3ZDZE

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 38
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE02
4XBEL 3DUSA 1V3JA 2UWEE 1W0YT 5JPMB 3BDYL 3BD5A 3QFJE 1NCCH 3VI4E 2XY1A 1FIGL 2EO1A 4ZAKD 3BPOC 1P69B 5IJKA 3FO9A 4HF5L 1HXMA 4XCCL 3D25B 3BQUA 1BD2A 4JO3H 4X6EB 1FZMB 4RBPK 5ESVA 2J88L 4MXQD 1IARB 2HG5A 2PXYA 2DRUA 4PJ8B 1I1FB 1EK3A 5HHVH 2DAVA 5C07E 3D0VB 2DYPD 1G7LB 2FZ3B 1WWBX 4JDVA 1DQQB 3B2VH 4KKBD 4IS6A 4JRYB 1K8IB 1S7VA 1ZS8B 4JFFD 1MWAB 1DE4A 2NX5D 2ZSWA 4X8JB 5DK3A 1S8DA 1ODAA 4CVZB 1JYXA 4K94C 5CKGA 1DVFB 3L3GA 4AIOA 5C8JB 5ACLA 3QISA 2MCPL 2GSIB 1HHIA 2R2EB 1A3RH 3U7YL 3STLA 5CGYC 5FOJA 4WTZA 4UNUA 3AXLA 4RMVA 1RJYB 2DDQH 3WFEH 3GBMH 4OQ1A 4APQA 4G5ZH 4FNLH 4P2YA 5IVNA 3NFPA 4AH2B 3H9ZA 3WNLA 3UPCA 5GXBB 4NDMA 4ODSH 2X4QB 1KBGH 2WW8A 5FHBL 5J11C 4M7LT 4FQXB 5F9WC 1UM6H 4P2QD 2P8LB 2PXYD 5IM7A 1P1ZA 2D0GA 3EYUL 5EPMA 4Q9RL 2DQDH 2Y07L 2J4WL 1II4E 1FFNB 3IT8D 5BV7B 1NBVH 3MLTA 1Q0XL 4JFQA 3ZTJG 3L3IB 5IV2B 1MI5B 2HT3D 2OJZH 4R96B 4OJFH 1DBJL 1MHHB 2YHGA 2YRLA 4UOW0 3IU3A 1EHNA 1I75A 1JZ2A 2GAZB 4APQD 2DM4A 5DJXA 4BKLA 3FZUD 4N0FA 3FQXB 1NBQA 3MRNB 4V1DE 3W9EB 2LU3A 2NQCA 3IDMA 3FB8B 4LSRH 1I3GH 4L3EA 3BISA 4HKXB 1CD9B 1JTPA 2AXJA 4Z77B 1Z6JT 2QADC 4KQ3L 2VDOL 5F8QC 3VD9A 2DQFA 3VD7A 4C56A 5JW3H 1ZA3A 3MJ7A 5A43C 4XNZB 1I85C 5ANME 4QF1A 5F1NB 3QUXA 4P46A 4FZEH 5CINL 1VACA 3DVGA 5BQ7A 2Z8VC 2VDQL 3MV8B 4KVNH 2NLJA 4KK8C 1MREL 5FECB 3OHXB 1A14H 4OD3L 5E5MB 1XR9A 3FB7B 1JN6A 4X4XA 1HSAA 4QGTA 2YBRB 4LRNH 5MENE 2QR0B 2FJGB 4RGNC 4U4BA 4W6XB 4PRPD 3P77B 5I1KL 1HCFX 1JF1A 5L6YL 3QCVH 1DSFH 4P5TD 1P7KA 4JO2H 1UEYA 1CE6A 4OCRH 1AJ7H 3NZ8A 2WUBL 2VISA 4ENEC 3AMLA 3DXAB 3UTPD 3CZFA 2N56A 4PJDB 5EUKA 4G6AD 4F37K 1GPOL 4PREB 3ILQD 3CSPA 3TBYB 3QIWD 5EUOB 4OD2B 4P23B 3BN9D 2A6DA 5HDQL 3ARGA 1UKQA 3MBXL 5DUMH 3B8SA 5F21B 3KPPA 1QR4A 4KUZL 2Y36L 1C08A 4KI5F 1NMAL 4YBLC 4JHAH 4TPRL 3MYJA 4CJ0A 4YXLL 3LVEA 1MJJB 3I3DA 1BAFL 5IOPA 5C0CE 3DRTA 1B4RA 2BVOA 4XNYL 12E8H 4XI5C 5INDA 3LKNB 2ICWB 5IVZA 1LEGB 2A83B 4N5UA 5KOVC 1OCWH 3KLHC 3TWCL 1XCTA 4QRPB 2P1YA 4DTGL 1WBZB 5IW1B 4IRZH 4WI7A 1HNGA 2Q76B 2YR3A 4JFEA 4ELMF 4O9HL 3ZDXE 4HS8L 1ORQA 2HJFA 4M62H 4UU9A 4E0RA 4LSTL 4OLZL 5K33A 1MCRA 4KK9C 4QRUB 3SDXE 3ULUL 4NQUA 3OR6B 5J6HB 4L3AA 4PJDF 5E2TH 1IEAB 4KV5E 2PO6C 2AERT 1BQHB 4PR5B 1ACZA 1W72L 5BMFL 2X70B 5CUSL 1J1XH 3S5LB 5GIRB 5D2LF 2HTLD 1PZ5B 5MHSD 3NIFF 4UV4L 1WIUA 3VGEA 2W9DL 3X14B 4GMSL 5T1DH 3I3EA 4NRXA 1TCMA 4LCWA 4JG1H 1QFPA 2F54A 3NMEA 1Z9MA 4ZAKB 2PW1B 5E2VL 2FWOB 5JNYA 4QTHA 3VFWB 1URLA 5CP3H 4KJWD 4D0DB 2VZVA 5D7LA 3PABB 1P9MA 4YR6B 5DD3L 2V2TA 5C0DA 3QXDA 5EU4A 3VFMB 5T3ZE 2DL2A 4YHPB 4Z7UE 1ZLVH 1FYTA 3QCUL 4OFVA 5E8DH 5FHAH 1UWGH 2X41A 5L2KA 1N2RB 2GJ6B 5HVWA 5EZJB 4LDEB 3IXAB 1K3ZA 3PWNA 4I9WE 1L0YA 4ZXBC 2DYPB 4YGVA 3WFHB 1J8HE 1S9KC 3MV01 1QNZL 3ZE0F 3AAZB 2XWTB 2H3NA 2NX5B 2YXFA 4H1LG 4NCC2 1Y18A 4G6MH 1CDYA 4K7FA 4ZO8A 4H20H 1OAQL 1KJ2B 3KJ4C 4GG6B 4OZFH 4XCEA 3EOTL 2N1KA 4K3DH 2GW5A 3T65B 2BX5A 4RFNC 4HT1L 1HHKA 1CGYA 3TFKD 2QKIA 3DUSB 1F11A 2DIBA 3CFKB 4KJYB 3BI9X 4LCWD 4XVJH 5I1JH 3WLWD 2AJVH 5DMJB 4P9ML 4DKEH 1HXMB 4AYFA 3I6LE 3BQUB 1BD2B 1ZA6A 3U0TA 5SWSA 2C9AA 1NCNA 4HGKC 3HR6A 3TCXA 5KSVA 2FR4A 2YPKA 3LN4B 2HG5B 2PXYB 5FUCE 4PJEF 2EIZB 3WEXA 2E27H 5H37G 1QBAA 2WMPA 4RWHA 3MV7A 4DUVA 1XGRA 4JDVB 2ICWI 1MCNA 1S7VB 1HYRC 3QUKA 1DE4B 2ZSWB 4NQEA 5DK2A 1S8DB 3MXVH 1KN2H 1RZIA 2DTML 4L8BB 3L3GB 4LP5A 4F58L 1G7JB 2Z0BA 1ACYH 3SDDC 1HHIB 4H8WC 2V2WA 5I8OL 1S3KL 4G9FE 5EWIH 3WFBL 1UH4A 2ZUWA 4E41D 5CBEA 4APQB 1CFBA 2YRPA 1WK0A 5TE4L 2B0SL 1A1OB 5DD1L 1G0XA 4NDMB 5DQDL 1TZHA 1QFUL 5ICXA 4GG6F 2IQ9H 2XN9A 3D9AH 5HI5C 4KJPC 2IBZX 4NUJA 1KGCE 1MRFL 4N0RA 3C6LD 2ATKA 1RZKL 1P1ZB 5EPMB 2GUOB 3FRPA 4FFVD 3U9PL 1ONQA 3ARPA 5JXEC 2E9IA 4TSCH 4QXTB 3CVHL 1PEZA 4NQED 3UJIL 3MLTB 3WDHA 4L8SC 4JFQB 3KVQA 3NIGE 1JI1A 2GJJA 4XPFH 2DQHH 4NT6A 4P49A 4OT1H 1OD7A 2JE8A 4NGHL 5SWQA 3X13A 4KK5C 3O4LE 2ZUYA 5F97E 5DFTA 3IU3B 2WUCH 2VUYA 1JIBA 2BFVL 2OJEA 4NC2B 1X9QA 4LPYA 2MPAL 4OF3A 5KVDH 4M5YH 3VD3A 1J1OL 1RHFA 5C6PB 1I85A 3FRUA 1ZV5A 4O2FA 2C7UA 3G6JB 4G80A 5EIVA 1EUUA 4KHTL 4XNUL 4Q9QH 2XN9D 4J3OC 1G7IA 1L7TH 1RZFL 3DV6A 2P8MA 3ROOA 4FS0A 3OXSA 1CLZH 4X6DA 3QJFA 2B1HL 2DQFB 1N64H 1JYVA 2OL3L 4C56B 2Q86A 1ZA3B 3MJ7B 8FABA 4D9RE 4OCSH 3MV9A 4QF1B 4CADA 1SEQH 1UG9A 4QRRA 1H3PL 1XAUA 2ZUVA 2VXSL 4WHYH 3QUXB 4P46B 1VACB 1SBBA 3DVGB 5BQ7B 1J0YA 3FAXA 1BX2A 1XR9B 1R5VA 1JN6B 2VDKL 4X4XB 1Z0NA 5DJZA 1HSAB 5HHXL 4LIQL 3A6CH 3O2VH 4NO0A 1L6ZA 2QV2A 4KH2A 1EHXA 1IBGH 4U31A 3TF7C 1X5ZA 3QAZB 1P7KB 1QRND 1CDJA 5CJ8A 3D48R 1MH5B 3LAFA 3S98A 1CE6B 3NZ8B 1A21A 1D3CA 2VISB 1TQCC 1A7BA 1GAFH 3CZFB 2AI0L 5EUKB 4KK8D 4NYLA 2W59A 4PV9A 2OTWA 2A6KA 2AJZA 3L6FB 4YHMH 5KVFL 3V4VH 2A0LC 3MV9D 2M1KA 5D9SA 4QRRD 1OHQA 3VFGL 2XYCA 1R3IL 4GLRI 1O7VA 1T1XA 3I75A 2AKRA 2VC2H 3BIKB 2FL5A 5D72H 3IAGC 3NTCL 2GTZA 4YQXL 1XF2A 2A6DB 3ARGB 4LARL 5IMOA 4IEFB 1C08B 5GISH 4TN9A 1ZTXH 5ADOL 4BQ6A 3JTSB 4RCAA 3I84A 3MYJB 2AGJL 3D85A 4U6XA 3ZSSA 5F1OB 4AEFA 4DQOH 5IOPB 3V52H 3DRTB 1KJ3L 2YK1H 2BVOB 3EO1B 4LEOA 5INDB 4DW2H 4QXWA 4NP4L 5IVZB 3VXMD 3PHOA 1QKZH 4JG0L 5T3XL 2XY2A 1XCTB 1J5OH 1TTFA 1H3VA 1JK8B 3ULVL 2XZQH 4N0YL 3U2SA 4NWTH 1ZT7A 3ILPB 4JFEB 1JPSL 4U05A 3P9WB 4JO4H 4ZTPL 4BH7A 1I1YA 1HHHA 3T0XA 1ORQB 3KPQA 4LMQI 2HJFB 2PO6A 3ET9F 4UU9B 2BZDA 1TVDA 5FYKD 3FFCD 1LHZA 4FFYH 1JPGA 4U6VL 2VDPL 4FQJH 4U7SA 4R7DA 2DQJL 4I3SH 3UP1A 1L6XA 2IPTL 3DYPA 4XI5D 5SV3A 3GSNA 3U4EA 2HRPH 2DJUA 4HWEL 1P7HL 1F4XH 4Q58C 4HG4J 3GO1H 3IDJA 4JQVC 4MB5A 4XBEH 5K59E 3D85D 3BDYH 2Q1EA 4KDTC 2OI9C 4J3SA 3BZ4A 1M7XA 4CU7A 2P7TA 5BOZG 4DK3A 1KELL 1TJHH 1FP5A 4Q6IC 4NRXB 1UZ6E 3EUUA 2FHBA 4GKNB 1CT8A 4EUPG 4KK9D 2GFBA 2D9QB 4M7JH 5B3JF 1E4WL 4LCWB 1SBSH 1DBKH 1B0GA 2QQLL 3UTSD 5JNYB 1GVIA 4QTHB 2A77L 4I4WA 1CDGA 5D7LB 5C0FA 2BXZA 2WIMA 2V2TB 5C0DB 3QXDB 1JP5A 3F7PC 1JBJA 1R24A 2C4XA 4UT6L 5D2NE 1LDSA 1EGJA 2VLJA 3PDDA 1M6OA 1FYTB 1INEH 5L2KB 3IVKB 3QO1A 3FJTA 3PWNB 4YGVB 2KBGA 1IAKA 2X9WA 1LVEA 2H3NB 3IF1B 1KFAL 1Y18B 3O3AA 3U6RA 2Y06L 4K7FB 2BNQD 3NVQA 4TULH 3T0EE 1EH9A 3BPOB 1RZJC 2RFXB 5I75C 4XCEB 1QQDB 2AW2A 1M1SA 4KROC 3OF6A 1HHKB 3PGDA 5E6YA 1F11B 1L0QA 2P4AB 5DS8A 1A4JA 1A7PL 4XHJC 2OYPA 2I60L 3LHPL 1DANU 3VMOA 1WFNA 2G75A 2Y07H 4ZXBD 3D6GA 4QCIA 1XF3B 4M1GL 5I15L 3NA9L 2AJUH 5EU7C 3SJVA 4ISVA 3U0TB 5SWSB 3RWIB 3SO3C 2DM3A 4KUCD 2FR4B 1PG7L 2FECI 2YPKB 4XP5L 3FO1A 3WEXB 3WUWG 5EOTA 5JUEH 3C6LB 3SDDA 1DBJH 3MV7B 4PJIA 1XGRB 4HMDA 4LEXL 3FCTA 3QUKB 4POZD 3H9SA 4NQEB 4WUUD 5DK2B 2P42B 5J7CC 4G6FB 1FZKB 3CXDH 1MELA 2R2HA 2V2WB 4KRLB 1HHJA 2ZG2A 2A1WH 2VDLH 2KZ1B 4F37F 5F9WB 1IM9D 4RSVA 1T66C 2Y5TA 5CBEB 1KXQE 2W38A 1P5VA 3UTQA 2PUQT 3O81A 5TDOB 1OTSC 1AGEA 2CDEB 4HV8B 5F1SA 4LSVH 5KAQG 5INCA 1TZHB 1NGQL 1YPZA 5DZOA 5ICXB 3SJVD 5JXEA 2CRMA 3PG2A 3EYOB 4KGJA 1JGEA 2XN9B 4A6YA 2VDQH 4M7ZC 4KK6C 4L8SA 4JDZA 4DAGL 1HXYB 3P40A 5EU3A 3QQ4B 1KT2A 2ATKB 3SDDD 2VZSA 3RVVC 2H6PA 5JR1L 4NKQB 1ONQB 1ERNA 4PRHD 4KKCD 5I1KH 4U2ZA 5L6YH 5EH1A 3RTQC 4OGAD 3T2OA 4I48A 3VFOA 4NT6B 3NACL 1T7YA 1MFEL 3BKMH 3X13B 2NY3C 5CP7B 4LFHD 4P48A 5GRZA 4ODXA 3TVMC 4XBGA 3SDCC 2OJEB 5LGJA 2QADB 5SX5H 5EOCL 1BBJA 1S78C 1TNNA 1D6VL 5KVEL 1LE9A 2AQ1A 3LZFL 1GPOH 1WZLA 5IMMA 2C7UB 1CE1H 5T3ZH 4G80B 1PBYA 3C2AH 3GSVA 3VGAC 3S88L 5CJXC 1WC7A 2OQJA 3DV6B 2P8MB 3ROOB 5J4MA 3OXSB 4Z7NE 4X6DB 4OCYL 3QJFB 3K0WA 1RFDL 3L5HA 4OLUH 4OBRA 2Q86B 1A5FH 4KUZH 8FABB 2Y36H 1U2HA 1MHCA 3MV9B 1J86A 3L5IA 4KK5D 4CADB 5HJ3A 4QRRB 4RGNB 2KZWA 4XRCB 5E8OA 5TF1L 4YXLH 1BAFH 1Y6NR 2GJZA 2FLRT 3I6KA 1A9BA 2APFA 1SYSB 1BX2B 3FT3A 4LOUD 1R5VB 2M8XA 3NH7H 2QQNL 5DJZB 3PWVA 3TWCH 1HDMA 1KB5L 5FYJE 4NO0B 43C9B 4FTVA 3MQIA 3JV5A 3NIDF 1NUNB 1EDQA 1MJ7L 4HPOL 1T80A 1RUPL 4HS8H 3F62A 3TJHD 5EOQL 4G7VL 4N0UA 5HD8D 1RUML 4KMLB 4LSTH 3ALWA 3VI3E 2FB4L 3UDWA 2J8UE 2OLDA 3MGOA 2Q7NA 3QHZL 5HI3D 1Q72H 4NYLB 3ULUH 4PV9B 2OTWB 1PSKH 2AJZB 1XCQA 2AK4D 3P4OA 4I18C 1OTUC 4JRYE 5D9SB 4MXVE 4XP6L 4YBLB 1MIEH 1T1XB 4YHYC 1N3NA 3I75B 4OD1L 3I3BA 4MMXC 4Y1AE 3N1GC 4S0TD 2FL5B 1XF2B 5SWZD 3KAAA 4O5LH 3OWEA 4UV4H 5IMOB 5LBSL 2YD9A 5LG1A 3HMWH 4X6DF 4GMSH 1T7ZA 3MNVB 4JGJA 3B8YA 5DRXA 4FTVD 4Z95L 1LP9E 3M17A 3D85B 4HC1A 1I3RA 2GT9A 3MLPA 1G0DA 2WV3A 1H3WM 5E2VH 5ID0A 4I13B 4RGMC 1NGPL 2A0LD 1NUDA 3K1KC 4EBQH 4MJ2A 5IJVB 3PHOB 2X42A 1AXSA 2AEQH 3MLWH 2Z91A 3U2SB 1NANI 1TZGH 3O2WL 3PP3H 4BH7B 1AI1L 1T20A 1I1YB 1HHHB 4QOKE 1YNTB 4JQVA 2PO6B 3MLSH 4JFOA 4XB7A 1MFAH 1FDLL 4XVSH 1UA6H 4HCRA 5B4MC 4XCNA 3P4NA 4RGOH 1DBMH 4R7DB 5HTSA 3VH8G 4KDTA 2D7MA 1OAQH 3S96A 1PFCA 3GSNB 3OKNA 3BGMB 4W4NA 4X4ME 2R1WA 1HWHB 3IDJB 1I9JL 1Q8MA 3ZKNC 2IJ0C 4QKXB 4I2XB 4KZEH 1JGLL 2BNQB 4HH8A 3BZ4B 1RUQL 4P9MH 5C92A 2NR6D 3S7GA 1VGEH 2ATPB 4MA3A 2DIJA 2YUWA 1CT8B 4P3CL 2ESVA 2GFBB 5FO9A 3UZQA 3KYNA 3SOBL 1B0GB 5DYOB 1U95A 1J0HA 1KPRA 3F7VA 4ZXBB 4XPAL 1KC5L 4ZO6A 3KR3H 4MNHA 5C0BE 4JZJC 5C0FB 4BFEA 1LK3L 2X4UA 1C5DA 1RAMA 1R24B 5EORL 1EAPA 2G60H 3MV8E 3RZWA 1K8DA 2VLJB 2NNAA 1NC2A 2DTMH 1M6OB 2DQCL 5I8KL 1L9MA 3KJ4B 3VXSD 5D7IE 4D0CA 5IG7B 4MAUH 1S3KH 5I8OH 1QLEL 1ZANL 4RFNB 3UPRA 1IAKB 3U6RB 1MEXL 1ULVA 2B0SH 3ZTJH 4RNRA 3PHQA 1F90H 1QYGL 1X44A 3CFCH 3DGCR 3MLYL 4GXVL 2Q7YA 3DXAE 4ZPVA 3KXFE 3MRKA 3PGDB 2FHFA 5DS8B 3LSOA 1IM9B 2J1KA 4R0LC 1MRFH 1A4JB 1KF9B 1UB6A 1UCTA 2R0LL 4U1GC 3V6OC 2G75B 1GZQA 5DD5H 4NRYA 4AM0A 3U9PH 1FBIL 4QCIB 2XRAL 3S34H 3TA3C 2XA8H 4FQ2H 5DLMH 5EUOE 3CVHH 3SJVB 3VGGA 2X89A 1RUAL 4ISVB 5J9PA 1JUFA 1NC2D 3D5OF 2J6EL 5CJBA 5D7KD 4X7SL 1BF2A 3TYGH 3FO1B 4ZO9A 5KSUA 1IGCL 2VZTA 2ZZUT 5DR5H 5E56A 4DOHE 3SDDB 3SE4C 2F53D 3FCTB 4YXKL 3UMTA 1QP1A 4BQ9A 2BFVH 1CGTA 1P6AB 3H9SB 2P5EE 4XHJD 2A2QT 1R0AL 1Z5LA 1D5MA 2NY1C 1SYVA 4KRMB 4POUB 5HHNB 1INDL 2R2HB 5EZIL 4KUCF 1EHAA 3N06B 1HHJB 3FQWA 3VXUE 1NFIA 3BAEL 2B1HH 2Y5TB 3V6ZA 3T2QA 2DWEA 3UTQB 4P3WA 3E1F1 1AGEB 3T0BA 2HVJB 1KLFA 4LVEA 1FV1A 1YPZB 5DT1L 2Z8SA 4XMKL 2X89D 1UWEH 3KPRE 1JGEB 5D5MA 1QOKA 4A6YB 4FQLH 4L8SB 3RTQA 4JDZB 3EGSA 4X80L 4FQCL 5EU3B 3GHEL 3VMPA 5TE6L 3D69A 1KT2B 3LPFA 1HEZA 5EO9A 4LIQH 3W39A 2H6PB 5GRJL 4JM2C 4DN4H 4EZMA 1CFSA 3TVMA 3SDCA 3WXWL 2GYSA 2H8PA 4I48B 1KCKA 3VFOB 1FNLA 4CMHC 3BEWA 5MP6L 1OTSD 4WRLA 4WEBL 5F3BB 4LNRB 4TUOA 5IB1A 5EOCJ 4PLJC 2N7AA 4LBEA 3VXRD 1Q9OA 4PJIF 1UXSA 2BSRA 3TYFA 3TPKA 1LE9B 4L9LC 1BMGA 3IB4A 4OIIH 5K9JL 3N1FC 3FQNA 2F15A 1R3IH 1NMBH 3GSVB 5IKCA 1KEMH 1WC7B 1E4XH 3NTCH 3RTQD 4YQXH 4KRPD 5IVXA 4D9QD 4LARH 4QLRA 4M02A 1K4CA 5EBWA 3RIAK 4JRWA 5HYQA 5J6GB 1PKOA 1KENL 5HJ3B 4JFFE 4WWKC 3U4BH 3WD5H 4Q2ZA 3MGTA 4M1DH 5EC2B 4CU8A 2GJZB 4OCWH 1D5IL 1KJ3H 1LDPL 1YPZF 1S78D 5FXCH 5JW4R 5KG9A 2XV6B 4JR9L 2ZG1A 4NP4H 2F19H 3FT3B 1HI6A 4PTUA 2RBLA 4HS6B 4JG0H 3PWVB 1DQLL 1K6QL 3GSRA 1JV5A 1HDMB 1TQCB 4PLOB 4U0QB 2LQRA 3ULVH 2ZOKA 4FTVB 1S5HA 5I1DB 2E8YA 4DN3H 2EE2A 3WV0A 4ZTPH 3DOSA 2B8OT 3CZJA 3QI9D 2HWZL 4I18A 4N5ED 4N0UB 2BSTA 2FD6L 4U6VH 4HMCA 2VDPH 1BZQK 4FG6D 4O2CB 3SKJL 4P2QE 3MGOB 3QH3A 1QPPA 2IPTH 3Q1SL 1CBVL 2JCCE 2AV7B 3WNOA 1XCQB 1B0WA 3P4OB 4HK0A 3L5WA 3VXNA 5K9OA 1U6AL 1MCPL 1P7QD 2VRAA 1N3NB 2SEBA 2NTSP 1YYML 1YN6A 4QYOA 4WY7L 2J2ZA 2VLKA 2YPVL 3BESR 4WUKH 4JVWA 4Z7VE 1KELH 3O8XC 2J12B 3BWUC 3P9LB 1ZLVK 2JB5H 4OZHE 4RZCA 5HYSG 1R3HA 3M17B 4LCCC 1YUHA 1I3RB 2GT9B 4H1LH 1BJ8A 4JFYA 5EBMA 1FNFA 2QQLH 1QVOA 3LRSA 5ID0B 1MLCA 1MPAH 5H94A 2A77H 1KV3A 4NO5A 3T4AB 4FZ8L 5D70L 1AXSB 3Q48A 4N1CA 4AT6A 4JPKH 3R8BB 4QNPE 4JFXA 1NKRA 1YDPA 3TM6A 2O5YL 1TJGL 5GZNC 1QFHA 1CD1A 1T20B 3N1QC 3GGWA 3SPVB 3O3BA 5AEAA 4JFOB 3P4NB 5LWYL 1SMAA 3RGVD 3P9MA 3H3BC 2IANE 2OI9B 2VLKD 3NZHH 3S96B 2I25N 1BZ7A 1T7VA 4MJ5B 4YZFF 1I7UA 3GRWL 5ADPH 3DX8A 1JE6A 2R1WB 4OZ4B 2C4FT 5H37H 5ALCL 2EDFA 4NO2A 5MEPB 3EO0A 4Q6IB 4PRPE 1JWMA 1BFVL 2W91A 5C09E 1OGAD 1A7PH 1DP0A 5ILTL 2I60H 5J89A 3LCYA 3NABL 1QSFA 5ABDE 3TBWA 2DQIH 5TFSL 3G6JE 4NSKA 4S2SA 1QSED 3NA9H 1A6WH 4JZJA 1OAXL 1AXTH 3UTPE 4MA3B 1ZHLA 2ESVB 5FO9B 2YOCA 2V7NA 4F80A 4D94A 2CRYA 3TZVD 4W6WB 3KYNB 1WTGT 3LEXB 1U95B 1KPRB 3DROA 3IDIA 3F7VB 4KKNA 2RHEA 3ZE2E 5GGVL 4MNHB 1S9YA 4MD5A 2M2DA 2X4UB 3VRJA 1C5DB 4LDLB 1IC4L 1N5AA 5HGDA 3PV6A 1EAPB 1XZ0A 5TJWK 2UY7A 3ZZ1A 1K8DB 1A0QL 4OZIE 2NNAB 1NC2B 1MCLA 3L3HA 5KS9A 3F6LA 4NQCE 4M6NL 1LO4L 1NFDE 1N7ML 1E0OB 5I75B 3K1DA 4D0CB 3IFLL 5FYJH 2F53B 4KROB 4XMLL 3UPRB 5CWSA 3I02A 4M43H 3IRZA 4ZS6C 4R0LA 4OZGB 1FO0B 3BYYA 1I7RA 3V6OA 5T1LD 4RNRB 1XMWA 2BK8A 3PHQB 4FFWC 3I9GH 3CU7A 3DPBA 4L4VD 2PR4L 4RDQF 3K8LA 2Q7YB 3TA3A 1T89C 3MRKB 4P9HL 3LSOB 3SO3B 4GG8A 2I27N 1NCDL 1U93A 4YNYA 4JN2A 3OKYA 3N85L 3QUML 3MTRA 1GZQB 1T83C 4NRYB 4AM0B 3SE4A 1HE7A 4JRXA 5I73C 1F13A 4YH6A 2XKNB 3QWOA 4Y16C 4LLVB 4KXZH 5E8PA 4OZFA 1NEZG 1S7XB 1JUFB 2VIRA 1KJVA 4KVCL 2OMBA 2W0PA 3CCHA 5FDWA 5BO1L 5KSUB 1N59A 3WNKA 1H8OA 5IFHL 4K3EL 1B2WL 3RWJA 2G2RA 3FMGH 4KQ4L 1QUNA 4N8PA 3ZL4H 1Z5LB 1D5MB 4YHOH 3V0AC 1KSRA 5DFVD 4RMTA 1MRDL 3FQRA 1SYVB 3LZFH 1ZHKA 3OG6B 1LO0L 1LEIA 3RUGA 3SGEH 5HHOE 4ODWB 3FQWB 3EYVA 2HFTA 4M7ZB 3VXRB 4OCYH 4EQ2A 3V6ZB 2BC4A 1RFDH 4N68A 2WBKA 2DWEB 5GSRA 3WLBA 4JRXD 3U9UA 4LL9A 1FV1B 4YHNA 2BRRL 4YWGH 3HUJE 2R0KL 5D5MB 5ACZA 5DC9B 4X5XA 3RTQB 3EGSB 5D71H 2NY1D 3FN0H 1BFSA 3D69B 2Q3AA 3P4MA 3T0AA 5JW4M 5EO9B 3W39B 4RRPA 5EU6A 2FJFA 2NY3B 3LN5A 4JANB 1CFSB 4LCUB 1MJ7H 3SDCB 4JPWL 1LQSR 3DMMD 1BOYA 4HPOH 2H8PB 5KTEL 1RUPH 2A73A 3B3IA 3GM0A 1R3JB 2Z93A 5EOQH 3BEWB 1QZ1A 4G7VH 1CQYA 4L9LA 4ONHA 1QA9A 4MNQA 5FEBA 1MIMH 4TUOB 3VGAB 5IB1B 4JY6A 4LBEB 4LCWE 1Q9OB 1LO3L 1YEDA 1G7HA 2B4CL 4G8EA 4PYGA 5AWNL 3VW3L 1UXSB 2BSRB 2XA3A 1NSNL 3TYFB 4PRBA 4HUWB 3QUYD 1MHPH 2XPGA 3FQNB 4JM2D 1O5DT 4B41A 2EH7H 3WFCH 4WV1C 3T2NL 2GKIA 4D2NA 4WWKA 1X5HA 5IKCB 4FQQA 2BVEA 3D39D 1GOGA 4Z7WA 1K4CB 4HWBL 5ALBL 5EBWB 2CRIA 1H8SA 4F7CA 5HYQB 4JFDA 5EU6D 1A7RL 1A6UL 2APXA 4ONFL 1WAAA 5GJTH 1P7QB 1P4IH 1Q1JH 2ZP0T 4Z95H 2MNUA 5F93C 3MGTB 4X7DC 4FXLA 5DGQA 1G0YR 3MJ9L 3B5TA 3ZDYE 5KG9B 5CJ5A 4FXGA 5D5MF 3RPIA 1HI6B 3RU8L 3FB5A 4MNQD 5IBTL 5GS2H 3GSRB 1JV5B 1GL4B 3BZFA 1JNNL 5FM5O 1S5HB 5DVMA 1H8NA 4E41E 1T03H 4MAYC 2OTPA 3O41B 3O2WH 2E9JA 4ALAL 1T22A 4X5WB 2B39A 1YECH 2FYYA 4GQ9H 2EH8L 3QWQB 2BSTB 1FDLH 3HB3D 5I1HH 1IFHL 2HKFH 4YHYB 2JELL 2ZCHL 1H5BC 2YN3A 5TQ2L 3HAEA 4EUPH 3QH3B 1KUMA 2J8HA 5C0JA 2UWEA 5ETUA 3TO2A 4P2OC 2QQKH 4JM4L 1ADQL 1WZKA 3QFJA 3B2UC 4JFDD 4HK0B 3VXNB 3O3DA 3O8XA 1OTTC 5IHUL 4ODVL 2APVA 2B1AH 2VQ1A 3BKJL 4U6HA 2X40A 2EKSA 4AEEA 4OGYH 1T5XA 1YN6B 4LCCA 3K7UA 1OL0A 1EVTC 2EDKA 2DQTL 2VLKB 4RGMB 3W11C 1KCUL 1QPXA 1RUQH 2Z9TA 4Y89A 5I30L 2LE9A 5IVXF 1KLUA 5C07A 1E6OL 4RZCB 1VEMA 2NZ9C 1R3HB 3FN3A 4EOWL 4YHLL 4OGXL 2EECA 4R2GC 4R3SA 4PRNA 1OPGL 3ESUF 4JFYB 5EBMB 2ZJSL 3LRSB 4Y4KC 1MLCB 5H94B 5C0RL 5FUCC 4NO5B 3INUL 3MJGX 4AT6B 5EORH 1V7MH 5E7BA 3KG5A 1YEEL 3RL1A 2EEAA 4JFXB 6FABL 4M3KB 3T3PE 4R4FL 1CLOL 1YDPB 4PJFE 4HQQL 5GS0H 1AC0A 1CD1B 3TLRA 3BO8A 4R4NC 4UV7L 3GGWB 4DGVL 3O3BB 4L5FL 1QLEH 3VCLA 4OGZA 3QDAA 4OM1H 4OLYH 1MEXH 3P9MB 1DQDH 2YKLL 4JFZL 3ZE1E 2IPUG 5JOPD 1BZ7B 1NCAL 3D2UA 1NCWH 2I07A 3MLYH 1I7UB 3DX8B 5GHWL 1EJOL 3UXFA 4NO2B 5DD6B 3ZT7A 3EO0B 1CZ8H 1JWMB 4HUUB 1HH6A 3P30H 3S8WA 4OUOA 3RDTC 3ISWA 5DK0A 2F58H 2R69H 1QRNE 4L3CA 4RMQA 1QSFB 2BVYA 3TBWB 5T1LB 3G04A 4NSKB 4S2SB 2FSEA 2XRAH 2NY0C 4JZJB 4L4VB 1RUAH 1BGXH 5F9OL 1ZHLB 2J6EH 2AXFB 1HK6A 3P4LA 2CKNA 5ID1A 5HI4C 3DROB 2H2SC 3QEHA 4YXKH 1JL8A 3SE3A 5DSCA 1S9YB 4MD5B 3VRJB 3GMMA 3TPUA 1N5AB 4PP1C 5HGDB 3PV6B 1WZ1L 1XZ0B 1R0AH 4X9FA 1QSVA 2BNUA 3R8QA 3KPMA 4YAQA 5KS9B 1A3QA 4LSSL 4GAFB 3EOYG 3D2UD 1AQDA 3PWJB 2LV4A 1LMKA 5ANMA 1GC1L 1RZ7L 3Q5YA 4NJAH 5CWSB 1T89A 3I02B 3GSXA 4M93C 3WUZA 3ZDZE 4R0LB 4Z76A 3L3JB 1WWAX 2JJVA 2VKXA 4U1GB 2CGRL 5J1TC 1I7RB 4DFIA 4L9DA 1T83A 1VEPA 3VXME 4GRLC 2W0KA 4NKMA 3RX8A 4Y7MA 3MXWH 4Y16A 3TA3B 4XMKH 3RWCA 3V4UH 3WFDH 5D1ZD 2VL5A 2DWDA 2VAAB 5MENA 1FNGA 1MJ8L 1YNLL 3RHWK 4YJZL 1NAML 1B6DA 1KTRL 2NY6C 4TVPL 4GG8B 4YNYB 1NGZA 1U8LA 4JN2B 1WEJH 2DQEL 2ERJC 2XWJA 2VXTL 3V0WL 5GRJH 4G43A 2AXHA 4EEEA 4JRXB 2CXGA 4KMQA 5FYKE 3FFCE 5SX5K 1HOCA 5E8PB 4OZFB 1BVZA 2VO5A 1RIHL 1U41A 3S4SG 2WBWB 1W0WA 4LSPL 3CCHB 2NY1B 4FFWD 5FDWB 3MCKA 1N59B 4NQSA 5D7SL 4NC1C 4WEBH 3UYRL 1KPUA 2WM0A 3RWJB 1M05A 3PWPE 2G2RB 2OZ4L 3U0PA 4LGRB 5CJQL 3V7AG 1XH3A 3J8F7 3H42L 5JPNA 3GHBL 2ICEA 3FQRB 1ZHKB 1DQJA 4M3JA 3GMPA 3MZGB 4H0IA 1MCDA 1A7OH 3IJSA 4HUKB 1LEIB 3RUGB 2V5RA 4Y16D 4OI7A 4YXHL 3QBTB 5GGRA 5MEND 4PP2A 2I9LA 1T2QH 2EYRA 3G6DL 1UFUA 5GGUA 1X3DA 4P3DB 3L5JA 5IT2L 2VITA 5GSRB 5CGTA 5E1AA 3UTSE 3RA7H 5C0CA 1F3JA 3WLBB 3OGOE 3QHFL 2E8ZA 2HMIC 1KENH 3U9UB 4JM2B 3MRPA 2XWBA 4PTTA 2HRLA 4ZFGL 3LQAH 1MVFA 1D5IH 4X5XB 4GQPH 4GAJH 2FH6A 2Y7QA 1O0VA 4JR9H 3KJ6H 4MXWL 4CMHB 3WMSA 3P4MB 4Z7QE 1FORH 2F8VA 3QIBC 1DQLH 5EU6B 3LN5B 1R3KA 2DLFL 3U48A 1D5XA 1J0IA 3ES6A 4R90L 5E08L 4I2XE 5AD0A 2K3TA 1VFUA 4UDUB 2BNQE 2A73B 1F3DJ 3AGVA 5CCKL 1OAZH 1F4AA 2Z93B 3TBVA 1AE6H 25C8L 4L9LB 2HKHL 4ONHB 4XPGL 3SDXA 2NY5L 2FD6H 1QA9B 3M1BA 4MNQB 4WV1A 1MFDH 2VDRH 4JY6B 4MHHI 3FHQA 3GNML 3BXNA 3C5JA 1YEDB 4PS4H 2FATL 4G8EB 2MQ0A 4YPGA 1A1MA 2YXMA 2BERA 2D7PA 5CSGA 2WIIA 4OLVH 3S37L 3UZEA 4FQQB 4WY7H 2EIDA 3RUGF 1DQML 4O00A 2YPVH 3TT3L 4DEPC 7CGTA 1MWAL 4JFDB 2VNCA 3TNMA 4MD0A 2WP3O 3CLEL 2FIKA 3O2DL 4WUUE 3PP3K 4WTXA 2CIKA 4MAYA 2HH0L 5C08E 3X17A 4PB0L 1SM3L 2D31A 3WNPA 4Z7UA 5FCSH 1EO5A 2XTJD 4HMEA 2AEPH 2BXYA 1MCQA 4FXGB 4LHUA 3RPIB 1RU9L 3FB5B 4FZ8H 3GSOA 3AC0A 4WWID 5FCUH 3BZFB 1J8HA 1CN4A 2VOTA 1NDGA 3BDXA 1H5BA 4JJHA 1FE8L 1H15A 3RQ3A 4LSDA 5D2NC 1OP9A 1IEHA 1OF2A 3F6IA 3PWLA 5CEZL 4G8FA 2R29H 4P2OA 3MODL 5KSBB 1T22B 2FYYB 1HZHL 4EN3D 3EYQC 3ULSB 4IDJH 2DLGA 4Y4FC 1OSPH 5E4EC 2HT4D 1U3ZA 3V6BR 4IOIA 4M00A 5C0JB 2UWEB 5ETUB 3TO2B 1T2JA 1YC7A 3UX9B 3QFJB 5BV7L 4K7PH 3IYLW 4G6KH 3JUYA 3QCTL 3T0EC 3O3DB 4Y5XC 4PRHE 4JKLA 2VQ1B 4P57A 4LASH 4GW1A 2YEZA 2EKSB 5T3ZD 4MAYD 4NN5C 1T5XB 3NABH 2AJ3A 2FDBP 5TFSH 1YEGL 2CLVB 1EO7A 3QG6B 32C2A 1OM3L 4HX1A 1KLUB 2VQTA 1UACH 4I9WD 5C07B 2F8OA 4Z7WF 1A6ZA 3WIIH 1J8HD 4A2MA 1HIMH 3X3FL 3QRGH 3O6MH 35C8L 4R3SB 3RVUC 4PRNB 4UB0L 1WAAF 2ED7A 1DL7L 1V7NH 2F5BL 5C0NC 3B2UD 5E8EB 1WISA 5GGVH 1OTTD 1K2DA 3QXTA 4TNWK 4I0KA 1ORSB 1IC4H 3M45A 5EG6C 1ED3A 4WFHD 2ORBL 4IRJC 1OP5H 3RL1B 4G9FA 2ZCLH 1N5YH 4W81A 4MA1B 5KBNC 1N7MH 4K7PX 5TDNA 1EEZB 3MREA 1SY6A 4S1QL 1F45A 4XMLH 1Y6MR 4ELKA 4BK4A 3VCLB 1PX4A 1WBXA 4P59H 2NZ9D 3GFUA 5FA4B 4FA8A 1JZ5A 4MB3A 3I6LD 3RDTA 4OFYA 2W9LA 1GGBH 3KYKH 5BZWA 3BMWA 4RWYL 4Y4KD 2V9TA 1S7RB 2YA1A 5GRVL 3D2UB 1AGFB 2I07B 2PR4H 4HWUA 4KTYA 3VE0B 3ULUD 1T0NB 2UWEF 4YIQA 5M94B 1X5XA 4GH7B 4B5EA 3S36L 1HH6B 3VI4F 3ORJA 5DK0B 3JVGC 1NCDH 4L3CB 4NWUL 3CMOL 3N85H 3QDHA 3QA3A 3G04B 3L5XH 3DGGA 3QP3A 4R4ND 5CHNA 4HS3A 3GSUA 4XHQA 2FSEB 2RCSH 3QXVA 1DN0A 1NLBL 5FO7B 4ZD3L 5D1ZB 4WNQA 3O4LA 2CKBL 3N1PC 2JIXA 4LLMA 4ODTL 1AD0A 2YUZA 4H88H 3PGFH 4DVBA 3C2SA 4XXDA 4CU6A 2AK4E 4X6BA 4J3WA 3OJVC 5CSZA 4DZBA 3HI6H 5IFHH 4K3EH 3PV7A 3QEHB 3EW3B 1MCSA 1OB1A 5AG8A 5DSCB 5MEQA 3GMMB 3TPUB 1UXWB 4CVUA 2GY7B 4MJ6A 4FP8H 2BNUB 4OLWL 3KPMB 1BP3B 3EJZC 5SWZE 4NZRL 4CL7A 2VQUA 1KGCD 4NFBA 5C2UB 1J1PH 1AQDB 3G08A 4HK3N 4PJ9C 1YEKL 5IGXL 4GRLA 3QNXA 2PETA 2XKUA 4GBXD 5LAXA 1FL5B 2NY0D 4C4KO 5ANMB 2RIKA 4JREC 3QZWG 5E94A 3GSXB 3W82A 4FFZH 2EDYA 3MRJA 4PYHA 4GXUM 1E6JL 1L7IH 5AYUL 4Z76B 3QG7L 4AENA 1DFBH 2BCKA 1CTNA 2YD6A 5HI4D 2H2SD 5E2WH 5L88L 5I73B 5CD5C 2BRRH 5F7HA 4Y16B 2UZIL 3O4LD 2DWDB 5MENB 1FNGB 3QEGL 2JIXD 2VH5H 1MCWM 4BSJA 2J3SA 3TT1H 1NGZB 4NHCL 1U8LB 2XWJB 1NC4A 2D7QA 4UI2A 1OAKL 4G43B 1OD9A 5KW9L 4Y5VC 3U1SH 2B7DT 1HOCB 1ROWA 4ZS7H 1XGQA 5GRUH 4JPWH 1XFPA 4WI4A 1AGDA 1BFOA 1AHWC 1IL1A 1NQBA 1W0WB 5DMKB 5SX4H 5GZOD 4RQQB 1F4YL 4N8CH 1JGVL 4PRIE 3MCKB 1F3DH 4QRQB 3MR9B 4NQSB 4OFDA 2IAMD 1X5IA 2XQYG 2H2PD 1KPUB 4D9RD 1JHKL 1M05B 1CQKA 4W4OC 4LLUB 3MRCB 3U0PB 5EU5A 1OW0A 3TBSA 1BIIA 4IOFD 1NSNH 3HNSL 1EVUA 3ZMRA 5JPNB 4XPTL 3VA6A 1DQJB 4MS8C 3GMPB 3IJSB 3JWOL 4J3TA 3T2NH 5A2JH 4J6RL 4WW1A 1VFBB 1ND0A 3QDGD 5GGRB 1UCBL 2R0WH 2EYRB 1RUKL 3V79C 2QBWA 5GGUB 3JUZA 4GUPB 4HWBH 5ALBH 4OM0H 2VITB 1NC4D 1F3JB 2VYRE 1A7RH 2P43B 2UV3A 3QIBA 4OI8A 3MRPB 1J0ZA 4UAOC 5IFAH 9CGTA 1MCIA 2XWBB 4PTTB 3QRFM 4Y8DC 1TITA 2XZCL 2NY7H 2Y7QB 3KDMA 4P99A 3VXSE 4WO4C 3LKSA 1OLLA 2G9HB 1LGVA 5DWUH 1ZVSA 2WLZA 1DJSA 1R3KB 1JNNH 2VXVH 1D5XB 5B22A 4M4PA 5BRZD 3ES6B 5DGRA 3ECBA 1KJ2L 3QPQC 5AD0B 4M8QA 3WKMH 5BJTA 3TBVB 1OAUL 3VFNA 2EH8H 4MLIA 3SDXB 1VFOA 1QBLL 4NKDA 4X4YA 3M1BB 4XPBL 5E00A 4WV1B 4WGWB 2XQBH 1N6UA 5TQ2H 1XIWC 4UIKL 2L4OA 1FN4B 3BXNB 3C5JB 1D9KC 1WBYA 4JM4H 2V7HA 4YPGB 3BZEB 1M71A 3HE6C 3OSKA 4Y8AA 43CAA 4GMTL 4NZUH 4NHUA 1N6QL 3BEVA 5D7KE 3REVA 1BOGA 1KCUH 4YHKL 2EIEA 1CFVL 3ZTNL 3CU1A 4JEGB 2F53E 2FH8A 3PJSA 3TNMB 1X4ZA 4MD0B 5DJ8A 4HDIA 3CX2A 4OZGE 4YHLH 4OGXH 2FIKB 3PQYE 3SE9L 2DLTA 1OPGH 4MAYB 5D2NA 2D31B 4HHAB 3NA4A 1A47A 4Z7UB 1FAKT 3G5XA 4XVUD 5C0GA 3INUH 1RMFL 4XCFL 3L9RA 2DBLL 4UNVA 2BHZA 3GSOB 4Z8FH 5DJ2A 2Y6SC 4NM4H 5L7XL 1J8HB 3C60D 4Y4FA 6FABH 1H15B 1CLOH 4HQQH 2XKSA 1OF2B 2V6HA 3PWLB 4L29A 4G8FB 3MZTA 4G7YL 4P2OB 5BZDB 2B2XL 7FABL 3CXHJ 3FO2A 1CL7H 5B39G 3W2DL 4L5FH 3T0EA 3OJ2C 4Y5XA 2VXUL 3BJ91 5HSFA 3JWDH 4OQTA 2FX7L 3K74B 4IOIB 2VZUA 3KPTA 4YUEL 4KV5F 5A2FA 2GCYA 5F3HA 4I0CC 2WK2A 3U0WH 2G5RA 4GW1B 2YEZB 3VD5A 5F7NC 2K7PA 1FL6A 3OR7A 4UOJA 4R2GB 2E7CA 3OKLA 5ACMA 4F7EA 4FMFA 2H1PH 4Y4KB 4EI5C 3EYFA 1E28A 5I19H 32C2B 5HYJE 1NCBH 3HPJA 3EYQD 1F8TH 4HX1B 4YX2L 3MA9H 5F9OH 4K23L 3VXRE 1Z9SA 4IRJA 2C26A 1FLTX 5C7XL 4D0BA 3T0ED 1G7MA 1S7UA 2IBBA 1K2DB 1YEFL 4Z7UF 1YJDH 4XNXL 2P5WD 3UAJC 4G9FB 3Q6GL 2GTWB 4D9QE 2EZ0C 2HTKC 4KDVA 3ULVD 2EE6A 5TDNB 3GKZA 4KKAC 3MREB 4MLSA 4HLZG 4O51B 2Z31D 1DUZA 1GC1H 1RZ7H 4H1LA 3QEQD 3P0VH 1WBXB 5JHLL 4WHYG 1KEGH 4M61A 4DUXA 4QY8A 3RVUD 4YFLF 2CGRH 3JVGA 1MVUA 2APBA 1WIOA 2JB6B 3MCLL 5BZWB 1IEBA 5CZVL 4DCQB 3GSQA 3ZKMC 2AXGA 2NY0B 4YIQB 2OSLA 1NAMH 2DMKA 3SDAC 1SMOA 4TVPH 1UC6A 3BX7C 2XOTA 3SY0A 2A6JA 1IVLA 3QA3B 1CGXA 1IGIH 2OM5A 5CHNB 1FGNL 4HS3B 3GSUB 4HJGB 1JNLL 5GS0C 4WNQB 3O4LB 1EO8L 2QHRH 2VDNH 1RIHH 2JIXB 2O61A 1AD0B 2R15A 4DVBB 1I1AD 4XXDB 2OBGA 4X6BB 5CSZB 4PJ9A 4DZBB 3VXPA 4JVUA 3UYRH 1NAKH 5HVHC 4R8WH 5J1SC 2BOBA 1MCJA 1YEJL 4XNMA 4M93B 2G5BA 2OTUA 3NBNA 4HXBH 4N1HB 3HS0A 1EV2E 4YDVA 3AMKA 4ZYKA 3RZCC 2FECL 1QHPA 1RK1A 4GRLB 1OSZA 3F8UB 3QNXB 5LAXB 4YXHH 4S1RL 4QHKJ 2ICWJ 4YFLI 5E94B 3S35H 3MRJB 5FK9A 1M7IA 2NY6B 4AENB 4YDLC 2R8SH 4ZQKA 3AB0C 2BCKB 4ERSL 2EDTA 3G9VA 4BM7A 3Q3GA 4NNYA 4Y5VA 5AUMB 5K93A 2A9NH 4Y5YB 3HZMB 1AHWA 4BK5A 4U2YA 3EJZD 4NQTA 5AYQA 4XXCC 3RWEB 3F12A 5JQ6L 1NC4B 1RJCA 4XAWL 4OLEA 1AR1C 3LS4L 2UZYB 4W4OA 3Q2CA 1VEOA 4PB9L 4R90H 2CK2A 1XGQB 3NIGF 4PJGB 3LH2L 3IDYB 1AGDB 2BP3A 3ARFD 1BFOB 3RBSA 1IL1B 1FZMA 3GZKA 5JZ7C 5CCKH 2J8UA 2FGWL 3BDBA 3QDJD 25C8H 3ZYIA 1PW3A 2NY5H 3WE6A 4MD4A 3S35X 3I50L 4JRYA 5DUBA 1OGAE 1ZLWH 3WN5B 5BRZB 3TBSB 1BIIB 3LDBC 4Y1AA 1BFTA 2CUIA 3VFPA 1I1RA 4HXAL 4KY1L 1QSEE 2GSIA 3RP1A 1CWVA 4WI2A 4WW1B 1ND0B 4P2RE 1LD9A 3MO1A 2OR8A 2RR3A 3S37H 3UCRA 5L0QC 4N9GA 1RJYA 3CVIH 5FYJD 1LP9A 1SVZA 3W9DA 1BM3L 4WO4A 4S10A 3QIBB 3CFJA 2X4QA 4AK1A 5FUOH 3RKDC 4G8GE 3O45A 1JPTH 3KDMB 2P8LA 5TGBA 3KHOA 3IDXL 3LKSB 4BSVA 4JCMA 1ZVSB 3WL9A 4J3XA 4LU5H 4QOKA 5IUSA 4PD4K 4YC2C 1RHHA 3ECBB 1FE8H 4X6CE 4AMKL 1D9KA 4Y1AD 3UROR 5CEZH 1RIUH 2FNBA 4KTEH 5JDJA 1ZK9A 5J8OA 5BJTB 1NUFA 2HLFC 3VFNB 3LRGA 2P46B 4NKDB 4K71C 4L4VE 3HE6A 4WDIA 4X4YB 4JGUA 4J1UA 5I18H 3S37X 4X4MA 3U7WH 2C3GA 3P11L 5DVLA 4X9HA 1BPVA 5KSAD 4J23A 1WBYB 2GAZA 2NPLX 2ADFH 3M8OL 1JRHI 1CK0L 2HA1A 3GBNH 2V7HB 4DEPB 3LQAC 3FQXA 2VDML 3MRNA 1M71B 3ZSTA 4BFGA 4Y2OA 2EDQA 2OR9H 2BDNL 1KXTB 2IH3A 1FGVL 2Z8RA 43CAB 4NHUB 1Q9LA 3FB8A 5IBLC 1EHLL 3NCFB 4IBLT 1H3XA 3REVB 1TTUA 1XGPB 1BOGB 4P5TC 4K2UL 1HINH 5FDYA 3MLRL 3PJSB 1JMXA 2CRZA 5F89A 1G9MH 1NLDH 5DJ8B 4HDIB 5IHLB 5C0BA 3X3FH 4JVPA 1XIWD 1OWWA 1D9KD 1IKFH 3NCJL 1DL7H 3V6OE 1UH3A 3MV8A 5TPWL 4TTDC 5FECA 3G5XB 4M8VA 3FQTA 5C0GB 2PYED 4G6AC 1MLBA 3L9RB 3BJLA 2YBRA 5D7IA 4YE4H 1EFXD 3ILQC 4LLQB 5DJ2B 2E3VA 3T04D 1GHFL 4Y4FB 3NFSH 4HFUH 3QIWC 5E4EB 5FIEA 4G42A 4L29B 3K8KA 5AZEL 3U4AA 8CGTA 4S1QH 5CJOL 2GK2A 4HBCH 3FO2B 3ABZA 4JRXE 2FX8H 2O5XL 3T0EB 2Z4QA 4Y5XB 1DEDA 3RL2B 2ZG3A 1LK2A 4NN6C 3DXAA 4RISL 4NN5B 3KXFA 3MOBH 4RWYH 2EDNA 2ICCA 5CZXD 1U8HB 1FPTL 2W9EH 4EI5A 5F3HB 2LVCA 2DN7A 1J0KA 3OL2A 5F9AC 1HILA 4WTWA 3GJEA 3IDNA 1IQWH 2Z31B 4NRZA 5K59F 4ZSOE 3B9KD 3DX6A 3RVWD 3VWJC 1YEHL 3SE8H 4MA8L 4MMZC 5GGTH 5FM5M 5BVPL 1QFWM 2I24N 1FL6B 5EUOA 3OR7B 2XXMB 3CMOH 3MRRA 3OKLB 4F7EB 4X9GA 1EJ6A 4W68A 4M48H 3EYFB 1E28B 3STBA 3HPJB 1GOFA 3MLZL 5TH2B 2CKBH 4IRJB 4N9OB 5E2UH 4PGBA 2NW2B 5LGHH 2VN4A 2APWA 2P5EA 4J12A 1N4XH 4D0BB 1BF8A 1G7MB 1EMTL 2A83A 1XF4A 5JOFA 2YMXH 5CILL 3D39E 3VXUA 5GS2D 5C3LD 1IAIH 4NZRH 4PJHE 3WS3A 5HBBA 4QHMA 2Q76A 1I1AB 1YEKH 5IGXH 2VSDA 1DUZB 2DICA 1GZPA 4H1LB 2X1XR 2C1PA 3O6KH 4M61B 5F88A 3SDAA 5AYUH 3QG7H 4QY8B 3KPRA 1MVUB 1IEBB 1N26A 3DUUA 2BY2A 3GSQB 2OCFD 3CDCA 1UB5B 5J6HA 3S3PA 1IEAA 2LVEA 5FA3B 3MROA 2FEDC 2OSLB 3A0OA 3UAJD 3HC3H 2YPLD 1GXEA 2EZ0D 3RI5F 2HTKD 2P5ED 4NHCH 3SY0B 3S5LA 3UO1L 3IU4L 2A6JB 4KKAD 3SCMD 2X4OB 4MCZA 5ERWA 5KW9H 3BVNA 3MRLB 4M5ZL 3X14A 1OARL 1VESA 1VB9A 3WUWA 3VXUD 1JGUL 3V0VA 1G9NH 2O61B 3UZVB 1JGVH 3BIAX 3NIDE 5IBUG 1A6PA 3RZCA 3KS0H 2P8PA 4PJ9B 3UBXA 3ZKMD 5FB8A 3VXPB 5EO1A 2AQ2A 1F58L 2BOBB 1JHKH 3GMLB 4JREB 1QBBA 4XNMB 2GI7A 2G5BB 2OTUB 3SDAD 4CN4A 5B8CC 3HS0B 1P4BL 3KLAA 4OV6F 2Y5EA 3HNSH 4QTIH 1WGOA 1CDHA 4ZYKB 5JORA 1RIVH 5EZJA 2V5TA 1OSZB 4K55A 5GS0D 1UCBH 4JFFA 4FN0A 2XWTA 5FK9B 1M7IB 3BPLC 2X44D 5JXAL 3LMJL 5KSBE 3IXTA 4XXCA 4JKPL 4ZQKB 2OX5A 3FQUA 1EBPA 5FYLL 1JZ8A 3KPNA 3Q3GB 3SO5A 1W8OA 2CR6A 4Y5VB 3MFFA 2O5ZH 2EDWA 2IMMA 3B43A 3CFKA 1AHWB 2WP3T 4KJYA 1CIUA 3PWUA 3RZCD 3F12B 1TDQA 5EZOH 5AZ2H 4FRWA 1TQBC 3CLFL 1CFTA 1INQA 1MUJA 3GSNL 1MCOH 3DUHA 5FUZH 3OJMB 4HBQA 2J8UB 4TNVK 2VL4A 4P2QA 3UJJH 3LN4A 3PDGA 5JOPE 1I9EA 1OAUH 2EIZA 4PJ7B 1GH7A 2JCCA 1OLZA 3E6FA 1TPXC 3H9HA 3WE6B 4MD4B 2IGFH 4BUHA 1I8KA 5DUBB 1WCQA 4XP1L 2X4RA 2WBJD 3WHXA 3DECA 4Y1AB 3VFPB 3F58H 1KCSH 1HH9B 4L8BA 2QHLA 1OP3H 1G7JA 2FBOJ 3C6LC 1AR1D 4Y19E 4RDQG 1ZE3C 1CICD 4UAOB 5KANI 1CLYL 1LD9B 3MO1B 1GSMA 4FFVC 4Z7NF 4Z7VA 1N6QH 4PRAA 4CVXA 2WAHA 4N9GB 4OZHA 5JZ7D 5EC1B 1T0PB 1YMHB 3RVTC 1LP9B 3VWKD 1CFVH 3ZTNH 2HVKA 4LAJH 3W9DB 3PIQA 3J7HA 4KDWA 4P4KD 4WO4B 5T1KD 1A1OA 1QRKA 4ONGL 5I17B 1EGJL 1YQVL 3CFJB 2K1MA 3RVXD 1U2CA 2CO6B 3WIHH 3SE9H 4GLRH 4KKLC 3O45B 3LEYL 3SHSA 4X4ZA 3A67L 4YGAB 4U1LA 1RMFH 5TGBB 4JFHE 5CLWA 4PV8A 1UZ8B 1P4LA 4BSVB 3SDYH 1YC8A 2GUOA 4PJCE 3WL9B 4QOKB 5L7XH 3OB0H 1RHHB 4QXTA 1XIWB 4K8RL 5DJYA 1D9KB 3R1GL 4X5LA 2V17H 7FABH 1J8KA 4K9EH 2IANA 3VI3F 1YY9D 4WDIB 3HE6B 2J8UF 1TCRA 3O6LL 4DGYL 4J1UB 4JJ5B 3RKDD 3T77A 2DLEA 4XP9H 3BGAA 2FX7H 1RVFL 4PRPA 2ZKHL 5C09A 4KHXH 4P5TA 1KLGA 1Q9KA 4MXVF 3DYMA 4DZ8A 5GJSH 4JAMA 5C0AE 3NN8A 3G6JA 2IH3B 2VUOA 1Q9LB 2PNDA 4H8WL 4QHLA 5LVEA 1KTDB 2WQ8A 4WU7A 2HLFD 2RGSA 3DX9A 1JHTA 1HKLL 3UTTD 1K5NA 4KI1A 3FTGA 1OP5K 1LP9F 3HMXH 4UTBL 3B9KB 5F89B 1BBDH 1FFRA 4K23H 5C0BB 2Y25A 3ARBC 3QIWA 3R06A 5F44A 2OS7A 4OZIA 3TIDB 4P4RA 2IAND 4HULB 3FQTB 2W1NA 4NQCA 1MLBB 3OXRA 2MTPA 3SKNB 1S7WA 1NFDA 4DGIH 1G6VK 1VKXA 5D7IB 5CEXA 1SJHA 5IBLD 3Q6GH 4HPYH 5C09D 4G42B 1IKNC 5C2BH 3TJEL 4WI6A 3T8XA 1FJ1B 4PJ5E 5E8NB 1B88A 3D87B 4OF0A 3PXJA 1MH5A 4A6YL 2Z4QB 4M6OH 2IMNA 2Q3ZA 3VWJA 3NCEB 1LK2B 4C4KT 1GGCH 3WFZA 2OK0L 3KXFB 2MMXA 4XPHL 4TTDD 3MUHL 4EI5B 5DHVH 3WSQL 1U8PA 3L6FA 1HILB 4KXZI 3GJEB 3IDNB 4NRZB 4Y0GA 1RURH 2HJLA 3DX6B 1EPFA 5DRNA 5GRYA 4FQIH 3NPZB 2WINB 3KYAA 5LQBL 4Y2DC 3BIKA 3H3PL 3MRRB 2FIRT 3RIFK 3MMEA 4NQCD 5ESQA 5FGCE 4WGVB 1J05A 4ZFOA 1JNLH 4F57L 4DOHB 5C9KA 2VJXA 4PY8I 3JTSA 3IETB 1FAIL 5E6IC 4HUVA 2YPLB 15C8L 4PGBB 2OP4L 3TV3L 1EEQA 4XVTL 2P5EB 2QQQA 3SCMB 3EO1A 3SGEI 3JWDC 2UZXB 1PGRB 3HFML 3E0GA 1XF4B 2R2BA 1C12A 3VWJD 1T0MA 2A9MH 5JOFB 1JHLH 3K2UL 5HHOA 1MJUL 1JK8A 1X5YA 3VXUB 5D7IF 5GSVA 3OAUL 3WS3B 4QHMB 3ILPA 1I8MA 4F8QA 1JF5A 1KULA 1GZPB 1MY5A 5CEYA 1Q0YH 1VFAA 2C1PB 4NKIL 1WFTA 5F88B 3SDAB 5L9DH 3V5DA 3HUJA 3RWFB 3KPRB 4WFED 3ZKSD 3MSPA 2XTJE 4PGEA 3BHBA 3DUUB 1PAMA 2F5AL 3EDDA 5KVGH 3ZHLA 4G6JL 5GGQL 5JIIA 3MROB 3ZT5A 4NCDA 4GAGL 5CS7A 4OB5L 3T0WA 1TZIA 4U1MA 4C83A 1PVHA 3T4YA 3FO0H 1YJDC 4XWOD 5EBLA 5E7FA 1AXIB 3CX5K 4MCZB 5EUOF 3LS4H 5ERWB 2CMRH 5HVHB 1O7SA 3BVNB 4ONOA 4PB9H 4RAHA 3MLVL 5HHOD 5B8CA 4GKNA 5D93C 3WUWB 3V0VB 2FGWH 4OCXL 3THMH 3B9DA 3RZCB 2DL9A 2P8PB 3UBXB 5FB8B 5EO1B 1N6VA 1CF8L 1OVZA 2FEDD 3OPZH 5F7LB 4JKMA 4M7KL 5F71A 3F65A 2H45A 3DWTA 4R9HA 3KLAB 4NBYB 4YDLB 1XGYH 4HXAH 4BZ1L 1SJVA 5IB4A 3AB0B 3QJHA 2ZUQC 4X7EC 5K9KA 5JORB 3IVKA 4KY1H 2MJWA 5ESAA 3A6BH 3IDGA 1CU4H 4IHOA 4HC1L 4NNPH 3NAAL 4TQEL 1DR9A 3LEVL 4JFFB 2XZAL 3IFNL 1UM4H 4F9LC 3IF1A 4MJID 2ED8A 1S5IH 3IXTB 3FQUB 2WLYA 2RFXA 3KPNB 5D96C 2B5IC 4KPHL 1QQDA 3MLXH 3MFFB 4WFHE 3O0RL 5F7EL 3B5GA 3VMNA 3TGXA 4MB4A 4POZC 5HHME 5J0BA 2ZUXA 3OAYH 5TF0A 4E41A 4YDKL 2DD8H 2FBJH 4BQBA 3PWUB 4HCRL 5BXFA 4M1CD 5E6ZA 1XF3A 2BVUA 3GJFK 4K3JH 1KTLA 1CFTB 1INQB 1A6VH 1MUJB 4AMKH 5JMOC 3LDBB 1UH2A 3RWIA 1YEIL 4P2QB 2XIDA 3V7MA 3E6FB 2JCCB 2BSSA 3C6LA 4MQXC 5GPRA 3ULUE 3CSYA 3H9HB 1IC5H 5AAWA 2NY4C 4QHKI 1MF2H 1P6FA 1U8MA 2H32A 1I8KB 5L0QB 2X4RB 5F1IA 5ELIA 5FO8A 1KOAA 3WHXB 1CK0H 3TH3T 2VKWA 4TSBL 4U3XA 3MUZ1 1FZKA 4UIMA 1F6AA 2XNAA 4Z7VB 5E99L 2FX9L 4PRAB 4UZGA 1MRCL 2WQRA 4CVXB 2EDOA 4KKCC 2F74A 1EHLH 4OZHB 1EERB 4XC3L 3WO4C 3QPXL 1UM5H 4OGAC 2X2YA 2HVKB 4K2UH 3PIQB 5TDOA 1FNSL 2CDEA 1FNHA 1L4IA 4HV8A 2A38A 4WCYL 5KAQF 3S6CA 4LPXA 4LAQL 4GS7C 4YC2B 1AQKL 3EYOA 3MNZA 3LY6A 2PW2A 1RZJL 1H3GA 3NCJH 3O3UN 4BFBD 1H3TA 1HXYA 4JB9L 4U1LB 4OCLC 4PJFA 3QQ4A 1AH1A 5DD0H 4PV8B 1P4LB 3FL7A 3P2TA 4K71B 3U79A 3V6FB 3DETD 4HIXL 4UINL 5E70A 2Q8BL 1S7QA 3N50A 4MHHG 3VDAA 3SGJC 3RVTD 5DJYB 5AZEH 5DA0B 5CJOH 1ZKAA 5HDOA 2IANB 5F6HI 1TCRB 5LGKA 1T7WA 3MV11 3UBXI 3T77B 1JNJA 1MAMH 5CP7A 1WFUA 1VDGA 4KKLD 4PRPB 5C09B 4R97C 1HWGB 3AS3A 4PJAE 4P5TB 1KLGB 1Q9KB 1Z3GH 1QRNA 4DZ8B 5TQ0L 1NANH 2D7TH 4JAMB 3NN8B 1WJ3A 1W2KT 5CMAA 5ENWA 4LOUC 3RY6C 1KCLA 3HA0A 1YEHH 3W0WD 2BVQA 4IJ3C 5I1CH 4X7FC 5C3TA 2X9YA 2GSGB 4I5BB 4QHLB 4M03A 4G3YL 1IGJB 1NCCL 4WU7B 3HRZA 1BQLH 3DX9B 3EBAA 1JHTB 5GQBA 3TJHC 1K5NB 1U8OA 3FTGB 3AROA 4HLZH 5HD8C 4XRCA 4HD9A 1IRAY 1ZAGA 5LXGL 1FVCA 4JO3L 5FV2A 5F9DC 3QIWB 3R06B 1IKNA 2CPCA 5HI3C 4OZIB 1DUYA 5GGSA 1SYSA 4P4RB 1KPVA 4NQCB 1KN4H 5D8JL 3OXRB 1S7WB 1NFDB 1VKXB 2VWEC 3B4NA 4QNPF 3QDGE 2X1QA 5CEXB 5CILH 2BVTA 4L4TD 1SJHB 4NN6B 1BEYL 43C9A 4KTDH 2BMKA 4HGMA 4NBXB 1WCBA 3T8XB 1CIDA 4NC1E 1I7TA 2IALA 2QTEA 3HC0A 4C55A 1A3RL 4PJGE 3VXMA 4NM8L 3VWJB 3ARBD 2DDQL 4Y2DA 3GBML 2MSPA 3NOIA 4RIRA 1G9MC 4FNLL 4G5ZL 5DDHB 4PFEA 4I3GA 4JN1H 1U8PB 4ZG1A 4ODSL 1KBGL 1V5JA 2HJLB 5BRZE 1RULL 5DRNB 1KNOA 2NY2C 3FFCA 1UM6L 5E6IA 2EEDA 5J3HC 2WZPD 4LSQL 3H3KA 3G6JF 3IU4H 3MMEB 5ESQB 4E42A 1J05B 4ZFOB 4M5ZH 5A2KH 5E2JA 4LSUL 4EJ1C 3MNVA 4JDTL 3OQ3B 1HSBA 3MRQA 3PWPA 1GGTA 5IEKA 4HUVB 4CAGA 4LPUA 4LKCA 4JKKA 4XC1H 1LO2L 1U9KA 3ZE2F 4G9DB 3ROLA 4TNVF 3OX8A 3NPSC 4FABH 4OJFL 2N4IA 1A6AB 5IJVA 2R2BB 1U36A 1C12B 5F1KC 1T0MB 4XBPA 4OZIF 5HHOB 5IIEA 1S9XA 4Y2DD 1NFDF 5DMIH 3BT2H 5F7MC 5GSVB 2ARJA 1I8MB 1GJIA 4OSUH 4YHZH 4A2LA 4O58H 5EA0L 3UTSA 3ZLQC 1YNTA 5CEYB 1J18A 2NR6C 1VFAB 3CAFA 1V05A 3OGCA 4LSRL 5E6ID 3V5DB 3HUJB 2Q8AH 3LMJH 3R0MA 1FCGA 4PGEB 5CIPH 3BHBB 5FYLH 3HC4H 3BGMA 3HZKA 5DMGD 3G5ZA 5E9DE 1MQ8A 2ENYA 2YZ8A 4LIQE 3PWPD 4FZEL 1TZIB 4U1MB 3C87A 4C83B 1J7VR 2LU4A 4KVNL 3T4YB 4I2XA 4PBXA 4BELD 2R39A 5EBLB 1FIGH 2BNQA 4XB8A 4NUGL 1ZLWK 1NEZA 4QHNA 5D1QC 1ITBB 4HF5H 4LRNL 4XCCH 1R6VA 3GSNH 2ATPA 1CXEA 5B8CB 3RWDA 5IP4A 2J88H 1DSFL 2JKXA 3ESVF 3V5HA 5DYOA 2ZSVA 3PL6D 4ZXBA 1C5CL 2Y72A 3KPLA 4OCRL 4AG4L 3QQ9C 4XP1H 1BJ1J 3ARDC 1WLHA 4EI6A 1U58B 2CO7B 3O4OC 4F9LA 3BPLB 1EUTA 1U42A 5IB4B 3QJHB 5K9KB 1EBAA 2MCPH 3HAEG 5E03A 5ESAB 3IDGB 4IHOB 4R7NA 3U7YH 2GQHA 4IDLA 5IG7A 2MQCA 3WS6C 3MRIB 1IGTB 3H7BA 4WUUA 1MCBA 5C08A 2YRZA 4K07A 5I76A 1TLKA 4TRPL 1EGJH 5JLZA 5DUML 1G9NC 3HG1D 5I6XC 5FHBH 3CC5A 2P5WE 4JHAL 3UYOD 4HUMB 4LKXA 1TQBB 5T3XE 1F2QA 1W0VB 1IM9A 4U1IA 4E41B 3ULVE 3D3VD 3ELAT 3EYUH 3JSSA 4TVPD 5BXFB 4Q9RH 1TPXB 3QEQE 4ZODA 2J4WH 3WDJA 1NH6A 5IFJA 4Q9BA 1KTLB 4Z7OE 4K8RH 4M7LL 1Q0XH 4IRZL 2OXHA 1F42A 3KNBA 3QDME 1L9NA 1B0RA 2KH2B 4W6YB 2BSSB 3O6LH 3CSYB 2CQVA 2NW3A 3ZKXC 4M62L 1U8MB 1ETZA 2H32B 4D8PA 1RVFH 4PJXE 2ZKHH 4PRHA 5F1IB 5FO8B 5JIHA 4E9LA 3MBED 5C08D 4PJBB 4AEHL 5LJYH 5HHNA 4CMMA 1DANT 3BWAA 4UIMB 1VADA 1Q38A 1F6AB 2XNAB 5F70A 1MCFA 2H26A 4I3RL 2F74B 4KQ3H 2VDOH 1J11A 1UJTA 2IPUK 1A22B 1WWWX 2ZNXA 1RZGB 2PYFA 3ARED 3VDBA 5JW5A 3JWNC 3RIFF 4MQXD 1U8JA 1MCKA 2HVJA 4UTBH 2NY4D 4F33A 2AEWA 5T1DL 3W0WB 5DXWA 3ZDYF 5CINH 4QHUA 3MNZB 5EN2A 2PW2B 2L0DA 3SGJA 3MA7B 4NQDA 2BJML 3OZ9L 1MREH 4JG1L 4OD3H 4PJFB 1YNKL 2AJXL 4NBZB 2R4RL 2JJTC 1K3IA 5E0QA 1S7QB 3JZ7A 1G84A 3SEPA 3I6GA 5E8DL 1UWGL 4KRPC 4I0PD 4A6YH 1AP2A 2XACC 3W81A 3RY6A 2WUBH 5DTFA 4DKFL 5F3BA 1KG0B 4L4TB 4LNRA 4U1NA 2AABL 3CMGA 2FHCA 4XPHH 3WSQH 2UVEA 4H20L 1JI2A 1ES0A 1QRNB 1F4WL 5CMAB 5ENWB 4K3DL 1XF5A 4M9OA 2BVQB 1DLHA 4XGZA 1MQKL 3ARBB 3E8UL 3ZYOA 5DQ9A 4NQDD 3QDJE 4EXPX 5HHQB 5HDQH 5I1JL 4MZ3A 4F7PA 3MBXH 1PY4A 3HRZB 2E7BA 5HYSB 5I1GL 1U8OB 2AK4A 5J6GA 3QI9C 4J4PC 4N5EC 1NMAH 4K9EC 5KZCD 4TPRH 1FAIH 3KGRA 2IF7A 5I0DA 1FVCB 1ZHNA 15C8H 4FG6C 5EC2A 2OP4H 3U36A 1DTUA 3R4DA 1DVFD 4XNYH 4W70A 3WCYA 1DUYB 5GGSB 5SWZA 1JWUA 1KPVB 2E27L 5CZKA 4OIBA 4HS6A 5FFLA 4DTGH 2X05A 4PJFF 4B7IA 1DBBL 2PCPA 1AR2A 4YK4C 4ETYA 5I1DA 2BMKB 1KN2L 1WCBB 4O9HH 1QLFB 1R5IA 1I7TB 2IALB 3HC0B 5CEZD 1ZT4B 2FRGP 3VXMB 2DLHA 4FQXD 4OLZH 3RWHB 3ZE1F 4O2CA 4UDTA 4Y2DB 1AGBA 4RIRB 4PJ7E 4PY7A 2VXQL 2AV7A 1RQ5A 3EDFA 3C09C 4I1NB 4AQ1B 4IM8A 5GGQH 1YMMD 5I1EL 4GAGH 5HY9A 1KNOB 2CH8A 3FFCB 1XGUA 1W72H 2IQ9L 1E27A 4S0SD 5E6IB 5BMFH 5CUSH 1M7DB 4QEGA 3U30C 1MI5D 2QSVA 4HEME 5EB9A 4BUGA 4E42B 4PRIA 3T1FB 2W9DH 1V3KA 3ALPA 4RMSA 3FKUS 3P9LA 4NOBA 3LIZL 1JZ3A 4H5SA 2AQ3A 1HSBB 3MRQB 3PWPB 1BQSA 5IEKB 1I8IB 4OCXH 4S1SL 4LKCB 3RGVC 4HZAA 4XPFL 2DQHL 1T7XA 5GGTA 3ROLB 3OX8B 4OT1L 2DBJA 4AIXA 1CF8H 4BQCA 1P84K 3HNTL 5DD3H 3T4AA 2YS4A 1SQ2N 4XBPB 2NY2D 5C86A 3CFEA 5IIEB 5J3HD 1BJ1H 1S9XB 3LB6C 3BGFC 1SJEB 3QCUH 1RD6A 4KI5D 3DURA 3PE9A 2ARJB 3KPOA 1TJIL 3ZDZF 3QUZD 4HC1H 3UTSB 3PL6B 3SPVA 1QNZH 3HKFA 3IFNH 3OGCB 4HIJA 1BVLB 5DRZA 1YN7A 1A6TA 1N64L 3TZVC 2PYEE 4RAUA 4PRID 3HZKB 3EOTH 4MJ5A 3VXSA 4OZ4A 5D1QA 2B20A 3IRPX 1SEQL 3SKMA 3G5ZB 5MEPA 3DVNA 1OT2A 4L4JA 4Q6IA 4HT1H 5D93B 4BQ8A 4YDKH 5CSBA 4HCRH 1Z9LA 1TMCB 2YD3A 2AP2A 1NEZB 4QHNB 4N1EA 5IESL 3S4SA 4LHUG 3ARDA 3A6CL 3O2VL 1OP3K 1IBGL 4EQ3A 3RWDB 1BWMA 1XT5A 3D3VB 2FJHB 2ZUQB 3V5HB 1NAMB 3LEXA 2ZSVB 3VXTA 3KPLB 4ZUWA 2EE3A 1NL0L 1H3UA 1S7TA 2KDGA 3VRIB 4XH2B 1BZ9A 1F02I 1T1ZA 1UWXH 4EI6B 5DVKA 3WS6A 3BMVA 5EULV 4HW6A 4LQFL 4NIKB 4F58H 1VPOL 3T3ME 5D96B 4R7NB 2B5IB 3EHBD 5D1QD 5E99H 2F53A 1G6RA 2FX9H 2IADA 3WFBH 4ZNEE 1RK0A 3BYTA 4LHQB 4OZGA 3PQYA 1FO0A 5D72L 4WUUB 3H7BB 5DQJA 5TE4H 5B3NA 1PKQE 3MBEB 5C08B 5DD1H 5I76B 4AIZA 1J0JA 4WCYH 3OB0K 4R4BB 5JLZB 5DQDH 2ZWLT 4ZTOL 4QRPD 3QQ9D 1QFUH 4OCMC 3ARDD 1ZTXL 2X1OA 1FFPA 3CC5B 3WYRA 4LKXB 3GEWB 1E4KC 1RZ8A 4U3HA 5A2LH 4U1IB 3E2HB 4Z7QF 3V52L 4Y88A 1DDHA 1JTOA 3OKDA 5DFVC 1ZWIA 1RZKH 5HGHA 3RNQA 3SN6N 1DLFL 3VFTA 1JZ4A 2NY4B 4UINH 1QKZL 2Q8BH 2XKNA 4HJ0D 4LLVA 1JZ7A 5IFJB 3UJIH 5CKAA 4GJTB 1S7XA 2XZQL 3KNBB 3Q5TA 4NWTL 4CDHA 1B0RB 1KB9K 4NQXA 3Q6FB 4NGHH 1FL3A 4DKDC 2NW3B 1FNEA 3BUYA 4ZFFA 1ETZB 4D8PB 4PRHB 2YPLE 4OAWA 4FQJL 2YUVA 3PQYD 1TNMA 2MPAH 4I3SL 4C57C 3WO4B 4CBPA 4LLWA 5DRWA 3WXVL 1J1OH 2CDFA 5TQ0H 2HRPL 2F9BT 3EFDL 3CSGA 3MUJA 4CMMB 3BWAB 1F4XL 1MOEA 3GO1L 1VADB 3RBGA 5HYJA 1X4YA 3SQBA 4ODWA 4GS7B 1ZLUH 4KHTH 4XNUH 1NUGA 2H26B 3IAQA 1RZFH 1KYOK 2YA2A 3V5KA 2ILLA 3VXRA 4G3YH 3DMMC 2PYFB 3QIUC 2OL3H 1JF6A 5JW5B 1NBZA 1NBYA 4JLRA 1U8JB 1MFCL 2F8XC 4F33B 2MFNA 1YY8A 2JJTA 2YC1B 1CGWA 1H3PH 1TJHL 5DJ6A 5LXGH 2VXSH 1NGWA 4QHUB 5EN2B 4G8IA 4JHWL 3OB8A 2R23A 4HKBA 4M7JL 4NQDB 2GJ6D 4FXKA 1CGSL 1FVDB 1SBSL 5D8JH 1DBKL 2VDKH 5HHXH 1EEUA 3QUYC 1U8KA 4JANA 4JY5L 1BEYH 4LCUA 4XZUB 5KZCB 4JPVL 1KTKE 4MQSB 4KZDL 4MGXA 3QWRA 4R97B 3VD4A 1INEL 3I6GB 2RQ8A 2W92A 3JTTB 3WIHA 3BSZL 1FG2A 1R3JA 1CXHA 1AP2B 4HGWB 5IW6A 4WW2C 1CDCA 4NM8H 5HYJD 4GKOA 5DTFB 3LS5L 3KPSE 4IJ3B 1HYSD 3VXQA 4U1NB 5I16A 4UT9L 2A6IA 1ZOXA 5CJXA 1JCKA 4AEIL 2AI0H 3HRPA 1OQXA 4TULL 1ES0B 5KVFH 4NNYB 4HUWA 4F7TA 4ZUUA 3LV3A 2O26U 1EX0A 3DRQA 3VFGH 3QI9A 2AVGA 3GMRA 1RULH 4J4PA 1XF5B 4M9PA 3BQUD 4GAYA 1BD2D 1DLHB 1TETL 1VERA 4RFEA 4RAVA 5F7YC 3C6SA 4XGZB 4YLQT 4LSQH 5DQ9B 2OMNA 3WHE0 4ODHL 1T21A 2YD2A 3BH9A 4F7PB 3GB7A 2AK4B 4LSUH 1HCVA 3LKPA 2C3HA 5ADOH 1YMMB 4JDTH 1P7QA 2AJUL 2E6PA 3HB3C 1ZHNB 2AGJH 3QWRD 3F7YB 3U36B 3VDCA 1LO2H 1ZVYA 5I0ZA 1T1WB 5SWZB 1FG9C 1JWUB 5JUEL 4F2MB 1V8HA 3G6AB 5T3XH 2X4SA 4NO3B 3EIFA 4DWHA 1OY3B 1KJMB 2PCPB 1T3FA 1J88A 3H7LA 4XWGL 4N8VA 1X5LA 3HMXA 4N0YH 4B50A 2XQYK 3C9NA 1JPSH 3O41A 4PGJA 1QLRB 5EA0H 1R5IB 3CXDL 2XT1B 4X5WA 3WNMA 1X5JA 2MKWA 4J4PD 4WEUD 3MUY1 3B9EA 4UILL 4IMLB 5HDBE 2A1WL 2VDLL 2NY2B 5ISZE 5GGSY 2DQJH 4UDTB 1AGBB 1FVEA 1A02N 4PY7B 4HWEH 3NCYS 3VU2A 3QUZB 4LSVL 2O93L 4BZ2L 3PGCA 1JVKA 2WWMC 4QGYA 4PPTA 5HY9B 2D0HA 1CD8A 1XGUB 4Q9CA 1I9RL 1E27B 4C59B 2DOCA 1A3LL 2PN5A 3TP4A 3RGVA 2ITCA 4HUNB 4NUGH 1CXIA 4PRIB 3NPSB 1IC7L 3SGDI 3CD4A 1V3MA 4U0RC 3MLUL 4ELMB 5DHVA 4H5SB 3ZT6A 1OGAA 2EKJA 2RJMA 1E4WH 3EAKA 4I77L 4MWFB 2QL1A 1PJ9A 5JTWA 4OKVB 3V8CA 1C5CH 4AG4H 2AAVA 1VCAA 4HEPG 3BKML 1QSEA 4MQ7A 4UT6H 4L3ED 1Q94A 2V5MA 3CFEB 4P2RA 4EDXA 3VA2C 3MPCA 3DURB 4C56D 4NPYA 3TZVA 4C54A 1NPUA 2CKBB 3KPOB 3QZWA 3UTTE 5T5NG 1Y6KR 1CE1L 3H6JA 5T3ZL 1ZEAL 3RNKA 3C2AL 5D2LB 3QUXD 3OAYK 3CK0L 4P46D 1QSZA 1IAOA 4HIJB 4G8GA 1KFAH 5DRZB 2Y06H 1A7NL 1YN7B 4MA1C 4OLUL 1A6TB 3QSKB 4TRPH 4RAUB 2J8OA 1A5FL 3PXHA 3VXSB 5D1QB 3SKMB 1ZGLA 2EC9T 5DD6A 3DVNB 4HUUA 3LB6D 1WSST 3LHPH 3PNWA 4X6CA 5B38G 1T4KA 4D3CL 2YA0A 4DJMA 1A64A 5T1LA 4N0CD 3NH7L 2YUXA 1CD0A 4M1GH 1D5ZA 5I15H 3S4SB 3BKYL 4L4VA 3ARDB 1QD0A 4P2RD 4M7LH 3T0VA 3O4OB 3VRLE 1AGCA 1CXKA 1PG7H 4XP5H 4HFWA 2AXFA 4HIEA 5CLTA 4YHIA 3EZJB 3VXTB 5BW7C 4LEXH 4ZOEA 4ZUWB 1S7TB 2IFFL 1BZ9B 4WENB 5D1ZC 1T1ZB 4G8GD 5C0IB 1VHPA 5IEHA 1LE5B 2FEEI 1Q72L 3KYOA 3ARGD 4AEHH 1PSKL 4CKVX 4ZPTB 3PWJA 4LHJB 2VAJA 5I6XB 5K9QG 1B3JA 1G6RB 4I3RH 2IADB 1MIEL 1E4KA 1RK0B 3BRFA 3L3JA 3PQYB 5DQJB 5CP3A 4Z0BL 5KN5A 4X9BA 4TSAL 2CUMA 3ALXA 1FRGL 1KIQA 3CDGA 3CDYA 3FT2A 4O5LL 4AIZB 2R1YA 3HMWL 3JXAA 1NGQH 4MNGE 1EXUA 1IMHC 1FFPB 1PDKA 4PJEB 2VAAA 1J12A 1SY6L 1PG7X 1RZ8B 3ETBF 2BJMH 3OZ9H 4DAGH 4JFED 1KCVL 3AU1A 1YNKH 2AJXH 1DDHB 2R4RH 3OKDB 1ZWIB 5HGHB 5JW4Q 3RNQB 3OAZH 4EBQL 2AK1L 3VFTB 3MRFA 5JR1H 3ZKXB 5MI0C 1AO7E 3EZ8A 2AEQL 2AV1A 3MLWL 1QFWI 5MEOA 4WFEE 4FMKA 3WKNA 5HHPA 4DKAA 2R1XA 1TZGL 3NACH 2A74A 3TBTA 1MFEH 4JZNA 4NQXB 1FL3B 2LTQB 4DKFH 1FNEB 3MLSL 3BUYB 1MFAL 5KANG 4XVSL 1UA6L 4ZSOA 4ZFFB 2AABH 3BP7A 3ARQA 4OAWB 4RGOL 1DBML 5EOCH 3DMMA 3QIUA 4LLWB 5DRWB 1D6VH 2CDFB 5KVEH 1F4WH 1NGYA 3TEUA 3HNVL 5F96L 2R0ZL 5HYJB 1QTYT 1MQKH 3S88H 3E8UH 3DVIA 1PLGL 3QQNA 3V5KB 2F54D 5IR1A 4KZEL 4P3DA 1HKFA 1PQZA 5I1GH 1NBZB 4K8RC 4F15C 1NBYB 1JRHL 1PG7W 3FO9B 4JLRB 4OZGF 5D7LD 3N9GL 2V9RA 1YY8B 3QUYA 4JM2A 5TF1H 1VGEL 3WBDA 5DJ6B 1IAII 1NGWB 1SEBA 5ESVB 4G8IB 1FYTD 2ZUSA 2R23B 4HKBB 5L2KD 4FXKB 3D39A 4KRPB 4FQ1L 4PJHA 3SKUD 1BECA 2QQNH 4WW2A 2BNRE 3UTOA 4EDWL 4IS6B 3KR3L 1U8KB 1CXLA 1KB5H 1DBBH 4Z9KB 1GGUA 3JV6A 4WFFD 4TYUA 4MJIE 2G60L 5JA9A 3T1WA 2KQMA 5B39A 3QIUD 4UDUA 4O2EA 1IC1A 1FG2B 3IJHA 5IW6B 3RY5A 3MGAA 3STLB 1RUMH 1C7TA 4MAUL 2HYMA 3AXLB 3M07A 2DTSA 2FB4H 3VXQB 5I16B 5IQ9A 3GKWL 2A6IB 3QHZH 4U33A 1VGKA 4U1KA 5F6IC 1X5KA 1KIPA 4U1JA 5FGSA 2VXQH 4L1DA 3NFPB 1F90L 2XTJC 4F7TB 4ZUUB 3LV3B 3CFCL 3DRQB 3QI9B 3GMRB 5I1EH 5HGBA 4XP6H 4GAYB 4RFEB 4RAVB 5SWSD 4OD1H 3C6SB 4I8DA 5L8KB 3QHTC 5IM7B 1T21B 3BH9B 5LBSH 3CGTA 5FKAA 4OF7A 3IKKA 3MV7D 2KPNA 2NTFA 3GB7B 5DD5L 1GIGL 5CGYD 2GIYA 3LKPB 4LVNC 3S34L 3LIZH 4EN3C 2XA8L 4FQ2L 5DLML 4YK4B 1FFOA 2DJ4A 2E6JA 3O9WC