1ZDSA

Crystal structure of met150gly afnir with acetamide bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
b'TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGGNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title A rearranging ligand enables allosteric control of catalytic activity in copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 87
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA02
2N0MA 2ZONA 1EZLA 3AG3B 1JXFA 1ASOA 2HLEB 1E67A 3DIVA 4L0PB 3OQRA 1OV8A 1XMEB 3WKQA 3PPSA 2WO2B 5AKRA 2VMJA 4NAJA 1HFUA 2BW4A 2QPDB 4A67A 3PLYA 2YAHA 2EILB 2FWLB 2PP9A 1PZCA 3N55A 1GS7A 1KGYE 2WO3B 3IN2A 3TU6A 1PF3A 4BWUA 1BYOA 2X88A 3UABA 1TEGA 4E9XA 1HAUA 5TK4A 4E9QA 2E86A 1FA4A 1BEXA 2VW7A 2FQFA 1PY0A 3ZDWA 1PNDA 1V55B 2Y69B 1SNRA 5I26A 1TU2A 1NIAA 1J5CA 1BQRA 2IDSA 4GXFA 2XUWA 4G7RB 2XXFA 1X9RA 1EHKB 4NERA 4FAAB 1IBZA 3EH5B 4N8UA 3NSFA 1E30A 3IE9A 4A2EA 2DWTA 3NJJA 1ZPUA 2XWZA 2YAMA 3FQ1A 1NZRA 3S3BB 2HZHA 1A4CA 4BDVA 4A2HA 2BZCA 4KO5A 2ZOOA 1NIEA 5FC9A 2XXGA 1AG6A 3WI9A 4YSQA 3EH4B 6PCYA 1A3ZA 1E5YA 3CG8A 1CC3A 2IWEA 1DZ0A 3S3DB 1ADWA 1SHXA 1OF0A 4BDVB 4AKPA 2YAQA 3ASNB 1MG3C 1FWXA 1CUOA 5I6MA 3PAZA 4KO7A 3FU7A 1WA2X 4NB7A 1ZDQA 1SFDA 1NPNA 1ETJA 2BP8B 3NJHA 2FJSA 3PAVA 4YSOA 5D4IA 2CCWA 7PCYA 1KDJA 2J57A 1KBVA 3UADA 3FPXA 2B08A 1OE1A 3AY2A 1J9RA 1CYWA 2JFCA 1PNCA 5B1BB 5AFAA 1W6WA 3FSVA 3D12B 4HIPA 2BWIA 3FQ2A 1IKOP 1AS8A 3HB3B 4KNTA 1NDTA 1OCRB 3EF4A 4GP5B 4G7SB 1QHQA 3TBBA 1E5ZA 1PCSA 3AG1B 3T71A 2AZUA 4E9YA 3QJSB 3MX0B 2Q9OA 3X1EA 2PPDA 3CDZB 1GS6X 3TA4D 1SF5A 1ZIBA 2GSMB 2P80D 2WSDA 2BO0A 2YXWA 3KW8A 2FQDA 4E9VA 1UATA 5IY5B 3ERXA 1SDDA 1SF3A 1JERA 1AZRA 2VSKB 4GP4B 3WKPA 4GP8B 3X1NA 1E65A 3IN0A 3S3CB 2IDQA 1NIFA 3X1BA 4YSTA 3ZIYA 4WKXA 1AZUA 1A4BA 3C75A 4YSUA 1ASQA 2YQBA 1A4AA 1MDAA 5B3SB 2IWFA 1I53A 2MTAA 2TSBA 1SDDB 5A7EA 1AACA 2H5UA 4N4YB 3QJTB 2QPEB 1N68A 2GC4C 5I28A 4Q89A 1X9UA 1PAZA 2VW6A 1AAJA 2CALA 2YAFA 3H4FA 3FT0A 1SHWA 3H4HA 2UX6A 3IEAA 3GYRA 1R1CA 4F2EA 1JZIA 2TSAA 1J9SA 3ABGA 2UXFA 5B7EA 4HZ1A 2J5WA 1M56B 2HRGA 1GY2A 1JZGA 3NJMA 4HAKA 3QJVB 4DP7X 1V54B 4DP4X 1ET8A 4RH4A 4TXVB 2XV0A 1BAWA 2AZAA 1BQKA 3FU8A 1RCYA 4AI7A 3DKHA 3FPYA 2I85A 2FTAA 5B1JC 1JXGA 1KCBA 1GR7A 1BYPA 4BK5C 3BQVA 4WTQA 2BW5A 3UAEA 2Y1AA 9PCYA 1L9RA 2XU9A 2LLNA 2XLLA 2GIMA 3T6XA 3QJRB 4W1TA 4F2FA 3T6VA 3ABMB 4AKOA 3RYMA 1MZYA 1HAWA 2QDWA 4BWTA 2UXGA 4Q8BA 3FU9A 2OJ1A 3TASA 2HX8A 2HX9A 3EH3B 1V10A 2PPEA 1AZNA 3NJLA 1KBWA 2RACA 1OCZB 1AQ8A 5PAZA 1RZQA 3WIAA 3FSWA 3L45A 1AZCA 3H56A 5B1JA 1ID2A 3SBPA 4G72B 3NP3A 2FT7A 4G71B 4YSAA 3GXUB 1WS7A 3NJGA 2GI0A 4F7KA 1PZAA 2R7EA 1TEFA 4HHWA 3QJUB 1OOWA 3KW7A 3PAUA 4EF3A 1ILSA 1SJMA 3PXLA 1ZV2A 1F56A 1WS8A 2DYSB 5PCYA 2BP0A 2CAKA 1JZEA 2DYRB 4YSEA 3JTBA 1IC0A 2YARA 2PLTA 1IUZA 2XV2A 4DP2X 2VW4A 2R7EB 2NRDA 3FU7B 3OD3A 4HCFA 1BXUA 4YSDA 5B7MA 2W8CA 1JZFA 4KOCA 5I6OA 1ET7A 1QLEB 4KO9A 3AG4B 2BP0B 4UAHA 2DY2A 1TKWA 6PAZA 2JKWA 1NICA 2EIKB 1NPJA 4JKNA 1PLAA 4P5RA 4CSZA 2B3IA 2XX0A 5F7BA 4KNSA 1CURA 3N2JA 1J9QA 1KYAA 2VSMB 2QT6A 1BXAA 4KOBA 2I7OA 1AG0A 3OMAB 2BWDA 3NSDA 4YSCA 2YXVA 3TBCA 2IDTA 1VLXA 1GW0A 2J55A 1L9SA 2IWKA 2JXMA 2HX7A 2CJ3A 2GB2A 1NWPA 2IH9A 3QQXA 4YVNA 4ZK8A 1JZHA 1OCOB 2BZ7A 4DP8X 3NP4A 1BXVA 2IDFA 7PAZA 4A2FA 1JZJA 3WNIA 4DPCX 4DP6X 5D4HA 4A68A 2PCYA 3NSCA 4PAZA 2IDUA 3AG2B 4CSPA 4AKQA 1JVLA 3IBOA 5I6NA 3ASOB 4G7QB 2H47C 1XB8A 4BXVA 5I5MA 5I6PA 2PCFA 3OM3B 3CZUB 5E9NA 1OCCB 4E9SA 3ABKB 2HXAA 3HEIB 1AIZA 1SFHA 1NIDA 4HCGA 3SBQA 2H3XC 4KNUA 1ET5A 3OMNB 3G5WA 2HRHA 3ABLB 1L9OA 4A2GA 3AW5A 1WA1X 3OMIB 1KDIA 3BVDB 2CBPA 3QJQB 1NIBA 1NWOA 1PLCA 1ZIAA 4MFHA 2AANA 2PP7A 3UACA 2VN3A 1N70A 1QNIA 4DP0X 2OV0A 1GSKA 4YSPA 1AANA 1RKRA 4DP5X 2PPFA 2PPCA 3CVDA 3PCYA 4KO6A 1B3IA 1IBYA 3NJIA 1W6LA 2DWSA 2FNWA 2EIMB 3DTUB 1J5DA 1WAEA 2ZWNA 5EHFA 5B1KA 2I7SA 1ZDSA 2YAPA 3GDCA 4A66A 3AZUA 1CYXA 4GYBA 4QLWA 3FSAA 4QKTA 4HCIA 1AOZA 3NT0A 3T6ZA 1WA0X 4PCYA 4AZUA 2XYBA 2XVBA 2XV3A 2UX7A 2OCCB 4GY4A 5ANHA 1XB6A 4M4RB 2PPAA 4JHVA 3V9EA 2FT6A 4A2DA 4P5SA 3SQRA 2CUAA 4BXSV 1RZPA 2UXVA 3T9WA 4E9WA 2FT8A 4YSRA 1URIA 2BHFA 3FSZA 3NJKA 3QPKA 1GY1A 3NJFA 4HHGA 3MBWB 3WNJA 2BP8A 1A8ZA 1BQ5A 2AVFA 1JXDA 3CVCA 4YL4A 3CVBA 4AX3A 4YVUA 3NYKA 2P80A 1GS8A 1L9PA 2IAAC 2EIJB 2ZXWB 3EHBB 3UAAA 4DPBX 3SBRA 2Q5BA 3FYEB 5I5JA 3S8FB 5LDUA 5I6KA 8PAZA 2YAOA 4E9TA 5I6LA 1XB3A 2J56A 1KCWA 1A65A 3U25A 1L9TA 3FQYA 1AZBA 5F7AA 1PMYA 4UANA 3ZBMA 1YLBB 4JHUA 3X2QB 1W8EA 3T6WA 2DV6A 5B1AB 2A3TA 3CDZA 4DP9X 4E9RA 3ZX1A 2GBAA 2XX1A 1MZZA 4W9ZA 4DPAX 1T5KA 1FFTB 2QDVA 3NSYA 4M3HA 3X1GA 1MG2C 3UGEA 1AS7A 5TK2A 4YSSA 2X87A 1M9WA 1M57B 2VM3A 2EINB 4UF7C 4BWWA 4HALA 1AS6A 1L9QA 5AZUA 2PP8A 2IH8A 5D4JA 4G70B 1PZBA 2MRYA 1PLBA 4ENZA 1AR1B 2GC7C 1NTDA 1ILUA 1ASPA 2UXTA 2VM4A 4K9JA 1JOIA 2W88A 4DP1X 5B7FA 1J9TA 3S8GB 3WG7B 4X4KA 5I5IA 1OE2A 3FYIB 3NJNA 3JT2A 3X1FA 1GYCA 1DYZA 1JVOA 3FS9A 2YAEA 2FQGA 3V9CA 1NINA 2GHZA 2AFNA 4FA7B 2FQEA 1OE3A 1KV7A
chains in the Genus database with same CATH superfamily
4AV4A 3ZTCC 3O4LD 2DF3A 3IXAB 4NNPH 1U8PA 1QEXA 5AOLA 5AW4B 3NFNA 1FLRH 1GYUA 4GB9A 5AZ2H 1XGYL 4JMXA 1E43A 2IPKA 2V0AA 3BO8A 3LPOA 1PVHA 3CXHK 1G9NL 5AKRA 5FHBH 4KXBA 1GC1H 3O8XD 3V10A 4PJBF 3NEXA 1S4IA 3S36H 4HC1A 1HILB 3MJGX 3WMSA 3F7YB 2W9LA 3BLBA 2FWLB 4DKDC 5LNEA 3BLKA 4J4PC 5HD8C 1SLXA 1R17A 2WO3B 2NY1B 1PF3A 2AV1B 5K39A 4N2CA 1SY6L 4HDIA 2MJWA 3FCUB 1HAUA 3VGHA 2BCKA 1FA4A 3T0VA 1AHKA 4MMYB 3ATBA 4LP5A 5FA4A 5DS2A 1JD9A 3LNDA 5JW4N 3JWNC 3PQYE 1Y0LB 3W39B 3GBEA 1WQVT 4D9LH 2V37A 3AJ7A 3FU6A 1JHLL 1JJUA 3ARXA 3C8HA 3TT1H 5AYUL 3VQMA 3ATEA 5D7IF 4UUJB 3HS0B 2WCGA 3Q8FA 4NBYB 1RZ7L 2A83A 2CK0H 4JN2B 4WV1B 1SJHB 3QJOA 5EBLB 3EH2A 4MDJA 1J8KA 1E40A 1X5IA 1PLGH 3MLRL 4P2YA 3WYRA 3WJMA 3TIDA 1U3JA 2CJTA 1KWKA 3G04A 4D2NA 1FO0A 3QG7L 4FXGC 3NOIA 1ZTXE 2EKSB 1YYMH 4PIRF 1U8NA 4RMRA 5AB1A 3HLKA 2EEDA 4HT1L 4JPIB 4OZIE 4PGDA 2HT2C 3U2IA 1Y6KR 3GLZA 5E2UH 5CJBA 3K80A 1CICA 4AENA 3FN0H 3U7WL 3RTLA 2YD0A 4G9FE 5CHNB 3VX0A 2F53A 2FJSA 2H1PH 4YSOA 3VDBA 3ZSTA 4L3ED 4RGNB 4AG4H 4M00A 5HYIA 2HKHL 3UAJD 1PY9A 2J2ZA 5TQ0L 2KBGA 3QDHA 3NDZE 4EIGB 3BFOA 1Z9SB 3RUGB 3DROA 4I7ZC 3B8SA 3HI1B 3BUBA 4PJEF 2JNZA 3C6SA 5J1AA 3ZGHA 1XSIA 2AXJA 3UTTB 4LLUA 4U7KA 3EOTL 2ZG2A 5ISZA 5KSVA 4K3HA 4HUVB 4JO1L 4RRPG 2Y06L 1F8TL 3UZVB 3JUZA 1ZANL 1B0RA 1RD6A 1UT2A 4K9EL 2YEZB 1NEUA 4OUOA 1OM3L 2FWUA 1F4AA 2PPDA 3EYFA 3ILPB 1SF5A 4OCRL 3IMWA 3U6RA 1K8DA 2DBLL 1PL3A 1EA9C 1TJGH 1T22A 1GW6A 4PJXB 4PRNB 1MFVA 4QRPA 1J5HA 3LNGA 3N44B 5LCVH 2FE0A 4EUPH 5D1ZD 1FNGA 1UZGA 4GRWF 4NQXB 2XIIA 3LKSA 4KKCC 4XN1A 3SKMB 4A38A 2JKTM 4PWJA 4FQCH 3UTPD 2R0LL 5EOCL 2QVFB 4R2GC 2XKNA 2A9AA 1HEZA 4OCWH 4GXVL 4ZTOH 5C0CA 4NQCD 3S48A 2F5AH 3U6XS 5BUPA 1XZ0B 4V1DB 5LJYH 4YPGB 1AR1D 2FUQA 1XF5A 2MMXA 3TVMA 4UTBH 3FQUA 2ZSVA 1F41A 1BP3B 2MQGA 2Q3AA 4APQD 3ARFB 5I28A 3F12B 5I0XA 1YYLH 3TT3L 1X9UA 1IBGL 2YSTA 1KB9K 3W9EA 1AAJA 1LEKB 3R1GH 4HIJA 4Z78B 2X3AA 3BSHA 1E7VA 4GJTB 4W9FC 4G8EB 4F2EA 1JZIA 2XT1B 3CHRA 2VLJA 3B3IA 2FJGB 1O5PA 1MFCH 1XIWC 1RJYB 4KJQD 3KLQA 3P2BA 2XPGB 1GGIH 4LOUC 3R8QA 3HNTL 3INUH 2IGFH 2G3MA 2PWHA 3GIZL 5CFHA 4TLKA 2P48B 4TSAH 3SE3A 2AXWA 2WBWB 3AREA 5DZNA 3QJVB 3WS6A 3RWFB 2HJLB 1BF8A 1DFBL 2ZPKH 1A25A 4J28A 3SYQA 2OL3B 4L9LA 3E1F1 2JIXA 4DKEH 4KKPA 1AOHA 5LBSH 1CFTA 4P3WA 3QEHB 4H0IA 1VFUA 2J88L 2IG2H 2ZG1A 3TBWA 1G7QA 2R51A 4JY4A 1EZVY 3L3OA 2R4RL 1Q9WB 2DJSA 5C2BH 5IB4A 4MZ3A 2BW5A 3KH3A 3VQLA 5ENWA 5IBLC 1MY5A 3HAEG 2LLNA 4OLEA 5GS1C 3OAYH 1DCLA 4P2AA 4UQ3B 4HYTB 3V7MA 4DVBA 5DZ9A 2ATAA 2VN5A 3ABMB 5TH2A 3LS4H 1A3RH 1IT9L 2W92A 4Z0BL 1KB5B 1NCGA 1K4DA 3KWXA 1WZ1H 3KWUA 3MAWA 4BWTA 2J1ZA 4JN1H 3G6AA 4G8GE 3RA7L 1A6UL 2X0VA 4RQQA 2YC1A 4JY5L 2WXNA 2WLHA 5IEHA 4KVCH 4TNVK 1T0MB 1MFDL 4JLRB 1AZNA 2RACA 3MBWA 2WQVA 3VFNB 5HVWA 1P4BH 4G72B 3V0EA 5HYSG 2VXUH 2PUQT 4FQQA 4WFGD 2WLNA 1XO8A 5FV1L 3DV6B 3CVIL 4NXKA 3U4EB 2R7EA 2HRPH 1FNEA 1CDHA 2F1BA 3KW7A 4POUB 3EG9B 4PV8B 1G7IA 1SJMA 4KROC 2IV8A 3EADA 1WVZA 1UXWA 5DA4A 1T04A 5DDHA 3BFQG 2H7WA 4U1GB 3CHXA 4B9PA 2CAKA 3QUMB 1RUKL 3EJTA 5HGGS 4I0KA 5FHAL 1TQBB 2EDHA 4JQXC 2YD7A 4YHLH 4HBCH 1YEIL 4UM8B 3L3DB 4FFYH 1H6UA 3GBNH 1Y18A 5JTWA 1QLFB 4RSVA 3L4ZA 1M6OA 4WEMB 3JV5A 3LSOB 3NABH 1MW2A 4LLYA 3WOVA 3KBPA 3FRUA 2V7NB 1WE5A 2H8PB 1YEKH 4CU8A 4HOMA 3QIWD 5SX4H 3W9DB 4MXWH 3VSUA 5J3HD 1YQ2A 2EYTB 4WWID 3HN8A 5KOVC 2PO6B 4JAMA 4NHCH 2Y2TA 4NO2A 1PDKA 2JQZA 5LAPA 2GSIA 1J9QA 1LWRA 3QXDA 2D2OA 4WJG3 4AE0A 3CX2A 5IHZB 4Z3JA 2GAZB 3QRGH 1KBGH 4NGHH 4O9HL 3ZL2A 4YS4A 4TPRH 3TFBA 5C0AE 5IMOB 5C09B 3LZOA 4XWOD 4PR5A 5HHPA 1IM3B 1MJ8L 2K6YA 1QO3B 1A3QA 2J55A 3BISA 4NJ9H 4DZBB 1FYTD 1CFSA 3VI3A 3VXSB 3MRBB 2GB2A 1L6XA 4G42A 2IAMC 3ETBF 4XPTL 3FO9A 3ZO9A 3LHAA 1VFOA 5KVGL 3BESR 3HW7A 5BOJA 2IDUA 3KPNB 4GAJL 4IJ3C 4AY0A 4D8PA 2V17H 2DQMA 1QVOB 3D87B 3BPLB 3N1FC 2ARJA 1RJZA 2YWYA 4UV4H 1AGCB 5F7YC 4W9EC 5I6PA 1BJMA 1JCKA 4Z7UE 3HE7C 3T0EC 4OFDA 4PRPD 4BA0A 1NGWA 2BERA 3OJDB 2PETA 2DL9A 4OZFA 1PZUB 4TVPE 1S9YA 4N2IA 4PY7B 5DGQA 3MNZB 5IESL 1N2RA 5E4EB 5CBEB 4XH2A 4G82A 1NAMB 1M3IA 3ROOB 4WUUA 2XYCA 2ADIA 4N5EC 5F9WB 2NR6C 5KYWB 1C5BL 3MGOA 5DJZB 4RMVA 1IAIH 4OJAA 2D31B 4N90E 3SGDH 1IEBB 3I9GH 3T77B 3V0FA 4M8QA 3WXVH 1SBBA 3NN8B 4NPYB 3G5YB 1M9SA 1AY1H 4WVRA 2DQDL 3IDGA 2ZXQA 4LARL 1MNNA 1DE4A 4ICXA 5BVPL 3B2UC 1IC5L 1F58L 3GXIA 3KPMB 3PWUB 1XD1A 1PY4A 2R1XA 3D69B 2M83A 2XG5B 2C26A 5A16B 3RURA 1CI5A 2AQ3A 1J5DA 4AMKH 4PB9L 4POZD 3CV5A 4HJ0C 1OW0A 4Q6KA 4LSDA 4U1HB 2NNRA 5IQ7L 5IM7B 3QUKB 1TMCB 4K4KA 4ONGL 4H0LC 1UCTA 3QHFL 4XO3A 3B7UX 5MEQA 4RCAA 4Z9KB 2XV3A 2ZP0T 3G5VA 2JI1A 1RPUA 2RCSH 4LSUH 5EEUA 2R83A 4Y4KC 3MRNB 4JHVA 4JFXB 5EO1A 3RVTC 2VLMD 4R96A 3RJDA 3TCLA 5BZZA 1SXCA 3FHEA 2FNBA 4HPOH 2AMGA 2IANB 2BINA 1LO5A 1GY1A 3I50H 3RZCD 1QSEA 3DXAA 2PR4H 4QRRD 1DEEB 1GL4B 3NIDF 4A39A 1Z6JT 2AVFA 1AKJD 4P48A 4K7FB 3MNDA 4HVBA 4Q4IA 4O4YL 3CPUA 1B9KA 1G87A 4IIQB 1LL1A 3OKOB 4DKFH 2PW2A 1OIOA 3BHBB 3OKLB 5KS9A 4PTTA 4YBHA 4GW4B 4YZWA 1E3XA 3LEYH 3S35X 5JHLH 5H94B 1FJ1A 1OAQL 1KTLB 4P06A 4X4ME 2NMSA 5C0FB 3P40A 4WI3A 1AZBA 1II4E 3HUJE 3G6JF 3KYNB 1ZXKA 1TO5A 1UEYA 2XXMB 4LIQL 1MPAL 4N0FB 3TA3A 3NGBB 2A99A 3PDGA 5AB0A 5EEZA 4XWGH 2FX9L 4H8WL 5KSUB 1E27A 1FFQA 4OD1H 4TOYH 5HI4C 1IVLA 2DWXA 2WYHA 4NYLA 3B83A 3QA3B 4U6YA 4MMXB 3RX7A 4M3HA 5IJKC 3NSYA 2CLRB 3H9HB 1E6JH 3VI4E 3LQAL 1AQDA 4ESKA 4HZLB 5L9DH 1U8HB 5F8QC 5IKCA 1S9VA 1YHPA 1JGVH 4NCC1 3L3IB 3SQOH 2PP8A 4FQXA 5ID1B 2QPUA 2AK4B 3B1TA 3OB0H 1IGJA 1PLBA 4RFEA 1G7JB 3IJ8A 3LV3B 4F7CB 1BD2D 4JB9H 2HTKD 2ZYHA 2AEQH 4P49A 2OJEB 2X2JA 3DTXA 3JWDC 3HZVB 4F92B 1ITBB 4M43L 4K71B 4UTCA 4JM4L 4FNRA 5H2BB 3FYIB 3TBVB 3PRZA 3TCXA 2R69L 1OAKH 3VWKD 1ZT4A 2YS4A 3X1FA 4UTBA 1GZPB 4FLSA 3AXIA 3G9AB 5BS0B 4GUPA 3KYOA 5J13B 3QG6B 4TL5A 1YVLA 3OR7A 3GM0A 5DD5H 2A0LD 3FT9A 4X0KA 3OXSB 4QYOA 2GHZA 1NMBL 5EPMA 2FQEA 4LRNL 1NANH 2QTVA 2VIRA 3GMMA 5IB1A 2ZONA 5E7FA 3JUYA 3MOAH 2X4NA 1JXFA 5D55A 1UHVA 3GXTA 2JTDA 4LLVB 1U93B 3A67H 3V52L 5AOKA 2G4GA 3SDDA 3TF7C 1J10A 1QPXA 4YPJA 2R29L 4KZDL 3QDGD 4AQAA 3MXWH 1IEAA 1IGFL 3PL6A 4GBXD 5J5EA 1NCHA 4U1KA 2P5WD 3LNIA 4IOFC 3IJYA 3V6OC 4DJMA 3IN2A 4J27A 2R2HB 4MRBA 5BRQA 4QXTB 4JREB 2E86A 2QEJA 3EJYD 2JCCA 5F7DA 1DEDA 4WDIB 4IGBD 1ZLSL 5MEPA 1F11B 1JNLL 1OAYL 3MRPB 4MYPA 5IROA 4U1MA 3QUZB 2ZJSH 1X9RA 3VCLB 4PGCB 2Q8BL 1R3KB 3NPSC 3BSZA 3L8QA 2GITA 3QEQE 2JJTA 1BREA 2Y7QA 2PW1A 3BAXA 3SGKC 2BHYA 3FQ1A 4AGQA 3DYPA 3MRJA 2C7UB 1KPRA 4I9WE 5BZWB 4NZUH 4XNUL 4WJ5A 4UQDA 4PJGB 3QFDA 2EXYC 3NCYP 3EGDB 3S35L 2I69A 2J1YA 2XN9B 4QMEA 5GRVL 1A3ZA 4HSCX 3HE6D 4HUKB 4FQHA 5E08H 3ZK0A 1TNNA 4AEIH 4L1LA 5EF3A 1FFPB 1VCAA 2OMUB 3DX9B 2PCPA 3VFOA 1I1AC 3PAZA 4P99A 5FWRA 1BVZA 5FM5M 2CCWA 4IU2A 1PTZA 2BZDA 2CQVA 2FZ3B 1T6WA 1I1FB 2VDKH 1CYWA 2F1AA 4BFIB 4I5BB 2HWZH 5TE7H 5E6ID 5GS3A 5AFAA 5CLZA 3LHPH 1Z5YD 1JWMA 2ADGA 5ALCH 3NA4A 3HAEB 3R7QA 4LF3B 2ICWJ 1L3WA 3KEHA 4P2OB 5M94B 1HH9B 3ARDB 3VD5A 5J11B 1XCTA 1PCSA 2F68X 4QHLA 2NSXA 4X98A 4PCKA 1BFOA 5ANMB 1MWAL 4PJEA 1T21A 3H85A 4LEOA 1GS6X 4O51A 5I75C 4FEMA 2EH7H 4MCYB 1QSZA 3KXFA 5IY5B 4PYHA 12E8H 4K8RL 3U2JA 4BFOA 1SOQA 1X6LA 1D5MA 3BD5A 5HYSB 1SF3A 4PJ7A 5KVMC 5DHVH 4MBOA 1WHPA 2QTEA 4BHUA 4Z76A 1KGXA 2GJ6D 3MBXL 3OL2A 4F7EA 4F8LA 4KFZC 3K2UH 5DI8A 1E65A 3IN0A 4MA7L 1URZA 2FBRA 5J6SA 5ELIA 2C3VA 5DQ9B 3ZIYA 1ICTA 1VEOA 1JPTH 4ANUA 1ASQA 3LKOA 4XBEL 3FTSA 4ZT1A 5GSRA 5IF0B 1YEDB 2F19H 2HLAA 4JJ5A 4WNSA 5D71L 3S98A 3ULUD 4N4YB 5L2KE 1A7NL 1FZMB 3X3FH 4YLCA 3MXVL 4L1DA 3V6ZA 4OGAD 4WSKA 4X4ZA 5HDLA 1Q38A 2DIEA 1FN4B 1S7TA 3AQYA 4YDLB 3IEAA 4JFDD 3BKCL 4JGNA 4RDBA 3F6JA 4P2CG 4YO0A 1IBFA 3K2KA 1QWNA 2NY2D 5KN5A 5DC2A 5D7EA 1MIEH 1ZT7A 1FSKB 5T1DH 4IRSA 3AT8A 4Y1AA 1ZSHA 1IKFH 1I7TB 1M53A 2ADFH 3HZYB 5HJGA 1CGXA 3H9SB 4ODWA 5DC4B 5FF6A 5ECGA 4H26A 4ICWA 2Q1EA 3GSWB 4GMTH 2XTJD 3P11H 3WE6B 4PIBA 1CK0L 4FKEA 3QRBA 1HKLL 2UWEB 4NQDD 3KPQB 3OKYA 2XCMC 2E27L 5IMKB 4WGVB 5K9JH 2V5TA 3ZDYE 2Y1AA 3P0VL 4J3TA 1QZ1A 4UV7L 5E8DL 4ZSOE 2A4ZA 3EFOA 2WXGA 2ZKXA 4GQZA 3A47A 5TQ2H 3G7TA 4JFYA 3GXFA 1D5XA 3H42L 5L0QB 4NWTL 3IETB 5A1AA 4WI0A 1SM3H 4XN7A 3IFPB 2C9RA 5JHBA 4NJAH 4XNQA 1DHKA 3UPAA 2XVKA 2VT0A 3PG2A 4DQOH 1QW8A 4X6DB 2NXYD 5LGJA 1DBJH 5GPRA 4W70A 3SKOB 1M71A 2FD6H 1KGIA 2CLZB 3VXRA 4PJ8D 3ZKXB 3SPHA 1R3JA 5CSZB 1UWYA 5T3ZL 3CJJA 3QUYB 4PG9B 1U6AH 3BN3B 3ZL4L 2QSQA 3SYCA 4UAOC 5AG9A 1HT6A 5SV3A 1WWCA 1A6AB 3BP4B 5L8JB 2DYRB 3QJZA 1IUZA 1JWSB 2QQNL 1NKGA 2VW4A 4KUCD 4LVHC 4WAFA 2OSXA 4AGLA 1G1KA 5FO8A 3VUAA 3I75B 1VCBC 4GRMA 3MFFB 2HAZA 1NCWH 4G59C 5AW6B 5D7HA 1JZFA 1A64A 1YY9C 3UO1H 3T4AC 4TNFA 1WFJA 3ES6B 2AXFB 4KKAD 2JKWA 4A7UA 2APTA 2RQEA 1DDHB 1R4XA 1PLAA 2Y5TB 3H1ZA 5D1QD 4IHOA 2XWBB 4FDWA 5KAQF 4G9DB 2OYLA 3H3PL 3L3JB 1XF3A 3N50A 3GM8A 4L5FH 2HPOA 4X7SL 4CGTA 1F4YL 2W0LA 4WHDA 5CLTA 3STLA 4ODXA 3ZQ9A 4JR9L 1IKNA 3KBFA 4G6FD 3QDJE 3OKEA 1KBPA 2BHZA 4PG2C 4RWYH 4LGRB 3NSDA 4L3CA 2ITCB 2DI8A 3GZQA 3N43F 3MU3A 1GW0A 4JDTL 4UOJA 2ITFA 4PVMA 3RKDC 2BNRA 1QHOA 3JV4A 2D0HA 3IJ7A 4A2FA 1Q72H 4DUXA 1Q0EA 1ZHLA 4ONOA 5L2JA 2D2CC 1O6SB 1KIRA 3O4LB 3UBXA 2GHWB 1XF2A 4HJSA 5BXFB 1QFWH 2NUTA 1FG2B 1A14H 1F18A 1UG9A 2ATKA 4FQ2L 5KBDA 3O8XB 4N2DA 5JHDE 3SKNA 1LP9E 2WIIB 4ANWA 5LGHL 1W0WA 4FX5A 1IAOA 1MCDA 3EJRA 4BINA 1HXMA 2A9ML 2H0PA 1KJ3L 2GEQA 5HHVL 4HEPA 3QAZB 4L4VE 2VR3A 3RVUC 2B4CC 4KI5D 1BMZA 1D9KA 5K59F 1KDIA 3BVDB 1Q9LB 2WHVA 1GJUA 4FZ8H 4W9KC 5DRNB 5IP4A 4GSQA 4H88H 2FBJH 1NSNL 5IV2A 2D3VA 3A21A 3C08H 3GJFB 4DP0X 5L88H 2WQAA 5GZNC 4X4XB 4GEIA 1U2CA 1HOCB 1NCJA 1KJ2L 3SBWC 1XIWA 4QO1A 3I3BA 4XMWA 4JO2L 1G6RB 4AQ1C 3AU1A 4YGVA 4A37A 2Z93A 2AVGA 1P7QD 2FNWA 4LGPB 3I3DA 5HHNB 4DGYL 1F1DA 3DX6A 2ZWNA 1OAJA 5E2VH 5TGBA 4F3FA 4Z7OB 3S4SB 4ONHB 2X2HA 1W72A 4GG6E 3HR5B 3FSAA 1AXTH 1FVCB 2CO7A 2OMTB 4WFHD 1MIMH 1BAFH 4JKMA 5L4JA 1WA0X 2NUPA 3BDXA 1J8HA 4NP4H 2YSSA 4KY2A 2Y36L 1CF8L 3LEXA 1P7KB 3GO1L 1SVCP 1PD1A 2CM6A 1X5LA 5GGUA 1P5UB 1UXSA 1HQ4B 1FV1B 2NY6D 2LHAA 2PPAA 5I71B 1A1NB 4LVOB 4LSTH 1U4FA 3QK0A 1WBXB 1KACB 1A9BA 4PJHE 2VDRH 4H0GA 2LR4A 1H8NA 3VTTA 1S5HA 3QCUH 1PKQB 2GBUA 3GSXA 4YL9A 1XSJA 3WNJA 2YZ1A 5F3BA 4ODSH 4U1NA 2YR3A 4M56A 3EDEA 5D1XD 3T3MB 4KPHH 1Y7VA 2ZYSA 3OGCA 1CTMA 5EZLA 4BE6A 2XFXB 4XCEB 1GTFA 1ZE3C 5CWSB 5CIPB 1OTTC 3D07A 2Z4TA 4PHZA 3J7HA 3NYKA 3HJEA 5DUPH 3QXVA 2D8KA 4H20H 1OHQA 4Y19A 4F33A 1CVSC 1SMOA 2DKUA 4WCYH 3ATDA 5KOMC 1J12A 4LLQA 4YX2L 1WZLA 2F5BH 4L37A 4NQSB 5LDUA 5KJ7E 1OSPH 4E9TA 4KRPD 2UV3A 2J56A 2P8PB 4AL8L 4IIZA 3UYOD 1JS4A 3U25A 3OC8A 3QHZL 3QO1A 4QXGL 5GSVB 2WLIB 3ZBMA 2HJKA 3V4VL 1UVQA 2N01B 4K73A 2D0FA 3T6WA 1PX8A 4K3GA 4LSVL 2DV6A 2ENQA 4OZHB 1HL8A 4M1CC 1M2OA 1BFVH 5KSBA 3Q6FA 3VFWB 5A7BA 1KN2H 1MZZA 2BSRA 5D1ZB 4W9ZA 1EVTC 2QDVA 1T2JA 2UZYA 2YRLA 3GF8A 3GTNA 3WHE0 3G6JA 3WY3A 3R06B 2ZWLT 1E42A 1TZIA 2Y7SA 4EN3C 3HC3H 3MHZA 4XP9H 4ZDHB 3DSFH 1NOLA 3WIFA 4ZZKA 1UD4A 4L05A 4NQCB 4AIZB 2OMYA 4RAVB 3M46A 4KTEH 1AR1B 1HJCA 2LQRA 2W60A 1FQ9C 1BZ8A 4Q9QL 1KZYA 4NM4H 3ULVH 4EDXA 2UXTA 1JMZA 5CP7A 1EFXA 1S7QA 1U8IB 3DETC 1J0JA 3P3SA 4YZFE 5A3ID 4LCCA 3M1BA 4LAQL 4OIIL 4AGNA 5IUCA 1JGDA 3D06A 5L6YL 1FF5A 4ABQA 4DN4H 1GAFH 3W0WA 2JXMB 4O02B 1CZ8H 3EYQD 1WCQA 2GTZB 1FNFA 3ARBD 4WHCA 1N6VA 2H2SD 2P24B 4WI4A 3WNOA 2FQGA 2NOYA 3CFEB 4UIKL 3V9CA 3MRCA 3WFHA 1NINA 1IL1B 3GXNA 3O9WD 3VSTA 5B39B 5CR1A 4QOKA 3PP3H 3WLWC 2EDXA 2IIJA 4U3SA 1X3DA 1DLHA 3DWTA 1YJDC 4R90L 2C8NA 2VH5L 1KYFA 1VZHA 1Q0XL 4G9FD 1E5CA 4PRAB 43CAA 5E51A 1XXFC 3T0EA 3HE7A 1AGFB 1DBKH 3QS3A 3TV3L 4ZW5A 5IMLB 5EZOH 4Y2NA 4P5KA 1YN6B 3RVXD 5C0RL 4R5TA 3RDTA 1PZCA 1SHMA 4S1DC 2APWA 1B6DA 1JPSH 2F53E 5E9DA 5I8EA 4ZO7A 1RHFA 4OKVA 4GH7B 1T1ZA 1BYOA 3DO4A 1M1XA 4GRLB 3P4NB 3VFMA 5TK4A 5DFVC 1CFNA 2W80C 2XZQL 3SDCD 2NR6A 3QZMA 4XHJC 5JPMA 4NQUA 5JXAH 3TNNA 4P59H 1JHTA 2VMCA 4YH6A 2OMZB 2XXFA 2V33A 3K46A 3QULA 1OANA 3AITA 3CFBB 1JI2A 4XP5L 5ISZE 4NRXB 5HGBB 3MODL 2EIZB 2YGVA 3RIFK 1KTKE 2MQCA 3I6KA 2H6PA 3Q2VA 3T65B 4EI5C 3VG0L 2A73A 3BP5A 3WLBA 1FFRA 4ZUTB 1J87A 1RZKL 4A2HA 1E2ZA 4KY1L 2NLJA 4FADA 1R0AH 4ELDA 4IKLA 1GYVA 3K2MC 3V5HA 4PRID 1ZK5A 1Z3GH 4J3SA 4FNTA 4QRPE 1EERB 1UB6B 4NKDB 1CL7H 4LO9A 3VXUA 1TCRB 3S37H 4ETQB 4XCNB 1AMYA 5IWLC 4EIUA 2PNDA 4XVSL 5DC0A 3ATFA 3QDMD 3WXWH 1FHGA 4RMBA 1GGBH 1MHHB 3VGBA 3Q8EA 3PS6A 4FP8L 1N0LB 4KKRA 5GGRY 5C0CE 3D34A 5J8OA 4Z3HA 5FGCE 3V4UL 2IF7A 5J1SC 5IHBA 2F08A 4MB4A 3FUIA 1E4HA 3QIWB 2KI6A 3TO4A 2OMNA 1OO2A 2IFFH 3Q01A 1UT1A 4B9ZA 1IGTA 3KPSA 3MROA 3QZPA 2ICEC 1OD7A 3DSNB 2XFGB 4MQXD 2AW2A 4E41E 3NIFE 2IGTA 1V7NH 1H8LA 3FQ2A 1K3IA 2VLJE 1CE6A 4CMMB 2V8MA 2QKIB 5KVEH 3QARA 4XBGB 2WZPD 3HG0A 3AG1B 4R3SA 2J4WL 3NAAH 3IDIB 3ESNA 1FYTB 2ROXA 3GUTB 1UJ3B 2AEPL 1ORSB 4IW4C 5SWZA 1WEJL 3H3BC 4JFZL 2HFEB 1VA9A 4QTIL 4WO4D 3CXDL 4HIEA 1ZCRA 4KXAA 1RK1B 2NCEA 4OQTL 1ZLWK 2Z7ZA 5EH1A 5I1JH 1JGEA 3GI8H 5JUEH 1TYRA 4LSRL 3I6LE 4YAQA 2DTML 4ANKA 3GK8H 3FZUD 3I9AA 1BA9A 4PRPB 3VNZA 4RGOH 3EYSL 2ROYA 4G8GD 2MFNA 4MXQD 1HX0A 3T8XA 3W2DL 4L29A 4HX1B 1P4IL 2AJYH 3K0WA 3VFRB 1AJ7L 2LABA 3BE1L 3PWJA 5GS0L 3HCVB 3K8MA 5T3XD 1YO4A 2GUOB 5LWYH 1JVKA 2EZ0C 1KGCE 4PVBA 3IJ9A 4M7JH 3CDFA 5E8PB 1XH3A 1DCEA 3H4HA 4XMUA 5KUKA 1IC1A 3TFKD 2QVKA 3Q13A 4LL1A 1ACYL 4NN7B 5ACZB 2VE6A 1MRCH 1IO4C 5EULV 2WQSA 5ICYB 3RWGB 4CBZA 3D08A 1R34A 1S7VA 4IBTA 5B7EA 4HKZB 3F83A 3P9LB 3BXNA 1I7ZA 5EU3A 5AAMA 2R0WL 4BUHA 4TSBH 3QCVH 2NYZA 2GFBB 3GJFH 2N56A 2DYPA 1AQMA 3RWEB 3TJEL 1KPVA 4PJAF 2WNWA 4NOBA 5LQBL 2J1WA 5KVDH 2RR3A 4QRTA 2E4FA 1G6RH 3HZKA 4AOFA 4MWFA 5DJCB 3TN0A 3FTUA 5EO0B 1D2PA 3DO7B 3MV7A 1GOGA 2WXLA 5J6GB 5TJWK 1WFMA 2CIKB 5CO1A 3WL9B 5K9KB 3S5LG 4M9PA 3T6XA 2VUKA 4P3DB 4GPVA 1WTGT 5IFHL 1JGUL 3UIYA 3QNZA 3MJ8B 1JF1A 4F91B 3GSUB 3CWGA 1XF4B 1F3DJ 3AADB 1CLZH 4LHJB 3WDIA 1Z9OA 3JYBA 1HNGA 4UU9B 5C0AD 3R8BB 3A6OA 4QRRB 1A9EA 4ABWA 1KBWA 1AKJB 1S5IH 4FYQA 1HZHH 1UYWL 5KTEH 1VRSA 3OC5A 5B1JA 4HGMA 1S8DB 2EUVA 1VGEL 2BS71 2H26A 1IBHA 3VB9A 5C86A 1QBMH 1MHEA 3L1EA 4U0RC 4UT6L 1GGTA 4F7KA 2MCMA 1NCCL 3SGKA 3VI3E 5CIPH 5DMYA 1NDGB 4M1DH 3TL5A 3D4GA 3RJOA 3S34L 5IB3A 1TT6A 1R3LA 5T1KD 4UB0L 3U7AA 3FF7A 1TZAA 3HRZC 4ZUSA 4X6CB 2IOMA 1F56A 1WS8A 2GK2A 5ITFB 2BIQA 4ZMZA 1UXLA 1A7OL 2X4QB 1E5UI 4G83A 4I18C 1QD0A 5AVSB 1WFOA 1A1MA 4TVPD 4O58H 5B3JE 5E6SB 2K4WA 4YQXH 3EGSB 4WNJA 1HXKA 5JOEA 5ICZA 4BRVA 3RBSA 4P2QA 4XP6H 3BIKB 2WZ5A 5CD5D 3IGLA 1I1AA 4GAFB 3S3CB 1OSEA 2VZVA 1CR9H 5DEGA 2BP0B 2YGOA 4UAHA 3ETTA 5JDJA 1KYOJ 1VGKB 3EJJX 3KPOA 4NRYA 1PGRB 4Z7WB 1O7VA 2YQGA 1XAKA 1BFSA 4X6EA 3LXBA 1CGWA 1FL5B 3BMWA 3MUGB 4KV5E 5FPIA 2C1OA 4KNSA 2XQBH 1TVBB 3BP6B 4JUTA 3MNWB 2M8XA 4KI1A 2FWOB 4ODUA 1J5OL 3HB3D 2VDML 4DCQB 4PGJA 4JJOA 3ECBA 3NQIA 5TE6H 3RWIB 5FO9A 1BDYA 4B3EA 1A0QH 3B3BA 1A4KA 2YXVA 2YK1L 4P5TB 2XA8H 3VWKB 3EFDH 2G60L 4MX7B 4KRNA 3RGVA 1RZIB 1WRFA 4GW5A 4ZQKA 2IH9A 4POYA 3QXAA 4ZK8A 1KGJA 4RFOL 4BRJA 4O02H 1XTMA 3CFTA 4JDZB 3OTTA 1F86A 3CZFA 5E8NA 4A68A 1BQLH 4MVBC 4NOFA 2NY1C 3LKPB 3D2TA 1JVLA 3WIHL 4H0HB 4TNGA 4DAGH 1GJIA 2FBOJ 3L6FB 3EZ8A 2KZWA 2WD0A 3SCMD 2WQ8A 3K6IA 3OM3B 5E9NA 4JPQA 3U9UA 3QDGB 4XVJL 3TONA 3N85H 3P0YH 4PJIF 1XR9A 2P5WB 4UOQA 1G84A 4BBWA 4GT7A 3HS0C 5JDSB 4TYUA 1QSEE 2X4RA 3DXAE 3ZE0B 4BFRA 5HSFA 1FVDB 4WV1C 5F1NA 4YWGL 4HIHB 2NX5A 5F7MC 1K5NB 1PLCA 4TRPL 2VDQH 1Z0MA 1BLIA 3D6GA 5DJDB 3KR3H 5D96B 4ERSH 3NA9L 4L1SA 5C0IA 5KS9E 3JVFC 3HFMH 4H7VA 3C60D 4QHNB 4BFFA 5J0BA 1PFOA 4M7LH 5I19L 2ZOTA 2YAPA 2DLGA 1DUZA 4KX8A 4HWNA 2PMZA 3F8UB 1X4XA 4U1LA 4AC2A 1QX1A 4L8BB 1P6AB 4C4UA 1CXHA 4IK7A 1K4CA 2OTWA 3DURA 1GGYA 5ESQA 5C6TL 3AQXA 4MLIA 2FECL 4QRFA 3J8F7 3BKYH 2ERJB 1BG9A 1G5GA 3F65A 4RZCA 2GJZB 3HE6B 2YEVB 2K9FB 1DLFL 2GI7A 1T66C 4I85A 2FT6A 1ZKAA 2OSLA 5C08B 4M5ZL 5BCAA 2EUWA 4U6HB 5D2NB 5CJOH 1NFKA 3AM8C 3IT8D 4AEHH 2IADA 4HHGA 4DKTA 1KYOK 2ZOLB 3ARPA 2QSCH 3JWOL 4X6FA 5C7ZA 3BGFB 3BWZA 1NC4A 1YY8B 1BQ5A 2D0GA 2ENJA 1NGXA 3N9GH 4LPYA 5DD3H 2XWCA 2P80A 5EEXA 4HUWB 1L9PA 5SWQA 2IAAC 2X53A 4AVHA 4F7MA 1LO4L 1INQB 3QI9A 2UY7B 3VE0A 4YHMH 1B4JH 3SBRA 1G4RA 2Q5BA 3HG4A 3CNKA 3GSNH 4LNRB 1QHPA 4LASL 2CHDA 2WVUA 5CN1A 2Z9TA 4NN5B 4YMPA 4PRDB 5HDBB 1A65A 4R0LB 1HDMA 3DVFA 3IFNH 2VLRA 3OG6B 1BBJB 5I76A 1JNHA 2PABA 1K3ZA 3EOAA 2L7EA 5BMFL 2FX8L 4OBSA 4AM0Q 4CDHA 4NO0A 1QLEL 3CDGB 4E9RA 3EOBB 1EXHA 1U95B 2O5YH 4TM9A 4S2SA 2GJ6B 3ARFC 2FSEB 2QHRL 3QZBA 5J57B 4FFWD 4H2CA 1TKWB 2EYSB 4FQ1H 3GLDA 4YDKH 1VSCA 1OCWL 2WUBL 5BV7H 3EJPA 3AUVA 3P9MB 4UM9A 3T4AA 5AD0A 1F13A 1KN4H 2GIYA 5IQ9A 2GSGB 3K6SB 3U0WH 1N3NA 2DM4A 5MP6H 4UIMB 4FC3E 1BMWA 2R9HC 4S1RH 3KJ6L 2JCCE 3E8UH 3Q8BA 3WY2A 1RZ8A 4OIBA 5TDPA 2W88A 3QEQD 3V0DA 3VWJD 4L8CA 4MQ7A 1A6ZB 2HCZX 4KBPA 1Y6NR 1IBBA 4KQ4H 5EOQL 4OI8A 2APXA 4GKNB 4JFDB 3OXRA 4ADGA 1MFNA 1GCYA 4KXZI 2F15A 4I9WD 1WK0A 4G6JH 4YFLI 4ZI8A 4PGEB 1F4HA 2BVPB 3WO4B 1OALA 2J72A 1VFBA 2VDNL 4K3JL 3DHJA 3A6BL 3VRJA 4HQQH 1OZTG 3RDJA 1CDIA 3V4PL 2W07B 2IQ9H 2AAAA 1J18A 3LD8B 4U1JA 3WS3A 4DQAA 4Z8FL 1B2WL 5FYJL 1SYVA 4WK2B 1DUYB 1BJ1H 3RL2B 1MLCB 2XTJB 2YGPA 1Z5HA 4NAJA 4BZ1L 3FH8A 3KLAB 2J1KA 4GIPD 4CSSA 5IJVB 4XO8A 4A67A 1QI4A 4PTUB 3MACL 4BJLA 1G0YR 4Z7AA 1NCNA 2V2WA 1IAMA 4HXBL 3HBQA 4GG8B 1DBAH 1PJ9A 2XHNA 2LU4A 4PPTA 5DQJA 1NGQH 1N4XL 5CILL 4MMZB 1Q94A 3UABA 2WIMA 5IMMB 5FW6A 4L4TA 1BEXA 1BYNA 2FQFA 1T83A 1SEQL 3QUXD 4FG4A 2NY0B 2WXIA 2F74B 2Y69B 4O2EB 3EO1A 5IEKA 3O6LH 1C5CL 2MQ3A 1IM9D 1CFQA 3V79C 5I18L 4ZAKD 1ZHNB 2FIKA 3MLTB 1QBLH 5ERWA 4XCCL 3SBWA 1P1VA 4TSCL 4U1GC 1BAGA 1T80A 2AI0H 3DX7A 3IJSA 3V5DA 3BRGC 2K45A 3NSFA 4TUOB 5I24A 2NXYB 1TQBC 5IT2H 1VF5C 3Q2NA 2P7TA 3C5ZD 1ESOA 1AD9A 4NFDA 4PJEE 1NCAL 3O3DB 4MNHA 1UJTA 4PJ8B 5AB2A 2ZOOA 2WLLB 3KXFE 5AKSA 3ZPDA 1I9IL 4LDCA 4J2QA 2OX5B 3ATAA 2KDGA 4PJ7E 4AVIA 1A7PH 5F3HA 1CT8B 4F1ZA 1WUNT 3RFZB 4F8NA 1G7PA 3HNVH 3RPIB 2DLFH 2PO6C 2VO5A 2CCLA 5I1GH 1MI5D 3ARQA 4JFUA 4YXHL 1L7TH 4H8UA 4WW2F 5EUOB 1MXGA 4NUJA 3E1ZA 5JLZA 5MEND 1FWXA 3MJ9H 1EDHA 4I2XA 4Y4HB 4KO7A 5L2KD 3HIZA 3MA7A 5TF1L 3BAYA 3KG5A 4M48H 3I2CH 4GRWE 1DVTA 1OY3B 2WGNB 3CFJA 4P4RB 5I1AA 1HHGA 3CUPB 3B7RL 4GLRH 1VFAB 2DDQL 5F96L 2HFGL 3JZYA 5C07A 1KT2A 1ZS8B 1JV2B 3MX0A 5A2IH 4CC1A 2RAMA 5D1QB 4OT1L 2HMID 4A63A 4MLSA 5DRXA 1EAJA 2ZXAA 3S5LB 2Z91A 3U36B 1GPOH 1MELA 5EIIG 4I48A 4TLSA 4G6FB 1C08A 3BP7A 5HI5C 3VFPB 4R4BA 3KZ8A 5CEZH 4OZ4A 3HHRB 2AZUA 2CDFB 3UPRB 1A3LL 3BPLC 3FO1B 4Y1AE 2VQ1A 1S7UB 1P6WA 4LXFA 1WD8A 3M7FB 4QRQA 1HQRB 1S9WB 2WKOF 2EXTA 2X4OA 3QPQD 1V3KA 5F7KC 3ZTEA 1MXDA 3WTWA 1C5DB 2EDNA 1VZGA 1XR8A 4MRCA 2HVBA 5E4EC 2KHAA 4N2MA 4ZTPH 4GI9A 4B3VA 3VXTA 4HK0B 1V8HA 5F9WC 5CJ5A 4CNIA 2OR9H 3MJ6A 5E99H 4ZFQA 1BVNP 2NNFA 4TUKL 4YSUA 4L8DB 3UBFA 1I8IB 2H3NA 1R5IB 1LO0L 4FFVD 4ZW7A 1KBKA 4MNQD 3HRPA 2PYFA 1A1OB 4JRFA 1ACZA 1N68A 4X42A 5A6MA 3DV4B 4UYPA 4XMVA 3VVVA 5E5UB 3D52A 5FLVA 1IFHH 3UTZA 4EAEA 4YXKL 1ZSDA 4F9LC 3N06B 1HHIB 1SRDA 4IKNA 2LTQB 2PWDA 1NCTA 2WTRA 3CVHH 4XP4H 3VFTB 4MJ6B 3ZGIA 4EO5A 5FFLA 3HMXH 3CQQA 3GMPB 3GHBH 4JY6A 5H35A 4NC0B 5C3TA 3OLIA 1J9SA 3J2PA 1QYGL 1SEBB 2PTTA 3ABGA 3FOMA 3SGEI 3ZMEA 4HZ1A 5FK9B 4IBUA 3LH2L 2J5WA 5AW0B 4YBQC 4JFOA 2D3JA 3VXRE 3S8WA 2RALA 4HKBB 1JZGA 1P7QB 1TJHH 3GT6A 3SPCA 5F7LB 5I1IL 2E4TA 3L4VA 1URLA 4N8VG 1HL4A 3T1FA 3VFSA 2VERA 1KEGH 4PJ5A 4TXVB 4NNPL 5AZ2L 4QXVA 5EUKA 4Y8DC 4C55A 2B59B 5M7QA 4CADA 1VPOH 1U91A 3P4OA 5DRWB 1GC1L 2WCPA 3S36L 3QQ9D 4PJAA 2BSTB 4Q2ZB 2EDBA 4F8PA 3O0RL 2NY6B 1G7LA 2EIBA 3GMRB 1WZMA 4BSVA 2FEEL 4WIQA 2ZAIA 4IIQC 4KX7A 2Z35B 3ARUA 3MSPA 2DPKA 3WJLC 4UOZA 2QKSA 4A2LA 4A2MA 3RWHA 3BKML 1DQTA 3HBPA 4TL4A 1KENH 3LXCA 3F01A 4KHXL 4AW4A 2Y7LA 5D1XB 4D9LL 4ZFGL 4YDJB 4IRJA 3FSWA 5EMYA 3TT1L 1H5BB 3NGBC 2E7MA 2OZ4A 1OLZA 3PHOB 1ZWIA 1V27A 1NEZG 2CK0L 3GRGA 3DBSA 1T2QL 1Z9NA 4P9MH 2G9KA 4B27A 3EAKA 4MMXC 2BNRE 5I15H 4UQBA 4KRPB 1PLGL 1HSBB 4R4NC 3JVGA 2VXTL 4H2AA 2XJLA 1BXXA 2VAAB 1QLRA 3F7QA 1FDLH 3MC0A 2WXHA 4KZ0A 3T4YB 3B6SA 3ZT7A 5PCYA 5FDWB 5JHDD 3UCRA 1PIFA 4DGIH 1IC0A 1YSOA 3KYKH 4NO3B 3D18A 3E3QC 2DI9A 4XNYH 5IWLA 5F72S 4J3BA 4CVXB 5D7JD 4O5LH 4LHUB 1EO8H 1T7YA 3U46A 4WEBL 1AC6A 5E2UL 3IDNB 4L4VD 3FN0L 3VFVB 1FZKB 3WN5A 3UOAB 1KBBA 3OAYK 2H1PL 4K71C 4OIFA 2EXWC 1OT1A 4R84A 1ND0B 3UDWC 2A5UA 4AG4L 1NICA 5KANI 4KNQA 1HS6A 3AMLA 2J6EH 1MCKA 3HPLB 5HHME 2DBJA 3FW6A 1TQCB 4MKTA 1NJ9A 1EEZB 5G55A 5J13C 5JNYA 1G7MB 3DGGA 3RI5F 4JPWH 4D0BB 5DD6B 3MLUH 2HT3D 2WXPA 1KYUA 3SOBL 1L0XA 1BCIA 1MW3A 4BKSC 2OBGA 3K4AA 4FOMA 2CH8A 2W65A 4F93B 1I3GH 4Y16D 1YMMA 2OTUA 2HX7A 3ARBB 1EZSA 2QZ5A 2XVLA 2BOBA 3UZQB 1EJOH 1HCZA 1SOKA 2IDFA 1TJGL 5EFIA 1S3KH 3O9WB 3U30B 1FRGL 3WNIA 4DPCX 1Q1JH 2CGRL 4QTHA 2VDLH 5IVZA 1UXMA 3BCFA 4K7PX 5LCVL 2OKMA 4OGQC 4AGOA 4OZIB 1D5BA 4PAZA 1WAAF 1J8HE 1NCUA 1MJJA 3ZJAA 3KLHC 1JK8B 4A7GF 4GOSA 1FORH 2OR7A 4JREC 2VABA 2WM0A 5E00A 4NIKB 2CK2A 4G9FB 4PRBB 2PCFA 1FCCA 3DC0A 4OCWL 1OCCB 5DRZB 4KTGA 4E9SA 4ZTOL 3C87A 4HLEA 2F5AL 1ETZA 3DI2B 1SFHA 3IGUA 1MCOH 3QUZC 3REVA 4JKLA 4A6YH 4UTBL 3PV7A 4NZRH 4MZRA 4FTVA 3DX2A 2CIIB 1ES0B 2R0ZH 2XACC 3LOWA 4BHUI 5KYUB 2CNYA 1DZBA 3AW5A 3R1GL 3ARRA 4R7LA 2ARJQ 3QJQB 3SDCB 2X5PA 1DN0A 3G6DH 4MFHA 3FQXA 4PJIA 1LO3H 2AANA 2G2RA 3L17A 4H8VA 4HWZA 5ABDE 2WO4A 3X14A 4Y19E 1MFCL 3C5JB 3CVDA 1GGIL 5JOPE 3NIDE 4MS8D 3INUL 5I1HH 2ESVA 1I31A 1SJVA 5INDB 4WUKL 2ZPKL 3BPCA 1YNTB 4WW1B 3BWSA 2WXMA 5LBSL 4OLXL 4PRIB 2CGYA 1T7ZA 3LRHA 2IG2L 2XYBA 5KSBE 5EA0H 1ZHBB 1RUPH 1KGWA 2BC4B 3NFPB 3OKKB 1A6WH 5JIDA 4FA8A 3G6JE 5C2BL 3QDMB 4I0CC 5GGSB 4ZOEA 3P2DA 1MCFA 1YEEH 4Z7VF 3AS0A 3ESOA 3DJTA 3GMQB 4NUGH 5AOIA 5DLMH 1JNJA 4KK6D 3CE1A 3MREA 4AXWA 3QJHB 4P2OC 1THAA 4MJ5B 5EDSA 2G9HB 5JXEC 1UWXH 1BVOA 4EZLA 3ARDC 5J11C 1ORQB 4JN1L 3L5WB 1TVHA 3DJRA 4KVCL 2FHFA 4GI6A 3QXWA 4ZFFA 4TTGA 5LUMA 1U8MB 3CAFA 3CVBA 4Z7NB 1CD1B 4XCFH 2VXUL 3W0WE 4E42A 3OPZL 5FO7B 4G80B 3UAAA 4Z7IA 1HSAB 2HVJB 2HRPL 4C83B 2WBKA 3NACH 1OSZB 1JV5B 1XEDA 3D2UA 3LIZL 2X6UA 5EZIH 5H37A 3ULVC 4ZOBA 4QOKE 2K3HA 3CCHB 3O3BB 1E4XL 3MOBH 4XZUB 2Q86B 5B1AB 5AYUH 4DP9X 4I18A 4IS6B 1CICD 4HJJL 4WO4B 4CAGA 4M9OA 4LMQE 2I9LB 4YHLL 1JPFB 1WT5A 2NYKA 4AQ8C 5A2FA 4FFYL 3GBNL 4GW1A 2H6OA 2DWDA 2F53D 2QBWA 3QORB 3X3GH 5C3LD 2NPLX 2XKUA 4X7FC 3GJEA 3NABL 3T0EE 3P73B 4LCUA 3BGMB 2NW2B 1CGTA 1LE9B 2PYEA 4YDLC 1YEKL 4L8SA 4PUBH 5EOTA 2IC2A 4MXWL 2BS9A 1H15A 2X4UA 2XQYA 4G70B 4G8GB 1OTSD 2AJ3A 3CXFA 3RNKB 2HFTA 2ATPB 3L3KB 1FIGH 1FSKC 4W4NA 3AACA 3TJHD 4HV8A 4IBQA 4WGKA 4YNYB 1MJ7L 3I6GA 3REWA 5ISZD 2BP5M 5IJBC 1UWEL 5E6UB 3QRGL 4NGHL 2YJQA 4TPRL 4AW7A 4X4KA 2CKNA 3LXAA 3BN9D 4PS3A 2HRLA 3Q06A 2WB1A 1I8KB 4GKSB 2R1WA 1QPKA 4NJ9L 2G3ZA 1GYCA 3ALWA 3FT3B 3L4TA 1N6QH 5KVFL 1BFTA 1TETH 1UUNA 2RFXB 3F7YA 5KJ4A 5IJCC 5LXGL 5JYMA 1ZD6A 1RZJH 3ECUA 3HMXA 4HUUB 3CZEA 4KUZH 2V2XA 4MA3B 5EIIB 4B0MM 5KYYA 1UB5B 2W1NA 3AC0A 3VXUE 1MAKA 1E28A 2LV4A 2IALA 2V17L 2RD0A 5DT1H 4XTRC 1OV8A 4D9RE 1XMEB 5C0CD 5L0QC 2G0KA 1MCNA 4UV4L 1IILE 1OTUD 3UJTH 1HFUA 2F8OA 3J27A 3VG9B 3MGTA 5CU5A 4FJ6A 1UM5H 2EDEA 3GMLB 4HWUA 4IMKA 4I8DA 4MNGA 2WXFA 4HJIA 1Y0LA 2YLKA 1J88A 3CQPA 1KGYE 2JV6A 3OB0K 3F3HA 4BH7B 5JA9A 4UUJA 5EBWA 5EU7E 3E9TA 3CHOA 1MEXL 3KPSE 1SJHA 5CZVH 1HI6B 15C8L 3ZKXC 1OP5H 2ICWI 5C0AB 1IAIL 3Q5TA 2L7JA 1TU2A 4PBXA 3ARVA 3I9GL 4JFEA 3EUUA 4S0TD 2Z8VC 5DJ6B 3WXVL 3QUYC 2FL5B 1INEH 3ARED 2K9UA 4FAAB 2BWQA 1F6AB 4N8UA 4ETYA 1XQ4A 2GVYA 4I0PA 1T5WB 3IE9A 2JIXD 4AMKL 1YECH 3NJJA 3CTTA 3CPLB 3L9RB 3NCXA 4YHOH 3WAKA 1Q9OA 3KD4A 1SXAA 2A77H 4TV3A 2X4PB 4M62H 3M17B 4IBLT 2FLMA 3VYPA 3L16A 5SWZE 5IVNA 1KY7A 1SQ2N 4HIXH 5LN4A 1WWAX 3RILA 2XXGA 3I6LD 2WUCL 5C6PB 3OJVC 2DEWX 1NFDB 4X5WB 5I8CB 2G75A 2EE0A 2RCSL 4LSUL 5K9OB 3EGXA 4TQEL 3Q7JA 4ZMYA 3S3DB 4XXWC 2A38A 3ASNB 4N8VB 1EJFA 1MG3C 4HU2A 3CGTA 1QRNA 4KZCA 4ZFZA 4K23L 2BP8B 1L0YA 1N26A 4HPOL 4K7PY 4LLWB 1KGCD 2CSPA 3I50L 3WTYA 2PR4L 3AM8A 4IKJA 4PW9A 5CJXC 2B08A 3UZVA 4WW2A 3L7FA 3E6FA 4RZKA 3BAJA 3PNRB 4PV9B 3IKKA 3MV8A 4EMZA 4Q9RH 4DKFL 3BZFB 2PWFA 3HB3B 4KNTA 3SE6A 1E0OB 3EJUA 5T5FA 3W57A 5C9JB 3FQ4A 3T71A 5JHLL 4E9YA 4LLMA 3QS2A 1CGSH 4BZYA 1M05A 4S1QL 1KJMA 2XZZA 3ME0B 2F7RA 4LOFA 3IJHB 3O8XC 1F2XK 4IMLA 4M6OL 4RNRB 5DSCB 2XTLA 2WSDA 1VADB 2M26A 4LPTA 2DJMA 4PI2A 1UATA 4JFPB 1L7IL 3GGWB 4KKLD 4XWGL 3E6HB 2XC8A 4TOYL 1XZ0A 2EE6A 3UC0H 3QAZC 1E6JL 1EIBA 3F12A 2YUVA 4HUXB 2IDQA 2WKOA 5DK2A 5D6CB 5L9DL 4U6VH 4WKXA 1AZUA 4Y9EA 4AYFA 1WCBB 3D1MC 4TNWF 2BVQA 1ZJAA 2X3CA 5HGAB 4LRIC 3SE9H 3V6OE 2PTUA 3ORJA 2F58L 4FCAA 3BVXA 2F7PA 2V3EA 3RWDB 4YDZA 4KHTH 4JB9L 4G5ZL 2AEQL 1BBDH 3O0LA 2H2PD 2IFGA 2VW6A 2XBZA 4LFHD 4QCIB 5ID0B 5HVGB 3B4NA 3L9EA 3H4FA 1WBYB 2K0RA 1X5GA 1JYXA 4N87A 3RWFA 3QPXH 3ZLQC 1NBZB 1TPXB 2BFVH 4M3KB 3QR0A 5I8OH 3R0MA 5FECA 1OAXH 3ZE2F 2ZX9A 2FO4A 1X7SA 2X09A 4K5PA 3JTTA 2QGEA 5DD5L 3C60B 1P5UC 2V5RA 4XCYA 3V6FB 1EV2E 5I71C 2WBXA 1P0SE 4LVOC 2OP4L 3A4EA 4K55A 4F37K 2XNAB 2VYRE 2CZNA 1KGUA 2YBRB 4F8TA 4YLQT 4IOIB 4UT9A 3VI4B 3L7EA 1UC6A 4DERA 3A67L 3HLAB 3DKHA 5GS0C 1OD9A 5GISH 1U21A 1CXLA 3IFLL 4ZNCD 5F7UA 1BQHB 2D7OA 2OL3L 4P2QE 3ECQA 4JZOA 3T0WA 4WUUD 4M1GH 3VFNA 1NFIA 4DN3H 3MRHB 3EDFA 1N10A 3K71B 3TPUA 1ETA1 1MUJA 2QDWA 3P77B 4IEFA 4Z7UF 1D7CA 1VKXA 3U4EA 1MVUB 3FU9A 1OARL 1R5VB 3S5ZA 3FUDA 4UDTB 3EG9A 1KELH 3LY6A 1U8KA 5AG8A 3VTMA 5BQ7B 1KB5L 1CCZA 2ZOKA 4PP2B 4KGJA 2TRHA 2GCYA 3QUMA 1S78C 1LE5A 2CXGA 2CO4A 3P02A 5D1ZC 3OWRA 4HJGA 3QEUA 1OOWA 4HCRA 1ZOXA 3L3DA 3V0AC 2UUDH 3CIAA 4NZUL 4TULH 1QLFA 1FI8C 3GC3A 5FUZL 1AIFA 1UD6A 3Q2WA 4AQEB 1NGPH 4M93B 1KCVH 1Z32X 3WUZA 1MFEL 2P3YA 1NGYB 2EYTA 3QNYA 5E08L 3TBTB 1AR1C 4XMLH 4N6RA 4AEIL 4B5ZA 1VJSA 3CZJA 4TLUA 1KYDA 5HHQB 2WLJA 4U1SB 1BIIB 4GKZB 5L8KB 3BLPX 3DVNB 3V4VB 1D6EB 1QSED 3DXAD 5IHZA 3L3GB 2CRYA 1DSYA 3AG4B 1DVXA 5C9KA 1BPLB 4GQRA 3ZUCA 5IMOA 5C09A 3OHMB 3B9AA 5GS2H 4L1BA 1USZA 3IDUA 4G8AC 4LSSH 2VDKL 1E2VA 1NCOA 5BJTA 4KJQC 1QA9B 2HWZL 5TE7L 2E7LC 1QUNB 3VXSA 1SYSA 2GEEA 2HTLD 3H6AA 3LHPL 5ALCL 2DTSA 4AV0A 3N42F 3AT9A 2R0KH 3QEQB 1C12A 1V3MA 3VWJB 4JFTA 2I7OA 3EOYG 3HNSH 3VD3A 1QTYT 4Z18A 3U9PL 4LPWA 5K59E 3PABB 3KPNA 1RZGB 3TA3D 2H6UA 4QHMB 3V6BR 2ZWZA 1G7HB 1L9SA 4KTYA 2EH7L 1AGCA 5EZJB 1JZHA 3U1SL 5KZCD 2F7IA 12E8L 3DOSB 2DJ4A 1A6VH 3OJDA 4MJID 4PGBB 2OYKA 2IXQB 3DGDA 1WWWX 3MTRA 1VENA 4PY7A 3FF8A 2J8HA 4ZODA 4M5SA 4IOSA 3K2UL 1ZMYA 4GRLC 3BH8B 5DVLA 4FQXD 3LNFA 3QXUA 4NT6B 1JSYA 4YC2B 1XCQB 3BZ4B 5C0JB 2VWEC 3D0LA 1JPGB 2DAVA 3GNMH 2HVKB 5TFSH 2F19L 1NIDA 1IGIH 3GBML 3T77A 4CU7A 2IBGA 3WN6A 4A7GA 2XDHA 3ZKMD 2X41A 4NPYA 4BV1A 3H6JA 5KYXB 3DECA 3SE4C 2MNUA 5FOBB 3T0AA 3O2DH 1U8LB 3X3FL 4MJ4A 3OR6B 5A16A 2XG5A 1GTNA 2EICA 4UQ2A 2H32B 2ZD0A 4F9LA 4LCYB 4OCNC 1AHMA 4U1HA 3QUXB 2G5RA 4WHYH 3SE8L 5JQ6H 1NAML 5IM7A 3FUEA 2A6IB 1IM9B 3E9UA 4ZAKB 1BM3H 1MIEL 5T1DL 1MQKH 2Q3ZA 3BH9A 4G3YL 3AFLA 1J1PL 4FJYA 4UNVA 4P05A 1KTDA 3DHMA 5B1KA 1RVFH 2IVFC 2ADFL 3MRNA 2VLRE 5IFJA 5ICUA 4IRZH 4OCMC 2X4SB 4PQXA 5LXVA 4GMTL 2Y24A 1VZIA 2FIRT 3HC2A 3IF1B 3P11L 4OLYH 2UYLB 5HHXH 3MNVB 3PL6D 5C0BA 2IANA 3AT0A 3QIWC 5J3HC 4ZW3A 1OT2A 2ADYA 1LD9A 5CBAA 2G0LA 5K9JL 3C2AH 3QUHA 3RTQD 3UYPB 1LEIA 1MI5B 2V2TA 4JFQB 3IPFA 4A2DA 1R24A 3C9NB 1FC1A 1XT5A 3MGAA 4JCWA 3V55A 5MENB 2OXHA 5TQ2L 4M29A 1GZHA 4PBVC 3OKLA 4NRZA 3V0VA 3WJLA 2QKIC 3CN4A 4XWOC 4GW4A 1SM3L 4Y9BA 1MRDH 4Z7VA 1ZVSA 3FUHA 2VQ4A 3LQZB 5H94A 1QFOA 2AP2A 3IDYB 4X6BA 1UM6H 4XN4A 4NJAL 4YL4A 5I5RA 5C7XH 4G1EB 2YPKB 1UJ3C 2YRZA 4DQOL 5J1TC 1J5IA 3VRIB 1JUFB 2C3WA 4NHUB 1LILA 2Q6WB 1ZA3B 4OTXH 1OQXA 2YAOA 2CM5A 1EXUB 4F7PA 1K2DB 2CLRA 5E7BA 1DDTA 3AS3A 1L9TA 3US9A 1GHFH 1U58B 1U6AL 2B0SH 1DL7H 3CK0L 4IBYA 3PJSA 1ADQA 3L1OL 4X5XB 4C47A 2AK4A 4FHBD 3WSQL 4J3OG 4IDJH 5F89B 4ZPVB 2HJFB 3LV3A 1RK0A 2FJFB 2D7MA 4ZYKB 1ZGLA 2C5DC 1NCWL 4PCSA 4ZSOB 2YPVL 2YPLE 2OJEA 3GRWH 2A7BA 1EAQA 5DLLA 4N0CD 1ZT1A 3HZVA 1FH2A 4YDVB 3CH8A 5AOZA 4D9QE 4DW2H 4HALA 5AZUA 4PM1A 3O3AB 4S1SH 5TDOB 2VXQH 3NQKA 4NN7C 1A8JH 3UDWA 3MRGB 1FL6A 1P4LB 2CKBB 3BUIA 1NCBL 4NENA 2FWSA 2GC7C 4HS3A 4MNQB 1RFDH 4XNBA 4L4TE 3QZLA 2OJZL 2NQDA 4XMPH 1BVNT 4L5FL 5DR5H 1Z9PA 2VUOA 4K9JA 1PS3A 3U7YH 4PP1D 3OXSA 1RJCA 4POZC 3Q1EA 4O2CB 2DWEB 4RWYL 2ICES 5FKPB 1OE2A 3P0GB 2IBZX 4CJ0A 1A7RH 3QQDB 4IM8A 5FLUA 1UA7A 3JT2A 3KXFD 2A1WH 5D9SA 3BJ91 2P8LA 3HG5A 4LBEB 3NIGF 3D9AH 4K94H 4KKQA 5HYFA 2VRKA 2Z34A 1Q72L 1TTFA 5C0EA 4PJFF 4CJ1A 5JW4Q 1E8ZA 3BEWB 2JH2A 1XGRB 3IPEA 1J05A 3QO0A 4JRXA 2RMNA 1QFWL 3RVWD 4QXTA 4GS7B 2O5ZH 5BUGA 3ZU8A 1N0XH 5GRUH 1AGEB 5DJAA 4WWKA 5CZRA 4HLZG 4WDIA 3HN5A 1QAWA 4I2XE 3AWGA 4K3EH 3OKNB 3MZTA 1I1RA 3MRPA 2PP9A 2Y7OA 3QUZA 3N55A 3VCLA 4PGCA 5AOMA 2AS5M 2VLKA 1I8MA 1P5VA 3ZYJA 5C07E 3R18A 3KJ4B 4FZ8L 5HPMA 5EEVA 2O61B 2GW5A 3KBEA 1CDCA 3JQOB 4J6RH 4YHKH 2XOTA 2FBJL 1SNRA 4ZRGA 3V95A 2E9WA 1R5WA 3C08L 5BZWA 1H8OA 3PWVB 3F5WB 3NSXA 4Y1AD 4N9GB 3RG1C 2H0EA 5E0QA 1N7MH 2G3NA 2XN9A 4OGXH 5T1MB 5JPNB 5ADPH 1A4JA 4JQIL 3ZDZB 1N5YH 1WO2A 1NZRA 2V9QA 1A4CA 2OMUA 4XMKL 1E9PB 4QYAA 1AXTL 3PP3K 4JKPH 4EDWL 3D85A 1MIML 1BAFL 5DMKB 4HWEH 5MEOA 3TNMB 4L23A 5JIKA 1O0VA 4NP4L 5JHDB 4RDQG 4OGYH 4DEWA 2QZQA 5DEZA 2Q0ZX 1M7IA 3APMA 2FZ3A 3O11B 1MRFH 1I1FA 2QPSA 5D7JB 3ROLB 4BFIA 2V5SA 4NUQA 5JMOC 4LFHG 2HTKC 5AW1B 1W8NA 1S7RB 4L4VB 5DYOB 2VDRL 4ZFOB 4LF3A 5JXEA 1HH9A 2EEBA 3QCUL 4ELME 4N20A 3ARDA 3FPXA 2HH0H 4P5TC 3VWKC 1HWWA 2N7BA 2X2IA 3D48R 5HDQH 4WFEE 3OX8B 2J73A 4BQ6A 4AYGA 5ANMA 3FMGH 3M1CA 4KJYA 5FYKE 4HHAA 2DKSA 1GH7A 2FH6A 2A0LC 3VSVA 5DUPL 4EOWH 4ZPTA 4N2BA 3VXRD 2VN4A 4WCYL 1PPIA 1UWGL 2B1HH 4D3CL 1E5ZA 1OSPL 2QGDA 1FH5L 2MCPH 4UZGA 5AVTB 4OZFG 3CMOH 3T3PF 2RJMA 3DMMA 3VB8A 4Y16B 1QEWA 5CSGA 2VDMB 1Z2KA 2OM5A 3CDZB 3Q6GL 3C6EA 5DQ9A 3U0TB 4NUPA 1EEYB 3IRCA 3VA6A 3O6KL 1WYJA 1JWUB 3Q43A 4JO5A 4PJ5E 4MCZB 4MHHI 4D0CB 1BFVL 1FFNB 4LBAA 3ASWA 4JHAH 4OFYA 2NY5H 4TQIA 5D2LB 1KN2L 2D9CA 1G9NC 2VSKB 1NOFA 3QEGH 4G1MA 4UT7H 3CFUA 4QRAA 1QFWM 4P07A 1T6BX 1FZMA 4OSUL 2ZKHL 2BDNH 1UQSA 3H2WA 4PJAE 4Y5YC 4J8RB 5AEAA 4BUGA 4PJHB 3HC3L 4XP9L 1WGOA 3DSFL 3L95B 1NH6A 4JM2F 3US1A 1BZOA 1FN4A 4P0DA 3X12B 4CUCA 2MTAA 4EI6B 4NNXB 5CU9A 5D96C 4KTEL 1LXMA 2Z7UA 3OKDB 4LE8A 2AABL 3CN1A 4Y7OC 3WELA 4MASA 4NPJA 3IDXH 4NM4L 1D2OA 1FGVL 3ULVL 1RHHB 2OSWA 4MZIA 4U7SA 1ZGLP 1GMEA 4HKXA 4KGLA 3K6NA 3W1ZA 1GAFL 2ADJA 2JK5B 2BNRD 3D0VA 2YMTA 3UTSA 4CN4A 3BWUC 3EO0B 4YIQB 4A1RA 3WE6A 4NKMB 1CLCA 4QYOB 2ERJC 2G2PA 1A7QH 2X6VA 2UWEA 1KXTA 4N2LA 3KPQA 4XP1L 4C54A 1DQMH 5IMKA 1U8PB 2NY4B 3NFNB 4E9LA 4J12A 2IPKB 3BO8B 4KKCD 2XV0A 3GMOA 5D2NC 1JZ7A 1BVLB 2VMEA 4R2GD 5CD3B 4AI7A 1LWHA 4U2YA 3WV0A 5AW8B 3N41B 1F45A 2MKLC 3IETA 3T0XA 4ZX6A 5J7CC 1JXGA 3BGFC 1T4KA 2E6PA 1DBKL 5EZOL 2I9TA 2WBJB 3TZVA 1AGDA 3KYMB 4M03A 1D9KD 5HHMD 1JPSL 5KJRH 1P1ZA 1MKFA 2BCKB 4IRZA 1HU8A 5HGDA 3T6VA 4R5XA 2DQGH 4X6DA 3AXLB 5FA4B 3F00A 4YHPA 2WVTA 1LP9F 4YDIH 3KL0A 5JXAL 2CLZA 4NN5C 1XIWD 2LFGA 2ENPA 2A4CA 3F58H 3WKMH 2WQUA 4R0LC 1QFPA 1R47A 2D3LA 1AQ8A 2ZOWA 3WFEH 1LO2H 4BIKA 3F7RA 1AFVH 4MDJB 1SXBA 4G71B 2PWGA 4K9EC 3NJGA 2MNWA 1JWSA 4ZX3A 3D4ZA 4GINA 1PZAA 2HUHA 4TTDC 1YMME 3TIDB 1PSKL 3G04B 1KPUA 1J8HD 2XZCH 1R0AL 3GJFK 5A6LA 4W9LC 5EWIH 1E8XA 1Z3GL 1DVYA 1U8NB 5DJYB 3PJNA 1ZLUK 1CL7L 3VGAB 4P23A 3ES6A 1DVUA 1PX3A 2AXFA 2IBZY 4YSEA 3PJLA 3F7LA 3WXWL 4AENB 3ULUC 4OVVA 1U92A 1GGBL 2FO8A 2OLDA 4OCXH 4XXWA 2XWBA 4GG6F 2NTSP 2APBA 2EVHA 1UOWA 1S7WB 4OGAC 1CGUA 1IFGA 4HIQA 5TDNB 1UCBL 1EDYA 5I6OA 1QLEB 1RMFH 2W38A 3CSYB 5FIEA 3UYRH 5FYLE 3VDAA 3W56A 4BFNA 4FTVE 1SVZA 1I75A 3HBZA 5DZPA 3WFCH 1DQQA 5C0DB 1KCRL 3DROB 3P54A 4JKNA 5HP5A 3C6SB 3WO4C 3K2IA 5AVVB 4PJIE 2F8IA 5JOPD 5KSVB 5ISZB 3GRWA 1V7NL 1T0NB 3T09A 3R0NA 1BXAA 3WNNA 2CKBH 1B0RB 2NNAB 5AVZB 5FM5O 3U6XA 5KVEL 1CQYA 1I8UA 3LD8C 2GK0A 2VXQA 3O6FA 4G7YH 1ODUA 4Y2OB 5I0WA 3U6RB 5BXFA 1K8DB 2ESVE 2XTJC 3QQXA 4YVNA 3O8XA 2BNUA 1C1EL 3ABZA 3OZ9H 3KS0H 3GSOB 3LVEA 2H41A 3QWNA 1EQWA 4TMPA 4MMZC 4ZNEA 1MCQA 4ELKA 4OCLC 4PWIA 2XKNB 1HEZB 5JUEL 5C0CB 3NBNA 5FGCB 1AP2B 5BVJA 1Q9LA 3GK8L 3MYJB 1D6VH 2NY0C 3B2MA 1TZHA 2HSIA 3FQUB 4RGOL 1IX2A 3BQUD 4G6KH 4OFIA 5GGQH 4LRIA 2XRAH 1EFXD 4X4XA 3WFDH 2AJYL 3VH8A 3W9EB 4HIJB 2O93L 2DD8H 4FQLH 4XO5A 5EN3A 2AQTA 3G5XA 4XXCC 5IR1A 3W0WD 4BZ2H 5F6IB 4UNTA 1LGVA 4Y4FD 5HI3D 1H3XA 4M7JL 5FWQA 5I73B 4PJ8C 2B1AH 1PYWA 3D50A 4ONHA 3S4SA 4W6WB 3AXHA 3QH3B 2EEAA 3HR5A 1B2YA 5H4YA 1FVCA 1W8OA 5CUSH 2W5PA 4XN8A 2C9AA 3AREB 3DPBA 3RFZC 1LDSA 3BVNA 5DS8B 4QOKD 4J39A 4TSBL 4DPRA 1XH1A 2YN3A 4L9LB 2JIXB 5KBLA 3ZZSA 3MRIA 2DQTH 2FB4H 1HQ4A 2VITA 1FV1A 1A1NA 1CFTB 1TJIH 4Y4HC 3KLLA 5L7XH 5AVXB 1G6RL 3TBWB 1G7QB 4JY4B 3LRGA 3P9WB 3IRZA 1VAHA 5IB4B 1HHJA 3APCA 5ENWB 5CEZE 3ARGC 1ZK9A 3RDTD 5E9DD 2FEEI 4JL1A 5A2AA 4MQSB 4NP9A 1H3GA 2LU7A 5D1QC 5HJ3B 5TH2B 3RJQB 2CUAA 2PYEE 2YKLL 3LRMA 5A2JH 2NR6D 4I3RH 3G6AB 4RQQB 1URIA 2KLRA 5EU4A 5IVOA 1EGJH 3MBWB 2J44A 4B96A 3HJ0A 3SKMA 4NQQA 4OM0H 1CB4A 3VW3H 1MAML 4N9OB 3ILDA 1S5IL 4FQQB 1HZHL 5IW1A 5KTEL 5GSVA 2A9NH 3KYAA 2DQEH 4NQVB 4C4KO 1FNEB 5BRZB 4G7VH 1SMDA 1XFPA 1QBML 4QRBA 2F6AA 2IH1A 2ZICA 3VM7A 1UXWB 4FFZA 5EB9A 5J4MA 1T04B 2EC9T 5I6LA 3VXUD 4XPGH 3R06A 1F3JB 4D9RD 1TTRA 2YBGA 3FT4B 4Y5VB 2VCOA 3HVDA 1I9JH 4DVRH 4F24A 3LZFH 3MR9A 4J7RA 4RAVA 3WGVB 4O58L 2GYSA 3GBDA 4LLYB 3WE1A 3B7TA 1U33A 3ZY7A 2L4OA 1Q0YH 4IYKA 4XP6L 4KI5C 4OI9A 1AS7A 1U3HA 1U8IA 4R6UA 3UG5A 3TO4D 5GRZA 1CR9L 2LTQC 1M57B 4JAMB 3FUKA 4BWWA 3KPSD 4NO2B 1PDKB 1D5RA 2COQA 4Y2DB 2X9ZA 2EJ1A 5IB2A 3K4ZA 2GSIB 4LDLB 3SDAB 2VDOH 3AMKA 5AAPA 2WTPA 2GTZA 5DQDH 3GKWL 1FBIH 4DTGL 3FOLA 4U33A 1NEPA 3CFEA 2VJ0A 4JFEE 3TCTA 1IL1A 2Z31C 5TE6L 1NLBH 3GS0A 4PR5B 4GAAA 5HHPB 4ONFH 4K5OA 5I5IA 2W95A 1A0QL 5DMIH 3VI3B 5EO9A 3QYCA 2XA8L 1AR2A 4G42B 1YEFL 5SWZD 3LPGA 5SX5H 3GSQA 4NO5B 2F1EA 1EMTH 1M3JA 4J3OF 5CZXD 3DUSA 1X5KA 3FO9B 5CP3H 1J7VR 4PRAA 3NIFF 2Z8SA 5BZXA 4O02L 5HI4D 1W0YT 3RIAK 3RU8H 4M6NH 1EZUA 2NY6C 4W4OC 4TUJB 4KKBD 3PHSA 5DK0B 2Z1PA 4HWBH 4D8PB 3QT2A 1BQLL 43C9A 1RJZB 4UMSA 2HLEB 5LDSA 1NGWB 4GRLA 3SPVA 3BAEH 1U8JA 3P4NA 4OZFB 5J6HA 4AIEA 2VXVL 3A5VA 1S9YB 3RVVD 4I77H 5TF0A 5HYJA 1N2RB 4Y7MA 4PJFA 1JHLH 3RUGE 4P46A 1H6FA 5D1XC 1QRNE 1DVSA 1A2YA 3N85L 3P0YL 4N8CL 4R8WL 2A6KB 3KPTA 3QSKB 1UACH 4HC1H 4WUUB 2OMZA 3GPEA 2ADIB 5AZEL 1LVEA 1H5BC 3P4MA 4LU5L 1F1AA 1RZ7H 3CFBA 4KVNH 1O9VA 1AXSA 2ZZUT 3GZPA 3MGOB 3NZ8A 3SE4A 5HGBA 1GOFA 2YUWA 3T65A 5CXPA 3T0DA 2ZF8A 3UIZA 3MLRH 3S2CA 3MV8E 2Z8WC 4U3HA 1IGCH 3IDGB 4KRPC 3QR1A 3L4YA 3QG7H 4PY8J 3KR3L 2OMBA 4B97A 3FFCA 4ERSL 2R1XB 2JKXA 5J06A 3U48A 4NKDA 2A74B 4HT1H 4XCNA 1GGUA 4M7LL 1EHXA 2H3KA 1QZNA 2VL4A 3TN0D 3MV7D 1N0LA 4R7VA 3BVTA 3N1QC 2AJVL 3G5VB 2HKHH 2APFA 4H8WC 3CX5J 4V1DE 5TQ0H 1TQVA 6PCYA 3C5XA 3O6MH 1FO0H 4R96B 4XI5D 3LQAC 1TQCC 5E1IA 3DSNA 3Q0HA 1MOEA 3M1OA 2QQKH 4MJJA 3C6LA 3DXAB 1AD0A 2W9EH 2Y06H 4JO1H 3NCJH 4AVJA 5A3IC 5CJOL 1NPNA 7PCYA 4CMMA 2AMUA 1I3RA 1OM3H 2QKIA 1CTOA 3EYQC 1CD0A 1B0IA 2QSCL 1WP6A 2JFCA 3IDIA 2DBLH 3ARBC 1YN7A 2PW2B 3N9GL 1FYTA 3UBXG 4Q7DA 2H2SC 5DD3L 5KS9B 3GUTA 4YFLF 2EDYA 3O9WC 3U30C 1N64H 4G8FA 2X28A 2HFEA 1FJ1B 3APDA 3WKYA 4YHML 3BPNB 5FGRA 1Z0NA 7TAAA 3DDGA 1RK1A 3GSNL 3GXDA 4FTDA 3VYOA 3LQMA 5EOCH 3TA3B 1JFQH 1E4XI 2P5EA 5HGHB 1AYOA 2XETA 1H3UA 3IFNL 2LT9A 4PMEA 2XWJB 1L9NA 2GSMB 1FP5A 3L4UA 4HEPG 5CGYD 4NYLB 5KZCB 3ERXA 4MJIB 4U6YB 1EAOA 3RVXC 2NY3D 4WFFD 1YMHA 1AZRA 4HKJB 1AQDB 1CXIA 2O5YL 1CF1A 1G94A 2ALAA 3VFRA 5IKCB 2DOCA 3VJ6A 5SX4I 4FQ1L 5ACMA 4BH8A 2GUOA 2K70A 4FQXB 3ZYIA 4DT2A 2MOGA 4TNVF 3SDCC 2DQCH 1IGJB 5BV7L 1KLFA 1A4BA 4NCC2 1TYJA 4RFEB 1KN4L 2I32A 4QT5B 3U0WL 4EUPB 1KXQA 3LN5A 1VACA 2B5IB 5MP6L 1SDDB 5ACZA 1G9MH 5B3JF 5ICYA 3DTXB 3GIZH 3SJVA 1DSFH 1CLOH 1HHHA 2GC4C 4S1RL 4QTFA 3E8UL