3ZDZE

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 38
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE02
4P46A 1ZLVK 2NW2A 2H3NA 4DGVL 3O4LD 1JRHI 4JHBA 1RK0B 3MRDB 4HSQA 4GMSH 3CZJA 1D5ZA 5B38A 3QWRA 3RQ3A 4UNVA 4WHCA 3UEZA 4P2QA 4YHYB 1FQ9C 5GRZA 1HHJB 2E7CA 4DN3H 5BVPL 4BFGA 3D3VD 4Q9QL 2P46B 1U6AL 1JN6A 5I2IB 3LH2H 2ARWA 1AXSA 3D25A 1T7WA 1J8KA 1TJHH 2JLLA 1B6DA 2D4DA 4DOHE 5IWLC 4GMTH 4LVHC 4OQTA 5DSCA 3OSKA 1FL6A 1TVHA 2F58L 2W0KA 1FL3B 2XA8L 3KPRB 4JFYA 1BJ1J 4MQXD 2JELL 1QRKA 3GKZA 2PUQT 4NKIL 5EU6B 3S36L 2AI0H 1A1MA 2BCKB 5IM7B 4NUJB 4ZAKC 2F54E 3T1WA 3H3PH 3C08L 3DXAB 1GGCL 3HE7D 5GJTL 5K9JL 3HPJA 4LLYB 1LEKB 3QA3A 1T80A 3PF2A 2ZG1A 4AMKL 5F88A 5E00B 3NFPA 2O61A 3QEQB 5GQBA 4I18C 1I7RB 3WD5L 4MX7B 2EDRA 2FBJL 5CGMA 3G6JB 3X3GL 4JFXA 2VXTH 4XCNA 4IS6A 5HTSA 4HS8L 2AXGB 4LSQL 2CIKB 4JFDA 2D7NA 1ZEAH 1DBJL 3NCJL 4RGMC 1G7LB 3DMMB 1BBDH 4DWHA 2VDLL 1ZA6B 3TFKC 4F7CA 1WC7B 1HSAB 3RVTD 1FL5B 3MLTA 5IG7A 4TUKL 5TQ0H 4MNGE 1ITCA 4S1DC 3NTCL 1N6QL 3E8UL 2BOBB 3IFOA 4GRLC 3K46A 4R0LA 4BH8A 2CKBL 2NNAB 4JZNB 2E8ZA 4OFYD 4X4ME 5JIIA 3GSNB 4Z0XA 4GG6E 5C0BA 5E94B 4NYLB 1I75A 4GAYB 4D94A 5IIEB 1RAMA 5EU3A 4L8BA 4WV1C 1AY1H 1A9EA 3R0NA 4OLWL 3ZE0F 3JSSA 4MS8C 3LRSA 4YE4H 3W39A 2A6IB 2OQJA 4OQTL 3RZCB 5KG9B 2HT4C 3SDDC 1HK6A 1P1ZB 2OR9L 1IBGL 2ZSVA 4QRRB 1J87A 5CCKH 5TE7L 4MD4A 4Z7VB 2GCYB 3GMRA 2BRRH 5JDSA 1CZ8L 2QKIA 5H94A 5J1TC 2MQCA 3DPBA 1OQOA 4KHXL 5C0EA 1T7ZA 2CR6A 1QFHA 1CFNB 1U3YA 4KK8D 1NBVH 3WUWA 3KDMB 4DFHA 4HBQA 5J57B 2DLFH 4AEFA 1NEZB 3MLYH 1UYWL 2YN3A 4APQB 3IT8D 3JBG7 2C1OA 3QUMA 2ATKB 2HA1A 1BQLL 4KK5D 4OZ4A 2X1XR 3KPPA 2XA8H 2ERJC 2VERN 2CK0L 1YMHB 3IU3A 2BSTA 2Y5TA 1NFDE 3TH4T 1MCFA 2EDLA 2X5PA 1JGDB 3FO0H 4LLDA 1BQUA 1U91A 2YD1A 2WBJC 1H3TA 2YPVL 1BECA 1PG7H 3W0WE 2CIIA 1KFAL 1VENA 4YHOL 5FEBA 2Z91B 4UUJA 1VACB 1EA9C 2DQFA 4X9IA 4YHPB 4ZDHA 4N0YH 5IQ9A 1MHPL 1A5FL 4KK9D 4JM2B 1MH5B 1G7MA 4AEIL 4KQ4H 4OZGE 2OJZL 5B3JE 2HJKA 2FR4A 1NMAH 3UTOA 5DK0B 4R97B 4BH8B 2GUOA 3BOVA 5KW9L 3GNML 3CK0H 3RKPA 4MWFA 4XNMB 1BIIA 1WZKA 4FQJH 2HFGH 1NDMB 4NZDA 1D5ZB 2DMBA 2UWEB 3PG2A 1B6UA 1X5AA 1LEGB 4HXBH 3FMGH 5F1NB 1GVIA 1KIPB 4OGAC 5FUZH 4RAVB 5AZ2L 1RZFL 5EB9A 4DKEH 4ZO8A 1J10A 3VFMA 3HR5A 3HZKA 4X4MA 1ONQA 2WWKO 1HIMH 1DE4A 3VXPA 4AG4L 5CWSA 4MD4B 4ODSL 3UTSE 3QWOA 4JJ5A 1EV2E 4NNYA 3PWLA 1INEL 1I9RH 1U6AH 1PZ5B 3ZKQD 5JW5B 2ZOKB 3BXNB 3WEXA 4L1HA 1MCSA 3LZFL 1OTSC 5BCAA 2DQJL 3D39B 4Z76A 3QQ3B 4S2SA 1AJ7L 2NW3B 5HY9A 3LIZL 3OXSB 4NKDA 3QJHA 4LBEB 1T1XA 4MCZB 4UAOC 3V6OC 1KCLA 2QQQA 1N0XL 4R4BA 4MQ7A 2H32H 3PQYE 1H8NA 4M3JA 2R0LH 2AQ3A 4XBEH 5DD3L 3QZWG 4UMGA 2AEQL 4XZUA 4FOMA 3ALWA 2AK1H 1LEIB 1K8DB 2E7MA 5FA4A 3ESUF 5EPMB 5IVXA 5IHUH 3MLSH 3QUMH 1AGBA 1FFNA 4N8VB 3F7YA 3PUCA 4BKLB 4QXTA 4RFOH 4ODXA 2EIZB 1IGMH 5EU6A 5FUOL 3CU1A 3X17A 2ZUUA 3CXHK 4NUJA 2VIRA 3STZA 3TA3B 4HIEA 1CE1H 1KC5L 2YSSB 2CK2A 1Y0LA 1DN0A 3WKMH 3SGKA 3S4SB 1RIUL 3DX6B 3MV7D 3JV6B 4N0RA 1A7NH 3GMLB 1HHJA 1HZHH 5E8EB 3HE7A 4YXHL 3E3QC 3OAYH 4NQSA 4K3EH 3AMKA 5I1HL 1E6JH 4H0HB 3V0VA 1ZA3A 3V6ZB 5HYIA 3DIFA 3TBTB 2QSCL 3L5WB 1Y18A 1DZBA 4X7TA 1CVRA 3RVVD 1LD9B 3UZQA 2XKUA 5DRNA 3MRJB 3VXUD 1A6ZA 4GRMA 3MGOA 3ZDZF 3IS0X 4PGBA 1QHOA 1FL6B 1TVHB 3MGAA 1QTYT 4Z7QF 3RGVA 1IM9D 3SO5A 2EYSB 3ZYIA 5FK9A 2DN7A 1QSFA 5J1AA 3C6LD 2AJSL 5E2WH 3VXTB 5BS0B 5EZIL 1DDHB 3BGMB 1NMAL 4G5ZL 5F9JB 3U30B 3BPNB 1OTTD 3AXLA 3P0VH 1WBZB 4MGXA 5A1AA 1TDQA 5FYJH 3CXDL 1B9ZA 4HUVA 1MRDH 3KDMA 1R6VA 4MSWA 4LHQB 4GS7C 3T0XA 1U9KA 5C0AE 5J1SC 1OCWL 2AKRA 5CZVL 1HEZB 5DA0B 2IWGA 2Z31C 3PV7A 1I7ZB 4JQIL 4EI5A 5D2NB 1CYGA 5J11B 4QRRA 4XPTH 4EI6B 4NQCA 4UINH 3L3GB 1XEDA 2F5BL 1KGCE 2DI9A 4LKXB 5ICXA 2NY4B 2OYPA 2CDEA 2VAAB 1T21B 2MJWA 2Z93A 1RZJC 3UJJH 1EXUA 3MLZH 4YDKL 3RVWD 4N1EA 2VR4A 2XWJA 4XAWL 4X9BA 4PRPD 1NJ9A 1QNZL 4P0DA 4DEPC 2XZAL 4U6VH 4Y0GA 5GS1C 1N64L 2H6PA 1FFQA 3DUSA 1BREA 3L7FA 4AIZA 1KLUA 3LEYL 2HRPL 3ESVF 4HUUA 1AD0A 1S7SB 1J05A 4OLYL 4KWUA 3L3JA 4HDIB 3V4PH 4AIXA 1BEYL 4L4TB 1ZANL 5C0GB 5TH2B 2EDEA 2DIJA 4LNRB 3EOYG 4WEBH 1FZOB 4OD3H 2AJ3B 5CFHA 1K6QH 5EUOF 2BVEA 4WW2F 1UACL 2GSIB 2GJ6D 2DM2A 3B2VH 4YC2C 5TGBA 3BZFB 1JCKA 1QQDA 3JWDC 3MLPA 1S7XA 1BJ8A 4U6YA 3BDYH 3HS0B 2X4RA 4X5XA 1RJLA 25C8H 3DETC 5IR1B 5BO1L 3FHQA 2EDHA 1ZK9A 4O9HH 5HJ3A 2W9DL 4YPGA 5I76B 1FVDA 4JVWA 4OGYH 5CD5D 1FGVH 1YEEH 5BMFL 1EO7A 2K7QA 3P4NA 1OTUC 4FZEH 4KHTH 2I27N 2BVOA 2LE9A 2R1WB 4TRPL 4MCZA 4PLOB 3TNMB 5I1IH 5BOPA 1Y6MR 3PP3H 2HJFB 1RZ8A 3BPCA 4XH2A 4BZ1H 1WCQA 3G5VB 5HGBB 2ZNWA 1OSPH 1JUFB 3NCFB 1JWMB 3ZTJG 4IIQC 5EOCH 4WO4C 4HKJB 3UTZA 3VDCA 5I1LA 2XWTB 3DECA 1FE8H 4PGEA 4KZEH 3WNKA 5L0QB 1A6WL 3IDYC 2X4SB 2V2XA 3ZE0E 3OZ9L 5LGKA 1YN6B 2C1PB 3T8XA 3KXFE 3IDIA 3MJ6A 4JE4B 1UM5L 3I02A 2RAMA 1KIPA 1WLHA 4LDOB 4FQQB 1G7PB 4KUCD 2F53E 3WFEH 4X98A 4GRWF 1LK3L 3U1SH 3QUZA 2PXYB 3BAEH 3O41B 4A6YA 1UQSB 4BZ2H 4HBCH 5E9DD 3OKDB 2WWKT 4D9RE 1PZ5A 3RWEA 3TBTA 3QDJB 4WU7B 3IF1B 3TCXA 5ACMA 4S1SH 3PL6D 2HRPH 1X5LA 2XACC 1F2QA 3PDOA 1AR2A 1V3LA 1JNNH 1G6RH 1QFWH 4G80A 4F7MB 2FLRT 5JQ6H 4Q7DA 4XNQB 2D9CA 1NEUA 5GGSA 1T7VA 5EO0B 2FNBA 4PRDA 1SVZA 3HUJF 2YSSA 5FA3B 1M7DB 1KIQA 5CILL 4ZUUB 1I85A 4XPAL 3BP5A 1NFKA 2Q8BL 4FTVE 3GMLA 4PYHA 5CUSH 2VLRD 1CFVL 2DDQL 3KPPB 5DR5H 5HJ3B 1J11A 1WBZA 1K8IA 2AK4B 1FNEB 1ORSB 5D1QB 4QRTB 3V0WH 4N0UE 3HPLA 3QIBD 5SWZD 3V6ZA 5IJVA 4H25B 2FB4L 3VFWB 2VKXA 1ULVA 2ILLA 5ANMA 1JFQH 3MLSL 3QUML 4NDMB 5FA4B 3OF6D 4NCDA 3VFSA 3DUUB 4R7NB 3RDTD 4JQIH 3F65A 1F4WH 1LP9B 2OTUB 4O51B 5IB1A 3CX2A 1D5MA 4X7EC 4QHLB 2NW2B 4K9EL 1T89A 3QIWA 5C92A 2X1PA 1L0QA 1E4KA 4MJIE 4G8FB 5JXEA 1DQQB 4JFZL 2NY2D 3U4BH 1W2KT 1DEDA 4P5TA 3HNSH 5GS2H 5I15H 3CDCA 3MLUL 1MVFA 3EO0A 3FT2B 1BFVH 1KTLA 5CSBA 1CGWA 3X13A 3Q48A 5FB8A 2CRYA 3BEWA 2GSGB 1NJ9B 4J1UB 2XPGA 3VXNB 3LIZH 1RIHL 4JRYD 5D7LE 3DX7A 3ZSTA 4Z7VE 3ET9F 2QQNH 5JDJA 4M5YL 3IVKB 1OWRM 3MZTA 1K2DB 4Q9BA 3CLEH 3LZFH 4PJBA 5CJQH 2IBZY 1KCUH 3LEXA 4QOKD 3TIDB 1R5WB 4CJ1A 3MYZA 3HE6A 3LOWA 3X11A 1MIMH 1L7IL 1MCKA 3NABL 5DVOA 4RMSA 4WHYH 1MLBB 1EXUB 4CL7A 1HIML 2VZTA 4HIJA 5MEOB 3MRBA 1G9NL 3GSOA 4EN3A 4MAYC 3LPGA 1P84K 2LVCA 1S7TB 3EOAA 3M8OH 3HAEH 3L9RB 3VRIB 2ZOKA 2M2DA 3FB6A 3MX0A 5HGHA 3WEXB 1N2RA 5DJ6B 1S9YA 1R24A 1NCBH 3EJZC 1J0YA 1S9WB 4BFIA 4LLYA 2ZUTA 5JQ6L 1A7QH 2NW3A 4M7LH 3SO3B 3AM8A 1FORL 5D2NA 4Z5RA 2BNQB 2JK5A 1Q0XL 4ALAH 4ZD3L 4PB0L 4POZC 5KSAA 2OJZH 3ES6B 4WHDA 2F53D 5DD3H 1TNNA 3QG6B 4XCNB 2WBJA 3L3HB 2R0LL 4Q0XL 1JWUA 1Z0MA 3ZHKA 4H25A 4PJDF 3FQUA 1YEKH 4UTAL 4LLUA 3OPZL 4Z77A 1SJEB 5KSBF 4LEOB 3RWCB 5MHSE 4YGVA 5HGAB 1JPFA 5GGRA 3VWKA 4RAHA 2R69L 4KVNH 5F96H 2GJ6A 3DNKA 5EO9A 4J3UA 2YPVH 4RRPA 3G04A 3NACL 2DQJH 1MFDL 4I1NB 5I1DB 3C5JA 4GH7B 1MI5A 3FT4B 2JIXB 4NRYA 4IM8A 3LDBC 3V6FA 3QXAB 2D2OA 3BP6A 4PLJC 4WENB 3VDBA 3R1GL 3PWVB 2EC9T 3I84A 2F19H 2FATH 1WFOA 3PWUA 5C0CA 4OF7A 5DJZB 4YZFE 2FYYB 1YN6A 2C1PA 3T8XB 1BM3L 4EXKA 3PWJA 3IKCA 5B4MD 4PRPA 5F7EH 3U0PB 1I7UB 4XAKE 4NUGH 4YHNB 5KZCD 2IH1A 1QBLL 2YBRA 3WUWB 4ACPA 2Q7NA 1BD2D 1WEJL 3I75B 3P77A 5E03A 3S37H 1CR9H 2R9HC 1S7TA 1L6ZA 3RPKA 3SE9H 1WFNA 5HGHB 2HN7B 4IEFB 4NN5B 3BH8A 3VGBA 1MWAL 3I02B 43CAB 4LLWA 4NC0B 1WAAA 4HWBH 4RX4D 1INDH 1DQLL 4XMKH 3GSQA 3PGDB 2EH7H 4NO3A 2PW1B 2NY4C 4GKSA 2X4UA 1NSNH 4GXVL 2EYTA 3RJDA 3TBYA 3C60A 1II4E 4FFYH 2XG5A 2X9YA 4JFXB 1AFVL 3QCUH 2IQAA 1QACA 3ZHDA 4K3GA 4WDIB 4X6CE 3OR7B 4IJ3C 2CPCA 4HS8H 4LCWB 3NIGE 3VWJD 1F45A 5BS0E 2G9HB 1DFBH 2XRAL 3H0TA 4GKZB 1E6OH 5AUMA 1ZT4A 3O6LL 4PGZA 4W6WB 4X6EB 2W07A 5HHQB 1U8KB 3BSZH 1CXEA 4HCRA 3C5JB 4HIHB 2G5BB 4D0DB 3ZKND 5T1DL 5IVXE 3R0MA 1T6VN 5CLWA 3VGDA 2DM3A 2IPUK 4F3FA 1U8JA 5FB8B 3L3JB 2BRRL 4ODTL 3OR6A 2GSGA 2GJ6E 2W91A 3PXJA 3RIFK 2BSSA 2XKSA 4OZGF 5GSVA 3VFMB 5JPMB 3QUKB 2AABH 2NY7H 2J4WL 2OTUA 3EOTH 2B7DT 2IQ9H 3FRUA 3QDJA 4WU7A 4HK3J 3X14A 4TOYH 3ARBD 3BPOB 3VFGH 1JNHA 3MJ8A 3ZZ1A 2CMRH 4QRPB 4TPRL 4AEHL 4R2GC 4O2EA 4Y4HC 5DFVD 1AQDA 1H8OA 3IDNB 3RWHB 5I6XB 2OZ4H 4FFVD 2P5WD 3CAFA 2CRZA 1IQWL 2J8HA 1DVFB 4LIQL 2ADJA 4U1KA 5H37H 4HLZG 3RNQB 5DO2C 1K8IB 5GPRA 1T03L 3I6GB 4XVUD 4LPYA 2D0FA 4GMSL 4LCUB 5IVOA 4LSPL 1FVCB 2P7TB 4ORGB 2YK1L 4K3DL 3AROA 4LSDA 2VLKB 1HHHB 3X3GH 5C08E 3HNTL 1Q94B 1PKQA 4M6NL 4Z5RB 3H9SA 2L0DA 1YQVH 3D3VA 4YIQA 4I3RH 1F6LL 3G9AB 4MDJB 3EW3B 3NFSL 3BPCB 3F7VB 5HI5D 3C08H 1X9QA 4JY4A 2CO6B 2Y6SD 3K1DA 3VD4A 3VRIA 5E4EC 2ADFH 4C83B 3TO4C 1B0WA 3LSOB 3H9YA 3ZTNH 4HWBA 1GOFA 4G9DA 5CGYD 4EDXA 2YMXH 4LHUA 5AUMB 4DUXA 4L3EB 4YHZL 5IFJB 4KRPD 3DO7A 2VR5A 1QD0A 4X6FB 3HI5H 1P9MC 4PJDE 4XNXL 3EHBD 3QQ4B 3WSQL 4WY7H 3BO8B 1U8QA 1RJZB 2VDNH 5SWZE 1J1PH 4FQQA 4M4PA 2F53A 1C8PA 3HC3L 3G5YA 3CLEL 1U3HD 4PGCA 4HWUA 3D69A 4LAQL 5FGCE 4CRPA 2FJGB 3BYTA 4HMEA 1NANH 2VLKE 2XN9A 3KPSB 4GBXD 5IW1A 3FONA 4ZS6C 4P3DB 1OAQH 1H0DB 1CGXA 2EKSA 5IBUG 3WL9B 3U0PA 4OCWL 3T09A 3IXTA 5GS0L 3RVWC 2IGFL 4N8PA 4HGWB 2SEBB 2OI9B 5D1XD 4WI5A 1CL7H 2IH3A 2X1OA 4PJIF 2JB5H 4Y2DB 3R8BB 1LEKA 1E4XI 3U9PL 3RUGA 3PWPE 1F58H 4L8DA 4JANA 3WUZA 2ESVA 2H26B 4DKFL 1CTNA 5JMOC 2O5YH 4LCYB 1YECH 1YUHB 1E4XH 1ZHNB 4YH6A 5C0IB 1G7QA 3GMQB 5EZOH 1E28B 2X05A 1JFQL 3VXMD 4IS6B 3NIFF 4TSCH 3QHZL 2YPKB 4MXWL 4KV5E 3HE6C 1IC1A 3M1BB 1IZJA 1LO4L 1T5WB 3BDXA 4FQCH 4JB9H 4U1HA 1K4CB 3VFSB 1N8ZB 5KVMC 5FXCH 4Z7WF 1VEMA 3L3KB 3MRNA 4KJWC 3KJ6L 4KMLB 4XPAH 5T3ZE 3GB7A 2A83B 2B5IB 4K3DH 4YR6A 3VDAA 1JWSB 2IGFH 4I2XB 4RMQA 3IRZA 1RK0A 3MRDA 1FC2D 3REVA 5DD0L 1T03H 2WQ8A 5F3BB 4HDIA 1J8HD 1M1SA 5I18H 3EDEA 4X6FA 1ADQA 4HUXB 1IGJB 4P4KA 2APBA 5AZEL 4XVSH 3VXPB 4LNRA 4XNYH 3QXDB 3O2DA 2UWEF 2Y36H 2VLLA 1T1YA 1TITA 3BIKB 2EYRA 2IH1B 4WU5B 4NN7C 5IQ7L 3BXNA 4LSSL 5ENWA 3S34L 1XGQA 2OS7A 1G7JA 1F4AA 3HI5L 5GIRA 1I8KB 4ODHH 1MI5D 3CXHJ 4LCCC 5AYUL 4PJGF 3U83A 5IGXL 3WFDH 2DICA 3TA3C 5D2LF 3OKLA 4MD0A 5I73B 2VN7A 3GBNH 4QGTA 3NN8B 3UROR 5KOVC 2FL5B 4TYUA 4CBPA 2ORBL 1DBML 4JAMA 3VFUB 3VXOB 1KCVL 1MLCA 3IDNA 1QSED 3RWHA 3RAJL 2O5XL 1TFHA 3ULVH 1MEXH 3UYRH 4ZQKB 3OJVC 2AQ2A 4RA3A 1P6AB 3IDMB 3O3EA 1RSFA 2QLVB 1B0GA 4X8XA 5TE7H 4Y5VC 4OLUH 3DXAE 3LY6A 1A64A 3CVHA 1LDPL 4JM2C 1QO3B 4U49A 5F72S 3M1BA 2IFGA 1N5AB 3BYYA 4HS6A 5T3XE 4FFYL 3KYNB 1K4CA 5DEGB 2W9DH 5ITFA 2Q76B 4KI5D 4OCSL 2J7LA 3PNWA 4YGVB 4MLSA 4R97C 5TQ2L 4ZAKB 1NGWB 3EIFA 3S3PA 1NCWL 3E8UH 3NGBC 1KOAA 2EDDA 5E2UH 1OHQA 1NC4B 3AU1B 4MA3B 5HYJB 3MMEA 3CJJA 3EOBA 4QY8A 1TJIL 1DTUA 1CR9L 3SPVB 1KYOK 5F7YC 1JJUA 5IFAL 1BQHB 4OLUL 4Y19E 2FBJH 4JM4H 1P1ZA 4H5SA 3R06B 3QNYB 4MVBD 3MC0A 3FFDB 4R6UA 1OP3K 1MFEH 4NUGL 4K7PY 4X0KB 1GHFH 1MQKL 4OZGA 4M4RA 3PE9A 5DS8A 2ZOLA 1LMKA 2C4FU 3VE0A 3UTQB 1T0MA 4DGIL 1S3KL 1M7DA 5D7IA 2A6DB 5ICZB 4KI1A 1L4IA 2X70A 3WFHB 2X4TB 3NH7H 3L6FA 15C8H 3DVNA 1FFRA 2ADGA 2F58H 1FYTB 1I7RA 3TH3T 2B1AH 3GUTB 5D93C 3O45A 4ODHL 4HGWA 4ZXBD 3E2HC 1AFVH 4M00A 1U8QB 4I77H 1NSNL 4MS8D 1DUZB 2GT9A 4H88H 1OOAA 3O6FD 4KTDL 4XXCA 1MPAL 1ZOXA 3HUJE 3VXRE 1JF5A 3O2WH 3QXVA 4FXGA 1MWAA 1RUAL 4P5KA 1VACA 3T1FA 1JGLH 3BJLA 4Q58C 4C83A 4YHKH 4BZYA 4CVWA 4I13B 2ENSA 4UOJA 1DN2A 2E7LA 1W72H 3H6JA 1EHLH 1DQDH 3LKOA 1CK0L 3UTSD 1OP5K 2NY0B 3U7WL 2PKDA 3P4LA 2V17H 5A2JH 3MV8E 3DBXB 1OWWA 5IBTL 4M7LL 5LAXA 5ETUA 1X4ZA 4MAUL 3OKNA 4ZO9A 1RUKL 2J88L 5CBEB 1NCBL 3ZSSA 5CIPA 4HS3B 4MJIB 4XI5D 1ZA3B 5DI8B 4R96B 2GHWB 3O3BB 3UJIL 4KMQA 3CDFA 2X7LA 3WNNA 1HOCB 4NM4H 4POZD 1D5XA 1O5DT 3G08A 4NO0B 5CEZD 2IADA 1MCPH 4GRMB 4OI7A 1X4XA 4HT1H 3QXUA 4L8SC 4AJ0A 1PEWA 4DKFH 1RUQL 3BMVA 1L7IH 2OZ4A 2ID5A 1U36A 1ZHBA 3D6GA 1OP3H 5MENE 3GIVA 4R9HA 3MV7A 1R24B 1J1OL 2EDJA 5DZLA 4OT1H 2GFBB 5FO7A 5IW3A 2DLGA 5KS9E 4CN6A 3AS2A 1AHWA 1GIGL 1YEGH 3LKRB 2YKLL 5I30H 3SCMB 4YBLC 2DQHL 2DRUA 2DTSA 1P9MA 3GMQA 1F4YL 4F7TA 4DGYL 4YFLI 3T4YA 3L3HA 5JHDD 4XNUH 4HQQL 5C0CE 4JFZH 4NKMB 2EDFA 1T0NB 4I0PD 2PR4H 2HG5A 3BD5A 2P5WE 3UYPA 1G1YA 4DGYH 3ARZA 5DGQA 1U8NA 1L6XA 2Z35B 2QR0A 2BVTA 1A7QL 2YC1A 3PHOA 4GLRI 4OZIB 1S9XA 4WEUD 3B9EA 4HH9B 4OJFL 1I7TA 4PG9B 1KN4L 3AUVA 1OW0C 5FYLE 1YPZF 1QZ1A 1IGFH 4YEEA 3EYVB 3L7EA 3NFNB 1UWEH 5LBSH 5TFSH 4WTZG 4XPBL 1IC5L 1LEGA 3HMXH 1J8HE 3OJMB 1B4RA 3RTQB 2XPGB 1FNSL 5DHVB 5KTEL 3WBDA 4MX7A 5FYLL 3IFLH 3TZVD 3FMGL 5FUZL 3SGDI 5HGDA 3HCVA 5DURB 1XF5B 2OL3B 3OB0H 3KYAA 1NC2D 4PD4K 4EVNA 1EHXA 5KN5B 1S9VB 3FQWB 1JPSH 1A6ZB 3X12A 1LE5A 2VLJE 1IEHA 1OVZA 2OK0H 2OSLB 3ZE2E 1J0KA 1JZ8A 3FFDA 4JFPB 1AIFB 3DSFH 4M1GH 4OIIL 1IFHL 3MV8D 1WCBA 3LN5B 3DOSA 1ITBB 1ORSA 4OFDA 5SWSD 1QSVA 1W0WB 3QPQD 3S4SG 2WUBH 5GS0D 2R0ZH 3OZ9H 1EH9A 4PV8A 1AHWB 5A2IH 5D7KD 5GGUB 3QDMD 3W9DA 4TPRH 2J1KA 2AP2A 4OF0A 1F4WL 4GXUM 3SCMA 5GZOD 4F9PA 3JV5A 4MZ3A 1FJ1A 1UA6H 2AV1B 3WIHL 5HPOA 2HJLB 4AT6B 4LSUH 4XB7A 4MJ4A 3WLBB 1A6UH 5EUKB 1YZZA 4QTIL 5DD1L 3VH8B 4G42B 1BFTA 4MA1C 4ODTH 4RFEB 3EYOA 3T0EA 4NQDA 3MRMA 3BH9A 4HLJA 4UT6L 4LQ1A 1YYLH 2C5DC 3JWOC 2CDFB 2DBLH 1V7NL 1JPFB 5GGRB 3RNKB 3O8XD 4P46B 4RISL 3RZWA 1VFBA 3MREB 4OZFH 4KI5E 4G6FB 1MCDA 4EQ3A 2OM5A 2ARJA 4GJTB 3FOMB 4PRAB 4R8WL 1CXLA 4NNPL 3B5TA 1UB5A 4M1DL 4AIZB 4XVTL 1DFBL 4GRLA 5FDYA 1QRND 5C3LD 3MV9D 3X11B 2FX7L 3ZT5A 2XWBA 5L2JA 1YY9C 3DBXA 5ETUB 3AY4C 4N8CH 3C6SA 2EXYC 4A6YB 4PGBB 3TV3L 4LPUA 5DUMH 4UV4L 4NIKB 5BRZD 3UBXA 4PUBH 4G9FB 2AQ1A 1QLRB 3BQUC 1CL7I 3FFCE 3MNVA 4OGAD 4X6DB 4I0CC 3ULUL 5H2BA 5EU7C 3ULUC 4IRSD 5IMOB 4PJGE 1GAFL 3SDAC 1NGPH 3EO9L 1MWAH 5DVMA 4K71C 1A6WH 1NBYA 1LE5B 4KROB 4KRLB 2NY5C 4YHIB 1VESA 4E0RB 2AEWA 2JK5B 1FAIL 1KIUA 5F6HJ 3UYOD 1KJ2A 4GKNA 2NY1B 4Z78A 5I1JH 4UV4H 3TPKA 1U2CA 4NNPH 2NXZB 3DVIA 3TYFB 4TTDD 2Q87A 3PWNA 3NCJH 4I18B 4RDQF 1F3RB 3ARED 4LRNH 5DJYA 3ARGD 2IAMA 4OGXH 4JY5L 3SJVE 5DVNA 4EI5C 1EEYA 4S11A 1T1ZB 3D0LA 4F7TB 4O51A 1CDHA 4PJ7B 1T89C 4YDJB 4P2OB 3HZMA 4UZGA 3RY6A 4F37K 5JNYB 4NQXA 5E1AB 4J2XA 4UINL 3NAAH 1KB9K 1CWVA 4O9HL 4OF3A 4QXGH 5KVFL 4CJ0A 3ARDA 1XF2A 1BFSA 3MRRB 4URTB 4I48A 3KLAB 1XGRA 3C2AL 4JDZB 1VFBB 1DQTA 5FUCE 3VXNA 2GITB 4L4TA 5HI4C 3MQIA 1U42A 3Q5OA 3K4DA 4DQOH 5IV2B 4MQ7B 2HTKC 4RAUB 1JNLL 5CD5C 2NY3C 3WFCL 3JUYA 2C3HA 5DD5H 2GY7B 3QNZA 1UKTA 4WW2A 5F89A 3KPTA 1J0HA 4LLQB 2D31B 4P5TD 3MNWA 1PGRB 3RBGA 3CFCL 4E41D 3SBWA 5I1EH 4KJPC 2V5RA 2CGRH 5DD0H 3CFEB 3O9WD 4FS0A 2G75A 4K3EL 5I1HH 4P5MB 4F7MA 1KTDB 1FNSH 1I1AB 4KGLA 1P7QB 3FO9A 4Y4KC 3DLQR 3HAEA 5ILTL 3QNXB 2VC2H 4DZ8B 1AXTL 1LO3H 4HJ0C 4N1HB 4JPKL 4ZUUA 3MA9L 3F12A 3M17A 1AO7B 2PTTA 5CD3A 5E7FA 1LE9B 4O02H 1KEGH 3NCEB 1XIWB 4EEEA 3IB4A 3GJFH 4XBGA 3WNMA 1CFSB 2DL9A 5I1CL 1UJ3A 5C07A 1F00I 2X9XA 4QHKJ 5EBLB 1IGFL 5CJQL 1XF3B 1J18A 4JGJA 2W92A 2VSDA 1ES0A 2VRAA 5JZ7C 1FZMB 2ZUSA 3HUJA 1PW3A 4HMDA 4WWKC 3VXRA 4Z7UB 1FLTX 3U9PH 1G9EA 2WP3T 5DQDL 4JY4B 5DVKA 3QRGL 3NCMA 4UTBL 3HB3C 4NQDB 3SDXF 4NRXA 2QADD 1C5BL 1NL0H 5D72H 3D0VA 4G9DB 2CO7B 5ID1A 2Z31B 4OM0L 5DK0A 5GSVB 4N90D 1H3UA 4G6JL 4FP8L 4JR9L 1CIUA 2D4FA 5I66A 4RNRA 4N0FB 4F9LC 4K7PL 3X14B 3BIKA 3OAZH 4K07A 1LO5B 3QUXC 2UUDK 1INEH 4EVNB 3W0WB 3D9AL 4U1LB 1H15A 3S96A 4I5BB 2ZUWA 2EDXA 3B43A 4JM2D 1PQZA 3MPCA 1E4JA 1A3LH 1N5YL 4Y16C 1HSBA 4NRZA 3BPLC 5EIIB 2E9IA 1YEJH 1D7FA 2ITDB 2YUZA 3NIFE 4U1NB 5T3ZH 1SEQH 3MLXL 4XXDA 1IGML 4W4NA 4IOFC 2QV2A 2NY2C 3MUZ1 4JZJC 3QDGB 1CICB 1EK3A 2VTFA 3PJSB 3RWGB 2IALB 1YMMD 3VFWA 3NFSH 1QR4A 5DRZA 2V5YA 1UCBH 4ELMA 1J12A 4HZAA 4ENEC 5ACZB 2MCG1 1YN7A 1VGEL 2DYPA 1JF1B 4HC1L 4FQIL 1T1WB 1A1NA 1LO2L 4HQQH 1E28A 1R3JA 2KZ1B 3SGJA 2IQAB 5DJYB 1N5AA 2EC9U 1BF8A 4C55A 3IDGA 4R90H 1R5VB 1FNAA 3IS1X 1UM5H 2NX5E 1MCRA 4YHML 3WKNA 1ZT1A 5GISH 2DIBA 3TGXA 1CLZH 5AYQA 3EO1A 4PBVC 1MREL 1X5YA 5C09A 1T3FB 2JJVA 4FTVD 3H9HA 4NJ9L 3OBAA 1MCQA 1R3IL 4D0DA 5E5RB 3IDXH 4KROC 1PD6A 4MHHG 4NWUL 1N26A 1Z2KA 1RUQH 1JGEA 3EYVA 3D0VB 1G0XA 2VL4A 3G6AB 1IM3A 5K9OA 1MAJA 1NAML 3MBEB 4K3JL 1AP2B 1MCNA 5TDNA 5CHNA 3A6CL 2NY7L 1FNGA 2DQIL 4NGHH 1I1YA 4FFWC 1QLRA 3O81A 3EFFA 1MF2H 1RMFL 5CIPH 5F93C 2VLLB 3S3JA 4WUUA 2AEIT 2R2EA 4QRPA 5C0AA 2FHFA 3GMNA 4M02A 3UAJC 3S88H 3GKWH 3LS4H 1MH5A 2EO9A 1BWWA 3GNMH 5I1LB 2KPNA 3BPNC 3B9KB 3WO4B 2E6PA 1DVFC 3TBWA 1S7RA 2H32A 2V17L 3C5ZC 2ATKA 1GHFL 3N50A 4EZMA 4X99B 2GI7A 4PJHA 4K7FB 1FFPA 3OXRA 3BKCL 1AD9A 4NWTH 4LHUD 5HDQL 3BEVA 5C1MB 4OLEA 5BRZA 5JW3H 1I9IL 4ZTOL 1UACH 1MFBL 4I8DA 2DKMA 4NJAL 1BZQK 5ESAB 1WZLA 3MXVH 4XI5C 2HJLA 4X6DF 2XY1A 4AT6A 3MFFA 3FQNA 4FXGB 1N3NA 1IMHC 4K55A 3QH3B 3TN0C 1ZTXL 4I3SH 5TQ2H 1UEMA 1KJMA 3ARDB 1IM9B 3CFBA 4P46C 1NAMA 5C0RL 5L7XH 2DQGL 1XF2B 2P5EE 5GRWA 1NCTA 1KG0B 3WIHA 4QF1B 4RZCB 1A22B 1JHTB 2ZCKL 3TFKD 5DJ8A 1WICA 4WCYL 6FABL 4XVJL 5LAXB 1NUGA 1CXFA 4O4YL 3ARGA 5SX4H 4GXUN 4KKAD 2CUHA 1RIVH 2EC8A 4PBWD 3FCTA 3L3IB 4EUPB 1OPGL 1UJTA 4GAGH 1CI5A 1RK1B 4W6XB 2BHUA 4CU7A 1PSKH 1GOGA 2KUTA 4LLMA 4M6OH 4GAYA 4V2BA 3G5XB 1ZGLB 2NY5H 2I24N 2NTFB 1RJZA 1F8TL 3WFDL 3V0AC 4QEGA 2F5BH 4NGHL 3QHZH 1W72B 3QEGL 3BIBX 3MRPA 2XN9B 5J3HD 4HJGA 4YE4L 4Z7NE 1OSZA 1PY4A 1Q8MA 2DQEH 3GBNL 3EYUL 3R1GH 4G9FA 5A40E 2HH0L 4ONFL 4NWUH 4HGKC 2NMSA 4Y5XA 1AI1H 1FBIH 5SX5K 1R3IH 3AM8C 5C71A 5JMRA 2N56A 2X44D 2Y7QA 3VFVB 5I18L 2RQ8A 3NFPB 3V8OA 5J9PA 4OCYL 5IR1A 3GBLA 2C3VB 4EJ1C 4XNYL 1O7VA 1A47A 4F33A 1INQB 5FHAH 2FX9L 4FHBD 4U33A 2HG5B 2WBJD 1KJ2L 1UGNA 4P2OC 1WF5A 2DYPB 2EDWA 3MRLB 1S5HB 2XQBL 2YC1B 2NLJA 1HHIA 2YHGA 2BNRB 5BRZE 4OLXH 4LP5A 1F90L 4KKCD 3TO2A 4X7DC 5T1KB 5J6HB 4NKIH 2R2BB 4R2GD 4Y4HD 3TA3A 3UDWC 2DQTL 4KI5F 3BPLB 4LGPB 4ZO6A 5C0ND 4JY6B 3SO3C 3Q2CA 3KLAA 1A02N 1QPXA 2FRGP 3SDXB 5C6WH 5K59E 3LS5H 3WLWC 3P0YL 4P57B 1CL7L 1QSEA 4WTWA 5DO2D 1UKSA 1YECL 1R3KB 2H2PC 2VISB 4O2FB 4QT5B 4XP4L 4HS3A 5C0CD 3KXFD 5C86A 1GH7A 1XCTA 5I8CB 3ZDXE 2GY5A 3QWQB 1SYSB 4UI2A 5DLMH 4X98B 1Q1JL 1ZHKA 1HOCA 5FHAL 2VAAA 2BDNH 5TE6H 4Q9RH 1KNOB 3X12B 4RMVA 3QUMB 4X7FC 4K94C 5I30L 5I73C 4V1DE 2QHLA 3B2UC 1RPQA 2Q20A 5FGCB 1HILA 1I85C 1XR8B 2VXUH 4XP9H 4QLRA 3CFEA 1MLCB 5EN2B 2NY6B 4PJIE 1TCMA 4P4KD 5DFWH 4KDVA 4UT9L 3SY0B 1JHKH 1JI2A 2VLRA 1T20A 3MBEC 2VITA 4HG4K 1AKJD 4DZ8A 3MACH 4PR5A 1BVKA 3UTTB 3C60C 4WY7L 1TZHA 4V1DA 5T1LD 1WGOA 4V2CB 2BNUB 3EYUH 4Y19A 3GJFA 1MJ8L 2IANB 4H0GA 3BZEB 5IMMA 1CD1A 4TUOB 1P7KB 3T4YB 1TQBB 2W60B 3QULA 4L3EE 2HMID 5EZLB 4P99A 3T04D 1L7TH 1E4XL 2HFEB 1E4KC 3WHXA 4RQQB 5JHDE 4IRJA 4YDVA 1G1CA 1D6EA 3PQYD 3BQUD 2A38A 1NFIA 1N59A 5AAWA 1RURH 1QQDB 3VWJA 4MAUH 1N3NB 2VDRL 4R0LB 3SKJH 5ECJE 3SDAD 4J8RB 5C0JA 2XQBH 3FFCD 4XRCA 4Y2DC 1RJLB 2HN7A 2LAAA 6FABH 1YEHH 1KELH 3CFJA 4PJ8C 2LU4A 1O0VA 3GSXB 5C08B 1MFAH 2P44B 3CFCH 4HIEB 2P42B 3NFNA 3P4NB 4JN2B 2R0KL 5GHWH 3W2DL 2IADB 1IAIM 1U8HB 3H2WA 3ZKNC 2BVOB 4Z7WA 4PGJA 3GBML 5DJXB 3C5SA 3QIBB 4D9LL 5L2KD 2ZCLH 3R06A 4P3DA 5CP7A 5DD5L 5MI0B 4PJ7F 3D85D 5CP3H 2APTA 2CDGB 4EI5D 4HHAB 3U0TA 3MV11 4FTVA 4K3HA 4U1LA 1CLCA 4M1CD 4HWBL 3T0DA 3GMMB 3NA4A 2IH3B 4KK6C 4WFGD 4PY7A 3JWDH 2NY2B 4K7FA 3NH7L 5INDB 3C2AH 3B5GA 4L8DB 4PJIA 4BK5A 1CIDA 1FL3A 4LSTL 4X4XA 1NUNB 1CDYA 5B22A 5FGBA 3VFNA 2BCKA 5IM7A 2AJVL 3GHBH 3KPQA 4KXZI 4XX1G 3FL7A 5C0AD 3E6FB 3WXWL 4M6NH 3MROB 3QUZB 1B0GB 4R4FH 5IOPB 2NR6C 1MWAB 3U9UB 1ZKAA 1C5DA 4PP2B 5E2JA 3O6LH 3RVXC 1N4XH 1KENH 3DTXB 4LKXA 2IFFL 2ZCKH 1QSFD 1CDBA 4JRYA 4JKPH 3VI3F 3DROA 4NN6C 2BK8A 3RWDA 5EOTA 2UY7A 3VWKB 5HI5C 1EFXD 3FOLA 2Y6SC 1UM6H 4GAJH 4P2QB 1FHGA 4PRPE 2I5YH 4WUKL 1YEFL 3FRPA 4AQ1B 4JPVL 4FQ1H 3CLFL 4LPVA 1OAYL 3D48R 3L5JA 5I1GH 2EXWD 4C54A 2XZZA 2IFFH 2IQ9L 2WWMD 3FTGB 2N7AA 4KQ3L 3D5OF 2A73A 4OM1H 3RY4A 4UTAH 4M7ZC 4HAGA 1H5BB 1AGCA 3BDBA 1QYGH 5F3HA 3PV6A 5HHMD 2VISA 1CS6A 4Y1AA 4PG2C 3RL1B 2FX7H 5FDWB 1EMTH 2Q7YB 2P49B 2WK2A 3I2CL 2RJMA 2X4PA 3V2AR 4M1DH 1PAMA 3VGAB 3SQOL 1MCOH 4RGND 1UT9A 4JHWH 1T7YA 3MXWL 1S7XB 3PHQB 2AI0L 3MV8A 3SJVD 2HFTA 2YOCA 3VE0B 5DQ9A 4OCNC 5DC9B 2UY6A 4F2MA 4JFED 5I16B 5IGXH 1MCWW 4Y5YB 2YPLB 4YDKH 1BM3H 1FNFA 1MHEA 3DETD 3V9FA 3QCUL 3SDDB 1H3WM 1Z9MA 1FVDB 4K3JH 1K2DA 5B3JF 3TM6A 1QBML 1YQ2A 2EEAA 1GL4B 5IESH 4J23A 4Z8FL 1FIGL 2ICCA 5D71L 1NCCL 1KGCD 2Z8SA 3TZVA 1F13A 1EEYB 4JO4H 1OP5H 2VLJA 4LLVB 1UVQB 3ARDC 3OPZH 2VXVH 4LVNC 1GRWA 4LCIL 4K7PX 5GXBB 5H8DA 2GKIA 4OV6F 2N4IA 4Q0XH 1NC2A 3MRKA 3L7FB 5F1OB 2R69H 3O8XA 4KVNL 1RD6A 4XC3L 1A7OH 1I9EA 3PDDA 2YZ8A 4M1GL 4IRJB 3ALPA 1DN0B 5E2WL 1FORH 2PTUA 4W70A 4DZBB 5HHQA 1H3VA 3C8HA 5DQDH 1CGSL 4EOWH 4XRCB 2FX8L 4N5EC 5KANI 4I0PA 3NZHL 3GJFB 3QDMA 4ZD3H 1MHHA 2JCCB 3AB0B 2LFGA 3SDCB 2OL3L 4KZDH 5FYLH 3FQUB 2BC4A 1U8HA 1NGQL 1MFCL 3QFDB 3W9EB 2BRQA 4LKCA 4GAFB 1IT9H 4BYHA 5DMJB 2X2YA 5E8DL 4I4WB 3SKOB 1KPRB 3I3BA 3VJ6A 1WAAF 3MA9H 4YFEA 2A1WH 3CSYA 1P4BL 1KCUL 4MXQD 1DJSA 3MTRA 5EN2A 3CNKA 3SKNB 4Z18A 1NDGB 4YQXH 1TQCB 1ZWIB 1I1AA 1SJVA 4JCLA 5L8JB 2X09A 4PR5B 3QFJB 2BSRA 3ROLB 1G6RL 2XTJC 2ED8A 4Y5VA 2F54D 2AV1A 3I9GL 5FO9A 1SEBA 1NKOA 4LCUA 2A9MH 1EO8L 1T1YB 2X6MA 1KCSH 3KPOB 3QAZC 5KBNC 4U1MB 2R2CA 3I85A 1PKQB 2FHCA 3T0EB 2YBRB 1QKZH 1U92A 4PYGA 2EDKA 1XCQA 1JZ7A 2HJKB 1JL8A 2GTZB 4DQOL 1OGAB 2CLRA 4P2YA 2CH8A 4ELME 3ZO0A 4XWOC 5E6IC 5FOBA 5IB2B 5AG9A 1PKOA 4P2RA 4N68A 1BIIB 4X4XB 4PJBF 1M05A 2JIXA 5CIPB 2LU3A 1DVFD 1KUMA 4Y19D 2Y06H 3EO0B 5JXAH 3B9AA 3IDJB 1A6VL 4G8GB 3TVMD 3ARFC 2DWDA 4JPWH 2D7MA 5JHLL 2BVYA 3IFNH 1HH9A 3JV6A 4NHUB 3QBTB 2IG2L 1CCZA 4N0CD 5IP4A 3TJEL 3NCYP 2L7UA 1RZFH 4K94H 1KB5L 4JHZA 1IEBA 3CVHB 3V6BR 3N9GL 4HHAA 1CGVA 1P84J 1FZJA 1WBXB 3RUGE 3GSUB 4DVBA 1IKNA 4PGCB 4TN9A 4LCWA 2FX8H 1H15B 2P4AB 4PY7B 4F7EA 4EBQL 2W9LA 3KPSA 4RBPH 5E2VL 1FL5A 3TN0D 1FGVL 1YEEL 4FZ8H 4GKZA 5BMFH 1G0YR 3GSRA 1X7QB 2NY6C 3C9NA 1OAUL 5HSFA 1MRFH 2PYEA 3Q6FA 4G3YL 1IEAA 4QWWC 4ERSH 2X4PB 4LARH 1ACZA 3HE7C 3FB8A 3GSNH 4XWGH 3REWB 1B4JL 5MEQB 1A7BA 4Z7UE 4KRPB 3GO1L 4G6MH 4LPCA 1PX3A 2BP3A 5HI3C 7CGTA 4OD1L 1QA9A 3B2VL 5D7SL 4PJCA 2W65A 4XZUB 1FN4B 4YHOH 2MOVA 2J4WH 5FO9B 4KTDH 1V3MA 1M7XA 3MODL 4Z95H 3HI1A 3BE1H 3P9WB 1NGYA 3TNNB 2R15A 2QR0B 3BZEA 5ICYB 1IARB 4GW1B 4GFTB 4C56B 3RVTC 4QCIA 1I1CA 3DROB 2BOCB 5ID0A 4XCEB 5I6XC 4OI9A 1FRGL 5CILH 1D6EB 4NZRH 3NAAL 4PJ9A 5K9KA 3LEVH 1KB5A 1ND0B 4P2RB 3IVKA 4E42B 2R56L 2ZCHH 1E6OL 3K2MC 2VZSA 1A3RL 2X4QB 5C0FA 5F1SA 1HQRA 5J6GA 4JFEA 5L7XL 4K8RC 3I2CH 4HKXB 4RGNE 5KSAD 3QPQC 4HFUH 3L5WA 2AJXH 2YD6A 1JV5B 2V5MA 1UB5B 2BVUA 3BDYL 4EXPX 4LRNL 3P11H 5DEFA 3QIWC 5MI0C 3D25B 4HUXA 1Q94A 3MNZA 4POUB 2IPTH 3MUHL 1JTOA 1HDMB 5GGRY 4HPOL 1R0AL 1KB9J 1VFUA 5IHZB 3N1PC 4JM2A 5B4MC 1QSEE 3AXLB 3P2TA 3ZL4L 1FLRL 2J8UB 1ZT7B 2VDKL 3VXRD 4GRWH 2Y4SA 2ICWA 4YAQB 1FP5A 1BEYH 1U93B 5FV2A 1HNGA 3CXDH 4L4TE 5C0BD 1N6QH 3TBWB 3DI2B 4TUKH 4PUBL 3ES6A 4XP6H 3Q5TA 3OKNB 5DT1L 3OXRB 1WEJH 3QIUD 5DJ2A 4JAMB 3VFUA 4MJIA 2YUXA 2G60H 1IAOB 3AB0C 3WS6A 1QSFE 1LDPH 2VMFA 4KUCF 4X7SL 3RWCA 4W68A 5GRJL 3SDCA 2YD7A 1A14L 3PGDA 1KN2H 4RFNB 4TULH 4KY1L 1HSAA 2FH6A 2VSCA 4PFEA 1B0RB 4XC1H 2JCCF 1HHGA 1ROWA 4C56A 1JYWA 3IJHA 5ESQB 3H3PL 4BSVB 4BUGA 3ULUD 1GGUA 1RIUH 2PO6D 2DIAA 1NCAL 5FUCC 4DK3A 1QVOA 3MLZL 4PJ9B 3C2SA 4L3EA 1EAJA 5D1ZC 3ZKXC 4IMLB 4K8RH 1M7IA 4ZNEA 4B7IA 1Z6JT 2NZIA 3LQAL 3P9MB 4FQXA 3LRHA 1CDJA 3BE1L 5C0DB 4ZUWA 4HIHA 3WS6C 1LO0H 4YO0A 1YEIH 1MJ7L 4X6CF 1F3JB 1MJJB 3QUXA 2X4NB 4WHTB 3VXME 3HE6B 3MOAH 5D7IE 2FZ3B 5JOFB 3T0EC 4PJAF 2R0ZL 4Y4FD 2JJTA 1ZVSB 2NTSP 4MXVE 4PJFF 5AZEH 4F15B 1W72A 3EJYD 3P0VL 4PJEB 2HMIC 1H8SA 3DSFL 3DWTA 5EZIH 1S7UA 1PFCA 3V4UL 5IVXF 5IB2A 1KELL 3FAWA 4LSRL 2B4CH 3O3UN 4MCYB 2GIYA 4DVBB 1LVEA 3V5HB 43C9A 5D5MB 3IRPX 3LHPL 3SE8H 4F7EB 4GS7B 1CDIA 3SKJL 3KR3L 1GPOL 2YRPA 5IEKA 1KF9B 3ARSA 1ED3B 3UPCA 4HPYL 2YEZA 1G9NH 3T2OA 4HH8A 4M61B 5GS0C 1T1WA 4RFOL 1EAPA 4JG1L 5AZ2H 1FG2B 4U6XB 2Y06L 2BSED 2P8PA 4LPTA 2FIRT 1FVEB 4W4OA 1U8OB 4LCCB 1XF3A 1OT2A 3MACL 4JKKA 1CD0A 2C4XA 2VDML 4KAQH 3U0WL 1S5HA 5IROC 5GS1B 4IRJC 3N85L 2NXYD 2BNRA 5BXFA 2R0WL 4KJPD 2I07A 1WWBX 2B8OT 4OBSA 4WI7A 2AJSH 4KMTL 3TO4D 4KDTC 3CMGA 4KKBC 3MRFA 5C8JA 5BW7C 4GSDL 2D7QA 4TSAL 1XF4A 3H8NA 1JZ4A 3HR5B 3VCLA 4JRXB 1ZS8B 2X89D 2GW5A 1AR1C 2YWZA 1NGYB 2QEJA 5FF6A 4W4OC 4OZFB 4RGMB 1QO3A 1T83C 5LQBL 3QYCA 3WN5C 3LKNA 1TZIA 3AGVA 4OSUL 3LS5L 1X6LA 5DR5L 2XZQL 1OTTC 1CFBA 2DBJA 1QG3A 2K1MA 4YXLL 3GFUA 4JRYE 5D7LD 4EN3B 1T1XB 1TQCC 4XHJD 3CSYB 3UTSB 5FUOH 5I1AB 4E42A 4OZIE 4N9GA 3QO1B 3MLYL 2B4CL 5H35B 3ZMRA 2CLZA 5D2LB 2AJUL 2PETA 1UJ3B 3BW9A 3NZHH 2DKUA 4IMKC 1MFEL 4QTHB 1D9KD 1S7WA 4V1DB 1J7VR 4GW1A 4FQJL 4JFDD 1JP5A 4XPGL 1YNLH 3QIWB 5CAYB 5TPWL 5DYOB 4BQBA 1BX2B 1DQQA 4Q74A 5A16A 5J6HA 2PYED 1IM9A 1C1EH 3CFBB 1GYAA 4OZGB 3TPUA 1CVSC 1R3HA 1CLOH 1IAIL 5HHOA 5I17B 3BEWB 3B9DA 4D0CB 1FGNL 1A5FH 5ICZA 4H26B 4KZEL 4XX1E 4IMKA 2IBBA 1NC4A 1M05B 1KFAH 3RTQC 1NCAH 4L4VD 4ONFH 3VRJA 5IESL 4DW2L 4I77L 1AGEA 3LKPB 2VDLH 3IXAA 5HI4D 2AGJH 3E0GA 4XBPA 4E41E 1KENL 3V7MA 3NPZB 2FJGA 2DQDH 2Y5EA 1JE6A 1A7PL 5E9DE 3OL2A 3T0EE 4WWID 3G5ZB 5CJOL 1BMGA 2VZUA 4CADA 5IJKC 1T0PB 5JW4N 2HFGL 2K9UA 2QQLL 4DGIH 4Y5XC 4AMKH 5MENA 3V6OE 2XY2A 1YC7A 2AJVH 2KZWA 3FT3A 3SY0A 3QEHA 5A3ID 4NZUH 3PHQA 5D1ZB 5FKAB 3O4LB 4MSWB 1JNJA 4XVJH 4PJEA 2E7HA 1EMTL 1S7RB 2H32B 3ECBB 4TVPL 3TA3D 1J8HA 4QRSB 5K33A 3ZDYF 1QFUH 5E0QA 2IANA 4N9GB 4PRIA 3S5LG 4D3CH 2CUIA 4H20H 5EZLA 1LILA 2UWEA 3ME0A 4H8WL 4CVUA 4NSKB 1JTTA 3NTCH 2Z4QA 4XPFL 4AIOA 1Q0YL 4N5ED 1T21A 4PJCB 2ICWJ 5IKCA 3ROOA 3D3VB 3SKMA 5CKGA 5F71A 2VDOL 1BBDL 3QWOB 3HRZB 4Y8AA 4EUPH 3B9KC 1NC2B 3WO4C 4G42A 2YWYA 1NAKL 2R0KH 2BVQB 4ISVB 1PBYA 4Z0BH 2VXSH 4MJ5B 5ALBH 1P7QA 5B21A 1FC1A 1N64H 3LEVL 3IFOB 1BVZA 4R4FL 5DFTA 1YNLL 3STLA 1TTUA 1YPZA 5J56B 3P4MB 2I07B 3QDMB 4QXUH 4U31A 1C16A 1U8PA 1CZ8H 1X4YA 5CINL 1CQKA 4HKXA 3IJSB 4FQCL 3QEQD 4MA3A 5F9WB 1PG7W 4QTIH 5E7BA 2AJYL 1MSPA 1IGYA 3E6HB 2E27H 2CLVA 4PJ5A 4YFLF 1FVEA 2WSKA 3RUGF 3CU7A 2QTEA 1MCWM 5INDA 4U6YB 1EFQA 2X42A 4DW2H 2ZKHL 3BIAX 3MJ8B 2J8UA 4XCFH 1OAXL 2HFFB 3EYFB 5BXFB 4UT9H 1NPUA 2PCPB 3BKMH 3KPQB 3WJJC 1GZQA 2VL5A 3HLAB 3KHQA 2VXUL 3NIDF 1ED3A 1DUYA 4G6FD 2BY0A 4YFDB 3P9LA 4HWZB 3GJFK 3UTSA 1PDKA 4UB0L 2J3SA 3NPSB 1ZEAL 3DGGA 3BWAB 1H5BC 5HVGB 2WANA 3WIIH 2C3VA 1F5WA 4GT7A 5TPWH 1T66C 2PYEE 2VH5L 5DLML 5E95B 5DJAB 5I2IA 4HC1H 2VDNL 1RZJH 3HCVB 3HI6H 1KPUB 2AJUH 3WSQH 1MCBA 1AE6H 4K9EC 4HH9A 1JHLH 4GRLD 4HWEH 1OM3L 4JG0H 5E1AA 1AIFA 1UWEL 5LBSL 1BFOA 4WFHE 1ODAA 4I3GA 1X5ZA 3KHOA 4APQD 2JELH 3QHFH 1IC4L 1N7ML 3VFOA 4B7LA 2NY1D 4OJFH 5EO1B 3WS3B 4ETQA 3LKQB 1HEZA 3MCLH 3OKEA 4X6CA 5D2NC 5IFJA 2OR8A 3VXQB 1MELA 3STLB 1FDLH 3LB6C 5E00A 3WHE1 3S98A 2AW2A 5LQBH 3OQ3B 4HJGB 2AK1L 1C12A 1DCLA 3HI6L 4PBXA 3FQXB 1YQVL 2VZ3A 3OF6A 1MJJA 1PLGH 4XTRC 5MERB 2NX5B 1CFQB 3RKDC 5ISZB 3BO8A 5LXGL 5L6YL 1A6AB 3SN6N 1OQXA 2VKWA 4FFWD 1A7RH 3RY5A 1SYSA 1FH5H 1B88A 1LGVA 4BK4A 5B38G 2BY1A 5HYSA 2LABA 5EO9B 1KIQB 3PWLB 4X83A 1T22A 5HHOD 3TT3L 3SJVA 2IAMD 3MREA 4LIQH 1W0WA 3VXSB 4KKCC 3GIVB 4OT1L 4OD2A 4PRAA 4YBLB 2UYLA 5DTFB 2V5TA 3HC3H 2VLKA 3DYPA 3NIDE 2WBWB 3ORJA 2ZKHH 2Z92A 4JGUA 5ALCL 5T5FL 5J89A 1MJ7H 3AS1A 4PS4H 4GW4A 4UDUB 5EDXA 2DQFB 1UWGH 4IBLT 1B90A 4DKEL 3Q0HA 1DQJA 4D9QD 3KPMA 2VLJD 5DJCA 4Z7OF 3QUYB 4XCEA 2JJSC 4U6XA 4U1SA 4MB5A 3O4OC 4MQXC 4RCAA 1GGBL 5E2TL 1UH2A 3DVGB 3QI9A 3U7AA 3VWKC 3VXUE 1FZKB 3WHXB 4O00A 3GRWA 4L5FH 2W0FB 1Q9WA 4OZHB 1AGBB 3NGBB 3BSZL 5KSUB 1WBYA 4QHUA 2I9TA 1HQRB 3B2UD 5J6GB 9CGTA 5EC2B 1JNNL 1QFWL 1DLFL 5C3TA 3TBVA 4CUCA 2FIKB 2P24B 5DRXA 1OARL 5CZXC 3LRSB 2R1XB 1ZVHA 1TLKA 2HKFL 3RI5K 4I18A 4LDLB 3WS3A 2X41A 2DMCA 5IB3B 1Q9LB 2PNDA 1SM3H 4PB9L 5TDOA 3BKYH 3X3FH 1BAFH 3HC4L 5SWZB 2A6KB 12E8L 5J06A 5JDSB 2X1WL 3RJQB 4OCYH 4Z8FH 2QKIB 3MOAL 1H0DA 5DQJB 2RHEA 4XMPL 3T2PA 1HQ4B 5CGTA 4M43L 1WBXA 2OZ4L 5D1ZA 2J6EL 2V2WB 4PTTA 4EN3C 1AI1L 4HUKB 5KVGH 3DRTA 1I8KA 3LQAH 4A2LA 4MLIA 3U36A 2HH0H 1X3DA 4X6EA 3B8YA 1SY6H 2GTWA 4G8EB 4PREA 2F8XC 2HYMA 4NCC1 1AO7E 1KTRL 32C2B 1AHWC 3EDDA 3UZVB 2ZPKL 3QEGH 1DL7L 1QLFA 3LVEA 3Q6GL 3BI9X 1NUDA 1FPTH 4HWNA 4NKMA 3ZKMD 1ZHLB 4X8JB 4YUEH 1FO0A 1PJ9A 2GT9B 4W6YB 5GGTL 1EJOL 2YUWA 3LQMA 3V5DA 4ORZC 3NVQA 1U8NB 5MEND 2R4SL 3KLHC 5EUOB 1B0RA 4Y1AE 4JY5H 3BWAA 1U3JA 1G7IB 5F9WC 3G6JA 4CN4A 2DL2A 3VXUB 4JJ5B 2A83A 1I7TB 2G60L 1F3DJ 4KK8C 2CQVA 3I50L 4Z7OE 4LSVL 5LGHL 1QSZA 4HKBA 2ATPA 5DT1H 3EJYC 4KFZC 5FO8A 1ZGLM 4G8GA 3QI9B 3C6LB 1Z3GL 3QXAA 4DJMA 1ETZB 1I3RA 2W0FA 3SDXE 4X4ZA 5L9DH 5DJZA 3IAQA 1KXVC 4CNIB 4RX4A 1Q0YH 2F74B 1MFBH 1X5JA 1XIWC 2XFXA 1J1XH 3T77B 3E3QE 2OBGA 5F9AC 5DUML 1Y6NR 5FYJU 2IMMA 4U6HA 1RHHA 2R4SH 2EE3A 3ARWA 2MQ0A 4M6MH 4PRBA 4U7MA 5EU7E 3ULUE 5EA0H 4TVPH 4FQIH 3BUTA 5C2BH 4PJ7E 4GLRH 4UQ3A 1NQBA 1CD8A 4WUUB 4WFFD 3C5ZB 5DJ0B 1RZKL 1XGPA 4PJEF 4UOW1 1ZT7A 1Q72H 1KCVH 1OT1A 3HAEB 5AWNH 2XT1B 4BQ8A 4PJAB 4Y89A 1J88A 1MAKA 4Y7MA 5D7IB 1A6TB 1ZXQA 3JWDL 1WQVT 3OKEB 4X6CB 5AYUH 5I0DA 4X4YA 1A3LL 3TJEH 5E6YA 4XMLL 2H45A 3A6CH 3MBED 4FABH 3VG9C 1SQ2N 4A6YH 3FQXA 4L4TD 5T3XD 4PLNC 4K23H 3D9AH 3DIFB 5C07B 2MTPA 2BOCA 2JJTC 5ID0B 3OX8B 4XPTL 4EDWH 1KPUA 3RHWF 3MLTB 4WW1A 2M8XA 3QQ3A 4S2SB 4MAYB 5F1IA 1RULL 5D96C 2C9AA 1M71B 2BX5A 2MWCA 2BOBA 4W81A 4GW5A 2FJFA 3MOQA 2LVEA 3L95B 2V6HA 3TWCL 5E8NA 4Z0XB 2KL6A 1EZVY 4P5KB 1DANT 4OIIH 5IVZB 5I8KL 5DDHA 2OX5A 1YEKL 1C08A 3MLUH 1EDQA 1CICA 3LKQA 4L5FL 4YHYC 4H1LG 3SPVA 4EBQH 5A43C 1U95A 1BQHA 1K8DA 3AVEA 3T3MF 4NQCE 1CFTB 3EUUA 4JFFB 5EC2A 1BHGA 1UCBL 3BZ4A 2OTWB 1LO4H 3OKKB 3KPMB 4H1LA 2D03L 1VSCA 1GC1L 3GSUA 3BHBA 1D5BA 3IDGB 1BQHG 4PJ5B 1XH3A 4UOW0 4HKZB 5GGQL 4UQ2B 5EU6D 1LNUB 3S37X 2OSLA 4PJCF 4R0LC 3U82B 3FAXA 3VWJB 4PG2A 3GSRB 5M7QA 1N5YH 3GSVA 5JXAL 4XXDB 1BLNB 4XPHH 1KBGL 4JN1L 4L3CB 4L9LB 4OD2B 4U4BA 2VC2L 2HFFA 3SE8L 3DUSB 3H3BC 2IALA 2FEDC 3QIUA 5DHYA 2V9TA 1AGDA 2OL3H 2CGRL 4YBQD 3P30H 5CEYA 4ZFGH 3V4UH 5DF0A 3FZUC 1OAZH 4QTHA 1BZ7B 1I4FA 3T3PE 4AL8H 4Y5VB 1AQKH 1IGTA 2BDNL 5TE6L 2OP4L 1G9NC 5LXGH 3ALXA 2BZDA 2VOTA 5ESVB 3TBSA 5DK3A 5DYOA 5DJCB 3RGVD 4AENB 5ICXB 5DHVH 4D8PB 4WU5A 4QHNB 5KANG 1TVDA 3JV4B 2XN9D 1CFSA 4GBXA 3HNVH 1N0XH 3HNSL 2V5SA 1M71A 4J12A 4WWKD 2BMKA 2ZSWB 3EFDL 3MRHA 4NN5C 4NZTH 1N7MH 3NN8A 5IT2L 4K8RL 4ZTPH 4LVOC 4TSBL 1SYVB 4YWGL 2R1XA 4EI6A 2ZUXA 1BZ9B 3QO0A 3EDJA 2ESVD 5T3XH 1ZHLA 4X8JA 4QRRD 1ADQL 3MRFB 5C8JB 4ETQB 2C7UB 2ED7A 4CVZA 5C9JB 4I3RL 3QUZC 2XI9A 3C6SB 4LKCB 4NPYA 1BJ1H 5HYQB 1ZMYA 1EX0A 3EAKA 1KJ2H 4JRXA 4I4WA 5CUSL 4RMTA 4J3WA 3HNTH 5I1IL 1GPOH 3KR3H 1C5DB 3TYGH 4NM8H 3T77A 2V2WA 3LHPH 4PTTB 2XQYK 4NN6B 3MXWH 1JUFA 4OKDA 1XH3B 3FO9B 4O5LL 5FKAA 5FO8B 1W0YT 1A2YA 5IBTH 1EJ6A 2EYSA 3RUGB 4XP6L 1S7VB 1H3PH 2ZZUT 2PTTB 2WM0A 4GKOA 5TE4L 4AM0B 5D6CA 3CSBA 2ERJB 4U1NA 4KQ4L 2BXYA 4FQLH 4CNIA 4JLRA 1JGLL 3C8KB 2FGWH 1TJGL 3UC0L 2HWZL 4PY8I 1YPZE 1FG2A 3VFGL 3O2WL 3BD4A 1YEIL 5GGUA 3VFPB 1MPAH 5ERWB 4MMXC 4C4KO 4OD3L 1MNUH 1N8ZA 5JPMA 4U3HA 3QUYC 5IMKB 2VXQL 3DO3A 2GJZA 4WW2C 5K93A 4PJ5E 5BOZG 4J3SA 3BN9D 1UM6L 4GAJL 3GI8L 1BOGA 3HG1B 3BQUA 1MFNA 3GRWH 1TPXB 2RGSA 5I76A 4MD5A 4CDGC 5T1DH 2N1KA 1R3HB 4LMQE 5FCSH 3CH8A 2A9NL 5GJSL 5F6IB 2FJFB 2HVJA 4J8RA 5C0JB 5I66B 1CGUA 1YMMA 4X4YB 5D7JC 1YYLL 4KHXH 1VADA 2Y1VA 3W82A 4TRPH 3IJSA 4HUUB 4ELKA 1FSKC 1BQSA 1NGZA 3HPLB 2BJMH 3FJTA 4JM4L 2AVGA 2XWBB 3WDIA 4OB5H 1FPTL 3VXMB 3QDAA 3HMWL 5KVDL 5ADPL 3OAUH 4P23A 4Y16A 5GGVL 3O3AA 3OJDA 4MAYA 4WO4D 4GW5B 4XCCL 4OLWH 1ZLSL 4PJDA 4NO5A 2R2EB 1OL0A 1A1MB 2VJXA 1ZLWH 3VXOA 2VABB 5KVGL 3BRGC 1QFUL 2B2XH 3SEPA 3EJZD 1YC8A 3FT2A 3BKCH 3FFCB 1QA9B 1L0YA 1K6QL 1CG9A 4ZUTB 2GUOB 1YJDC 4OLZH 4XNMA 1AO7A 1F6FB 2IPTL 5D5MF 5D70L 8FABB 1GCFA 3V52H 1N4XL 3DHMA 1KXQE 5EH1A 4ZFOB 4Y2OA 3TLRA 2HKHH 2AJXL 4K8RD 5F9DC 1RZ7H 3D2UD 5ANMB 3EYOB 3F6IA 3LB6D 2BC4B 1MF2L 1DE4B 3D85B 3UBXI 2A0LD 3QQ9D 4JZJA 5KZCB 4N5UA 2A77H 4YXHH 3EZJB 4D8PA 3GSVB 5T5NG 3HZMB 2GK2A 1MI5B 3MV7B 1K5NA 2OI9C 2H8PA 3EYQD 4LSTH 1Q9OB 4Q97A 2J8OA 1HHKB 3RWIB 1CDCA 2IAMC 1ZT4B 3B6SB 1SJHA 4PRHA 1ZLUH 1QSEB 4RDQG 5KSVA 1T2XA 1A6UL 4ZXBA 2ZSVB 2C26A 1WUNT 4TVPD 1SEBB 3VFRB 5EIQA 1MOEA 5H94B 3RDTC 2VO5A 3O2DL 2A6JB 4XPGH 1G7PA 3K7UA 2BSSB 2ICES 5JXED 2ZUVA 5EPMA 2XICA 1VGEH 4P23B 1NFDA 1V3JA 5GHWL 5HYSB 2AXFA 1OAUH 3VD9A 1A8JH 1U8MB 4WI6A 2X4RB 4Y1AB 1CF8L 1FFNB 4NC1C 4LCWD 5DC0A 1ZE3C 1GXEA 3L9RA 5T1MB 2X4TA 3STBA 3DRQB 4RGOH 5DJ6A 1EFXB 3TYFA 3WFBH 2Q3ZA 5E8PB 1F11B 4P2QD 3TYGL 5I9QC 4OF6A 5JR1H 2DJ4A 5L6YH 3LV3B 3P4OA 3BX7C 3INUL 4M6AA 3U79A 4KVCL 5IEKB 1G9ML 3FN0H 4YXKL 5CBAB 1UXWB 2NY3B 3L3DA 3MRIA 3PXHA 2NY4D 4OLVH 5FYJE 1UWXK 4JFOB 3CZFA 3DVFA 2O93L 1I9JH 3JV0A 1L7TL 4ODSH 3MCKB 3OGOE 4WDIA 5FYKD 5HVFB 1INQA 4X6DE 3IDUA 5D2NE 5GGSY 1TIUA 4KZDL 4P2QE 4PRPB 2BVPA 4DCQB 1NAMB 5JO5B 3LAFA 4BSVA 1ZSDB 4OFYA 5BJTA 3QHFL 1DLHB 2O5YL 4FXKB 3N1QC 4Y4FC 2P45B 4NZTL 2MNUA 3T4AB 5IBLD 5E4EB 5HHNB 2YD9A 1VEOA 4JG0L 1D3CA 4Y4KA 4MWFB 2DTMH 2P5WB 5IF0A 4KJYA 1BFVL 1P4IH 3MO1A 2GYSA 3TT1H 2VN4A 4JLRB 3P73A 1D6VL 5IB3A 5F7NC 4QRUB 3AS0A 3PWUB 2HT4D 2W38A 4PRID 5F44A 4ZXBB 2FYYA 3SDDD 3QEQA 3WLWD 1V5JA 3PGCB 4IRZL 4HAFA 5EWIL 1NCCH 3ARBC 2H2PD 4LPXA 4DKAA 1OF2B 3RL2A 1DANU 2HT2D 3PP3K 2J5LB 3DX8B 5EU4A 4U2YA 1A4KA 2XZCL 3O0RL 5J8OA 1S7QA 4MNHB 5D4QA 4YEFA 4L9LC 1OAXH 2ITCB 1U8MA 2QQKH 4U1KB 3PWVA 1QLEL 2OXGA 4G6AD 3ULVE 4XNZC 3BZDA 4IRJD 4TVSa 3WFBL 4G7VH 5AWNL 4KKLC 3RA7H 2X4QA 5C0FB 1EEZA 3CFKB 3PWPB 2G2RA 2NCMA 2QSQA 3IETB 1NCNA 1UB6A 2E27L 3FKUS 4LSRH 3RWJB 5E5MA 1CF8H 4QRQA 2HP4A 4M7ZB 4MJID 1MQKH 5CINH 1PVHA 4ZOBA 2HKHL 3H7BA 1YY8B 3Q1SH 3CX5K 3QUKA 1G7IA 4M6ML 3V52L 5DRWB 3WN5B 5LGJB 1JBJA 4U1JB 3WYRA 3KPSE 3ZTJH 5IHZA 4FQ2H 4O4YH 3VGAC 3LSOA 1JNHB 4NO5B 2G9HA 4PJFA 5E6IA 4P49A 3O8XC 1OTSD 2R9HD 1XCQB 3VFOB 1NLDH 2UZIL 4EIGB 3L7EB 4ZPVA 4JZJB 1ZTXH 4PJ8B 1NEZG 1YDPA 4XCCH 1I3GH 1C12B 2W1NA 4YPGB 1WBYB 4PJBB 4FQXD 4OCSH 1BZ9A 4JKPL 3HMWH 5C08A 1OAKH 2ENYA 2EXYD 4CAGA 4M48L 2OTPA 4RFNC 1JPTL 4R3SA 1AGEB 1I9IH 4ZTOH 1U3HC 4E5XA 1N6VA 4H20L 1RQ5A 4HIJB 4NHUA 5MEOA 1S5IL 5HDOA 5TDOB 5FCUL 2VXTL 2V2TA 3EGSA 5HDQH 1P2CB 2VQ1A 3AAZA 3RVUD 4OUOA 4Y4FA 5DSCB 4RWYL 2EDBA 3PABA 5BS0A 1HYSC 1AQDB 2DLFL 1A4JB 2A9NH 5GJTH 4FRWA 4X6BA 5TDPB 5JIPA 2P8MB 4HD9A 5K9JH 5D1XC 2VLRB 4PGEB 1MCJA 1PEZA 4MYWB 4ZUVB 4CW1A 5I1JL 1DBMH 2QL1A 3LPWA 1DUYB 1X7QA 5DRZB 4PJXB 1U8IB 2AK4D 2Q6WA 2IEPA 5ACZA 3MJ9A 2BNUA 4Y19B 4HWZA 1G6RA 2XRAH 3NPSC 4PJHB 1MY7A 2FWOA 2A74B 3K80A 3A67L 1FV1B 5C0RH 5F7UA 5KS9B 1DBKL 5C9KA 3GSWB 2F5AH 5EUKA 3I6KA 1WIOA 1F11A 4M43H 3EBAA 4OQTH 3ILPB 1T5WA 4FMFA 4U1HB 5IW6B 2AGJL 2R4RH 3S7GA 3MRGB 5DJAA 3S34H 4WEBL 1T04A 4JO2L 2MFNA 2PTVA 3TPUB 4F15C 3DVGA 1UQSA 4CVXB 1UXSA 4OB5L 3IGAA 3KWWA 3KYMA 4FQ1L 5IMKA 5DRWA 4KJWD 3CPLB 3WN5A 5LGJA 1NFDB 1ZANH 3VGFA 4DN3L 1INDL 3PIQA 5IW1B 1W8NA 4F58L 4YDLB 5BVPH 2R39A 4NOFA 5EC1A 3MRKB 5KSUA 2RFXB 1IQDA 4NBXB 2H8PB 1DBAL 3VXSE 3KYNA 1CXHA 1F4HA 3FQRA 5LGHH 4ZOEA 4PRDB 3AMLA 3PNWB 2NZ9C 2HLAB 2XKNB 5GJSH 5K9KB 1JYVA 3QFJA 4MB4A 2NQCA 1CE6A 4CMHB 4P9ML 1OGTB 1T2QL 3BISA 4UT6H 2WLYA 3LS4L 4CMMB 5LWYH 3WMSA 2FEDD 1FNEA 5D1QA 1G6VK 2EE6A 1GGYA 2LAGB 5DMIH 1JGVH 4YBQC 3GDBA 5JUEL 5DD1H 1G7JB 4WHYG 3G5YB 1NGZB 4QRUA 5C70A 5JO5A 2VXQH 2QSTA 2AV7B 4JFQB 1MJ8H 3NZ8A 1UA6L 2H9GB 2KKQA 4Y16B 3MCG1 3C6LC 3DMMD 4ZTPL 4APQA 2EE2A 2FL5A 5GS1A 2XV6B 4X0KA 2Q7YA 1KULA 5ACLA 1SVCP 4KDWA 4PJCE 4IDJL 4M3KB 5FYKL 4ZODA 2E6QA 3KPNB 1W0VA 1U2HA 2XN9E 1NGXA 2EE9A 1KXTB 3REVB 3QJFB 4G5ZH 4KTEH 4BUHA 3DARA 3S4SA 3BFOA 4LVEA 5JHDA 4X9GA 1BZ7A 1I4FB 4HUMB 3QT2A 3DVNB 2X4UB 4O5LH 4NO2A 1GJIA 4XVSL 3N1MC 4R90L 5CSZB 5IOPA 3IU4L 1K3IA 4PB9H 4P3CL 4DUWA 5HYJD 4PP2A 1HCVA 4LMQI 4FP8H 3G5VA 1F6AA 2YA2A 1MFAL 4HKBB 4PRNB 3B3IB 5E70A 3FB5A 1KB5H 3RBSA 3MRJA 4LDEB 2CJUL 4NOBA 5EOTB 1A4KB 2D7PA 3MRBB 2F15A 3CPLA 3VRLF 4TQEH 1HZHL 3RWFA 2Q8AH 1XGRB 3O6KH 5ADOL 4HJJL 3LN4A 3N85H 5CJXA 4GUPA 1IILE 3KPRA 4JFYB 4LU5L 5DEZA 2EEBA 5J0BA 4M7KL 1CE1L 1KC5H 3MLXH 5CLTA 3LRGA 3CCHA 1Q38A 1NCDH 4MXWH 5IB4B 1QRNE 4QO1A 4WI3A 2NXZD 3WNPA 4JG1H 5FGBC 3E6HA 3OHXB 3U2SA 4L8CA 1U95B 4U1GC 2VLMD 4HK0A 5ALCH 5IVNA 3QUXD 3NABH 3FRUB 1OF2A 2BY3A 1RV6X 4BSJA 3QEUA 1U0QA 1UZ6F 2I60L 1LO3L 1LP9F 3DX9A 1BD2B 2F54A 5JPNA 4M62H 1CGYA 3OKKA 3UTPE 2A6JA 3QG7L 4YDIL 1IC7L 1TCRB 3T08A 2VLRE 4HS6B 1HYRC 3OB8A 1I8IA 3PGFH 4YX2L 3GMMA 4BFEA 1F4YH 3A6BH 2Q76A 4IOFD 1LNUA 1GIGH 1YEGL 5I1EL 3BP5B 35C8H 5HHPA 1IRAY 3ZYZA 3DYMA 4YQXL 4JKLA 4LAQH 5I15L 3CFDB 3SKNA 2XTJB 1KBGH 4JN1H 1HCFX 3WJJA 4L3AA 1PLGL 2RCSL 4Q9CA 3FQTB 3IDMA 2BSRB 3ROLA 3W39B 4AEHH 5F8RC 3S97C 4K23L 2CKBA 3SKUD 2FBOJ 4LOUC 3P0GB 4MDJA 3PWJB 4XP5L 1J0IA 1X5FA 4HUNB 1FCGA 3BMWA 1PZUB 4WNQB 2IPKB 4E9LA 2CXGA 3MGTA 4HXBL 1CD1B 1UM4L 4PJFB 4JFHE 3UTTE 4JQVA 3PL6C 4MB3A 1HI6A 4P5TB 5JTWA 3JV4A 2O5ZH 1TENA 3DXAA 1OD7A 2J88H 3QEHB 1I1FA 1I8MB 1JHLL 3I3EA 4HWEL 3FOLB 4HJJH 3SE3C 3K8LA 2DS4A 5HYFA 4G43B 3ARVA 3ISWA 1I1AD 3ECBA 4OCMC 2XNAB 1QRNA 4YR6B 5DJDA 5C2BL 4NHCL 4J3VA 4I2XE 3V0VB 2VXSL 2FX9H 1KV3A 2V7HB 4OZHE 1LWRA 4X7SH 4O58L 1LD9A 1IVLA 1KIRA 2AXHA 5HGGS 2FDBP 1XZ0B 2H1PL 5EOQL 1C5CH 1G9MC 4XGZA 4Z7WB 5D71H 4JQVC 3EJJX 3KYMB 4JO3H 4H88L 3WFCH 4RSVA 4KJQC 4NJAH 1S9KC 1KACB 5CP7B 4XPFH 4ZDHB 5HGBA 3C87A 3DX8A 1P5UA 3DV6A 1IGIL 2A0LC 3QQ9C 1BGXH 4PGDB 4PJ9C 4Y2DA 4NQEE 5B38B 2NYYD 4ESKA 4RRPG 3ZL4H 2HLAA 1G6RB 3ULUH 3BT2L 4LCYA 2GITA 2G5BA 4G8IB 1YN7B 1IL1A 5KVFH 2IF7A 4Z7VA 4LLAA 4CN1A 3CH1A 1B2WH 1OLLA 1U8JB 1QLFB 1X44A 3FHAA 5D5ME 1IKFH 5CEZL 2QQLH 3UPRB 5E9DA 3OGCB 1DR9A 5JOEA 1HWGB 1PSKL 1UXSB 1QYGL 1F3DH 3TZVB 4LVNB 2UZXB 5K59F 4WI2A 1K9TA 4WTXA 2WMPA 3MJGX 3W0WD 3VA6A 3WNLA 5MEPA 1NBZA 2DQIH 5DURD 4DK6A 1BX2A 1EBAA 4OZ4B 1CN4A 5JXEC 4Z7UF 2KDGA 4S1DD 4MXVF 4PJFE 1QFWI 3LPFA 1YNTA 5CJXC 4F7PB 5HHXL 1VFAB 1FRGH 5DDHB 1HKLH 1XAUA 43C9B 1IGIH 4ZNEE 4Z76B 4ZPVB 2BXZA 3BKJL 4KDTA 4QOKA 4RIRA 5FM5O 2PN5A 5HY9B 1FAKT 5DHVA 5E08L 4ZPTB 5HD8D 1F2XK 1SJXA 4YHMH 1AGFA 2WBKA 4R4BB 1F4XL 1G7HA 4OUUB 1S8DA 5JW3L 3ULSA 3T3ME 5CEXB 1HQ4A 2JJSA 4YZFF 2XFXB 4L1DA 4M8VA 1C7TA 4OKVA 3QIWD 1OARH 1ZA6A 2AXFB 5FM4A 1NANI 1NMBH 3UBXB 4ERSL 2PYEB 3Q6FB 5D1XB 5T1KA 4U0RB 2J2ZA 2ORBH 2VLME 5HVHB 3HPJB 3S88L 5AAMA 4U6VL 4BSWB 1V7NH 2CRIA 1KPVB 3WLBA 4P57A 4U1GB 3MROA 4CDHA 4K94L 4WRLA 4RNRB 1R3KA 4QT5A 1YMHA 4M48H 3VCLB 2GJZB 2Y5TB 3F7PC 3QH3A 3FB5B 2OR7A 4M7JH 5IFHL 4JPWL 3RX8A 4HCRL 5FV1L 3GK8H 4OCXH 4JO1H 3ARYA 1BWMA 4G9FD 3ZE2F 3K3QA 1SM3L 1MFDH 4C4KT 2Y07L 2B5IC 5FOBB 5CJ8A 1SMOA 4OM0H 4KJYB 3QDME 1RUPH 5FYJL 4JHAH 5EU3B 3C09C 3UTPD 1JVKA 1MCHA 3PGFL 3MRRA 1S9WA 4BFIB 5DEFB 1DEEA 4HW6A 4JFHD 1N6UA 5TF1H 3MSPA 4ZS7H 3V6OA 1G84A 2CKBB 3OKDA 3QG6A 4I0PC 1JZ5A 4X80H 1JMZA 2MKLC 3RL2B 5D6DA 5C0EB 3EKCA 4U05A 4AYFA 4WFFE 3KPRD 2JCCA 2Y9RT 4LLUB 3TEUA 4Z77B 1YA5A 2RB8A 3NMEA 4WWKA 2P1YA 4IIQB 1NEZA 4YDVB 1I9JL 4OBRA 2ARJQ 3W9EA 3MRCB 2J8UF 4F7CB 4XPBH 5I71C 2Y7QB 2X70B 5IHLB 2FD6H 1G9MH 4YXKH 5IG7B 3DXAD 1KPRA 4OSUH 4U3CA 5JW5A 4G9FE 3REWA 5MEQA 1KN4H 3DGCR 3DRQA 3IFPA 2Q3AA 4JZOB 4TTDC 5F9OL 3F5WB 5FYLD 1NGXB 3C60D 1RZJL 3R8QA 3OX8A 1RJCA 5K9OB 3O4LE 3QJHB 3P9LB 1SHMA 3B4NA 5F1NA 3ZDXF 3NCYS 3VH8G 1SBSL 2Q1EA 3ZKMC 3IU4H 3TNNA 1I8LC 4H1LH 4HBCL 4U1IA 2ZNXA 1G7MB 5CP3A 3UXFA 1Z5LB 5E9DB 1FNLA 3VWJC 3MRMB 5DFVC 1DQMH 1VDGA 2DTML 5DVLA 4DVRL 1LO0L 5C09D 3QRGH 5F21B 3QR2A 3QDJD 1U8OA 2YKLH 4D0CA 3MCLL 4XC3H 2ADIA 3HG1E 1BPVA 4KAQL 3U0WH 3LN4B 3O9WB 3VFTA 3KYOA 1Z9SA 5IV2A 2VXVL 4LIQE 4G8IA 4XVUC 1IL1B 4LRIC 1PG7X 1V7ML 2DD8L 2HTKD 1JRHL 4GG6F 4OCXL 4DFIA 5T33H 4LRIA 4YPJA 3UPAA 1WWCA 4HUWB 3U6RA 4MNQA 1JGDA 4S1RH 5ID1B 1D5XB 1AO7D 3G08B 3MLRL 4NO0A 1XZ0A 4O02L 1YNKH 2ZUQB 3MNZB 5J4MA 3D69B 2C7UA 4JM2F 2E9WA 3AREA 2YRZA 5DMIL 2B1AL 4ZFZB 1CLYL 3VI3E 4WI4A 2D9QB 5T3ZD 1XIWD 3SKMB 1U3HA 3GHEL 1R3LB 1G7HB 4OUUA 1OP9A 3OAYK 3GEWB 5FO7B 4FFVC 3O2VH 2BNRD 3OJ2C 5LKNA 2KQNA 5CGYC 3FFCA 2VDPH 3RX5A 4ZAKA 2W9EH 3RZCA 3QPXH 1T22B 4JQXA 4R4NC 1ZVYA 8FABA 1EERB 2GCYA 3GMRB 4C56E 3U46A 2CMRL 1T5XB 3L5IA 1FLRH 3RRQA 4F8TA 5C2UB 1TJIH 3FB7B 4Q2ZB 3ULSB 2AKRB 3LD8B 3LQZB 3ROOB 3R4DA 5C6PB 4L4VA 1PG7L 4RMUA 3MFGB 1MHCB 1YY8A 2FJHA 3QNYA 3HI1B 3OV6A 4WNQA 4UQ3B 1YEFH 1R3JB 3MGTB 3P11L 1RUML 1V3KA 1CU4L 5JIKA 4MJ2A 3EDKA 2R23A 5F7WC 5DZNA 1JPGA 5KJRL 5J12C 4JFDE 1B3JA 4QXGL 3MJ9L 3LMJL 4HUVB 2B0SH 5F70A 1CGTA 1T2JA 3VXSD 4BZ1L 3O9WA 3VFTB 5FKPB 1IGJA 4P4KB 2ADGB 1NBVL 4PJ8A 5CJOH 3G9VA 1CICD 1EHNA 4PV9B 1KN2L 1MHEB 2FEEL 5CZKA 1M4KA 5DMGC 1RZ8B 1YMMB 5FCUH 1LO5A 1Y18B 5T1LB 3RU8L 3BESR 3IXAB 2JJUA 5EORH 1OAKL 4WI8A 1KIRB 5INCA 3DYOA 3DUUA 1T4KA 4R7NA 1HSBB 2EZ0C 3QUYD 2WW8A 3WV0A 3WIHH 3D39D 1D5MB 1DQLH 4XMKL 2GK0A 1EZVX 2ZJSH 5M94B 2AK4E 1BGXL 1NCWH 4NC1E 4PY8J 3BZFA 5C6TH 4FQPA 4NQEA 1AD0B 1S7SA 1C08B 3MUGA 2L7JA 4HP