 1VZIA 4ODXA 5GS3A 5H35B 3AS0A 3DJTA 4TNFA 1HOCA 5FV2A 3AAZB 4M48L 1S7WB 4UT9A 4EF3A 4W9HC 1YMMB 1UB5A 4ZO8A 2Y69B 5F6IC 1HQ4A 3IMUA 3PXJA 2Z3FA 3INUH 1E30A 4FQXA 1IL1B 2FYYB 3IMTA 4Y19B 4D0BB 2FZ3A 1XGPB 3GBNL 2BWDA 4XGZA 4PJ8C 1OM3L 3CFIC 3WN5B 2FYYA 3FMGH 4UOW1 1LWRA 1U3HA 2ITDB 3WN6A 4D0BA 4TUJA 5FCUL 2EECA 4G3YL 5SWQA 5DLMH 2HXAA 5CZRA 1EO7A 2NNCA 4XCNB 4XC1L 3TC9A 2VJ0A 3K72A 2HLAA 4OV5A 5HDBE 3BZ4B 3P3RA 3BXNB 3PWLB 1QSED 4G7RB 3D2TA 5FO9B 1O5DT 4WHYG 2J25A 1TZHB 3GTVA 4NNYA 5B1JC 5JPNC 4HWBA 1E8YA 1WEJH 1KACB 4UT7L 1YEDA 1SLVA 4WI9A 4IRZL 4HS8H 4HCGA 4UTCA 5LJYH 2A74C 1WBYB 1EK3A 5DK3A 1V7NH 2IDCA 2ZX6A 2X4UA 3CTTA 4GSRA 3ILQD 5AKRA 3UBHA 4HUMB 4DGYH 3LZQA 1KCRH 4NZJA 2GTWA 1I1AD 2IPUK 3QZLA 2X4PB 1RJLB 1XGYH 4DZBB 3ULVD 4J3WA 1A21A 2Z0BA 4RFEB 4AUJA 3B7RL 2YUZA 4FFZH 2ADFL 3BKYH 4AX3A 3TOPA 5E70A 4E41D 3GI9H 4LLQA 3HA0A 4FP8L 3VNZA 4JVPA 1TDQA 4IHBA 4N2FA 5L7XH 1RAMA 2WWMD 3TNMA 1L7IL 8CGTA 5FYKD 4N8VB 1GKEA 3WMPA 5IESL 2DD8L 3O3BB 5KYYA 4UQ3A 2EYRA 4F2MB 4UIKL 3Q2VA 3MUGA 4IHOB 2ADJA 1Y6MR 4WKZA 4M6ML 5BRQA 1T6BX 1BLNB 1QW9A 4OLVL 5F6HI 1BZDA 3KJ6L 4YHPA 4HKXA 3X2QB 1CXKA 3D52A 1G7JA 1OCWH 4FI6A 4F33A 4LLVA 4C4UA 3HHMA 4QUOA 2C3GA 5JXAL 5BRZB 4OQTA 4TLSA 2H41A 4PJ8B 2XV0A 2NR6A 1AP2B 5I8EB 4WJ5B 5D6DA 5FYJU 4AEHH 5GZOA 5AYUH 4K3HA 3GZKA 4GT0A 3SDDB 3L1FA 3IB4A 3CN2A 2DMKA 2NZ9D 2XZCL 5KZCB 3NRFA 2E9GA 1XGRA 3COOA 4G8EB 4Q58C 2I7SA 3IPFA 2DQJL 2A6KA 1HEZA 1HS6A 3WMSA 1NCOA 3H8NA 4XPFH 1SMAA 4FABL 3LHPH 2VQ1A 2VDMH 3NFNA 4I77H 4D7BA 3FQRA 2KT6A 5IF0A 4CADB 2Z8WC 3MHZA 3N06B 2W1NA 4FS0A 4PS7A 5I0XA 5F1KC 4ONOA 4KDVA 4XOEA 5BQ7A 3ETBJ 1NUGA 1HQRB 1SOSA 1W72H 1OSZA 1ZSHA 2ZIDA 4KQ0A 4H44C 1F90L 1DBJL 1RJZA 1SXSA 2C26A 3UO1L 3M1BB 1ZLVH 1GGIL 1KBWA 5C8JB 2HRGA 1BX2A 3QQXA 1A65A 1P9MA 4MQXC 5TK4A 2UXFA 4HCIA 2H0EA 5ADOL 4S1RL 3K6NA 4QI3A 2UY7A 4HK3N 1J0JA 2XTJC 4LASL 4MD5B 3NCYP 1J05A 4PJGB 3SGDH 5KVDE 3W56A 4J6RL 1G7MB 1LP9A 3FO1B 4JHWH 5F7NC 2GC7C 4RGMC 2Y1YA 1ORQA 2BSED 2ZCHH 3B9KA 4DP4X 3FOMB 3ERXA 4ODTL 3WJMA 2GSIB 2AKRA 5DQJA 4N5UA 4N9GB 1TNNA 3EOTL 1FH5L 1QG3A 3I02B 3DX6A 4HJTA 1INQA 1CFMA 5LG6A 1E5CA 3QRGH 4MCZB 4KXZI 2XV6B 4NLAA 4ENZA 2CDGB 2X6UA 3FONB 4H2CA 4P46D 4N28A 2CGRL 2ODHA 2NLJB 2EO1A 2ZKHH 4XXDB 5CWSB 4MA8H 1QLEH 4HF5L 5DXWA 5CJQH 4DGVL 5BUAA 1PF3A 4K7PL 4YQXL 4G7SB 4CBZA 4FKKA 2F7RA 3TEYA 4UQAA 3CZKA 1OSPH 4MDIB 3OKEB 3T0BA 4P5TA 4RGND 1WIUA 2RFXA 1I1YA 2YD3A 4OFYA 4E2OA 5H4ZA 2QGCA 5EZLB 3LPOA 3FZUD 5B3NA 3AU1A 4TLKA 4AQEB 4CILA 3ARGA 4JCWA 2MCMA 4ZFGL 1S78D 1GIGH 1BJ8A 2O5XL 2OMTA 3GSQA 4NUQA 3V0EA 1TQTA 3AS2A 1XCQB 5BO1L 3SPHA 5C08B 3VXTB 1TFHA 5C0BE 2IBBA 2IQAB 3BOVA 5I73B 4HKZB 3BAYA 4FQ1L 2XNAB 2YD4A 5DJCB 3MLWL 4AY0A 5KBPA 4LSPL 2VLLB 5L0QC 4U0RC 2PLTA 3LZRA 1RIUL 2A5UA 3HRZC 4NNPL 5DO2C 4ZPTA 3QISA 4JRXA 5CLWA 1NFDB 4ZQTA 2CHXA 1IARB 3TURA 3PV7A 1BQUA 1RUML 3UP1A 1RU9L 4I3RH 3MLYL 4AGMA 4D9LL 5AENA 5E2TH 2WIIB 4U6VL 3N1GC 3K2UL 4G8EA 4S1DC 4YDVA 3DRTB 3L4UA 4HWBH 4L37A 4YLCA 5IR1B 1QFUH 2NXZB 2HKHL 1AHWC 2JSFA 5GSRA 1EJ6A 4LQ1A 4Z1PA 3D30A 3QEGH 4WEUD 3QUML 1JHKH 1Q94B 2D73A 2HKFH 3P0VL 5D7KD 2D0FA 7FABH 2VR4A 1KPVB 3A6BH 3SDYL 3UC0L 2AJ3B 3D69B 5I1IL 4BGDA 2V33A 4LAQH 4MX7B 1TVBA 2XWBA 2GT9A 2VWEE 5I6KA 1J12A 4N0CD 4HVBA 4QCIA 4PG2C 2WINB 4HH9B 5CO1A 1NAML 4LSDA 1BZQK 1JWSA 3BAKA 3QG6B 3V4PL 3LCYA 1FG9C 3W9EB 4UV4L 1F3DJ 3RYMA 4X4XB 1J1OL 2EDBA 3JV4A 4P2QE 3ZJAA 4BH8B 4W6WB 4C83B 1P7QA 1MI5A 5DD6A 5ICYA 3SQRA 2VKXA 5DO8A 5K9JH 1CFNB 1GGBL 5E24E 1BA9A 1XZ0A 3CLWA 4R9HA 3GKZA 4IOIA 4U49A 1BVNT 2ORBH 1FN4B 2ZCZA 4ZI8A 2Y5TA 4Y5VA 1XR8A 2TSBA 2FWOB 3PIQB 4A2DA 1DUZB 1N0XH 2FAUA 3DXAD 4B5EA 1PIGA 1NEPA 1CG9B 1RZJH 4I18C 1I1RA 3QZWA 4KMTH 5ERWA 3MLZH 4H8WC 4U0RB 4JLRA 3BX7C 4QNPF 4EKJA 1VESA 5EU3A 3NSCA 3S36L 3O6FD 1KELL 4OJDH 2VRKA 1E6OL 5A2JH 2XZAL 2FBOJ 3CCHA 1ZA6B 5AUMA 5BZWB 1H9VA 4JDEA 4L37B 4ODVL 3VM7A 3T04D 3X3FL 1KXVC 5BJTB 2E6QA 3EYSH 4OAWB 4NRXB 4LSTH 2A6DA 1BWWA 4HETA 5EZOH 3D18A 1CD1A 3E6HA 5C07A 2V2XB 2X0WA 1B3IA 1VFAB 1Z7JA 2D3NA 4G9DB 3IDMB 4PTTA 4OD1L 2JKXA 3V6OA 4Z7QE 1GZHA 4HG4K 3APMA 2GABA 1YECL 2Q10A 5ENWB 4LLYA 4HFWA 5C2BH 1XDTT 2Q7YB 1A7QL 4WEEA 1RMFL 4MNQA 4YGVA 5D72L 5IF0B 3UYOD 4DGWC 4UT7H 5CF3A 4LOFA 1IBBA 4H20H 2WIMA 4IKNA 4P3CH 2YPLD 1E9QA 4XPAL 3KWTA 2VDLB 5TE7H 4S10A 5LCVA 1IGYA 5GGUB 4BE6A 3L95B 5TDPB 3OAZH 4U1HA 2VAAA 4DKFH 1NBVL 3N3EA 1HDMA 2F0CA 5KSUB 2K8MA 1SDYA 3PHOA 1K85A 4DGYL 1MRDL 5C2UB 5DA4A 1ADQH 4XXCA 3SBWC 4NC1C 3FOLA 2DH2A 2GJZA 5I18H 2V9TA 2E74C 2JE8A 3MFGB 5C0FB 3PJSA 2BNQD 2EC8A 5SV3A 1YEIL 3O6FC 1SYVA 1NKRA 3ARPA 1ADWA 2A77H 1KPUB 1AVAA 2J6EA 2Q1EA 3GHPA 2LFEA 1L7IH 1ZV5A 4ZDHB 3LHAA 4A7GA 3VQLA 1RZ8A 2JKJA 3KPQB 3AACA 1WBXA 4YHIA 1QYGL 5IFHH 3BDYH 3RDTC 1WO2A 2YMOA 3ABZA 1Q0YL 2F74B 3DTXB 2QPFA 3CHXA 5IB1A 5D6DC 2I9TB 4I4WB 3HZYB 3IN2A 2P5WE 3BH9A 3U25A 3DUSA 2VSKB 4GUCA 3CQQA 1XCTB 4EIUA 1SJVA 4J3OD 1G6RH 4M1CD 5LBVA 1K2DA 3MGAA 3D6GA 1GYAA 4RNRB 3V6FA 2NX5A 3NFSL 3DOSA 4M43H 1GMIA 1EEZB 3BZ5A 3FT1A 4PGBA 4R97B 2W5PA 1ZVHA 5DVNA 5T3ZH 3RURA 4AIZB 4K7FB 4MYPA 5BVPH 5A6IA 3MOBH 3FFCB 1ZWIA 2F6AA 4KVCL 1PFCA 3N1PC 1MSPA 1IGTB 5B21A 5KVMC 1FV1A 3VW3L 1MCBA 3MZTA 4WNQA 3GSVA 3AS1A 3SKNA 5IJVA 1T1YB 4U1MA 2NY6D 4PRNB 4BH7B 4IKKA 1M71A 1WQVT 3L7EB 4N4YB 4LRNL 2BVQA 1X5HA 1F2QA 2IAMC 3APDA 3BH4A 3JV6A 5E7FA 4PP2B 3FOLB 1I7TA 4WFFD 2VR7A 3B6SA 1HZHL 4JFEE 3WUWB 3F7YA 3T3ME 4DERA 3CHOA 2BHYA 3LTVA 1QRND 1CURA 3RWCB 4EZJA 1ZD6A 3WN5A 4PGEB 4IBSA 2OI9C 2FEEL 4QRRA 2H1PL 3W0WD 4BSVB 2YIHA 1KCVL 2B2XH 4AZUA 4G11A 1YN6B 2QEJA 2X3BA 4MNQD 2V5YA 3WIIL 3ASNB 4JM4L 4OLEA 4F7CB 5KANI 2J4WH 2WC7A 1HYSD 5DR5H 2PTTB 5FHAH 4YSRA 4B9JA 4PG9A 1SJEA 1DVUA 4M1CC 4FOMA 3OKLA 4UNUA 3CC1A 4ALAL 4G9DA 2UXGA 3MV7B 1PQZA 4ZQKB 3VFTA 1MPAH 1UB6B 4IOFD 2CKBL 5SWZB 3TXAA 3TWCH 2H3KA 4AH2A 1UJ3C 2Y1AA 3GBDA 4FQCL 5FYLD 4A2GA 3X1NA 1GGCL 2XWEA 1G9NC 2W07B 3ML9A 5IMOA 5TDNA 5C70A 4Z7NB 1JIBA 1KXHA 1FBIH 2O5YL 2YPLE 2Z1PA 2NTSP 4DGVH 4WUUA 2EIZB 5F1NA 4R84A 5HGBB 3ORJA 1MFEH 3ARFB