3ZDZE

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 38
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE02
3VXOA 4N8CH 1AXIB 5DURB 4X5WB 3EJYD 1KJ2B 2HLAA 2DQGL 2WQRA 3TFKD 3H42L 4PLJC 2VIRB 4UQ2B 4POZD 1CXFA 1INDH 3ARFB 3LS4H 2Q86A 4UZGA 4GKNA 5F7MC 3D39E 3OJVC 4L3CA 3SKMB 3W9EB 3P77B 3B9VA 4XNMA 2ZZUT 4L4VD 1A6VL 2XQYK 5DK2B 4RAUA 5FHAL 1SM3L 3S98A 4HIXH 1JJUA 2OL3B 3GO1H 4S11A 1J8HE 3IAPA 5C9JB 1NAML 4NT6A 1S9XB 3MUGA 4PP1C 4X83A 5DA4A 2A6JA 4PJ5A 3SGJC 2LTQC 1OTSC 4QF1A 5B4MC 3TYGH 2E27H 2VXVH 2ARJQ 3EYVA 3VG9B 1A0QL 3GMRB 1AD9A 4APQC 5C6PB 3QDGB 2E6QA 5HHOB 5FF6B 1AE6L 4ETQB 1JIBA 3VXUD 4WI2A 3S3PA 3FOLB 1ZLSH 1OAYL 3MRIB 4HDIA 4OZGE 2CKBL 5FFLA 4EOWL 5F6HJ 2L0DA 4YHIA 4OD2A 4S1RH 2DRUA 2VQTA 1CGSL 3QEQB 1BF2A 3KJ4C 2VABA 2DYPB 3TPUA 3SGEH 4U0RB 4XHQA 5IESL 2AK1H 4FQJL 5L2JB 4YIQA 5FO8A 5M95B 1ZA3B 3BVNA 3A6BH 1K4DB 4AY0A 1MCDA 4NKIL 3QXAB 3GSXA 4Z76A 3MLPA 3L3JB 3MRHB 5EZLA 4GRLB 3RDTD 2WMPA 1RUKL 4XC3L 4JHAL 3KYOB 4NO0A 5GZOD 1S7QB 5TGBB 2EIBA 1BZ7B 2JK5A 1CFQB 4OT1H 3JTSA 4Z9KB 4EN3D 5TPWL 4U1SA 2GJ6E 2W60B 5GS3A 1H8SA 1CXKA 1G7QA 1MFAH 1EX0A 3HC0B 3OG4B 1NCBL 2IEPA 2ZPKH 3V2AR 1D3CA 1HDMA 1AO7E 4OFIA 4WRLA 2K9UA 4MQSB 1MFAL 5I71C 1VADA 3FO9A 4GBXA 5EC1B 5F3BB 4J2XA 5BO1H 2CRYA 1I9IH 2GCYB 3RDTA 4CNIA 4TPRL 4IS6A 2M26A 4HGWB 4JM4L 1FFPA 3LRGA 3GGWA 1MCEA 3G08A 4HIHB 2QQKH 1C1EH 3DUUA 5B39G 2PO6C 2NCMA 3O3BB 1J5OH 5D1ZA 2D03H 4P9ML 4X8XA 4S1SL 3VXMD 4HUVA 1PQZB 3L9RB 4R9HA 4QLRA 4NBXB 3GKWH 2Z8WC 5C9KA 4WEMB 1H3TA 1K8IB 4Y19E 1I1FA 3OR7A 3PABA 4WV1A 1RIVL 3MSPA 2FH8A 2NY1D 4NN7B 1FO0L 2HMID 3FT3B 5I1AB 3QAZC 4NUJB 2DOCA 4UT9L 2EEAA 3D0VA 4JFXA 1LO5A 1S7SA 4P3CL 1F4WL 2BY2A 1CGUA 4E0RA 5EBMB 4W6WB 3ESUF 5JPMA 4R2GB 1RUQL 4EI6B 4I48B 1OTUD 4ZUWB 4NNXA 1A0QH 2W65B 3GM0A 4RGOH 5DFTA 1A1MB 2EE2A 4LSUH 1CU4H 1MREL 4AT6B 5BW7C 1A5FL 5E6IA 1CGTA 3CCHB 4K07A 4L5FH 4O2CB 1H0DA 5SWQA 3TA3A 3ZKXC 2HVJB 3MA7A 4K3DH 4ZUTB 4AM0A 5ICZA 1GVIA 2LV4A 4F57H 3MNWB 2RBLA 2BZDA 3S96A 4F9LC 3QHTC 2AS5M 4HWEH 5H94B 4LFHD 3L3DA 4AEIL 3H7BB 1DUYB 4U1JB 4JEGB 1YEHL 4BM7A 2Q7YB 1MQKH 5KVGL 1BMGA 2QHRH 5D6DC 4NKQB 4J8RA 1U41A 1QHPA 2YC1A 4Q9BA 4GXVL 1VEMA 4OSUH 5FYKU 3X3FL 5JZ7D 3NH7L 3TYFB 4WW2A 3WNLA 3PWJA 1JGEB 2BP3A 1A7QH 2DM4A 3OGCA 5DUMH 6FABH 2BVQA 5KAQG 1S9KC 2AXFB 1Q0XL 1I7RA 1U92A 1F42A 3HCVA 3L3IB 1EK3A 4QRPD 2IBGA 3TNMA 2E7LA 4QOKE 3O11A 3R06A 5I0DA 1XCQB 3FAXA 1HI6A 5DRWA 4L4VE 1NLDH 1X7QB 4N9OB 1VACA 2ITCB 3O6KH 1BZQK 3VXOB 4CVXA 3F7VB 5TQ2L 1U9KA 3KWWA 3HI1B 1OGAA 2P1YA 1EHLL 1Q9KB 3TT1H 4JCMA 1QTYT 4KQ3L 4LCWB 2A6DB 2YXFA 4M62H 2X41A 2E7BA 2EXWD 1INEL 4OF6A 4HF5H 4LSPH 5CZVL 2R4SL 4MWFA 4HMEA 4EEEA 5T5FL 2BJML 1YEDB 3HZKA 2OL3A 3UTPE 4PJIA 5HHNB 3RY6C 3P0VL 5DK0B 2AXGA 1WICA 5JW5B 3RY4A 1UM4H 5IR1A 4YXKH 1QR1A 2A74A 3SE4A 3SDDC 1D5BA 3KPRD 4P9HL 3Q6GH 1MFDH 5IBLC 1N6VA 5EULV 3TIDB 3HNVH 3UCRA 3IJSA 1RULH 1D9KC 1PSKH 2VR4A 2XY1A 5H8DA 1X5YA 1KIRA 5DMJB 3C2AH 4N0CD 3KLHD 3FOLA 5BXFB 1MCRA 2GEEA 1D9KA 2EH8L 5E5MB 5LQBL 2RR3A 5E4IA 1FZMB 3QDME 4HFUL 4XI5C 3O3AA 5L8JB 4A2MA 4FQCL 3B43A 2LU4A 5K9OB 5HDBE 2A77H 2R0ZL 3TGXA 4PREB 1TMCB 2XA3A 4JJHA 3OMZA 3OKOB 2QBWA 4RX4A 3BKCL 2HFGH 5L8KB 3VWJC 2FWOB 2IAMC 2X70B 4O9HH 2ESVD 4PRPB 4GRWF 3VXUB 3WFEL 3WJJA 4JRXE 3VW3L 5DMKA 4X6FB 1I7ZB 2UWEB 3FB5B 2ESVA 1CFVL 2V17H 4PRIB 3LMJH 5TDNA 3FQRA 4HEME 4WY7H 5T1DL 3HB3D 3WJLA 4P57A 4FQLH 1AKJA 3MLXH 4UIMB 5C08D 1Q9WB 1DQTA 3KAAA 4PGDA 3MV9E 1A7NH 3JTTB 3E0GA 3SGJA 1S7UB 2NMSA 4NFBA 4RRPG 2F54E 3AB0C 3BAEL 4ZFFB 4M1CC 4NZTL 5F88B 2F5AL 3WYRA 2MCPL 2R69H 1U8IA 1UZ6F 1NBZA 1INQB 4H20H 3QA3B 1MIML 1YNKH 2A83A 3VRJB 3H9YA 1JTPA 3CLFL 3KXFE 3DVIA 3LD8C 5F3BA 2DIBA 3ZSSA 1D6EA 2HFTA 4JLRB 1QFHA 3NZ8A 4MX7A 3RNQB 4XCNB 1FVEB 2GTWB 4KAQL 1TQBC 3GGWB 3IFPA 4HKJA 3DBXA 3SO3B 4I0KA 2IPKA 4NSKB 1ZANL 4UBDD 5IJVB 4GG6A 3EYUL 1NC2A 3BT2L 2CUHA 4EIGB 1CGXA 4X7SL 2YK1H 4FMFA 4S1DC 3VXRE 3U7AA 3IT8D 2YRLA 1HSBB 1MVUA 5F7HA 1LMKA 5ELIA 5I0ZA 5MENE 4YHOH 4LNRA 2ICWB 2F19L 3KPPA 2O5YH 3LV3A 1X5FA 4C55A 3UPCA 5BW7A 5E8PB 4ODHL 1S5HA 3TM6A 4QXGL 4RRPA 5A16A 3EYUH 3MV7A 4IOIB 4ZXBD 1ETZB 2VL4A 4NPYB 1FE8H 5HHPA 4G42B 4HKXB 3TBTB 2NX5E 3WL9A 1WTLA 1IFHL 5GXBB 1KV3A 3WO3B 3L3GB 2GSGA 1NEZB 4MD0B 1H3WM 1Z9MA 4R4FH 4NWUL 3TN0D 2FEDC 4ZSOE 1FG2B 4RGNE 4MZ2A 2HA1A 2XKSA 4P3DB 4K3JL 5TE4H 4KMQA 2E7HA 5DYOB 1CZ8H 4JRYA 3RTQC 3FFCD 2O5XH 3TO4A 4ETYA 3MYJB 5IMMA 2VLKE 5E2TL 1KJVA 4M4PA 2ED7A 4D9RE 2HFEB 2E9IA 3C6LA 4OZFH 4OI8A 2APWA 4C56E 5D7LB 2ZCHH 4R2GD 3LSOA 5KS9E 4XAWH 2WINB 4KRPC 1JGLL 4NGHH 4F7MA 2P24A 2A73A 4YO0B 2WBJC 5BOPA 2FGWL 5E4EB 4NO3A 1RURL 4FZEH 3QZWB 1J9CT 4ODVH 5SWZA 2BVQB 4BA8A 1HWGB 4XVUC 4NRZB 1MCNA 5E8EA 4OGAC 1G9NL 1U58B 4PFEA 4XP9L 2DMCA 4MDJB 5C07A 2VDQL 3RWDA 2IC2A 3GMMA 3QXWA 4GBXD 5I16B 3S3JA 3HPJB 5ESQA 4YQXL 4LU5L 5HI4D 3QI9D 4WHTA 3QUZD 5HD8D 1EV2E 2OJZL 5BRZE 3OB0H 1EFXD 1Q9KA 4R0LA 3RVVC 1CBVL 4UQ2A 4PJ8B 4LVOB 5HVFB 1FVDA 5MP6L 3P11H 4Y16D 4LCWA 1JNJA 1IILE 5I9QC 5CJ5A 4LLWB 3PP3H 4P2OA 3VRIB 2GJZB 4OLEA 1MWAA 2OLDA 4OLXL 3VRLF 5AWNL 4YXHH 5DGRA 4ZYKB 3OKNA 2VXSH 1HXMA 1MHEB 5E9DE 1QG3A 1U91B 3NIDE 1FYTE 1PSKL 3AU1A 5KOVC 2V7HB 1CFNB 5FUOL 2FECI 3W2DL 5GS0D 4KKLC 2GKIA 3ULVH 3Q2CA 5JHDB 1UQSB 3TESA 3S34H 1JGDA 1Q0YH 3D85B 3U6RA 1JWSA 3TO4C 1ZLUH 1B2WL 3RTQA 2R0KH 5B22A 2A74B 3C09B 4WTXA 1W8NA 4PJ7E 3S35H 2EICA 5I73B 5CMAB 3K1DA 2B5IB 3F7YA 2ZG1A 5FCSH 1J05A 1RMFH 5E94B 4HMDA 1P7HL 4LP5A 4KRPD 4MMZC 1QFWH 4HKZA 5CJ8A 3V9FA 5ACZB 1BIHA 2VH5H 1U8KA 5IK3A 5LBSL 2AJZB 3BYTA 32C2A 1AO7D 1ZEAL 3KYOA 1ZGLP 1E0OB 3VGEA 2HKHH 3VMPA 1KEMH 4APQA 4E41E 5ACLA 3T0BA 4HCRA 4FQQA 4NKOB 3TO2B 5FGCB 4RMQA 1D5XB 2YBRB 4PR5B 3OSKA 2X4RB 1M4KA 1RZIA 3VXMB 2WP3T 2LFGA 3QHFL 3BZEB 4I13B 1IGFH 2XZQL 2NY2B 5IB4B 1WIOA 3DV4A 5CEYB 4F7PB 1NGXB 5FGSA 4M1CD 4OGXL 1A4KB 3IKKA 3U7WH 4QRPB 4JRWA 1DLFH 1G0YR 2XG4A 1TVHB 4DKAA 2OZ4A 1ZHLA 1F90H 4JM2D 2ADGB 1J1OH 3C5JB 3VXRB 2MKLC 3MRJB 1NEZG 2YWYA 1MJ7L 4LLDA 5E08H 2ZSWA 4UNUA 1Q9WA 5BVPL 3TV3L 3H9SE 2QHRL 2W9DL 3N9GL 2OYPA 4HWBL 5D1QA 1HINL 1YMMB 3D2UB 1V3KA 2FX9H 4TRPH 4OV5B 4XH2A 4TUJB 4O2FA 4X4YB 3PL6A 5TF1L 2Q6WB 1VDGA 2J8HA 1AR2A 2XWBA 3D85D 2J8UB 2I27N 1K8IA 3MV8D 3NZHL 3BDXA 8CGTA 3ZL4L 3D18B 2VNCA 2GCYA 4BFGA 1PX3A 2G9HB 5E99H 3R8BB 1DSFH 3ES6B 1NAKH 4MNGA 3FMGH 3BSZL 5IBUG 4WO4D 2IBZY 3DSNA 3WHXA 1DVFA 4KDWA 4HS3B 1JGUH 1RUAL 2DKMA 2NY1B 2V9RA 3VFRA 4KDVA 1A7RL 4ZNCD 4S10A 1MI5A 4ZOBA 4NQUA 5SWQB 1I1YB 3GIZH 4PJFF 3KLDA 4Y5YC 4P23A 4PJDE 5F9WB 3NCJH 4OCYH 4P2RA 3P9LB 1NC2D 3QUYA 5IB3A 1U2CA 3OXSA 1T5XA 2D03L 4P9MH 5D7KE 4OZ4A 3ZHDA 4YHKL 4CN1A 5KSVA 4WGWB 1HIML 5GS2D 4Y4KC 3SGEI 5AZ2H 4P2OC 5CJOL 3VFPA 1FFOA 4S2SA 2PCPB 3DETC 4LLMB 1QOKA 1RZGA 3REWB 2ZCKH 2ADJA 2J88H 3MGTA 4FS0A 4TULH 5C0FB 2HKHL 2PW1A 4RBPH 2HVJA 5B39A 3TNNA 2NZIA 3JWOC 2EH7H 3LKQB 4G7VL 3IDIA 2DI8A 4JO1L 2C7UA 3PQYA 5ABDE 4HXAH 4XI5D 5IEHB 1RIUH 3CFDA 1S8DA 4OGYL 3T0ED 2OJEB 2Y5TA 5CLWA 4KI5C 4KJYB 5DEGA 3C60B 2J3SA 1L7IL 3V6FA 2IALA 5C08A 3QQ4B 4NM4L 3SCMA 3MOAL 4DGVH 1B2WH 3C87A 3UAJC 4RGMB 2XY2A 1JPSL 2FBJH 3GMLA 2PTUA 1BOGA 3CX5K 3OGCB 3SKMA 1GIGH 3GIVA 1J0YA 1FSKC 4I5BB 5D7JC 5BZWA 2ATKA 3W9EA 3MRCA 2I25N 1IBGH 4P5KB 5FUZL 3WN5A 3ZYOA 3GMMB 3SDCB 1I9JL 4NZRH 3SDYL 3WIHA 3K7UA 3D69B 4G8FA 1KCRH 4RX4D 1TENA 1MRFL 4PD4J 3PV6A 3V5KB 4ONFL 5E9DD 4YX2L 3UPAA 3GHEL 5HBBA 2PUQT 3ARUA 3B9DA 3QDJA 3NCEB 2R39A 4I0PA 4PY8I 1S9YB 2O5ZL 3GDBA 4LKCB 3AS3A 1TZGL 3CDGA 3EDJA 2XN9B 3IFOB 1Y6MR 3DTXA 1J10A 3Q48A 3QUXD 1L6XA 1MSPA 3D5OF 4QOKB 3W39B 4ZUUA 2VR5A 4M93B 3M17A 3QG6B 3KYNB 4KTDL 2W1NA 2MHAB 3PWUA 1YNTA 1KIPB 4JFFE 4LPUA 3UTZA 2YPLB 1JNLH 3O2DA 2D0HA 4MJ6A 5K9QI 4OCXL 1H3PH 4K8RD 1KC5L 2V6HA 2ERJC 1AGDA 3CZJA 2AXGB 5DUBB 4RGNC 1QHOA 2XZZA 3M1BB 2AV7A 5K59F 1N0XH 4TVPD 1KBGL 2EYSA 4JG1H 3GO1L 3QAZB 3HE7A 4XNZC 2EDDA 5E94A 4ODWA 5I8OL 5ID1A 5D5MA 3DMMD 2WIIA 4XNXL 4WUUA 2X89A 2AJZA 4LARH 3KPOA 3CSYA 2GSIB 4DEPC 5C0CA 1JYNA 1C7TA 1J0ZA 5TDNB 2AK4D 4NQDE 4G6AD 4CN4A 3CUPA 2C5DC 3IDYC 1DQLH 5F1OB 2JKXA 4YR6A 1WBZA 3IU4H 1RZJC 3SGDI 3H42H 4LPXA 5CAYB 4XWGL 3WUZA 1S9VA 4RMWA 5F7DB 3CJJA 3DV4B 2YD8A 5CEYA 1NDGB 3FO2B 4JDTH 4EJ1C 1QFUH 3PWNA 1T66D 3B2VL 2A6KA 3VXRD 4IMLA 4K8RH 2XFXB 5EU3A 1Y18A 4OM1L 4ZMAT 4JPIB 3DX8B 1CWVA 1QO3B 1UH3A 3MPCA 5C0JA 2MNUA 4MX7B 5CEXA 3Q5YA 5EFIA 3BZDA 4KXZI 5GGTA 4Z7OF 2AAVA 3AS0A 1P6FA 2B0SH 1XGTA 25C8L 1QFPA 1EGJH 2DBLL 2OI9C 4HK0A 3D25A 4NQVB 4JQIH 3EGSB 3WDHA 4GBXC 5HDOA 4HPYL 3IF1B 2JIXD 1EZVX 4TUJA 2C4FT 4X4YA 5D7JB 1JN6A 5HHQA 4LSVH 5FO9A 5EIIA 1U8IB 2H6PB 4L3EE 5DZOA 1OAKH 1CQKA 4GJTB 5T3XL 1JRHI 3IAQA 4WEUD 3LEVH 5IBUB 3GJFB 3MV9A 4HUXA 1T4KB 3ILQD 3AAZB 1DANT 4N1EA 2DL9A 3OAUH 1N64L 3K81A 3VMNA 2OL3H 4FQPA 4ZNEE 4KJPC 1ZT1B 2BRRL 3ES6A 3VXSE 4GXUN 4ZFGL 5I75B 1ETZA 4NPYA 3JWOL 4NZTH 1TITA 2P8PB 3BAEH 1XGRB 4MNQB 4OZIB 5EU6E 3RJDA 5JDJA 3KXFA 5EU6B 2QLVB 4MNQE 5EBMA 2MPAH 2CIKA 1FIGH 4PB0H 5GGVH 4LCCA 4YHMH 3FB7B 4XBPB 3JWDL 4HQQL 4Y4KB 1ZXQA 4MJ5A 5KSAC 2IAND 3EYFB 4MGXA 3MV11 1JNNL 1HKLL 2AK4E 5KVFL 4I9WD 3L3KA 1EUUA 2JB5H 3V0WL 4S1QL 1TJIH 5BVJA 2CUIA 4L3EB 3CLEH 2P5EB 4KMTH 3GRWA 1G7IB 1TJIL 2XWJB 1DFBL 1T2QH 3HN3A 3D0VB 1A6UL 1HKLH 4HKXA 4PJ8D 3FOMA 5I75C 2IADA 4NJAH 1NMCC 3VFWB 4X4ME 1Q38A 1RZ8B 3S36X 1TTUA 3JWDH 4LHUA 2QADB 5FYLH 4HHAA 3DHMA 3CFKB 4F9PA 1NLBH 2H2SC 4HMCA 1FNFA 3IDGB 1I7RB 2BVTA 3O6LH 5IHLB 4XWOC 2IGFL 2F54D 3ARGC 1H0DB 3OXRA 3QIBB 4Y2DB 1YMME 2WW8A 4O58H 4Z5RB 3VD7A 2QR0B 5IMMB 2YA2A 1BGXH 1UACH 4HPOL 4PJFB 1GZPB 3P4OA 2CUMA 2X4QA 4Y4FD 1VPOL 1LK3L 1VKXA 4LKXB 3WO4C 1SY6H 1XF5A 2YA0A 3OAYK 5IHZA 5IFJA 4FA8A 5IVOA 3I6GA 4NO0D 2CD0A 2A6DA 1JK8B 1FHGA 4JFFA 5EUOB 5DD3L 3VGAC 3MRRB 1T83A 3RJQB 5D6DA 3HR6A 3KG5A 4QRUA 4Z7WE 1FRGL 3O41B 1LQSR 3A67H 4PJBF 4YUEL 1XR8B 4TSCH 1T6WA 25C8H 2QKIA 4GRMB 3TT1L 5EIQA 1MHPH 3MXVH 3PHQA 2OR9H 5LGHL 4NO5A 4DAGH 1KLUB 1NFDF 3QRFM 5E6IC 1A6WL 3NACH 4YDJB 3LIZL 3TIDA 1SMOA 4IJ3C 4NZJA 5C0RH 1FFRA 4W4OA 2FO4B 1ZLVH 3KPSE 1KXVC 3MLUH 3RHWF 2YPLE 3STLB 1MCHA 4XNYL 3KDMA 2Q8AL 1JRHH 3ZDZE 1P4LB 2X1PA 1OCWL 1DDHB 4N8VG 1DBML 5TH2A 1IEBB 2HFFA 3GI8H 4K7FA 4GW4A 3I02A 4FQXD 4HV8A 3PDOA 4JB9H 3MZGB 2Z9TA 1T80A 1XGYH 4F15C 3U7YH 3H3PL 5DJAA 3TN0C 1FJ1A 1XF1A 2FX8L 4LNVA 5DR5H 4BSVA 1D5BB 5CMAA 1YY9D 3OKOA 5IB4A 2NY6D 3KPNA 2K1MA 3BGMB 4NWTL 1ZGLA 4LHJB 2V5TA 4C56D 1VB9A 2BNUA 5C86A 4JZNB 4F7EA 1DQQB 4HKZB 4LSRL 4UUJA 3GSNA 4JG1L 1QD0A 4NDMA 5FGBA 4K3HA 4Z7NF 1U6AL 3SHSA 4X6FA 1TVHA 4JFPA 4K94H 2AJUL 4MAUH 5DJ0A 1BJ1H 5F9OH 1GGCL 3QUMB 1UKTA 4LLDB 3TH3T 4P57B 3L1OL 4CL7A 4AENB 1TVDA 2IFFH 3G04B 2NY5H 3MLZH 3HC4H 3QEGH 1ED3A 1QYGL 4OV5A 3M8OH 4RIRA 1LO4H 4UV4H 2XOTA 4F33B 1ZLWH 3K4AA 4XNUH 2OP4H 2UVFA 2W0LA 4PY8J 1INQA 2VL5A 2HRPH 2B2XH 1VERA 2VLKA 4MCYA 4MAYA 5C7XH 5KVEH 2X9WA 3LZFH 3MLZL 3ZE1F 1UCBH 4RNRB 3NZ8B 3RNQA 4E42A 2YD2A 4P4KB 3HAEA 4BFBD 4YX2H 1WV7T 4M5YH 2D4DA 2DMKA 4PTUB 5D7JD 1X6LA 4OF7A 5T5NG 3QNXA 4O2EB 4MAUL 4GAGL 3IXTA 4YDIL 5EZJB 4PV9B 3TZVA 3TBYB 3UAJD 1D5ZB 3GJEB 3ILPA 1M71B 3CFIC 3STBA 1GCFA 1FZJB 5DC9B 3BKML 1BWMA 4JFEA 4NWTH 5IV2A 3KR3H 5C8JB 1YEJH 5E95B 3IDNA 4LGSB 3QO0A 4ZAKB 4DQOL 5F3HA 3FQUB 3MLWH 3UO1H 3O8XC 4G7YH 4GO6B 1C08A 5HGBB 2B39A 4PY7A 4U1HB 4X6EA 4XCEA 1XGYL 2YMXL 3DXAE 4P23B 3B5TA 2FL5B 3NA9H 4JFED 1R5VB 1A3RL 1DBMH 5JLZB 4OCLC 3EOBA 4HXAL 5L88L 3VFGH 1IKNC 3SQOL 3SBWA 5IGXH 2R8SL 1HHJA 4P4RA 1JTOA 4ALAL 2XV6B 2AJVH 4KY1L 4ERSL 4WHYH 1DEEA 4NM8L 5GGSY 2AJ3A 5ICYA 3GMPA 1YQVL 4E41A 4LCCB 1R3IH 4CMHC 4HKBB 4X4XA 1M05A 3ZLQC 1NEZA 4MD0A 4OT1L 5TFSL 4TQEH 5KVDL 1A21A 3VFSB 2ICEB 2DLIA 5JNYA 3VWKB 5BMFH 5FV1L 1WCBB 3QHZL 4OZHF 1J1PL 4Q0XH 2Q87A 1ERNA 5MEPB 5ESVB 4LLVB 4HCRH 5JQHC 1F11A 4EDWL 3OAZK 4HUNB 5E8PA 5EBWA 5C09A 5HYSA 1ZTXL 2L4OA 4KVNH 1ZT4A 3AM8C 4M7LH 4Y16B 4J7RA 1HN1A 3HS0A 3MRPB 5BRZD 1BFVL 2WUCL 5DHVH 5F21B 3T2QA 4KGJA 1TCRB 4HLJA 3T4AA 3AREC 2HVKB 1NKRA 2XRAH 5GS1A 2MCG1 3SDDD 4HHAB 2CDGA 4IRJD 3L3GA 1ZVSA 4ZFZA 1WUNT 4FQXB 3QFJD 1JCKA 2H2PC 5HGAA 4X5LA 3WN5B 1G9NC 1WAAA 1OP5K 2CJUL 3V8OA 4C83B 4HBCL 1F4XH 1S7WB 1BBDH 2BNQD 3FO0H 1TETL 2AQ1A 3HE6C 4ZOCA 4L29A 3CFEA 3SCMB 5C0ND 2IMMA 2R23B 3N0PB 4FFWC 3WJLC 1U3HB 5CLTA 4PRPE 5MI0C 5D7IB 5DFWH 4P4KC 1BX2B 3MRRA 3S6CA 1U36A 3PWUB 1EJOL 4KRPB 4TRPL 3LOWA 1FAKT 3REVB 3SDCA 5D71L 2Q1EA 5ISZA 4D0BA 1ZVHA 1SVCP 1KJMB 4GW5A 4FFYH 5HYSG 5I8EB 1KJ2L 43CAA 1WC7A 1IEAB 5GSRA 2E6JA 3BRDA 5KAQF 4HUMB 5IFAL 4KROB 4FZ8L 5D5MF 4MNQD 2DM3A 2BNRB 3O9WB 3C08H 1F90L 3RTQB 1CVSC 4CVZA 4C4KT 2VERN 2QTEA 5EZOH 2R2CA 3G9AB 5A2FA 2EDNA 1WZMA 2XQBL 4K9EC 1GHFH 3GMRA 2DYPD 4PB0L 2NYYC 4M8QB 1CT8B 2FO4A 5JHDE 3WEXB 2WIIB 1CICD 5GZOC 1K4CB 1MWAB 4QKXB 2GSIA 4MYWB 2M8XA 1IC5H 5FA3B 1MPAH 5ECJE 3NFNA 1MUJA 4GMTH 4J1UB 2GYSA 5IVZA 3HE6D 2KDGA 4LVNC 3QXDB 3BMVA 3GHBH 1MCOH 1A6TA 4X6CE 5B21A 5D7IF 3BEVA 4E9LA 5I73C 1UWEL 2XXMB 4IRJB 1FN4A 3SE4C 5DMIH 1EDQA 2AV7B 3F8UB 1RZIB 4LCUA 4YDLB 2ZNWA 4NC0B 5GISL 5CBAB 4R96B 4R3SA 3CZFB 3IJYA 4DKEH 4JANA 3GSUB 5HGGS 4YXLL 3IXAB 3RUGF 3VWJD 1Q9LA 2R0KL 32C2B 5C07D 4U49A 3ROOB 1OVZA 4KDTA 5T1MA 5I9QB 1SYSA 1HH9B 4XVTL 2HTKD 3CUPB 4Q2ZB 4XC1L 2NX5A 2FIKA 2CDEA 5C6TL 1YEGH 3RGVB 3VGDA 4D0CB 1IZJA 2NXZC 2H1PL 1OAZH 3VI3F 4OLXH 3RKDC 1XMWA 1U8HB 1YJDH 1LEGA 5ESAB 3DXAB 3P11L 5EZIL 5MP6H 5F44A 1MAKA 2QHLA 5I66B 2YMXH 2H26A 4QTHB 3AVEA 5C0JB 1CL7L 4JRYD 3WIHH 4WTZA 4G9FA 4G7YL 1S5IL 1V7NL 1CLYL 4HT1L 4U6XA 2G9HA 2EO1A 2A38A 4R7NB 4G8GE 5E00B 3MLRH 1AXSB 4OZGF 5IFHH 1KTLA 3U36A 1WISA 1MJ8H 1MJJB 2CR3A 4OZIA 5ITFA 3ARGB 3EHBC 2SEBA 2DLFL 2FD6H 3LEXA 3D2UA 3NIFE 2NTSP 4WUKH 4U1MB 4FZEL 1CXLA 3MV9D 3WIFA 2VLRA 3RFZC 3FB6A 4XCFL 4M61A 1UCBL 5DJCA 4F15B 3F7RA 3L3HB 4OCXH 1AIFA 3O2DH 2HN7B 1MCIA 5CGTA 5BVJB 2F5BH 1VGKB 1AJ7H 3O2VL 4XPBL 3ARBA 5D2NB 1ZT1A 3SY0A 4WI8A 4HG4J 2IF7A 4RFNB 4NCDA 1DUZA 1GGTA 5TE4L 3MLRL 3O45A 2ERJB 5LGKA 4RMUA 2GJJA 3BGFB 5KANI 4X6BA 3IDMA 4O2CA 2AEPL 2GK0A 5C0FA 3BXNA 2G5RA 2E8ZA 3IYLW 5CZKA 4OI7A 1F5WA 3N1FC 4AM0B 1WVZA 3OX8A 4UILL 4W81A 4X6CB 2Z8SA 4LHUG 2Q20A 4RFEA 4TUOA 2VC2H 1KEGH 4QXUL 3GUTB 2JJTC 3P4OB 1GGBL 4YH6A 1LNUA 2ZCLL 3G5YA 3WFCH 3MNVB 3OXSB 3RWEA 5DEGB 2FYYB 5IROA 1R3LA 2F58H 1K6QL 1DP0A 2H8PB 1YDPA 1RU9H 3ZHLA 1N59A 3TBWB 4GKOA 5A2IH 4NNYA 5DD5L 1XIWB 3QWRA 5HVHC 1BD2D 1FDLL 1KJ3H 5C0NC 4QXTB 1BVKA 5FUCC 4DGVL 5AAWA 2R2HB 1QLEH 4LF3A 5HGAB 3HCVB 4OQ1A 1YPZB 3MCG1 1RUPH 1CG9B 4GKSA 4UTAL 2IANE 3NCCB 3CMOH 4P4KD 3TNNB 3O11B 3DECA 2Q8AH 1ZANH 3C8KB 2R29L 4K8RC 4L9LB 1TZHB 3MLVH 1RD6A 4R97C 4BSWB 1L9NA 2FB4H 2NPLX 4RGMC 1EGJA 3LKNA 4NCC1 1OGAE 4FN0A 3NACL 4NO5B 2V2XB 4CRPA 2A9NH 5DJ8B 3QQ4A 3ARFA 1FFNB 2ITDA 4YDJA 5DJ2A 4NHUA 3ARYA 4PS4L 4JFDB 4BYHA 3SJVD 3OAYH 1SVZA 1O0VA 4XXDB 4Z7WB 3A67L 2LQRA 2VQ1B 4ONOA 3WIIH 3NABH 2DD8H 1OD7A 1A3LL 3MODH 5FHBL 3LRHA 2C4FU 4YFLI 3I02B 4GW4B 3MLXL 3RL2B 1TTFA 4LDLB 5FV2A 4QNPF 1V5JA 2X4OA 5SV3A 4BUHA 3MREA 3FHAA 2V2TA 2C26A 3M1BA 3GIZL 5E9DA 1YUHA 4YHZL 3VW3H 4E5XB 2OXHA 3MOBH 4YIQB 1HYSD 3SDAC 2BNRE 1JGVH 1F3JA 1TCMA 1VSCA 3BH8A 1XAUA 3BGMA 4JGJA 3HLAB 3GSWA 1BAFH 3UJJH 3GSXB 1CF8H 3LPWA 1BGXL 1UACL 4K9EH 3O4OC 5JUEH 1BD2E 3MRHA 3EDEA 3HPLA 5I18H 1CDCA 1EHNA 2K7PA 4QT5B 2OSLB 1HYRC 5LG1A 5C71A 3ZKMC 4FQ2L 3KYKL 2RIKA 3MRLB 5D2NC 5AYUH 2ZG2A 2RJMA 1OWRM 1RY7B 4QRRA 2PYFA 4Y19D 5AD0B 4HLZG 4NJAL 4M6ML 2O93L 3QDMD 4FHBD 4ZUVA 3LHPH 3QI9C 1WF5A 1W0YT 1UADC 1ZGLB 5C92A 3FO2A 3O4LB 5CGYD 3UJJL 4N9GB 2A0LC 4MDIA 3RAJL 4F80A 4YHZH 1V3LA 3MRMA 3VXSA 4KJPD 1CE6A 3RWJB 2APTA 5A3IC 5D8JH 4M6OH 3MX0A 4MA3A 5D7KD 3OKDA 1WBXB 4PJ9A 1WBZB 1K3ZA 3MBED 2XT1B 2DQJH 1BJ1J 2KZ1B 5E2WL 4OZIE 4ENEC 5JXAL 1M71A 3N85L 3ZE2F 1OHQA 1SY6A 1AGCB 2NLJA 1H5BC 2QQLL 3FKUS 5FKPB 3QISA 1DBKL 4C54A 1UZ8A 5DA0B 5KVMC 1T20B 2P43B 1J1PH 1HOCA 3PE9A 4PS4H 4Y4FB 4KFZC 3TCLB 3MJ6A 4IRSA 4XPGH 3VFTB 2XFXA 4WWKC 4QTHA 1FL5B 2DMBA 4WFEE 1EO8H 5D2LE 3OL2A 1I9RH 3B9KA 4QHNA 4F37F 3QJHA 2YUWA 1NH6A 4AEEA 4G9FB 2A6IB 3O6FA 5C09E 3QXUA 1IAII 3U0TA 5HPOA 1GPOL 1OAKL 2FB4L 4Y88A 4JVUA 3BUYA 4NQEB 4ALAH 2AP2A 4WO4A 1AY1H 4MXVE 5HVHB 3CFJB 2QADD 1XGRA 2VH5L 5B3JE 1Q1JL 3GJEA 2HLFC 3D2UD 2P48B 1FNEA 4MA8L 5AUMB 3PV7A 4JFEB 4PJEB 4OJFL 5DUML 1I7UB 4U6VH 2G5BB 4AZ8A 4F8TA 1VEPA 5HYFA 4HC1L 1FZKB 1KFAH 3FQNA 3QIWC 4PRDB 1PZ5A 4TN9A 4K71C 2RB8A 1LO0H 4HH8A 3SJVB 4X7TA 2WWKT 4XCEB 3BWAB 2F58L 2HJLA 4D8PB 4YDVA 1MI5E 2PXYD 5E2UL 4LSDA 5FYKL 1P7KB 4NQSA 3P30L 4UU9B 2OMBA 3OKYA 2D7TL 1T7YA 3IGAB 4LSQH 3UTTE 3PGCB 3QEQD 3VD4A 1VFBB 3TVMD 3VXPA 4HS8H 1PY4A 3VFWA 1YMHA 4CDHA 2X9XA 3QWOB 1C16B 5T1LA 2HJKA 3T1FA 3V5HA 1LE5B 4JPVH 1L4IA 2FLBT 3X12A 4OFVA 1XT5A 4JKKA 5ERWB 3GSNH 1ZKAA 4AH2A 4Y4KD 2FX7L 4O51B 5C0BA 1L0XA 4IIQA 1XIWD 3GK8H 1IAOA 1FLRL 3WD5H 4MA7L 1LO4L 1C7SA 4AK1A 1KNOB 1LNUB 4WCYH 2X4QB 4FG6C 4NQDD 1PYWA 4OI9A 4WNQA 1DL7L 1QBML 2VO5A 3DV6A 3QUZC 3EOAB 2DQDH 3GMNA 4JN1L 4X99B 5J7CC 1G6RB 2FGWH 4OAWA 2CDGB 3BN3B 1RK0A 4R90H 1YPZA 3ZDXF 2P8MA 1RUML 4LDOB 3P9MB 4QGYA 3PXHA 4ONHA 1G9ML 3C6LC 3OF6A 4MA7H 1G9EA 2BSRA 5J3HD 5DRWB 3CXHK 4XAKD 4KKBC 5ADPH 2ZUSA 4NIKB 4ZOAA 1CDUA 2VIRA 4G6MH 1TNMA 1OM3L 5I1JH 1QRNA 5EOCH 2ICWJ 3QEQE 2Q86B 2AV1A 5E7BA 4P2OB 1IFHH 1NC4B 3SGKC 4ONFH 5D7IA 4PP2A 2UUDH 4GKZB 4ZYKA 1ZS8A 4NP4H 3PP3K 1HQRA 4IDJH 5C3TA 2O61A 2Z0BA 1WEJL 2ZUXA 1OAZL 2IFGA 1MUJB 3B6SA 3SDCD 1YECL 3DARA 1IBGL 2AKRA 5FK9B 4U31A 5C6WH 2W59A 2P5WB 5FM5O 3VDBA 1G1YA 4KVCL 5J1AB 5DJAB 3ARZA 1S9XA 4BQ8A 4Z7QE 1EXUA 4NQED 3ZSTA 3V5DB 2XPGB 5FO8B 2J1KA 4LIQH 2X7LB 5INDB 2WWMC 4IM8A 2DF3A 1QEWB 3WEXA 4PLJD 3WNKA 4L8DB 5K59E 2AK1L 1I1AD 3CSGA 3TN0B 4G7VH 4NYLB 3RVTD 4QGTA 4IOFD 2UY6A 4P2RE 5DJ0B 3I9GH 4KAQH 5TQ0H 3BOVA 3QFJA 4Z7UF 2D0FA 3MC0A 1EAJA 3QEQA 4HWNA 4MLSA 4M7LT 1F3DJ 3FQWA 4TSAL 3E1F1 4JFQA 4GMTL 4YE4H 4XPGL 5JMRA 5BRZA 1CICC 4NQCA 3SQBA 3RIFK 1XZ0A 5E1AA 1A4KA 2YR3A 4QYOB 2QQNL 3TT3L 4JANB 1J0IA 4M00A 5F9JB 3KPMA 4DGYL 4MAYB 3L6FA 5L7XL 4KXZH 5CSZB 2L7UA 3FQXA 2X40A 2H3NA 1CE6B 1T03H 3RWHA 4QHUB 1U3HC 3BZ4B 2CLVB 3LMJL 4K2UH 4PJEE 4WFGE 3MA9L 1AKJB 3JV4B 1KJ2H 1M6OB 2AI0H 3EYSH 3RAJH 1E28A 1F58L 4Y5VA 3IJHB 3BPNC 3HE6B 4RIRB 4O9HL 2YWZA 3C8HA 5LCVH 5KG9A 4PRNA 3T65B 4X4MA 1INDL 4LNRB 1LO2L 4KTEL 2VLLB 1KB5H 3ZKND 4QHNB 3ZL4H 2J8UE 4X6EB 1VFMA 3JUYA 4P2CG 5ETUB 2LABA 4MQ7A 4L4TB 4NQXB 4O4YL 2VN4A 1N5YL 2CLRA 2KKQA 1NCTA 4LSTH 1F4YL 2NXYD 5ID0B 1P5UA 1U8MA 1II4E 4PJDB 2OBGA 2VLJD 5IJVA 4LCIL 3JWOH 1SEQH 2CJUH 4GAFB 3WS6A 3LEXB 1UWXH 3G6JE 4BZYA 2W9DH 4I48A 4J3UA 4PJEA 1T3FA 3OAUL 3NTCL 3HI5L 5JW3H 1KLFA 2BHYA 3ARQA 4QY8B 1UM4L 4XHJD 4M3JA 4PRID 2AJYL 2XA8H 1KPRA 3K2UH 3TO4B 4DVRL 3EZ8A 1PY9A 2AJSL 4P2RB 3CK0H 4NQSB 2HAZA 1BFTA 1NKOA 2BY3A 3H7BA 1RHFA 4U3HA 3HG1A 3NABL 3ALXA 3LB6C 3UTTD 3L7FA 3MNZA 5BZDA 5F7KC 1C16A 4FRWA 2EYRA 3UC0L 3UTSE 1OP9A 3QZWA 5SWZB 1CDIA 4BJLA 3DSFL 4PJ8C 4YK4B 5I1CH 4UINL 2WUBL 4A2LA 4NM8H 3RWDB 1S3KH 1W72B 1WZKA 1AGFB 1WWAX 3DO3A 1TZHA 3SQOH 2JCCB 1B90A 1IAOB 2NY4C 4W6YB 3VDCA 4G80A 3C6LB 4KJYA 3NA9L 5GRXG 1DUYA 1IGJA 5HI3D 3RRQA 1Q0XH 2DTSA 4R0LB 1X6NA 2R23A 4FQHA 3EYOA 1G6RA 1U95A 2QSVA 3HUJF 3ZE0E 2X4NB 1FDLH 4MD5B 1YEJL 4Z7WA 1FYTB 2JJUA 4NRZA 4FQXA 3DYMA 3BKMH 4JO4H 4U6HA 1YEHH 2NZ9D 2IQ9H 1JZ5A 4L8SA 3VXME 1AHWA 1IC7H 4JZOB 2X4UA 4QXUH 4JFDE 1N6UA 5TDPB 4OLZH 3ABZA 4WWKD 4GQ9L 3KNBA 5JR1H 5KTEL 1AGEB 4TVPL 3LKNB 3MLTA 4JPWH 4WU7B 1NC4D 2BNRA 2VXQH 3O9WA 1J1XL 2VWEE 4NT6B 4I18B 3MLYL 3WE6A 4X0KB 3FTGB 4Q9RH 3HUJB 4RDQF 3AMLA 1EUTA 2DQUH 2E9WA 2YEZA 3QSKB 2FEEI 1XCTA 3VWJB 1JYXA 3Q5OA 1RUQH 1T1ZA 2QADC 4G6JH 4XPAH 3M07A 3W11C 4KTDH 2VDLL 1H15A 1G9NH 4XCYA 2M2DA 5FK9A 1I1AC 3O2VH 4XPBH 3TCXA 1BD2A 1A7OH 4H0IA 4RA3A 1OAQL 4Q9RL 3O3AB 3PGFL 5IR1B 5E9DB 2EYSB 3GHEH 1U6AH 1IE5A 4JPWL 5EWIL 1QSED 5I17B 5ALBH 2JB6B 2VDRH 2DQIH 2FWOA 3O2WH 5K9KB 4M8QA 4S1SH 4QRPA 3CGTA 2DLFH 2FD6L 4U7SA 2IQ9L 2XZCH 3DXAD 4JFOA 1HHHB 2B4CH 1JPSH 2FBJL 2AVGA 3WFDH 4HT1H 4KJQD 5CKAA 4Y1AB 2NR6C 4NN6B 3BJLA 4P46C 2JK5B 4R4FL 1QSZA 2PTTA 3N50A 3MOAH 2QQQA 1KXTB 3RDTC 3GI8L 1AQKL 1ZMYA 5JOPE 4ODUB 3RGVA 4PRAA 4JR9H 3S97C 3ARBD 12E8L 2Z91A 1XGQB 3G5VB 5ITBL 3QQ3B 2D9CA 4C4KO 4X6DE 5EBGA 2Y1VA 2NQCA 2C9AA 4YZFF 2R0LL 2L7JA 2H1PH 5E6ID 5IBLD 1XF4B 4JM2B 3D18A 4BZ2L 4MXQC 2K7QA 5TPWH 4D2NA 4ZAKD 2IANA 3R0NA 1EIBA 3U0TB 3VJ6A 1KLGB 3I6LE 1KPUB 2C1PB 2WIMA 5E00A 1H5BA 1AXSA 3ULVF 2N4IA 4PGDB 1IMHC 4ZTOL 3O6ML 1P4IH 1J0KA 3OKMB 4NC1C 2C3HA 1QVOB 2SEBB 3IJHA 3P9WB 2BNQB 1BFOB 3CDYA 4J3TA 1TZIB 2H9GA 2R4RH 1EBAA 2HWZL 4OQTH 2VZOA 5DVNA 3RVXD 5HHMB 1OY3B 5HYJE 1IGCL 3OKKA 4HS6B 4YHNA 2DQHL 1F02I 3K2UL 4IRSB 2AJYH 5E8OB 2GITB 3T0VA 4W6XB 1RJZB 4DTGL 2LE9A 1R3HB 3U9PH 2NY2D 3S7GA 2X05A 1AIFB 1MFEL 5FYKD 3GHBL 5IM7B 1P7KA 5EORH 1UT9A 4KHTL 3IFPB 3PDDA 4HKJB 1ZLSL 4LPWA 1SEQL 1FNSL 4PTTA 1QSEE 5FB8B 4U0RC 5DDHA 1S7XA 1DUZB 2HT3C 3E6HB 4ZPTB 1T3FB 3QWOA 1F00I 1ZAGA 3T3PF 4FQLL 2G5BA 3EFDL 3LPGA 3K8MA 4OF0A 5EZOL 1HEZB 1I1AB 1LDSA 4AT6A 3FQNB 4JCLA 3NZHH 5IBTH 5B39B 1UKQA 2V17L 4GRWH 1MNUH 1Z6JT 4QHKJ 5FGCE 2XI9A 3S4SB 5CIPH 5D72L 2OK0L 4B7LA 5IEHA 1WIUA 3B4NA 5HYJB 3VG9C 1HHKA 4MD4B 4K3GA 2JB5L 1AFVL 3SY0B 3DV6B 1I3RA 3I6KA 4H26B 3OHXA 5GJSH 1JL8A 3QXTA 5DK3A 4X80L 1G0XA 3DUSA 4D9LH 4AG4H 3VD9A 1PG7X 2PCPA 4LLMA 4NO3B 3LS4L 2GSGB 1DR9A 3TYFA 3PWJB 5LQBH 1LE5A 3MRNB 4PJ7B 3LDBC 3MRCB 5I1LB 1ZWIB 5J12C 2FZ3B 2VN7A 3VXQA 3MYJA 1RK1A 1KCLA 4JDVA 4LCYB 3CXDL 3SEPA 1BBDL 1E6JH 4DKFH 1NGZB 1KG0B 3GUTA 4P49A 1MCPL 1IM9D 1ZHBA 4PJXE 3KWWB 5BV7H 3C60C 5B3NA 3S9DB 2P5ED 4P9HC 5D70L 1I9EA 3LVEA 5DQ9A 1UWGH 4NNYB 4ODTH 3S37L 4YNYB 1KEML 3VXUE 3RVVD 1NC4A 2BNRD 3O9WD 4KQ4H 4ZUUB 5EUOA 1ZEAH 2R2HA 4XXDA 2VDNL 2VISB 3NIGF 4HF5L 1BM3H 3OBAA 1CD0A 1UYWH 2AABL 3LKPB 4KUCF 4OIIL 1X4YA 1Z5LA 2VLJB 5HY9A 3UJIH 4DCQA 1UWGL 5MERA 5IROC 4O5LH 3FQTA 3NCYS 1W2KT 3PWPE 4K8RL 3DTXB 3F7YB 3H7LA 4PJCB 4R2GC 2AJVL 4KY1H 3IJSB 4ERSH 3W5NA 4GFTB 3ALPA 4TTGA 5FA4A 4I9WE 3A6CH 5HHMD 1MHEA 2KUTA 3CU7A 3ULUF 1KT2B 3QXVA 2QL1A 4ACPA 4AJ0A 2HRLA 4MSWA 4NKMA 6FABL 2Y25A 5L2KE 4G6ML 3V6ZA 2XNAA 5IB1A 2VDKH 3B2UD 3VD5A 1BEYL 1OL0A 3VFOA 3FFCE 4RGNB 5CSGA 1EXUB 5BRZB 5I19H 5KVGH 1RVFH 4YQXH 4DQOH 3ARBC 4XPTH 1RQ5A 5BS0D 4P2QB 5F1IA 3UPRA 3QUKA 4IMLB 2ZUUA 4LLQA 4XP9H 3U4EB 5EOTA 3GBLA 2LTQB 3GMQA 3CSYB 5F8RC 4MDIB 4ONGH 4TUKH 3TEUA 5GSVB 3NCMA 1JZ3A 2IQAA 4L4TD 4Z7UB 1WAAE 4HJJL 1N7ML 5D93C 4ZS7H 4R90L 4PRIA 4WI4A 1RURH 3BZ4A 2H32A 3RWFB 3MZTA 3BEWB 4M1DH 1VHPA 3SO5A 2VITA 4OUUB 4JN1H 2AXHA 5HPMB 3G04A 3G5VA 5C7XL 2G60L 2EDBA 3BE1L 4O2FB 2OP4L 3DVNB 5EB9A 4UT9H 5AEAA 2P5WD 3C5ZA 3LQAC 2G75A 1MFEH 5EU3B 3TWCH 3QEGL 4HSQA 1HCFX 3IB4A 5F89A 5ACMA 3B9KB 3RU8H 1CK0L 1NUFA 2DQHH 3EOTL 4ZSOB 4XCNA 2GAZB 5GZNC 1GOFA 4GLRI 5L9DL 1BIIA 4LEOA 2NY2C 3MRJA 4V1DB 5I1KH 3OKDB 1Y6NR 4ZUSB 3WN5C 3WHXB 3ZTJH 4HZLA 4PJGA 2R2EA 3P30H 4TNWF 3HNSH 3PWVA 1FORL 3CVHA 5LAXB 3PL6B 1GIGL 4JAMA 2NY4B 4ODXB 3AMKA 2F54B 3GMOB 4YDLC 1FZKA 4K3EL 1T89A 4A6YB 1KPRB 4NM4H 5DF0A 1KFAL 2CK2A 3KPPB 5KSUA 1AH1A 2XN9D 15C8L 4MQ7B 3WUWA 3MV8A 1OWWA 2IBZX 1BQLL 1C5DA 4WEBH 3KPTA 3UDWC 5CCKL 4PJIF 5ID0A 1JHLL 5E2VH 3WS3A 3FFDB 3NFPA 12E8H 3K46A 1BLNB 4CBPA 1WZ1H 4H1LB 4PPTA 1DVFB 5KSVB 1HKFA 5F6HI 5DFVD 5F9AC 1DE4A 1IM9A 1NSNH 2H2PD 1ES0A 1B6UA 3DX9B 1KCSL 4HUKB 3WFDL 3DHJA 3WV0A 4EUPB 1HIMH 2P4AB 1RZFH 1D5MB 3QULA 4D0DB 1YNKL 2EKSB 4Z5RA 3O0RH 4KROC 4TSCL 1VA9A 1G0DA 3KPRB 4LRIA 3U46B 3O2WL 4NKIH 4N0RA 4ZO7A 4Z0XB 1NUNB 2V7NA 5EWIH 4H26A 4X9HA 1IARB 3HI6H 1G7JA 5I1HH 5CJQL 2IH3A 3T0XA 2N7BA 2DI7A 3BP6A 1ZVSB 4ZFZB 4J4PA 4ZODA 4I5BA 5BZWB 4PRIE 3O3EA 3RHWK 1W72A 3VXQB 3WFEH 4HPOH 1HILB 3EO1A 3MO1A 3D69A 2CRZA 3ZE2E 4G6JL 3GSQB 3V5KA 5ALCH 1EFXB 4R4BA 1RZKL 1TPXB 4U0QB 2FJFB 2X4SA 2FHCA 4X5WA 3SE3C 5KOMC 2PR4H 2CDFB 4I18A 3QNYA 4I0PB 3EO0B 3LN4A 5DO2D 1T04B 5HDLA 1NAMH 1NL0L 1GAFL 5F7EL 3RTQD 1OLZA 3ZMRA 5F7YC 3CX5J 1JK8A 4LLWA 5FKAA 1BOGB 4JHZA 3STLA 1Y0LA 4S0SD 4N68A 5JO5B 4U6HB 5DXWA 5EBLA 3OKNB 1HXMB 5CFHA 1DQDL 4N90D 4K7FB 2AKRB 2DLTA 2A1WL 2BOCA 3GI9L 5F71A 3ZKSD 3PHSA 4DCQB 5KVFH 5DUBA 1NMCB 2OTUA 4OZGB 1MY5A 4EN3B 1U8NA 4PJFE 3QFDA 1TTGA 1UB5A 2D7QA 3EYVB 1QRNB 4N8CL 5LXGH 3WSQL 1T21A 5EA0H 1SEBB 2BHZA 5GRJL 4JZNA 4F7EB 4OF5A 5SWSA 4L8DA 2YUVA 5DLML 1Q9OB 3DUHA 2I5YH 4GRLA 4KJWC 3KPOB 5B38A 1U3HD 5C0CB 1T89C 1U8JB 4LMQE 3UYRL 3D6GA 4JKWA 4KQ3H 3QUMA 4Z8FL 1A14H 4ELKB 1N64H 1HHIB 2NY0D 2Y23A 4YR6B 3T8XA 4X5XB 5T1LD 5I6XC 1KUMA 1NBYB 1U8PA 1NCUA 1T2JA 1A1NA 1B3JA 2Z91B 1EMTH 5HDQH 4WU5A 3IRZA 2HLFD 5CD3B 3V5DA 4XP5H 2VL5B 5EA0L 4G8EA 1KPVB 3D39B 3ESVF 4KK5C 1CGVA 4OM0L 1A6PA 2BCKA 3QUML 3GMQB 1T0NA 1ORSA 5SWSD 5L0QC 4Z95L 4UTAH 4GAYB 1PAMA 4ZPVB 3EYQC 4L8CA 3HI5H 1CFQA 4GAJL 5JW3L 2VITB 1X5ZA 1I1RA 1KLGA 5IKCB 3DX6A 3KXFD 1JPTH 4XGZB 4Y19B 1MQKL 4G8IA 2YKLH 4OV6F 4JN2B 2VXSL 3NGBB 3WFCL 4UT6H 4YBQC 2Q3ZA 4JDTL 1G6RH 4ZAKA 4ZXBA 1HDMB 4LBEA 3KGRA 3GB7B 2ILLA 4QTIL 3DX8A 4UV7L 5CINL 2FEEL 5JXED 2JJVA 4PJBB 4H8WL 4JQXA 3V4UL 4P5MB 4LU5H 3VCLA 4JREC 4LSSL 3WHE0 1O7SA 1P69B 1IVLA 1SQ2N 4HK0B 4NQVA 5HXMA 3PWPD 4X6DF 4FFWD 3SE9L 5J12B 5JPMB 4B0MM 1DN2A 1D7FA 5GGVY 3FRPG 3PWVB 4DOHE 4B5EA 2AJ3B 3TFKC 3HR5A 4KV5E 4WHCA 3UTTB 2W65A 2VLRE 3BKJL 3MBEA 4Q9QL 5E5UB 3WIFB 3VFRB 4NQCE 4N8VA 8FABA 2HKFL 4PV8A 3OKKB 4KPHH 3MA7B 1I1YA 4MJ5B 3WKML 4U1KA 4RWHA 3VWKA 3F5WB 3H9SA 3OR6B 3QEUA 3JXAA 4XX1G 4NKDB 3RA7L 2FL5A 4FQ1L 1JV5B 1VFAA 4QHLB 3FT3A 2EECA 2C3WA 4WUKL 5I1AA 5HYJA 3DRTA 4NQXA 1QBBA 1JNLL 5CUSH 1JFQL 4Y4HB 2J5LB 4PTTB 4BQ9A 1JZ6A 2YC1B 3VGHA 4P99A 3MGOA 4LAJH 3QDMA 4QRSA 5ICYB 4EI5D 5C0AA 4NQDB 4JKLA 3BD3A 4NQEE 5TQ0L 4QRRD 4UOW0 3FB7A 4XBPA 5TE6L 2BVYA 5JXEC 1NGQH 1FYTD 1JVKA 4XX1E 2JJWA 4OD3L 2J8OA 4K71B 4RFEB 1FL6A 4N0FB 5T3XD 3SKJL 1NMBL 1OTTD 4NOBA 2ITCA 4XVSL 3V52L 3RKDD 1BECA 3FRPA 4NRYA 1JZ4A 4OLWH 1MFCH 4HK3J 4D9QE 2ADIA 3C60A 5CHNA 4WWKA 3FT2A 4IRSC 2EYTA 4RWYH 3VFVB 4UT7L 1R3KA 1JGEA 5E0QA 4GMSH 3LQZB 5L6YL 1B4JL 4YHPA 2YK1L 3HA0A 1E4KA 1WEJH 1OP3K 5ISZB 1T7XA 3L95B 1KULA 4DKEL 1NMBH 2BVOA 2XACC 3QP3A 4LQFH 1NGZA 3QPXL 5B8CC 4G6KL 5J6HA 1KCKA 3HI1A 3QIBC 4Y2DC 1QR1B 2QSCL 4GT7A 5FM8A 3EO0A 3LN4B 3NA4A 4HGKC 1XR9B 3KLAB 1FLTX 4TULL 1CGSH 2DQTH 2AJXL 1F97A 4KKBD 3Q6FA 5DJYB 4EOWH 3SDAD 3W9DB 4H5SB 2R69L 3CIQA 4MJ4A 2MCPH 1U93B 4JKPH 3GJFH 3LAFA 1A47A 1AE6H 1IAIL 3MBXH 3V4PL 1PGRB 4L3AA 5DSCB 2VSDA 3EZJB 3JSSA 3O41A 5GGRA 4YHIB 1BD2B 1AR1D 5C0BE 5FM5M 4G43A 2P46B 1QLFA 3CFBA 3HRPA 4ZS7L 1YUHB 4WFHE 2ZP0T 4Y5XA 4LPCA 1YEKH 2FRGP 4ELMA 1SM3H 3QT2A 2MWCA 3W81A 3RIAF 4I2XB 4PGBA 3U4EA 3OGOE 4GLRH 1RVFL 3OJDA 1H3VA 3SDXB 4N1HB 2A77L 1O7VA 1DSFL 1QBAA 2P5EE 1S7QA 5TGBA 1KT2A 2E7CA 3IETA 3O4OB 2FNBA 1QLRB 1I3UA 3H6JA 4PG2A 1KGCD 5F1NB 3PGDB 3HZVB 1W0VB 2KQNA 4U3CA 3MRQA 5I30H 3RPKA 4LSQL 3C2AL 3F58H 3UJTH 1JTTA 2R1WA 1MRDL 2X70A 3KPNB 4PB9L 5DD6B 4XPHL 3OG6B 5TF1H 3HNVL 3TJEL 3L5XL 3X13B 5MEQA 3KVQA 2BVPB 1K2DA 2ZKHH 5EOTB 1MFDL 4ZD3L 4BQCA 2Y4SA 3N9GH 1P7QA 3AC0A 1RZJL 4AQ1B 4I18C 3VXSB 3VXNB 4Z7UA 2GY7B 5BVPH 2GTWA 1M7XA 3B2UC 3GSOA 4CNIB 4L8CB 1MF2H 2GAZA 2IANB 2NY7H 1ZK9A 4F58L 1EPFA 5IIEB 2AABH 2BFVH 1Z9SA 3L5HA 2NNAB 4HFWA 3GBML 1S7UA 5C2BH 4HZLB 5A2KH 1N0LA 2VDNH 3VFMB 4BH8B 4PG9A 1PQZA 3L9RA 3MJ9L 3DVFA 3UTQA 3GSVB 2ZUYA 3QO1A 4P46A 1IC4L 4HIEB 3JWDC 4NHCL 2JE8A 3C5ZB 3ZT5A 3MRDB 4GG6E 3HMXH 1TNNA 3JV0A 3RI5F 2I60H 3Q1SL 3FAWA 4M61B 3WFHA 5L0QB 1I1FB 1T5WB 4V1DE 2GY5A 3AAZA 4IS6B 3MCKB 3ZDYE 1J18A 2XG5A 4KK8C 5EU6D 1HSAB 3G08B 4HIHA 1AD0A 1WBYB 4AEFA 2IPKB 1FNAA 1FVCA 3FFDA 4JG0L 3F7QA 3N85H 3O3BA 3L3OA 4PJGB 5GRJH 4LFHG 2CIKB 3QIUC 3MBEB 3FN0H 4XMLL 1JUFB 3HKFA 4XNZB 1IGYB 1A7QL 4W4NA 4N8PA 3NFSH 1HEZA 1I1AA 1JHTB 2J6EA 1WQVT 1NFKA 1OSZA 1UZ6E 4QRPE 3PABB 1ITBB 3R1GH 3S96B 3U46A 1C5BH 3W2DH 3ARDD 3KYAA 2B5IC 1C5CL 1A7PH 1WTGT 3F58L 4MD4A 3UYPA 4QEGA 3FHQA 1S7SB 3V7AE 1H8NA 1SYVA 3BQUD 3QQ9C 1T1XB 4CUCA 1YYMH 5IBTL 3BQUA 4M93C 1ZVYA 1NCWL 2HVKA 4OLUH 1A5FH 2LU7A 1FNGA 4ELME 2HYMA 1GAFH 1YN6B 4NQDA 4LSUL 3D9AL 5FECB 5MEND 4XPFL 3DIFB 5I1LA 1U58A 5DWUH 3DLQR 5A43C 1RI8A 1FNLA 4CW1A 2FJFA 3UTSD 2MQ3A 2ZOKA 3LRSA 3OQ3B 5SX5K 5CEZD 3MOBL 3LSOB 3NPSC 5HI5C 1BWWA 4DWHA 3HHRB 1HWHB 3ULSA 4Y1AD 2YD6A 4YNYA 4DUVA 5F9OL 2XIDA 3NPZB 3F6LA 4H25A 5GZND 3CPLB 5KZCB 4K94L 2A9MH 2AXFA 4LASH 1P2CB 1OT1A 1UJ3C 2WLZA 4JGUA 3L3IA 1F3DH 3I85A 3L5IA 3UROR 3MFFB 3O6MH 3BHBB 4D0BB 5I16A 4Z7VA 3H3KA 2BSSB 1FH5L 1ZHKB 1RHHB 5E2TH 1VGEL 4DGIL 1EFXA 3AREB 2GTZB 2O5XL 3BQUC 3QQ9D 1ORQB 5DI8B 5DMYA 4P46D 3QUZA 2A6JB 1DANU 2W91A 2Y07L 4PYHA 4MAYC 3U7YL 1UB5B 3RVWC 3BP4A 5DJ2B 4HWZB 3O3UN 4JFDA 5L2KB 5SWSB 1BZ9A 1DQJA 5CD5C 5D2LF 1KIRB 4HEPG 5IK3B 4FQIH 3S5LB 4G5ZL 4NC1E 4Z7VF 3WXVH 4A6YL 1LE9A 1R0AL 1QLEL 1D5XA 3T3PE 4IRJA 5AD0A 2O5YL 3ZT6A 5K9OA 1IGIL 4MA1B 4JO2H 1RU9L 4XMPH 5DMGC 2Y06L 3BFOA 4KV5F 2D31A 1GGBH 2D3VA 1J11A 5EH1A 4OB5L 1FH5H 2BOBA 1ZA3A 5I76B 4KRNA 2DS4A 4P2QA 3O4LA 1P84K 4N9GA 3SKJH 1QZ1A 5A1AA 2EC9U 2EEDA 3D0LB 4PJAB 3U4BH 4QT5A 3TN0A 3F7PC 3ZTJG 1I8KA 2PXYC 3K1KC 4JZJB 5IVZB 4APQB 1SYSB 5B4MD 5TJWK 3RQ3A 3VG0H 1A7OL 3CX2A 2NX5B 4JFHE 3B3IB 2ORBL 3JTTA 1P6AB 3MLSH 5C0GB 4UOW1 3N1MC 1MIMH 4WU5B 4K23H 1PVHA 2EDWA 1AJ7L 1HOCB 3ZHKA 3BE1H 3O6FC 3QA3A 4O58L 3RZCC 5DWUL 1QACA 2RHEA 1VADB 3TYGL 4YC2C 5MENB 5EU7C 4G8GA 1Q9LB 3MUJA 4EQ2A 2HKFH 4P0DA 3HAEB 1BIIB 1NCCL 2H41A 1HZHH 3QUXC 1FO0B 4MXWH 2VUYA 2DQCH 5ITFB 4PGCB 1NC2B 3IFNH 3N1QC 1N26A 4XBGB 3FZUC 3VE0B 4JKMA 4MZ3A 1AXTL 4P3WA 1CLYH 3QIUD 1J12A 3KLHC 2WBJB 3SPVA 4G9DA 2J8UA 2VLLA 1XH3A 4EVNA 3FL7A 5DJCB 3H9SB 1XGPA 3OR6A 1QA9B 1OT2A 1TVBB 4MQTB 1MHHA 3OR7B 4HFUH 4NOFA 5AZEL 4XMLH 1T1WA 3MV8B 3EJZD 4MJIE 4X9FA 1G7HB 2PW2A 4UTBH 1YJDL 1AD0B 4HJ0C 5D96B 1R3JB 4IEFB 1OTUC 4WO4B 5AG8A 5KSBE 3EOBB 1FVCB 3CFCL 4WI3A 4G42A 4MA1C 3BKYL 1VFBA 5JOFB 3DMMC 2J6EL 1HHJB 5D1XD 4KHXL 3MGOB 1QSEB 1KCUH 3FB8A 4QRQA 5EU5A 2VAAB 5EU4A 5D7SH 2JELL 4XC1H 3EBAA 3BPOB 3NOIA 4XVTH 1T7ZA 1EA9C 7FABL 2QV2A 4N8VB 3UC0H 5IMOB 3WFBL 4PRDA 1BQHB 3LN5B 4GSDL 3WBDA 3EKCA 3TA3B 3C9NA 4P5TD 3QRGH 1U8QA 2CMRL 2GJ6A 4NBYB 4YXLH 4EI5B 3QUMH 5B3JF 1ZOXA 4Y1AE 1A3QA 1CCZA 1OOAA 5HHME 3GEWB 1BM3L 1S5HB 1WK0A 5FO7B 3TVMB 3WCYA 1UM5H 3MV7B 4XMKH 2IALB 4Y4HA 5C08B 3SDDB 5CHNB 3IKCB 3HS0B 4WWID 4OLVL 4GXUM 4JJ5A 2WWMD 4M62L 3QDMB 4F58H 3O45B 2YPKB 1ROWA 3GSRB 3MJ9A 1OARH 4ODTL 1RZGB 2BSED 3REWA 3S37H 4K7PY 3GIVB 3LQZA 3RWGA 3B8SA 5ERWA 2FH6A 4ZD3H 4DW2H 4OM1H 1IC5L 3FT4B 5DD1L 2OZ4H 4C83A 4PJAF 2I5YL 3O8XB 3R06B 1H3GA 2EE6A 4WFGD 3PV6B 1MRDH 4LSTL 1I3GH 4X9BA 4CW1B 3T1WA 1KJVB 1RZKC 2CK0H 4QWWC 4AEHL 1N5YH 3IFLH 2VZSA 3M45A 3OWEA 2XQBH 2V2XA 4TSBL 4JHWH 5CWSA 1NUGA 3IU4L 4WWKB 1YEEL 1OF2B 5I1GL 4BQBA 1DQLL 5IVXE 1T1YB 5LCVL 5F8QC 4KUCD 1FYTA 5GJSL 3HC3L 3TBVB 2A1WH 1P2CA 4FFYL 1Y0LB 5D71H 1CG9A 2HT4D 3P9MA 3FONA 2Z4QA 4PJCF 5JXEA 4Z7VB 4MXWL 4HW6A 3QJFB 4J6RH 5GPRA 1LK2B 4MLIA 2ZUQC 1WC7B 1JGDB 4ZXBC 2OK0H 5D72H 3DYOA 3HMWL 3OB0K 1ORQA 2JF1A 3EO9L 4NJ9L 4YPGB 4OF3A 4CVWA 3B83A 5DUPH 5GGUA 1KTDB 2PR4L 4WUUE 3JV5A 4Z7QF 5IOPB 2C3VA 1MELA 2DLHA 2P8LA 2QQNH 2DJ4A 4ODWB 2EXYC 4IOSD 2I07B 1TETH 2V2WA 1QBLL 4OFDA 4UOJA 1F4XL 3QG6A 1VESA 3M17B 4WUUB 3EOYG 5IHBA 4RZCB 1J0JA 1CL7I 5KBNC 3MACH 1YEFL 2RFXB 4MJ6B 3TF7C 1QLRA 4J3OC 5EOQL 2DQTL 3MBEC 5EO9B 4UAOB 4OGAD 1RIVH 2VWEC 5JORB 3BIKA 4NZUH 2N7AA 3PWPA 4JDZB 4LHUD 4FFZH 3RBSA 3VGFA 2BY1A 1LO3L 4N0YL 3UP1A 5F7DA 4NNPH 1EEYA 5DHVB 1MH5B 3ARGD 3SOBH 5I15L 2X6MA 4XB8A 5INDA 4ELMB 4K7PX 4G8EB 3L6FB 1P4IL 4JPIA 1V3MA 1ORSB 5L6YH 3BGAA 4XMPL 3X14A 5HYQB 3MRMB 1IL1B 2QQKL 4R7DA 5HI3C 3P4NA 3JV6B 3BESR 4EUPG 5EUOE 2PTTB 3H0TA 4FQQB 3CH1A 4OZHB 4XGZA 5BO1L 3SDXF 5KJRL 3DVGA 3RUGE 1C12A 3ULUC 1MLCA 5D1QB 3PGDA 4W70A 4HULB 4KKLD 4G6AC 4JN2A 2R8SH 4ZUVB 5JIHA 4FQIL 5JOPD 4G9FD 2XICA 2Q6WA 4BK4A 5DD6A 4HIEA 4QYOA 1T20A 2NXZD 5DFVC 5GIRB 1Q72H 3I50H 4PJGE 1YC8A 4TOYH 4QCIB 4Z18A 35C8H 5DC0A 4OTXH 1EERB 2E7MA 4FABL 5IW6A 4FXGB 1NFIA 5CEXB 5JHLL 5GGSB 1I4FB 1DN0B 4PGEA 1T0MA 3LN9A 4PJBA 4H0HB 3HZMB 2GK2A 4DGIH 1JWUA 4L4TE 2E9JA 4MA3B 4ZG1A 3LQMA 3JV4A 5DQJA 5D93B 1G7PB 3LQAL 3ET9F 2NNAA 3KXFB 4MVBC 4M4RA 1MJJA 3ARGA 5GS2H 3LDBB 3MUY1 3PP4L 3BW9B 4KI5D 3SE3A 4YDIH 3VFMA 3X3GL 3AXLB 3RWCA 4EBQH 4OCYL 2KZWA 2DQIL 3G6JF 1I7UA 4AIZB 2BX5A 5JDSA 5L9DH 5HVWA 1K8DA 1KTRL 1RSFA 4H88H 3GJFA 5IP4A 4GRLC 2AK4B 1HXYA 2D7MA 3ARPA 1AGBB 3QJHB 1P9MC 1AO7B 5KVEL 1A7RH 4X7DC 4Q9QH 5CILL 5DVKA 1T0PB 1UC6A 2CKBH 3ZZ1A 5FB8A 3G6JB 3FMGL 3E6HA 1QSEA 2NY5L 3FB8B 4D9QD 4JE4B 1RZ8A 3PJSA 5IUSA 1OD9A 4JPVL 5DRNB 2VXVL 1RIHL 2P7TA 2ZSVB 5FUCE 2EDJA 1GH7A 3D3VD 4GRWE 3AS1A 1YYLH 2BNQE 2YHGA 4HS8L 3LKSB 4LLUA 2J5LC 4LPVA 1KACB 4GQ9H 4HIJB 4UDUB 3P9LA 4YWGL 3TVMA 3CDFA 1PYWB 3SDDA 3G5YB 2YKLL 2ZNXA 3BDBA 1SYVB 3R0MA 2ADIB 1AP2B 1T22A 3FCTA 3IDJB 1JPTL 4PRBB 3ELAT 2EYTB 5D6CA 4LHUB 2PYED 1MOEA 2OR8A 5T1LB 4QXTA 3KJ6H 1CYGA 3EW3B 3VA6A 3BDYH 1P9MA 3SDCC 3J7HA 4JHWL 3HZYB 4WDIB 2UZIL 1CFBA 3BIBX 3X11A 4OM0H 3S36L 2BC4B 2GQHA 1RK1B 4O51A 5C0BB 3C8KA 2BSRB 4HC1A 1R5WA 1I3GL 3KNBB 3UXFA 1U3YA 2VXTH 1ZHBB 3QHFH 2APBA 4BH7B 1IEHA 2EIDA 3QDJB 1CS6A 5CWSB 3RNKA 2R2BB 1GYAA 4M48H 3CDGB 3DSFH 3Q1SH 3E3QC 5DRZB 5H2BB 1A14L 1YEIH 4XT1C 1J7VR 2C3GA 4H25B 1OSPH 4UQ3A 4GOSA 1OP3H 3RVTC 2QSTA 2QQLH 5C0DB 4P5KA 5D1QC 1P4LA 1X9QA 4HX1B 4RAHA 4CADB 5IWLC 5BV7C 3WMSA 2NXZB 2E9BA 1UG9A 3MRGA 2DQJL 3B6SB 3T0EE 3B9EA 1HHGB 4L4VB 3BP5A 4J23A 1U3JA 2AJSH 1Z5LB 4M6OL 4I4WB 4FXKA 2P5WA 3C5ZD 2V5SA 1SY6L 4CN6A 1LK3H 5GGUB 2Z93A 5I17A 1RZJH 3E3QE 2EDQA 1JZ2A 3NAAH 2D31B 3NN8A 2XN9A 4P59L 2W9LA 5SWSE 4X8JB 4YBQD 4AL8L 4KK9D 4NDMB 4LCIH 4ETQA 2J6EH 4JFPB 3OJDB 5CKGA 1YNTB 5E8DL 1KN4H 2OQJA 1OGTB 2ICWI 5TH2B 5CEZE 4O4YH 3IETB 5DQDL 1SJEA 5AYUL 1LEKA 4QOKD 1QP1A 3G5ZB 2DWEB 1LO2H 4KTEH 3H9HB 3P0YH 5JQ6H 5F1NA 2C1OB 3RY5A 5JIKA 1A6UH 4PJ5E 2X1QA 3KPQB 1AXTH 1YQ2A 4DN4L 4KH2A 1AQDA 3PHOA 4X9GA 3CLEL 1MJUL 3ARED 2A6KB 3X13A 5MEQB 5IB5B 2YPVH 5GSVA 1Z9LA 2IQAB 2DQCL 1NDMB 2N1KA 4I8DA 4JZJA 4ZNEA 4HQQH 2ZUQB 3BPLC 4DVBA 4F3FA 1T03L 5HPMA 1FL3B 2MSPA 4MNHA 3LH2L 3TZVB 1MLCB 3MODL 4R8WH 1S9VB 5C3LD 5I2IB 3U0PA 1DVFD 5D7JA 1W0VA 5DTFB 4ZFGH 1FNSH 4NQCB 2VSCA 2R1WB 2DKSA 2EDXA 3UTSB 2BVEA 4KI5E 4LK4A 3BI9X 4ORZC 4R0LC 3MRDA 5E8OA 2AJXH 4U1NB 2Z8VC 4PY7B 1FZOB 3AROA 2NY5C 2DTMH 2B1HL 2ORBH 4UB0L 2ZOLB 1TPXC 4O02L 1P4BL 2PW2B 2G2RA 1UXWA 4P2QD 3DUUB 2PYEA 3E8UL 1FE8L 3BISA 1JHLH 5E2VL 1CFTB 1ZT7A 1FZJA 2XTJD 4NN5B 1KELL 2YD9A 4RQQB 1PLGH 4URTB 5F6IB 5EU5B 3BRFA 5C8JA 4BH8A 4HKBA 4X4XB 3UBXA 1E4JA 5JDSB 2W92A 3GMOA 4UI2A 3A0OA 2GUOA 5EN2A 2QJDA 3MJGX 1CLOL 5DJZA 1MI5B 2FHFA 2Y06H 4A6YA 3I2CL 3WKNA 3BD4A 3WXWL 1MCKA 3KJ4B 3BWAA 4EI5A 2HH0L 1F11B 1QFUL 3D3VA 4NC2B 5CJBA 1FORH 5LWYH 4YBLC 5EO0A 4X7SH 4Y7MA 5FO7A 2BMKA 4CDGC 1FV1A 1T5XB 4JFEE 2VQUA 4OFYA 4YLQT 3E6FA 2YZ8A 1CTNA 3GBNH 3MNZB 2VAAA 3GSRA 1M05B 3CVHL 4CMHB 3MRNA 2R9HC 5IMOA 1X5XA 1DVFC 1KN2L 2DTML 4YEEA 3P4LA 2B4CL 1R24A 2VTFA 3TWCL 1WCBA 1U8QB 2X2YA 4UDTB 1CI5A 1YY8B 2PYEE 4XNXH 4OBRA 1HNFA 2P5EA 2Z35B 4RAVB 1ZT4B 1IJ9A 2FIRT 5C0CE 3RX7A 5ALBL 1I8IB 2FJGB 3FOMB 2A9ML 5IHZB 2VMFA 1T1XA 3LS5H 4UIKH 3DUSB 3GMNB 4FQHB 4P5TC 4X99A 1OAQH 4WY7L 5T1DH 1XGUB 3P73A 1GGYA 3PL6C 3BKJH 2JLLA 1EVTC 4I3RH 1CD1A 2FZ3A 4L8SB 2BC4A 2D2OA 1V8HA 5F97E 5SX5H 3UMTA 4QHKI 1ZHKA 5TF0A 1F3RB 3QDGD 3P0YL 1TZGH 3CFEB 4WI9A 1U3ZA 1KLUA 3ZKQD 4FQCH 5KW9H 2EC8A 3MJ7B 2AW2A 2XKNB 1MHCA 1EVUA 1P1ZA 3V0AC 5KTEH 1AD9B 2VDOL 3QI9A 2I24N 1FGNL 4WJ5B 1KN4L 1IQDB 3A6CL 4HX1A 1IC7L 4CADA 1UKSA 4ZS6C 3P2TA 4JY4B 4B50A 1A9EA 2YRZA 1FNHA 1I8MA 2P5WE 5IVXA 3WNPA 5HGDB 4GAJH 2X10A 3X17A 1L7TH 4K94C 2NY0C 3MRBB 4CVZB 2NX5D 4BFEA 2X42A 4Z95H 3P0VH 2F8OA 3BP4B 3BVNB 4UNVA 2F8XC 3RGVD 3EUUA 3CZFA 3IJYB 4M1GL 2XWTB 4OJFH 1X5KA 3FN0L 2BJMH 3EDFA 4DFHA 3T08A 1A8JH 3QR2A 4HJGA 1T1ZB 1CIDA 4GRLD 5DHYB 2EDRA 5CZVH 4Z7OE 2PXYA 5HHVL 4B53A 1TJGL 5FA4B 1I1CA 4JO1H 7CGTA 1CTOA 4RZCA 1I8KB 1IL1A 1OAUH 1H15B 2FJHB 4GG6F 4NYLA 3LKOA 3GKZA 3K4DA 1YNLH 1CLZH 1A64A 1ACZA 1FZMA 1J87A 2MFNA 1MCOL 4KZDL 4Z8FH 4D0CA 1FAIH 4NN5C 3B3IA 1C12B 1I7TA 4PD4K 3VFOB 4YHKH 1BJ8A 3UYRH 4X98A 1EEYB 5DHVA 2ENYA 1U8HA 3V6OA 1MFBL 3S8WA 3QYCA 1DBKH 2X4TB 1WT5C 3MJ9H 3QXAA 4X7CC 5GIRA 4Z76B 4I1NB 1W0WA 4MB5A 1Y18B 3QWQB 5EC1A 4EIZC 2ESVB 5CSZA 1PKQB 3EJJX 4OCWH 5T1MB 4E42B 1WCQA 3FQRB 4QHUA 1MFNA 1B0GB 4AG4L 3BEWA 3UTOA 5IKCA 4LEOB 2NY7L 1SMAA 4ZQKA 5IFAH 2CLVA 3QNXB 4O2EA 4LPTA 3VD3A 1FL3A 5DQJB 4Q6YA 1RUAH 3RP1A 4R26H 1DQDH 1JGUL 2VAJA 4NFDA 3TBYA 4M6NH 1AFVH 4YHLH 3R8QA 4RFOL 3RZCB 4FP8L 4DZBB 1IGML 3TJEH 4WHDA 4AIZA 3UJTL 3LHPL 1CICB 1WFTA 3BH9A 3DXAA 5I30L 1C08B 4PRNB 4L8SC 3G6DL 3O3DA 4B7IA 5K9JL 1YYLL 1KCVH 1H3XA 1RJZA 4FQXC 1T4KA 2NW3B 1L6ZA 1YJDC 3CC5B 1RZKH 3QZWG 5F1KC 1N8ZB 2IMNA 4JZJC 3V4VL 4FP8H 5EZJA 1CD9B 2P47B 2FX9L 1ACYL 1JPGA 2WLYA 4M6NL 4YHLL 5LGJB 4KHTH 4R26L 4ZUWA 3TV3H 4Y4HD 1NBVH 1DEDA 2H9GB 5D2NE 1YEKL 3MA9H 4XRCB 5DJDA 1HYSC 2VLRB 3TP4A 1NGYA 2HTLD 1IAIM 1YN7A 4S1DD 2WBJD 4NKDA 1N2RB 2GJ6D 3L3HA 3GKWL 3S4SA 4DUWA 2E8YA 1MCBA 3OKLB 3T77A 3JVGA 4XZUB 4XTRC 4FG6D 3X3GH 4L3EA 1PG7H 4IOIA 1G7IA 5HHPB 2DD8L 4HD9A 4JFXB 4Q0XL 3NFPB 4HH9A 4AYFA 2X4PB 4M7JL 3U0WL 3ZKNC 1T6VN 2IH1B 1XF3B 3HG1D 5EU4B 1NFDE 4KZDH 4X6BB 4L9DA 3RL1B 1CLZL 1NSNL 3I9GL 3IDUA 2VDML 5JHLH 2E3VA 1WIPA 2QSCH 4LOUC 4EZMA 3HZYA 4WDIA 1D5MA 4UDTA 4XBEH 4TOYL 4XAKE 1HILA 3DURB 2RGSA 4ENED 3QIWB 4KWUA 1X7QA 4JPKL 1NCBH 1ZA6B 2FATH 2R1XA 5KZCD 2RCSH 1SJHB 5CCKH 1A3RH 5DEFB 4J3SA 4LIQL 5A3ID 4FTVB 1WLHA 3CMOL 5IWLA 3S35X 1UJ3B 1IM3A 5GGRY 4W68A 1G7JB 2Y36L 2EXYD 1VFOA 1L7TL 1TCRA 3SGDH 3AFLA 4OFPA 1P53A 1Q0YL 3S34L 5FYKE 4CJ1A 4P5TA 5EOCJ 2IAMD 5GS0L 5FUOH 4PJ7A 5JW4M 5JA9A 3MRFB 3REVA 4Z77B 4CAGA 3RUGA 2CXKA 1AR1C 1E4WL 3TBSA 1BBJB 1FGNH 4LVHC 4GAGH 4R4BB 4M5YL 3L5WB 4OF8A 2NZ9C 4FQJH 2VJXA 4L29B 4GRMA 2X4SB 2OTUB 2R56H 3QCTH 2I9LB 4PYGA 5J6GA 2P45B 3GNML 2HT2C 3AY4C 4ZO9A 4PJHF 1YA5A 1P1ZB 2WM0A 5KS9F 1I75A 1N6QH 4GKNB 1KENH 1UM6L 3WLWC 2HG5A 3SKNB 4HUUA 5FCUL 3TBVA 1Z3GL 4MAYD 4IOFC 1UA6H 1JFQH 4GS7B 1A7BA 4YFEA 3QBTB 4J1UA 4WTWA 3VWKD 1YEDA 1CN4A 3D85A 3HZKB 3U6RB 5JW4N 3T8XB 2W0FB 4ISVB 3V0VA 4EXPX 2X4OB 4U1IB 5JORA 2DWEA 4DEPB 1A4JA 3MCLL 1FJ1B 4NQCD 2Z93B 2OMNA 4P2RD 3KPSD 3HRZB 2EIZA 3LPFA 5D1QD 4WCYL 4HIXL 3HLAA 4R3SB 4DFIA 3LCYA 2W9EH 4G8GD 3NIDF 4JY5H 2J7LA 4I2XA 3QUKB 5K9KA 4XPTL 4Y5YA 2I9TB 1CDYA 5E1HB 5KS9A 1JMZA 3DROA 5I19L 3I3BA 4C56A 4K3JH 4U7KA 5CIPB 1UVQA 1BEYH 4HBQA 3GSNL 3V6BR 3MFGB 1S5IH 1V7NH 2VZ3A 1U0QA 4NKOA 1QFWM 4Q2ZA 3TO2A 4OD2B 5I1GH 4KZEL 1CL7H 2YBRA 1DQML 4Y5XC 1A6AA 4FTVD 3SDAB 4K7PL 4AENA 1MLBA 4PRAB 3MRQB 3HC0A 3IAGC 3E2HC 1FG9C 4LCUB 3IFLL 5EPMA 2UUDK 1HNGA 1MH5A 2CK0L 1TLKA 4D3CL 2BSTB 1MCJA 3GB7A 3VFTA 1F8TL 5F7LB 4U6YA 1HQ4A 1FZOA 4KC3B 1DLHA 2WUBH 4L4JA 4O5LL 3EFFA 1HCVA 1I7ZA 3O4LD 1FVEA 4HUWB 3RWJA 4YGVA 5CP7B 3C5JA 3PL6D 1JF5A 2H32B 3RWFA 3VJ6B 3KPRE 4OCRH 4HG4K 2VZ1A 1BP3B 3NGBC 3PF2A 4XMKL 2VZVA 4ZUSA 2NYYD 3CVHB 4NN6C 5LAXA 4JHBA 3HAEG 4R6UA 3EYQD 4M43H 4MCZB 2PN5A 5HYIA 3UTSA 5DJZB 5GRUH 3VH8A 1K8DB 3IVKA 1F4AA 2R0WH 4JFFD 1NCAH 2B1HH 2W07A 3QEUB 4GSDH 1EO8L 5HYEA 5JW4R 1F2QA 1MIEL 4FNLL 3CC5A 1PBYA 2JELH 1R5VA 2YD1A 5FYJE 4DKFL 5LJYH 3BUYB 3HZMA 3EIFA 4NQEA 4PP1D 4UU9A 4MJIA 3ULVE 1NQBA 4JFZL 4N1CA 1RJYB 4KKNA 3CFCH 4KTYA 5JXAH 5J9PB 2P42B 1F4YH 1YMHB 2IGFH 4KGLA 5E2WH 3O6LL 3DI2B 3U1SL 1NLBL 3GMPB 5CGMA 1HSBA 1MVUB 3KPLB 4X6DB 6CGTA 3NCBB 4JAMB 4ODXA 1IRAY 1E6OL 1OAXH 5DS8B 1XEDA 1WWWX 3N06B 3F5WA 3SBWC 4NUGL 1FBIH 2HJLB 4WIQA 4LPYA 3MNWA 3GI9H 5KSUB 4POUB 5I1EL 5E24E 1MJUH 5CSBA 5EO0B 5F9WC 1RZ7L 2Z35A 1F13A 5IW1A 5I1EH 5SWZD 1D5IH 3EYSL 2AI0L 4NUGH 5F1SA 1PJ9A 3I6LD 1AP2A 1T22B 2VKXA 3FCTB 4M6MH 2B1AL 5H35B 1SJXA 1JBJA 3OF6D 3W82A 3RIFF 3RL1A 3VGGA 2Y72A 5E6ZA 1W72L 2Q76B 3BMWA 2VYRE 5DC4B 1Z2KA 5E8EB 1BF8A 4ONHB 2CO7B 4P2OD 2PO6A 5DYOA 2UWEF 3TNMB 3TT3H 5FM4A 5D5ME 4FOMA 4JREB 5ALCL 5FYJH 4HIJA 3CFDB 4R97B 4ZOEA 3LEYH 5DEFA 4AL8H 5EORL 4JDVB 2ZOKB 1E4XL 4NRXA 4PRHD 3L3DB 2AQ3A 4YE4L 3CNKA 3NAAL 3U9PL 2LAGB 3SCMC 4BFIB 1GXEA 2J4WH 3QNYB 2H8PA 1M7DB 2VLJE 2Z31C 3VFVA 5T3XH 1PG7W 3I3EA 3OPZH 4YDKH 1R3KB 3RVWD 1BVKB 5FXCH 4WJ5A 2X9YA 2R4RL 2CSPA 2VQ1A 1HQRB 1A3LH 4HPYH 5EBLB 4Z77A 1ZTXH 3WIIL 4YK4C 1QNZL 5IVXF 4PIRF 5GGRB 5IJKC 4XXCC 1P7QD 3K8LA 1HHGA 4L4VA 5IVXB 4WW1B 4G43B 1KF9B 5HDBF 4WHTB 1JWSB 3QHZH 3INUL 3V7MA 3IDXH 4RISH 1JI