3ZDZE

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
216
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 216
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zdzE02
4EQ3A 4KI5C 4KJQC 1RUQH 5KANI 2R69L 3D9AH 1EMTL 4L4VE 5KZCD 3ISWA 3P0YL 4MB5A 1YEJL 4PJDB 3OKNB 5GJTL 2V9TA 3BZ4A 4K7FA 1EX0A 5B8CC 1IGTA 4OCWH 1H8SA 5DJCB 1M05B 5MEQB 4NO2A 4IRJA 5GRJL 1HH9B 2R9HC 3DBXB 5BOZG 4X99B 1NBVL 3NFNB 4LVOB 4NZUH 3BZFB 4BFBD 5DJ2B 3L3IA 3AREA 4KDWA 3ZSSA 1VCAA 4KZDL 1K4CB 1K8IA 3I85A 5TQ2H 4Z7WB 4HXBH 2A0LC 4X7DC 3RZWA 4KVCL 1IQDB 1S9XA 3MLUL 4BFIA 4RMRA 3LY6A 1XF3B 12E8L 2KUTA 2V2WA 3I6LD 3D3VB 3CFKA 3ZKXB 4POZD 4YHKL 5F6IB 5IWLA 3BMVA 3F6LA 4KH2A 5CUSH 2PYEE 4ZAKA 2J88L 1TZIA 4AIXA 5KVFL 4P99A 5E8NA 5I15L 1A3QA 1OL0A 4WWKA 1YEGH 3ZDZE 2C26A 3TC9A 5EN2A 3UYRH 5IMMB 3VG0L 2NY4B 3MV9E 4NZRL 2LV4A 1AH1A 4WU5B 3RL2B 3S36L 3RWHB 3C08L 1GPOL 3QCVL 1OHQA 2HJFB 5DJYA 4YWGH 1X5AA 5IW1A 4S1QH 5EZIL 3BYYA 4YDLC 2DM2A 2NX5D 3Q5OA 2JLLA 4Q2ZB 4TUKL 5CLWA 5FYLE 4FZEL 3DXAA 4PP1C 5T33L 4HUXB 4FHBD 2V17H 1UM4L 5ETUA 2HMIC 1MI5E 3K4ZA 5D7KE 3V52H 1IEAB 5C71A 1CF8L 1KCVH 4EUPH 1JK8A 1X6LA 1PY4A 3D87B 3P30H 3L5JA 1F00I 3NN8B 3MO1A 2F58L 3ARSA 4G9FD 3H7BB 2NXYD 4TSCH 3IFNL 4NIKB 1YEHH 3TNNA 2P8PA 1OAZL 3WDIA 4X4YB 1O0VA 3FO9A 1LDPH 4PLJC 4F7CB 1A4JA 4QO1A 1OAUH 1OPGL 3RI5K 2IPKB 5DMJB 1OTTC 2GK0B 1ADQL 3V0VB 1F2XK 4JHZA 4J4PC 3RNKB 4WTZA 4JFPA 1QUNA 2GJ6A 1T5WB 2DIAA 4H0IA 4HIEB 1GZQA 3KS0H 2C3GA 5BS0D 4MNGA 2H2PD 1XIWD 1XT5A 3D48R 1EAPA 4HUUB 3MCKB 1UGNA 5GJSH 3C6SB 1S7SB 4MS8D 1KJ2L 4LCWE 3PABA 2Q3AA 1JV5A 4L4JA 1KEML 3FB6B 2W59A 1KC5L 3WL9B 2YXFA 1ZTXL 1BJ1H 3LQZA 3T8XA 1A7OH 2J4WH 4F3FB 5DZLA 4NKDB 4XPAH 5FYKU 2VC2L 1G7QA 4MYWB 2QEJA 3BAEH 1T03L 3UO1L 1FVCB 2XN9E 4IMLA 1F90L 4U6VH 3IXAB 1FN4A 2D9QB 5FDYA 3OAZK 4PGEB 1XF5A 2AJ3B 3CK0H 2IAMD 3HC0A 1NUFA 2E9WA 1NFKA 5HGDA 3HS0B 5DYOA 1RPQA 3PQYE 1U8JA 4LRIC 1DJSA 3E6FA 4JFHE 2I27N 1X44A 3CMGA 1IVLA 3VXUB 4PR5B 3QUML 2DLTA 4BQ6A 1MVUB 2DM4A 1FG2A 3LN4A 5HBBA 3ULVL 5DHXB 3LH2H 5GSRB 4C83B 4YHIA 4QWWD 3IJHA 1DBJH 1UT9A 3LHPH 3RWDA 2MPAH 4F8TA 3Q3GB 5F9JB 4YHOL 4HUWA 1QSED 4MWFA 4Z7QF 2B0SL 4X9BA 1I4FB 1CR9H 1YDPA 3WIFA 2IADA 4NQUA 4I3RL 4J1UB 1CDGA 4WI6A 4Y4HC 5TE6L 1ZSDA 1E4XL 2QKIB 5T5NG 2VLRA 1MCOH 5I2IA 2NXZB 2QADD 2ZNWA 2V6HA 5TPWH 1CFNB 1QFWH 4R4ND 1T89C 1G7IB 5IB1A 4QHLB 5IFAH 5H37G 3HG1B 3F12B 2BHYA 1XH3A 4LPVA 4JFZH 4NQXB 3RGVD 2DRUA 5E8DH 2HWZL 1CCZA 3KG5A 1AC6A 1RV6X 4PY7A 4ZFZB 3T0EC 1PG7X 4FQCH 2C1PA 2ZG2A 3DRTB 4NJAL 2VDNH 4KJWD 2WWMC 5ANMA 4ONHB 1TETL 4XCFL 1BAFH 2FJGB 2JJSC 1REIA 2R0ZL 1MFBH 1MHHA 4E41D 3S35H 2YEZA 1M1SA 1XCTB 1Z5LA 1CGWA 4M1DH 5J1AB 4XB8A 2GT9A 1NFDB 1UA6H 5CMAB 4Q97A 3SDYH 2Z8SA 1H8OA 5C09A 4ZPTA 2G2RB 1IMHC 1CFTB 1TCRB 3DJ9A 2EH7L 3TBSA 1AJ7H 1QRND 2H9GA 4Z9KB 3PNWA 5AD0A 3CDGA 4GAGL 3PF2A 5GRYA 4ODVL 3NIGE 5DURD 4I5BA 3FQXB 4X6DE 1A6UL 5CJBA 2VLKA 4U1NA 4K94H 4RGMB 4G6ML 4QRSA 4UU9B 3RDTB 3RAJL 1N4XL 5DJ6A 3GRWA 4KHTH 4K9EC 3ZYZA 3DROB 4GBXC 4JGJA 3FRPG 4UOW0 3OAZH 1DBBL 3VJ6A 3NIFF 1WC7A 4KY1H 4I0PB 5BZDA 3LEXA 4CJ1A 1E28B 4KTDH 3DO7A 4L4TE 1I7ZB 1JHKH 1VACB 4WW1A 2D0FA 1JWUB 3GSNB 4L8SC 1R3KB 5LGJA 3JWOL 1MJ7H 1IL1B 4RNRA 3GRWL 1YEKL 3V5DB 3O3DB 3W11C 5EU3B 4W6YB 1FGVL 4JFFE 5CKAA 4N8CH 3FQWB 3R0NA 1DVFA 4F7TA 1MFCH 3HA0A 4P57B 3EGSB 3OKNA 1WWWX 1YYLL 4WFGD 2NW3A 4DGIL 2DWEA 2W60A 4A6YA 1RZJC 3TVMB 1KENH 3MA7A 1WBXB 4HFWA 4UI2A 5MI0B 3WUWG 3MC0A 2SEBB 3G6DH 4JDVB 4UDUB 5JIHA 3T3PF 4KRMB 4P5TD 3T77B 2AEQH 2PTTA 4OLXL 1TZHB 4RDQG 1UB5B 3F5WB 4JRYA 3KYNB 3UTPE 1Q94B 3LQAC 1JNNH 1MFEH 3GBNL 4M6NH 4A6YL 3KPSB 1NLDH 3OKEB 3CH1B 4YHLL 1F4WL 2F15A 3GMQB 5KANG 3CMOL 5I1EH 5F9OH 3O11B 1T3FB 3VFUA 2QJDA 1S9YA 4WFEE 4U0RB 1JUFB 5I30H 4KRPC 4P2RA 3WXWH 2P5ED 3BP7A 2V9QA 15C8L 5CINH 4M5YH 4GG6A 1FNGA 3BP6B 2I5YH 5D1XD 5IBUG 1KFAL 4TNWF 4OGYL 4YFDB 1NGXA 3HAEH 4D9LH 1UFUA 3PIQB 4PJ8D 3QUXC 1T7XA 3KPRA 1W72A 4W81A 2HVJA 1V3LA 4WU7B 5KSVB 4LARL 4QRRD 4OFPA 3WJJC 5CZVL 1A9EA 4OLZH 2E8ZA 2BX5A 4CADA 5FAAA 5BMFH 3VRIB 3O2WH 5GQBA 1EERB 4PLOB 3PHOA 3T0XA 4JCLA 3TCXA 1YPZA 2L4OA 2HT2C 4JJ5B 1V3MA 4Y16C 4OCRH 4Q6IB 3MNVB 2X4PB 5DQJB 1QBMH 1W72L 3P9WB 5C92A 1KGCE 3ALWA 1IGJA 1I8IA 5EO1A 3VWJC 1VFBB 5C2UB 1WZLA 3S7GA 1LEIA 4O58L 2ZCKH 2X1QA 4ZUSA 1ERNA 5HDOA 4L3ED 3MRCB 2PXYB 5B38G 4MGXA 2C1OA 1JPSL 2BFVL 3I9GL 4MAUH 1OCWL 3FO2B 2IFFH 3MJ8B 1OWWA 4LSRH 4Y0GA 3VGHA 3FN9A 1MRDH 4PREA 1IM9A 1ACYH 4NRYB 2RHEA 3RNQB 2VXQL 2P7TA 1HINL 2JB6A 3ULUC 1FO0H 3LRSB 3PL6D 1U8MA 5HHME 5BJTB 1MNUL 4P4KA 3VXNA 4X6FB 5KVGH 3HTLX 4NBXB 3OV6A 4R4FH 4NNYB 3UTSA 4X5XB 1SEQH 4KKLD 2HKHH 1Z9MA 2AERT 4B41A 4Z95H 2MCG1 1IC7L 3GZKA 3QPQC 3VRLE 2DD8H 1ZLUK 3O4OC 1P69B 2EDRA 2GSIA 4PJ9B 2GJ6E 1YN7B 1YNLL 3QWRD 4XT1C 3S36X 1LDSA 1ZHNB 4M43L 2FD6L 3QH3A 2ZKHL 4G6KL 4GAJH 1HHKA 1RQ5A 5DVNA 1C12B 5B8CA 3TZVD 4XB7A 1B0RB 5F71A 5GGRB 4H1LA 5E8PB 4YAQA 1RIHH 2HKFH 1FJ1B 3QA3B 3QFJB 4LGSB 4ERSL 3KGRA 3HUJE 1Q9KB 5LKNA 4MZ2A 3GSWB 1NC2B 4FXKA 5J1TC 1KLUA 3BDYH 5SV3A 5K9JH 5L2KD 4M62H 3MQIA 2Y07H 1BMGA 3BD3A 4LCYA 4M1GL 4PJIF 4OB5L 5DMGD 3SGDI 1SBSL 5IB3B 1N5YH 4XHJD 3RVWC 1VPOH 2P8MA 1U41A 1K5NA 2A6IA 2HVKB 2XTJB 1TMCB 2UZXB 1KJ3L 5HDBE 4DOHB 4RMQA 4JM2C 3ULVE 3TO4C 1OLLA 1FVEA 4U3CA 1KTRL 5L2JA 3M1BA 1NGPH 4Q0XL 4QHMA 1PQZA 4KTEL 1CFQA 2XI9A 3KJ6L 1CLOL 2UY6A 1K4DA 3ZE1E 2GAZA 1CICD 2AP2A 4N5ED 1KBGH 4AQ1B 4QLRA 4BH8A 3MV8B 1FFQA 4XMPL 2V9RA 4QOKA 3RU8H 2AXFA 3S96A 1B4RA 3U1SL 4ZSOA 4E9LA 4OZGF 4EIGB 1T0NA 2YXMA 4XVUD 3IRZA 3CSBA 3EO9H 3ARWA 5DMIH 5SWSB 5H2BA 3ARGB 1LO2H 1YQ2A 4PBVC 5TH2A 1G7IA 3B2UD 4ELMA 4ZUUB 3MOQA 1IAKA 4JO3L 5I1GL 8FABA 4ZDHA 3DVNB 3DGGA 4APQC 1CGSH 3MLXH 4Y4KC 5KVDH 2FIKB 3U30C 3UC0H 1KCLA 2VLRE 4Y2DD 3LIZL 3S3JA 1I3UA 4FNLH 1C08B 4OAWA 5DMKB 5MENB 2HP4A 4GSDH 2IGFH 2RQ8A 5DJ0A 5DQDL 5I1KL 3RVXC 3KR3H 3Q6GL 5IHUL 4EVNB 5HPOA 5IW6A 3RX7A 3QZWA 4MXVE 3O9WD 4HXAH 4S2SB 3H9ZA 2BRQA 2NY3D 4GS7B 3ARFD 4BFGA 2Y6SC 4TQEL 4HPOL 1XR9B 3OXSA 1S5HA 3B9DA 2NTSP 1MIEH 1E4XI 3UPCA 3LKOA 3MJ7B 1Z9LA 4J4PA 1C5CL 1P2CA 5IHZB 2AVGA 5ENWA 1ZANL 4DGVL 4PGBA 1ZLUH 4MA1C 4NQSA 2CMRL 3H9YA 3CVIH 1OOAA 4G5ZH 4Z77B 3A6BL 4Q9BA 3MUGB 3W0WE 3W5NA 5IOPB 4JVPA 4OQ1A 4U1MA 5I1AB 5FB8B 1H8NA 5IVXB 5E99L 3BZEA 4FFYL 2VDKL 4F8QA 1I85C 4BELD 5A3IC 4R0LC 5DGQA 1Z9OA 3FO1B 4YPGB 4UDTA 2B5IC 3F58L 1U8NA 2OI9B 3WFDH 3N1MC 4NQDB 2A2QT 1D5XB 5A2IH 3AMKA 4QRPB 1BEYH 1JF6A 4PB0H 1QSVA 1WJ3A 3KLDA 1MHPL 1A1NA 4JZOB 4NQVB 1ZS8A 1MFDL 2AK4E 4KUZH 1UCBH 4LVHC 3LKNB 3GSRA 1BZQK 5TDPA 4FQIH 4YE4H 4TSAH 1KIQB 5IBLD 5B39B 4KAQL 5CILL 5I1LA 1NGZB 1KXQE 4JRXB 4RFEB 4LRIA 4XWOD 4YNYB 5EA0L 4JZNB 4OLVL 1AGDB 4NOFA 5EZOH 3VFWA 5SWQB 3D3VD 4XBEH 5E2UH 1YC7A 1N5AB 1WBXA 3P4OB 4NFDA 4WI5A 5K9OB 1RJYB 3I02B 4UDUA 3C9NB 4HZAA 3VFPA 3SHSA 2EYRB 2VDOL 5JOPD 1FBIH 2R0WH 4G7VL 4KK6C 3BOVA 4F2MB 2JELH 1CWVA 1P84K 4NO0A 3I2CH 2NY2B 3B9VA 2NY4D 4GXVH 2V5SA 4HK3N 3GMNA 2CK0H 2VXTL 3MGTB 2BNRB 4H26B 1DL7H 1P4LB 3HN3A 4PD4K 4Y4HA 1L4IA 1CD9B 4LSUL 2VQUA 5F89A 2XKNB 1NFIB 2FO4B 3U6RA 3LV3B 1T7YA 1I1YA 1GOGA 5D7LA 3VE0A 4XNQA 3WJLA 2YN3A 5EG6C 1Q1JH 2YBRB 3BPLC 1T89A 3NACH 3S5LG 1JZ6A 1DANU 1DQML 3C8KB 4WHYH 4S0SD 3DV4A 2YSSA 3OKKB 4XWGL 4ESKA 4PJDF 5FO8B 1I9JL 5I6XC 3TH3T 1F13A 2EE3A 1UVQA 5E8EA 5LQBL 2EDLA 4MJ2A 3UJTL 2I9LA 4AT6B 5ADPH 5IB5A 3JVGC 3T0EA 3MUJA 4Z0BL 2YZ8A 2KQNA 4POUB 4ZOAA 3U9PH 2KDGA 3OX8B 1J1XL 3WFBH 2LE9A 2CLVB 5JOEA 2JJSA 4P2RE 3PV6A 4Z7WF 3QXWA 1ZHLB 4WJ5A 3QWQB 4EOWH 5INDB 2X4UB 1OAKL 3DSFL 4GUPA 4QTIL 5CSZB 3KPRE 2PCPB 2YKLL 3ILQD 1U92B 1BBDL 2Q87A 1I8KA 4L8CA 3R06B 5DI8A 5MHSD 5GRVK 4ZPVA 1KTDA 5GXBB 3OR7B 4PRPE 1SM3H 4NHCH 4ZTPH 4GLRH 1KLGB 4G8FB 1VA9A 2A9NH 1MFAL 4N0UA 5F88A 3O45A 1U8OB 1C16B 4RFOH 2AXGB 3CVHA 4YFEA 3SDCC 4DKFH 1VGKA 1GYAA 4FTVE 3OXRA 2DJUA 3JWNC 2F54E 3Q1SL 2H32B 3HE6B 4KJPC 1TJIH 4HIIB 5I66A 3EFDH 1A47A 4GBXA 4JR9H 3GHBH 3T65A 3HZYB 4DTGH 3QWOB 4PRDB 3CVHL 4NGHH 3RWGB 5JXAL 5GHWH 3MRHB 3HAEB 1BQLH 4KMTH 1QLRA 1UQSA 4OV6F 4EI5B 4L8SA 3MGOA 3B4NA 5FO9B 3L1OH 2CO7B 4OF5A 4HJGA 1JHTA 3RY6C 5I19H 5ESVB 5KJRH 3MJ9H 3UTTB 3PV7A 5FM8A 1IGFL 3OL2A 1U95A 5HHOE 1VB9A 3O81A 4O51B 1DQLL 4OFVA 5JW3H 1V05A 4JFDB 3UTSE 5GS0D 1N2RB 1J8HA 3SE8H 5T1LA 2XPGB 4FXGB 1QNZL 3STBA 5HHVH 2L0DA 2HN7B 1XFPA 5E5MA 5J12C 3WDJA 5J1SC 1T1YB 3VXUD 4QCIB 4Q9RL 5C07A 3V5KB 2XQYK 1FRGH 4ISVA 5B22A 3O2VL 5DT1H 4MJ5B 4WENB 4PRIB 2LU3A 5FGBC 3FOLA 3MOBH 4E5XB 1MCPL 1BWMA 4CBPA 1RZJL 4YK4C 1QBAA 4LLVB 4YH6A 3I75B 2XQYG 5BO1H 1ND0A 4JFEB 1H3PH 1I1AC 1G6RH 4UV4H 2RGSA 4HX1B 5HYEA 4LCUA 2W9EL 1ZLWK 5EIIA 3L3JB 2WBKA 5HI4D 5IQ9A 1FO0B 2VDPH 3VFOB 3F7YB 1A6AA 4YDJA 1J1OL 1K8DA 4F7EA 1D5ZA 5E6YA 2NXZD 2YPVH 3LS5H 1EJ6A 1K3IA 1E4KC 5FUCC 1RULH 1CFBA 2GW5A 4HK3J 2DIJA 4DZ8B 5TDOB 3FOMB 2X4TA 3QUXA 3MA9L 4UT7H 1A02N 5HHNA 1MREH 3HG1D 1AP2B 2ZUWA 1N7ML 1RJZB 3WJJA 4TVPH 1T7WA 1D6VL 1AXTH 4LSQH 1P1ZA 1AQDB 5D4QA 3N1FC 1IJ9A 2H41A 4DUVA 5ILTH 3OJ2C 3S4SG 3GI8H 3AY4C 1CFVH 4QXGL 4MCYB 4Y16A 3RA7L 4EDXB 5E2TH 3CX5J 4FQLH 4K71B 1NMCC 5CSBA 2RFXB 3VGFA 3HI1A 4X4XA 1FIGH 1R3JA 5MP6L 1DLHA 2VLJB 2J12B 4C58B 3VWJA 4RSVA 5IV2B 4N9OB 3QIUB 4U1JB 2W9DL 4ZOCA 1CD8A 4YBQD 3SDDC 2AJVH 3EYVB 3V5HB 1DUZB 4UNVA 4PJ7A 1G7PA 2Q76A 1ORSA 3GK8H 1XGUA 3LKQB 2RB8A 3O0RH 3JWDH 2WUCH 1D9KB 4WEBH 5C9JB 5DEGB 5CIPA 5DUML 2DL2A 1LE5A 3QEQA 3TFKC 3Q5TA 2OL3H 3M8OL 3MLWH 2Z0BA 3BQUC 4IS6B 4HHAA 4K8RH 3EYSL 3VW3H 5DUBA 1P53A 4LPTA 2UWEE 3U0WL 4MA3A 4RFNB 5C8JA 4G7YL 1N3NB 1A21A 1IGYB 2IALB 2J6EH 4WW2B 3RDTD 3KLHC 1FH5L 3V8OA 3FFCE 1C1EH 3BHBB 3CU1A 3O8XB 1H3UA 4BUHA 1NLBL 1U6AH 4HGWA 2A6DA 2EEBA 2PO6C 4YR6A 3TBTB 4RX4A 3FMGL 1ETZA 5J8OA 1TJHL 4I0PD 3H9SA 5C0CA 3OG6B 1LK3H 5TDNB 5DEZA 3KPOB 1MRCL 1CLYH 2PNDA 4JY4B 4NBYB 5D71H 4PTUA 1T6WA 2XWTA 2PW1A 3DX6A 5CD5D 3INUL 4GW4B 1D6EB 1A4KA 4D3CL 1JZ4A 1NFDF 3TA3C 3TBYB 2AJUH 5GGRY 3MRNA 1I1CA 1WEJL 4DN4H 1MF2L 1AFVL 5J12B 1J86A 2P48B 4KPHH 3BKYL 2FX8H 1IBGH 5IHLB 4MB4A 1T22B 1IAMA 2NPLX 5C7XH 5JQ6H 4ZOEA 3P9MB 1L6ZA 2P5WB 1ZLWH 1V7ML 1YUHB 3HZMB 3IVKB 3WIHH 3HPLB 5F1SA 2CIIB 4D0BB 4RWYL 2ADIA 5HGAB 4M02A 4M9OA 5IVZA 1CT8B 4NO3A 1U42A 3MRLA 3KPSD 4PB9L 4QHUA 3WHE1 1HCVA 1XF1A 5F3HA 4GRMB 2AQ1A 2BSRB 4XPHH 4JG1L 2OMBA 4JM2A 2FRGP 4JM4H 3TO4A 1BOYA 2AEPH 5T3XD 1OP3K 4AZ8A 3CFBB 3SCMB 5CJQL 1S9WA 1A8JH 1OSZB 2O5YL 3BXNA 1YNTA 3K3QA 1D7FA 1KACB 1I7TA 2KBGA 5FYJD 1NJ9B 3HMWH 3DURB 4M6AA 2ADJA 1E0OB 2A6KA 3HMXA 5I8OH 3B8SA 4R4BB 3CLFL 4XAKE 3BP4B 3GB7A 1BGXH 4ZFGL 1TJGH 1GH7A 3D39B 5HYSA 2CLZA 2FX7H 2NTFB 1D3CA 2IG2H 5EORH 3UTQB 1INEL 5DRWB 2F53E 5L0QC 3MBXL 4LAQH 5DVLA 4APQA 4FG6C 4Y4KA 3MXVH 2JF1A 3HMXL 1RHHB 3NCYP 3VFSA 4OFDA 1CBVL 1EO8L 1R5IB 2AW2A 2IPTL 5CLTA 1ULVA 3D2UA 4OZIB 4JFYB 5MEPA 4OCLC 1FNSH 3CFEA 2CDGA 2BDNH 1FV1B 3FB7A 4U6XB 1KPRB 5EIQA 2IH1B 1BJMA 1VFAA 2PXYD 4Y4FB 1D5BB 1DANT 5EC2A 3UAJC 1W0YT 3NH7H 3TYGL 2NY6C 1DUYB 3BQUB 1ZT7B 4FFVD 2DF3A 4Z7UA 1CK0L 5JZ7C 3BZDA 2FHFA 3DV6A 3C60B 2ESVE 4N90E 3RWEA 4QRQB 4KQ3L 4QTHA 3I6KA 5EBWB 2O5XL 5ESAB 1AGBA 3EDFA 3T04D 5IEKB 3VFMB 1JGLL 1F11A 1GAFL 1M6OA 5EZLA 3MUY1 4JHAH 1I85A 5JLZA 4JFXA 5D9SA 4CN4A 4R0LA 5CEXB 3T08A 3SDXA 4CVZB 1OAXL 1RZ8A 5LAXB 5MERB 2AJXL 4PJ9D 3QEHA 2P49B 4N0UE 3EJZC 5EZJB 1MHEA 3VH8A 2GCYA 3C8HA 4XNUL 3RPIB 4ZNEE 3A6CL 1F4HA 1UACH 4OQTA 1T2QL 3I6LE 3S88L 3V6BR 3WLBB 4HULB 3KPLB 1HK6A 3QFJD 4XTRC 5IMOB 1GGIH 3ARDB 4PJHA 3HZKA 1NC2D 2ITDB 5D7JB 2W07A 5D70H 4Q9CA 3VWKC 2M2DA 2NZIA 4XCNB 1OP3H 1KSRA 4P0DA 2VH5H 4G8EA 3WXVL 4YIQB 2J8UA 3BSZL 3HZVA 1YEFH 4OQTL 4K3HA 2OTUB 1YEDA 2XZAL 2XTLA 1CIDA 4XC1H 3ES6A 4HIXL 4NNPL 3T0AA 5FA3A 4OLWL 2XTJD 5C0BB 4QXTA 3T0WA 1ZVSA 4KGJA 1LO3H 2NX5E 5HDQH 4RZCB 3QDGA 4XCYA 5EBGA 1J8HE 3G6JA 4X80L 3UROR 3QUXD 1Y18B 1QEWB 3SGJC 3U46A 1FP5A 3AB0B 4H8WC 3QRGL 5ICYB 3GI9H 5E9DB 5I76A 1HXYA 4PJXB 2GIYA 1GCFA 4LFHG 4JY5L 1QVOB 1GGYA 3H2WA 3SKJH 5L0QB 5SWSD 3G9AB 3ARGD 4G9FE 4B5EA 2BVQB 1S7QB 5F1IB 5D1QA 1XGQA 4L9LB 3JVGA 2HFGH 3BIAX 4HW6A 2YUVA 5FCUH 3GJFB 2VLMD 5C0RL 2DYPA 3RUGB 4BZ1L 2VXVL 5D6CB 2CUIA 3ZYJA 3MRKA 5IESL 2YS4A 4JJHA 4QGTA 3LD8B 3EOTL 3K8LA 3STZA 4AH2A 5EUOB 2P46B 2DQDH 2ICWA 1BFOA 3W9DB 3JV6A 1D5MA 2AGJH 2VLJA 3DMMB 4D8PB 1A7QL 5BS0E 2ADFL 3K1KC 3QEQD 2AV7B 1CTNA 1LP9B 4OGXH 3VFRB 4U6HA 1EUTA 2ZUYA 5GGVY 3I3DA 3ULUD 2IC2A 4XCCH 5DLML 4M7ZC 1KJMB 3IU3A 3ARRA 3SDCA 4HAFA 4PRHB 2X70B 1GGBH 3OJMB 1A9BA 2YMXH 4NM4H 5HGHB 1GZPB 3IDYC 3QUKB 1A3RH 4Z78A 1V7NH 3CUPA 4RX4D 3EYOA 4LQFL 3DSNA 2HG5A 1HQ4A 3ZYIA 1JI2A 1NGQL 2FH6A 3ZLQC 1CFSA 5ITFA 2VABA 1LVEA 1GC1C 3SO3C 4P9HH 1P7KB 4JKPH 1I75A 1QO3A 4WY7H 4OF3A 4L8BA 1HN1A 3B83A 3PP4L 4NN6C 4RISL 4NQDD 7FABL 3VGAC 3U9UA 5FA4B 5C0EB 3H7LA 4QRPD 2AJZB 2ID5A 1U2CA 3LN5A 1MJUL 4U31A 4OSUH 3ZT6A 1WSST 2F5BL 3RY6A 3GMMB 4L1HA 2EKSB 5I9QB 5KSBA 3VD4A 4U7MA 2CDEB 4R3SA 5CBEA 2VZ1A 1X5IA 3U7WL 2GFBB 4JQXC 3VWKB 4MD0A 1CG9A 2ZJSL 4PJ5A 4HWBH 1P9MC 3FONB 1KT2A 4JRXD 3DIFA 4BSWA 4P2CG 3H9SE 1J10A 4FFZH 5C0CE 3TN0B 1KELL 4NSKA 3CCHA 4ONFH 1KV3A 3ULUF 2EIZB 3LAFA 1RZ7H 4J3TA 4M6MH 5GGSB 1NL0L 2EH8H 2G5BA 4NDMA 5IT2H 1EHLL 3BGAA 4PJFA 3GBML 2ERJB 5FGBA 3FN0L 2R23B 3M07A 1LO4H 1UZ8A 5I73B 4LIQH 2BCKA 4PRAB 3BESR 3THML 2IPUK 3UJIL 4ZTOH 1I1AA 2NY2D 4N8VA 1G9MH 3NCEB 4GAYB 5K59F 3ARPA 2BNRD 2AI0H 5JIKA 4AM0A 3C2SA 5JW5B 4HLZG 1TNMA 2N7AA 4I77L 1EBAA 1AQKH 2CIKA 5E1AB 4X6CB 5F3BA 1G9NC 4YQXH 1E4KA 4JPIA 2ICCA 4M7JL 1NDGA 5D72H 3K46A 2MJWA 3VXMA 1P4IH 1DN2A 1JYVA 1KTLA 2ZZUT 3IU4H 1AKJB 1RU9H 2DQJL 3PWPA 4MA7L 3FT2B 1O7VA 3QZWG 3MLPA 1WFUA 5ICZA 2CDFB 2V7NA 1U3YA 3DHMA 4P23C 4WUUA 3DX8A 4OTXH 4UUJA 2VL5B 2DBLL 3AY4A 3D2UD 3BPNC 2I26N 1J05B 4V1DB 2DI8A 1AXIB 1X5KA 2C3XA 3T3PE 2QQNL 5CS7A 1FL5A 2Y6SD 3NCJH 1LGVA 3SDDA 5EU7E 3B3IB 2FL5A 3FJTA 1O5DT 3TV3H 3S9DB 4PTTB 1A0QH 1J18A 4LLMA 4M7ZB 4LCCA 4Y5VC 4MVBC 4RAUB 3HC4L 3MGAA 3SKOB 1TVHB 2JIXB 5E00A 1OGAA 3MRRA 3ZHDA 2LU4A 1HOCB 1QZ1A 1Q9LB 4FRWA 3LKRA 4ZQKB 1OAYH 1KG0B 3HE6D 4F37F 5HJ3B 4WI7A 1LO0H 4J6RL 4RQQA 3OPZH 4RGNC 4MXWL 1NBZB 5C6WH 1IC4H 1FFPA 1UWGH 1JYXA 4X8XA 5FHAL 3QDMA 4OZFA 2PO6A 3SGEH 1NH6A 35C8L 2DWDA 3ZYOA 5ID1B 1EEYB 1I8MA 5AZ2H 2C4FU 5IMLA 4PG9B 4EI5D 5FM4A 5FYKH 1BLNA 3GMLA 4YO0A 2WINA 1Q9WB 2H6PB 1I9EA 4MDJA 3UTTD 3WN5C 4MD5B 3TA3A 2X7LB 1JRHH 3IGAA 4YXHH 5L6YL 1ZA6B 2BNQB 4U3HA 4HIHA 4JFDD 4D0DB 1CS6A 4XC3L 4GMTH 4HLZH 2NYYD 1EFQA 1A6PA 1S7VA 3REVB 3OSKA 4R7DB 5D2NE 3LMJL 1BD2A 1YMMB 1IT9H 1TVBB 3UXFA 2W0FA 4JDTL 4JKWA 5A16B 5TFSL 4HS6B 5D8JH 5AZEH 4O4YH 4KFZC 5JPNA 5KW9H 4HS8H 5EU5A 1GSMA 4PRID 2VAAB 4XVTL 3H3KA 2F19L 5IK3B 4NUJA 3BEVA 1RUMH 3QBTB 4JFED 1Y0LB 2AEWA 1JNLH 1LD9A 5F7UA 3NPZB 5ALBL 1ROWA 2HT4D 5K9KA 3K2UL 5LBSH 4QRRE 3LRHA 4LDLB 3QHFL 1MJJA 1QYGL 2WIMA 3BW9A 2UZIH 2V7HB 2EDWA 4WDIA 1TVDA 1EBPA 3N06B 4XP1L 4ZO7A 1CDCA 2J8UE 3KYKH 3LS4H 4YHNB 1IGML 3NTCL 3S8WA 1NGWB 4DGYL 4G6JL 2YUZA 3T3MF 4XZUB 2ZUQB 4OIIL 1NANI 1AXSB 3FKUS 3IDJB 1JHLH 4UAOC 5K93A 4MJIB 3V6FA 5EC1B 1RIUL 4F57L 1FAKT 3N85L 3F7QA 3QO0A 5I1DA 4OGAC 1FAIL 1G7JB 5LGHL 3G6JE 2V5MA 2XKUA 2MWCA 5EDXA 2FHCA 2WIIB 3HNTH 1SY6H 3W82A 4HMDA 2VLJD 5IW3A 3MJ6A 4XXDA 1U8PB 1MWAB 5LCVH 3QIUD 3QUZB 3CDYA 1ZA3B 2AV1A 1A6VH 3IAQA 3QSKB 4XNZB 2MOVA 4BQ8A 5SWZB 1A2YB 1T20B 4UV7H 3HB3C 4BA8A 5FO7B 3GSVA 1Y6NR 1QBBA 5CEZL 2EXYD 2WSKA 1D9KD 1QSFA 3GKWL 1B0GA 3OKMB 3E6HA 2VDQH 2HH0H 1SYSA 1X6NA 4S1DD 1QQDB 2QQKL 1I3RB 3DWTA 2H26A 4NQEB 3QEUA 1KJMA 2YD8A 4BZ2L 4UIKH 1KCUH 1IE5A 3GMPA 2VIRA 3O8XD 2XRAL 1B2WL 1J7VR 4YHPB 3RZCB 5FK9A 3HRZB 2GTZB 3OB8A 1HYSC 1FORL 1QKZH 2Y06H 1ORQA 1A7PL 3B6SA 3C2AH 1RIVH 1LHZA 4XNYL 5IIEB 3TH4T 3FQUB 2Q86B 3MRDA 1RMFH 1G7LB 5L2KE 4DCQA 5GISL 4YHYC 3O6FC 3QUYB 2N56A 2CJUL 3RL1B 5L9DH 1T83C 2HFFA 1NAMH 1X9QA 4F33A 1KIRB 3RTQB 4O2CA 2O61A 3LRGA 4GKNA 2A74A 3REWA 3L3OB 3T2NH 2ARWA 1DLFL 2X4OB 4JG0H 1DN0B 2BHUA 2P5WD 1S7XB 2ITCA 4Z8FH 3DRQB 1JGDB 4WHCA 4MNQA 2DI9A 1HWHB 1Q72H 4GW1B 1SYVB 5I1IL 1NBYB 2D31A 1VERA 4M7LT 1PKQA 3SQOL 3UJJL 1T0PB 4LKXB 3QO1B 4PBWD 2Q7YB 4WW2F 5DJZB 3V4VH 3Q48A 3UX9B 3EAKA 3V6OC 3NFPA 1X3DA 1T04A 3W39B 2EYTB 2FJFB 1BVKB 3TIDA 4CMMA 3QXDB 4G8GA 3IFLL 1V3JA 1WGOA 1VKXB 5EOCH 3EOBB 1G7HA 3O6KL 1EHAA 3TIEA 3ZHLA 2J1KA 1JWMB 2DMCA 1W2KT 5IGXL 3UZVB 4WUUD 2V2XB 1R5WB 1YEEH 3D39D 5HVHB 5K9QI 5DXWA 2DQHH 5I0DA 2P24B 4JKKA 5EBMA 4DZBA 4PUBL 3KYOA 5AWNL 5C0DA 4H8WL 5GIRA 2XACC 5KSUA 5C0AA 1FYTA 1EFXB 2CD0A 4GG8B 3NZ8A 3FAXA 5KSAC 1A1OA 3G5YB 4TPRH 3VI4F 4FABL 5C08A 1T0MB 4EIZC 1AY1H 3MXWL 2HT3C 5ID0A 3D0VB 5FUCE 5I8KH 1LEKB 2KL6A 4DKEL 3VXME 3OG4B 2VAJA 2KZ1B 3MLYH 5DZOA 4YEFA 4FQJH 4S1RH 4LNRB 2ZPKL 4Y4FD 5DD1H 4LCIH 5JUEL 1XF2A 3RVUC 3WO3B 4WHTA 5FGCE 4K7PY 5FF6A 4XP4L 3QI9B 3BQUD 1XGPA 2YA2A 5IB2B 4HH9B 1H3TA 1XCQB 5CP7A 2IQ9H 5DFVC 1F3JB 2XY2A 5F7FA 4J2XA 3C60D 2VXUL 3AUVA 1BPVA 3IFPA 1OGTA 3P4NA 1LO5B 1RK1B 2YWYA 3NPSC 2D03L 4XMKL 2R39A 5JHLH 4HKXA 2DM3A 1R0AH 4YDIH 2R2HB 5B21A 3I3BA 3TWCH 1I1RA 1FPTH 2BRRH 1MHCB 4PJEB 2WQ8A 1PG7H 4LMQE 2BVYA 3BH8B 4O9HH 1ZWIB 3TJEL 3AS1A 3BT2L 5TF0A 3SN6N 4DVRH 3N50A 1HYRC 3O4LB 4KC3B 1K85A 2NLJB 2DJ4A 4OF0A 2ED9A 3TT1H 5A2KH 3ALXA 2Y36H 4LNVA 1KYOJ 4CAGA 1SEBB 3PDOB 4ODHH 1RZGB 1MJ8H 5EU6E 1GC1L 4EQ2A 4OZIF 4JN1L 2F8XC 4HCRH 1YJDH 3MZGB 4FZ8L 4JQXA 3ARDD 4C55A 4IRZL 2N4IA 3OF6D 5D7JD 4KK8C 5JOPE 1UM6H 3BYTA 5EOTA 3FRUB 2L7UA 4OD1H 3EZJB 3A0OA 3U36B 2DMKA 5E6IB 3QDJB 2BSSB 1CZ8H 5GGSY 4Y8DC 1JWSA 3VRJB 2DQFA 1JYNA 3KXFA 4LMQI 1V8HA 4YGAB 1B6DA 1ZEAH 1CU4L 2DQCH 2Q8BL 1SBBA 2HJLB 5DD5L 1RK0B 2IQAB 1QLEL 5E4EB 3QJFB 1X5LA 1AC0A 4U1IB 5C0BD 4HS3A 3LEVH 4JO2H 3RX5A 5EIVA 4N0FB 4RMWA 3SQBA 3D9AL 3MRFB 2R2BA 3L6FA 1RFDL 3PJSA 3BRFA 2CRIA 4OCWL 4OZHA 3TJHC 5AAWA 3KNBB 1CGXA 5H35A 2X1WL 4QHNA 5E9DD 3A67H 1PEWA 5D93C 1KJVA 4NZUL 4MNHA 5C0JA 4L3CB 5TQ2L 4GFTB 4F7PB 4Y5YB 1ZT1B 3WNOA 2R29H 3KLAB 2GUOB 3DYPA 4Y19B 5KSAB 4P23A 2LAGB 3CXDH 3MRPB 1A1MB 4M61A 2YA1A 2DTMH 2Z35A 5FGSA 5H94A 2EKJA 1YN6B 5CUSL 4P2QB 5MHSE 4X8JB 3MV7A 1OB1A 3UYPA 3QIWB 1YEGL 2GTWB 5D7IB 1AD9A 3UYRL 3ILPA 1KCKA 4N0YH 1U8KA 1WBZA 3C6LC 4FP8H 3RJDA 1DEEB 3DMMD 5KTEH 2C7UB 2JCCA 5JZ7D 2JK5B 5DA0B 2EDXA 4PY8I 4JAMB 5D5MA 1H15B 4Y5VA 1QA9A 4EUPA 4YWGL 4S1QL 1HSAA 3KHOA 4X7TA 1E6JH 4QKXB 2GQHA 4JRWA 5GZOD 4PRHD 4X7EC 2YPKB 1FNEB 1YY9D 5CEZE 2V17L 1VFUA 3VH8G 5ITBH 1J11A 1U3HB 2YPLA 3V52L 5BV7C 5FV1L 4OKVA 5F1NB 4PJXF 1KCVL 2BVTA 5E5UB 4KI1A 3UBXB 4NQEA 1JPFA 5DEFB 5DF0A 4G42B 2ATKA 3PWLB 3SDAC 4ZUWA 3AS3A 5AAMA 3LKPA 4TSCL 1ZVYA 1QSFE 4PRNB 1FLRH 1BZ9A 1LDPL 3QQ4B 3RUGF 1Z2KA 3IJYA 1OAUL 3SJVB 1BBJB 3HE7C 3L9RB 3WN5A 3P0YH 3VXUE 4YDKH 2R1XB 3KWWB 3ZT7A 4ZXBC 1FVDB 3RP1A 5EUOF 2G9HA 3VWKD 4CNIA 2PTUA 4LSPH 3MBEC 1HIMH 4EI6B 1WT5A 1XGRB 1NCWL 4KZDH 1LP9F 1PX4A 4I3SH 4ENED 2VISA 1OF2B 2CKBH 3ZDXF 5GJSL 3TN0D 1RSFA 3F65A 3MLUH 2XG5A 3WLWD 1U2HA 5F7MC 4R97C 5IP4A 1IGIH 4HH8A 4HT1H 1KB5B 2H3NA 4LLYA 1DQJB 3N9GL 3VA6A 3WSQH 4PJCA 6CGTA 3FT3A 3I6GB 1A7OL 2J4WL 3X3GH 5C0GA 3MTRA 2V2TB 3L3KA 3L5WA 4UIMB 4HFUH 4XPAL 4Z0XB 4UQ3B 2OXGA 3BAEL 5J3HC 4ODSL 4XBPA 5D1ZB 1HHHA 3S36H 4U6VL 3BIKB 1WZKA 2ZP0T 4U1LB 4O02L 4NHUA 3QCVH 4HKJB 3OKOA 4Y8AA 3CK0L 4J3OC 1N59B 1AKJD 3FTGA 3DVFA 2DKSA 3OJDA 3OR6B 5C0AD 2OK0H 5DRZA 3RX8A 1BM3H 1NFDE 1S8DA 5DVMA 3WS3B 1N64L 5FFLA 2DDQH 3OKLA 3IFOB 3VCLB 1B4JL 4LHUB 3SEPA 4GKSA 3LH2L 4K7PX 5HYQB 4V1DD 1DBJL 1EH9A 3VXSB 3LHPL 2CK2A 1S7RA 2MPAL 3LZFH 2ZOLA 1ZVHA 5ESQB 1NAMB 1IZKA 3QPXH 3CX5K 4TUJB 1KF9B 2JE8A 4U1HB 3VXTB 4XNXH 1MCOL 3X11B 1EJOH 3OHXA 5TPWL 1QFWL 4RGOH 5K9QG 1JIBA 2APWA 2JIXD 2I24N 5IFAL 2WBJB 1P4BH 1A3LH 2E8YA 4UILH 3E8UH 1JZ2A 4AEEA 3MV9B 2WV3A 1AGCA 4JFZL 4QT5B 2F9BT 5E8DL 2MQ3A 1Z0MA 1FFRA 1U36A 1E6OH 5F7DB 4FQCL 1T1XA 1HNFA 2VDNL 4U1SB 4JZJB 1A6WH 4WEUD 2X89A 1MCCA 1BAFL 2VYRE 4JQIH 4LLWB 2RR3A 1MFBL 3PWNA 4KK9D 4D2NA 3AROA 2VSCA 4M1DL 3ESUF 4DKAA 3SE3C 5DJXA 4Z7NF 5IFJB 1L0QA 3GSXB 2X40A 4QF1A 2ZUSA 4NKOB 5EUKA 3PG2A 4KKBC 2FSEB 2NR6D 3W5MA 3O4LA 4HF5H 1CQKA 4LLDA 4P5MA 1ZHBB 3NAAH 1AJ7L 3MBEB 1R5VA 2Q1EA 4PP2A 3DVGA 2BNQD 3O6FA 1YC8A 4HKBB 3MLTA 4NRXB 1T83A 5AG8A 3QNYB 5DJDB 3KPSE 2X4RA 3BO8A 1YMMD 3P77A 4G6AD 4PYGA 3WHE0 4AQOA 3K81A 1FIEA 3FB8A 4OKDA 5T3XE 2X4SA 1BIIB 1R3LA 1ZT4B 3TYFA 2VOTA 4KHTL 1MCJA 4WV1C 3QXAA 5DRNB 5JORB 1WV7T 1KUMA 4O2EA 4KY1L 4B50A 1J9CT 4WO4C 5F7EH 1CDYA 5FYJE 4KTDL 1SQ2N 2BNUB 1JHKL 1UH4A 3LDBB 3V6OA 1I7UA 3MROB 1A64A 1INQB 1TQBC 1P5VA 4IOSD 2Y4SA 1MJ7L 3BEWB 4XP5L 3AS2A 3U4BH 4QRTA 2NXYB 1U8HA 2FR4B 2BOCA 3EYQD 4N8CL 3UPRB 1MFCL 4PLNC 5ISZB 1BQHB 3HR5A 4HV8A 1OTSC 4JDZB 32C2A 4JPKH 3KXFE 3EDEA 3X12A 4G9DB 4UT9H 1VGEL 2D7TH 1CDJA 2IBZY 4JPVL 4NYLB 3R0MA 2OJEA 4PV9A 3TBWB 2W38A 4OD2B 4OJFL 2XN9B 3G6DL 1FFNA 4MJ4A 4MJID 2NZ9C 4CL7A 2AEQL 3MRJB 3OTTA 4FFWD 4JQVC 4F7MB 1UXWB 3GJEB 3CFJB 5IQ7H 3B2VH 3MRBA 5F70A 4MSWA 1JNNL 1MFEL 4M6NL 1M7DA 1NLDL 4PJGB 5I1EL 1FL3B 5JA8B 2FEEL 5F9OL 3PQYB 1J0HA 1CD1A 3KJ4B 3VFTA 2VLLA 3QUZD 4EBQH 3O3UN 5D2LA 1LK2B 3IDXH 5E8OB 4MVBD 5JHDA 5ALCH 4P3DB 5CWSA 4C59B 5I30L 3P4LA 3FO0H 5SWZD 2WMPA 4Y1AA 3LB6D 4P46B 3P4MB 4HPYH 5CINL 4M5YL 5T3ZD 2I5YL 2DQUH 2EC9T 2PF6A 5CGYD 2OR9L 3SE9L 1OM3H 5IHBA 4HAGA 4D9LL 1NC4A 1A5FH 3V4UH 2OTPA 1XF4B 1JGVH 4K3EH 3ZE2F 2IMMA 3MV7E 2VUOA 1I1FA 5DFTA 4NQED 4HMCA 3IF1B 5TF1H 3O2WL 3FRPA 4F58H 1EEZB 4OCRL 2YD2A 5GZND 1RURL 1NCNA 1R24A 4NPYB 5JOFA 2UYLA 5I8EA 3RZCD 4R7NB 4NQCA 1BQUA 4I18A 4DUXA 4HLJA 2NW2B 2O26U 2JKXA 3DETC 5DSCB 2ZCKL 1GHFL 3QFJE 4P5KB 4ZAKC 4HWZB 1JGEB 1BOGB 3HCVB 1M71A 4GRLC 1FE8H 2IH3A 4TVSa 4IRSB 3HI5H 3TNMA 1RUPH 1F8TH 4MQ7A 4BUGA 1CYGA 3QCTH 2VE6B 3BPOC 2IFFL 5FIEA 3O3AB 3C5ZB 4LSRL 3QUYD 3T4YA 2YRLA 3UTZB 4AIZB 3T4AB 4QXWA 3L95B 1NUNB 3ROOB 3EO1B 3WUWA 5DD3L 3DTXA 3RTQD 3FZUD 1WCBA 3SKMA 3KPNB 4MA8H 3RBSA 2BHZA 4LGRB 2OQJB 1FO0L 3TCLB 2X42A 4DOHE 4WV1B 4LVNC 4K3JH 3PHQB 1BZ7A 5ICXA 4G8IA 1EXUB 1IARB 4R4FL 1ZGLB 3JTSA 1SEQL 2EXWD 2HKHL 2J7LA 4Z95L 1C5BH 3L5XH 1CXIA 4TUOA 1MCWM 2DD8L 1S7UA 3MV8E 1MVFA 4JEGB 3IRPX 4PJAA 4E42B 3IKCB 1EVUA 3CDCA 3VGDA 2EDEA 1AGFA 4G43B 1UXSA 3KPQB 2IFGA 4JO4H 4YDVB 5SWSE 4E41B 2APFA 1UJ3C 4GAJL 1TCMA 2E9IA 4PGDA 1T80A 2H2SD 1HQRA 2X1PA 2NY1C 5GGQH 1RIHL 3U79A 2ATPA 2FATH 2HKFL 1TTGA 4I2XA 4X4MA 3D1MC 2HLAB 3MYJA 2B4CH 3ZDYF 2Y5TB 4HKZA 2OP4H 4LARH 5K9JL 1FGNL 3GSOA 3V2AR 5MENE 2B20A 2YD4A 2Y07L 1PBYA 5FUZH 2OTWA 3FQTA 4M6OH 3H3BC 3IDMB 5DTFB 5I17B 3LOWA 2ZUXA 1EFXD 1N5YL 4L4VA 3GM8A 2FJHB 1VPOL 4JY6A 3MUHL 5IFHH 3ARUA 4Z76B 1CN4A 2QQQA 3QFDA 3BDXA 3IAPA 1KULA 1U8LA 4W6WB 4ZOBA 5TE7H 2X4QB 2C3VB 2FNBA 2NCMA 2X4NA 4JLRA 1YEIH 5JR1H 3WFEH 5B38A 4I3GA 1NGPL 3C6LA 4EDWH 4ZYKB 1VADA 1XGTA 1X5JA 1BHGA 1QD0A 5ESQA 5IR1A 3I9GH 3QI9D 3BZ4B 4K7FB 5JPMA 1IGTB 1OCWH 5IVXE 3VXTA 4NO2B 2PYEA 4IRJB 1QRKA 5K59E 4F9PA 3EO9L 4WCYH 1MLBA 2OMNA 5DMIL 3L3IB 1LO2L 5KOMC 3AREB 5I74B 1K8IB 4I4WA 4MMZC 1PX3A 2EEAA 2DQTH 1S9XB 4BFIB 1Q9OA 3O3EA 1CGSL 1IAOA 3MLXL 4QRPE 2V2WB 5KVDL 3UC0L 1DE4A 3CFKB 3JSSA 5GS2D 3QIBC 1T21B 2X10A 2C3HA 1K3ZA 2WWKT 3RY5A 4ZAKB 5HYJA 3SDAA 1TZIB 3BPCA 4FNLL 3O4LD 2ENYA 4GSDL 5E8NB 2IGFL 3C5SA 4WWKB 3L3GA 2QQLH 1PEZA 2W0LA 3KR3L 2NY0B 2JB5H 5BV7L 2B8OT 5EN2B 4WI3A 2AKRA 4XI5D 3U83A 4KHXH 4NKMA 4HXAL 3EO0A 4JRXE 2CXGA 3HE7A 1MI5A 4N0CD 3HPJA 4G6KH 2HLFD 4OV5A 1FYHB 5IKCA 3EBAA 1MIEL 4XMLH 4OIBA 3JV4A 3K4AA 4DAGH 4ZXBA 5DJYB 5IW1B 4NT6A 3WE6A 3DUSA 4R2GB 3D5OF 3CVIL 4XVSL 4G5ZL 4FQ1H 3LSOB 3QDHA 3DXAB 4FQXC 5L8KB 2Y1VA 3GGWA 4S1SH 5M94B 1LNUA 2HRPH 1KIPA 5ETUB 5E6ID 1T4KA 3QDJD 1QOKA 2XNAA 3BN9D 5C86A 1SBSH 4WFHE 1JK8B 5LJYH 5C0NC 4IOIA 1TQCB 2APTA 2W92A 3GSUA 4M5ZL 3KDMB 3WFDL 3FQNA 5HHMB 4PLKD 1KJ3H 1CXEA 4P3WA 3U0PA 5GS0H 2XV6B 3TNNB 2P8PB 1BEYL 2Z8VC 4PB0L 4PJEF 4KTEH 2QHLA 3FO9B 4X4ZA 5EWIH 3T2OA 1A4JB 4OFYA 3EUUA 1NMBH 1I7RA 4KUZL 3TH2T 4LCWA 1UCBL 4U7KA 4UB0H 3BKJH 4CVWA 3U4EA 5FKAA 5I1CH 4Z5RA 3B9KA 4FQIL 4YE4L 4TSAL 3MFGB 4JFPB 2GJ6B 4KDVA 2QTEA 1GZQB 4JDZA 5C1MB 4MNGB 5EZOL 5KSAD 4Y19D 3I50H 1EAPB 4YBLB 4R6UA 3V6OE 4EXPX 4XBEL 5E2UL 3B8YA 5FYKD 3PABB 4P2QD 4LPWA 5FGRA 1JV5B 1JFQH 1JPTH 3QIWD 4CN6A 1FBIL 2E27H 4L1DA 4JREB 2JELL 3LQZB 3T8XB 5HPMA 1NCBH 4HQQH 3KPPA 2CK0L 3Q6GH 1ED3A 4TYUA 5F72S 5AUMA 1DL7L 1G7QB 3PQYA 2CLRB 1WAAF 3LPWA 4KTYA 3X14A 3P73A 2A1WL 4ZO8A 3LCYA 3BGMA 4IMLB 5B3JF 4TQEH 4ZS6C 1Q1JL 1FN4B 3NACL 3CPLA 2R56H 1FNLA 1XF5B 2ZSVA 3D69A 1BX2A 1P7QA 2J8HA 4DGVH 4M1CD 2K9UA 3HC0B 1BWWA 2CMRH 1T66C 4OLUH 1U3HD 5HGDB 5DYOB 4YGVA 1FZMA 1N26A 1U8JB 2LVCA 4QNPF 5ERWA 3E6FB 1ZGLP 1HHGA 5ADPL 1TENA 4Q74A 3U9PL 1J88A 2B2XH 5JHDE 1TPXC 1FG2B 3LN4B 1ES0A 2VZVA 3T3ME 4Y1AE 1OP9A 5JMRA 4YHIB 1EEZA 3IJHB 1R6VA 1WFOA 3QQ3A 1JN6A 3SE3A 4EOWL 2Z93A 3RWDB 1T1ZA 4FMFA 5GS1C 4HUWB 4MWFB 4X6EA 1ZOXA 4XP6H 5I1HH 5I8CA 2FEEI 4IEFB 2DJSA 4M7LH 1DR9A 1YDPB 3SJVD 3WIFB 2IADB 5JW4N 1A7BA 43CAA 4HK0A 1ZSDB 4PV8A 1SM3L 4NHCL 5D7IF 4ZTPL 2VLRB 5HI5D 4BSJA 5I2IB 2A9NL 3S37X 3WIIH 3MLRH 1XR8A 4KKCD 4RMUA 4RFOL 4PRIE 4Z6AT 4CUCA 1BVLA 5IB1B 4DKFL 4GAFB 4PFEA 4NQCE 1XH3B 4GQ9H 4AIZA 5EA0H 4JFEE 2IANA 1X4YA 3WCYA 2V5YA 2AS5M 3W2DH 4KRLB 1XGYH 4PY7B 3GSNH 4CGTA 1TJIL 4WV1A 3ETBF 2C1PB 3EFDL 4JR9L 3GHBL 4DTGL 4HIJA 5ANMB 4NGHL 4WO4A 1HHJA 1MHHB 5GHWL 1BQLL 2YEZB 4KMTL 5HD8C 1Z5LB 3CDFA 1PSKH 2GT9B 2YD7A 3D25B 4CMHC 5D1ZD 4X6DA 1Q0YL 3L1OL 4EZMA 5C09B 4ZPTB 5I19L 4YZFE 3S5LA 5KJRL 3MJ9L 2ICEA 1U58A 3TBSB 5JW3L 5DUPH 2H9GB 5AD0B 3SE8L 1X7QA 1MELA 3NA9H 3CDGB 4Y89A 4QHKI 5HHVL 3RIFK 3T1FA 3V0AC 4HZLA 4I5BB 4L4TA 1G6RA 4PJAE 5E70A 1G9MC 3SBWC 5J11B 4KV5E 2VLKB 4U1NB 4V2CB 1FRGL 1VDGA 4JQVA 4PS4H 5T3XH 4QRSB 5KN5A 1OVZA 5DT1L 3QG7L 2GSGA 5DJ6B 2FHBA 3MOBL 4JFFA 2NMSA 3VXSD 4P4KC 4HJ0C 4PYHA 3X13A 3VJ6B 1WC7B 2IBGA 5BO1L 3C09C 4U2ZA 5CZXC 1WBYA 5BZDB 3P40A 3LEXB 1EK3A 1G6RL 4UV4L 1OT2A 1NCAH 2VKWA 4WW1B 2DLFH 4H5SA 3VXOA 2VDPL 5KS9A 1BBDH 4ZD3L 5LGJB 4RNRB 4MJ6A 2YPVL 4MXQD 3LS5L 4AIOA 5HI3C 1RULL 4ZYKA 1MIML 1B6UA 1P6FA 1DBKH 4NO5A 4F7TB 1DVFB 4WI8A 2WBJD 1EDQA 3F6IA 1MREL 1M4KA 2NW3B 3UTOA 2DWEB 2W60B 3MV9D 4TVPL 4ODTH 4A6YB 1AXTL 4LSQL 5IJVA 4RIRA 2EEDA 2OXHA 3MA7B 4X7SH 3BGFB 4HFWB 2L7JA 1F4XL 3OKDA 5ILTL 2D7QA 3ROLA 1CFVL 5GRVL 2PTTB 3ALPA 4GKOA 5E2TL 2FYYA 2HA1A 4FQLL 5FYLD 4JRYB 1YY8A 4OCYH 2CUMA 1FIGL 3QYCA 1PG7W 3NMEA 3HE7D 1T21A 4W4NA 3VFUB 2OL3A 1MCEA 3ZE0E 1S9YB 4NN7C 1OD7A 3NCCB 2RIKA 4ODXA 1UYWH 3U2SA 1IZJA 4GRLA 4LLUA 4GQPH 2J6EA 3EYFA 3GK8L 4K9EH 4P2RB 2P5WE 3BP7B 5INCA 3O0RL 3MBED 1G1YA 1IAIM 4GG6B 1FNGB 2WUCL 3TGXA 4NZDA 1DQLH 1NGXB 3P2TA 4KRNA 2OL3L 5AYUH 4AENA 3MLWL 3FN3A 1E4WH 1W72B 3KPRB 3NIDE 4K8RL 2HVJB 3VW3L 4L29A 3QQ9C 3AXLA 5HYJE 1A9EB 3FQRA 4CADB 2J6EL 3VXRA 3ZDZF 1C1EL 1UEYA 3LSOA 2DLEA 3PHOB 1U6AL 1YPZB 3O2VH 4NP4H 2DLHA 3GIVA 5C2BL 1AHWA 8CGTA 2BY3A 4CMHB 3L7EA 1LK3L 1X5GA 5DRXA 4YX2H 1A14H 4KROC 1CLYL 5F21B 2W0PA 1IGJB 5D71L 1I8IB 5E2WL 5EO1B 1LEIB 3KDMA 5B4MC 5IM7A 1ADQA 3ARBA 4ALAH 3D39E 2A83A 4ZUSB 4M4RA 3BKMH 4TTDD 3VMNA 1UJ3A 2Z31C 3MRGA 3DVIA 3WIHA 4OUUA 3LQAH 3ZKQD 2AJUL 2C1OB 3ZKMC 5ISZD 1QFOA 4DN4L 3NGBC 4MB3A 5DHVA 4NZJA 3IJSA 1UEMA 3MA9H 4KPHL 1VHPA 4PREB 2FX8L 1F97A 1MQ8A 1IM9B 3D0LA 1IBGL 4QY8A 1KJ2A 3S4SA 4HG4J 5C7XL 2P7TB 5JQ6L 2XN9D 2JB6B 3DOSA 1U8MB 1VESA 2XY1A 3PDGA 3ARYA 3WIHL 4P4KB 1NCCH 3VXNB 3RVTC 1AIFA 2LQRA 43C9A 4QXGH 1YA5A 3UTSB 3WMSA 1HXMB 3VG9B 1BF8A 5B39G 2E6QA 3G04A 4NKQB 3P11H 1X5YA 4ONGH 3PQYD 4XPHL 2VQTA 3QQNA 1EIBA 4JFHD 4JM4L 3HUJA 2AEPL 1FZJA 1LQSR 5I71C 2GSIB 4CVUA 4UBDC 5IB4A 4P46D 1WIUA 3QH3B 5BVJA 5DZNA 2EDHA 3DX7A 1HHKB 5B8CB 3HMWL 2CLRA 3UDWC 5I8OL 4H1LB 1XZ0A 4YAQB 3LPFA 4F37K 5J13C 1BGXL 1UKQA 1TJGL 3QUMA 4LSVL 2XYCA 2IG2L 5EORL 3AM8C 3EYSH 4FXKB 3CX2A 5F7HA 3VFGL 1KLUB 4K3DH 3DX9A 1S7WA 4L8DA 3ECBA 3V95A 4LCYB 1FH5H 1SHMA 4WTWA 3MXVL 1MPAH 2Y7QA 3VD3A 5T1KA 3QIBA 1VFMA 2N1KA 2P8MB 3FMGH 1DBMH 3E3QE 1K5NB 2A6IB 3ULUH 4MDIA 1FNSL 4OCXH 2XWBA 1MRCH 1FVEB 1LILA 5L2JB 3M1BB 4QHMB 1RZFH 1PQZB 1CLZH 2D0GA 4PJGF 1CFQB 1F3DJ 3D18A 4IRSD 5HGBA 2ZG1A 3NH7L 4OCNC 5F96L 1FLTX 1K4DB 2GAZB 3C5ZD 4MAYC 4BK5A 1DDHA 4BH8B 5EH1A 1KYOK 1J0KA 1KIUA 4QOKB 4ELKA 2AXFB 3CC5A 5DO2C 3BIBX 1JMZA 1H0DA 3S96B 4YDLB 4GKZA 4X0KA 4ZSOB 2DLGA 5AYQA 3RVVC 1T0NB 4FQXA 3RIAF 4U7SA 5GRUH 3SOBH 3WJLC 5C0BE 3O41A 5H2BB 1AO7A 1ZKAA 5TH2B 3M45A 5FDWA 4ELMB 4Q7DA 1IAKB 2BSTA 4BKLA 8FABB 3NCBB 4ZDHB 1NGYA 3DGGB 3QR2A 3L3DA 4JHAL 4K2UH 2P8LA 1J87A 2GHWB 4OAWB 4PJXE 3OZ9H 3OMZA 4F15C 5DJ0B 2YUXA 3WDHA 3W0WA 2R2EA 5IW6B 3QZWB 4M3KB 3MRIA 4ZFOA 4LSSL 3SPVA 1UACL 2IANE 3D25A 1PVHA 3U7AA 3HAEG 3OXSB 1S5HB 4X98A 1GGIL 4GLRI 3LKOB 1P2CB 1X4XA 2K1MA 2Z91A 5ENWB 4S0TD 4PGBB 5JDSA 4NQSB 5D70L 3BP5A 3H42H 3CFCH 2UVEA 4GMSL 1S5IH 1SJEA 2VH5L 5BZWA 5DC0A 4PG2A 4ZFOL 1YEFL 4U1MB 5IJKC 2ADGA 3BZEB 1QFUH 5T5FH 2AK4A 2W65A 5EBLA 3STLA 2JJWA 1LP9E 3VFNA 1CBVH 1KCSH 1EO8H 3ZDXE 3V79C 1W0VA 5EPMA 4UDTB 3IETA 3PXJA 1LO3L 1U8NB 5HDQL 3NVQA 3BJ91 1L7TH 2VJXA 3S97C 3NIGF 4OZ4A 1A1NB 4X6DF 3W9EA 5BXFA 1ZS8B 3TYGH 2QLVB 1QR1A 3GI9L 3NBNA 4TULH 2B1HH 2HTKD 2IMNA 4IRJD 4WFED 3GSRB 5TDPB 5DK2A 4NM8L 3SKJL 3OAUL 4JANA 4LOUD 3ARED 1G6VK 4LP5A 3IYLW 5I1LB 2RCSH 5CJ8A 3AU1A 4Z7VA 4LU5H 3VFWB 4UTAH 2HFGL 3P0VL 5FCUL 4TVPE 3IDUA 4FQQA 5KS9E 4ZAKD 4PJBA 3MX0A 1CGTA 2A73A 3VFPB 5MEOA 3QRFM 2J5LC 4WWKD 5GGVH 1INDH 1OAXH 3WD5H 5GS1A 2NY0D 1PJ9A 3VI3E 3QNXA 4NO0B 2AGJL 1A6TA 3QHZH 3GMNB 2VL4A 1T5XA 1HHIA 1PKOA 4Y4HB 2H32H 5HY9A 5F89B 4GRWH 3BH9A 3U6RB 1JF5A 2EO9A 5CZKA 1I1YB 1G7MA 5D7LB 4XCCL 3VE0B 4XNQB 1OWRM 2X9XA 2GITA 4R2GD 4AL8H 1MCSA 1GGBL 3DXAD 3DV4B 4NM4L 2YSSB 3ZTNH 2R4RH 4CU7A 3VDCA 3SY0A 1UVQB 1A3RL 1V7NL 5E8EB 2YR3A 4U6YA 2MQCA 5EU4A 1MEXL 3MRQA 2I9LB 4A2MA 5IB5B 2H2PC 1XIWC 3T0EB 3DYMA 4PRPA 4P9HL 1DQDH 2ZG3A 4JKPL 4WY7L 3PV6B 4X6CE 5GRZA 3QEGH 2ICES 5HHMD 1QFPA 2EE9A 4WJ5B 3K4DA 3C87A 5F44A 3D6GA 4GUPB 3RKDD 4FTVA 2R0LH 3ZT5A 2F54A 5CBAA 1I8KB 4L8CB 5DI8B 5DQ9A 2GY5A 4JHBA 4ZPVB 1KTDB 3VXRE 4XNMA 5DD0H 3FFDA 3JV5A 5IG7A 4N0UB 1HSBB 4V1DE 5F88B 2GJ6D 3O45B 4OT1H 3CVHB 4LPUA 4KMQA 1VGKB 4FFZL 4PGCA 2IAMC 1L6XA 3OXRB 1KPVA 3PDDA 4ONFL 3SBWA 4UQ2A 4IJ3C 1DP0A 1RZKH 1RZ7L 4M6ML 1HILA 5L7XH 1TITA 2EH8L 5IT2L 2WQRA 5KAQF 1T1WA 5FV2A 1JF1A 4WGWB 5I66B 1LO4L 2EZ0D 4GBXB 2BY1A 5HHOA 3T65B 2K7PA 4YC2C 2YD6A 1GRWA 1HXMA 4ZTOL 4QWWC 1AE6H 1G9ML 4JPWH 3GIZH 5FOBA 1QLRB 1EZVX 4BSVA 1UQSB 1MCLA 4L8SB 3MGOB 4CKVX 3HNSL 3VXPA 4HJGB 1JHTB 3QT2A 5HHQA 4YQXL 5D72L 1U95B 4CN1A 1MUJA 1N6QH 5ABDE 2R8SH 3ULVD 3IU4L 2QR0A 3G5XA 1RU9L 1J8HB 1NUGA 1FCGA 5T1LB 4DN3H 5CJOL 4WI2A 4R4NC 1CVSC 3VRLF 3JTTA 5E5MB 4OTXL 3NCMA 5BRZA 1XEDA 5C07B 3RGVC 2CRZA 4ISVB 2XZQL 4ODBD 5DD6A 2GI7A 1MSPA 3V7AG 3FOLB 2VTFA 2WM0A 2BNQE 4KJWC 1L7IH 5IF0B 5A2LH 3JV0A 4XVJH 1K2DA 1ND0B 3DGCR 3NCJL 5F7KC 4KK5D 1GIGH 4KVNH 1NEUA 4LCUB 2FEDD 5EIIB 3TV3L 1A0QL 1MJUH 4M9PA 5IQ9B 1T7VA 4KRPB 1UENA 3ZSTA 1OLZA 1A6AB 2JJUA 2VLRD 3H3PH 1K8DB 4YDJB 4F7EB 1D5ZB 3L5HA 3EYUH 2DN7A 2R0KH 5F9AC 3UZEA 3T09A 2X4TB 3DARA 3QUXB 5HHNB 7CGTA 2BY2A 1OAYL 5E0QA 1OTUD 1P1ZB 3DUHA 5C0ND 1LO0L 5HDBF 5EU7C 3OPZL 4UNTA 3ULVF 4CRPA 1UWGL 3ZE2E 3D85A 4Y16B 3FCTB 4RRPG 1F6AA 1JP5A 2GK2A 3GBMH 2A9MH 3C5JA 3ZE1F 3QAZC 3HI1B 4X4XB 3WNNA 1R3JB 1DLHB 2MHAA 5AZ2L 3VWJB 4XPBH 3QP3A 5FYKL 2ED8A 3H9HA 4GO6B 2UWEA 4N5UA 5C09D 2Z31A 4MJIE 1AO7E 4PJ7B 1G7PB 2Q76B 3FFCA 1JRHL 1ORSB 4YXHL 1XGUB 4LKCA 5C0IA 3G6AA 1URLA 5IVOA 2BY0A 4GMTL 4WHYG 2F74A 2NY5H 5CIPB 2VERN 1I3VA 1LE5B 2PTVA 3QEQB 3NFSH 3PGCA 4CW1A 3GKZA 2COQA 1IT9L 2A6JA 1L9MA 2QSQA 4HHAB 4MA7H 1TNNA 3KPMA 5DUBB 2VLKD 3WHXA 5D8JL 4MA3B 3VDAA 2N7BA 1GOHA 4O4YL 5AZEL 5C8JB 5KW9L 3WFCH 1P84J 5F9DC 4BH7A 4YC2B 3E2HC 5SWZE 5DMYA 4MXVF 4UOJA 4HGWB 2A6DB 4P5TC 5E08L 1RUML 4YR6B 3HLAA 4NC0B 1ETZB 2BOBA 3H0TA 2AXJA 1JNLL 3H9SB 5C0CB 3U82B 2DKMA 3O4OB 5A1AA 4I1NB 2A77H 3HC3H 3O2DH 1IEHA 5LBSL 2DQGH 5IMKA 5D2NC 4PTUB 2XWTB 5I1JL 2PW1B 4JFOA 5CAYB 4J3VA 3DX6B 4NWUH 5I75C 3U0TA 1FSKC 4X7FC 4YXKH 1CQYA 1A4KB 3GMOA 1CDBA 3UDWA 5E2VL 3KYKL 1DVFD 3LS4L 3MRNB 1UB6A 4LBEA 3CH8A 5LGKA 4C56A 4R8WH 1II4E 1SY6A 5D1XC 5BCAA 3F7VA 2KZWA 3P0GB 3AM8A 4PJ8C 5F97E 1JHLL 1ZV5A 3JUYA 4ETQA 3P9LA 4MD4A 4HJJH 2WK2A 2BC4A 4P4RA 4MXWH 5F6HI 4JRYD 3ZDYE 2ADIB 3GJFK 5IVZB 3HNTL 1SY6L 5GSVA 4JN2A 4NO3B 3MRLB 1WZ1H 4QHUB 3LKSA 2EDKA 4M48H 5F3HB 5LCVL 3CFDA 3KVQA 4JM2B 3U48A 1A6VL 3TO4B 1HZHH 4UV7L 1R3IH 3BWAA 1KEGH 1S9WB 4P2RD 2F53A 4WNQA 4OZFH 3BXNB 1YNTB 4Z7VE 3QULA 4MAYA 1H5BC 2XT1B 1I7TB 5L6YH 3FT4A 2HH0L 5D96C 2ADJB 3UP1A 4ZUVA 2A6KB 2VR4A 3KPRD 4X7CC 4PJBE 2VR5A 3GB7B 4U1GC 5HYSB 2CLZB 3L5IA 3ZTJG 2BVOA 5SX4H 2ZOKA 3EJYD 4UIKL 1KCUL 4TNVF 3ULSA 2DIBA 5DWUH 2B1AH 3MLSH 1UZ6E 3QAZB 3PL6C 4APQB 2QBWA 2MTPA 4LSTH 4Y4KB 3U30B 2FB4H 3ZO0A 5D1QC 2ZCHL 3MPCA 4EJ1C 4I9WD 3TBVB 3VFSB 2WP3T 1SMOA 3DI2B 4KKLC 2Q3ZA 1AR1C 1QKZL 3D2UB 5LVEA 3RGHA 3C2AL 4LFHD 5MEPB 3MODH 2ESVA 3TEUA 2DBJA 3ELAT 1Q0XH 3MMEA 3CFEB 3MNZA 4QXUH 2CDGB 3IDNA 3FB7B 1RMFL 1T2XA 1VFAB 2XA3A 2I07A 4IIQC 5EC2B 4D0CA 4RAVA 2WW8A 4Z7UB 5L9DL 5FKPA 3TZVC 1HE7A 1IM9D 1Z3GH 1J8KA 3DV6B 5E7BA 3T2NL 1IM3A 4MA1B 3BKCH 4JG0L 3RWEB 1C5DA 4GG6F 1HSBA 4Z8FL 3MACL 4QTHB 3I6KB 4P4KD 1RIUH 1AGBB 2HFEA 5HHOD 4F57H 1Q72L 1OP5K 5IJKA 2MQ0A 4MHHI 4ZNEA 3UTSD 1NEZA 2BXZA 4G80A 1F11B 1M6OB 5EZLB 5HDLA 4GRWB 5JLZB 3OJVC 4JFXB 5DMGC 2YA0A 5D9SB 2EDOA 4R0LB 3RKPA 3V4VL 4OD3H 4XHJC 2B5IB 3SDXB 4JFQA 1RZ8B 3QEHB 2AEIT 4KI5D 1YPZF 4P59H 4LF3A 1UWEH 4KJQD 4EXKA 5BQ7A 1MHEB 1IAII 4LIQE 3VH8B 2GCYB 2PR4H 1KB9J 5EOCL 5E24E 5J56B 2BVPA 1M7IA 4LVHB 3GJFH 2R9HD 2R4SL 5L88H 1JPGA 1TZGH 1YEEL 1CICC 4WTXA 4N5EC 2FX9H 1I9IH 1V5JA 4PJHB 3HZKB 1NMAH 3SGKC 5M7QA 4N1CA 2NX5A 2A0LD 1S3KH 2F8OA 4BZ2H 4G8EB 2J8UB 3HZVB 1YEDB 1B2WH 3IXTA 3J7HA 1SVCP 1CXLA 3ZTJH 4XPFH 3TPUA 3ES6B 1KNOA 3TLRA 5FA3B 4K7PH 5FECA 1AY1L 3L3HA 2I9TA 5I8KL 3FHAA 5JQHC 3MOAL 4QXTB 1ZVSB 4MLIA 4N9GA 3MLYL 2VNCA 4FQJL 4Y2DC 4S1RL 4G9FA 1NUDA 3ABZA 3QDGB 4XCYB 2Q6WA 3HI6H 5DD1L 5IF0A 4LCIL 1JCKA 3G6JB 1IC5L 1UKSA 2E5EA 5D96B 3U46B 4NCDA 3QDJE 2DB8A 3NABH 1UJTA 2ILLA 4HUVA 2LTQC 3DO3A 1JL8A 2IQ9L 3O9WC 4L9DA 4QOKD 4KI5F 5BRZE 2Y25A 5I76B 1QLFA 3BPLB 1HXYB 2NY3C 3ARFC 5J6GA 1WAAE 2H8PA 4PP1D 5I6XB 2FZ3A 3G5ZA 5B3JE 5LWYH 2EE6A 3SKNA 2HMID 4HUNB 4CVXA 4YDIL 5D1QB 1XGQB 1FNHA 1TDQA 3TWCL 1FPTL 2BRRL 5BS0A 1XIWA 5CD3A 4AEFA 1PG7L 5CEYA 5DR5L 2DYPB 4O9HL 5DA4A 2Z4QA 3QJHA 3CZFA 1KCRH 2BZDA 3MRKB 3FCTA 5DJAA 4MQTB 3TT1L 1IQWL 2Y36L 5CCKH 2VDRL 3ZKMD 4E0RA 3STZB 4AH2B 5J4MA 4WFFD 2ICWB 4PLJD 4ODHL 1BFOB 5KG9A 3JV6B 1D5MB 1MJ8L 5DHYA 5GGUA 5F7YC 1WFTA 4U2YA 1OP5H 4Y19E 2I25N 4HCRL 2AK1H 1R3HA 1OTTD 1YJDL 3WFHA 5DJ8A 5FYKE 4U6HB 4P2QE 1U8QA 2W0KA 4J4PD 1MQKH 2UV3A 5IGXH 4TTGA 5JMOC 4LCCC 2ENSA 1ONQA 3IU3B 1SMAA 4GW5A 1UM6L 3RVTD 3SDCB 5FUOH 2VXSH 4R90H 5D7IE 4OD1L 1A9BB 2IAMA 1NCUA 4NZTH 3VDBA 2Q20A 4LVOC 3ARTA 5IBLC 1UG9A 4Z78B 1CZ8L 3O6LL 3IAGC 1N0XL 3CUPB 3EYOB 4NWTH 2HG5B 1HQ4B 3CLEH 4XWOC 1ZEAL 2DQCL 1CFSB 5ITFB 2VABB 4AK1A 1L9NA 1CL7I 4FABH 3ZKXC 4ELMF 3LEVL 4JO2L 1AD0A 1QO3B 3SGEI 1FQ9C 2D7PA 3T2QA 4L8BB 2B4CC 1E27A 1YYMH 1MLCA 4YFLI 3RWCA 3MREA 3U9UB 5E5RB 2ZCLH 1QSEA 4IHOA 3LN5B 4RAHA 4M4PA 5JUEH 2NY4C 1RHFA 3PWUA 1RUKH 3K8MA 5KSBB 3GSQA 3T2PA 3A67L 4R3SB 1BFVH 2O5ZL 5CBEB 1S7TA 4QYOA 4R96A 5EB9A 3CAFA 1JRHI 1S9VA 4MD0B 1CG9B 4WEMB 2QV2A 3VXQA 1FL6A 4PJ5B 3NZHH 1KPUA 1KT2B 3RY4A 5KVEL 3DIFB 2R29L 4BSWB 3OBAA 3CXDL 5FOJA 4NSKB 2DTML 3CCHB 3X17A 5EOQL 3GUTA 3SKUD 4Y5XC 3RGVA 3SJVE 2G5BB 1N8ZA 4XAKD 3VFVA 4NDMB 4PJFB 3MCG1 1UZ8B 2FLRT 4YK4B 5EULV 3BT2H 5C0FA 2BCKB 2VITA 3RWIA 4UINH 4AEIH 4N0YL 4HC1H 4NO0D 1I1AB 4FP8L 4C56E 4N8VB 3KYMA 4J23A 4YHZL 5KTEL 1WTLA 4AM0B 4Y4HD 2C4XA 5LXGH 3V6ZA 3UBXI 1WIPA 5IEHA 2CIKB 3ILQC 1IRAY 1SJHA 5D7LD 5F3BB 4JPIB 5T1MA 1NDGB 1X5FA 3VXMB 1I9RL 1WZMA 1KTLB 2XFXA 5ITBL 1QRNA 4PRBA 3PWPB 3PGDA 3HFMH 2XZZA 5ICZB 2IEPA 1JNHA 2V7NB 3ZKSD 2R1YA 4WUUB 3E0GA 3DX8B 4UUJB 3BUYA 2Z9TA 4KJYA 3T0ED 4JGUA 2CGRH 5BW7A 1C7SA 1NAKL 2WWMD 5SV4A 4RMSA 1NMCB 4ZFFA 1J5OH 2NNAA 3ARQA 4TRPH 1HDMA 3QXVA 5DDHA 3EFFA 5J6HA 1FLRL 1DFBH 3TBVA 1FL5B 5JO5A 1RFDH 3SDDB 4OLYH 2CKBA 3AAZA 2FL5B 4J8RA 1AI1H 1MAMH 3FB5A 1ZK9A 4LLMB 4YDKL 3G08A 4LCCB 2B7DT 4JE4B 4KKAC 5DS8A 1CVRA 1EO7A 3PWJA 4ODUA 4JVWA 1X5ZA 4LSPL 5E00B 1HIML 1BFSA 1OGAB 3VXSE 3MRRB 1RUAH 3OGCA 4KZEH 1LEGB 1YECL 4I3SL 3ARVA 3R1GH 1U8IA 2CKBL 3UMTA 5TGBA 5GS0C 5EU6B 3X3FH 3LKRB 1PYWA 2BMKA 1A7NH 2XWJA 2ZSWA 5I16A 4X5LA 1IGIL 4U4BA 1PD6A 4RQQB 1GXEA 1G9NH 1NDMA 2AABH 1WQVT 4HT1L 1CDIA 4FQHA 3WSQL 1FFPB 3S3PA 2YK1H 4GBXD 4P5TA 3QDMB 4OZFB 2PO6B 2APXA 3PHSA 1NCDH 1AGEA 2DWDB 3X3GL 1I3GH 4HFUL 3BVNA 1I8MB 1HKLL 1ZXQA 5IMLB 5D2NA 1BLNB 1CDUA 2Z92A 1U3JA 3GMLB 4U1KA 2WINB 1YMHA 4YO0B 4MDJB 3W11D 5C3TA 1W0WA 4HDIA 5HI4C 3TA3B 3IGAB 4H25A 4MX7A 2P5EA 4MLSA 4QRUA 5HHPA 4HIHB 1KN4H 4TOYH 2NXZC 1J8HD 5D1XA 5T1LD 3RPKA 1QTYT 1FC1A 2OK0L 1BM3L 2UVFA 1S78C 4PJ8A 4Y5XB 1S7VB 4NRZA 3T0DA 4MHHG 1T2JA 1BD2B 2DDQL 5AG9A 1MWAH 2W0FB 4X5WA 2VZTA 4QRRA 2EYSA 3QG6A 5C07D 5JPNB 5EU5B 5J57B 1K6QH 3EOAA 5T3ZH 1WICA 5E56A 3LZFL 4NUJB 1A6ZA 1J0JA 1QHOA 3BEVB 2VQ1A 3QPXL 2OCFD 4AMKH 1LD9B 1BECA 2DAVA 2VSDA 25C8H 5K9KB 4XNXL 2QHRL 1JTTA 4KRPD 1MJJB 1NKRA 1IEBA 1EJOL 4UMGA 3BW9B 4XGZA 4YBQC 3MR9A 4RGOL 4ZS7H 3GBLA 4WDIB 1H5BA 3O3BA 4L3EA 1P4BL 4M8QA 1A3LL 4Q9QH 4UILL 3TO2A 3E8UL 1FFOA 4XH2A 4P9MH 3L7FA 4PJIA 1NCWH 3KLSA 1GOFA 3G5VA 1UM5L 1B90A 1E6OL 4NBZB 3V6FB 4LRNH 1A6WL 3PL6A 3QO0B 2HT2D 5I1DB 4Y16D 5TQ0L 4JQIL 4RGMC 3UEZA 1C8PA 3N9GH 3RDTC 3ZKNC 5IVNA 2PYFA 5ISZE 1BF2A 1DSFL 1ZHKA 3RIFF 5E94A 5J9PA 1RJLA 3MRMA 4XXDB 3VWJD 4XBGA 2BVUA 4I0PC 5JNYA 4O5LL 1IKFH 4HF5L 4ODSH 2AV1B 5C6PB 4P48A 3GMRA 3NAAL 4K55A 5ACZA 4P2YA 1HI6A 4IIQA 5DK0A 3QWRA 3GSVB 4O02H 2NY6B 4X9IA 3DUUA 4XCEA 4OZGA 5CD5C 3EW3B 1QSFB 6FABH 4L5FH 1VEOA 1B0GB 1PZ5A 3E6HB 3TZVA 1SYSB 4Y2OA 1FZOA 4PJGE 4W70A 1DQQA 4K23H 4Z7QE 3RWJA 2IJ0C 3PP3K 4U49A 2H26B 4XRCA 3IKKA 3QEUB 3TVMC 1N64H 2AJYH 1E4JA 1GGCH 4P3CH 3GMPB 1B4JH 2VIRB 2Q8AH 1JBJA 4DVBA 4MCZA 5L2KA 5MI0C 2FGWL 4M7KH 4HG4K 5F9WC 2MCPH 1D5IL 5F7EL 3QPQD 1RZIA 5FK9B 3WEXA 1EGJA 4O2FA 2R1WA 3H9SD 2PW2A 5C0CD 1CE6A 2BJMH 4X6BA 1ORQB 5EFIA 3B6SB 3IDIA 5EO0A 3U4BL 2VO5A 3WKMH 3MRDB 1IAIH 4U0RC 5TE4H 4DCQB 4OI7A 2FWOA 4M3JA 5E4IA 4ZNCD 3M17A 1EGJL 1RJCA 1MH5A 4JPKL 5EO9A 2OSLA 4UT9L 3JXAA 4BZYA 1CICA 4HWEH 2D7TL 5CHNA 2HFFB 4F33B 4O2CB 2O61B 2WUBH 2A74B 4GKNB 3REWB 4PJ7F 3SGKA 3MLZH 4AG4L 5HHXL 1OAQL 2C9AA 2ITCB 5IQ7L 3B2VL 1U93A 4MNQB 2D31B 3RVWD 4LLQA 1QSEE 1PKQB 3B9AA 3MJGX 4H0HB 4Q6IC 3MFFA 4EBQL 4LVEA 2I60H 4JM2D 3IDXL 4AEHH 3TO4D 3NFPB 1T04B 5ALCL 1QHPA 4Y2DA 5C70A 4WIQA 3FO0L 4ODWA 3VGBA 3TIDB 4HPYL 4CMMB 2VDMH 4G8GB 2DQUL 1WVZA 3MV01 1OM3L 2RJMA 2HJKA 1B88A 4HBCH 1G7HB 4OBSA 1A7RH 1U91A 1UC6A 3O9WA 2PXYC 3TIEB 1A5FL 3V4UL 3MNWA 5CP3A 3NIFE 2CSPA 1JGVL 4NNXA 2HAZA 4K3EL 5GS2H 3ARFA 5E03A 2IPUG 3VGGA 4XP9H 4FFVC 5TF1L 3HNVH 2YZ1A 3Q6FA 4LEOA 1MY5A 4F58L 2BP3A 5EBMB 4DZBB 3CSYA 1HH6A 1YNKH 3KYOB 5C0DB 5GIRB 3LPGA 4APQD 1PLGL 3QHTC 5C0AB 1FYTB 4E41E 2YC1A 5KSUB 4Y4KD 1TTUA 3NZ8B 4I48A 1FZKA 4OF6A 1A1OB 2GJZB 3K0WA 3V4PH 5C08B 1HEZA 1KTKE 5ID0B 3RVXD 3UBXG 3PP3H 4KQ4L 1FE8L 4XP5H 1QRNE 3O6MH 3HI5L 3IDGA 5J7CC 4PJ9C 1RUPL 1F8TL 2E6PA 1XF2B 3QCTL 4HEPG 4WHTB 4X9GA 5FF6B 2FLBT 4JM2F 1UWXK 1XGPB 4PJDA 1MCDA 1CI5A 4H20H 5CP7B 3S37H 1DBAH 5DJCA 1M05A 4MA8L 5MEQA 1VGEH 4JPVH 1HH9A 5T1DH 4K3JL 3DBXA 4X99A 4OJFH 3IFPB 5JIIA 1OGTB 3IDYB 1WF5A 3NFNA 3P4NB 1QP1A 3BZFA 5DJ2A 5F9WB 5F7WC 2D0HA 5H37H 1K4CA 1FDLL 1LEGA 4Z7WA 1CXHA 4HKXB 4M93C 1C5BL 3L5XL 1IQDA 2VZSA 4J12A 5EU6A 1CE1L 1XF3A 3D3VA 5A3ID 2QSTA 1J1PH 3SO3B 2P44B 2QSCH 1CL7H 3OKYA 5D7SH 1QPPA 4NN6B 2J3SA 5DK3A 4JO4L 3VGAB 1F4YH 4PGJA 4LASL 2XTJC 1JPST 1QBLH 5IMMA 2EIDA 4WFGE 2DQEH 2OR9H 5GGQL 3SE9H 2FATL 4WU5A 3RL2A 3RWHA 2B4CL 2RAMA 4X9FA 5EOCJ 4LAJH 4A2LA 2HJFA 2OP4L 5ADOL 4Q2ZA 5FUZL 2VRAA 3FL7A 5EOTB 4M6OL 2P45B 4ZG1A 4Z7UF 2CO6B 4HUXA 4EEEA 1WT5C 3ARGC 1F58H 2ED7A 2D9CA 4Y5XA 1JWSB 1RURH 2DQFB 5IFHL 1NQBA 3KXFB 1BREA 1IEAA 4NKIH 5TE7L 5JR1L 1YEIL 4KK6D 3WFEL 1WWBX 1F3DH 3DI3B 4HS3B 3NN8A 3QCUH 1GHFH 2VZOA 2P5EE 4JO1H 5KBNC 4EDWL 4PBXA 1LE9B 3QDGD 4LHUG 3H7BA 3DXAE 4GRWF 9CGTA 2R2BB 3L6FB 2E9JA 3PJSB 5HXMA 4X4YA 3SDXF 3CNKA 4F7CA 4OZHB 5JIPA 1XAUA 4LL9A 5H35B 4QHNB 2IPKA 4GS7C 3N1GC 4NUGL 1KJVB 2GK0A 3V0VA 4WCYL 5DD3H 1NKOA 4MNHB 5ACMA 5C0JB 2VN7A 2XQBH 3RNKA 3AVEA 4JGMA 1T5WA 2DQTL 4HIEA 5D1QD 4P23B 5GRXG 4M61B 2Z35B 1AR1D 4HUUA 5H94B 3MCKA 3BPNB 4PJHF 3C6SA 1S7SA 2DYPD 1RAMA