3GEWB

Faee-faeg chaperone-major pilin complex of f4 ad fimbriae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
207
structure length
199
Chain Sequence
SLAVDQTRYIFRGDKDALTITVTNNDKERTFGGQAWVDNIVEKDTRPTFVVTPSFFKVKPNGQQTLRIIMASDHLPKDKESVYWLNLQDIPPALEGSGIAVALRTKLKLFYRPKALLEGRKGAEEGISLQSTMLVNTTPYIFAIGSLLDGGKKIATDNGTTQKLLMFMPGDEVQVNVVKVDSLNDYGELQTWTINKKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Chaperone protein faeE
publication title Structural and thermodynamic characterization of pre- and postpolymerization states in the F4 fimbrial subunit FaeG
pubmed doi rcsb
source organism Escherichia coli
total genus 36
structure length 199
sequence length 207
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gewB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gewB02
5ID1B 4MWFB 4Y19A 1AQDB 3S5LA 2ZOLB 3EYQD 3JWOC 4JANB 2BOCB 4EI5C 3LIZH 4PJXE 5I66B 3P30L 1AGEA 3ARRA 3IJSB 2MTPA 3O81A 3U46A 1JZ4A 3OJVC 4UT6L 5TH2A 3O3DB 4KJYB 2ICEB 3W81A 5HGHA 5IFAH 3CJJA 4WW2A 3DX6A 1U95A 4QXUH 4KKCC 4ZD3L 2A1WH 2IH3B 3AS3A 3RY6A 2G2RA 3THMH 1V7NL 3QCUH 4XBPB 4LAQL 3VRJB 1F11B 3ARFA 5E6IC 4YXKH 4JZJB 1NUGA 3C09B 1HQ4A 3V6OC 2VDQH 4J4PC 3HRZB 3BDBA 4LOUC 1E4WH 2HTLC 3BQUB 2WWMD 3RJDA 2FZ3A 2OCFD 1NGXA 5TDNA 3OG6B 1V3LA 2IGFH 1BOGB 1R5WB 5F7EL 3RX7A 3KYOA 5ISZD 1QFWL 1Q1JH 3DNKA 5CZXC 5GISH 5DMJB 4IS6A 2JB6B 2JB5L 1T22B 3SJVA 1E6JH 1X5AA 4LLUA 4U6XA 4Z0XA 2HFGL 3SGJA 4WCYH 2BNQE 2BVQB 3FHAA 1ZA3B 1LO3L 4AEHL 4Q9RH 1EEZB 4YFDB 5CWSB 3BX7C 4G8EA 4HWEH 2FB4L 5GS1A 3KPNA 2GUOA 3B9DA 3G9VA 4HX1B 4HUUB 3CPLA 4WGWB 3VFMB 1E0OB 3NN8A 1OF2B 1R3IL 2DM2A 3KS0H 4DAGL 1AKJB 2Z8VC 1ZANL 1P4IL 5DK0A 4HWBL 4JGJA 5IWLA 1IEHA 3TYFB 3GSUA 3KXFD 4NQEE 4D0DB 3QRFM 4OGYH 4P5MB 1HILA 4DZ8A 2VDMH 2DDQL 3FO1A 3G5XB 3RIFK 4AIXA 2XTLA 5ALBH 3DVNA 1BFTA 1LO4H 3HNTL 3QXWA 1JIBA 1WITA 2QTEA 2VLKD 5BRZD 3G5VA 2DBLL 3D0VB 4RA0C 4LEOB 3VXRD 5TQ0H 2VABB 4TSCH 5KVFH 3G6DL 5BQ7A 4WV1C 5CJQL 1D9KA 2XRAH 1QBBA 2VH5L 4MA1C 3MJ9H 5CP3A 4OQTA 4M1DH 3FJTA 4N90E 3KPOA 1A6ZA 2CSPA 1DQMH 2GTWA 4NSKB 1S78C 5IGXL 4LGPB 3P9MA 2DQJH 2BY2A 2ESVA 5LBSL 3BW9A 4OAWB 3TIEA 1FC1A 1ZXQA 5GGSA 1OAUH 5BV7C 4Q9QL 5D2NE 4FQXD 1NAKL 4NGHL 4O2FA 3LKQB 4CJ1A 4HK3N 2VXTL 1MCHA 4LMQE 3MGOB 5K59F 3ZDXE 2CKNA 4QRPB 2J5LB 5IW6B 2IH1A 5E08L 3WNPA 1YEDB 2A9NL 4JFEE 4PJHA 5HY9A 3JUYA 4PJEF 3WUWA 5DK2B 1QO3A 1U41A 2CH8A 1FNLA 1KF9B 2VZ1A 2VZOA 3ULUC 3O41A 4BZ1L 1DUYA 2GAZA 3IFNH 2ERJB 5TE6L 3QSKB 2HKHL 2O61B 1QPPA 3KPRE 4ORGA 4MSWB 2VL5B 2QBWA 5HHME 4FFVD 1LMKA 3MRMB 4C58B 1UH3A 2J2ZA 5IT2L 1TJIL 4UT9H 4N8CL 4YGVB 3KPSA 3UC0H 5IVNA 3PNWB 4L29A 1IAIL 4IOIB 1W72L 2F54D 2PKDA 2J8UF 1V7ML 3PHQB 4ZNEA 1S7QA 2Y36L 5IFHL 1TMCB 2NYYC 3NFPA 4HUVA 5DURD 3LAFA 1QVOA 5DQ9B 4NQSA 1U8JB 2EYSB 2PR4H 3DTXA 3DBXB 4WEBL 2F58L 3RRQA 4I1NB 1A6TB 4G6KL 4JM2B 1YMMD 4QOKD 4YHPB 3HMWL 3GHEH 1HHHB 3AB0C 5BW7C 4HV8B 3MOAH 1IGYB 1U8OA 3KDMA 3TT1L 1ETZB 5HVFB 1N0LA 1HH6A 1ZLVH 3PWVA 2JJUA 3IAGC 2NXZC 3PJSA 4G8GE 5FO8A 3L3JA 4S1DD 1T3FB 3MJ7B 1Z9MA 1T1WA 4P5TD 3L7EA 5JHDE 2E5EA 4YIQA 1M71B 4KGLA 4KKAC 1OP5H 3X14B 1LNUB 4MNGE 4ERSL 3IXAA 3MPCA 5JTWA 4KI1A 3IVKA 1JHKH 3OSKA 3BGMA 1DBML 3VXOB 1JV5B 4CU7A 4AK1A 3KYNA 4ETYA 2A6JA 4R4BA 4NKMB 1N0XH 3WJLC 3PXJA 4LEXH 4X6EB 1AY1H 1R0AL 1B0GB 1QA9B 1NLDL 3GK8H 4XNZB 1FBIL 4PB0L 2VDOH 4Q6IA 3UTSD 2DYPD 1U3HB 2PO6D 3QZWB 3WD5L 1XGPB 1CXEA 5C71A 2HJFB 5J13B 1BQSA 1JPST 2EKSA 4I2XA 5KVMC 1A5FL 4JFDA 3LS4H 4M6AA 3IETA 5FYKD 1ZLWK 1MAML 3SOBH 1EVUA 4KKBD 1KIUA 5SWSE 4X98A 1FYTE 5J11B 4R26L 4XVJH 3UYPA 4S2SB 5T3XE 4L4VA 4YZFF 3IJYA 3LQMA 1JZ8A 1NCCH 5FK9B 4PJBF 3H9SD 3V4UL 3VD3A 2ZUUA 3MNVB 2FHCA 1FLRL 3DX8A 3H6JA 1FPTH 2M2DA 5D1XA 3NFSH 1TETL 1WBZA 1WT5A 4OZGE 1MFEL 3FB8A 1CXFA 3ZMRA 3MV7B 1I9JH 4JPKH 1BGXH 3IGAB 2WZPD 5KSAA 1I7UB 2OMNA 1NUNB 1DEDA 1TZIA 4Y2DB 3GSOB 4NC1E 1PDKA 1A1OB 4XPAL 3SKJL 3CFBB 4RGOH 4H26A 4QY8B 1F4WL 2P8MA 2R1YB 2HFEB 1KJ2B 5JLZA 1QRND 3JXAA 4PY8J 3BWAB 1YEIL 3TBYB 1AP2A 4NC1C 1JZ2A 4GRWF 4EEEA 5CILL 4G6AD 3T0ED 1ZWIA 5C0BA 1UWXK 5SX5K 3MLPA 1ZLSL 2IMMA 1NL0H 3NCYS 2AEQH 3AREB 3MLWL 3QUMH 3MCG1 4Y4KA 5D93C 1AXTL 3MACH 1G7PA 4TUKH 1OTUD 2NY3C 1DN0A 1UQSB 4I0PB 1E27B 2VXQL 5C0GB 4CL7A 1QSEE 2V2WB 2BSED 2ICCA 2XY2A 4U1KA 5EWIL 1OY3B 5F9DC 2BNUB 4X6DA 4XPHH 1T7WA 3GKWH 5EFIA 1MI5D 4ELMB 3VWJC 3MRLB 5F3HA 4M61A 3HCVA 1N5AB 5T1DL 1BAFH 3MLZH 4C56D 1DZBA 5SWZE 1IT9L 3B4NA 5HI4D 2V5SA 5KVEH 4P9HH 4HC1A 2DMBA 2X10A 3OGCB 3VE0A 3CUPB 2JK5B 3HE6A 1SQ2N 4LNVA 3ZKQD 1NQBA 4IBLT 1A1NA 4TUOB 1VFAA 1OAZH 4QXGH 4XWOC 5D72L 2NW3A 3I3BA 1NCWL 4PYGA 3WEXB 5D7SH 1MVUB 4PJFB 1NCUA 2IAMB 1JGEB 3IRPX 4JB9L 4QO1A 3RWCA 4JM4L 1W0VA 5E1AA 3RGVA 4HS6B 2Z8SA 4KPHL 5E7FA 1KPUB 3I84A 3NFNB 4G6JL 2AERT 3MSPA 4MB5A 1IRAY 5T1MB 5I8EB 1QOKA 3SQOH 1NDMA 4PBXA 2RFXB 4XH2B 1TJGL 5CKGA 5I1JL 3WL9B 4X80L 4Y4HA 4NWTL 15C8H 2NXYB 3ZKND 5I1GL 1UEMA 4B41A 4OUOA 2FSEB 4DKAA 3DUHA 1ULVA 5BS0D 4C83B 3SHSA 1DE4B 1NMBH 3QIBB 4FABH 4POYA 4P4RA 2KQMA 3MC0A 4G8FB 3O4LE 1X5YA 1P6FA 3VI3F 5JPMA 3AM8A 3W11D 1X5KA 4P99A 1Z2KA 5TE7H 4ODWB 1CXHA 4LPVA 5DLML 4V1DE 1CD8A 1IGIL 5HGBA 5EULV 4JG0H 3U2SA 2QSTA 5I1IH 5I18L 4LVNB 5KANG 1SJVA 4NZTH 3V8OA 2EE2A 5EG6C 1XFPA 3SE9L 5TE4H 3IT8D 5L8KB 2DL2A 2UWEF 2XTJD 1VHPA 1FC2D 2RBLA 4N5ED 4Z7VF 2NCMA 2FBJH 1JF5A 4YFLI 1DFBL 4GXVH 5AZEL 4J23A 2EIDA 3QRGH 4LKCB 5K9OA 4X9GA 4DUXA 4GAJH 3OZ9H 2MHAB 4MQXC 1QLEL 3GMMA 1CDHA 2IWGA 4J1UA 4GG6F 3QB7C 1X5GA 1YDPA 4LBEA 4ONHB 4Q9BA 1FCCA 2OR8A 4R3SB 5T5FH 4GOSA 2LVEA 5C3TA 4U49A 3VXPA 3N85L 1KEMH 3QDMB 3FOMB 1C8PA 3QFJE 4CW1A 4MDJA 1WEJL 1A14H 3SDYH 3P9LA 4UZGA 1FRGL 2JJSA 3IDYC 2X1PA 5CCKH 1N4XL 2XN9E 4K3HA 1Y6NR 3ALWA 3ARBB 3WNKA 4RMQA 3QIWA 4HBCL 4M93B 1NGYB 2YS4A 2W60A 1EK3A 3FRPG 4OQTL 4DW2H 2D31A 1C5CH 1KBGH 2P42B 1T1ZA 3GHBH 3SY0B 1I8IB 4G9FE 3WFDL 4GQPH 4J3UA 1UGNA 1LO5B 3BT2L 1A7PH 5IW3A 2ZKHL 4WY7H 1INEL 3KPQB 3QIUC 2IFFH 4LF3B 3U0PA 4OSUL 2AXJA 2EXYC 4A6YA 4J6RL 1TLKA 1S7WB 2YPLE 2HN7B 3V9FA 3G6JF 3GMNA 4X4ZA 5EZJA 1N8ZA 1MJ8H 4X9HA 1KYOK 1UM5H 4HS8L 1BD2E 3V6OA 1D6EA 2DQHH 4J4PA 1UA6H 1W72B 3MYZA 4R97C 2GSIA 4UV4H 2H6PA 4TSAL 1WBXA 2UYLA 3KJ6H 1A4KB 1XGTA 1AD0A 4JN2B 1LILA 4Z76A 2AJSL 4JGMA 1IM9B 2X70B 3WLBA 1G6RH 4E5XB 3A6OA 3R1GL 4PB9H 2CLZA 2B20A 4N0FA 5HDOA 4ZO8A 2QSVA 1J05A 4CMMB 3DROB 4D9LL 2WQRA 3KHOA 4OFDA 1I7TB 1BP3B 3IYLW 1HI6B 2EEAA 3IFLL 1AFVH 4TVPH 5LQBL 3EOAA 4FQ2H 1X6NA 4X0KB 3VRIA 3OPZL 4WUUD 4NWUL 1S3KH 3X11A 1RIHL 4XGZB 2B1AH 1DQLH 4DWHA 5KW9H 2XPGA 3EOTL 3SDCC 3EYSL 1CS6A 4DVRL 1FL3B 3HB3D 3VGFA 1A6WL 2CDFB 3BPNB 3FZUC 5HDQL 5EZIH 2AXHA 2WWKT 1GC1C 1T66C 3P0VH 4JQIH 5GSVA 4XHJD 1CGWA 1NGQH 4DKEL 1HHKA 4OZHF 1SEQH 1IFHL 4JREC 4NQDB 2A0LC 4MNQB 5JQ6H 4MA8L 3FT4A 3OR7B 5T1LD 3RL2B 1DBBH 1EHLH 1L7TH 1Q0XH 1RMFL 1E6OH 5GS2D 5KVGH 1CF8H 2VLJE 5I75C 5MERA 3TCLB 3U7WL 2CJUH 1EAPB 3QNZB 1IM3B 2XACC 5IIEA 3OAUH 2P5WA 5BRZE 5CEZE 35C8L 2AGJH 1LO2L 3EYVB 5C09D 1VFBB 3S3SA 4N68A 5HSFA 2ITDB 3NPSB 2ADFH 3C5ZC 2XWBB 2UUDH 4DCQA 3QXDB 1MIMH 5L88H 5CJXA 3MX0A 1J1PL 3EYOA 4MJIB 1HH9A 1MFDL 2F8OA 3FB5B 4NHUA 4YHLH 5I74B 3VFWA 4P2OC 1ZGLB 5F7UA 3SQBA 2R1XA 4OJFL 1ACZA 1A0QH 5EBLA 5FF6B 2XI9A 1RZJC 1CLCA 3S3PA 2XG5A 3WDJA 2BP3A 5D7JB 4F33B 5IB5A 2BSRB 1PX3A 3SDXA 5F3BB 1CFQB 5HHOD 4KROB 43CAA 1J0ZA 5ESQA 4XNYH 1K3IA 5C0DA 1ORQA 5DVMA 8FABA 2FCBA 1QYGL 3GMOB 3HG1D 2AJXL 3MA9H 3QISA 1GZPB 1NCTA 4M3KB 1F02I 2FIKB 3WS3B 1DBAH 3P4MA 3GSQB 5IMOB 4PBVC 1G7QA 3UEZA 5JIPA 1ZS8A 4ZPTA 1B4RA 3BZ4B 2ZSVA 2V9RA 3O3AB 4TPRL 4DZBB 5IR1B 3KPLA 1P1ZA 1ZT1B 1T4KB 4CMHB 5HHXL 2IQAB 4R8WL 5DJZB 3GMLA 5A1AA 5K9QG 3TO4D 1F3RB 2O5YL 4Y19B 1QACA 1VGEH 4HPYH 3ORJA 4AT6A 2DM3A 1NFDA 1NH6A 2VZSA 1B4JL 1JFQH 2AV1A 5BW7A 4EOWL 5I1DA 2EIZA 4HMCA 3QUXD 1AGEB 2YN5A 1TCRA 3DURB 3QXAA 3U46B 3HN3A 2DQEL 4G9DA 5TH2B 1JGLH 4M7ZC 1OW0C 5HGHB 2D0GA 1JHLL 4WW2B 4UUJB 1HKLH 3DX6B 1YPZE 2VXUH 3EO9H 2BVTA 1X5JA 3U4EA 5EU7E 1FGVL 2X4QA 2G2RB 3CSPA 1MF2L 3RUGA 3ESUF 2FX9L 2H1PH 3ARFB 3GIZH 3I50L 2VLRD 3TBWA 1HQ4B 2VDRL 1CXKA 1S7RA 3F5WA 3O2VL 4FG6C 4RX4A 3U4BH 4JY4B 5ADOL 4JM2F 2EYTA 2EDFA 4K23L 1F13A 4C55A 2FZ3B 2IF7A 4P3DA 5C08A 1NGXB 5TDNB 1BQLL 4GH7B 3LKSA 3DUSA 4AIOA 3KYOB 2AJZA 3DVIA 4WEUD 5I2IA 4LLWA 1HINL 2J88H 4IS6B 4UNVA 2F19L 4GMTH 3VA2C 4NJAH 2BRRH 4KK8C 3SJVB 5IK3A 4LLUB 3SE4C 3WO3B 4KJPD 2AS5M 3ZTNL 4U6XB 1ZE3C 3UTTA 4Z0XB 2R1WB 5SV4A 4XP9H 5DR5H 5F6IB 1WZ1H 1RI8A 2BJMH 4HWUA 1QHOA 5H94A 3T09A 4D8PB 1EO5A 2XZAH 5GRVL 1U3ZA 5GS1B 2PW2A 3KPNB 2VR9A 3DIFA 4F7CB 1RIUL 2J6EL 2GUOB 4XMPH 2P24A 4NN7B 3CPLB 4NZRL 3GEWB 2YC1B 3I6KA 5E5MA 4GMSH 3NN8B 1F2XK 4D9RD 5JUEH 1I1CA 3FQWA 4PP1C 5B39G 1T5WA 4EN3A 5IBUB 2D0HA 4BQ6A 5DK0B 3GSUB 3QCTH 3GMPA 3NGBC 1OTTD 5HYQB 4UOJA 1HILB 2IBBA 2SEBA 4DZ8B 3FO1B 5DGRA 2YKLH 2LU7A 2YPVH 1XCQA 3DVNB 4K7FA 1NEZA 4TVPD 3SCMA 3Q3GA 5ICXA 3G5VB 1B0WA 2PUQT 3BEWA 4Z7WE 1S7UA 1TPXB 1IC5H 5BQ7B 1KTKE 3LKNB 3PHOA 1D9KB 2HKFL 3JV4A 2PYED 1Y0LA 3KPOB 1A6ZB 4JN1H 2GTWB 4ZFGH 1LK2A 3I6LD 3P9MB 2ESVB 4NRXA 3BW9B 4U4BA 3REVA 5DD0L 2IADA 5GGSB 1F8TH 2E8YA 4YUEL 3F7VA 1OLLA 1AC6A 1BQHG 1JNLL 4O2FB 3IU4L 2WBJA 3GBLA 4M43H 3VWJA 5DFVC 2VZ3A 1GRWA 4Y89A 1JZ7A 4POZC 1CI5A 3D25B 1HXMA 5MP6H 1NSNL 1KLUA 3EYUH 1UZ6E 3UBXG 3GM8A 1OAQH 3HPLB 4U1JA 3ABZA 4TTDC 2IH1B 4KDTA 1T21A 5I8KL 2AQ2A 4LFHG 3JWOL 5DRZA 4JRXA 3WUWB 5HY9B 4PJHB 5GRJH 5IVXF 1NCNA 1MCEA 1QO3B 3O41B 1I7ZA 5GHWL 1DUYB 2GAZB 4LQ1A 2APVA 5D7IA 4ONFH 1JMXA 4PJDA 3F7PC 4DGIH 3MYJA 3C2SA 4ORGB 4ELMF 5BXFA 1JBJA 2IG2L 1NANI 4R2GD 4A6YL 2CR3A 4K2UL 2B0SL 2UY7A 3JWNC 4BSVA 2CRYA 3H3BC 3H2WA 4UAOB 1OAYL 1AQKL 4Y5YC 3KPSB 4M1CD 4L29B 4G6FD 2VXSL 3MV8E 3PP4H 4FXGA 3VFOA 4KK5D 2P8PA 4JQXC 3U7YH 1WWAX 1S7QB 3MXVL 2HRPH 4O9HL 3D18A 2ICWJ 4FZEH 3NFPB 4PJFF 4HUVB 2A9MH 2Y6SD 1QVOB 3EDDA 2UV3A 3RHWK 1SY6A 4N0CD 3IXTA 3HAEA 3X17A 1I9RL 4GAGH 1MCWW 1KEGL 1YEJL 5JPNA 4EBQL 2RJMA 1PG7L 2B7DT 1QFWI 4M5ZH 2LTQC 3MUZ1 1XT5A 1U8OB 2HVJA 1FORH 1HH6B 5K9JH 3PWVB 3BGFB 3PJSB 4U3XA 5FO8B 3L3JB 2YD7A 5FGRA 4I0KA 3K0WA 1J86A 4YXLH 1T1WB 1KN4L 3L7EB 1VGKA 4YIQB 4WRLA 1G0YR 4L3ED 2BXYA 3IXAB 2JCCE 3IVKB 1KCVL 3BGMB 3VFPA 1T5XA 2WLZA 1ZHNB 4B0MM 4HLZH 3HC0A 2E3VA 4JFHE 3RP1A 2A6JB 4R4BB 4FS0A 1ZGLM 5HYSA 1IEAA 2ZJSH 2CKBA 1WC7A 3G6AA 3TEUA 4Q6IB 4OM1L 3D3VA 3VXTA 3TVMD 3RDTA 1GH7A 2NY4B 1WZMA 4WFGE 4IOSD 7FABL 4Y8AA 4FZ8H 1KB9K 5DYOA 1QFUL 2EKSB 4I2XB 3TN0D 4ZUWB 4JFDB 3SDAD 3L7FB 1N7ML 3IETB 4X98B 5ILTL 5D2LF 2R0ZH 3F58L 4L4VB 4UU9A 3IJYB 5GGRY 2R2CA 2V5TA 4GG8A 2XA8H 3QEGL 3UDWC 1FL6A 1X5ZA 3D6GA 4GRLC 3DX8B 4JO3L 3QIUA 4LRNL 5D1XB 5DJ0A 1UKQA 3JV6A 1XGRA 1KJ3L 1WBZB 1A4JA 4M6NH 1DVFB 5D4QA 1YEGH 5IJKC 4LSPL 3FB8B 4I3RH 2DD8H 4R0LA 3OF6D 4ODHL 4OLVH 5KSAB 4XNUH 5D8JH 3SKOA 3P11L 1TZIB 2YBRA 1BZ9A 3TLRA 2AK4A 1UB6A 2WIMA 4LVEA 4H26B 3STLA 4U1HA 1T0MB 1QP1A 4Q0XL 4F15B 2V5YA 5JLZB 5H37G 3G9AB 3VXMD 2QQQA 3NAAL 1QSVA 4XXDA 3O6FD 1AP2B 1YEFH 2NY2B 4M00A 3ULUL 4XAKD 2AEWA 1EFXD 2X6MA 1ZWIB 2P1YA 2VWEE 3LN5A 1RU9L 2CIIA 3O6ML 2VUOA 1G9EA 2AJUL 3QR2A 2AEPL 2I5YL 1KCUH 2CGRL 4Y4KB 3UZEA 5DA0B 4WHCA 5HHPA 1DN0B 3L5XH 4NFBA 1IGCL 5JW5A 2G5BA 3DRTA 5C0CB 4U1KB 2OK0H 2KKQA 3WFCH 4G3YL 4X6DB 5D1QD 4XVTL 1P4LA 2PN5A 5EFIB 4OV5B 3OTTA 4M61B 2VRAA 3HCVB 2I60L 3JWDL 5I1CL 1Z9SA 5I16A 4X6CA 3B6SB 3HUJF 5I9QC 3IDJA 1IAII 3OB0K 3FQXA 4LHQB 1F58L 3P30H 1NANH 4PLJD 4PJ9C 1R5IB 1XF4A 1A2YA 1TDQA 4KMQA 3PG2A 3HE6B 1A1NB 4UT6H 3K74B 1VFAB 2EDKA 2NW3B 2ORBL 3QFDA 4X8XA 5FA3A 5E1AB 3RGVB 4WVRA 2W92A 1HWGB 1UJTA 4X4ME 3B5HA 2E27L 1WGOA 1YN6A 1V7NH 2FDBP 4LAQH 3KPMA 1NDMB 1T04A 3WXWL 1U6AH 1INQB 4H1LH 5DJ8B 4Y4HB 2E7LC 1DUZB 4C4KO 3H42L 5DXWA 5JO5A 2L7JA 4RGNE 1MUJA 5F7EH 4HWZA 1QFWH 4P4RB 4U6YA 2JJTC 2JB5H 3CFIC 5JPMB 2PTVA 1MHEB 3EDJA 4RGNC 5IVOA 2D3VA 2BOBA 2HFGH 2ED7A 4P3CL 5HGBB 1N59A 1IBGL 1LO3H 4AEHH 1FO0A 4NZJA 3U2SB 4LARH 4LVHB 4P9ML 1FG2A 2BNRA 1RZ7L 1X3DA 3T0BA 3F7YA 1NLBL 2X09A 3DYMA 5C2BL 3N0PB 5FM4A 3QWOA 4WO4C 4JGUA 3TZVD 1EO7A 1R3IH 1YJDC 4V2BA 4NFCA 2LAAA 4DAGH 2W07A 1OQOA 1ZANH 4P57B 4ZFOA 1KB5A 1P4IH 4JFFE 3WIHA 3OKOA 5T3XL 4HWBH 1RUPH 5DZLA 1UH4A 3GMMB 3E0GA 4J1UB 4QHUA 2DDQH 1YDPB 4LBEB 3MUHL 5BCAA 3M07A 3EOBA 3QH3A 3VXPB 5LVEA 3ILQC 3HNTH 2AK1H 3QPQC 4XP4L 4GW4A 3MLYH 2DBLH 4UI2A 4YHML 5J9PA 3PP3H 4S1QL 1M05A 4M4PA 2A6KA 4MDJB 3G6DH 3P9LB 2BSTB 2F8VA 4PRBB 5CJQH 3X3FL 2VH5H 2H8PA 3CVHL 4QWWC 4RWYL 1UJ3A 3QIWB 4LP5A 4KTYA 1XIWC 3LS5L 1GSMA 2W60B 1UM4L 1YNTA 4HQQH 5IGXH 2NNAA 1VB9A 2D31B 5LBSH 5EZOL 2XKUA 5HBBA 1T1ZB 3MLXH 1SJEB 1NJ9A 4OFYD 4Q9QH 2D7TL 1NAKH 1OW0A 4NGHH 3QI9C 1XF1A 5BVJA 4KKLC 4LQFL 1J8HA 3VFSA 3P3YA 5I17A 4APQC 3U0PB 4M9OA 1EVTC 4PJIE 4A6YB 1J8KA 3MV9E 5B4MD 2OYPA 5I6XC 1OOAA 2EECA 3T3ME 1A7BA 5E6IB 4J12A 1B0RA 3GMNB 5EZJB 1ZHBA 1N8ZB 3EDKA 5EOQL 5E08H 3FAWA 1D6EB 1ACYH 2A9NH 3N06B 2GSIB 4Y16C 2H6PB 2NX5A 5DMIL 1WBXB 4XP6L 2UYLB 5DO2C 3ES6A 2X4PA 1I75A 1XGTB 1AD0B 3EFFA 5TE6H 4Z76B 2HKHH 3WLBB 4YEEA 2ILLA 1CGSL 1RZ8A 4K94C 3MROA 3U9UA 1AH1A 4N0FB 1EMTL 5B39A 1A21A 3CFCH 5C07A 1PKOA 4PUBL 1J05B 5JOFA 5IT2H 1IVLA 1F4HA 3T3PF 1CE1L 1T2QL 4N8CH 1LO0L 1MCBA 4N1HB 1IAIH 4M4RA 1W72H 3RVWD 4PRPD 1V7MH 3OX8A 4FQQA 3EOAB 3GSWA 4OGAD 3RTQD 3VRIB 2Y36H 5IFHH 3EZ8A 3O2DA 3RGHA 2A83B 1QLFA 3X11B 3QDGA 3T65B 4RA3A 2XPGB 2WMPA 5DJCA 1OQXA 4WEBH 5D7LA 5ALCH 2CMRL 2ZOKA 3Q5YA 4G6KH 1SY6L 3HMWH 4JPWH 4ELKA 3RVTC 5GSVB 5GRUL 3VFUA 4H0IA 4GRWE 3TT1H 1U8KA 4F37F 1HHKB 5ACLA 5EOCL 1BQHA 1XCTA 1BFOA 5HGGS 3FT4B 3HRPA 1BECA 1DL7L 2MWCA 1F97A 4LLMA 4MA1B 2F5BL 3UBXA 4ERSH 3PGFL 5MERB 4PV9A 1DBMH 4M8QA 1S9WB 3OKEA 5IIEB 5EIVA 2P5WB 4P2CG 2UY6A 2XG4A 3ARED 2R8SH 4P2RA 1N3NA 2C9AA 4FN0A 2R56L 1YUHB 1R0AH 3W0WA 5EC2A 4XX1E 1FBIH 1TTFA 1L9NA 5BV7B 4JPVL 5C0AD 4Z77A 2W9EL 4OFIA 3DLQR 3EJJX 2MFNA 3RY4A 3WD5H 4H0GA 4DCQB 1JK8A 2DI8A 2PYEE 1NUDA 4LSTL 4QHKJ 4WFFD 3EYOB 1A5FH 1H3VA 1HH9B 1J11A 1NBZB 3ZT7A 1MAMH 3VFWB 2HG5A 3I6LE 4ZUVA 5D1ZC 5E9DA 3REWA 3V5KB 1QFHA 2R1XB 3ZDZE 4X9IA 5EBLB 5I71C 3ZYZA 1SEBA 4RQQA 2P47B 3QWQB 5LGHL 3VDCA 1FLRH 5IB5B 4FNLL 2OL3A 3SDXB 3GSVA 5IEHA 4UOW1 1CVSC 3K8KA 4C59B 1TETH 2YD1A 1UM6L 43CAB 3Q0HA 1MFEH 4OI9A 5C0DB 1ORQB 4BH8A 1YNKL 8FABB 1HHJA 4XPAH 3SKJH 3CSGA 3QHZL 3P4MB 3DO3A 1F4WH 2HRLA 3OKMA 1G7QB 2X4OB 4RBPH 3VI3E 1ZS8B 1JTTA 4PJHF 4Y4FC 4ZPTB 1YEIH 2DWEA 4FFWD 1HN1A 2ZSVB 1G9MC 3C60C 3KPLB 1P7QA 4M02A 4I77L 3TBSA 1P1ZB 5CILH 2GJ6D 4OZ4A 1FSKB 4WU5A 1BJ8A 1X7QB 3EGSA 3GMLB 1VCAA 4PREA 5B38A 2A77L 5LWYL 2I24N 1ZLSH 1NFDB 3MLWH 1JWMA 1AXTH 3HLAA 4JQVC 2AV1B 3WNLA 5I1DB 2EIZB 3PV7A 4J3SA 2VXQH 4XPFL 3V4VL 3MLTA 4YBHA 5F7WC 4M3JA 2JIXA 4XCCL 3QXAB 5EWIH 4Z18A 3S6CA 4F9LC 3TP4A 2NXZB 3FOLA 1R3HA 4IJ3C 4GG6E 3QDJA 3U4EB 4HKBA 1CGXA 4PRAA 4RDQF 2XZQL 1HWHB 1MFAL 4IRJA 5GS0C 3U30B 1IT9H 3RUGB 3SGKA 4P23C 3TBWB 1S7RB 3F5WB 1WSST 3HZYA 2EYTB 4NQCA 5D72H 1GC1L 1I1YA 4RIRA 1NCWH 5C08B 4HJJL 2HFFA 3QDMD 4JM4H 1OGTA 1UC6A 4KPHH 4ZS6D 3LKSB 3DUSB 1ADQA 4PTTA 2AJZB 4Z8FH 4NNPL 4RMRA 4G6JH 2Z93A 3R4DA 5I2IB 4LLWB 3L3IA 4TVSa 3JTTB 5IK3B 3BD3A 1TJGH 2A6DA 2Y9RT 5I1JH 5HYIA 3UTTB 4X80H 4XMKL 4NWTH 2D03L 4X5XA 4OT1L 3FB7A 3T2PA 4U7MA 3W82A 3L3OA 4IIQC 4AJ0A 4F8QA 5I30L 4MZ3A 5KSVA 2KZ1B 4JRYD 2VMFA 1K6QL 2PW2B 3UDWA 3DIFB 4JO4L 2KUTA 3UAJD 4GRLA 2P24B 4HMDA 5GGTL 5E5MB 3I6KB 4OCYH 3G08A 3WNMA 4PJ5A 1JGVH 3O45A 1MHHA 5IJKA 5DLMH 3FQWB 3UTQA 4EXPX 1XR8A 4EN3B 3H9HA 1IGIH 4G80B 4UBDC 3GMPB 5IB3A 5I18H 2SEBB 4B50A 5DRNA 4PRNA 5IUSA 3WHE0 4MCYA 1IARB 3SE9H 1XCQB 3O9WC 4K7FB 1F6FB 1MCWM 3Q3GB 5ICXB 1RZJL 1AGFB 3CVHB 3M17A 4HK0A 3BEWB 4PGBA 1DFBH 5AZEH 1A6AA 2C4FU 1S7UB 3PHOB 3TWCL 4YXHL 1QLEH 3JV4B 1MJJB 3WIHL 1Y0LB 4DUWA 5D93B 3VRLE 3N85H 1JE6A 1CE6A 3CXDL 2NY3B 3IKCB 1LK2B 2QADB 4XMLL 2HH0L 4MNHA 3TFKD 3LDBC 2L4OA 4NRXB 3REVB 3CK0L 2IADB 3BQUC 1WEJH 3F7VB 5M94B 2WBJB 3VWJB 3F7RA 3FHQA 1N4XH 3MREA 3HZVB 3BVNA 4HBCH 3Q6GL 5L8LB 2CR6A 3T4AA 3MLVH 1KLUB 4JCLA 4EI6A 1QSFA 4OQTH 4U1JB 3T0VA 5F71A 4AIZB 5CIPA 4FTVA 1TZGL 3GMRA 4MMXC 3WFDH 2D4FA 3WE6A 2MJWA 4W4NA 3EHBC 1KOAA 5KSBA 1L0QA 1I7ZB 1MCLA 3BT2H 2ZKHH 1JJUA 4OLYL 1INEH 1LDPL 4MNQD 5D7IB 4PJDB 3EYQC 5F9WB 1SBBA 4J6RH 5LCVL 4WDIA 4P2YA 2G60L 2F53A 4HS8H 3K7UA 4JHZA 2E7LA 2HJLA 4BSVB 4TSAH 5F72S 4FMKA 1MOEA 2QJDA 1CLOH 5DEFA 5DI8A 1HIML 4FXGB 3VFOB 2AJSH 1CDUA 4M7LT 2P8PB 1D5ZA 4LLAA 4P4KD 4QRRA 2JJTA 3D18B 4NCC1 3R1GH 1KCKA 5E2WL 1AXIB 3PGCB 3MBEA 2EDRA 3IXTB 3HAEB 4D9LH 5ACMA 1U42A 3B9AA 4PS4L 3RWJA 4WJ5A 4BYHA 1IL1A 4M5YL 2WWMC 1DQJA 5JPNB 4WI4A 4C54A 3IFLH 2BNQA 1J0IA 1H0DA 4PJEA 3V6FB 4PJ8C 5LQBH 2HVJB 3OPZH 2GJJA 1K4DA 4NWUH 4PRIA 1KIRA 3GSNA 1RIHH 4X5WA 4JPIA 4V2CB 5EU6D 4WO4A 4NM4H 1ITCA 4QHMA 2C26A 3GIVA 3EOTH 1G7LA 2O5ZL 4DVRH 3N1MC 4QRPE 3B9KA 1A6WH 3QP3A 5B8CC 4J3WA 3WO4C 1JGDA 1VGKB 2XV6B 4WHDA 3PWPA 2M26A 4NQEA 1ZTXL 2E8ZA 3RL1B 3VFPB 1T5XB 2J5LC 4L9LC 4DKEH 5ETUA 3CFDB 3HC0B 1YEKL 1IFHH 4HFUH 4PJAF 5HYSB 3E3QE 2J8UA 1IEAB 2XNAA 2CKBB 1NDGB 1WC7B 4MA8H 3G6AB 4XCFL 2AEIT 3VXTB 1NAMA 2UVEA 1VESA 3RDTB 1G6VK 3LSOA 1LP9F 1RMFH 3IDYB 1C1EL 4JHWL 2GI7A 3QBTB 1HXYA 5DYOB 1U8PA 5DVKA 3U7WH 5GISL 4DN4L 1XIWA 4QRTA 35C8H 5JXED 1LO2H 3G5YB 4MQ7A 5DD3L 3AMKA 1HSAA 4UU9B 1BFSA 4X8JA 4GG8B 3UCRA 3EO0A 3VWKD 1FNAA 3FFCD 3QI9A 5EA0L 2R2EB 4W6XB 1FL6B 4HWEL 4E0RA 5HYJB 1T1YA 3QIUB 1J1PH 3RVUD 3E8UL 5DJ0B 1MFDH 3JV6B 2IPKA 1QLRA 1XGRB 4PV8A 1A4JB 2NLJA 1FNGA 1J7VR 4R0LB 2CK2A 4OJFH 3GSRB 3SKOB 4AEFA 4Z7OF 4U1MA 4R97B 1BZ9B 5J3HC 1BEYL 4JM2C 1I3UA 2AK4B 1UB6B 3STLB 3GMQA 4U1HB 2DLFL 3HTLX 4OF7A 4Z7NF 1KULA 4HJGA 1KGCD 3IDGA 3TCXA 1JWSA 4PRDA 3K46A 4TN9A 1DQTA 1JL8A 3MQIA 1T7VA 3VXSA 3KPRA 3LN5B 2CIIB 1QYGH 5EBMA 5E70A 4MAYC 5DUBB 1X5FA 3WMSA 2ZUWA 2B2XH 1JTPA 5HHPB 1CD0A 3DSFL 1PY9A 5EO1A 3HR5A 1UT9A 1CGUA 4QRSA 5JW5B 3UJJL 2R0KL 4TPRH 4PJBA 2R69L 3MRHA 4PPTA 5J4MA 3HE7A 4PR5A 4R8WH 1OGAA 4XNZC 2PXYC 5HHXH 1FVCA 1P4LB 4LSRL 1NC4D 3HZKA 4FFVC 2O5YH 1U3HC 5D70H 4KK6D 5I15L 1NKRA 2FECL 1IKNC 1GPOL 2YRPA 5I16B 5J13C 3CSBA 1B4JH 3IDJB 3AMLA 3FQXB 1PFCA 5CMAA 1M7DB 5E00A 4FP8L 3L1OL 1XF4B 1A2YB 1X4ZA 1P5UA 3J8F7 2IALB 1CGYA 4KGJA 4KJWC 4JREB 1CBVL 3DMMD 1JHLH 3QFDB 2P5EA 2XFXA 3NIGF 3HKFA 1U2HA 4MJ6A 3MV7E 1FGVH 1YN6B 4GBXA 1MF2H 2FX9H 3KPMB 5FGBA 3I50H 1T04B 1U8NB 2VDRH 3O2VH 1RY7B 4ACPA 5ADOH 3RWEA 2IPTL 4X9FA 4MDIA 4NUGL 1OAXL 1T83C 4JLRA 4K23H 2BCKA 4BK5A 5HJ3A 2NY6D 4UT9L 3I6GA 5JO5B 3V7MA 1BQLH 3C5SA 3H3PL 3H7BA 4S1DC 1MUJB 4HWZB 3C5ZB 4P59L 3WSQL 4U6YB 3VFNA 3VXUA 1HINH 4P5TC 2F19H 1AIFA 5C6TL 3NCJL 1KFAL 3LY6A 3VG9B 1MWAL 3UROR 3ZTNH 2DLGA 2BOBB 4X7FC 5D1ZA 2EDEA 1OB1A 4CAGA 5MEPA 2XA3A 1N59B 3VH8G 5C8JB 1DCLA 1FG2B 1GVIA 2BNRB 1RIUH 1L7IL 2J6EH 3JSSA 5CJ8A 3F7YB 4ELME 1MRCH 2R4RL 3K4DA 1D5MB 4NZRH 2VUYA 1RVFL 3QWOB 5L2KA 4ZFOB 4KKBC 5ICYA 4NO3A 4LLVA 4MLSA 2GHWB 4YE4L 1TITA 3ESVF 1PG7X 1G84A 4QHUB 2HT2D 1NGPL 2AXFA 3DXAA 3MRIA 1X6LA 4U1SA 3GUTA 3EOBB 4PJFE 4UIKH 3HNVL 4YDKL 3U1SL 1A64A 3PDOB 4JDZA 1T20A 4GW4B 4Y4FA 3M8OL 1QPXA 1MIEL 5J9PB 3GFUA 1M05B 2A6KB 1V05A 3HC4L 3BRGC 3KVQA 1YECL 2Q1EA 2IAMC 2YWZA 3GK8L 3U9PL 2ZG1A 3MRRA 2HKFH 2H8PB 4ZFFA 1UKSA 1UJ3B 3SE8L 4AEEA 4NO0A 2EDBA 1K9TA 3PDDA 2F5AL 4LMQI 3TBVA 2ADGB 3KR3H 1YNTB 3BZFA 4PLKD 1U58B 2NNAB 3V7AE 3BD5A 3VGAC 1CICD 3LZFL 2NXYC 3CGTA 5DD0H 4FA8A 5IEKA 3T0EC 4LCWD 4F9LA 2Z31A 4M7ZB 2YUVA 3IU4H 2UWEA 3FKUS 1I8MA 3BN9C 5BVJB 4Z7VA 1J8HB 3QIBC 3VFSB 4CBPA 5I17B 3S36L 1NSNH 1K8IB 1ZHBB 5I8KH 4X7DC 4K8RC 4U0RB 3ZYOA 3JWOH 5JIKA 2VAAA 1B90A 1YQ2A 5F89A 5GHWH 3T4YA 3ES6B 3MGTA 1GGCH 3EFFB 3TNMA 5MENB 4IRZL 1I7RA 4MXWL 1QG3A 4WU7A 1RZ8B 1S7VA 4TRPL 2E7CA 1H5BC 3U9UB 1YC7A 5B39B 1AO7A 2IG2H 2NY4D 5EUOA 5HI4C 4MS8C 3PQYA 5FHAL 5C07B 3BD4A 5IHZA 1OLZA 3PWLA 4A6YH 4OGZA 4ONGL 3SEPA 5AYUL 3RUGF 4U31A 1OAYH 2X9YA 3OJMB 1QFOA 1AQKH 3QDME 4NNYA 4IIQA 1J88A 2VXSH 1MREL 5FUZL 3QUML 4R90H 1HNGA 3OX8B 1XR9A 1ZLWH 4FQQB 1CDYA 4TUKL 3GSWB 4ZUSA 2KDGA 1U91A 4O9HH 2DJUA 1QLFB 4GKNA 4J7RA 2AQ1A 4GO6B 4HUXA 3QDGB 2OS7A 2DTML 5DJCB 2ZUQC 2DL9A 2C5DC 4O2EA 1I9RH 3AUVA 1FAKT 4O2CA 1KEGH 1DVFD 3MNWA 4EJ1C 3ZKNC 5D7LB 4NKOA 1YEJH 3NGBB 3C08L 3ARBC 3G6JA 1PG7H 4ELKB 4YAQA 3D39D 4IMLA 1OCWL 4E41D 1CD1A 2MMXA 1FN4A 3SDDA 3VFUB 3TPUA 1IQDA 3O9WA 1U8KB 1I3VA 2Q20A 2Z9TA 2X89D 1VEOA 2DKSA 2AJYL 1BQHB 2OTWA 1XCTB 4Y1AD 5FO9A 1BFOB 5T1KA 2CO7B 2R0WL 3T2QA 3P4NB 3NVQA 3N50A 1RZKC 1KN4H 3ARZA 3ECBA 4LLMB 1YJDL 4NUJA 1Q9OA 4HAFA 3UBXB 5GGSY 4PV9B 1KCVH 4M8QB 3QA3A 3OKEB 4Z7WB 3BZEA 5C9KA 4F2MA 3UTPD 1YQVL 3BP6A 4P2RB 1UWXH 2NY0D 3RZCA 1MQ8A 4Q9CA 3W0WB 2APWA 3L3HA 4N5EC 4OM1H 3CIQA 5C0CD 3D2UD 4Z77B 2WNGA 4R7NA 5MEQA 3HUJE 3QNXB 5T3ZE 1JK8B 3ARWA 7FABH 1QFUH 3RWIA 2HG5B 4ZAKA 4MHHI 4HH8A 5ILTH 4WFED 3LH2L 5E9DB 3CFEA 1D6VL 1WFNA 2QR0A 3F58H 1I1AD 2QLVB 1U2CA 1OSZA 1SEBB 4OZHA 3LRSA 2B39A 4JO3H 1ZV5A 4LRNH 2OL3B 5EBWA 3GSVB 2R0LH 5IEHB 5BV7H 3RZWA 5E2JA 4EUPA 1U93A 2DQGL 4LSPH 4HKJB 5CEYA 4JR9L 4BH8B 2FBJL 4ODHH 3W2DL 1HHJB 1CG9A 3P11H 3QEQD 3BPNC 1HHGB 1SMAA 4JFQA 3L6FA 4NQDE 4NT6A 1Z9OA 1FLTX 3OKMB 4MNQE 4Q0XH 3OKKA 4MXVF 3B9VA 3B2VL 4X7TA 3S97C 3NAAH 4QKXB 5DRXA 5I1AA 1P7QB 3MLRL 4N0YL 3TBSB 3ULUH 2RAMA 4OZ4B 1Z3GL 5K93A 4CNIA 1RU9H 3O6MH 3I02A 2V2TA 4PJDF 4PREB 2AJUH 5TJWK 3UTOA 2AEPH 5F8RC 4K94L 5ESAA 3NIFF 3QO0A 2I5YH 2HFTA 1JWMB 2CGRH 3VGGA 3HLAB 4K3DL 2GY7B 1A22B 1J1OH 1IGCH 4PRHD 3QUKA 2FX7H 5E56A 3MLTB 2PNDA 2JIXB 5GGUA 5ISZA 1ZLUH 3UTZA 4DW2L 5ITBH 1AR2A 4G3YH 3V0WL 4KJQD 5DJDA 3K3QA 4JFZL 4MJIE 3FOLB 3NPSC 1R3HB 3VD7A 3PL6D 2I60H 5DK3A 5B8CA 3CVIL 1NBVL 4HKBB 1J5OL 1A7PL 1K3ZA 1WUNT 4PRAB 4L4JA 2DOCA 4IRJB 4WTZG 5I74C 3MRCA 2YA0A 1F58H 5KANI 3BYYA 1ZA6A 4P2QD 2PW1A 4L9LA 1S7XA 3RWGA 5H2BA 3HZYB 4NQCB 2BHUA 2G5RA 3GI8L 1I1YB 4RIRB 3BIBX 4LSQL 2ORBH 1C08A 1MJ7L 2OX5A 4HGWB 4PJ7F 3CH8A 2HTKD 4KRPD 1CFSA 1OGTB 4NPYB 2VXVL 5D7JC 2IAND 3S37H 2E27H 3KXFA 4N1EA 4AL8L 4CUCA 3RPKA 1G6RL 4L8SC 3WXWH 4Z5RB 3D9AL 1EBPA 4XHJC 5CGYD 2CDEA 4X5XB 3QJFA 5BRZA 4AEIL 2VLKA 4EI5D 3L3OB 3H42H 5I8CA 3CZJA 3VXRA 5KSVB 4YLQT 3VXNB 5C0FA 4GRLB 4J3TA 4Y19E 5LXGL 3KYMA 3G08B 4PJ5B 2MCG1 2Y07L 1ZAGA 1OT1A 2GFBA 5C6PB 1MHHB 4KKCD 3UTQB 2XZZA 4P3CH 3H9HB 4LIQE 1WBYA 1IBGH 5IB3B 5E6ID 5CBAA 5EZIL 5I76A 4P9MH 5DRNB 4PRNB 3MJGX 4X99B 1RZ7H 4UQ2A 4FQXA 4MCYB 2D4DA 1NLBH 5L8JB 2WAHA 3PGDA 1NGQL 4F58L 1C12B 3BKCL 2COQA 2D7QA 1JN6A 3M17B 2H32H 2W0KA 2NY7H 5FKPB 5JQ6L 4QF1A 3DVFA 1Q0XL 3RY6C 2C3VA 4WI8A 3S5LG 1OAKL 1KGCE 4PTUA 2NTSP 4R9HA 4XP4H 4NBYB 5FYLE 4XP1L 4YHMH 2AGJL 1URLA 4S1QH 3U6RA 5HI3D 3SJVE 4MQSB 3X3FH 2RHEA 1G9ML 3CVHH 4DJMA 3MREB 1EXUA 4RWYH 3BVNB 1IKNA 2X1WL 4WI9A 3T4AB 4CADA 5KVDL 5I9QB 3LS5H 5EZLA 1UM4H 4EI6B 1QSFB 1EJ6A 2B1HL 2CXKA 4R7DA 4YWGL 2F54A 1ES0A 3KLAB 5EZOH 5CIPB 3SGJC 3K2UL 3VGHA 1CWVA 2D7TH 3H3KA 1F4AA 5HD8D 4NRZA 1KTDA 4L1DA 5KSBB 2BVPB 4C4KT 4LQFH 5KJRL 3L3GA 4WDIB 1KXVC 1YMHA 1YMMA 2WUCL 1ZLVK 4QOKA 3HZMA 5EOQH 3QUXC 1KG0B 2F53B 4X6CF 3V95A 3VH8A 3MCKA 2HJLB 5IBLC 5DMIH 1ZHKB 3ELAT 1A3QA 4LSUH 4NBZB 4O5LL 1S78D 1TTUA 1OPGL 4OCWL 1OP5K 5DI8B 1D5ZB 2BMKA 4JHBA 4AZ8A 4QRRB 2VLME 4N90D 1CGSH 4XC1L 1SVZA 4P5TA 1EMTH 4HD9A 1SYSB 2LFGA 5MHSE 3NCEB 3Q5TA 3MBEB 3LQZA 1P6AB 3BH8A 4HWNA 1T2QH 2VDPL 4WJ5B 1LO0H 2V7NA 1IL1B 2ESVE 1DQJB 1BJ1H 1JHTA 3WYRA 3BKYL 1H0DB 3UTSA 5IVXA 1UWGH 4PJEB 2DYPA 4YDIL 4JFXA 2PO6A 3ARGD 1K4DB 4PRIB 5JW4Q 1KIRB 3GSNB 4X5WB 4YDVA 4JPIB 4ZOBA 4FFYL 4ZOEA 3T1WA 4WO4B 4QHMB 3GIVB 2HMID 5KSUA 4B7LA 4QTHA 1JGLL 4JFED 3K2MC 5F21B 3B9KB 5CJOL 2NZ9D 2CMRH 3ILPA 1SY6H 3VFVB 5ABDE 2FRGP 4J3VA 2F8XC 4UB0L 3PWPB 4PJHE 5FM5O 5GRUH 3SN6N 3H9SA 5ETUB 4JVUA 3GIZL 3KJ4C 1ZT4A 5EOCH 4PGCB 4EIGB 4I3SL 5HHMD 2J8UB 1G7JA 2XNAB 3EBAA 3DRQA 4DKFL 1MLCA 1NAMB 3LSOB 2NYYD 1HHIA 5ACZA 3BI9X 2DBJA 1HXYB 2F5BH 1U8PB 1OTTC 1YNLL 3PGFH 4YNYA 3HI6L 1LE9A 1L6XA 1XIWB 1HEZA 3KPSE 4QRTB 5B3JF 4JJ5A 1QRNA 1RJZA 3KYAA 3ROLB 2R56H 1MNUL 1HSAB 2C1OA 5DR5L 4UAOC 4X8JB 4JPVH 5C0IA 2C4FT 3T0EA 3EO0B 3QI9B 2EIEA 1X5IA 5K9QI 4E0RB 1BIIA 2CKBH 1GOGA 4LSTH 5MI0C 2NXZD 4APQB 2IPKB 1QLRB 4PV8B 5I6XB 2NLJB 4QHLA 1FNGB 2YR3A 2W91A 2I9LA 4ZQKA 2GK0B 4C57C 3ARUA 4KV5F 4G8GD 4U1MB 5E2VL 3NZ8A 1MJUL 2LAGB 4PLNC 3GMQB 5C0NC 3SPVB 5LGHH 5JHDD 4FNLH 1MI5A 4HJGB 4P48A 4PRDB 3RWHA 4BH7A 1UM6H 4OM0L 2W65A 1XF5A 4C56A 2FJFA 1H5BA 2BC4A 4BFIA 2J4WL 1YNKH 1C7TA 3VXSB 3U48A 5DD5L 4FFZH 2Z92B 3QAZC 5EBMB 1QFPA 3TT3L 3A67L 4RDQG 3ULVF 1FZJA 3QHZH 5D2LA 1A3RL 4GRMA 5HPOA 3WS6C 5BMFL 3MLSH 5EO1B 3HR5B 2RIKA 4ZFZA 5M95B 2VN4A 4QRSB 2OLDA 4PJBB 5HGAA 5SWSD 3MGAA 1MY7A 1KYOJ 4I2XE 4ZUTA 4PR5B 1OGAB 3QUZD 4JFDE 5T3XD 1FVCB 3AY4C 1F8TL 4XP5H 2A77H 3HZKB 4KTDL 5LWYH 4R2GC 4KVNL 1UVQB 4UV7L 1U8LA 1LE5A 4L4VE 4ZO6A 5BS0A 5C0RL 4XPFH 3EYUL 3V4VH 4MYWB 4XCCH 3CLEL 3UZVB 3S34L 5C86A 3RX5A 2Y6SC 1IMHC 3RVXC 3VJ6B 4HHAA 3T08A 4N0CC 2P5EB 2XFXB 1ZHLA 3C6LD 4MJ6B 4ZXBD 2XZQH 1MFAH 4ZMAT 4ONFL 3RX8A 1WT5C 3QNYA 2Q8AL 5GZOC 4F37K 3FN9A 3V6ZA 3ZTJG 3RWEB 5KTEH 5KSAC 1GC1H 4JLRB 2L7UA 2DN7A 2BCKB 2WLYA 1QKZL 3I6GB 4HJJH 3C5SB 3H7BB 4H5SA 3EYFA 4UDTA 1WCQA 4QCIB 5DMKA 4F15C 4NNPH 5JQHC 4K71B 2AJ3A 4OF8A 5GJTH 3VFNB 3VXUB 4AM0B 4PJCF 1AIFB 1QBML 3JBG7 2NY2C 2HRPL 5GRZA 1QSED 3HPJA 2X4TA 4LCUA 4XMKH 5D1ZB 5JMOC 2JELH 2D03H 3ZT6A 3LEXA 5I30H 5KAQG 2D7PA 2OP4L 5CUSL 1AR1C 3DO7A 2ED9A 5I71B 1K6QH 1JNJA 1BBJA 4X6DE 2V2XA 4Y4KC 1IKFL 4EVNA 3LV3A 3TVMC 4ODTL 5LGKA 5SWZD 1F3JA 4JO4H 4LCIL 4XWOD 3MOBL 4KU1A 2ARWA 1PSKL 3K8MA 2ZUXA 3GRWL 4JDTH 3TN0C 3SDAC 7CGTA 3ETBF 5L2KB 5CSBA 3BN3B 4U1LA 4NO3B 5ICYB 2DAVA 4LLVB 4XNMA 3X3GL 2VITA 2D9CA 4D9QD 4YXLL 2X41A 4MX7A 2AXFB 3DXAB 3MRIB 4U1SB 3F62A 3GUTB 5AYQA 1VACA 4PY8I 3S4SG 1A02N 4JDZB 1T20B 4Y4FB 5DS8A 1RZJH 3U83A 3OBAA 4ZOCA 4EDXA 4JO1H 5JA8B 1F00I 3TWCH 4MAUL 4YXHH 2XWJA 3K4ZA 4L4TB 3CFJA 4ZFFB 3GNML 1NBYA 1N26A 1RJLA 4NO0B 4A2LA 3WIHH 4AQ1B 1O7SA 5IBTL 1ZSDA 4WHYG 3O4LD 3CXDH 3TBVB 3D48R 3BZFB 4HIHA 4XMLH 2HH0H 4XWGL 3UZQA 4Y4HC 3CK0H 3VCLA 3O6FC 1R5VA 3FONA 4V1DD 4GSDL 5EIIA 1QUNA 1ZT7A 1T2XA 1IILE 2ICWB 2UWEB 2EEBA 1I8MB 5KOVC 1F3DJ 2XA8L 4IJ3B 4Z7VB 1KCRL 1IAKA 3Q6GH 1KCLA 2FO4A 1A7NL 3MRJA 3EKCA 4P23B 4M6NL 1Q72L 2H2SD 2GIYA 1PD6A 2OZ4L 3TBTA 1T0PB 2VAAB 4KH2A 1TZGH 4WUUA 5DMGD 4ZSOA 4XNUL 2ID5A 3P2TA 1DBKL 5D1QC 3BDYL 4MXQC 3T4YB 2EDWA 4OLYH 1RUKH 3TNMB 1LDPH 1AJ7H 2I9TA 1I7RB 2N1KA 5DTFB 4WU7B 2FEDC 1S7VB 2BY0A 1AO7B 1WK0A 4HUNB 5EUOB 4L8SA 2G60H 4S0SD 5IHZB 1IGJA 2R4SL 3QFJD 4PLJC 5FA4A 3PWLB 1IEBA 5I1HL 2H2PD 2OTUB 2XKSA 3AROA 4NNYB 4IIQB 3U79A 2XN9D 1YY8A 4LASL 2YRLA 1XR9B 4ENED 5T1LA 4MD5A 4ZUSB 3L5XL 5KS9F 5E2WH 4GKNB 4HUXB 2JKXA 4OKDA 4BFBD 5HYJD 4XNXL 1KENL 5E5UB 1JCKA 1KJ2L 4KI5F 3GZKA 3ARTA 1VSCA 2EXYD 4O2EB 3M1BA 5E8NA 3RKPA 4O2CB 3MNWB 4PS4H 2PCPA 4G9FD 4F7TA 2UUDK 5C09A 2YMXL 5INCA 1DEEA 2AKRA 4M5YH 4U1IA 2MCPL 3WXVL 3G6JB 4Z7NE 1CLZL 1RHHA 3QIWC 2BZDA 2FBOJ 2HA1A 4IMLB 1WCBA 1CD1B 3SDDB 3TPUB 1IQDB 3O9WB 4YHZH 5FYJH 3WFZA 4EKXA 2YPLD 1JZ5A 2OTWB 2O5ZH 3JTSA 1BD2D 5FO9B 4WI6A 3ALXA 5T1KB 5ENWA 3IFPA 3EJYC 4HDIA 4JY5L 2APBA 3MUGB 3ECBB 4GUPA 5D5MF 4PP2A 3V6OE 4NUJB 1T2JA 1Q9OB 1VKXA 2BVOA 1ZTXH 1KIPA 3QA3B 5JORA 4RGMC 3BZEB 3VI4F 4F2MB 3BP6B 1YEKH 1U6AL 1MFBL 4OCLC 3RZCB 5HHOA 3LDBB 3CH1A 1OHQA 3L3HB 4XCFH 1UXSA 4R7NB 1WFUA 5MEQB 3B43A 1UEYA 1C1EH 1LHZA 1WAAE 4JHWH 4JZNA 3SDCD 3HG1A 3RWIB 4DN4H 4ZAKB 1CQYA 1MCNA 5KZCB 1LK3L 3B5GA 4QXWA 3CFEB 5DD3H 2QR0B 1T66D 1M4KA 5C6WH 3NIGE 1OSZB 5GRXG 3IDUA 1KELH 4OZHB 5A3IC 5EA0H 4LARL 3IFOA 3LRSB 2A0LD 3TO4A 4UQ3A 4F3FA 3E8UH 4OZIF 4EUPB 3OKYA 1VA9A 3U82B 4OF6A 4BELD 5CEYB 3QEHA 8CGTA 2ZUTA 3DYOA 3QUXA 4XI5C 5E6ZA 1CG9B 4XTRC 5E8EA 1B2WH 4YC2C 4TNVK 3AFLA 1BEYH 1RUPL 4JFQB 4U2ZA 3L6FB 2VSDA 1OP3K 2DLFH 5EO9B 4K8RL 2VLJD 2A74A 5IMLA 3OKKB 4PJXF 4XRCA 4X7TB 5B22A 4YFEA 3MRKA 2AK1L 5DRXB 3QUYD 3NH7L 5F6HJ 5CEZD 5KSBF 3C5ZD 3MLYL 4YBLC 1MPAH 4CNIB 3I02B 2V2TB 2VLRA 4XBGA 2P5WE 3KGRA 5HDBE 5ESAB 4HLZG 4P2OD 3C6SA 3QO0B 3MRGA 3S88L 3F12A 4JO2L 2W9LA 3RNQB 1JPTH 1V3MA 3DSFH 3QUKB 1NFIA 3K81A 4H20L 3UJJH 2R0KH 4PJ8B 1CIDA 5GGUB 2R69H 5ISZB 4HQQL 1AGBA 3UTZB 3VFGL 5I0ZA 1P9MA 1JYWA 5DJDB 4LSRH 3MLXL 3TNNB 3BPCA 3O11A 3DETC 5I15H 2E6QA 5B8CB 1GPOH 2PYFA 4JG1L 5CJXC 3WO4B 3MRCB 1ZA6B 3NABL 2PW1B 4FP8H 4L9LB 3L1OH 5I73C 3ULUE 1S7XB 3IDMB 4OGAC 5H2BB 3RWGB 1FNEA 2HJKA 3SDXE 1ACYL 1MFNA 1CBVH 1CFSB 3LKRA 2WP3T 3S36X 4Z78A 3KXFB 5E94A 3PIQA 4HZAA 1RZKL 3T8XA 2IPTH 3CFCL 4NUGH 1OAXH 3QJFB 4CVXA 5I8CB 3VXRB 4U05A 4LLQA 3H3PH 1I1FA 4XXCA 1E28A 2AJVL 1Q9KB 4HIEA 3RAJL 4P59H 2IMNA 5C0FB 3WSQH 5C6TH 5L2JA 4LSSL 2VAJA 1W8OA 3NCJH 3BEVA 3KYMB 5EBGA 1KFAH 1NFDE 2PYEA 2GFBB 1MWAH 2ADJA 3RU8L 1FSKC 5D6CB 2RB8A 1WBYB 4Z7UA 4NQTA 5CINH 5ALCL 4FG6D 5I76B 4QT5B 5T3ZL 2K1MA 1KB9J 4JPWL 1K5NA 1L7IH 2BXZA 2R4RH 5J6GB 1MCRA 3PGDB 3KNBA 1HCFX 2CRZA 1RVFH 1MAKA 5H37H 1KV3A 1B9ZA 2R29L 3VU2A 5AD0A 5MEND 3BWUC 1JN6B 3RUGE 4MVBC 4MD4A 3RA7H 4YE4H 1YEEL 1JZ3A 2AXGA 4WFHE 1NGPH 4WGVB 4LP4A 4MAYB 2C3VB 3DX7A 3U30C 2JE8A 4I13B 5B21A 1BOYA 3ZDXF 3WS6A 4YDKH 3HNVH 4PTUB 5C08E 5DEGA 3U1SH 2QHRL 4CVWA 4NC0B 3M8OH 4XVSL 5DEZA 5DDHA 2R8SL 5D7KE 1MIEH 1JUFA 2H41A 5JOEA 5CSZA 3PABA 2DQCL 3U6RB 3HC4H 4OLXL 1YECH 2PXYB 3AY4A 4D3CL 3U9PH 4W68A 1NKOA 3ZLQC 4KTEL 3UTTE 1EXUB 2J3SA 3LD8C 3SE8H 2EC8A 2JJVA 4H1LG 4PP1D 4CADB 2ZUSA 3LKOA 2F5AH 1J0JA 5EZLB 2BHYA 1IGTA 1I8KA 5E6YA 4R7DB 2F54B 1ES0B 3LZFH 4YR6A 4FFWC 3N9GL 4ZODA 1S5HB 5DURB 4ZUUB 4NRZB 1KTDB 4QXTA 5DC9B 2XKNA 2VQ1B 3QULA 4NBXB 1T6VN 2BFVL 5E4IA 3L3GB 3S36H 4TQEL 4XNQA 4LHJB 3R06A 1YMHB 5FV1L 1A47A 4WIQA 4QOKB 5C7XL 4KHTH 4PJGA 5JZ7C 4EN3C 1DJSA 3ZYIA 3VH8B 4OV6F 4U0QB 1UCBH 3U36B 2CDGA 2QQNH 5IB1B 2HLFD 5CIPH 2FD6L 4YQXH 4IRZH 5F7FA 1S7TB 4MXWH 3W0WD 3RFZC 1S9XA 3DUUA 2FYYA 4P5TB 4TRPH 3SCMC 4L3EA 4FQLL 5FHAH 1N5YL 1JNHA 3B2UD 4POZD 3LQZB 4ONGH 5AYUH 3BMVA 1OVZA 4X4YB 2V7NB 1KCSL 2H3NB 2VZVA 4N1CA 1XZ0B 4TTDD 1MREH 3K4AA 5FUZH 4GAFB 3S4SA 1FZOA 3TVMA 3UTSB 5IVXB 2GJZA 2DYPB 3CLFL 4JFXB 3UPAA 2PO6B 5AUMA 2QADC 4YDVB 1NEZG 2OI9C 3TN0A 4OCRL 5ID1A 2DTMH 3SDAA 5KSUB 4QTHB 4KK9C 4ALAL 1VFMA 2WBJC 4IRSC 2D7MA 2FIRT 3C08H 2PTUA 3ILPB 4JKKA 1JWUA 3H9YA 4M1GL 4CU6A 4JRXE 1OCWH 3NA4A 3H9SB 1PJ9A 1N2RA 4RAVA 3UAJC 1FAIL 1EHXA 4KDTC 1ZT4B 2ICEA 2XQBL 5D7IE 2AJYH 4PJDE 1G7JB 3WKNA 4Z6AT 1JPSL 4LIQL 2R0WH 2IH3A 4D9QE 1T7XA 5ACZB 3OF6A 1YJDH 2CLRA 2X40A 4XBEL 1YYLH 3MV8D 5C0EB 4YNYB 4Z8FL 5F9WC 3LEYL 1LE9B 3TA3D 1HEZB 1YQVH 2FWOA 4JJ5B 2DM4A 4GKZA 4S1RH 1QRNB 1Q94A 1RJZB 3VGAB 3VXMA 2C1OB 3O6FA 1FV1A 2OR9L 2X1QA 2WM0A 1R5WA 5C0IB 3T0EB 3ARDD 1EFXA 2C3WA 5CP7A 1BIIB 4IOFC 2VIRA 1RAMA 3CX5K 5DQDL 2DIAA 4X9BA 2P45B 4XT1C 4QHLB 2DQFA 4U6TA 4OCYL 3C9NA 5FYLL 1JGVL 2I9LB 3LH2H 2X7LA 1D6VH 4ZQKB 1TXKA 3FB6A 1IAMA 4S11A 3NZ8B 3FN3A 1I3GL 5A43C 5D1QA 1ZVSB 1UCTA 3RNKA 4PJAA 5J0BA 1R3LA 1MI5B 5DSCA 1KNOA 4QEGA 3RWHB 4BH7B 4C56B 2DQGH 1XF5B 2W65B 1LP9A 1H5BB 2BC4B 4BFIB 4JFHD 1N6VA 4JR9H 3OKNA 3W2DH 4P5MA 3ZDYF 4LSVL 1B88A 3DV4B 1MHPL 2OJZL 3IDNA 3LN4A 3G5XA 4HXAL 4HZLA 4R4ND 3HAEG 1U8HA 4GS7C 1FZJB 4OUUA 5D2LB 3P0GB 4NHCL 4GRMB 4WFGD 3B2VH 2GT9A 3T04D 3D3VE 4OB5H 4J3XA 4GXUM 5HGAB 2ICWI 2VABA 3MLRH 4N0YH 4OD2A 1Z3GH 4LHUD 3KLDA 4OIBA 4ZUTB 5KN5A 2Z35A 1CL7L 3N1FC 1EPFA 2ZUQB 3RDTC 4K94H 4I5BA 5EUOF 4MQTB 1U8LB 1LE5B 3VD5A 4K3DH 1FE8H 5BS0B 1MSPA 2Z8WC 4XCEA 2Y25A 3MLVL 5JXAL 5GSRA 4LLDA 4P4KC 5HYJE 3O3BA 3V0WH 1A6VH 1C5DB 4JFZH 3GBNL 4HHAB 3FRUB 1AI1L 1TENA 1HKFA 5HYSG 3CVIH 1NBVH 1ZHLB 4B5EA 4YHOL 1EHNA 5F7LB 1ZOXA 1J5OH 3MRQA 1GGYA 1LEIA 1ZKAA 4MLIA 4YHNA 3OAYK 2WV3A 2DQTH 3QNYB 2AK4E 1RK0A 4R0LC 4KZDL 4I8DA 1FH5L 3V6ZB 1UADC 4G42B 3UMTA 3GI8H 3X12A 5L0QC 1KTLB 2XTJB 4LSQH 4B7IA 1MJ7H 3KYKL 2NY5C 3TZVA 4X7SL 2O61A 2VXVH 3EYFB 4UDTB 1CLOL 4F80A 2DTSA 5DMKB 2AJ3B 4AL8H 1GGBL 1T03L 1G0XA 3D87B 3EFDL 2LE9A 4GRWH 3QCVH 4HJ0C 2NR6C 3D9AH 5M7QA 2GYSA 1UZ8A 3HPJB 2X4TB 1JF1A 4H25A 3HUJB 5DT1L 5BZDA 3EJZD 3LCYA 4YGVA 1KLFA 4AEIH 3LEXB 4HS3A 4IOIA 4BFEA 1RUAL 4PJ9D 3N1QC 1MRFL 4RSVA 1BBJB 3MUY1 1WICA 1A7RL 2V2XB 4EVNB 3LV3B 5J12C 1F3JB 3FO9B 1VFOA 4K9EC 3MA7A 3FCTA 5LXGH 1U8JA 2Y07H 3VGDA 4H88H 2GSGA 3DBXA 3R0MA 4U1LB 4NM4L 1WZLA 4XNMB 5JXEC 4U3CA 4G7YL 4Z95L 2P48B 4YHPA 5DA4A 4G8IA 3P9WB 2RR3A 1HSBA 3CCHA 2G75A 1OSPL 4MX7B 2XQYG 1PYWA 4OFYA 4X4XA 3VWKC 1VACB 3MFFA 2O26U 4LDOB 4F58H 3BP7A 5DS8B 3RI5F 3RVUC 3BKCH 4EDXB 2EH7L 3OKDA 4HFUL 3RQ3A 3T2NL 4YX2L 3ZHDA 4ZS7L 4YDLC 2AV7A 4W81A 3X14A 2XWJB 2GCYA 3CFJB 4RGND 1NBYB 1I8LC 4GKOA 4RAHA 1OAKH 1AHWA 4TNWF 2LABA 1ZSDB 2FJHA 4NOFA 1CGTA 1CFVL 4HIHB 4XP1H 1B0GA 3QT2A 1PQZA 4XCNA 1R5VB 4RNRB 3DGGA 4J3OC 3L5WA 4OLEA 5EIIB 3QZWA 1ZT7B 3BH9A 2HJFA 1G9MH 5DJAB 1O0VA 1FNSL 1IAKB 3NZHL 2FO4B 3GJEA 5KVDH 3MRJB 3LOWA 3BGAA 1YEHL 1EZVY 3VG9C 2B1HH 3MO1B 4YWGH 4PRPA 1R24A 2BNRE 3K2UH 3TBTB 2VDKL 1SMOA 3RPIA 1GHFH 3RTQA 1QTYT 2YD3A 4JFFD 4WUUB 3OJDB 4ZSOB 3FT2A 3ILQD 3GJFH 3QPQD 5BJTB 5KJRH 1VDGA 2I9TB 4KK6C 5B3JE 4HG4K 2P46B 5GGQL 2WUCH 5GJSL 4L8SB 1VADA 2ARJQ 4QWWD 1IGJB 3Q6FB 1IEBB 1DBJL 4Q74A 5GS0H 3CDYA 2NZIA 3RY5A 2CLVA 4O5LH 5K9KA 2R1YA 3LRHA 1OPGH 4OCWH 5CAYB 5AG9A 1YY8B 2N7AA 3QPXL 3ZHKA 3WNNA 2B2XL 4FQPA 4MD5B 3BP4A 4L9DA 4XC1H 2ATPA 4OD1L 2IPUG 5ANMA 3LVEA 4KKLD 1T7ZA 4APQD 1GIGL 3W39A 3M1BB 2N4IA 3WCYA 1TJHL 3AREA 4LKXA 2PCPB 2VDPH 5C09B 1DEEB 3S5LB 5D70L 1UJ3C 1RHHB 1UQSA 4UDUA 1WCBB 3BKYH 5C0AA 5TDPA 1FVDA 4WWKD 4Y16D 4YDIH 3MV9D 2YEZA 3JUZA 2BNUA 2QL1A 3BHBA 1J8HE 4FFYH 2FLBT 5ADPL 4QLRA 1OD9A 4DGVL 4BA8A 3JTSB 5JW4R 3BUTA 1IQWL 5ENWB 3IFPB 5TF0A 3ULVE 5CJOH 4HDIB 4YBQD 1RV6X 2EZ0C 4H1LA 1MCFA 1U95B 4GUPB 4PP2B 4UB0H 1VKXB 2FJGA 2BVOB 4RISL 2NX5E 1DP0A 5JORB 5DJ6A 3ULVC 4MB3A 1Z5LA 5HI5C 4I4WA 4D0BA 1YY9D 4JZOA 4U0RC 4I3SH 5MENE 5HHOB 1TNMA 3CH1B 4DKFH 2YZ1A 3QQNA 4HC1L 1UXSB 2C4XA 3O3EA 1TZHA 5C07E 4PFEA 4JZNB 4RBPK 5I8EA 5GS3A 1YNLH 2DRUA 3HG1B 3HI6H 2HT2C 3O8XD 4LU5L 3J7HA 3WL9A 1VERA 3WIIL 5FYJE 1CLYL 3BMWA 1J18A 4Y0GA 4HFWA 1MNUH 2YK1L 4N9GA 3RVTD 1HE7A 1CCZA 2IQ9L 2EDTA 1K8DA 2GJ6A 1DE4A 3QDGE 3IFOB 3PWNA 4G8EB 4HWBA 3TO4B 4F3FB 3S3JA 1MRCL 1EJOL 5D7LE 2XQYK 1OL0A 1KT2A 5DJ2A 4H8WC 4P46D 4YHKL 2AW2A 1XGQA 3DWTA 3QUXB 1ED3A 4URTB 5E2VH 5GXBB 2FX8H 1CICC 5E8EB 4MJ5A 1MJUH 3LEVH 1CDJA 2X4RA 2A74B 5IMLB 1EV2E 4XRCB 4YHYC 5MEOA 3MRBA 1IC1A 4PIRF 1ZK9A 1OWWA 3MRKB 4IM8A 4UIKL 2VL4A 4OM0H 2F9BT 3OR6A 2J4WH 3IDXL 4LKCA 2WW8A 1I4FA 1NCDH 5DD6A 5DD5H 2VLRB 4XBGB 3TT3H 3A67H 4P2RE 3C6SB 5TFSL 2FHBA 3MRGB 1A3RH 3F12B 2D7OA 5GRWA 5BMFH 4NNXA 3W0WE 2MPAL 1NFIB 1CGVA 3KR3L 4PG2C 4BJLA 1AGBB 3WHE1 3TIEB 2NW2A 4F57L 2YPKA 4KTDH 3BPCB 3O11B 4IRSA 4KVNH 4FRWA 1H3TA 2PYFB 4UV7H 5E9DE 2CQVA 5CD3A 1FQ9C 1AGDA 5IM7A 4NC2B 5C0RH 4JRYA 2EO1A 4LCYA 4AMKL 2LV4A 3CLEH 2DWDA 3KJ4B 4N0UA 3S34H 1FNEB 2HJKB 2VR4A 1SJHA 3ZE1E 2VDLL 4ZTOL 2VZTA 3UP1A 2HWZH 3BIAX 3QO1A 4L1HA 5DWUH 2VISA 5E8PA 3C60D 5I1KL 2E7HA 5GZNC 4Z78B 1GGCL 1Z0NA 4GQ9L 1QEWA 2VKXA 1RURL 4ZYKA 3V5DA 2Q8AH 4L4TD 4XPBL 4PGZA 5E94B 3PIQB 5H35A 5E4EC 3T8XB 2HP4A 5JOPE 3VFTA 4CVXB 3VMPA 2IPUK 1MCSA 1U8IA 4YHIA 1QKZH 4LLQB 4F7EA 1I1FB 1E28B 3GBML 4HIEB 3AC0A 5AG8A 5SWQA 2YD6A 4P3WA 4R90L 4QHKI 5L2JB 5MI0B 1QBMH 2X5PA 3V0VA 2ADJB 2GW5A 1FVEA 4RFOL 1TQBC 1QNZL 3LRGA 4NQSB 2VO5A 4Z7UB 2NY0C 2K7PA 3DTXB 4M6OL 4P23D 2OP4H 1PKQA 5CUSH 1INDL 1DLFL 1IKFH 1WV7T 2O5XL 4ODTH 1K5NB 2E7BA 2GKIA 4LCIH 3MOBH 4XGZA 1G1YA 4PJ7A 1PSKH 3KNBB 3KDMB 4NKIL 5EUKA 3GRWH 2CD0A 2K9UA 2GY5A 1TVDA 5F88A 2FR4A 1A1MA 2Y4SA 4HCRA 1DDHA 5ECJE 3X3GH 4DN3H 1WIPA 1S8DA 3QAZB 3D85D 2AXGB 1I1AC 1FFNA 4M48L 1WTLA 4NQCE 1MCQA 3I85A 4IRJC 5B38G 3DX7B 4E9LA 4LVOB 5EB9A 2EDHA 1UZ6F 3SGKC 5DEGB 1Q9WA 3N1GC 1L4IA 3IAPA 5INDA 1KTRL 5DDHB 3KYNB 1JUFB 3NACL 5CSZB 1A6UL 1J10A 3PABB 2ICES 4I3GA 2RCSL 4MAUH 4W4OC 3GNMH 5JW3H 4R2GB 1S5IL 4Y88A 2H9GA 4KI5C 1FDLH 1VEMA 3QXVA 3E2HB 5IBTH 1J87A 3LKOB 5CGTA 3EYVA 4UBDD 3BO8A 1IGTB 2V5RA 1I8KB 4LGRB 4XWGH 1RQ5A 1J1XL 1KN2L 4P4KA 4GSDH 4N0RA 4QGYA 4XPTL 4NRYA 3O4OC 4PJ5E 4QXTB 1UACL 2XKNB 4LRIC 1KCRH 2A6IA 3NIDF 1A7NH 4XNQB 4R6UA 2R0LL 5BV7L 3SKMA 2BERA 1Q72H 3WN5A 4PJGB 2OZ4H 5F1KC 5FF6A 1BWWA 4W6YB 4NQXA 2CDGB 3FMGH 1F4YL 4Q58C 5EU6A 4KJQC 1DBKH 4HGKC 3BDYH 4GW1A 1KPRA 4KMTL 2EXWD 2P8MB 3BQUD 1W2KT 1A7QL 1S9XB 3DUUB 4XVUD 4L3EB 3BPOC 2X42A 5TQ2H 3WJJC 1JNHB 2R4SH 5C0BB 4RFNC 2ADIA 5I1HH 5FAAA 2DMCA 5KZCD 5IMOA 3SO3B 2WANA 1EX0A 4LASH 2HTKC 3S4SB 1FZOB 1MQKL 5IR1A 2EO9A 3TVMB 1G7PB 4PGEA 1J1OL 4U7KA 4BZ2L 4OGXH 5AUMB 2FX7L 3MV11 5IQ7L 3EHBD 3ZKSD 1QBAA 5E95B 3TN0B 4YO0A 4XNXH 1KENH 1X4XA 1A7OL 3QQ9C 3SDAB 4YEFA 5ITBL 1KJ2H 2B8OT 1KSRA 3FN0L 1FIGL 1KJMA 5CGYC 5JXEA 1QSFE 2YMXH 5F3HB 3WXVH 2MCPH 4O02H 1CLZH 2CUIA 5BO1H 1JWUB 2ATKA 4FTVE 1AKJD 5F1IA 5A2LH 3TJEL 3DURA 4K3JL 3VWKA 1N2RB 3FFCA 5KSBE 4RAVB 3T0AA 2NY1C 3VE0B 4UUJA 2ZG2A 1PEZA 4M7JL 1E4KC 5KOMC 4JY5H 3RWCB 1W0VB 2F53E 1GL4B 2CLRB 4M62L 5FYKH 3S37L 3W5NA 4KKNA 4YPGA 3P77A 1I8LA 4JY4A 3S7GA 1GJIA 2FWOB 4GKZB 1MFBH 1Q94B 3VXMB 4QRRE 3O6FB 1FV1B 2HAZA 4PJ8D 4I48A 5DHVA 4U3HA 1EFXB 5A2JH 5CP7B 4AH2A 3K1KC 2VIRB 2ARJA 4S0TD 3QDHA 5JW4M 5K59E 2DMKA 3DPBA 3BP5A 3IAQA 2DQFB 1FG9C 2R1WA 3C9NB 1BVLA 3MBEC 1LK3H 2PF6A 2X7LB 3FB6B 5EIQA 4PJEE 3B5TA 4D8PA 3KPPA 4PRIE 4QRPD 5DJYA 2GK2A 1NFKA 4F7CA 5D1QB 5HI3C 3RNKB 4F9PC 1WWBX 4PJAB 1R3LB 1NC4A 5DSCB 2YC1A 1KNOB 3VD9A 5IHBA 3FO0L 5DRWA 4L8BA 5FOBA 4CN4A 1LP9B 3TGXA 3CXHK 5C70A 3PWPE 3ISWA 5HYQA 3OKNB 5EH1A 3B9KC 1RZFL 2K7QA 4QNPF 2NY7L 3IDNB 3LN4B 4LDLB 5K9OB 4HZLB 2XXCB 1ONQA 1A6PA 1U8HB 4OUUB 4XC3L 1JF6A 5HD8C 1ND0A 2J8UE 4K8RH 4UIMA 3DMMA 2YZ8A 2GT9B 4O51A 2G9HA 3PUCA 5FGCB 4DGYL 3NH7H 4OD2B 1RD6A 3O2WL 4J8RA 3LKNA 5KN5B 2Z35B 4CW1B 2DJSA 4BQ9A 4KUZL 1BFVL 5CD5D 4I5BB 3TC9A 3I2CH 3S88H 2QSCL 5I1LA 4JO2H 4YK4C 4X6BA 1FNHA 3IRZA 5J7CC 4XCEB 2NPLX 4H20H 5J3HD 1UG9A 1LQSR 1MCPL 4JM2D 4LLDB 5GSRB 3TPKA 3VFGH 3RWFA 3O3BB 1MCIA 1TIUA 4LSDA 5I1EL 2F15A 3LQAC 3D25A 2OSLA 5GRVK 4JG1H 3MRQB 5D2NC 3P4LA 1LEIB 3EO1A 1P5VA 2MQ0A 4DTGL 4YHNB 3HPLA 1ZMYA 1MRDH 1AE6L 3NABH 1RK0B 4RGMB 4MAYD 2E7MA 4MGXA 2X1OA 3ARGC 5F7MC 3ALPA 3X12B 1I9IH 2GITA 4UINL 1S9YA 1F90L 1H8OA 3TZVB 2HMIC 5HYEA 4LSUL 4LLYA 4GW5A 3MODH 3VXSE 2HVKA 2NZ9C 2EDYA 1KUMA 2PXYD 1PBYA 2DJ4A 3L5HA 2A73A 3P40A 3VXQA 1U3HD 2CLZB 2EH8L 1RZKH 4Q7DA 4YPJA 1UZ8B 3I3DA 1JF1B 4H25B 3ZKMC 1NEUA 2DLHA 5BZDB 4YZFE 1ZEAL 4Z7QF 1WF5A 1IAOA 4PJBE 4HS3B 4R4FL 4LPXA 4UILL 4Q97A 4M6ML 2AJVH 3RAJH 4MMZC 1AD9A 1CVRA 1OGAE 2UVFA 2X9XA 3OAZH 4KJWD 3JWDC 3T0WA 4KFZC 3MA7B 1IGML 1UWGL 4LSSH 1MY5A 3FCTB 1VPOL 4GKSA 2LQRA 3RU8H 1NMCC 5EC1A 4D2NA 2GSGB 4XCYA 5DUPH 2FGWH 3HE7C 3TJHD 4TOYL 5J1SC 5DUML 1Q38A 4G8IB 1CICA 3CCHB 1HSBB 2G75B 4WWID 1F6AA 4YC2B 1RFDL 5T3ZH 1PYWB 3MV7D 4U1GC 4X4XB 4LCWA 1T0NA 4HEME 43C9A 3MFFB 3WIFA 4Y2DD 2P5EE 5A16A 2AI0L 3BP7B 1BM3L 2R29H 4JRWA 2YN3A 5GGVL 4JFYA 3OKDB 3O0RH 4YBLB 5FUOL 2OJEA 2R9HD 3CC5A 4PJCA 1WWCA 4R96A 2AV7B 1LEKA 4HLJA 1YEEH 5E0QA 2GCYB 2VN7A 2Q86A 1ZHNA 4PJIF 3U0WL 4GBXC 4HCRL 1AHWB 4W6WB 3IF1A 1IC7L 2X9WA 3T3MF 2FJHB 5FGBC 3QG7L 2QHRH 5LG1A 4XVSH 5CLWA 1OARH 4PG2A 1PQZB 4XCNB 3VXUE 2DQCH 5F9JA 2FGZA 2ITCA 3DGGB 3L5WB 1WIOA 4I0PD 4OLXH 3SBWA 4D3CH 3BH9B 2FO1A 4OIAA 4KTEH 4ZUWA 3L7FA 4K71C 3GJEB 5F7YC 2CKBL 2C3GA 5IOPA 4RMVA 1DN2A 4KUCD 4NHUB 1WWWX 5EO0A 4PRPB 1R24B 5I73B 3MLUL 3N9GH 4M03A 2BY1A 3RPIB 3RTQB 2H26A 3FT2B 2M1KA 1CL7I 3QUZC 5L2KE 1OP9A 1TVHA 2BFVH 1DVFA 5JIHA 4TQEH 3GO1L 4QHNA 2MKWA 2IAMD 4JHAL 5C7XH 3DXAE 1VADB 5ESQB 5I8OL 3D39A 1UWEL 4E41A 3NA9L 9CGTA 3MXWL 3UO1L 1XGYL 4FFZL 2CLVB 1JNNL 1T0MA 2CPCA 2X89A 4DEPC 1TNNA 5K9KB 5F1NA 4Y1AA 2FD6H 2VTFA 2NXYD 1BIHA 2DQDL 1ORSA 5FOJA 2GQHA 3C6LC 3ZO0A 3MLSL 4ZXBC 3BP4B 1PZ5A 2ATPB 1PZUB 2NY5L 4L4TE 1OM3H 2W0LA 5ANMB 1OTSC 3BN9D 3DVGA 3KS0J 1F2QA 3BFOA 4FQLH 4OF5A 1N5YH 3QIBD 1N64L 1H8SA 3W39B 3VG0L 2C7UA 4XP5L 4LKXB 4MHHG 4NQUA 1QBLL 1KCSH 4XPGH 4DKDC 4AT6B 4K8RD 2Y7QA 4UDUB 5C0CA 3D2UA 5C0AB 1FVDB 5TDPB 3ZL4L 3CLFH 2UWEE 2YEZB 3KLHC 1LDSA 3BHBB 4Z7VE 5JDSA 1R3JA 1M7XA 1TCRB 4OLUL 4OV5A 3ZDYE 4OCRH 5E99L 1MHCA 4G9DB 3TH4T 4ALAH 2Z31C 5GS2H 3TF7C 4K9EL 4KMLB 3B6SA 5JMRA 1AXSA 2BK8A 4H1LB 1CFNA 1I1AA 1CTOA 3FQUA 4M1GH 4MS8D 2FJGB 1LWRA 1R5IA 2X4QB 2Q6WA 5DJ6B 4Z7UF 3MZTA 1UENA 5T33L 1Z5LB 1FAIH 4RRPG 2ZCKL 4I4WB 4D0BB 1MAJA 2XQBH 5FCUL 4JZOB 4JFPA 5KTEL 3ZDZF 1G9NC 1JPSH 5DC4B 4LIQH 4Y5XC 2Q7NA 1AO7E 1PLGL 5KS9A 5EUOE 1F4XL 2X44D 3KAAA 4P3DB 3O3EB 1TZHB 4OLWL 3PQYE 4W4OA 2NMSA 4ISVA 4KVCL 3RKDC 4XBEH 1G7MA 3QEQA 3LD8B 3LEYH 5GJTL 3S8WA 2HT4C 4OZFG 1INQA 4FXLA 4Y5VA 5DJ8A 2FATL 2LVCA 3BJ91 1DUZA 3ARBD 2J6EA 4GXUN 3PWUA 4HFWB 4N9GB 2JELL 2V7HA 3BPLC 2OR9H 1CK0L 3WFHA 1K8DB 2GJ6B 1TQCC 4NKDA 5H94B 2DQIL 1RZIA 3PWNB 32C2A 4D94A 3W9DA 5D6DA 3M45A 4LRIA 4EQ2A 5F7DA 5GPRA 5DQDH 1ROWA 1MHEA 3BUYA 4LCCA 4O4YL 3UXFA 1KT2B 4YFLF 3G6JE 1ZLUK 3X13A 5FYLH 5DJ2B 4JDTL 5D5MA 3NCCB 3W9EA 1IE5A 1XGQB 4PRHA 3IKKA 1ED3B 1T5WB 4MJ5B 1SM3L 2M8XA 2B5IC 1I3GH 1T80A 2OR7A 3JV5A 3FT3A 2X4RB 1JRHL 1HZHL 4HSQA 4I9WE 3SDDC 3PL6A 5MEOB 3MRBB 4HXBL 1NEZB 1FO0L 4P57A 1RJYA 5FM8A 1QR1A 3SCMB 3OR6B 4NDMA 1I4FB 1P4BL 2YD4A 4JO1L 1IM9D 4RZCA 5DD6B 3WJJA 3QJHA 4P2QA