3ZDZE

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 38
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE02
1QSFA 4HKZA 1N0XH 3B43A 4FQPA 5EU5B 5FYKL 1LO4L 1ZKAA 4G80A 4UMGA 1ETZB 3STZA 5EZJA 2NY3C 4R7NB 4NQUA 1Q0XH 1KOAA 3TM6A 1B2WL 2ESVB 3BN9D 5F96L 1XF3A 1NCTA 3BMVA 4V1DD 3ZL4H 4K8RC 5MEPA 1PX3A 2VXUL 4MX7B 3DIFA 3LEVL 3BD5A 1QNZL 3KYNA 5A2KH 4KQ3L 1UKSA 1IAIL 4OLXL 5ALCH 3K1KC 5EU5A 3MNWB 4Z7WF 4K7PH 2XNAB 4JFFB 5D9SB 3SKMB 4Q6IC 5DA4A 2CGRL 4EI5C 3MTRA 1FNFA 4R7NA 4Z7OE 4TTDC 2VLJD 2IALA 3BPCA 5C2UB 3ZE0F 3OPZH 2ESVA 1QO3B 1VACB 2W0LA 3DECA 4XVTL 3P9LB 1IC4H 5FUCC 4ZDHB 3BP7B 1MCNA 2BSTB 3VA2C 4D3CL 1WBYB 3A6BH 1L6ZA 3L7EB 4J23A 1IKFH 5D6DC 1MI5E 3V2AR 4DKDC 5FHBL 5BMFH 4NGHL 5ANMB 5F1OB 3I3DA 3PG2A 4KK5D 2C9AA 1MJUL 1X7QB 2XNAA 4JFFA 1I1AC 2IPKB 4MLSA 3PHQB 3SKMA 3M45A 4F7PB 1J86A 3X17A 5IP4A 1KN4H 3EJYD 4LSSH 1FH5H 1VACA 3BP6B 5FDYA 2XRAH 3K2MC 5E99L 3P9LA 1HYSC 4M6ML 4YFEA 1A2YA 2BSTA 3L7EA 1FVCB 2E7HA 1SJHB 5B4MC 5J9PA 5GRVK 1ACZA 4NRZA 5ANMA 5D7KE 3P0YL 1HNGA 2OMNA 3PABB 1S8DA 4PJIB 5JHDB 1X7QA 5AZEL 2BRRL 2IPKA 3NMEA 3GSQB 5E7BA 5BOZG 4F7PA 5I8EA 2FJHB 4AENB 3VRJA 3KGRA 2NXZD 5TDNB 3FT2A 1MIEL 1JF1B 4QNPF 1JGDB 2EDOA 1VEOA 3IAGC 1DBKL 3S5LB 5HPMB 1MCWW 1QSZA 1YEKH 3WIIL 1TVBA 5F9OH 1F90H 3QXAB 3T8XB 4DZBB 1G7QB 2YPLD 1FPTL 1SJHA 1X5AA 1M6OB 3MPCA 1CZ8H 3RNKB 3WE6B 2PO6B 1CE1H 3PABA 4PJIA 5JHDA 1HQ4B 2B7DT 4ZFZB 1URLA 3MBEB 1MCEA 2Q8BH 5HDQL 4NUGL 3U2SB 3K1DA 4XGZA 1A9EB 1Q9KB 3RVXD 3UC0H 1JF1A 1JGDA 3LDBB 4HZLB 4YHZH 1EO8L 2WAHA 3U0PB 3K7UA 3BKYH 5DMGC 1EZVX 5HHNB 2VXQH 4KV5F 3MBXL 1NCAH 3QXAA 3NFSH 3IAQA 3KYKL 4PJEF 4DZBA 1Q9LB 1U8HA 4HBCH 4AL8H 1EFXD 5GRJL 4JANA 2IAMA 1EAPA 1FRGL 1A1OB 4ZFZA 4AEIH 3CZFB 3U2SA 1AC0A 1G7IA 4G9FD 4DJMA 1A9EA 1Q9KA 2EYRB 1YJDC 3EOBB 4JR9L 4HZLA 5D2NB 3IJYB 3MYJB 2B20A 3GSOB 4DZ8B 1K8DA 1QFPA 3N50A 1RIVH 2P4AB 3MOQA 1Q9LA 4CMHC 1D5IH 1YN6B 4PBWD 2VLKE 5GRUH 3HUJB 3T4YB 4S0TD 4P2CG 4WCYL 1A1OA 4IDLA 4YLQT 3LRHA 5FOJA 4K3EL 5GGVH 4OQTL 2Z31D 1KCSH 3OHXA 1U0QA 4P59L 5EG6C 3ARBD 2EYRA 3CFBB 3JTSB 3EOBA 4JRYD 2X2YA 4XNZC 3IJYA 1J0JA 3GSOA 3R06A 4DZ8A 4NT6B 3SE3A 2DQCH 3EHBC 2JK5A 1YN6A 3D39D 1GXEA 4IDJL 1L7TH 4YEFA 3Q6FB 4K3HA 5BS0B 5J1SC 3RJQB 2OSLB 4ZO6A 4LRNL 4LVNB 3KJ4C 1J88A 2GFBB 1ZHNA 3SGJA 2XPGB 4D0CA 1RJLB 2MCPH 4U0RC 3BAEH 3MV7E 3ZTNH 4P2RB 2VYRE 1LP9E 3JTSA 3MZGB 4UT7H 1S7SA 2LQRA 4NWTH 1KELH 3DV4A 2JELH 3ARTA 4RRPG 3UZQA 1UKQA 4S1QH 3EIFA 3HPLA 3EDKA 3MODH 4JO3L 2VQTA 1KNOA 5BS0A 5DHVH 5I74B 5ADPL 1S9XA 2OSLA 1JJUA 2IFFH 1I1FA 3A6CH 4NRYB 1AKJB 2XPGA 2XZQH 1P84J 4HQQH 4LHJB 5B38G 2MJWA 4Q0XL 3IDIB 3VXUB 4P2RA 1RUAL 3FMGL 2IMNA 1FG9C 1BQLH 1QYGH 2XTJC 4ALAH 3GSXB 1CFBA 3GMLB 4ZXBD 4HIJA 5T3XD 4FZEL 3TV3L 2G60L 2MWCA 4HWBH 5IB2B 4NN5B 1MHPL 4TVPD 4CW1A 4BH8A 2EYTA 3PXJA 4H1LA 4EDWH 1AQKH 5IBLC 3EYFB 4IRSD 2ITDA 2D0GA 3BGFC 1MCCA 1EMTL 3VXUA 5BV7L 4GMSL 2VO5A 1JNLL 1U58B 1Y18B 1I1YB 2APTA 3GSXA 3MXVH 3DTXB 3QG7H 4ZS6C 1Z3GL 3NN8B 2R0WH 4EN3D 2GSGB 1FZKB 3LKQB 3VFPA 4UNTA 1NBVH 1VGEL 1Q9OB 1NC2A 4XCEA 2WP3T 5DHXB 2P5ED 3EYFA 1E0OB 1FGVH 2VQ1A 2W92A 3F7RA 2PYEA 2CQVA 4ETQB 2DQIH 3IJSB 4Y5VB 4GXVH 3PL6A 1PJ9A 4S1RL 2RGSA 1GC1H 1I1YA 2DI8A 1WTGT 4R26H 4PD4K 3NN8A 3D9AL 1CN4A 2R4RH 2GSGA 5CKGA 2PR4H 1FZKA 1DN0B 1GPOL 1KJMB 3BGMB 1PKQB 5BXFB 1CFQB 1Q9OA 4NFBA 4Z7WA 3V8CA 1MRDH 1TJIL 2DI9A 1OCWL 3T0EB 2VZTA 2R1XB 3VD4A 4FN0A 4WTZA 5EPMB 3C8HA 1J8HB 3MV9D 3IJSA 2JJUA 4B53A 3EYUL 2PXYB 4Y5VA 1K6QH 4LQ1A 4BZ2H 4XCYB 4HUXB 2DIJA 3QIWD 3WO3B 2F19L 4N1EA 2A73A 4FXKB 1PKQA 2AJSL 1BP3B 4XVSL 5KZCD 3L5XH 4HPOH 3PIQB 4G7YL 4HC1A 2BDNL 3LPGA 3ARDC 2R1XA 1QHPA 5DQDL 4OLUL 5EPMA 2BSSB 1J8HA 2EXWD 2FIKA 3HE6C 1BOYA 3GHEH 2FH8A 4QHNA 3B9KD 4HWBA 4KH2A 4KKCC 2ARWA 3CDGB 4NZDA 4XCYA 1FGNL 3FN9A 3P11L 3SGEH 3IJHB 2HT4C 3NGBC 2JJTA 4FXKA 1A14L 4F7MB 4Y5XA 1A7QL 2AXFA 4XH2B 4FMKA 1G7MB 3PIQA 3IXAA 3QDJA 4K23L 3OKLA 4WW2C 5I75B 5KVEL 3FHQA 25C8L 4YHKL 3EOTH 1HIML 2BSSA 2H6PA 3STLB 2J88L 3QIUD 1M4KA 3VWKB 4OV5B 4PGJA 1MCPH 5KVFH 5C0RL 3GRWL 3D85D 3VXNB 5J8OA 3HRZB 1IM9B 2G2RA 4PLJD 4PJEB 3QXUA 5DK2B 1H8SA 4M7ZB 4F7MA 3OKNA 4M1CC 3V4UH 4JGJA 3HMWL 5FCSH 5FYJL 3RL1A 1SM3H 3SKJL 3DNKA 3GKWL 3ARFD 4KKNA 3BESR 1M1SA 1J5OL 1I8MB 1INEL 5C3TA 4PJXB 4PJ9D 5EUOB 5GS0D 1IILE 4LLYB 2PCPB 3RDTA 4DVBB 4OV5A 4GS7C 2ADJA 3VCLA 2AXJA 1TDQA 3BKMH 3VXNA 5D1QA 3M1BA 4PYGA 4PJEA 5C92A 5DK2A 1C1EH 3QHZL 1DUYB 1QG3A 1NL0L 2EH7H 3NACH 5JR1L 5IMOB 4R96B 4PRID 1AI1L 5C86A 3ESUF 1W8OA 3MFFA 4CVXA 1W0YT 2IJ0C 4NKOA 4LLYA 2AGJH 4I5BB 3VE0A 1JYWA 3KYMB 2MQCA 3HC3L 2F53D 1S7XB 2VC2H 1KPRA 3O6FC 2E6PA 1J12A 3RFZC 4HKJA 1GGBH 2R4SL 1T0MA 4KKAD 3L5IA 4N0FA 4NQVA 1DVFD 5TE6L 1IGTB 5BRZB 2OQJA 1ZANH 5CD5C 5IMOA 4R96A 1X5GA 5FA3B 3O6LL 5EUKB 4QRUB 1CF8H 4I5BA 4KAQL 1OL0A 2XG5A 1QSEB 3NPSB 5DJZB 1LD9B 3QQ9C 3KYMA 1Y6NR 1A3LL 5I1JH 1FSKB 4JFOA 5DC9B 3TA3B 2VXTH 3MRHA 3U4EA 2AEWA 4HKXB 3RY5A 4YDJB 3X11A 2D7TH 5LJYH 1MAML 1DBML 5J06A 5KVDL 2D03H 1II4E 2CMRL 1AR2A 3TNMB 2VZVA 1QSEA 5MI0B 1LD9A 3JUYA 3OJVC 3Q3GB 1B2WH 3OR6B 5IGXH 3ROLB 3CSYB 2DM2A 1ZLWH 4RGNB 4P3CL 3TA3A 2ZCHL 3ZKQD 4L3ED 3IT8D 4U7KA 1TITA 4YGAB 5MERB 5SWZB 3TNNA 1U8JA 4NO0B 3S6CA 1AGEA 2BNUB 4UQ3B 2W38A 3TJEL 5CLWA 1VPOL 3MCLH 5K9OB 1IGFL 4HKXA 4KQ3H 4OLXH 2F15A 4PJ7B 4YDJA 5IHBA 2PF6A 2E3VA 4K9EC 3V4VH 3X3FH 2CGRH 3HE7C 3U4AA 3VXTA 4ZPTB 3QRFM 2NY5H 4O9HH 3Q3GA 5KW9L 1DQTA 2Z9TA 1R0AL 4G9DB 4ODUB 4XVTH 3CSYA 3OKKA 1E6OL 4FFWC 5IBUG 5MERA 1J1XH 4BSWB 1TQCB 4D3CH 1D9KD 4NM8L 5DJAB 5CFHA 2AK4E 5IFJA 4KZDL 3C5ZC 4UQ3A 3ARQA 5EIIA 2HG5B 3L7FB 4X6FB 2YHGA 3KAAA 4NGHH 3ILPA 4PJ7A 4JHBA 3VRLF 4MS8D 4DCQB 3JXAA 3UXFA 4IM8A 4WU7B 2X4PA 1W0WA 1UC6A 4LCCB 3O45B 3VRIB 3LKNB 1LILA 4ELMB 4MAYD 3KG5A 3T1FB 3TO4A 3DV6A 2W9EH 4PJ8D 3EO0A 4GG6E 4U05A 1LE9B 4TTGA 1GSMA 3FQRB 3S34L 1IC1A 3DI2B 4AIZB 2HG5A 4X6FA 5BVPL 4U6YA 2EIBA 2GJJA 5FB8A 5AZEH 2O61B 4N9GA 5EDXA 1DLFH 3WLWD 4LCCA 1LDSA 3K8LA 2NXYD 4H1LG 1C7SA 3LKNA 3SCMB 1MIEH 3C2AH 3RVVC 1RZKH 4WFHE 3T1FA 5IB5A 5GSRB 2E27L 1CICD 3BSZH 4L9LC 3C8KB 3MSPA 3FAXA 4U7SA 1LE9A 1B88A 1RIUH 4M8VA 4AIZA 2D7NA 4KJPD 4QO1A 5F1SA 4JREC 2CKNA 5JPMB 1MJ7L 3QEQD 3TIEB 2O61A 5C8JA 3GKZA 4NKIL 1UGNA 2LTQC 1BD2E 4BM7A 5C08E 5DR5L 1OW0A 3NTCL 3SCMA 2HWZL 3BN3B 1HINL 2FECL 5T3ZL 3FB8B 1SJEB 1ED3B 1CFSA 2V6HA 2K7QA 3MBXH 4PJCE 1RD6A 5IJKC 4HWUA 1UXSB 5DQ9B 1E4KC 3QPQC 3SPVB 2V2WA 5GRJH 5KANG 3T0XA 2G9HA 5JPMA 4JFPA 3TIEA 1R5VA 2A38A 1P7QD 1HK6A 4EI6B 1DDHA 3VXQB 5HI3D 5ITBH 1NLBL 2CIIA 1MH5A 1FYTE 2M8XA 2NY4B 2NW2A 3FOLA 2WBJC 3KPOB 4JR9H 3OTTA 3FB8A 3L5HA 1I3VA 3PWPB 4PJAF 1EPFA 1IL1B 3FZUC 2BNRB 2Q87A 4UQ2B 1UXSA 2C4FT 1ES0B 3SPVA 5KS9E 3D18B 2QADC 4TQEH 3ULUL 4L8DB 4WCYH 4G6JL 4EVNB 4Y19A 2VUOA 3V5DB 1XGUB 4EI6A 2P8PB 3FT3B 4LDOB 3ZE1E 3RZCB 1XF1A 4ZTPL 2R2BB 4IBLT 5F3HA 1YQVH 5DGRA 2YPVL 3PWPA 4QRPA 3LD8C 3QUXD 4LLUB 3AB0C 4KTEL 5BOPA 2RCSL 2A2QT 2IQ9L 1J05B 1RU9L 4OZGE 4Z7VF 1EGJL 3D18A 4GKNB 2HVJB 3DRTA 1CT8A 4NFDA 5JW4Q 3ZKND 4POZD 1MCSA 3V5DA 4QRTB 4OT1H 1IQDB 1S78D 1XGUA 4AMKL 3W82A 4E42B 3FT3A 4GJTB 3J7HA 2JB6B 3BQUA 1JGEA 3B2UD 5HHMB 3RZCA 2VDLL 2R2BA 4Y2DD 4ZG1A 3H7LA 1LEKB 2OK0L 4KRPD 1WJ3A 4N0UA 4WENB 1WZ1L 2M26A 3CH1B 4XP1L 4JO3H 4DFHA 3U7WL 43C9A 2D4DA 4GKNA 4TUOA 3TPUB 5HVHB 3KPLB 5C09A 4QRTA 5K9KB 4E42A 1BQHA 4YHYB 2VLJB 4RIRA 3MCG1 4Q0XH 5JORA 1FDLL 2XA8L 1LEKA 3FN0L 1A7BA 1G0YR 2EDTA 3O6ML 2GT9B 3GMOB 3QDME 4WW1B 1JGVL 5TDPB 2FGZA 1WZLA 4E9LA 3CH1A 4FZEH 5MEND 3FL7A 2G60H 4S0SD 1MHPH 5C7XH 1NAKH 2BVQB 4XPTH 5L9DH 4EIGB 1Z9OA 3TPUA 5E4EB 2EE2A 1WZKA 3RUGE 2FWOA 1ZHLA 3MO1B 1R5WB 1JNLH 1KB9K 2BZDA 5F6HJ 4N5UA 4WW1A 3LQAC 4G8IB 3LPFA 3IFPA 5JIPA 5FIEA 3IXTB 5HYFA 4OQTA 2YD4A 4DKAA 2BVQA 4JG1H 5IB3A 2YZ1A 4LLDB 5E5MB 5E7FA 3QB7C 5E2UL 2Q7YA 5E8NB 5CJQH 3K74B 3GHBH 3L5WA 3EO9L 3MZTA 4XAWL 4OBRA 3MO1A 2DIBA 3CNKA 3CD4A 2VDQH 5ACZA 4G8IA 3WUWB 2P45B 1U8IA 1ZHBB 3T2OA 4UTBL 3REVB 2YPLB 4N0RA 1OF2A 3C60D 4TSCL 1G0DA 3L6FB 3QDAA 2P44B 4YIQB 4KWUA 2WQRA 4LLDA 5E5MA 4ZUWB 3SGKA 1JP5A 1OCWH 2C3XA 2XQBH 1U2CA 3EO1B 4LSQL 1FYHB 3B9EA 3VD3A 1PSKL 3V6OA 3TN0C 1G6RH 4MA1B 3HPJB 1A7PH 3C5SB 2F19H 4XB8A 3REVA 2LFGA 3NAAL 5KSAD 2WWMD 1QVOA 4UTAL 3QQNA 1RZ8B 3OJMB 4Y4KC 4XVSH 4P3DA 1BVLB 4X4ME 1WUNT 4J3TA 3T2NL 3WJLA 1QBLL 2HKHH 1VA9A 5BV7B 2BDNH 4ZUWA 1NMCC 4N8PA 5DS8B 5DQDH 4Z76B 1KTKE 3EO1A 3TZVA 4P5TC 5IVXB 4G9FB 2KQNA 4XC3L 5FO7B 3BH8B 2BY3A 4XCFL 4TUJB 3EGSB 1HKLL 3HPJA 4NC1E 3P11H 3WN5B 1OGAB 4GRWF 4PRHB 3L3JA 1DBAH 4UBDD 4ONOA 1DL7L 2F9BT 2J8UE 2UV3A 1C5CH 1A14H 3WDIA 4LLWB 1NMAH 4OF3A 1UJ3B 5IHUL 1BAFH 5T3XH 2GJ6D 1YPZF 5DS8A 2FB4H 2J8OA 4FQHB 4DOHE 1S7WB 4LQFL 2HFFB 5CP7B 5FO7A 3JV4B 1SVCP 4WFGD 2VXVL 3VDAA 1HZHH 3VD9A 1X5ZA 1AJ7H 2R0LH 3WEXB 4F15C 2EEBA 5E2JA 4NN7C 4PY7A 1OM3L 4UT9L 2W9LA 3C08H 3WN5A 1OGAA 4PRHA 2CXGA 3MRBB 4KKLD 3P77A 5EULV 1K85A 4HFUL 3RI5K 3PQYB 1CGWA 5E9DE 4XP9H 2APVA 2FNBA 4LLWA 4D9QE 1UJ3A 3HMWH 1KPUB 3GKWH 1BJ1H 1QA9B 4HEME 1RJYB 1J5OH 1S7WA 4MXVF 5DJ8B 5A3IC 1G6RB 1Z6JT 5C0CE 5CP7A 1KCRL 3JV4A 4OCRH 5JO5B 3SKNB 1OOAA 1HOCA 3DYMA 4G8GD 1JNHA 4C56E 4LFHG 5D1XB 3QWRD 4PG9A 4HS3B 2G5RA 3QAZB 4XXDA 1TJHL 2ZZUT 3PQYA 3VJ6B 1NCUA 3QHZH 5M94B 1KPUA 4Z7NF 5JR1H 1CGUA 4XI5D 5SX4I 2OZ4H 5HYJD 2HJFB 1AI1H 1P5VA 1HXMA 4M6NH 3KWWB 1WAAF 3D2UD 4XHJD 4BYHA 4WUUE 5JO5A 1WWAX 1TTFA 1AGDB 4XMKL 2ICWJ 4HK3N 3FB5A 5D1XA 3GI8L 4HS3A 2F54D 4FP8L 4U1JB 2R4SH 3VJ6A 4Q74A 2K9UA 5SWSE 1TFHA 5TE6H 4LFHD 3O2VL 3W0WA 2NX5B 5F7FA 5DMKA 3MV8E 1H3PL 2UZYB 3V0AC 5FGCE 4IRSB 3ZTJH 2HJFA 2M1KA 4OI8A 3O6LH 1KCLA 4Y8AA 2EKSB 4KAQH 3KWWA 3QUYB 1ORSA 5GQBA 3SE4A 1AGDA 2IANE 4B7LA 4PGDB 2YD8A 2QL1A 4JQVA 4EN3B 1I7ZB 3LB6D 3ULUF 3QO0B 3LQZB 3UMTA 3HRPA 1XIWC 4Y4FA 3U30C 5LGJB 4WEBH 1DEEB 2I27N 1CL7L 4ZNEE 4E41E 2EIDA 2NX5A 1NGPH 3CXDL 1I7UB 1MAMH 2VLLA 5KVDH 3MRCA 2Z91B 3GRWA 4W6XB 2EKSA 1CFNB 3QUYA 3MQIA 3UTSE 1CD8A 3G5VB 4JM2D 1T83C 3CLEL 4WY7L 4G6AC 5D2LF 2FO4B 4PGDA 3QO0A 3N85L 4HDIB 4J8RA 4PJHB 4PTUB 2HFGH 3ZHDA 3L9RB 4I0PC 4G6ML 2WUCH 4XPBL 3W39B 4OSUH 5GRXG 4HG4K 4YHMH 4JN1L 5IJVB 2AJ3A 2V5YA 4QHMB 3SDDD 4B7IA 1CFNA 1IARB 3HG1E 4ODTL 2Z93B 4JPWH 2WWKO 3G5VA 3BE1H 4YEEA 5KW9H 1R0AH 1HH6A 2FO4A 2OCFD 1NBZB 4LEXL 5GS0H 1E27A 4WHYG 4HDIA 4HWNA 4OF8A 4PJHA 4PTUA 4PY8I 3L9RA 1BEYL 2LU3A 4NQDB 1TIUA 3GZKA 5F8QC 1AD9B 4OGZA 1GCFA 4HS6B 3NPZB 2HTLD 2HP4A 4NM4H 3T2QA 4OZIE 2I60H 2IQAA 1QLEH 4OGYL 4J3SA 1Q1JL 2Z93A 1JFQH 5KBNC 2GTWB 1BQHG 1NBYB 4XXCC 3QCVL 1NSNH 2V17L 3PE9A 5DVMA 5AG9A 4NQDA 2GK0B 2MPAL 5BVPH 4QGYA 5H37G 3B6SB 1T5WB 3U79A 4QWWC 3RWJA 2ZSVB 4WV1B 5F7EL 3GMNB 4ZUUB 5IOPB 1RPQA 4PR5B 1JPSL 3QIUB 1N7MH 5IB4A 3C9NA 4KRMB 2OI9C 4DTGL 2O5XH 2YD3A 2JCCB 1PG7L 4LDEB 4F37F 3D85B 2B0SH 2E27H 3TBYB 1NCWL 5KAQF 2VDML 1S7RB 3B6SA 2NY7L 1MY5A 4PRBB 4X5LA 4WV1A 3P3YA 4M7KL 3GMNA 4ZUUA 5IOPA 4L8SC 4PR5A 5E2VL 4RFNB 2ZUXA 3DYPA 3ZLQC 3MA7A 2CO6B 4Z7OF 2JCCA 3NTCH 4LHUB 2HWZH 4H8WL 5JMOC 3S97C 2CLVB 1UZ8A 2GITB 5FF6B 3TBYA 4HUWB 4FFZH 2CK0L 1RURH 5DJYA 1U8PA 3RL2A 1F4YL 4NNXA 2VZOA 2Z8SA 1RZJC 1S7RA 2H32H 4PRIB 4PRBA 1MFEH 5CZVL 4I4WB 4X0KA 1NLBH 3CPLA 2A6IB 1KEMH 4LHUA 4QF1B 1FFPA 5BJTB 4MJIB 2CLVA 3P73B 3V8OA 1RIHH 4P46B 4HUWA 3VU2A 1CLZH 1DVFB 4WUKH 3QDGE 3RWHA 5EU7E 7FABL 4BK4A 4HXBH 4RWYL 1A6ZB 4QLRA 4BH7B 1NAML 1GOFA 1YPZA 2UY6A 3WFCH 1MRFL 4BUGA 4ENEC 2NZIA 4ZTPH 5L7XH 2AXHA 4ODXB 5HYQA 4LPVA 3FQWA 1LO5B 4MJIA 2YPVH 4OLYL 4P46A 5BVJA 5F9DC 5LAXB 4ZSOB 2RCSH 2IQ9H 2AKRA 2RIKA 4HWZB 4KXZH 2E7BA 4YHOL 1U8NB 1EGJH 3D0LB 2DQUL 5C0BA 4NCC1 1A6ZA 2A0LD 5FO8B 4AMKH 4Z18A 3IDNA 4AH2B 3H9SB 4P9HC 5K9QG 2VDLH 3GMMB 3HI5H 1CLOL 2VR9A 4QOKA 3O4LD 3W9EB 2ZUQB 4X9FA 1DANT 4C58B 4L3EB 2H32B 4GMTL 4X6CB 5LAXA 3FO2B 4XP1H 1NUFA 4ZSOA 3RIFK 3M8OL 1U8NA 3U7WH 3D0LA 1FL6B 4LSRH 3WIFB 4WI9A 2O5YL 5FO8A 3TT3H 5I76B 2AEQH 4TNVF 5DZOA 3H9SA 1FNSL 5E1HB 1WAAA 4IRJD 4XNQB 2AJVH 3GMMA 4NQEA 1KN2L 4LGRB 1NDMA 4P2OD 2MHAB 4GRLD 1AY1L 2AERT 4GO6B 1VENA 3HAEG 3FO2A 1YEDB 5I15H 3Q5YA 4WI2A 4KK9D 1FL6A 1TQBC 4YDVA 4MWFB 5DK0B 3O9WC 3NCJH 4HF5H 4PFEA 4WO4C 5I76A 2D7QA 1XF5B 2IPUK 1ONQA 1KGCE 2C4XA 3AAZB 4B50A 3C87A 1R24A 1ZEAH 5C07B 3ILQD 4PJ8B 3G6JE 5F44A 4KK8D 4ZOBA 8CGTA 2X4UB 5DD5L 3HFMH 3U9PH 1H5BB 3DUHA 4HJ0C 5DK0A 5C0EB 1ZAGA 4GLRH 4PJ5D 3EW3B 2DD8H 1T22B 2NXYB 3EO9H 2J3SA 3AAZA 3KR3H 1LP9F 2UZIL 1Z0MA 1HQRA 5C07A 1SEQH 1EGJA 2K1MA 4TSAH 1CICB 5F1KC 1PY4A 3KHQA 4UTBH 4X7SL 1QRND 4MCZB 4K8RD 4TSCH 1CGSL 3RP1A 3V9FA 1N6QH 4AQ1B 3DRQB 4MJ6B 4NC1C 3QEQB 2BP3A 2J6EH 1ZHKB 5C0EA 1MREH 3JWDC 3NVQA 4LSQH 3V52L 5C0GA 2Q3AA 4EI5D 4NQCD 5DZNA 3RWIB 4TTDD 4UDTA 5I8OL 4QYOB 2XQYG 5FYLE 3L3KB 4YFLF 15C8H 1ZT1A 1FZMB 3REWA 4X9BA 4MCZA 3SE9L 2IPTL 5HVWA 5T1MB 3DXAD 4K2UH 4JY4B 1QBLH 5EBWA 3DRQA 4MJ6A 2DWDA 1D5XB 4RGOH 4YWGL 5GGRB 3RY6C 5HGBB 2ZPKL 1H0DA 4NN6C 5CBEB 1UACL 4N8VG 1JZ4A 1I1AD 2VLMD 1TNMA 4XWGL 2Z4QB 4DGYL 1I3GL 4AIXA 1MAKA 1F6FB 1GGTA 3BZFB 1INDL 4F7TA 2OP4L 3L3KA 3THML 5LBSH 4JCLA 2VL4A 2HAZA 4Y7MA 3C6SA 5J11C 1HYSD 5TE7L 4WVRA 3WHE1 2WUBH 4JY4A 5AUMB 4F2MA 4XBGB 3DJ9A 2VTFA 5B4MD 5HGBA 4NHUA 4DEPB 4Q9RL 3K80A 1H3WM 4QKXB 1BJMA 4LQFH 3BPLB 4JRXD 1J0IA 2DYPA 4DGVL 1ZTXL 2APWA 3A67L 5F9AC 3OXRB 4Z5RA 3S98A 2AEPH 1K3IA 2Y06L 4KHXH 3QUXB 1RK0A 4X6DB 2IH3B 4CGTA 4NP4L 3WJJC 4HFUH 2NTFA 1IQWH 5AUMA 4WIQA 1MCQA 5D96C 4XBGA 1Y0LB 5ICYB 2J2ZA 3C2SA 5IV2B 1MFNA 4HHAB 1HNFA 5EU6D 4Y2DB 4CADB 1QSFE 4M3KB 3OXRA 4KRPB 2DQJL 3HZKA 2XWBB 2CIKB 1T4KB 5EZOH 4HLZG 3UBXB 2IH3A 4F58L 3GIVB 4WFED 5DMGD 1LNUB 1LO2L 4J2XA 4QRQA 4HUMB 2VXSH 2E8YA 1KTLA 5D7JB 5ICXB 5ICYA 5SWQB 5IV2A 3RGVC 3L3IA 2W9DL 3PGCB 3GMQA 4IIQA 2ZKHL 4HMEA 4FP8H 1W72H 4DK6A 2NW3B 3D6GA 3BPNB 5IR1A 2FHCA 2B1HL 1I8LA 1KCUL 1OAKL 3O2VH 3WXWH 3BRFA 2ESVE 5D7JA 1H3PH 3JVGC 3VFRA 3I02B 4GAJL 1T80A 4DKEH 3PGCA 4LMQE 4XX1G 3S7GA 3I6LD 1H15A 3NH7L 3QHFL 4KTDH 5F89A 1UYWL 2APFA 2C3WA 1DBJL 4JFFE 1OQXA 4PBVC 5F21B 1MQKH 4KUZL 2VAAA 2W0FB 3OQ3B 4MHHI 1KPVA 4LHUG 3HNSL 1G9NC 1CL7H 2EDLA 5LXGL 1XGPB 3EHBD 3OKYA 2VH5H 1M71A 3FFDA 2BK8A 4UT6L 1NC4D 4ZPVA 1U91A 4I18C 5K9JH 5CILL 5FCUL 2NNAB 5ANME 3RWEA 3NZ8B 1NGXB 4YX2L 1BQUA 3T4AA 4MNQB 3EUUA 5EU4B 2DBLL 4ONGL 3N85H 2DDQH 1K2DA 1IZKA 2DMCA 4XBEL 5DSCB 3C60B 3CCHA 1XGPA 3EYSL 4OLZL 5DTFB 2IF7A 2YMXH 4HS8H 4RMWA 3HZYB 1VKXB 3QJFA 2AXGA 2JJSA 3MLWL 3BKJH 4Z6AT 1I3RB 1EEYA 1QR4A 4OCLC 3MLYL 1W72B 4XNUH 2EXYC 3NZ8A 4PJIE 5JHDE 1B0RA 4LIQL 4LOUC 3VWJB 1HHGB 4MNQA 1NQBA 1ERNA 2AQ3A 2XTJD 4FQJH 5DTFA 5BZDB 2WSKA 3WO4C 4JJ5A 5F93C 1H9VA 2WV3A 5IBLD 1I3RA 1I3UA 5GRWA 1NH6A 1JGLH 5HGAB 1EDQA 4YQXL 3OJDB 4OB5L 5J13C 3SOBH 3TPKA 1Q9WB 3VWJA 3VXRD 5GGUB 4PB9H 3AREC 4MA3A 5TPWL 2V17H 1MCRA 5ENWA 4ZS6D 5BZDA 1YNTB 2ZSWA 5JUEL 5C0NC 1OPGH 5ICZB 2ARJB 1DFBL 1JVKA 4O2FA 4KROC 5F7EH 3IDXL 3U4BL 5I8KH 4Z77B 1JPSH 2ICES 5HGAA 3MRQB 1PG7H 4PGEA 3H3PH 4X5WB 1JPTH 5CUSL 4NNPH 3EYOA 3QXDB 2RQ8A 3DMMC 1XMWA 4MB5A 4AQOA 1CLYH 2Y7QB 1YNTA 3I85A 3TEUA 2ARJA 1T20B 4M9OA 3HI1B 4M7KH 3RWDA 4OCXL 4NWUL 5FO9B 1HXYB 5EU7C 3MRQA 3E8UL 2XY2A 1MFBH 4EOWL 1Y6MR 4G8GB 4BQ8A 4X5WA 3QO1A 3BRDA 3ZKSD 3VXSD 2HJKB 1CFTB 4UINL 5F7DB 3L3GB 4Z7UF 2I9TA 5FKAA 1ZGLA 3CVIH 4JFZL 5I1CH 1D5ZB 4Y16C 5HYJB 2BY1A 5CEZE 2L4OA 5CZVH 1IGIH 1T20A 2RBLA 5I1EL 5I8CB 3HI1A 2Z35B 3V6ZB 1KLUB 4Y88A 1CTOA 2FX9H 2YK1H 4QCIA 3LY6A 4MQTB 3ARDD 5BS0E 2BHYA 1NJ9B 3MUJA 3HE6D 4X7FC 2PETA 3FQXB 1DE4B 1KC5L 2HJKA 1CFTA 5EO1B 3OJ2C 3QEHB 4KKCD 4KDTA 4PB0H 4R0LC 5A16B 4M43H 4DKFL 4D8PA 5I1KL 4P2RE 1A22B 1D5ZA 2X41A 2GI7A 2HT4D 2MQ0A 4RWYH 1LK2B 2WANA 2Z35A 2DRUA 4XCCH 2ZOKB 1DN2A 1MRFH 1VDGA 5CZXC 1YNLH 4MZ2A 1NCBH 5C6TH 3QFJA 2YZ8A 1I8KB 2ADFH 3BPOB 3H2WA 5EO1A 2XG4A 3TT1L 2DICA 4U6HB 3D25B 3S88L 4UAOC 3VXUE 2R23B 1ZVHA 2DQUH 1U8LA 3V0VB 5LGHL 3UTTA 4LF3B 4M1CD 4UDUA 1RJZA 3GK8L 5FA4A 1AO7A 3KLHC 4JQXA 1YYML 1FLTX 1TPXB 1S3KH 1CG9B 2EIZB 2X4RB 3FFCA 4JM2B 3DX9A 4M6OH 3CFDB 1G7PB 2X1XR 3TBSA 3A6OA 4X80L 1ZS8B 1I8KA 1NKOA 3BWAA 2PYEE 1MCOH 4PJCF 4LCYB 2BOBB 3D25A 5CJXA 4FG6C 4HWEH 3RPIB 1EHNA 4HUKB 1QFWM 1DUZB 2IWGA 1XGTB 2O5YH 3V0VA 4TNVK 2EYSA 1BOGA 3J8F7 5KAQG 5I6XB 2Z8RA 5ID1B 5JDSB 4G3YH 3SDDB 2BSRB 1FNSH 2EIZA 3W5NA 4GXUN 3QZWB 4OIAA 3CFDA 1G7PA 4JPKL 1S7TA 1KN2H 4Z7WE 4C54A 4LCYA 2OJZH 5F9WC 3O6FD 2DQHL 4BZ1H 1DSFL 2XZZA 1BZQK 3ZE0E 5I19H 2LVEA 2X9YA 1DUZA 3KPRB 3LKSB 4NHCH 2I07B 2G75A 5ID1A 5CD5D 2BSRA 1P9MC 4Z95H 1DQLL 4MB4A 1PKQE 1T0NA 5KOVC 5D1ZB 1QLFB 5I17B 3KNBA 1TZGH 4XNXL 4RMTA 3RA7L 3QQ9D 4YNYB 2X9XA 1NAMA 2IGFL 2NMSA 3TJHD 1J8HE 4L8CB 3MACL 4JHWH 1RUQL 1I9RL 3KPRA 4OFIA 4RWHA 3MGOA 4O5LL 3UTZB 5HI5C 3IFNH 2ZUWA 1DQQB 4CNIB 5D1ZA 5I17A 1YEGL 2UZIH 4IHOA 3QDJE 3KDMB 1MI5D 3GM0A 1IGYB 5KJRH 5FOBA 3GNML 2QQNH 2CKBH 2KBGA 3UPRA 3UTPE 3INUH 5AG8A 5ESAB 5E94A 1OAXH 4QNPE 4A6YL 1IEHA 4KUCD 3UTZA 3EYVB 3Q5OA 3WV0A 1DQQA 1JZ7A 3JZ7A 1D6VH 3HE7D 4NZJA 5DRNB 1T6WA 3KDMA 2P42B 3QUZC 5I8OH 4YE4H 5FM4A 1IGYA 5D7KD 3ARWA 5IMLA 2FD6L 3TWCH 3SE9H 2OXHA 4FFWD 5ESAA 2IPTH 1IC5L 1V3LA 2HTKC 4UUJB 2AV1B 4O2CA 3CXHK 2HLAB 5BQ7A 3C5ZD 3EYVA 4PJEE 5BO1L 2DMKA 3G6AA 3MLRH 4ZUTB 1UACH 1RK1A 3M07A 1FV1B 5I1AB 3U0WL 4Z0BH 1IEAA 5I1DB 4K7FB 3HLAA 4GBXB 5I16A 4O02L 1MFCL 1P4IL 4PJXE 3MJGX 4FQCL 4K55A 4J1UA 4FXGB 3QNZB 3GBLA 3UX9B 1X5XA 4CJ1A 3F6LA 4UUJA 3B83A 2HH0H 1T7VA 2HLAA 1IEBA 2FJGA 4TOYH 5HHOB 1WQVT 2YD6A 4ZUTA 4DGVH 1F6LL 1MAJA 3A67H 4NJAL 2CKBB 2LVCA 5I1DA 1CK0L 4K7FA 3BX7C 3OG4B 4GBXA 5FGSA 1WBZA 4NSKB 2ERJB 3RVVD 3E1F1 3QNZA 3QXTA 4JZNA 1KFAL 4OD1L 1KCVL 3ZDYF 2P48B 5HHOA 2B1AL 5DLML 3ZT7A 4X7TB 1W2KT 3DVFA 3IU3B 4ELKB 5FDWA 2Q8AL 5BRZE 3D3VA 2X4NA 2VLKD 4J12A 2WK2A 3ZYIA 4NSKA 4K94L 4WWKA 5FECB 2G5BA 4Z7UA 3GJEB 4HIXL 1QSEE 4G42A 4BA8A 1LO2H 5F7MC 3QXWA 1T83A 4LLVA 3QPQD 4N0YL 4RMVA 4JFQB 1YNKH 1LO0H 1P4LA 2FYYA 5DJDA 2FO1A 1T7YA 1IJ9A 5DFWH 1PVHA 3CH8A 1T2XA 1BVZA 4TSBH 2WBJD 3IYLW 5FECA 3KHOA 1V7NL 4P57B 4Y5YB 4OD2B 5T33L 5FV1L 2B1HH 2E7LA 5SV3A 3FZUD 3QP3A 3MV7D 1S7QB 4RGNE 2YSSB 4QXGL 2QADD 5DURD 4ZAKB 1G7LA 4U1LA 1LDPH 1RMFL 4LP5A 4U3XA 4PJ7E 2YA2A 1GHFL 1MWAL 1KF9B 1UB5A 1KJVB 3VG0H 5GGQH 3TC9A 1RVFL 1KIUA 2X89A 3VFNB 5HDBE 4P57A 1WC7B 4Y5YA 3HNSH 1G7HB 4OD2A 2VITB 5DHYB 4A2MA 5GZNC 1XGYL 5HYSG 3OWEA 1QKZL 1S7QA 1YEIL 1JHKL 1LK3H 2YSSA 3HNVL 4ZAKA 2C1PB 5DMYA 1YUHB 4O58L 5D7IF 4PJ5B 3IF1B 2Q76B 3RKDC 4JFDD 2R0KH 3BJLA 4H88L 4O4YH 3WKMH 5HGGS 2JF1A 4OM1L 1EVTC 1A7RH 4B5EA 1W8NA 3G5XB 3GI9H 3OG6B 2YD5A 4I48B 1JHLL 4OFVA 2UVEA 2VR4A 2UWEB 3VFNA 5GRYA 1WC7A 4XBEH 3QJHB 1A6UL 3PWNB 3SJVA 1T3FB 5D72L 3EYSH 1OLLA 2IAMC 2E8ZA 5LCVL 1MLBA 1OWWA 4OD3H 4OGAC 5HGHB 1J0KA 2VZSA 2C1PA 5FYKE 3IF1A 4IEFB 3EDDA 1UA6H 3F5WA 3QDHA 4G6KL 3UJTL 3MLYH 2FR4B 3QH3B 4NQCB 3G5XA 4I48A 1VFAA 4LIQH 5HPOA 4G6FD 1OD7A 4XP5L 3JV6A 2UWEA 1ROWA 3QJHA 1MFAH 2Y07L 1AE6H 1A0QH 5AYQA 1YEJL 1EEZB 4HAGA 1L0XA 4JGUA 5HGHA 1CU4L 4JGMA 3SDCA 3CFCH 1TCRA 1OGTA 4OTXL 1S9VB 3Q2CA 4MSWB 1I1AB 1JN6B 1T1XB 2FR4A 5IHLB 4CU8A 1VB9A 4JM4H 3WFBL 4HGKC 5C3LD 1MUJA 3TLRA 1NLDL 4HFWB 3SE3C 2V5TA 4ZO9A 2YD9A 2NY0B 4OIIL 1SY6H 4BFGA 2D31B 1QZ1A 1AC6A 5DD3H 1EEZA 5DRXB 1MNUL 2W60B 4IOFC 3NABL 2Q1EA 3SDYL 3SGJC 1RFDL 2CO7B 4P4KA 1A02N 2E7CA 1IZJA 1S9VA 4JRXB 4MSWA 5JTWA 3GIZH 5JW5B 1FC2D 5IMKB 1FAIL 1SBBA 4YDKL 4Y19E 5CUSH 4R3SB 2MNUA 4W6YB 2GTZB 5HHPA 1EBPA 3P0VL 2J7LA 4ZS7H 3QI9B 1AXTH 4M5YH 3T0WA 2D31A 1KULA 4L5FL 1YY9D 1IGJB 4LVNC 5DRXA 2W60A 5F70A 5B39B 1SBSL 3ULVL 2J5LC 3PWPE 4QRPE 3SKUD 4K07A 5CEXA 4LAJH 4WU5B 3U1SL 2K3TA 2R9HC 5EU6B 5EOCL 5F88B 2Y1VA 3CC5A 5IMKA 4G7VH 4EOWH 3S37X 4JKPH 5LQBL 5C2BH 3PWJB 4PGCB 1UXWB 1T1ZB 3WXVL 1V3MA 1NGZB 1YA5A 3HNTL 3TN0D 3QI9A 1F58L 4M4PA 4HW6A 1IGJA 5DO2C 1BFVH 5IIEB 1AD0B 4P48A 4Y4KD 1KENL 4N0UE 4N1HB 3IETA 1J8KA 2VE6B 3K8MA 1RUKL 4WU5A 4OZIF 5I30H 1MPAL 5F88A 4UIKL 4P5TD 2F8VA 4G43B 3O8XB 3OXSB 3OX8B 2DQGL 5EBGA 5L0QB 2ITCB 5EORH 4MVBC 5C09E 5I73B 1UXWA 3F6IA 1U3JA 4MDJB 2NY6B 1V8HA 3VW3L 5DJXA 5HHME 5IF0A 5GGTL 1OAYH 3DUUB 5F6HI 1AD0A 1I7RB 5JIIA 3NCFB 2IG2H 1A4JB 4BQ6A 1I9IH 3MUGA 2KUTA 1F8TL 3PL6C 5CSGA 3O8XA 4FABH 4PLOB 3OX8A 2ITCA 1MCFA 5A2JH 1DBBL 1FO0H 2LAAA 3RX7A 1U3HA 2DQEH 4WGWB 4MDJA 1N5YL 3K4AA 1J87A 4R90L 3LN9A 1UM5L 3WNPA 4HBQA 4YJZL 3JWOC 1FZOA 3DUUA 5I9QC 4NUJA 5LGHH 2EDXA 2UUDK 1NC4B 5D4QA 3E6FA 4YGVA 2X1OA 4AK1A 3KJ4B 2DL9A 1A4JA 3TBVA 2W0PA 4P23B 4Y5VC 1Q72L 4OJFL 3QSKB 5A3ID 3GEWB 3P4MB 4U0RB 1QR1A 5IW1B 5IESL 5EWIL 2X10A 4XZUA 2MOVA 1CVRA 4AY0A 4P0DA 1EVUA 1YYLL 1MFDH 4Y4HA 3T0VA 4M7JH 4MNGB 2APXA 4XMLH 2WMPA 4EDXB 4P23A 4FQQA 4ZFGL 4JPKH 3P4MA 5IW1A 4F8TA 4FOMA 4POUB 1GOHA 1S7VB 1IC7L 2VJXA 1VEPA 5DJCA 2JJTC 2P47B 4Y5XC 5TDOB 2YEZA 2W65A 5DMJB 1RZFL 5CGMA 3V6OE 1Z9LA 4MNGA 1MHEA 5K33A 4F3FA 5JXEA 1F6AA 5D7IB 3QNXA 2YR3A 3HR5A 2E6JA 2HVKA 4EDXA 3TH3T 1FO0B 5IFAH 1U93B 2DM7A 2V7NB 1TJGL 4L8BA 1XH3B 3VXRB 3EFDL 1S7VA 2D4FA 3HCVA 4B0MM 2IGFH 2I9LB 5TDOA 1GAFL 2AW2A 1ZA3A 6FABH 1XIWD 4GQPH 5ALBL 2H3NA 4OLVL 1JZ5A 1GC1C 4ISVB 1K4CA 5D7IA 4M9PA 3RDTC 4OCYL 2ED9A 4CAGA 2V7NA 1YEGH 2AK4D 4UNUA 1RI8A 5CGYC 5D1QC 4U1SB 3TYFB 3GNMH 4G6AD 5IVXE 3PWVA 4G9FE 4M7ZC 4JFYB 3RVUC 2FGWH 4OZFA 3PV6B 1Q0XL 4WI8A 3S36X 4A6YH 3ZL4L 1OGAE 4PRHE 4ISVA 4I0PD 3EJZC 3G6DL 2CDFB 4Q9BA 2BC4B 1CE6B 1NMBH 5IMMA 3MLXH 3V6BR 5I0DA 2RJMA 3MLZH 4OZ4A 4P4RA 1DLHB 5EO9A 4U1SA 3RKPA 4S10A 3IFLH 1CGYA 2FD6H 5DK3A 4JFYA 3QXVA 1IC5H 2ADGA 1KSRA 5C71A 3MV8A 4PJDF 2ICWI 3GUTA 4XTRC 5KN5B 1IC4L 1NEZB 5D71H 4WFHD 3PQYE 2C26A 2VSCA 2BC4A 1CE6A 1GH7A 1X9QA 4C59B 3LVEA 3VMNA 3HE6B 1YDPA 5IKCB 1XEDA 5JPNA 3G6JF 4L4VB 5EC2B 4FQCH 2ARJQ 4RISH 3KLDA 2R2EA 1KN4L 4LSSL 1P4BL 3NGBB 4PRDB 1FH5L 5AD0A 1BD2D 3W2DH 5C08D 5IHZB 4PRPA 4XPAH 1EEQA 1ZT4B 4RFEB 2BMKB 1T89A 5LVEA 1NEZA 3VDCA 4WW2B 3GSWB 4QWWD 3NPSC 3SY0B 5KANI 3DETC 1JIBA 2N56A 1HSBA 4Y1AB 3AS1A 3W0WE 3RX5A 1SYSA 2DM3A 2AAVA 2NCMA 3TA3C 4A6YB 3QT2A 5DVLA 4NDMB 4L4VA 5EC2A 2BVEA 3D48R 4G8FA 5E00A 1Q8MA 1FC1A 4HIEB 1MSPA 4ZQKA 4O2EA 2VDKH 1FYTD 1C16A 4L1DA 1KCVH 4KI5E 5IHZA 4RFEA 1I9JL 4AG4H 2VISA 2B1AH 5DLMH 5F9OL 1F90L 1CYGA 2R1WB 4Y1AA 2NX5E 3ZO0A 3BKCH 4X7CC 4GS7B 4RGNC 3DO7A 1TTUA 5DJ6B 4A6YA 3T77B 3ZE2F 2Q8BL 4FQ2L 3I6KA 1JPST 3FAWA 3MRKB 3ULVF 4G8EB 5F7LB 1XF2B 4HIEA 1J10A 1GZQB 2X70B 2BFVL 3UC0L 3WS3B 4GAYB 1C8PA 4M1DH 3NCCB 3BKYL 2VXQL 3Q1SH 3NFSL 4OZIA 3GSNL 1A7OH 4Q9CA 5CP3A 4AL8L 3FHAA 4OKVB 5F9JA 5ACMA 3TO4C 4QRSB 4FFYL 2ZCKH 1BF8A 4M61B 4K9EH 1TQCC 3T77A 5HI4C 4AEIL 1V7NH 3O6FB 4OF7A 2ICCA 1XF2A 5T33H 1YEFH 3MRLB 2X70A 4X8JA 3WS3A 2BOCA 1R3JB 4UZGA 3PWUB 2NZ9C 2R29H 1RIVL 1YECH 4LCCC 3VXMB 4PJHE 1D5IL 1FVEB 2EE3A 4TPRL 4RNRA 2VLRB 1I4FB 2M2DA 4ENED 3U7YH 4JFEA 1RVFH 5GGVL 5DF0A 1EEUA 1MCHA 4NO2A 4CVWA 3SEPA 5T1LB 3O3DB 5CSBA 4PREA 4KZEH 4ORGB 1YEIH 2X1PA 3PWUA 1PZUB 1JHKH 5CGTA 3WHXB 4QRRB 4DGIL 2DQCL 3SQOH 3QDMD 3VXMA 4H88H 1FVEA 4NQDE 4OM1H 5GSVA 1OW0C 3PDGA 3SCMC 2WINB 2VLRA 4I9WE 1EJOH 4WI3A 5DD0H 5IEHB 1DR9A 4HUNB 3OGCB 3KPSB 3UJIL 5T1LA 4F7CA 1A6UH 3BAEL 3ZTNL 4UT7L 4NWTL 5LCVH 1FZJB 2BNQB 3LEXA 5HGDA 3DLQR 2C3VB 4QRRA 1MCKA 4RBPH 4S1QL 2L0DA 3UP1A 3MODL 2PW2B 4X99B 4G6KH 1QTYT 2WINA 4M6AA 1RZGB 1EX0A 1KV3A 2X4TB 5IEHA 3A6CL 4XP5H 3KXFB 3OGCA 2XZQL 3KPSA 4XPHH 2H8PB 5F7HA 2Y07H 3H9YA 2JCCE 1NCCH 1V05A 4I2XB 1FZJA 2BNQA 3C5ZB 1BQLL 1QYGL 3LCYA 1YN7B 5HVFB 3DX7A 4YHLH 4YC2B 1P84K 3HZVB 2XZCH 4YPGB 3O9WD 2PW2A 4WO4D 4X99A 1AIFA 2APBA 5E1AA 4XX1E 5AYUL 3RPKA 1CR9H 3WFBH 4EDWL 3QUMH 1NLDH 3HS0B 3E2HB 3KXFA 2VN4A 1ULVA 3ZYJA 1U95B 3CGTA 2H8PA 2ZCLH 3K0WA 1QQDB 3GBNL 3L3OB 1L4IA 3TBTB 1CXKA 3IGAA 4H0IA 2QKIB 4I2XA 2W1NA 4LLQB 3QIBA 3LKOA 3NABH 1BGXH 1RFDH 3QG7L 3WNKA 4HJ0D 1MWAA 3X13A 2R0WL 3BQUC 3RZCC 2OR7A 5AZ2H 1P69B 2R15A 1FAIH 1YPZE 4KVCH 1FGVL 4EBQH 3H7BB 4ZFFB 4JKLA 4OLEA 2OR9L 5CIPH 2HKFL 2DQIL 4L9LB 1QQDA 3EDEA 4K71C 9CGTA 4KFZC 4GXVL 4PJDB 1LQSR 4MJIE 4LCWB 4FHBD 4HMDA 4FTVB 4LLQA 4U1IA 1SBSH 3IB4A 4MZ3A 4XNYH 5GPRA 4R26L 2WBKA 2R4RL 2DQTH 2PR4L 4GKSA 1AGFB 3MYZA 1A8JH 3NA4A 3WL9A 5AAMA 3V5HB 1F4WH 1V5JA 5C0BE 5C9JB 4AEHH 4PJIF 5LQBH 2X1QA 3N9GL 2VDOH 2VRAA 4YBQC 3H7BA 4ZFFA 1GZPB 4HV8B 1RZIB 3VD7A 4EUPG 3MRPB 1F58H 3VFUB 4DN3H 4ONFL 4PJDA 5HVHC 4OFKA 4LCWA 4QOKE 4FTVA 5FGBA 1RUKH 1VFOA 3QUMB 3UAJC 4YHYC 3L5JA 4OZFG 4ZSOE 3KS0J 3F58H 3IS1X 4UIKH 4JPVL 3QWOA 4LSTH 1FFOA 2FDBP 3L5XL 4HPOL 5E9DD 5C9JA 5EBLB 4D9QD 1WBXB 1C08B 3GBMH 4PGBB 3QQ3B 5SX4H 5T3ZE 3DX8B 5HHQA 1GZPA 4HV8A 3QFDA 3BZDA 3H9SE 1BFOB 3VFSB 1WAAE 2ICEA 5EB9A 5GGTH 3GHEL 2FX7L 5C0CD 4QXUH 4NQEE 5JW4M 1D5BA 1TXKA 3AU1B 2JE8A 5DURB 3MRIA 1QEWB 2GW5A 4FQLL 4C56D 2NY2C 4U1NB 4HUUB 4MB3A 1F8TH 3CX5J 2IH1B 5JOFA 1B4RA 1WBXA 4JJHA 3QQ3A 5JLZB 1DBBH 4NOFA 2A6DA 3DX8A 1N5YH 3EOTL 3VFSA 3V4PL 4KPHL 1V3KA 3RVWC 3QPXH 1MCPL 3CFKB 1G7JB 3SGKC 4WUUD 3CFJA 3LQAH 1QEWA 3LV3A 3ULUE 4L29B 1KIQB 5DT1H 3BH9A 4JFDB 1AXSB 4U1NA 1Q72H 3V4UL 3V6OC 1IAII 5SWSD 4QEGA 3HUJF 4AM0B 3V7MA 1XR9B 2CRIA 1S9YA 5FK9B 2V2XB 1T5XA 1QPXA 4BSVB 5IEKB 1ORQB 3CFKA 5JA9A 1AGCB 5C07E 3P4NA 4PYHA 1FP5A 3BGAA 4L29A 3TZVC 2QQLH 2IAND 1KIQA 3WFEH 1OWRM 3JTTA 1HWGB 4U3CA 3RGVD 2EH7L 3NACL 3ZKMC 3SBWA 4AM0A 1Z5LB 5J6GB 4E41D 1XR9A 1IC7H 1F11A 1KIRA 2EC9T 5FK9A 2V2XA 2I24N 4BSVA 2AGJL 5IEKA 2WBWB 5BZWA 1T7XA 3QWQB 1DQJA 3ABZA 5BV7C 2VC2L 3UTSD 1JMXA 3IDYB 1JYVA 1XR8B 1GGBL 5IW3A 2JIXD 1N4XH 4PJBF 1JWUA 1QP1A 3DGGB 1W0VB 3O4OC 5GGTA 1Z5LA 3EFDH 3WN5C 3PJSA 2R69L 4GW4B 3O2DL 5J6HA 3DGCR 2H9GB 1UJ3C 4PP1C 3HG1D 2AS5M 3BDBA 3BZ4B 4UU9B 1YZZA 4KJQC 3GFUA 1ZA6B 1XR8A 4XVUC 2VXTL 2DLHA 4YXHH 5KSVB 3VDBA 3DPBA 5EC1B 3EBAA 4XMPH 1T21B 1W0VA 1CGXA 2D7TL 1B3JA 3RTQB 2NLJA 3SDXF 1KLGB 2D03L 4IRZL 5C0DB 2YXMA 3TO2B 2BY2A 5IGXL 3BZ4A 2SEBA 3RQ3A 2A74B 3HC4H 3CAFA 4JLRB 2VIRB 3UTOA 2C3HA 5KSVA 3G6DH 4F7EA 3LAFA 1IBGH 3HTLX 5EC1A 3JSSA 3MCLL 1WWWX 5D1XC 5DRZB 2DLGA 1Q38A 3RTQA 2EXYD 3V4VL 1ETZA 3ZHLA 3X3FL 1KLGA 2CUMA 4LLMB 4LOUD 1R3KB 2H41A 1OTTC 4X4ZA 4K3DH 2NY5L 4O9HL 3G5ZB 4NNYB 5I1HH 4HJGB 2A74A 4Y4KB 3CDCA 4JDTL 1NFIB 1P6AB 3QA3B 3S9DB 1J1XL 2R0ZH 4MX7A 1NMCB 4YHIB 3CZJA 2XICA 2XA3A 3SE4C 1A21A 4KI5C 3S96B 1FJ1B 3MNWA 3WDHA 4JQVC 1NBQA 5D9SA 4WWID 3PGDB 4Y4FC 3ZDXE 2YUXA 4LVOB 2CH8A 4XAKE 4CVUA 1P4BH 3O6KH 3ARED 1QO3A 3GJFK 3DURB 1F3DH 3MRJB 2W9EL 3OB8A 3SE8H 4ZDHA 5F1NB 4FQXD 3BP7A 5C0ND 2DB8A 3RRQA 2VDPL 1WBYA 3QUYC 4CU6A 3I84A 4KROD 4YHIA 1WFOA 4JFHE 4J3WA 4KHTH 3QNYB 4L4JA 3ES6B 3PHQA 3PGDA 4F15B 1DLFL 4DUVA 4NN7B 4X4YB 3U6RB 3DMMD 3BP6A 1O5DT 3C2AL 2DTMH 3DURA 5EA0L 4DQOL 1RZKL 2PKDA 4QGTA 1I9JH 1OAUH 3BSZL 5C9KA 1D3CA 4V2BA 1RIUL 1FVCA 3LS4L 3LS5L 3N1QC 3BIBX 1LVEA 3O3EB 3QNYA 3QDGD 4JY5L 4QHKI 1I7TB 3GSQA 5DC0A 3ARZA 4FQ2H 3H3KA 3UZEA 2H1PH 3K81A 2FJHA 4X4YA 1N59B 3U6RA 4AENA 1I85A 4DAGL 3AROA 5TDNA 2BFVH 1QACA 3TFKC 3V6FB 3S5LA 2IBZX 3S4SG 5HPMA 3F7VB 4Y16D 3T8XA 3N06B 3AFLA 1G7QA 3GSNH 1M6OA 2EDDA 2DLIA 3O41B 2B8OT 3RNKA 3WE6A 2PO6A 1PFCA 1UJTA 1HQ4A 4FFYH 1H8NA 1I7TA 3MBEA 4UOW1 2OJEB 4PJXF 5ITBL 5EUOF 5K9QI 1N59A 2DLFH 3QISA 1IVLA 4NPYB 2BVYA 4H26B 3V6FA 1F2XK 3U0PA 3H9ZA 4M7LH 4MNQE 1P1ZB 5HHNA 3VGGA 1J0HA 5E6IB 3W81A 1Z9MA 1UH3A 3O41A 4LASL 1LO3H 4TPRH 1P7KB 4KJYB 5CZXD 1UWXK 4TQEL 4FA8A 1S7UB 5F7KC 1LWRA 1K5NB 1WLHA 5FHAH 3CZFA 2AJZB 1FFNB 3NZHH 4OCNC 3OKMB 2XKSA 4ZODA 1YQVL 1SQ2N 5D2NA 4WV1C 3MLSL 4CRPA 3MYJA 1P1ZA 1IKNA 2P46B 4LPWA 1QPPA 5IK3B 12E8H 2UUDH 4LGPB 4DGIH 4GUPB 3IVKB 1K9TA 2WNGA 3HUJA 3T4YA 3KLHD 3DWTA 3HZMB 3O3AB 4OT1L 2AJZA 2D3VA 3UJIH 4OLWH 4XCNB 1C7TA 2BVTA 3RWGB 3OKMA 3CFBA 3GSNB 4FG6D 5GS2H 1KGCD 4DW2L 4NT6A 4I0PB 1BJ8A 4RFNC 3PGFH 4GUPA 3WFDH 4GG6B 3NCEB 3Q6FA 4PJBB 5DFVD 1MJ8L 3VFGL 4C83B 3HZMA 4BQCA 2GFBA 4YHNB 1KB5H 3O3AA 1G9EA 1OAZL 4Q9QH 2OTPA 5L2KB 1N0LA 3BDYH 3LMJH 1RJLA 2F5BH 2F74B 2V5RA 4XCNA 3RWGA 3BDXA 1JI1A 3L95B 1GOGA 3GSNA 1QFHA 1EO5A 4KMLB 4BUHA 5DMIH 4YBHA 4MCYB 1UVQB 5L88L 4WI7A 3C6LB 5D5MB 1D7FA 5AYUH 5C7XL 4PJBA 3FRPA 1NAKL 4XPTL 4C4KT 5L9DL 4PJ7F 1OSZB 4P46C 4LAQL 4YHNA 1FIEA 1BX2B 4NRYA 2NTSP 1AKJA 3SDXB 4WTXA 4HUVB 5L2KA 1PYWB 1WIOA 2DL2A 2P43B 2F74A 5HDBF 5TQ0L 3GBNH 3IDIA 4GW5B 4OFYD 2FEEI 4J7RA 3L95A 4G8GE 5C08B 1M7IB 3GMLA 1J0YA 4MCYA 3V5KB 1TMCB 3C6LA 4HK3J 4HGWB 2ZG2A 5D5MA 5FYLD 2BXZA 5D7LB 5IB2A 5HI5D 3IDJB 3BRGC 1FLRH 5T1KB 1N26A 4JG1L 3ALPA 1OSZA 3E6HB 5CJQL 3SDXA 5B8CB 3L3HB 1F3JB 2A1WH 3R8QA 2OR9H 4BELD 4APQB 1EHAA 2HKFH 3GHBL 5FYKU 3P4OB 4GW5A 1FYTB 3IFOB 4FNLH 1U58A 4ELMF 1B4JL 1Y18A 4LPUA 3QFJE 5DHVB 2CRYA 1M7IA 2VDQL 3DTXA 4LSDA 1OB1B 1H3VA 4OGXH 4HGWA 4P2QB 4PJFB 3LKQA 1KB5B 3KLAB 5D7LA 5IG7B 4L8SB 4O51B 3OB0H 5T1KA 1ZOXA 2P5WB 1S9WB 1NFKA 3UTTE 5KS9B 3N9GH 3WNNA 1DQDH 5B8CA 4MJ5B 2XQBL 1JRHI 1YMMB 1AO7E 3QUZD 4ETQA 5I18H 4P9HH 1CD9B 1M7DB 2D7MA 3FFCE 1ZVSB 3IFOA 2V5MA 4ONFH 5FAAA 2COQA 5DHVA 1G6RL 1UWEH 2HTKD 1OB1A 2VABB 1A7PL 1WV7T 2LU4A 2PW1B 4P9ML 4P2QA 4PJFA 1DN0A 1KJMA 3BGMA 3KLAA 4BK5A 5C0FB 5IG7A 5BXFA 4JPVH 1CFQA 4O51A 2P5WA 4J4PA 1S9WA 4OZGB 1Q0YH 4M62H 5JOPE 2HKHL 1FN4B 4EIZC 3ULUC 5J4MA 3T0EA 2Y25A 1YMMA 3OMZA 5EN2B 2FX7H 2PXYA 3M17B 4RMUA 2Q6WB 1QSFD 2D9CA 4PGZA 4HUXA 4FQLH 1DBAL 2PW1A 5CD3B 5C0FA 1C5CL 1A4KB 1NMAL 1EBAA 1BAFL 4U49A 5GRVL 5T3XL 1VESA 1FN4A 1JYNA 4LKXB 2FB4L 4TVPL 5IVZB 3QEGL 5DI8B 3G9VA 3V4PH 3B2VL 4KPHH 5H2BB 3GSRB 5TF1H 1HZHL 1TNNA 5CSZB 4D2NA 3M17A 1AJ7L 2R0LL 5EU3B 3RHWK 1NCDH 3CDGA 2MMXA 3HB3C 4YBLC 3C08L 4UV4L 3QDMB 3S35X 3BD3A 3IJHA 5CCKH 3OGOE 3B8SA 4XP9L 3UYOD 2CLRB 2YRLA 4XH2A 1G7MA 4WDIB 1F02I 4JQIH 1CICC 3KPRE 2FRGP 1TLKA 2ESVD 2MKWA 2P7TB 5DI8A 3STLA 4OCSH 4WI6A 5H2BA 2E9JA 3VWKA 1VADB 3GSRA 4OCRL 1OD9A 4U1HB 2BXYA 5CSZA 4PJGB 2IFGA 3UYRH 4RAVB 3VG9C 4R97C 1G6VK 3HRZA 1IM9A 1U6AH 4QY8B 5F71A 2ZP0T 4JFFD 1YC8A 2XXCB 5KOMC 1A1MB 3Q6GH 4WDIA 1CDBA 2OZ4L 4N90E 3NFPB 1EZVY 3F7YB 4ZYKB 5CAYB 2VL5B 4MJ4A 1JWMB 1I8MA 4PJXA 4QHLB 1VFBB 3OR7B 4M6NL 5EUOA 4NYLB 5I0ZA 2PCPA 2O5ZH 4DVBA 3VH8B 3AMKA 4PJGA 2XN9B 4MXQC 4RAVA 4XRCB 1H3GA 4MYWB 3RIAF 1TQBB 4QY8A 1KEGL 2AEIT 2BSED 1A1MA 3O9WB 2FEDC 3RBGA 2IMMA 2XWTB 3ARGB 1DUYA 1D6EB 3S5LG 5J57B 4L3CB 3LSOB 1T7WA 4ZYKA 3QCTH 3QQ4B 2R69H 3O2WH 3O2DH 3B5TA 4QHLA 1VFBA 3GDBA 3T0DA 4NYLA 3BP4B 3KLSA 3VFTB 5DD1H 2XN9A 3K3QA 1S7XA 4JRWA 1TZHB 3OAYK 5GZND 5JHDD 3BPLC 4IS6B 4NRXB 2EEDA 4WEBL 3ARGA 1IGTA 1D6EA 5BRZA 1NGPL 3RKDD 4L3CA 2KZWA 5F3BB 4ZUVB 5E95B 5E4IA 2CDEB 3QQ4A 5EZLB 5FA3A 5EUKA 4ODWB 3X3GH 4QRUA 4IRZH 5FGRA 3U46B 5HY9B 2EDBA 3VFTA 1U92B 5DJZA 1CGTA 2HFEB 2IAMD 4EZMA 1K8IB 4IS6A 4NRXA 2WIIB 3MRDB 4NOBA 4OGAD 2GJZB 2EH8H 1T2JA 3DSFH 2HFGL 4IIQC 3N0PB 4RGMB 5CJBA 4LVEA 2J8UB 1KCKA 5F3BA 4ZUVA 2WUCL 5SX5K 4OSUL 2D2OA 4YDLC 5EZLA 3ZT5A 4YHML 3MC0A 5HHOE 4ODWA 3MLVH 3FONB 3TNMA 5ESQB 1I8LC 3U46A 4DOHB 4JPWL 5GGSY 5D7JC 5AWNH 3BE1L 4NQTA 3OR6A 3D3VE 3MMEB 3ROLA 3CMOH 5DYOB 1X5FA 5GS0L 4JDTH 2HFEA 2O93L 4Z7UE 3CDFA 4NO5B 5GHWL 2WIIA 5SWZA 2GJZA 4NO0A 1IAIM 4GSDL 2BNUA 4NKDB 4W4OA 4PPTA 2XZAH 5K9OA 3BW9B 3GSVB 2OTWB 4NM4L 2I60L 3BPNC 3DI3B 1YQ2A 1QLEL 3FONA 4ZPTA 4X9HA 5IVOA 1A6VL 5E8PB 3V7AE 4D0DB 1JFQL 1H3XA 3ZZ1A 1PG7X 3MMEA 4G9DA 4ODUA 1ZVYA 5ECJE 5DYOA 5BCAA 5A40E 2HLFC 3S3JA 1E4WH 2VDPH 4BSWA 2NYYC 3FRUB 1NSNL 4IOFD 5MHSE 5DJAA 4NQXB 3O2DA 3OKEB 5E56A 4NKDA 3L7FA 3RZWA 4XT1C 4TNWF 4DCQA 2YA1A 4HIIB 4WU7A 2ZNWA 5CEZD 5IVXF 1ADQH 3FCTB 3FRPG 3OV6A 1N7ML 4EQ3A 3O45A 3VRIA 4D0DA 4Q6YA 2O5XL 4ELMA 5BS0D 3OF6A 3W11C 4WUUB 5EA0H 4DQOH 4NZUH 4GQ9L 4F57L 1HH9B 2B0SL 2JJSC 2GY7B 5FM5O 5F6IB 3FQRA 4NQXA 3LS4H 3LS5H 5EOCJ 2KZ1B 1MCDA 5SWSB 2R9HD 3OAUH 4LNRB 4JY5H 3VMPA 4P2RD 1MJJB 2XIDA 1X5IA 1A7NL 4HIIA 1MF2H 4F33B 1HHJB 2F8OA 3R1GL 3FCTA 5ISZB 1JV5B 1ZXQA 4NC0B 2Y6SC 4DAGH 2I5YH 3LIZL 1EK3A 5HHXL 4CMMB 1HH9A 4P3WA 5GSRA 4BKLB 4UILH 1CDUA 2X4QB 5DO2D 3C5JB 4FFZL 3C8KA 1RURL 2K7PA 2DAVA 3P9WB 1AP2B 2ORBH 3SJVE 5ELIA 2DI7A 3CFIC 2OS7A 2YD2A 3VWJC 4LNRA 3VXUD 1N6VA 4LPCA 1MFEL 1MJJA 2GEEA 1IAMA 4PJ5E 4F33A 2N4IA 4ZUSB 5ISZA 4MVBD 1JV5A 3WFHB 3TVMB 1QLRB 3MOBH 1KEML 2EDNA 2FLBT 1SJEA 1ED3A 1DQMH 3GM8A 4WTZG 1NC2D 1RIHL 4L4TB 4BKLA 3C5JA 2UWEE 3FT4B 4MMZC 4ODVH 1CQKA 4NKMB 1CLZL 1HYRC 5GS3A 4WUKL 2PYED 5DQ9A 4LASH 4KI1A 5E08L 4HXBL 5DQJB 3SN6N 4ZOAA 3FQUB 5I66B 3PL6D 3SDAB 1K3ZA 4ZOCA 3VXQA 3WFCL 4ZUSA 4PV8B 3WFHA 3TVMA 1QLRA 4HJJL 5L7XL 3KPOA 2R56H 1BF2A 1UB6B 3MLSH 4KI5F 4H25B 4L4TA 2AQ2A 4M03A 4EXKA 1IL1A 1MLCB 5C0AB 4NKMA 2OM5A 2BNRA 4UQ2A 4FQ1H 4RX4A 1ES0A 3OKOB 3LKRB 5TFSH 4I18B 4L8DA 4M8QB 3FQUA 4EVNA 2V9QA 5E8EB 1CDGA 3SDAA 1X6LA 4JZJB 3CU7A 2P8PA 5FYJU 1NDGB 4WHDA 4PV8A 4U1KB 5H35B 3RVTC 5TGBB 4NKQB 3HI5L 3MOAH 4V1DB 5DRWB 4H25A 5A2LH 4DW2H 5IT2H 1S5IL 2DJUA 5C0AA 1MLCA 3FB6B 4LLUA 1WICA 1J05A 2FJFB 3U36B 4LSRL 1J8HD 3BYTA 1MJ8H 2HVJA 4S11A 3VFGH 4M8QA 4R9HA 5E8EA 3TT3L 3V0WL 4M93B 4JZJA 1IQDA 1OAZH 2AEQL 4KDTC 2LE9A 4YXKH 2JB6A 1TVHB 5TGBA 1CDYA 1MCLA 2AJVL 5IROA 5B3JE 4V1DA 5DRWA 2EKJA 3LN4B 2Y9RT 3FB6A 3QDJD 3WO4B 5I1IL 5L88H 3DVGB 4PJHF 1O7SA 1CS6A 3ARRA 5I15L 2FJFA 3UTPD 2AJYH 1OP5K 3NCJL 4LAQH 3KPLA 4HF5L 3QG6B 5K9KA 4LIQE 4H20H 4RMQA 1TVHA 5CMAB 5GS1B 1BREA 2VLJA 1PZ5B 5GRZA 5TQ0H 4BSJA 3AREB 1KYOJ 3PDOB 4GG8B 3TF7C 1ZEAL 4Q2ZB 1WF5A 2GT9A 3GMOA 4C55A 5TDPA 4FQXB 3AXLB 1BBDH 5CWSB 4JQXC 3DVGA 1YEHH 4KROB 1U3YA 2EDKA 4HK0B 2XKNB 1C5BH 3HFML 3U9PL 3RDTD 1QOKA 1BFSA 3BPOC 3IKCB 3LB6C 3QG6A 3NIFE 3QULB 4OF5A 1KUMA 1N3NB 4FS0A 5CJXC 5CGYD 4AJ0A 5GS1A 5CMAA 5D1QD 2DD8L 1NGQH 2NXZB 3WMSA 3KR3L 1R5WA 3PDOA 1B4JH 4Q2ZA 1SEQL 3RVUD 5B22A 1R6VA 4H8WC 4TSAL 1KT2B 1BM3L 3BISA 2V5SA 4D0BB 5CWSA 3UPAA 1OAQH 3IXTA 4X9GA 4FQIH 3EJZD 4HK0A 3UCRA 4EQ2A 2B4CL 3ZDYE 3DO3A 1U42A 1LMKA 1N6QL 1RULH 2YPKB 5J1AB 3RJDA 3FO1B 5E8NA 4JKMA 1CTNA 2J6EL 1N3NA 1MREL 2YS4A 3K8KA 2EC8A 4EXPX 4XPFL 2JCCF 4XP6H 3B9AA 1BECA 5I6XC 5IUSA 2HRPH 1KT2A 5E2TH 2X40A 3WUWA 1HHKB 15C8L 32C2B 4D0BA 1FNHA 1ZHBA 4P9MH 2X6MA 3MUY1 2H2SD 2YPLA 4XTRD 4R4BB 1SYVB 1J11A 3L6FA 1EFXB 3MJ9L 1OP9A 4YIQA 4K2UL 3T3MF 2GAZB 4RGOL 3FO1A 2VWEE 5FKPB 2XWJB 1BWWA 3I50L 1FNAA 1XZ0B 2OL3L 4W4NA 3G08B 4R0LB 3GJFH 3F7PC 4X7DC 4TULL 1OLZA 32C2A 1L0QA 3C5SA 2Z92B 2IADB 5LBSL 5FM5M 4ZTOL 4R4BA 1SYVA 5D1ZC 4GH7B 1RZ8A 2AJUH 1EFXA 1DZBA 1BVLA 4MD0B 1QSED 2WUBL 5MEQB 4MNGE 3K46A 5FKPA 2XWJA 4FRWA 4TVPH 4Z76A 3QEGH 1XZ0A 2Z31B 5IVXA 1RY7B 4G9FA 3B2VH 3TA3D 3ARBB 3BH8A 1WGOA 4JRYB 4UAOB 4OZHB 2AEPL 3PP3K 4TUJA 3EGSA 8FABB 1T2QL 4I3SH 4KHXL 4UV4H 2Z92A 2BHZA 2IADA 3D39B 3LPWA 2EEAA 4YFLI 4MD0A 1IQWL 2HYMA 2X42A 2PTUA 2XYCA 1M05B 5D7IE 3NFNB 4FQHA 4MGXA 2Z31A 1OARL 2HFFA 4RGND 3BZEB 4E0RB 4LK4A 1J7VR 3ARBA 4JRYA 1RSFA 2YWYA 3WEXA 4I13B 4OZHA 4PUBL 2J12B 5EZOL 3MRBA 2QBWA 5T5NF 4LU5L 3OZ9H 3D39A 1FL3B 3MV11 4QHUB 4QXWA 1G1YA 2VXSL 2HN7B 1WIUA 4R8WH 1M05A 1QA9A 1RJYA 3NFNA 1T66C 5DJ8A 3TO4D 3GJFB 1G6RA 1E6JL 3BZEA 4E0RA 5JA8B 5T1DH 5HI4D 4IMLB 5I1LB 5E24E 2IC2A 5F9WB 3ZKXB 3SKNA 4U1GB 3GSUB 1HEZB 1AXIB 4ZXBB 1IM3B 5BW7A 4PRNB 4X6CF 3B8YA 1KEGH 1W72L 1FL3A 4MAUL 2NZ9D 2F58H 3BXNB 4QHUA 3V79C 1D5MB 3WXWL 1XCTB 4GBXC 4U6XB 2BVPB 4QTIH 1UWXH 1TCMA 3BO8B 4NO3B 2UZXB 1S5HB 3GJFA 4DKEL 5FYKD 5I1LA 4KTDL 3EOAB 2OLDA 1HEZA 4ZXBA 5B38B 1IM3A 3BEWB 1MQKL 4PRNA 3F7QA 4U1JA 4YO0B 4RRPA 4X6EB 1YMHB 5EO0B 1D5MA 5I71B 4U6XA 2VH5L 2P5EB 4PRPE 4IRSA 4NO3A 4WWKC 3SCMD 3TP4A 3VXOB 2VUYA 5K9JL 3RAJH 3EOAA 1KACB 2QR0B 2BRQA 3H8NA 5MEOB 2AP2A 1ZT7B 1UM4H 4L4VE 1I7ZA 1NEUA 4EN3A 3LQZA 5JQ6L 2DDQL 5LGJA 1F4AA 1DEEA 4FXLA 1KTRL 1JCKA 1T03L 2CLZB 5CBAB 2YMXL 2P5EA 1I7UA 4HS8L 2AV7B 3VXOA 4TUKH 5HJ3B 2Z91A 1B6UA 3BKJL 3MV9B 2E7LC 4JCMA 4Y1AE 4XNUL 2QR0A 4NJ9H 3T0AA 4LSUL 1EFQA 4AIOA 1AHWB 1C5DB 2OZ4A 3QIWB 4YZFE 2CJUH 3NIDE 5GHWH 1ACYL 4Y19D 1MRCL 1REIA 4GSDH 4GKZB 4FQJL 4MXWH 5KZCB 5DEZA 5IB1B 5CBAA 1FG2B 3W39A 2AV7A 1T7ZA 5IJVA 3LRSB 4Y5YC 2Q20A 3SHSA 4JPIB 3NIGE 4QHMA 3PWPD 3MV9A 4QRPD 43CAB 1A6VH 1JGLL 3PP4H 3B9KB 2R1YB 3HN3A 1EXUB 3SOBL 1NBZA 1QSFB 4HKZB 4ZAKC 1AHWA 1C5DA 2JB5H 4G5ZH 4PP2B 4RSVA 5JXAH 4G80B 4PB9L 4YH6A 3STZB 3BQUD 3I2CH 5IB1A 3L1OH 1WSST 3RZCD 1OPGL 1AD9A 1FG2A 4HS6A 1KJ3H 3HMXL 2AQ1A 1QFWI 1JHTB 1XF3B 4OFPA 5MEPB 5I8KL 3BIKB 2KH2B 4Z7QE 3B9KA 2KL6A 2R1YA 3DIFB 5AAWA 1EXUA 3B9DA 2Y36L 3H3PL 4F57H 1FE8H 1JPTL 3P30L 4GQ9H 4JFEE 4NNPL 2GTWA 1NBYA 4PP2A 5C09D 1CLYL 2GK0A 3RWCB 1L9MA 3BIAX 1CFVH 4LHQB 5HHMD 2IALB 3ARFB 3BPCB 1T5WA 2ZSVA 2VOTA 1A7NH 1FORH 3V95A 1JHTA 4PJ9B 5DXWA 3VXME 3BIKA 3R1GH 3QIUA 4YBQD 2VLRE 1MFBL 4NQSB 3LIZH 1A3RL 3SDCC 3D85A 5HHXH 2FATL 4QXTB 4X6DF 1AFVH 3LHPH 5TQ2H 3RWCA 3CVIL 5I1CL 3UAJD 1J18A 3ARFA 3S36L 5I1GH 1IGIL 4QRRE 4YUEL 4PJ9A 3ZDXF 2FX9L 1A2YB 2YK1L 3EKCA 1PLGH 1BIHA 2J4WL 1V3JA 4LRIA 4NQSA 2F53B 4LNVA 5J9PB 4NRZB 2GITA 4P4KC 5F7NC 4QXTA 5FF6A 1X6NA 1S8DB 4BJLA 4RA0C 3KPSE 5EH1A 4PB0L 3KJ6H 4M43L 5DUBB 3VI4F 5I8EB 2OYPA 2NY2D 1VGKB 3VRJB 3WUWG 5E08H 2BNQE 4PRIA 1A6WH 3FT2B 2NY1C 2NY0C 2Y23A 4JO2H 4I4WA 4XCCL 5JDJA 2VDNL 5FUOH 5GISH 2Y5TB 1N8ZB 1TVBB 1YNLL 2A6IA 1PGRB 3ZT6A 4HJJH 3UDWA 4HPYH 4QF1A 2F53A 4JZOB 1NCBL 2GSIB 5BJTA 4Y0GA 5C6TL 3RVWD 3P73A 1WK0A 2ADFL 3KXFE 4NZTH 1G9ML 1YEEL 4FZ8L 1DVFA 2VB5A 5DUBA 3VA6A 4I2XE 4LBEB 1VGKA 4XGZB 3OL2A 2NPLX 4LCIH 3NBNA 4BH7A 2XQYK 5FEBA 2Y5TA 3QI9C 1N8ZA 2R39A 2GHWB 1S3KL 1U8HB 5GIRB 4JZOA 4M6OL 4ODXA 2GSIA 1KBGH 1LO5A 5CEZH 1NKRA 4PIRF 4JANB 1OP3K 1L7IH 3NCBB 2IAMB 1S5IH 1EAPB 4JHAH 1MCOL 1EH9A 4HWEL 1JUFB 4HWZA 3TZVD 1G7IB 4LBEA 2C7UB 1F4XH 5C6PB 4YAQB 4YK4C 2DWEB 2QSTA 3AC0A 3V0WH 2RB8A 2I26N 1CBVH 3ZKMD 4G3YL 2E9WA 4GKOA 1CCZA 4AH2A 4DUWA 1K8DB 2J1KA 5CLTA 5GIRA 4R4FH 2VERN 3ARUA 3W9EA 4XWOC 5GJSL 4L3EA 2H32A 4X6CA 5I1IH 2OJZL 4KDVA 1D9KB 1JUFA 4BZ1L 5GXBB 4OM0L 5CJOL 5ADOH 4LPYA 3GO1H 3OHXB 5LG1A 3O8XC 2C7UA 5I19L 3WIFA 4H1LH 4GAGH 4PJDE 4YAQA 5L0QC 1JL8A 4LCWE 2DWEA 4FTVE 5I73C 4NHCL 4PG2A 1U3HC 2NY6C 4U6VH 2YRZA 3R06B 5D70H 4Z95L 1OGAD 4PRHD 2EDWA 4XNQA 1G0XA 2JK5B 3ZSTA 3ISWA 1TZGL 4MAYB 4JG0H 2MHAA 2VKWA 4PP1D 4HKBB 3OAYH 4D9RE 4CN1A 4DN4H 1ZHNB 4KJQD 1D9KA 3CSPA 1YEDA 4D0CB 2YA0A 4XVUD 4KDWA 1UEYA 4JHWL 5IBUB 1EHLL 4MWFA 5E8DH 1S7SB 3DV4B 1XF5A 4AYFA 2DIAA 2ZG1A 3IFNL 3HPLB 5T5FH 3PQYD 1KNOB 3WD5H 4Y4HC 4MAYA 2NY3D 1S9XB 3MR9B 2VWEC 4PJ8A 4HKBA 1BM3H 1PKOA 5CZKA 5KJRL 1QUNA 2QQNL 1I1FB 2CKBL 5F7UA 2J5LB 3P9MB 3INUL 4P23C 1JTPA 2X4UA 1OAXL 1H5BA 3D87B 2B4CH 3JWOH 3UO1H 4LGSB 5SX5H 1CXIA 5J3HC 5D1XD 5CJ5A 2P8LB 2VZ1A 4HIJB 1T22A 4W70A 1D6VL 2EDRA 1OSPH 4XPFH 3D5OF 4Z0XB 5EBMB 3MR9A 4CW1B 3W0WD 1OTTD 1CICA 2EYTB 4BH8B 4YE4L 5JXEC 4H1LB 3ZE2E 4IJ3C 4YPJA 3FOMB 3ULVE 1GGIH 3P9MA 2ITDB 3TWCL 1JTOA 2ICWB 2A9ML 3MJ9H 3WUZA 4HC1H 1N64H 3QEQA 4YDIH 1ZHKA 3MRNB 1P7QB 3I50H 4KI5D 4JFDE 1FCGA 2P8LA 3MLRL 2OL3H 5CEYB 4Y4FD 3VFPB 4Z0BL 4Z0XA 3RWIA 5EBMA 1MIMH 2B5IC 2NX5D 4QTHB 4QYOA 1RUMH 1NC2B 1SEBB 2RFXB 4XCEB 4TULH 3FOMA 1FZMA 2VQ1B 4ZTOH 2X5PA 1BIIB 2PYEB 2ICWA 1A3QA 5T1MA 1IT9L 3QUYD 2HH0L 1U41A 4KY1H 5GGRA 1D5XA 4X5XB 3PL6B 1A5FH 4TOYL 3MRNA 1P7QA 4I77H 1WWBX 4OF6A 5FYJD 5CBEA 1MEXL 5CEYA 2Z4QA 3VGAC 4Y2OA 5JMRA 3BZFA 4QTHA 4R2GC 2RFXA 1SEBA 1T2QH 2C1OB 3FQNB 4Z7WB 5DJ0B 5I9QB 3RBSA 1CDJA 1IMHC 1BIIA 4JEGB 1HCFX 4OIBA 4X5XA 4GT7A 3ZTJG 1OARH 3KPPB 2F5AL 1J1OH 1JTTA 2A73B 3ZDZF 4TRPH 4PUBH 2C1OA 3FQNA 1QFOA 3QUXA 5DJ0A 4X6DA 4LU5H 3TFKD 2D7OA 2J6EA 2W91A 2FIKB 2JLLA 4OV6F 2OL3B 2XFXB 3SO3C 1UCBH 3JUZA 4QHNB 5DVNA 5GJTH 4K8RL 2MFNA 1Y0LA 1YNKL 3FO0H 3SKOB 2CPCA 1LO0L 1XCQB 5GZOC 1E6JH 4HHAA 5EOQL 3KPPA 1R3IL 4Y2DA 1K4DB 4CADA 4JM2F 4RDQF 1KLFA 5E70A 5KVGL 4ZMAT 4NQDD 4Y5XB 2XWBA 2AXFB 5IWLA 2CIKA 3Q5TA 3S37H 4TSBL 1PDKA 3MJ9A 1T4KA 1T89C 3IXAB 4I9WD 4RQQB 3QDJB 3UBXA 3OKLB 3GIVA 5MENB 3MA9H 4KRLB 4MAUH 4PS4H 1LNUA 2H6PB 4WNQB 1T04B 2OL3A 2XFXA 5TF0A 4JB9L 5ICXA 5SWQA 3SKOA 3ARPA 1XCQA 4HGMA 1LDPL 2G2RB 1EAJA 3FJTA 1K4DA 3CLFH 3OKNB 5DWUH 5K93A 4PLKC 3RL1B 2JKXA 3VG0L 4RQQA 3WNOA 5CINH 5GGQL 3K4ZA 5MENA 3AMLA 2NW3A 4LSPH 4IMKA 1IFHH 4JO4H 3T1WA 4WNQA 1T04A 3RDTB 4JY6B 5IQ9B 2PYFB 2ADJB 2DTSA 3IDGB 2FEEL 3VCLB 1LK3L 3I02A 3WHE0 3LZFH 2VDRH 5D1QB 3SQBA 2R0KL 3M1BB 4O4YL 1JPFB 3WKML 5J12B 2FX8L 3FTGB 1A7RL 3BWUC 3GI9L 1KJ2L 3VI3E 3RI5F 1OY3B 3ELAT 3MJ8B 1TETL 4R4NC 3HI6L 2W0FA 3H3BC 5HDLA 5JQ6H 4CVXB 5HVGB 3MFFB 1XAUA 5E5RB 1T03H 4KQ4H 4NKOB 4JY6A 5IQ9A 2PYFA 3VE0B 3IDGA 4OD3L 4H5SB 4LHUD 1KTDB 4JAMB 1KPRB 1P2CB 2BX5A 4HKJB 1JPFA 1UA6L 3FTGA 4YR6B 2NNAA 1T0MB 4LVHB 4N0FB 4NQVB 3I75B 1NGXA 4LSUH 2OQJB 4WGVB 3MJ8A 5EU4A 1ACYH 1MRCH 5KSAB 4WI5A 1MFAL 1QFUH 5DSCA 3C60A 1JRHL 1AE6L 2ID5A 4F9LA 1A0QL 3F8UB 4KGJA 1ZGLM 5T5NG 4H5SA 4HT1H 1KTDA