3ZDZE

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 38
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE02
3RNKB 3T04D 3SQOL 3RAJH 1LDPH 2KH2B 4P5TA 5IVXF 1NMBH 3MGTB 3VXRB 4MQXD 4YHIA 3U7WH 5DXWA 5I1GL 4RGNC 1JHKH 4H0IA 1J05A 4ODTH 3CU1A 2BNUB 1IRAY 5J3HD 1CICD 1GYAA 4PLJD 1KIUA 4BK5A 3RNQB 3MJ9L 3Q6GL 1U8HA 2HT2D 3BI9X 4Y5XC 3RVTD 1WICA 5DD5L 3VXTA 1QPXA 4MMZC 3A67H 4GG6F 1JNNH 1R3LB 1FQ9C 4XB7A 2AABL 1MCWM 5DJYB 3MJ9A 3DX6B 2VQ1B 5E03A 5TDNA 3KHOA 2NX5A 1ZANL 3U6RB 1FORL 2AGJH 3MRJB 1MWAB 5E2JA 2Y1VA 3ELAT 5ACMA 3SDYL 4JGJA 1NFDB 2VDPL 4JFPA 2NY5L 2EXWD 2R0LL 1P84J 4HMEA 4KJYB 3FT3B 5GHWH 4QHUB 5F88B 2AXGB 1RUAL 2Q7NA 1G6RH 2X4UB 3CFBB 1EH9A 1KIRB 5KJRL 4PS4L 1DSFL 4XCNA 1OSPL 5FYKH 2OL3A 1QRND 3FB6B 1IL1A 2VR5A 4X6EA 5T5FL 3CXDH 3CSYB 4CDGC 3BDXA 4Y4FB 3QISA 2R2HB 1I1AD 1UG9A 5C0BA 3AM8A 4OLUH 4GRWF 1JF6A 3QG7L 5E2UH 4C56A 3BAEL 5HPMB 1UH2A 4ZFZA 3S3JA 1KNOB 4QO1A 4MNQB 3WYRA 2JLLA 3LIZL 1XH3A 4S1DC 1JGVL 1O5DT 3EJJX 2C4XA 3SQOH 1NMAL 5J8OA 4WWID 3E3QC 4HLZG 3VG9C 4CADA 4EUPA 1QBBA 4HWZB 2CLVB 4UAOC 4WVRA 4OV5A 1YQVL 1BQUA 1E4KA 1KENH 3CVHL 4TTDD 2F5AH 2EXYD 4NNYB 2GJ6B 4LASL 1MI5B 4TSAH 3QXTA 1Z0NA 3RGVC 1UYWH 2YPLA 4OFVA 5HD8D 4FA8A 4JGUA 4WO4A 4UIKL 1FZKB 2FEEL 3FT2B 1YC7A 3IFLL 4XPAH 5D7JB 3QIUD 5F89B 4M8QA 1ED3B 1OLLA 4PRPA 1OGTB 4KU1A 1EX0A 2AJZA 3BOVA 1OTUC 4A6YA 2NY4D 2RCSH 5CBEB 4WHYH 1NL0L 3QQ3A 1BFOA 3TJHD 4KZEL 5IUSA 3ZHKA 1I85C 4RAVB 3SHSA 2A77H 3BXNA 3WN5A 3LEYH 4CJ1A 1KB5L 3QHFL 35C8L 2DDQL 5HDBE 1FCCA 3T2NL 4KK8C 4LDLB 3TBWB 5F1OB 3LRGA 3QDJA 1OCWH 2A6IB 3BP6B 4W6XB 4EJ1C 3MV01 4ZYKA 3ZLQC 3W9EB 4KROB 5D7SL 1U8PA 1XF1A 1HKLH 2A73B 4Z7UE 2XRAH 5D72L 3ARFD 4AEHL 1H3TA 1A7QH 4Z7NF 1FC2D 4JZOB 2DAVA 2XA3A 3O9WC 5DJ0B 5EPMB 1MVFA 4GG6E 1S8DA 4HCRL 1WWAX 4Y1AD 2BVPB 1SM3H 2X4SA 3PWVA 5DHYA 5F70A 1U42A 4O2CA 5DHVB 1KJ2L 1UQSB 4L8CB 4GFTB 4UOJA 3RJQB 1ZHLB 1SBSL 2HVKA 1CVSC 4GMTH 4IOIA 3IXAB 4XAKE 2PTTA 2JE8A 4PP1D 4LSTH 4M8VA 3EYOB 5E2WH 1DVFA 1IAOB 5CSZB 5IIEB 3TT1H 5ID0A 3RX7A 3T2OA 2YPKB 3S37L 5F88A 1MI5D 1A8JH 3WL9B 1WITA 2IPUG 5FHAH 5DJCB 2AI0L 2OI9C 3LN9A 1NCTA 3SDAC 4WFGE 5B8CA 4K7PL 1S5HB 4PJFE 3MGTA 1DTUA 3B2VH 4NHCH 1RZ8A 4M1DL 3NGBB 3Q6FA 2FHBA 2NY1B 1HEZA 2RCSL 1MFAL 1G7IA 3CLEL 5DRZA 3I3DA 5TE6H 2F54E 4TNVK 3P30L 3N06B 3MLXH 1UM5H 1I8KB 3HC0A 3KPNA 1UJ3C 1LO5B 3RI5F 2EIZB 3DLQR 3MLYL 3VFTB 2Q6WA 1PEZA 3LN5A 3KPRA 4NKDB 5I1CL 1A21A 5HVWA 3RL2B 1B4RA 3B3IA 4Q7DA 1FVCB 5E5MB 1F4WH 2UZIH 3LS5L 3KLHD 1UEYA 1JPSL 5GS1C 4GRLC 4OLYH 4HH8A 12E8H 3IJSB 3L9RA 1MAKA 5C0CE 4HWEH 4NKMB 1DSFH 2IFFH 2JIXA 1FP5A 1F02I 3KXFE 1WCQA 4MDIA 1HQ4B 4PJ7B 4RNRB 4QGYA 4YPJA 4JGMA 5C07A 4J1UA 2ESVB 3ZZ1A 4XWGL 4L29A 5CJ5A 4OGAC 5K9KA 1AGDA 3KPQB 3VXUE 1KJ2H 5I1KL 3MRCB 5JDSB 3U30C 3VMPA 4WEUD 5EN2B 1UXWA 1MCOL 4UINL 5DVMA 1J1XH 2J3SA 1CYGA 3EO1A 4MSWA 2VABB 4X6BB 1YEGL 3E6HB 3MV7B 2IBBA 4P46B 3U7AA 2F58L 1D5XA 3NN8B 1IGML 4N0FB 5HHPB 5HDQL 2VAJA 2BK8A 3MJ6A 1U8MB 5KOMC 4JFDA 1X5IA 4UDUA 1HEZB 2AI0H 3TZVA 2JJWA 1WZKA 1EJ6A 3WNKA 2IADB 3O6KL 4YDLB 5EZJB 2OJZL 4N0UE 3PWNA 3X14A 4OT1H 5DUPH 4XMPL 5A16B 1OP5K 5EFIB 3MUJA 4NZUH 4ZO6A 2H3NB 5DZLA 1E4WL 5IT2H 5IK3B 2V5MA 3H7BB 2H32H 2LTQB 4N1CA 5J0BA 3BD5A 1QSED 1MQKH 2ITCB 3IB4A 4LLDA 3AXLB 1VESA 4PP2A 4ZTPH 1G7JB 1MCBA 5FYJL 4HDIB 3MUHL 3DVGA 3ZMRA 1H3XA 2A1WL 1WGOA 2Z8VC 4XPFH 2Q3ZA 3V6ZA 1HOCA 4HK0B 4ZFFB 1J0HA 5LAXA 1F4WL 4UU9B 4PRID 3RWHB 3T2NH 1PG7L 5I1IH 4KI5F 4XBGA 3K3QA 4AL8L 3OKDB 2AJ3A 5KSBA 5DWUH 1E0OB 3DSFH 4JN1L 5D8JL 4I48A 1TETL 3V4UH 3HI5H 2NX5E 4XRCA 3RWEB 3C09B 3QEHA 3MUY1 1IGJA 1R5IB 2BNRD 5D72H 2JCCF 1ONQA 3GBNL 4J4PC 1AHWB 3HC4H 2OR8A 5EUOA 1FH5H 3NFSL 5FECA 1TJHH 1YPZA 1H0DB 3ARED 3RUGE 2VIRB 3G5ZB 4OI9A 1X5KA 3BQUA 4JRWA 2ESVD 43C9B 5FYLE 3SDXB 3LHPH 1UACH 5JQ6L 2EYSB 1U8IB 1I7TB 2FCBA 4FQCH 2Y4SA 1SBSH 2WWKO 1CLOH 2D31B 4F8TA 4C58B 3QNYB 5HHOE 4P9HH 4PV9A 4BSVA 1D5IH 4LEOB 5E2WL 2IFGA 3CDFA 1NAKL 1W0YT 3TYGH 4KH2A 3SE9L 1RUPL 3SBWA 3L5WA 3BWAB 3CSYA 4JFYB 4CVWA 3PQYE 1BIIB 1PG7X 5T3ZH 3AY4A 1MHEB 4Y5YA 4FQJL 4OCLC 2PO6A 3NTCH 4OZIB 4K2UH 5GGUB 3GMRB 3GGWB 1JYXA 1AXTH 4EBQL 4ALAL 5IW1A 4M1DH 5DJ0A 1CFSB 3C6LA 1LO4L 4M7JL 4YPGB 1N2RA 2BOBB 5KAQF 4G42A 3PABB 3H3KA 5KSAD 2Z92B 1MCKA 3KYNB 1BBJB 2DQEH 3MRIA 1BHGA 4OF6A 2QQKH 3IS1X 5T5NF 2X4PA 3MLXL 4YXHH 2VJXA 1S7WA 5CINH 5D7IB 4L3CB 5BS0B 4M5YH 4PG2A 2X9XA 5E8OA 1NAML 1GC1C 2ILLA 3TBWA 4J3XA 4R26H 5HPOA 1EMTH 3MRBA 3D6GA 1CGYA 1XF3B 3VJ6A 7FABL 2PXYD 2XT1B 1VPOL 4LF3B 3IRZA 1ZHNB 3DETD 4Y16B 4LMQI 3UYOD 3L3OB 4AJ0A 1L7TL 3UTQA 3I02A 3SDAB 5E6IC 4Y7MA 4ZXBB 2EKJA 3TO4D 3T0ED 2R23A 4LDOB 3L7FA 5IGXH 2R1YA 1MJ7L 2F5BL 3VFMA 3UTTA 1ED3A 2ADJB 3D2UB 2XXCB 3LKPB 4PY8I 1KPUA 5JW4Q 5JPNA 3HS0A 4NQDB 4JQVC 4MA1C 5CFHA 1I7ZB 4F3FA 4H1LA 2X1OA 1CIDA 5GJTL 5ITFA 3DUSB 5HHQA 3UEZA 3UTSA 5KZCB 4K8RC 2ORBH 2P48B 5DD1H 2HLAA 4MDJB 4WW2F 5T3XH 5E7FA 2VXUL 4YHOH 5I1DB 1X44A 5JORB 1W0WB 2HN7B 5EU7C 2VDOL 3FTGA 4LHUD 4LSSH 3KPRB 4NKDA 5GGTH 5FM8A 4FQIH 3UROR 1KLFA 1AQDA 3F5WA 1OM3H 3UJJL 1SY6A 5DEGB 5EUKB 4EN3A 2NQCA 3ARXA 4QOKD 5DO2D 4X0KA 1NGYB 1SJVA 3PWLB 3LKRA 5DC4B 4APQA 1BBDH 2Y7QA 3KAAA 2HJFB 4KJPD 2CRIA 4I18A 5DQ9A 4KTYA 3K4ZA 5C0ND 4L3CA 3AFLA 2VWEE 1NEZB 1KACB 4K71C 3RY6A 5D2NA 3BW9A 3KPLB 4XPHL 1JNLL 3HC0B 3RWJB 2VLRB 2DD8L 3BH9A 1FGVL 3O8XA 2OJEA 2PF6A 1UADC 4E41B 1BOGA 2H32A 1S7SA 2ATPB 1CFTB 4K7PX 2YA0A 3C8DA 3MCG1 2FR4B 4MQSB 2I60L 3B2UD 3N9GH 4EDXA 3JSSA 2V9QA 1TTUA 5DD3L 4XCFH 5FYKU 1HYRC 3GSNB 3D85D 4G7YL 2OP4H 4U1SA 2J6EA 4PRHD 4JPIB 5IESL 3MMEA 4XNMA 3V4VH 3U46A 3CH1B 5JHDD 4PRPD 3SE4A 4N0CD 1YNKL 4GRLA 1NC4D 2DWDA 1J10A 4MD5A 4YXLH 3OAUL 4ZO9A 4ZD3L 2EECA 1IAKA 1Z0MA 3I2CL 3SE8L 5CGYD 3CIQA 4IJ3C 1F8TL 3QIBD 3VD5A 2KZWA 5L7XH 3W9DA 5JDSA 4OFYA 4YK4C 2ZSVA 3ILQC 4YDIL 2GJ6E 4Z7VE 2OMNA 1UJ3B 4HKZB 5FM5M 1T5XA 1OPGH 1B6DA 5H35B 4FRWA 1NKOA 2AQ2A 4YFLF 1FN4B 2WMPA 1LNUA 2A6DA 3ARFA 1KCUH 4GOSA 4PJEA 5E4EB 1T7ZA 4LLUB 3INUH 3MOBH 4KTDL 1GZPA 4QT5B 4S1SH 4I0PC 4F7CB 1K8DA 4FG6D 3T0XA 5KSBB 1C5BH 3IDGB 1FL6B 1RK1B 5AYUL 5E95B 5KZCD 3MA9L 3QJFB 4X4ME 3AMLA 3RVUC 4GLRI 1OOAA 3OHXB 3V9FA 5CMAA 3EYSL 5FKPB 2FBJH 3VXSA 4R90H 3D3VE 4PB9L 1BZ9A 1F6AA 3OX8B 1NUFA 4I2XA 1PQZB 4KY1H 5B4MC 4JJHA 4UBDD 2P8MB 2A0LD 1XZ0B 1NCAH 2C1PA 5IBLC 4JFEE 3DTXA 4MQ7B 4ZXBD 2AK1H 2V5RA 2WP3T 5CINL 3I9GH 2N7AA 4HIIA 3QXDB 4NKOB 4PD4K 2Y36L 3VH8B 2JK5B 2WM0A 5LQBH 4YEEA 3U79A 5CJXA 4XNUH 1NFDE 1QZ1A 1MELA 2DQUH 2XPGB 1HH6B 1MPAH 4MCZB 5E6IA 1EFXD 3FT4A 3F7YA 2HFFA 1EZVX 4JRXD 3ULVH 5D7IF 4JDTL 4MWFB 3D69B 1KB5H 2DLIA 4PJ9D 4Y2DA 5BVJB 5JHDB 3VFPB 4Y4HC 5IOPB 3SDXE 1U8QA 3IGAA 5C09D 4U1NB 3VFUB 4C83B 1VFAA 2V6HA 1KIQA 4K7FB 3SE8H 1N7ML 2D3VA 3NA9L 4BH7B 4HFWB 3QXUA 5TF1L 2NYYD 4PRIB 1JGLH 1CICA 1Q9KA 3AU1B 4OFIA 2HFGL 4QCIA 4Z0BH 1UWGL 3GSUB 4ZAKD 2D9CA 1HQRB 3IVKB 3QO1A 3UP1A 1I7TA 5KW9H 3S96B 3BKMH 1A2YA 2XICA 3TVMC 4M02A 5GQBA 5E9DA 5GS0H 4PGJA 4KTEL 3UZEA 4DUWA 3O11A 3G6DH 2X4OA 4QTHB 1F58L 4LBEB 4QTIH 5F7NC 1MCJA 1MFCL 1MHEA 3TO4A 2MQ3A 4PJ5B 2VC2H 3NCCB 3JV5A 3D48R 1QR4A 1RUKH 3ZYIA 4QRRA 1I1AB 1S9WA 4JO4H 5KVEL 3VI3E 4MNHB 5CGTA 1A9BB 3SPVB 2X5PA 4H5SA 3I6LD 2FDBP 4MQ7A 2BOCA 3TT1L 4K8RH 1U6AL 2DQGH 3AUVA 4L9LB 4XXCA 1B90A 1S9XA 3ABZA 4RCAA 3VGEA 3TLRA 3U9UA 1WFOA 3MRRB 1Q94B 3HE7A 2MTPA 5D7LA 5TE7L 5L8JB 4OLWH 1CD9B 3I9GL 1IT9H 4PV9B 1FL3B 4NQSA 4PRPB 2FX8H 4YHMH 1ZLVK 1T03H 5CD3B 4V2BA 3QEQA 4LHUA 5GRUL 3Q1SL 4S0TD 4PJCA 5DFVC 5MEOB 3CXHJ 4HWBL 1MOEA 1OGAA 4AEIL 4KRLB 1CGWA 3WS6C 4FFWC 1YY8B 2KPNA 3HUJF 1U8NA 4NQXA 3P4OA 4YE4L 3UDWA 3M1BA 3QUYC 1UKTA 2Y07L 2KDGA 1ND0A 4Z77B 3LDBC 2UWEA 3LQZB 1AE6H 4NPYB 2C7UA 4HV8A 3S37X 4M43L 1JGDA 5L2JB 1NFDF 4XB8A 5HBBA 4GS7C 4S0SD 1WBXB 1MIEH 2PXYB 1FCGA 4WJ5B 5IOPA 2CRMA 2J88L 5IBTL 1A22B 1S3KH 4MD5B 1S7TB 4Z6AT 4LLVB 1V7NH 3T0EB 3O4LA 2GITB 3MJ9H 3Q6GH 4XI5D 4NRZA 4KTEH 2JJTC 5L88H 4CUCA 5C09B 5T1DH 3NVQA 5JLZA 4J12A 1C1EH 5DK2A 4UTBL 2UWEF 1RUKL 1I8LA 2OX5A 4NM8H 1HINH 5AUMA 3DXAB 2VL5B 4Y2DC 1X5JA 2BERA 3MA9H 4NN5C 3OKNB 1NUDA 1G6RA 4HMDA 1VHPA 4U6HB 5D1ZC 3FOLA 3FFCA 3WV0A 4AQ1B 5T1KA 3TJEH 1EFQA 4R90L 5SWSA 5J6GB 4ZOCA 1F6AB 3OX8A 4XVJL 2QQLH 4Y89A 3M8OH 3BO8A 4ODUB 3RVXC 5JOEA 1NCAL 2APBA 3BSZH 3ARBB 2P7TB 1MCRA 3PWUB 3GSNL 1BREA 4PJ5D 4M62L 4OCWH 4OM0H 4QNPE 4JKPH 1B0GB 5HGBB 1HNGA 3M1BB 1FSKC 5CZKA 1BZQK 1U58A 1OF2B 4HUUB 3DMMB 3TO2B 1AKJA 1BFOB 3GI9L 3WFCL 2R0ZL 1MCFA 3S4SB 5E4EC 1AIFA 4HV8B 4YIQB 4U6VH 1FJ1A 1U8JA 2VDNL 5TQ2H 3SDYH 2YSSA 3JWNC 3EOBA 5BVPL 1MCSA 3MUZ1 5E94B 3B43A 2W65A 5CD3A 4ELMA 4KMTH 1YMHB 4M48L 2D7TL 4UMGA 1II4E 1DL7L 3HI1A 5EO0A 1PG7H 2YD3A 2A6IA 1CGUA 2P49B 3BHBA 3PJSA 1MIML 2XACC 2IBZY 3NH7H 3PP4H 4ZO8A 4APQC 4EI6A 3WHE1 4NKMA 5KVFL 5AZEL 4KZDL 2BZDA 1NBZB 4LLWA 2D7PA 3KYKL 3RHWK 5ALCH 2CGRL 5CS7A 1KB5B 1JK8B 3HC4L 1QQDB 2R15A 3NIDF 4WCYH 4UIKH 3EHBC 5D2NC 2JKXA 3WFHA 1T20A 5SWSE 3I75B 1VFAB 4A6YH 4XPAL 3B5HA 1IBGH 3MO1A 1QSFD 5DHVA 3RTQD 4LCCA 4RZCB 3PIQA 3OR7A 4BFBD 4XPBH 3GSOA 3SKOB 3O0RL 4WO4B 1RJLB 3DGCR 5A2FA 2F19H 2GJZA 5EU6B 2YPLB 3FT4B 4GW4B 4TQEH 4WY7H 2BCKA 4YBQD 1DN2A 5IHUL 2YD8A 4Y1AE 1IJ9A 3ROOB 1N5AB 2B8OT 4AIZB 5JA8B 4J4PA 1FNGB 4BQ8A 1P7KB 2IAMC 2MFNA 4U6XA 1F00I 4PJEE 3WLBB 3BEWB 2CJUL 3DTXB 1T83A 5DUBA 3AAZB 4POUB 3MNVA 4U31A 1R6VA 4GSDH 4NNPH 1UWXH 4RAVA 4P23B 4S2SA 4X4MA 4GW5B 4P4KA 2D03H 3TYFB 1IM3A 3P9MA 1W72A 4RA3A 3S36L 3VFOA 1OP5H 2X89A 3QJFA 4P3DB 3UPAA 1MFNA 5DJZB 3T3MF 4PJHA 1ITCA 4LKXB 4BQCA 1FGNH 3VFPA 3JXAA 4HJ0C 1QO3B 4R26L 5GGVL 1S8DB 2H8PB 3HRZA 3EFDH 3MJ7B 3VGAB 3GHEH 4WTXA 5JOPD 1BJ8A 3RVTC 5DSCA 5CIPH 5B21A 4MB3A 4JLRB 3O81A 4H26B 4NO2B 3HUJB 5ALCL 2EEBA 2FWOB 5C0AB 5IMMB 3BN9C 3WEXA 3HE7D 5D7LD 1IEAA 1H0DA 5BV7B 1C12A 1Q9WB 4PRIE 4HUXB 4NO3A 3WFBL 4HX1A 5JIPA 4MS8C 1HXYA 4RMSA 2IG2H 2Y6SD 3O3AA 3ROLA 4I4WB 3C5ZC 2UVEA 1OB1A 4ZXBC 1QSFB 1GL4B 5ANMB 3RTQB 1I3UA 2CO6B 5C1MB 4D9LL 3LVEA 2EDKA 2XIDA 1PX3A 5T3XL 3Q5TA 4MZ2A 3ARFC 4M7LL 2NLJB 5HYJA 1PKOA 1EBPA 1RZ8B 1QA9A 4U1HA 4XC1H 2E9BA 3B5GA 2IGFH 1FDLH 3NIDE 4F58L 5C8JA 3MXWL 1MJUH 3E8UL 2J12B 5KVGL 3KYMB 4DQOL 4U6YA 4HQQH 2YXFA 2DTML 5E08L 1UFUA 1NC2D 2VLMD 3TYFA 1EERB 4G8GD 4OGYL 3AGVA 3EYQC 1A2YB 4WO4D 3G9AB 1UKSA 4LLQB 5IHZA 4MAYC 5ERWB 1HH9A 4YQXL 2P4AB 2X1PA 2X4NB 5I73C 1FO0B 2ADJA 3D2UA 3FAWA 5EBMB 4NM4L 5HJ3A 3O6MH 1Q72L 1A6PA 1YC8A 1T22B 2DD8H 4JO3H 1HDMA 1KN4L 4K7FA 2R0ZH 4BQBA 3MODH 2V2XB 2VZOA 4ODXA 1U8NB 5C07B 1KXVC 1XMWA 4P5MB 4RSVA 1CLZH 3U4BL 5H8DA 2IF7A 3Q0HA 2C9AA 2KZ1B 4QXUH 1JGDB 1U8LB 4QRPD 1GIGL 1NANH 2HN7A 3TIDB 2O5YL 3BH9B 4LOUC 4M1CD 1BJMA 3CUPA 4XX1G 1MAMH 2V7HB 3QNXA 5KOVC 3SKJH 3HE6B 3HCVA 1J0JA 3W2DH 5TH2B 5KVFH 2GI7A 2EDTA 2ZKHL 5LJYH 4RGOH 4WWKB 3BKJH 2EC9T 1Q9OA 4HS6B 4LSUH 2Q86A 5E70A 2VLJE 1OSZB 3ARQA 1MCPL 2HJFA 2V7NB 4NCC2 4H1LB 4Y16D 5CD5C 1BWMA 5GS0C 4J6RH 3QDMA 5F9OL 3L3IB 1YEJH 1KCVH 3I2CH 3MLZH 2R8SH 2AABH 4JDZB 3T0EE 1JPFA 2CLRA 1KJVA 2EH8L 4NZTH 5CZXD 1F13A 3PGCB 4FMKA 4NN6C 1C12B 3P4NB 4JR9L 5FUZH 2EH7H 4J3OC 4X6DA 3CCHB 5DMIL 3QI9C 2OK0L 5FYJH 1GPOH 4NO5B 1I8MB 3TF7C 5DC9B 32C2B 3SJVD 5F7YC 5B3NA 4I4WA 1MSPA 4LVNB 1GAFL 4KMQA 5FUCE 5E24E 4U0RC 3KG5A 5DEGA 1CDGA 1HHJA 4D9RD 3TH2T 3OMZA 4ACPA 1H3PH 1RV6X 1NFIA 5K59E 3HRZB 2I25N 1D9KA 3H3PL 4P2QB 5LGJA 5GISL 4KDVA 3HA0A 1P7QB 4BUGA 1CGVA 4EI5B 4GS7B 3ZHLA 3I6KA 3P4MB 5F9JA 5SWZE 1Z6JT 2RR3A 1WK0A 3NABH 2AXHA 4HKJB 5FYLH 2H1PL 3VGHA 3MGOB 5D7KD 3F65A 3S4SA 3IXTB 2CDFB 1M4KA 1RFDH 3DUHA 2YRLA 4X5WB 4OD1H 4NQDA 1H8SA 2J7LA 5MP6L 4L3AA 1A6ZA 3LHPL 3L3JA 2A1WH 1WBXA 4KDTA 1YPZE 1WZMA 3BWAA 4OD3L 4I0PA 1W72H 5HHOD 1EUTA 5EBWA 5I66A 3O3DA 3OKKB 5GRJL 1LO3H 3ARBD 4OZ4B 1WEJL 1GIGH 3U83A 2Z93B 2WZPD 3ZE0E 1ZTXH 3NPSB 4NWTL 4KJQD 4G80B 5E99H 2W9EH 3CK0L 1BEYL 2EYTA 3U2SB 4Y19B 1RUPH 1U8IA 2EC8A 1QSVA 2X1QA 2EDRA 1FIGH 1U2HA 2L7UA 2BRRL 1G9NC 1PAMA 1KSRA 4K2UL 4P57B 4JG1L 1CXEA 2VAAB 3MRNA 4CMHB 4NBYB 3D85B 3KPSB 2YBRA 4Z7VB 2M26A 1FNEB 3L5WB 1P4BL 3IRPX 2F15A 5FUZL 1KC5L 3O6LH 3DX6A 1E27A 4AH2A 3E2HC 1NC4B 2FJGB 4JG0H 5CJOL 4G8GB 5GS2H 3OAZK 1MHCB 3LZFH 1ZVYA 4PD4J 3DUUB 1UEMA 1QEWA 3CD4A 3TN0B 2ZCHH 4Y4FC 1QFWH 1KIPA 5ENWB 1P4IL 4PV8B 4R8WH 2XQYG 5AWNH 1CD0A 4MS8D 5EBGA 3F12B 5MEND 3T09A 1N8ZA 2JB6B 4OGAD 4QGTA 1ZAGA 2G2RB 2HG5B 4JLRA 1A4KB 4JRXE 1QFPA 5IMMA 3KPNB 2CDEB 4AEHH 2H1PH 4IRJC 1C16A 1ZXQA 2HLAB 3IDNA 1CGXA 2WBJB 1LO4H 1T83C 3U0TB 3WUZA 4C59B 4CMHC 1A3LL 1OAXH 5GJSL 3ULUC 3QRGL 4NM4H 4QRRB 3O9WA 3CLFL 4X5XB 1FZMA 3EDDA 4OTXH 3CFEB 3FMGH 5JNYA 3R1GL 4GBXD 2R23B 3TCLB 2HVKB 4N8CL 5AEAA 3BUYB 2IPTH 5GGTA 4FQQA 3HNSL 1ZTXL 3H6JA 3S96A 1MCNA 4Q9BA 3P73A 3EOTL 3MRNB 3BRGC 1IAOA 4LSPL 3C5JA 4WUKL 5K9JH 4NC2B 5FYJU 4F15B 3TP4A 3GMNB 1N5YL 5C08D 3LMJL 4Y19D 1N3NA 3FN3A 3QB7C 3FQUA 4LSUL 4M1GL 3L5XL 3JUZA 1ZSDB 4UT6L 2YC1A 2IAMD 1KFAL 2EIBA 3MCLH 1MNUH 5D93C 3MRPB 5F97E 1KXQE 5F9OH 1J87A 5LWYH 5GGQH 5GGRA 2ZCLH 5E8PA 4AMKL 3HI6H 3KHQA 5C92A 4JM2B 1WBYA 3VRLE 2YHGA 2OMBA 2ZCHL 4X7CC 1EEYA 3RDTC 1I8MA 4YHZL 1AD9A 4LCIH 4YX2L 2HJLA 3S88H 1HCVA 3RL2A 2VXSH 5HHVH 3UYRL 5I6XC 5GSVB 1JV5B 2KUTA 4LAQH 4GAJH 1WAAF 4PRPE 1RK1A 4KVNH 5GISH 4Q6YA 5JXEA 4WI9A 5DQJB 1LQSR 2PXYC 3TBVB 5E4IA 2QSVA 1R5WA 3VXMD 3T3PF 2MCPH 1BZ9B 5BV7C 5E6YA 2FHCA 5EU5A 4NRXA 3RVWD 2P24A 4TUKL 2R4RH 3LRHA 1EO8L 1T5XB 2B4CL 4FQ2L 3V5KB 4S1QL 4PJXE 1RZIB 3TEUA 4E5XB 3EOAA 1JN6B 1DBJH 4K3JH 3BSZL 1E6JL 3PGFH 4Y4HB 4YHKL 1DBBL 2WWKT 3GMQB 4ZPVB 4UV7L 4OF7A 4XMLL 1LP9E 4JPKL 3RWEA 4A2MA 1DLFL 5DD6B 1IGJB 1R5IA 3OB0K 3QQ9C 4ODXB 3ZKND 1J0YA 3MLSL 1S7VB 2DIJA 1GXEA 1DQJB 1SYVB 2H2PC 2XQBL 3TA3B 1Z9MA 4LVEA 4S10A 3QI9A 2ZSWB 3ROLB 5F3HA 3W9DB 1A14L 1MQ8A 4NQCD 2FRGP 1JF5A 4PY7B 3FN9A 3L1OL 2ZG1A 1VEPA 5MERB 1DL7H 2OJZH 1IEBB 3FQWA 3ULUH 1M05B 3WNNA 4P2OA 1ZOXA 2DF3A 4C56B 5LWYL 2B2XH 5HD8C 5I73B 1JZ5A 4QHLB 3EYUH 2DS4A 5JHLH 1WLHA 4AMKH 2ERJB 3HZKA 1C7TA 1WFTA 2A6DB 4QYOA 3C9NA 4X80H 3PWPA 5JW4N 4BFGA 3MRHB 5D1QA 3QCTH 1DBKL 4WCYL 4QXWA 4U1LB 5C08B 2Z9TA 2BNRA 3G5XA 4MJ6A 3BN3B 1VERA 4YXKH 1HHHA 4J3WA 3NCYS 5HI3C 3ZDXE 2VLJA 2BVQA 3MPCA 3HAEH 3FQRA 2BFVL 2VDQH 4ODSH 1PSKH 4N9OB 1KB5A 3BZ4B 2ZZUT 1MHHA 5DWUL 2JELL 3U9PH 3IAPA 1OD7A 5J6HA 3DO7B 4ZG1A 1KG0A 2EDFA 4JDTH 3WIFA 5DUML 3G5YA 2X89D 3GSRA 4JKLA 4E42B 4I3SL 1AY1H 1P4LB 3OB0H 3VFSA 3X12A 1QBML 4AY0A 1ZHLA 2G75A 5GS2D 2R4RL 2XWJA 3WUWA 4LAJH 4MNGA 3PWJA 1ND0B 3QSKB 1LD9A 4D3CH 3KLAB 1U8PB 3BQUB 4X7TA 4JQXA 1U8KA 1T1ZB 5EORL 3NA9H 1BQLL 1AXSB 1J7VR 3HN3A 1UACL 5JQ6H 1MUJB 1ZA6A 3CMOL 6FABL 4NYLB 4V1DE 5F71A 2FD6L 2PO6D 3QCUH 4JRYB 3KPMB 5E2VL 3QXAB 2YZ8A 2D03L 4Y19E 1BZ7B 4XNUL 1WQVT 3F7RA 5MEOA 4OLUL 1X7QB 5C2BL 1LHZA 3EOAB 3L9RB 3W9EA 4AENB 2AERT 4V1DD 5C0FA 3H9YA 3JTSA 4CN1A 3VMOA 1YNTA 5A2LH 5FGCE 2LTQC 1V8HA 1XGYH 4Z0XB 3EAKA 1F58H 4OCMC 2VLME 1HZHH 1KJVB 3UTOA 4Y4HD 4IRJB 1I1FB 2W9LA 5E8DL 2FX7L 5IV2B 5CUSL 4HUNB 3K2UH 4EBQH 5DO2C 2VXQH 3GMOA 5IKCB 1F3RB 4JB9L 3UXFA 5D9SA 4X6DE 1JGLL 4O2FB 3TA3D 4F7TB 4IBLT 3QA3A 4PGCA 4ZFOL 2UUDK 4MNHA 2XZQH 2IPKA 2WW8A 2WBWB 2XWTB 4PJ5A 3H9ZA 2SEBA 4U3XA 4F9PC 4FFZL 4O00A 3WHXB 4M5YL 5ICZB 2GFBB 5CBAB 3GSRB 4NUGH 4U1JA 2FO4B 4YX2H 2YUVA 4GW5A 1N0LA 1NL0H 4XP9H 1OF2A 1QACA 4X6CA 1UB5A 1U91B 2ZCKL 4WU7B 1IC4H 5KVEH 3FONA 1N59A 2MNUA 2P8PA 5ESVB 4KKAD 1J0KA 3FO2A 4HZLA 3QHFH 5FYJE 3RUGF 2BVQB 2IQAB 4XVTL 1ZEAH 5GRYA 2R0LH 2VE6B 1MCWW 4JFXA 3T0BA 1FV1B 1ZA3B 1B0RA 2DWEA 4MCYB 4UQ3A 2HRPH 4DOHE 2DBLH 3ORJA 3IDMA 1D5XB 1G7JA 5C0GB 3H0TA 4OZIA 1OT2A 1HWHB 4PJCE 2BNQD 1W0VA 5INDB 3ARDD 3RTQC 3HZKB 5I0ZA 4K3JL 5JW3H 1E4XL 3LSOA 3V6FB 4Q9RL 5HVHB 4KQ4L 4Z77A 5AYQA 2Z92A 2C1OA 1Q72H 2WUCH 3ARZA 2BSRA 4K7PY 3KPPA 3L3HA 4Y2OA 1CF8H 1HZHL 3BAEH 5HVFB 3TH4T 5IVXA 1Q1JH 3QEHB 3L3DA 1F4YH 2J5LC 5I1LA 4P23D 4LLVA 1A6UH 2XXMB 3U1SL 43CAA 2VLLB 1U93B 2O26U 1QHOA 2O5XL 4OQTA 3RIAK 2QSQA 1JHLH 4Y5YB 2DQFA 4K9EL 5MERA 2BXZA 2BVYA 2JCCB 4YHYC 2ARWA 3SKMB 2QR0A 1D6EB 4R7NA 1ORSA 4P4RB 3NA4A 4CVZB 4P9HC 5DMKA 1M1SA 4ZOAA 4U6TA 4UV4H 2DKMA 2CIIB 5C3LD 2XZQL 2HYMA 5I8OH 1XF2A 1GZPB 1FFNB 1S5HA 4HFUL 2IQ9H 4ZAKA 5D7KE 4JM2A 5DURD 1CT8B 4K94C 2HVJA 2A9NH 5IK3A 5L88L 4L3EE 5HVHC 4TVPH 1J0IA 2VXTL 1L0YA 3HI1B 1RU9H 2IANB 3DV4A 1CDBA 3KR3H 5T5NG 4LARL 1UM5L 4HDIA 3HB3D 3TA3C 3W82A 3BWUC 5M7QA 4OF3A 5GSVA 3ALWA 1KTLB 2ZJSL 4ZTOH 5D6DC 3KJ6H 1HOCB 4XVTH 2DTSA 3BT2H 4OFYD 1BFVH 3MOAL 4Z7OE 4KQ3L 1RZJH 5K9OB 3I6LE 4S11A 2VO5A 2ICWI 6CGTA 5KVDH 4X6CB 1KPUB 1NCDH 3BKCH 4PJ9C 4LSQH 1EAPB 4H88L 4C54A 3AAZA 4DZ8B 5FO9A 3MUGB 1CFNA 5L8KB 1LEGB 3CMGA 3FL7A 3HG1D 1IQDB 5GS1B 3B9VA 5CLWA 4JQIH 3JZ7A 5D96C 2VDRL 2UZXB 2PUQT 1QPPA 3MRMB 3PDDA 2VLJD 3MV8A 2W60B 2J2ZA 3GHBL 4L29B 1MJJB 4Z7UB 4K8RD 3ZTJG 3WNLA 3SJVE 2GQHA 4NP4L 1E6OL 2BVOB 5CWSB 3T0WA 5I1KH 3ZYOA 2VZUA 3K8KA 4PJ7E 1JZ4A 4X6FA 3GO1H 4H0HB 5DK0B 3BZFA 1BOGB 4UT7H 1EHLH 1WVZA 3HPJB 5I76A 1RSFA 2CIKB 1BVLA 2DYPA 3N1FC 4P46D 1PGRB 5C09E 4OZGE 5E8DH 1I1FA 4HLZH 2OL3H 1EFXA 4PGZA 4WIQA 1CN4A 4UQ2B 4EI5D 1JHKL 4FQPA 5FGBA 4WW1A 5IMLA 5AAMA 5HGHB 1IM9A 4MVBC 5FCUL 3TV3H 5ID1B 2IQ9L 3QQNA 3RA7H 1KBGL 4DKFH 5I19H 5DJ6A 3ZKSD 1S7VA 3WSQH 1G9NH 1IVLA 2WAHA 2R69L 3RWDB 1OT1A 2HRLA 4F33A 5I30L 5LQBL 1AGEB 1QSEB 2F54D 3OPZL 1ACZA 1U3HB 4C56D 2ZSVB 5HYEA 3GEWB 4EQ3A 2VXVH 4QLRA 1Y6NR 2R9HD 4OV5B 5D2NE 4CVXB 2FBOJ 3UBXG 3Q3GA 2QKIB 3ZT7A 1JZ3A 3QZWB 1UH3A 1FVDB 3UC0L 5DC0A 5SX4I 2ICWA 4M9OA 1QRNE 2QLVB 5LBSH 4O2EA 5BJTA 2X4QA 5B4MD 3IKCB 1U95A 1ZLVH 4AL8H 4BK4A 1OQXA 2O93L 3EFDL 4JAMA 3ET9F 1Z3GH 4QF1B 4BM7A 4LIQH 1NC4A 5C0BB 5BQ7B 4P3DA 5ICXA 3QFJA 3HB3C 4EIZC 2MSPA 3PNWB 1YEKL 3C8HA 2AEPL 4M61B 3S35X 1QUNA 1BECA 4AQOA 2IFFL 3FQNB 3LKOB 1AQKL 1WJ3A 4YUEL 1I4FB 3QZWG 3SDDB 4WI7A 4P2QD 1KJMB 4N8VA 2X10A 2A9MH 3CFBA 1OLZA 4RFEB 5F6HJ 3SY0B 1LNUB 3CH1A 1XGQA 1QP1A 2ZPKH 4JY4A 3MXVH 1IARB 4KRPD 2NR6C 1UB5B 4JEGB 4WU7A 5T33L 3C8KA 1TENA 5CILH 2XNAA 2DJ4A 3QDGA 2F5AL 3L3KB 2DRUA 4EVNA 4P3WA 5C71A 4MX7B 1SJXA 1ETZB 2NZIA 3VG9B 1NMBL 3GIZL 1KNOA 3MV9B 1R3LA 4OQTH 1T1XB 2VUOA 3FHQA 3BQUC 4NN7C 8FABA 3VXUA 2ZG2A 3UO1L 1CTNA 3VWKC 1HDMB 4DTGH 2P5ED 1DUYA 1DQML 1K3IA 4OZFB 4PGDB 3WIHL 3NIFF 1FYTE 3VU2A 1KYOK 1N4XL 4WUUA 2EXYC 1KIQB 3WLWD 3JTSB 5I17B 3LD8B 3W39B 1S9YA 1KPRA 4JFHE 2W0FA 4IIQA 4J3UA 2X7LB 2MMXA 5FAAA 3IKCA 2A74A 5T3ZE 3HG1E 2QHLA 2APFA 5D6DA 4M7LH 1K9TA 1I1YA 1S7SB 2VSDA 2EYRA 4CNIA 4JZJB 4EUPG 35C8H 2IGFL 4YE4H 1FDLL 4F58H 2J8UB 1N0XH 1AJ7H 3HG1B 5DYOB 3FAXA 2CLZA 4I2XB 5F9DC 3VI4E 1HWGB 4N1EA 2E6QA 1P7QA 4LAQL 4LCWE 1T4KA 3BD4A 5I8CA 4QOKE 4Y5VA 3E3QE 1DQDH 4OCNC 5J12B 1NLBH 1VFUA 1PYWA 2BSTA 1MRDH 3SOBH 5T1KD 3MLWL 4FQHA 1IM9B 2O61B 5EU4B 3KYAA 3SGEH 1MCEA 5K9QG 3ZE1F 1CL7I 4H1LG 3QFJD 4NO5A 4OCSH 1FPTH 4EXKA 1MY5A 4NHUA 5HHNA 4IOSD 1YEJL 2ARJA 1XCTB 2E8YA 5DD1L 4OCRL 2CMRL 4YHOL 1CDJA 4LMQE 1DLFH 3K80A 3EO0B 4JFZL 4P48A 5CLTA 5I76B 4X6CF 5FDWA 4XZUA 4LRIA 1IQWL 4QRRD 3KPRD 5ISZB 1EAJA 5B3JE 4LASH 5DJ2A 4EZMA 4NQED 3HZMA 1S9YB 4M7KH 1BX2B 2W07A 5E5RB 5DTFB 4UDUB 3SGDH 4CADB 3QUYD 3MZGB 1LEGA 4K3DL 1T2QL 4HHAB 3PHOA 5JQHC 3QI9B 4BFEA 4Y2DB 5BVJA 4QRUB 4YBLC 5IJVB 2Y23A 4GKZA 5FHBH 4JFXB 2BMKA 4GAYB 3MNZB 3C08L 4RX4A 1BM3L 1YMME 3NGBC 1L6XA 2EH7L 1IMHC 4DUXA 4FTVD 5CEZD 5F1KC 1CFVH 3DBXA 3SKUD 4HKJA 1A1MB 4Z8FH 1FL5B 1AJ7L 1TTFA 2A73A 3P77B 1KPVA 3PQYA 4XI5C 1YEEL 3HNTL 5SWZA 1BMGA 3WLWC 3T0EC 5I8KH 2FJFA 1FIEA 1H3WM 1GGTA 2AS5M 2ICWB 2EDLA 1R5VA 3OQ3B 5HYQB 1FSKB 3PP4L 1NBQA 2D7OA 2GJ6D 1QFHA 1KT2A 1T7XA 1C16B 4NQCE 1S9VA 2DM7A 2CGRH 3VXQB 1JUFA 1JHTB 5FUCC 1FVCA 5E5MA 5IQ9A 2V9TA 5T1LA 3AC0A 1IM9D 4BQ9A 1L9NA 3QO0A 3QDJB 3WUWG 5B3JF 5L8LB 2JCCA 5JMRA 3QFJB 4ONHA 4PB0H 2UWEE 1ZGLA 4M8QB 1F97A 1HIML 1SMOA 3MRDA 1ES0A 2DYPB 3CC5A 1T6VN 3QNZA 3MBEB 4RBPK 1BJ1H 2YEZB 5HHMD 4P57A 3QQ3B 2QQNH 3QEGL 4MD4B 5DRXA 1K4CA 3CNKA 3WMSA 2VISA 5LCVH 4XP1H 1INDH 1RZKL 3J7HA 1PZUB 4XVSL 4LSTL 4DVRH 3MSPA 3O4LE 4LPWA 2GT9A 5J1SC 2GEEA 3MV8E 4Q58C 2HWZH 3VCLA 2YKLL 3D0VB 3SCMC 1PFCA 1PG7W 1MHPL 4C56E 4JO1H 2EC9U 5JTWA 3P2TA 5I75B 4IS6A 5I9QC 3EGSA 1P9MC 3RGVB 1QVOB 3GJFH 4OLVH 5DJ6B 1DVFB 4FP8H 3MR9B 4YDLC 4R2GB 4L8DA 3UBXA 2VITA 2YOCA 4YHNA 1P4BH 1MY7A 5IB5B 5EIIB 4DUVA 5JOFA 4PJFB 4AIXA 4UU9A 3DRQA 2VZSA 4G43A 1CL7H 4I9WD 3FMGL 5MEQA 4MAYD 2QEJA 4G9DB 3RVWC 2C3XA 5FOBA 2X4QB 1P6AB 5T1KB 1FNLA 5LG1A 2FATH 4L5FL 4L4VE 4MD0A 2XKNB 2QL1A 4R8WL 2OM5A 3UDWC 4RNRA 3LEVL 3U0TA 1MCIA 1I9RL 5CD5D 4KJWC 4Q0XH 2AJVL 5D5MA 4POZC 1UC6A 2MPAL 2HJKA 4MZ3A 5JNYB 4FTVB 1P5UA 4PJAE 1CD8A 3QFDA 3G08B 3H9SD 4G6ML 1M7IB 4LOUD 4M1CC 1QLEL 1RY7B 5DZNA 1U8OB 4OCXH 1G7MA 4HK3J 3OKOB 4KMLB 5JW3L 3OR7B 1YQ2A 4WRLA 5IMLB 1XF5B 1XCTA 1VFMA 1S5IL 4KKNA 3O6FB 1D6VH 5EOCH 2CUHA 1ZVHA 1G9ML 1NBVH 1LO2L 4ELMF 2FZ3A 4H25B 1IGMH 3O45A 1FYTB 4CU8A 5HHVL 2F74B 4ENED 1OAUL 3H7BA 3ZSTA 4W6YB 1INEH 2ICES 4NO0A 5BRZD 4W4OC 1A02N 3H9HA 4ZDHA 3RGVD 4K3DH 5FYKD 1PLGH 5JLZB 5F7UA 4JFEB 4EI5C 4DK6A 4GQ9L 4R2GD 3TZVB 3ARBC 1QLRA 2AKRA 3PWJB 4RMUA 4G6JL 5HJ3B 2AJUH 5EB9A 3PDOB 1W72B 5FB8A 1Y6MR 5CJQH 1IC5L 3I3EA 1W0VB 4S1DD 3T08A 1HI6A 2WQ8A 2FX8L 4YHML 1JF1B 5IW6B 5IFHH 4J3SA 15C8H 2BVTA 4OCYL 4WEBH 3TM6A 4UNVA 1KELH 4KHXL 3HNTH 4OAWA 2AEQH 4U6XB 3HR5B 3MRKA 1TVHA 1MH5A 4G43B 1G7HB 3BO8B 3E1F1 2EDDA 2X4PB 3GB7A 3VG0L 2H6PA 2BSRB 4M6OH 1S7XA 2BHYA 4NKQB 3DVGB 3BVNB 1IL1B 4X6EB 1B0WA 2L4OA 2VDLH 3VCLB 3BD3A 2G5BB 1IGFH 4BZ1L 5F9WB 1BFVL 2OTPA 4GRMB 5F7MC 2F54A 1MWAL 1EEZB 4WHTB 4P3CH 5ETUA 5IHLB 1FAKT 4CGTA 4ENEC 3QDGB 4QRTB 4Y4KB 2DQHH 1V05A 2D2OA 4LEXL 4FQLH 5GRVK 5ADPH 3MLPA 1RHFA 5ABDE 4G80A 2K7PA 1NFDA 5IFAL 1OWRM 4UAOB 4UILL 1X3DA 4JPKH 3OBAA 1EZVY 2GUOB 4NRZB 3CZJA 4PY7A 3NOIA 3TIEA 3WS3A 1G9MH 2Y06H 2GCYA 5DRXB 3VRLF 4I18B 5DQ9B 4AENA 2BNQB 3P9LA 4DKDC 3E2HB 3HUJA 3SDCB 3BKYH 5KANI 3X17A 2HWZL 5SWZD 3U0WH 5C0IA 1CGTA 1FYHB 2NNAA 2OTWA 5FGBC 4JO1L 5K93A 3PXHA 4YGAB 3NTCL 1DLHB 3MRQB 5IB2A 4GKSB 4TVPD 2FJHA 5DEFB 3LKSB 5KAQG 1ZVSB 3EYUL 5FYLL 2CIIA 4NZRH 4KROD 5ADOL 4CMMA 4OZFG 1NEUA 2ADIA 2J1KA 4RWYH 2DQTL 3QXAA 4A2LA 1HSAA 1NGXA 5IQ7H 4ONFH 1KLUA 1JWUB 5ISZD 4DK3A 2MQ0A 3TBYA 5EORH 3DI3B 4GRWH 4XWOD 5C0GA 5DFVD 4KFZC 3KPOB 4JFQB 1SEBB 4XNZC 2W59A 2D7NA 3MRFB 4X7FC 1VEOA 1KOAA 5DF0A 2KKQA 3LCYA 4HJJH 5DQDH 3KXFD 2XWJB 1RIUH 1T0NA 1VGEH 3CFKA 5C0CA 3V4VL 3SDCC 1I9RH 1M7DA 5IHZB 2V7HA 3QNXB 4LLQA 2A77L 2RB8A 4WW2C 4OKDA 5EPMA 2DQIL 3MRBB 5HHXH 3D25B 5FYKE 2R2BA 2BRRH 2YN3A 3PV6A 4OBRA 3NPZB 4ZD3H 2NY4B 1R3HA 5JW4R 5BMFH 1QLEH 1MRCH 3QDGD 4DN3L 2ZG3A 4M43H 4JB9H 1ZT7B 3K1KC 2H26B 1UZ6F 3NMEA 2XZCH 4WFFE 2AEIT 4I77H 3VE0A 1FNSH 3TH3T 4YUEH 2WANA 2L0DA 1D6VL 2Q8AL 3WHE0 4X7SH 4I3RL 4XNZB 2HTLC 4LFHG 4YH6A 1GGIL 5HTSA 3ZKQD 3SKNA 4JKWA 4JREC 4BZ2L 1BJ1J 1NCBL 3JWDH 5FKPA 4JFED 2J8HA 4GLRH 4I0KA 1BIHA 4P2CG 4G6KH 1C5BL 4A6YB 4TTDC 2VTFA 4Y4FA 4GO6B 5T1LB 1MCDA 1KJ2B 2AW2A 3EHBD 1U8QB 3V2AR 3MLUH 5IHUH 5C0DB 2I07B 2B1HH 4NO0B 3RPKA 4MXWL 1BGXL 4FG6C 4LCUA 4XAKD 3ULSB 1ZHKA 3VFNA 3RZWA 1EGJL 4WEMB 5LXGH 1CLYH 3PL6B 2YEZA 1QKZH 2FGZA 2QHRL 4F3FB 2LU7A 1TQBC 3MLVL 4I5BA 3HCVB 2AK1L 32C2A 1XIWA 5DEFA 4LPCA 4ZUTB 4O5LL 4C55A 3VXSB 4NHCL 4OCWL 3B3IB 2IEPA 3O6FA 5JXAL 5JPMA 3OJVC 5DT1H 1IM3B 4XBPB 4KQ4H 2DQFB 3DYPA 3KWWA 1MLCA 2C3GA 3FRPA 5IBLD 3LKNA 3I6GB 5F7DA 5FFLA 2CK0H 4F37K 4XGZA 1QRNB 1S78D 4LLUA 3KS0H 4NOBA 3SCMB 4XCEB 4WTZG 3UBXI 1VKXA 3DX9A 5KS9F 1UKQA 7CGTA 3G08A 5HXMA 4G5ZH 2XY1A 2CUMA 2D7TH 3GHEL 2JJSC 4WFHE 4OM1L 2PW2B 3BESR 4K9EH 3ZE2F 3ULUE 1FLTX 2FECI 3GSNA 3C60C 2E9IA 4N0YH 1WIOA 3HE6A 5D71H 3OAUH 2FWOA 5JHDE 2YBRB 3PQYD 5FO8B 2GYSA 2ESVE 4RFNC 1PY9A 1A7PH 1OSZA 3S5LA 3BPOC 1ZGLM 5ECJE 4DN4L 3S36X 2X70B 1H5BB 1B9ZA 4FQ1L 1TCRA 3X13B 1FPTL 3NFNB 3P0YH 5FDYA 3VD9A 2Z31D 3QR2A 5I17A 4TNWF 4BUHA 3FCTB 1MFCH 4JHBA 3S4SG 5JOFB 1QFUH 3MJ8B 2E9JA 1GHFL 4U49A 2EE9A 4LVNC 5TDPB 5A1AA 3JVGA 4R0LA 5D1QB 3L3JB 4PBWD 5F7HA 4MWFA 3MOAH 1WUNT 3FOMB 5DMYA 5HDQH 1G6VK 1LEKA 3QZWA 4OI7A 1RHHB 1Z9SA 2DI8A 5DRNA 3K4AA 4JQXC 3HPLB 4KY1L 2J8UE 2B4CH 5F9JB 2XPGA 1RZIA 3FQXA 4LSVL 4UIMB 4PYHA 4X9IA 3IJYA 1KTDB 5EH1A 5IB2B 5EOQH 1T1YA 2VZ3A 2YA2A 1NJ9B 1YUHB 4R96B 5L0QC 2YWZA 4YQXH 3TWCH 3UTTD 3BPOB 1FFPB 3A67L 5CJXC 4NZUL 4KUCD 1CFQA 1KF9B 4F9LA 3AS1A 3JUYA 3ZYJA 3ZDXF 1BM3H 1YEDA 3C09C 1JYVA 3LKQA 5JUEL 2AGJL 1MPAL 3HFMH 4HIEA 1WC7A 1T0PB 1IKFH 2E5EA 1A0QL 4JJ5B 5C9JA 2UV3A 1IZJA 1TFHA 4PUBL 2QADB 5CKGA 3SKJL 2AV1B 3DGGA 1HXMA 3HAEG 4PP2B 2AJSL 5ITBH 2NY6B 5T1MB 2I9TA 1PYWB 3HMXA 5IB4A 4IHOB 1MRCL 4GG6B 2C5DC 5EZOH 4HS8H 2GUOA 1S3KL 4HK0A 4WENB 4PRNB 4APQD 5DGQA 1FNSL 1EFXB 1FH5L 1QHPA 1KCRH 3QIBC 2J4WL 3V5KA 2Q7YB 5C0CD 1G6RB 1FJ1B 1U8JB 3OKNA 1KJ3H 2CK2A 2HJLB 1LEKB 3OPZH 1RIVH 5F7EL 3LIZH 4ZS6D 2OK0H 3JV4B 2E8ZA 4D9LH 4RMRA 3QO1B 3AREB 3FRPG 3WNPA 4R97C 1GGBL 1XGUB 5FKAB 5E8PB 4MXWH 3ES6B 4W70A 3SDAD 3VXRD 4OAWB 3LQZA 4CAGA 4JDVA 4JZJC 1B2WH 4U1NA 3VFUA 5DD0H 1WWWX 3MBEC 2Q8BH 3NAAL 5DHVH 1KBGH 4PRHA 4DKFL 4JFFE 5HGAB 3SO3C 3VWKD 1JYWA 4P46A 4F8QA 3EBAA 4HXAH 2MKLC 1ZLWK 3TPKA 1OQOA 4U1KA 4D9QE 1AR1D 3ULUD 3FB8B 1RIHL 1BPVA 1RJYB 1S7TA 3WJLA 3B9KC 5E6IB 5DT1L 3LS4H 3O2WL 5JUEH 5BS0E 1NC2A 4QRQB 4PR5A 5DDHB 2JB6A 3QUYB 3MZTA 3VXPB 1WFNA 3WO3B 2PETA 4UT9H 5L2JA 4YXHL 5E9DD 5FGSA 1ITBB 1IAIL 5I1HH 2GSGA 3SCMA 5DVLA 4PJXB 3GUTA 3NFPA 1KJMA 4N8VB 1JRHH 1VKXB 5FA4A 1ZWIA 4JY6A 2X4TB 3STBA 1M05A 3IJSA 3LQMA 3BUTA 3D39B 4WWKC 5F7DB 3I50L 2NXYB 2AJVH 3BPLB 3W11C 4U2ZA 4MJIE 5D71L 3QIUA 3L3HB 1Y0LB 5E56A 1DUZA 5F96H 2PYEB 4NFDA 1BD2B 1WWBX 1AQKH 1LWRA 3BYTA 4YFLI 3G6AA 1SVZA 5F7WC 4MDJA 5C6TH 4DN4H 1AD0A 2Z91A 3OL2A 5C86A 4HUKB 3OZ9H 1XGRA 4KVCL 2DMCA 1RK0B 1XIWD 1YEFL 1C8PA 4NRXB 1Y18A 1RIVL 4RX4D 2BSED 3OSKA 3VFVB 4L1DA 3QCVL 4RMVA 2EKSA 3T2PA 5CIPA 5KSBF 2DLFL 1HSBA 3RDTB 4BZYA 3QDJD 5D1ZB 2VIRA 3G5ZA 4X6DF 5TJWK 1U3JA 2YSSB 3TT3H 4Q6IB 2ATKA 2GY7B 2ZWLT 4OZHE 3L95B 1U8MA 1XFPA 1T3FA 2MQCA 3FB8A 4W68A 5C3TA 5F1IB 3JWOH 4J3TA 3VGDA 1XF5A 2FX9H 4R4FL 1AGBA 4DGIH 1TZHB 1I9IH 1JPSH 5HI5D 3IDMB 3QH3A 1J8KA 5HPMA 1I8IA 1J1OL 4S1RL 2CKBA 2IWGA 3PHOB 1LK3L 3FZUD 1U3ZA 3B2VL 3OV6A 3AS0A 4X9GA 4WTWA 4E41A 5T1LD 3FQRB 5L6YL 2XA8H 4XP4H 3EDJA 4PY8J 1X4ZA 1OAXL 4HUVB 4NQVA 3QHZH 4H8WL 1TZIA 2QADD 4K23H 4YNYA 4YHPB 1FBIH 1DVFD 4GBXB 1INQA 1VFBA 3FB7B 2GFBA 4Z7WA 3VWKB 4XCEA 4P9ML 1RJLA 1IKFL 25C8H 2HH0L 3FFCD 1JMXA 5CEZL 4LGSB 3ZL4L 3ZT5A 1HXYB 2I24N 5KG9A 3QRFM 5IVNA 4CVZA 1T1WB 2E27L 5D9SB 1MRDL 3GMOB 5IKCA 2RBLA 2H2PD 4AG4L 4LFHD 3O6KH 2FSEA 4ODVH 2DMKA 4AM0B 3MV9E 4MMXC 3HMXH 3T2QA 4L8BB 8CGTA 5CCKL 4M4RA 3QAZB 4ZOBA 4OLXH 1RUQH 3B6SA 2VYRE 4XT1C 3IAQA 2JJVA 4PTTA 5HGDB 2MWCA 1UCBL 5J11B 3IDIA 1YPZF 2XTJD 4ZTPL 5INCA 3LKPA 2E6JA 4Y88A 1EHAA 4X7DC 2FB4L 3K0WA 3E8UH 3KGRA 4PJDE 4ZS7L 3WBDA 4Z7WF 4TNWK 5EOTB 1GGBH 5AAWA 5J1AA 2NZ9D 1XZ0A 2HKHL 1RJZA 3RY5A 2X4TA 1PJ9A 4P0DA 4X4XA 2DWEB 3IJHB 3BKCL 4MCYA 3FQXB 4UIMA 4U1IA 2HTKC 3PWUA 2X9YA 3IU3B 2OZ4L 4PRDA 1O7SA 4DKEH 4X6CE 2FEDD 3RDTD 2R56L 3E0GA 1D6EA 4W4OA 2EO1A 4UTAH 3MRIB 4S1QH 3MLTA 4JO3L 4NP4H 1U8LA 3O2WH 2DLHA 4I13B 5HI5C 3QRGH 4HIXH 1F90H 4OGZA 5B38B 4MJID 3D2UD 2OR7A 4MD0B 4LCWB 3PDGA 1EHLL 4BA8A 5GSRA 1JP5A 2PCPB 4F80A 3FB6A 1B0RB 1NMAH 1FV1A 1ZA3A 3TZVD 4RRPA 2O5YH 1TCRB 2W0LA 2XQBH 4MXVE 4MJ5A 1MFBL 4O51A 2F53E 4ZPTB 1EVUA 3ULVL 3SY0A 1MCQA 2YRZA 4Z95H 4X99B 1FLRH 1VA9A 3TV3L 4ODVL 1AGBB 3EYQD 1NCCL 4FFYH 2R0WH 3RA7L 2D0FA 3QH3B 3AU1A 5BRZA 3VGGA 1TJHL 2MCG1 3RNQA 3B8YA 3MO1B 1ZT1A 3OHXA 4KI5E 3W5NA 3QP3A 2B1AL 3FO0H 2B39A 4CMMB 5FXCH 5DJYA 2OL3B 1LO0L 3PP3H 4MAUH 4PJ9B 4TN9A 5LVEA 4LSRH 1YN7A 1OP9A 4U1LA 3NIGF 2BY3A 4X4XB 1ZLUH 1ZKAA 3K74B 4R4BB 5CIPB 2YMXL 5KN5B 2Q8AH 5LCVL 1FZOB 3EGSB 4I0PD 5GGVY 4XNXL 5J89A 5MHSD 2VOTA 3ILPA 3G6DL 2BNUA 2XN9A 3HZVB 3B8SA 2YZ1A 2IPKB 1AR2A 4IMLB 4RQQB 4Q0XL 4N5UA 1DLHA 2ADFL 1DE4B 3F62A 4ZMAT 1T1WA 3MLUL 2XRAL 3X12B 1I1YB 3TBTB 3U36A 3HE7B 5D7LB 3SDXF 1G0XA 2F5BH 2H9GA 4TVSa 4LCYA 4LK4A 2EIZA 3T4AA 1U6AH 4D3CL 2YD1A 1RZ7H 4I8DA 4AM0A 1J1PH 5D7IE 5ID1A 5J06A 3RL1B 4NQTA 1BQLH 4FQXB 5TF0A 3V0WH 1CTOA 1NCNA 5H94A 3MV11 2DQJL 2AK4D 1I3GL 3VDAA 4PJBB 5TE7H 3MODL 4YHKH 3CVIL 1RULH 5I75C 1YN6B 3ZHDA 1YEHH 1YJDH 5D5MF 1KCKA 3V79C 4Z7UF 4EUPB 2HH0H 1MFBH 3LOWA 5C2UB 1AHWC 5HYJD 1T6WA 5CHNA 3EJYD 2YRPA 5C9KA 1WIPA 2YUWA 3UJJH 3QEUB 4X7EC 3W2DL 1EHXA 2WK2A 1NGPL 4PJ9A 3RU8L 1S7QB 4POYA 4QRPE 3MV8B 1T5WB 4JG1H 4MJIB 3MYJA 1KJ2A 4M93B 1AP2A 3T77A 3HE7C 4UNTA 4N0YL 2B1AH 3FO0L 4BH8B 3DX8B 3SGJA 1A9EA 2R39A 3W0WB 3O2DA 3L3GB 4WFFD 4XPHH 1IKNA 4HSQA 4U4BA 5E1HB 3UPRA 3GBMH 1T22A 2KBGA 3L5HA 4CVUA 1ZLSL 2Q76B 3W0WE 4OV6F 4GBXA 1OHQA 3AS3A 4U6YB 1L7IL 3RI5K 4N5ED 4Q6IA 3CXHK 4B5EA 1X6LA 5D2LB 3QXDA 2Y25A 4ETYA 5DFTA 4URTB 5BJTB 4UTBH 4G8FB 3BPLC 1PSKL 2P42B 3FQUB 1V7MH 4ERSH 4D0BB 5EIVA 4W4NA 3IU3A 3LN5B 1A3RL 1TJIH 1FNHA 2BC4B 5AD0B 4PJEF 4KK6D 4M6MH 4M4PA 5EU4A 1F42A 4XAWL 1B0GA 1J1PL 1A3LH 3THMH 2PW2A 2GCYB 3BIKA 5EO9A 4XVJH 2DN7A 4OZHA 4NUJB 2DQJH 3B4NA 2LAAA 2L7JA 4HIXL 3MRFA 4Z9KB 1EEYB 4HWNA 5DJXA 2ZOLB 5F6IC 1JZ6A 1K8DB 1UB6B 5F21B 5FYLD 4R3SB 5LKNA 1J1XL 3FOLB 4LRIC 1G0DA 4LDEB 4RGNE 2KQNA 1MLCB 2DM3A 1ONQB 3O9WD 2Z35A 3G6JF 3DRTB 5F3BB 3UTZA 4N0RA 1FZOA 5IEKA 2ZUWA 5C2BH 3DWTA 3KDMB 5FV1L 3VG0H 4EKXA 2AAVA 5IVXB 5KBNC 3IJYB 5E99L 3TBVA 3MRPA 43C9A 4HS6A 1Q9OB 3INUL 1IGFL 1NGPH 5DA0B 3WJJA 4BZ1H 4HGWB 5JXED 3TO4B 5DVNA 5KTEL 2V5YA 1LMKA 2FBJL 5MEPB 4LLYB 2VXQL 3AY4C 4Y5YC 3RY4A 4Y19A 4P2RD 3FFCB 1VACB 1DEEA 3W39A 1GC1H 2X4RB 1ZGLP 2FGWH 4PPTA 5EZJA 2ZUYA 3FJTA 4PLKD 4JPWL 4LCCC 5F1NB 4QHNA 2DQDL 4GBXC 1YMMD 4GXUM 4IS6B 4NPYA 4Z8FL 2I26N 4XC3H 3SKNB 1R0AL 2CQVA 1U3HC 2K3TA 4G6FB 3JTTA 1I85A 1T1XA 4LBEA 1GOFA 1ZANH 3AXLA 4GRWB 3PV6B 3QDME 4KDTC 3C6LB 3GM0A 4ORGB 4LPTA 2W0KA 3DSNA 2OSLA 3T0EA 2IALA 2ADFH 4YHPA 5FDWB 3MX0A 3QUMB 5L2KE 1GVIA 3MGOA 3ULVC 2ED8A 2BDNH 4PJAF 4RISH 3RVXD 1MJ8H 3EZ8A 3GMLB 2OR9H 4OIBA 1UM4L 3M17B 5H37G 4J1UB 4NJAH 3PNWA 3MRJA 4POZD 5KJRH 2EDOA 3ARPA 1OY3B 1UWEL 4X8JB 1AGDB 4YWGH 2X41A 3QDGE 4LLWB 1I9JH 4HUWB 4BYHA 3MROB 1I7UB 1FHGA 3EO1B 4MSWB 1P2CB 4HGKC 1OGAB 3WFHB 1T4KB 2CDGB 3OG6B 4Y5VB 5JO5B 5IMKB 3TN0D 5C07E 1FVEA 1R3JB 3B83A 2W65B 1J8HD 1NCBH 3JWDL 4WUKH 5CAYB 5D2LA 2CIKA 4J3VA 4TYUA 1RPQA 3TVMB 1KCLA 3F12A 4NJ9H 3UTSB 3QQ4B 4JO4L 4G9FE 3SGEI 1AKJB 2EYRB 4CNIB 2V2WA 2B2XL 3RWGB 1R5WB 5IB4B 4ALAH 5A16A 3U7YH 1LE9A 4TSAL 3ZE2E 3ULUF 4LHUB 1GC1L 4H25A 3BE1L 4LKXA 2WV3A 4EXPX 3QCTL 5ISZE 1X5YA 2CLVA 3A6CL 3RIFK 2B4CC 4JPIA 2P5WA 1ODAA 4JQVA 3O2VL 5I18L 1ZLSH 3D39A 5I30H 5DJ8A 5ID0B 5IVZA 3EIFA 1VACA 5DJ2B 1OTSC 1L7IH 3IDUA 1X9QA 2YS4A 3Q1SH 3RZCC 3RWHA 5LAXB 4V1DA 2CSPA 1ZV5A 5HYQA 4DGVH 5HI3D 4F7PB 3FRUA 4FS0A 3MOQA 2MPAH 1QLFB 4P2QE 2VLRE 3UAJD 3VW3L 3T8XB 4HQQL 1AGFA 1W8OA 2X70A 4ZUVA 5ICYB 3ARRA 1LK2B 3DX7A 3HLAB 4XXCC 2W91A 1L0QA 4FQ2H 2OI9B 3H0TB 3FQNA 3D1MC 3LKOA 4XGZB 3VWJC 5BCAA 3BVNA 1A7PL 5C6WH 3O41A 4XCCL 3MCKA 3BP6A 1D7FA 4YGVB 2YR3A 5FOJA 3CZFB 3RWIB 3O8XD 2VISB 4JFDE 3DRQB 4JANB 2YK1L 1ADQH 4QY8B 1LP9B 3FTGB 4U1GC 3FONB 1XGYL 4LGRB 2ZPKL 1F11B 1X5XA 4N8PA 1LE9B 1S9VB 1IGTB 3SJVB 4NJ9L 2O61A 3X3FH 3PP3K 1CDCA 4QKXB 3WFEL 1CK0H 2A2QT 5SX5K 4QEGA 4XZUB 3DRTA 2Q86B 4IRSD 5DLMH 3REWA 3PJSB 1CE6A 3ARWA 2ED7A 3KPQA 3S3PA 1J05B 4OQTL 1OGAD 1WISA 3WEXB 1DUZB 5FHAL 3AREC 1MIEL 5EBLA 2A83B 1I1RA 4PRNA 1NMCB 3CCHA 3ZDZE 4YHLH 5TQ0H 1T7VA 1HILA 2IH1B 2VKXA 4OZHB 2Q76A 1ORQA 5C7XH 3PGCA 1AIFB 3ZE0F 5GRWA 2AJXH 1FZJA 5CJQL 3G04B 5F7FA 2R29L 5CSZA 4ZAKB 5IIEA 2Y7QB 3WSQL 3TWCL 1I7ZA 1M71B 1MI5A 3HE6D 4PJHF 3IFOB 4LLMB 2VE6A 2R69H 4F7EB 3L3DB 4NZTL 4D0CA 2IBZX 1G7LB 3OTTA 4N0CC 5EBMA 4UB0L 4OGXH 2A6JA 1HINL 4U6VL 3TC9A 1CGSH 1EHNA 3L3IA 3ROOA 4L4JA 2EIDA 5F9AC 2G9HB 4YPGA 4ORZC 1MJ8L 3AB0B 4ORGA 1X6NA 1VENA 3QAZC 3WLBA 2QTEA 4XNYH 5ITBL 4JRYE 1DBML 2C1OB 3V8OA 1G1CA 3EW3B 3MFFA 5IEHB 4HWEL 3VDBA 4HH9A 3BYYA 5IFAH 1KPVB 2R56H 1P6FA 3IF1A 1NEZG 1F4AA 2Z4QB 4HW6A 3CMOH 5JR1H 1MREL 1XGTA 4TRPL 4YDJB 3WUWB 3UTSD 1NDGB 3OXRB 5B39B 3P9MB 2VDML 2NX5B 2XZAH 4IMKA 1QOKA 3UTQB 3ULVD 4PJXF 3WE6B 4K94H 3V4PH 4KK5D 4MA8L 1CFTA 3WKMH 4KMTL 4U1MB 4L4TA 1A0QH 3U0WL 1MI5E 1JJUA 3BEWA 2F58H 1F4XH 2VL4A 2J5LB 4EOWL 5ESVA 5CUSH 5K9KB 4KRNA 2Y5EA 1CDIA 2H45A 1JWMA 3K2UL 3EYSH 3L5JA 4NRYA 1VDGA 1M71A 1B4JH 4QHMA 1QR1B 4M7KL 4I18C 1P69B 4DFHA 1KLGB 1BFTA 1NCCH 2XN9D 2Y6SC 2HT2C 4OIIH 4RMTA 4JN2B 4UDTB 1JPGA 3UTZB 2A9NL 3JV0A 4GRWE 2FZ3B 5IFJA 3O3AB 1E4WH 3DUUA 2GT9B 2VXTH 2Z31A 1P1ZB 4G8GE 1Z5LA 4XPBL 3RWDA 2IH1A 3STZB 1LO0H 3RWIA 2HMID 3ZTJH 4NKIL 1OTTD 4U0QB 2ZCKH 4EDWH 4GAFB 4KQ3H 3D85A 1PY4A 5I1LB 4LLAA 1NANI 2AVGA 5GGVH 1L4IA 1N0XL 1J88A 1FVDA 2XZZA 1T04B 1TZGL 2HLFD 1MEXH 4TSBH 3KNBA 4KJQC 4PTUA 5D8JH 4PS4H 3M17A 5GRVL 3FKUS 2WWMD 2HJKB 4UUJA 5EUOF 2K7QA 4QXGL 3CUPB 2H2SC 2NW2A 5GGSB 1GZQA 4JQIL 4K3EL 1MREH 4TRPH 5E1AB 2V2TB 4OUUA 1PKQA 1X5HA 2APTA 4PLOB 1E4XH 3D5OF 1YDPA 4OZIF 3MQIA 4TOYL 3SDDA 4OCSL 4LNRB 2EDYA 1SJEB 1HIMH 4XP6L 3P9LB 3P73B 4XNQA 3KS0J 4XPTH 4OZGB 5KVMC 3WKML 1SHMA 1FGNL 2R1YB 2VKWA 1F4YL 3ZDZF 2BNQE 3OKYA 1B3JA 4PFEA 1CLOL 4ODUA 1JRHL 4HD9A 3HZYB 1A6VL 4LP5A 3ARDB 3DXAD 2LFGA 5LGHL 4X9FA 2XKUA 3REVB 1PZ5B 1H5BA 4BSWB 1JF1A 4XPGL 1S7UA 3PHQA 1F3JA 5IM7A 2CRYA 3VFVA 1AC0A 1N6UA 3WIHA 2OYPA 1K5NA 4ODTL 3DX7B 5I19L 1LGVA 5IB1A 2WINA 2A83A 1AGCA 1I4FA 3ALPA 5HYIA 3KVQA 1M6OA 1G9NL 3GDBA 1IGCH 5D2LE 3JV6B 5DJ8B 2AJYL 2AJXL 5D70H 3ARTA 5E94A 1CZ8L 5DUPL 4MA1B 1FVEB 3V6OE 2I5YH 3WXVL 1AKJD 5C70A 3FT3A 4WHDA 3LV3A 4U1GB 4JAMB 3LKRB 1UENA 2EDJA 4FQXA 4EDWL 3GMRA 1YYML 4P99A 4ONGH 2PN5A 1M7DB 3QUZC 2IAMB 3GFUA 1I8KA 2JJUA 1L6ZA 4RMQA 4DW2H 2AP2A 3CDGA 3MYZA 4KRMB 1HSAB 1NGXB 5EO1B 3S88L 3B9AA 3V5DB 4OM1H 1QLRB 2AKRB 3JWOL 5I8KL 4JE4B 5CEZH 5DGRA 3GI8L 3IDXH 1JN6A 4U1IB 5GGRY 1KTKE 1RUAH 1QRKA 3BIAX 5BW7A 5MENA 1BF8A 4R0LC 4OGYH 3LKQB 1TITA 1NGZB 3BZDA 3GSVA 3VWKA 4Z7WB 4WW1B 3VXUD 3Q2CA 1QD0A 1LEIB 1KLGA 5SWSD 1OSPH 5FYKL 4KKLD 2Q3AA 3U48A 1KB9J 3DROB 1PVHA 1WCBB 3THML 2W0FB 4IIQB 1ZK9A 4DAGL 5E6ZA 3RKDC 3QXWA 4M5ZH 5D7JD 3KPSA 5DVOA 2PR4H 2Y72A 5C0RH 3ETBF 1JVKA 5TE4L 3BPCA 4UV7H 3O11B 1JPTL 5EU5B 3O4LB 8FABB 1Q0YH 2D0HA 3QWRA 5TPWL 2HFEA 3AMKA 1SJEA 5D1XA 3S35L 4ZS6C 3ARSA 1C08A 3KPTA 5EZLB 1ZLUK 4IM8A 4W6WB 2UUDH 2BOCB 3DMMC 4ZFFA 3O3EA 1B4JL 3TYGL 5HI4C 1QNZL 3A6BL 3HZMB 5C08A 3TFKC 3X14B 1H3GA 4JFHD 4YO0B 2WSKA 5D70L 3L6FA 4IDLA 5EU6D 3AREA 2Z31C 1OP3H 5IF0A 3IT8D 2X4OB 3WXVH 3BQUD 4LQFL 4GQ9H 1ZHBB 1K5NB 4P2OC 4HZAA 2H3NA 3BP5B 4FXLA 2ENYA 1TXKA 1C5CL 2PO6B 3VFRA 1HI6B 5DMIH 4JRYD 1DBKH 4NBZB 3TESA 3C6SA 3RJDA 4PJFF 4NKIH 1Z2KA 3GRWL 3MACH 1I9EA 4M61A 2XWBB 3HR5A 2DDQH 2F9BT 4L5FH 2Z35B 4UNUA 3RZCD 3QEQE 1SYVA 1Z3GL 5I71C 3QPXL 3VFWB 5HDOA 5E00B 1FZJB 3T1WA 3ARGD 2QKIA 2UZYB 3P11L 2W9DH 3NABL 1R24A 3FO9A 5EN2A 4G6AC 2N4IA 5EO0B 1A7OH 5JPMB 2NY7H 3SE4C 1MJ7H 4PJCB 4L3ED 3BIKB 1YMHA 2VERN 5D1QC 4UTAL 5F9WC 2PW1B 3P4LA 1DQLL 4NJAL 5TFSL 4L9LC 4U7SA 4HCRH 2NY2B 2PR4L 2ID5A 3MLRH 3VXRA 2IALB 3ILPB 5BV7L 5DZOA 4UILH 2V9RA 1OAZL 2XYCA 2BXYA 1JPTH 1HN1A 1P4LA 5DJDB 2A74B 2VB5A 3MXVL 4TVPE 5GRJH 3FB5B 4ZUWB 4KHTH 3A6OA 4GMTL 1WAAA 1A4KA 1VCAA 3LZFL 1TIUA 5KS9B 5HYSB 3ARDA 5GXBB 4PJBF 2W9EL 3CK0H 4P4KD 4JCLA 1N64H 1JTOA 3VXOB 3FN0H 4S1SL 5EO1A 2NX5D 1Q9LB 2X44D 5A3ID 3BGFB 1RHHA 4DEPB 5HY9A 3CFCH 5J6GA 1I7UA 4FFYL 5CZXC 3MNZA 4D8PB 5HDBF 3L3OA 3GMPB 1AFVL 3X13A 4YDVA 4RWHA 1DQMH 3WIHH 1IGCL 1JPGB 4O4YH 3MNVB 4L4TE 5L9DH 5BO1L 5IT2L 4QYOB 1CZ8H 5GGRB 3QDAA 3F6LA 1XIWC 1FFPA 1A6WH 3NACL 3C08H 4KV5E 5CP3H 1LE5B 4PJDF 3CX5J 1X5FA 1BQSA 1IEBA 2DJUA 3FQWB 3TFKD 1BBJA 1XGQB 1F6LL 4TSCL 1F6FB 3SO3B 3QHTC 4L1HA 5HYSG 1A5FH 3RL1A 5I1JH 4CDHA 2P8MA 2FNBA 4KHXH 3N9GL 4F7MA 2A38A 3GNML 1PZ5A 5MI0B 2VRAA 1DQJA 2XWTA 2ITDB 3GSQA 1F2QA 4ONHB 3EKCA 1AQDB 4OBSA 2V2TA 1CQYA 3WHXA 4HK3N 5DJAB 5GGSA 4Y4KC 3CGTA 5DTFA 4PJIF 3VH8G 2NY1C 4HBCL 1YEDB 4ZFOA 1KFAH 5AG9A 3E6HA 3RWGA 3SGKC 4Z7QE 4QRPB 5CZVH 3C87A 2W1NA 2DOCA 4M5ZL 3R06B 4X98A 3RWFA 3SE3A 1ROWA 1KCSL 4Z0BL 1BQHA 5M95B 1IAIM 1YJDC 3CVIH 4PLNC 3KLHC 4G8FA 4HAFA 2BJML 5HSFA 4E0RB 2HP4A 4YFEA 1A1NA 3T4YA 1W0WA 2GIYA 2Y5TA 3TJHC 5DQJA 2DJSA 5TGBA 2FSEB 2P44B 5KSVA 5JO5A 4DVRL 4WI8A 3RKPA 1FL5A 3OAYH 2OCFD 4WW2A 2J8UA 3UTPE 2ARJB 2VLKD 4NIKB 4HUMB 3S35H 1A1OA 4Z0XA 3SEPA 4BZ2H 4DQOH 4GG6A 4MNQA 1QBLL 3CFJB 4JDZA 3UYRH 2EIEA 2FYYB 5E8NA 1OB1B 1LILA 3L3GA 4R0LB 3OXSB 1O0VA 1XF2B 2O5XH 4X0KB 1P7QD 2B1HL 3L5IA 1F5WA 2CO7B 5DLML 4O4YL 3RAJL 5E7BA 4M6NL 3WFDH 1V3JA 3GJEA 4JZNA 4K3GA 4XMPH 3NZHH 4NGHL 5E8OB 1NLDH 1YNTB 1IC7L 5I16B 1FO0A 2ZNWA 4P4KB 5IQ7L 3GM8A 1U93A 4Y16A 4F7MB 3FT2A 1WF5A 5AD0A 2F53D 4RAUA 1FBIL 2OTUB 4AZ8A 2ZUXA 4PJGE 1MUJA 1ZA6B 3PHQB 2V2XA 1ZHBA 4P9MH 3RWCA 4ZUUA 1KUMA 5IJVA 1K8IA 3QIWD 1NQBA 3DURA 4PJAB 1AGCB 2DQUL 1MWAA 1V7ML 3DVNA 3TIDA 4KKBD 1H3VA 3GB7B 4IRSB 4WV1A 3KJ4C 1NMCC 2Y9RT 5FO9B 3C9NB 3VFSB 4P5MA 4Y5XB 1JL8A 2ADGB 3IDJB 1BX2A 1RZJL 3TBSB 2YUZA 4JM2F 5ESQB 2NY0D 1NCDL 4MNQE 1TZHA 2FH6A 1EXUB 1IZKA 1YY8A 3F7YB 5FB8B 2PO6C 4RFOH 2NY5C 1Y18B 2ORBL 3HHRB 3EO0A 2H2SD 2UWEB 3B5TA 2E6PA 4Y1AA 2HAZA 4RGND 4DZBA 3NFNA 2WIMA 1HSBB 3RDTA 4ZFGL 5BZDB 5DSCB 4ZUWA 2NTFB 2D7QA 4EI6B 3GJEB 3PWPE 4IHOA 4P9HL 1PBYA 4KI5C 4PRHE 3VD3A 2GY5A 3IDNB 4IRZL 3UMTA 1L9MA 3G5VA 2BFVH 5GZOC 3QQ4A 3SDCA 2YKLH 3C60A 5IBUB 3G6JA 3CFDA 3TNNA 3GIVB 5IV2A 3L1OH 4M00A 3V6BR 2B20A 1MHPH 1U8HB 5HGHA 3OG4B 4TNVF 4N9GB 5KTEH 4WFED 4X8JA 4X6DB 2FJGA 4AYFA 4PGEA 1ORSB 1A1OB 2OQJB 4D9RE 5DMKB 5C0BD 5KG9B 3TJEL 3S34H 2VQ1A 1KGCD 1N6VA 4KKCD 1BZ7A 2DQGL 3M8OL 3F7PC 3OXSA 5LXGL 4M3KB 3SE3C 4K9EC 1CLYL 2AJ3B 3GKWH 3M45A 3ULVF 4MYWB 1WV7T 1ZLWH 1UWEH 1T2JA 5H35A 4L8BA 4XC3L 1CFQB 4OCYH 1FNFA 4B41A 4OD3H 3MBED 4NRYB 4GRMA 2X9WA 3STLB 1FFOB 1LO3L 3HNVH 2FATL 4PJIA 4KUCF 1JGUL 2W60A 4PR5B 1TJGH 2YC1B 5HGDA 4LKCB 4NWTH 1XR9A 5CJBA 5GZNC 3LEVH 3BGMB 1WTLA 1FFQA 4QRTA 3U4EB 4HWBH 1IAKB 1TTGA 1PW3A 4NC1E 5IBUG 1R24B 3FO9B 4N68A 4GQPH 1YMMA 4AT6A 3WL9A 5D6CB 4I3SH 4S2SB 5IB3B 5FA3A 4KXZI 4QOKB 3W5MA 2Z8SA 4HUWA 5LBSL 4D8PA 3HUJE 1J11A 1TZIB 5GS0D 3OKEB 2VABA 4X6BA 1DN0B 4HF5H 3QQ9D 1YA5A 4FTVE 1AE6L 5CEZE 1DBAH 4Q74A 1HKLL 1KTLA 3IF1B 3WJLC 4AK1A 4P5KA 4YDIH 1CXLA 4G9FA 3QEUA 5E2VH 2ICEA 4XTRC 4F7PA 4KPHL 4LGPB 3O2VH 5I18H 1ETZA 1UH4A 2A0LC 5DK3A 4Y16C 2HVJB 2HFFB 1T89A 4HC1A 1ZVSA 4FQIL 5T3XD 1I7RA 5IW3A 1T66C 3BPNB 5AYUH 4JHZA 4Q2ZB 1KTRL 2H6PB 1DDHB 3I75A 4OF5A 4PRBB 4XMKH 1INEL 4P4RA 4CW1B 4RFEA 4R7NB 4XBEH 4PV8A 3U7YL 4XPGH 1SEBA 4ZO7A 4GXUN 3GSOB 3TN0A 3VFGL 5IW6A 4O2EB 1B2WL 1FFNA 2YA1A 3N1QC 5FUOH 4MXVF 2HKFL 3R1GH 2AJYH 3ALXA 1IC5H 1Q94A 3RVUD 3IDYC 4B50A 3PG2A 2K9UA 2Y36H 1ADQA 1P1ZA 4NUGL 1FE8H 3ARYA 2VLKA 1YJDL 4XH2A 4DZBB 1OAQH 2LABA 3EJZD 2ITCA 3REWB 3T1FB 1F2XK 3QUMH 5I8EB 4XXDB 5TE6L 4NN6B 1H15B 3GI9H 5CWSA 3QUXD 4H5SB 3K1DA 1Q1JL 1FO0L 4JPVL 5EUOE 2F74A 5CKAA 4Q9QL 4DW2L 1VSCA 2NMSA 1UZ8A 3IDIB 3GSUA 1MWAH 1AGEA 4QY8A 3SO5A 3CDCA 1NBYB 3HZYA 1DBAL 3QWOA 2AK4A 3I50H 5F44A 1UA6H 3QUKB 4OLYL 1P9MA 3MRRA 2AJSH 4Y8DC 4XRCB 1FNEA 1EXUA 5ADPL 2F53A 2DKUA 3HI6L 4YAQA 5TQ0L 4O58L 1GGCH 2UYLA 1OAYL 2Z0BA 4YDKH 4XCYB 5C6TL 5HHOA 1H9VA 4O02L 4WDIA 4EEEA 3ARBA 2GSIA 2P5EE 1UCTA 4ZPTA 1AD9B 4HPOL 5ALBL 1GH7A 1JNJA 3N0PB 1J8HA 1BVLB 4RBPH 3KR3L 4OCRH 3MOBL 3V7MA 5JW5B 3KLSA 4X4ZA 5FM4A 4H0GA 5F7EH 5FO7B 4IRSC 4ZUSA 3TCXA 1CFNB 2YWYA 5F1NA 5B38A 2VL5A 4IRJD 4KGJA 2NY5H 5HVGB 4IDJL 5ILTH 2VZVA 2F54B 4MVBD 1CR9L 3C2AH 5FO8A 2FX9L 2PXYA 4R4FH 1DP0A 1WZ1L 3KWWB 1G6RL 4ONFL 1QA9B 4U1HB 3CFKB 3X11A 2CJUH 2GITA 4PGEB 3T77B 5E0QA 5FIEA 1FE8L 1NFKA 4JRXA 1JK8A 4JFFB 3QHZL 4TVPL 3K8LA 3GHBH 3O6ML 2BVEA 2XZAL 4J8RB 3HNVL 1KN4H 2DI9A 3DYOA 2CD0A 1CD1B 1JWSA 2GAZA 1VGEL 3GMQA 1R5VB 3BGMA 3GRWH 4Z5RA 4E5XA 3DIFA 4RA0C 4Y4HA 1YEEH 1FFOA 4R2GC 2FEEI 3VXQA 4ELMB 3L7EB 5A2IH 2YD6A 4WGVB 3KPMA 1Q8MA 2W38A 2P47B 1P2CA 5IMOA 5H94B 2DL2A 1FN4A 1DBMH 1XGPB 4OJFL 1ZHKB 3VFNB 4M03A 1TPXC 1NJ9A 1YUHA 3P11H 3QUXC 4DFIA 5T5FH 1ES0B 2R0KL 3F58L 3M07A 1WT5C 5DMGC 4HAGA 4OB5L 3RVVD 3NCMA 4GH7B 2NY1D 2EDXA 3U82B 4O51B 4F57H 3MV9D 1A4JB 4OZGA 5TH2A 1ZT7A 2DLEA 4LVOC 4LVHB 5SWSB 2WQRA 3C5ZD 4KZEH 3PWPB 3PV7A 2VC2L 4PGBA 4J7RA 1WTGT 5INDA 5EFIA 3AROA 4MX7A 1DDHA 3V0AC 3OB8A 3RZCB 1GZQB 5FGRA 2SEBB 1T1YB 4Z7VA 4ZOEA 1D5IL 4JFPB 3W0WA 1YN6A 3ARGB 2JK5A 3KYNA 3MJ8A 4JFYA 5DI8A 5IB1B 1ZS8A 1NAMA 2X4UA 3RRQA 2D7MA 3CDYA 3GZKA 3RIFF 4FQJH 1IGYA 4DVBA 2DQCL 4E42A 4Q9CA 4O9HH 3FOMA 3HM