1ZDSA

Crystal structure of met150gly afnir with acetamide bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGGNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title A rearranging ligand enables allosteric control of catalytic activity in copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 87
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA02
3WNJA 2YXVA 2QDVA 3AW5A 4BWTA 4BXSV 3UABA 1PLCA 1L9OA 1GS6X 2I85A 3OQRA 1NIBA 1FA4A 1IUZA 1AQ8A 1CYWA 4BWUA 2GC4C 3S8FB 1OE3A 1GSKA 3TA4D 4KO7A 1BYPA 4E9QA 4AZUA 4Q8BA 4K9JA 1RKRA 3UACA 5I6KA 1J5CA 4F2FA 4DP9X 7PAZA 1B3IA 4A2GA 1A3ZA 3C75A 3FU8A 3CVDA 4DP4X 2BHFA 4KO6A 4YSRA 3OMIB 1A8ZA 1BQ5A 4YSSA 1PNDA 3WIAA 2X87A 1A4BA 9PCYA 2A3TA 1PZBA 4A67A 3RYMA 2IH9A 4KO5A 1ET7A 2FT7A 2CUAA 7PCYA 3UADA 3NJIA 2PP9A 3IN0A 3DKHA 3PPSA 2MTAA 2WSDA 3UAAA 2WO3B 3ABLB 4KNSA 3NJKA 1NIAA 2MRYA 1JVLA 1JVOA 5I6LA 2PPEA 5I6OA 4KOBA 2J57A 4F7KA 3H4HA 2PPAA 2FQFA 1RZQA 2FT8A 2X88A 1UATA 1ZPUA 4N4YB 2VW4A 2PCFA 1AR1B 3NJJA 3QPKA 4NERA 4HZ1A 1AZRA 1GYCA 3T6VA 1SDDB 4E9RA 1NWPA 1W6LA 2J55A 2ZONA 4HALA 1JXDA 1AG6A 1OCZB 2XX1A 3NJFA 3WI9A 2PP8A 2H5UA 2TSAA 2UX7A 2QPEB 3PCYA 1NIEA 2IDTA 1AG0A 4BK5C 1WA1X 1ZDSA 3FPXA 5B1AB 3CDZA 2CAKA 4DP6X 5FC9A 3UAEA 1KBWA 3FQ2A 3FSZA 5AFAA 2XU9A 3EF4A 1V54B 2PPFA 2ZOOA 3NT0A 2CBPA 3PAZA 1AS7A 5F7BA 3V9CA 3OMNB 1WAEA 2AZAA 3QJUB 1F56A 1GY2A 1SDDA 5D4JA 2PPDA 2YAFA 3FSWA 5B1JA 2XYBA 4YSPA 1SNRA 1KDIA 1MDAA 1SHXA 2GIMA 3AG2B 1PMYA 3NYKA 3SBQA 4BWWA 1JZFA 1J5DA 5I28A 2YAHA 2BW4A 1KCBA 4G7SB 1R1CA 1OCOB 4G7RB 1NIFA 1HAUA 1SJMA 4GP5B 2DWTA 2DV6A 1JZEA 3D12B 4HHWA 2CALA 4E9YA 1BQKA 3PAUA 2ZWNA 4JHVA 1MG3C 1OE1A 2XVBA 4G72B 2FNWA 2XX0A 3NSDA 4M3HA 2Y1AA 4FA7B 2BWIA 4DPCX 1NIDA 3NJGA 2VW6A 4YVUA 1BEXA 3ZX1A 2HRGA 4RH4A 3G5WA 1JXGA 1AANA 1A4CA 1L9PA 1JZGA 4DP2X 4KOCA 1J9QA 3ASNB 3SBRA 2B08A 4E9TA 1BXAA 2EIMB 5I6PA 1KBVA 4DP8X 2OV0A 4E9WA 1M57B 2DYRB 4A68A 4HCFA 2XWZA 2UXVA 3NP3A 4GXFA 2GB2A 3WKQA 6PAZA 4PAZA 2AVFA 3UGEA 1XMEB 1BYOA 2H3XC 3NSFA 1YLBB 3FQYA 4KO9A 3QJRB 1TEFA 1PZAA 3FQ1A 3T6WA 1GR7A 1JZIA 2PPCA 1ETJA 1XB8A 2CJ3A 1L9SA 4YSQA 1AIZA 1M9WA 3QJQB 3X1NA 3CZUB 3HEIB 1KYAA 3CDZB 1ZIBA 2DY2A 4NB7A 3TBCA 5I6NA 1SF5A 1JXFA 3NP4A 1SFHA 3GDCA 3TU6A 2XXGA 2W8CA 3FU7B 2EIJB 4A66A 2OJ1A 1BAWA 3IE9A 1IBZA 4BDVB 4DP1X 3PXLA 1XB6A 3NJHA 2WO2B 5TK4A 5D4HA 1ID2A 1L9RA 2FT6A 2YQBA 2XUWA 3AY2A 1CURA 4YSCA 3AG1B 2HXAA 4UANA 1AS8A 2I7OA 3S3DB 2XV2A 3BVDB 4P5RA 2OCCB 2R7EB 3L45A 3FSAA 1QNIA 3T9WA 1EHKB 1OOWA 1WS8A 1N68A 4W1TA 2QPDB 5I5MA 1OCCB 1JOIA 5PCYA 3OD3A 1BXUA 3CG8A 2YAOA 1AZCA 2IWKA 2JKWA 3H56A 4AKOA 3IEAA 3MBWB 3GYRA 1JZHA 3FU7A 4BDVA 1WA0X 3ZBMA 1IKOP 4HHGA 3SQRA 4AI7A 3V9EA 5D4IA 5I5JA 1AS6A 4KNUA 1FFTB 1W8EA 2BWDA 3FU9A 2IWFA 5B7EA 1JZJA 1NWOA 1QHQA 2HLEB 1HFUA 1MG2C 2PLTA 2R7EA 3ZDWA 3WG7B 1N70A 4EF3A 4GP4B 6PCYA 3S3BB 3T6ZA 2FQDA 1SF3A 3FYEB 2P80D 4E9VA 4QKTA 2AANA 4ZK8A 1W6WA 1OV8A 2FQGA 1ASPA 4UF7C 5PAZA 1CC3A 1IC0A 4CSPA 1V55B 1CUOA 1TKWA 3NJLA 1JERA 2DWSA 5I6MA 2HX8A 3ABMB 3SBPA 4W9ZA 2UXGA 2LLNA 4G7QB 2RACA 5I5IA 3T6XA 2BP0B 2HZHA 3HB3B 1AZUA 1OCRB 3TASA 2BW5A 4A2EA 2YXWA 2YAPA 3JT2A 4X4KA 5E9NA 2VN3A 2P80A 1CYXA 3ABKB 4KNTA 1NPNA 4AKQA 5A7EA 4UAHA 2FJSA 1RZPA 2YAQA 2JXMA 4DP0X 1I53A 1PY0A 2IH8A 4G70B 2GI0A 1PZCA 2IDFA 4F2EA 1ILSA 2HX9A 1AACA 2E86A 4BXVA 2YARA 1NINA 3N55A 1DYZA 1PAZA 2N0MA 5EHFA 1PLBA 4Q89A 5B1JC 4DP7X 1GY1A 2BP0A 4MFHA 4YSUA 1E5YA 1WS7A 2JFCA 1AZBA 1GW0A 3FPYA 4CSZA 5LDUA 3X1FA 1ASQA 2YAMA 3CVCA 1ADWA 1ASOA 2BP8B 4HIPA 5B7FA 3S8GB 1WA2X 4DPAX 2J5WA 3DIVA 3WKPA 3ZIYA 2Q9OA 1NTDA 4YL4A 2YAEA 3EH5B 1PF3A 1TEGA 3EH3B 4TXVB 4WTQA 3X1BA 3X2QB 5AKRA 2IDSA 3NSCA 3NSYA 3MX0B 2UXFA 4HCGA 1NZRA 4YVNA 5IY5B 3FS9A 1MZYA 3AZUA 1EZLA 3KW7A 4HCIA 3QQXA 1NICA 1E30A 2VM3A 3QJTB 4FAAB 2PP7A 1T5KA 1ZIAA 4QLWA 3EH4B 2EILB 1TU2A 3IBOA 4GY4A 2BP8A 2DYSB 3QJVB 3U25A 1MZZA 5B7MA 1A4AA 2CCWA 3ASOB 3N2JA 2Q5BA 2AFNA 2I7SA 2B3IA 2EIKB 2IDQA 3PAVA 1AOZA 1ILUA 2H47C 4AX3A 1V10A 1BQRA 3EHBB 3FT0A 2QDWA 1ZDQA 2VW7A 1KCWA 3NJNA 4YSTA 3WNIA 4DPBX 1GS8A 5I26A 2HRHA 3ABGA 3T71A 4DP5X 1E65A 2UXTA 1M56B 3X1GA 4YSAA 5B1BB 3OM3B 1NDTA 2J56A 2IWEA 4JKNA 4N8UA 1KV7A 1E5ZA 3QJSB 2VSKB 1J9SA 2PCYA 4HAKA 3BQVA 3PLYA 5F7AA 2NRDA 3H4FA 2VSMB 2Y69B 4E9SA 3DTUB 2FQEA 1L9QA 1ZV2A 2EINB 1FWXA 3NJMA 1J9TA 3AG3B 1SFDA 3CVBA 1ET8A 4JHUA 2IDUA 1IBYA 1AAJA 1KDJA 1SHWA 2IAAC 1L9TA 2HX7A 1GS7A 2BO0A 4GYBA 5B3SB 2GC7C 1OE2A 2XXFA 8PAZA 1PCSA 3TBBA 2VM4A 3X1EA 4P5SA 5TK2A 3S3CB 2GBAA 2FTAA 1QLEB 3KW8A 2VMJA 1A65A 1ET5A 5ANHA 1AZNA 1DZ0A 4G71B 3FSVA 4ENZA 2XLLA 3JTBA 5B1KA 1PNCA 4YSEA 3IN2A 1J9RA 1X9UA 1BXVA 1XB3A 1KGYE 1OF0A 2BZCA 1VLXA 2UX6A 3OMAB 3AG4B 1RCYA 4M4RB 4NAJA 4PCYA 4WKXA 3ERXA 4AKPA 1HAWA 2ZXWB 2BZ7A 2XV3A 4A2HA 4YSDA 2AZUA 1E67A 5AZUA 4L0PB 2GHZA 2FWLB 3FYIB 4GP8B 2GSMB 1URIA 1PLAA 2QT6A 2TSBA 4YSOA 1X9RA 4A2FA 4E9XA 1NPJA 4A2DA 2W88A 3GXUB 2XV0A
chains in the Genus database with same CATH superfamily
4EZMA 4ZZKA 5L4JA 3ZQWA 4IHOA 3I84A 2F6AA 1BPLB 3GXPA 4LSUL 4UT6L 2BP5M 3CHPA 1ZGLB 2WGNB 1F45A 1DBJL 3CLFL 4GI9A 3QBTB 4ZFOA 5LAXA 2OXHA 1HL5A 3QQDB 3TL5A 5DJXB 2GC4C 4D7PA 4AIOA 1R47A 1QFHA 2BSSA 4Y1AA 2GK0B 4WI0A 3ARXA 3BH4A 1RKRA 2XTLA 3DC0A 4BKLB 4XVUC 4IBVA 2YWYA 1IJNA 3M1BB 2HWZL 4L8SA 3PPEA 4HBCH 2YLHA 1JF1B 4DZ8A 1GGCL 3L3HA 3OMIB 4GAGL 4JREC 3LCYA 5IB1A 2H0JA 3WIIH 1PNDA 3WIAA 5BW7A 2X87A 4JRXB 4LASL 5B39B 1I3GL 1CDIA 1S9YA 5D70L 4P5TA 3DOSA 5D96C 2WP3O 3ZYOA 3MHZA 2Q8AL 3NJIA 2O6FA 5D1QD 3P54A 4B9ZA 3BH8B 2X7LA 2MCPH 4HFWB 3IDMA 4B95C 1QASA 3P69A 3SKMB 1JVOA 3EXLA 3M17A 3L2NA 5FYLH 4OTXL 5DS1A 5IK3A 2FCBA 3CFMA 2LFEA 2DWEB 2NZIA 3FT3B 5GSRB 5AAWC 4H8WH 3PQYE 3NPZB 5EU7E 5T5FL 5SWZE 1N4XH 5C9KA 4APQB 2IPUG 1AY1H 5DURB 2JK5A 3UG5A 3UYRL 3VSQA 1DVXA 3LB6C 4Z7IA 3AAZB 4L23A 3DX2A 1XSIA 3CMOH 4KWUA 3GBNH 2E9WA 3IKCA 4U49A 4XXWA 3WEOA 1U8IB 2EDMA 3DJZA 2BNQA 4S1DC 3BUDA 4NQEA 3TH2T 3HZVB 3CBJB 1LNUB 3IXAA 1QHOA 1G7LA 2WY3B 3DROB 1N5AB 4OLWL 3DXAE 2PW2B 3QUZD 5D7IA 1NM4A 4JANB 2EC9U 4RMVA 1I1CA 4G8GB 1I8IA 2GT9B 4NIYE 4YHPB 4AJWA 2E4TA 5AQ0A 1ZV5A 5I16B 3QWRD 1HHIB 2H6OA 3FXIC 1RH8A 3B43A 4F15B 1UQSA 3RVWD 4CNIB 3PUUA 4PJ9B 4N2MA 3TVMA 4YUEL 4L9LB 3BPLB 2FD6L 4BKSC 2I60H 5IJBC 3MUGB 3II2A 4ZAKA 5FUOH 5ABZA 1BVNT 2X0VA 2OAAA 1HQRB 3AITA 5E8DH 2XNAB 2JNZA 5I8KL 2VDPH 4G43A 1OAZH 2RQEA 4PJDB 4JQVA 2AMGA 1J05B 3GSOB 3Q6GL 1WFMA 1TFPA 2GJ6A 2FR4B 2EDJA 2DQEH 4BWWA 2IQ9H 4JDTH 2IEPA 4N1EA 1HL9A 3CZGA 1E0OB 2V2TA 1C12B 4CMHC 2CO6B 3S96A 1OCOB 4EN3C 1MJUL 3Q8AA 4GEIA 3BUYB 3W3BA 4HPYL 2J6EL 4JGMA 1VIWA 4DEWA 4IIQC 3EJZD 3RWFB 4P06A 1I85C 1BQKA 1VA9A 4LNRB 2PTVA 3N9GL 4HH9A 2EIZB 4JHVA 5SWZD 2R56L 4LEOB 4DAGL 5K59F 4J1UA 3F00A 4POYA 4HZLB 4EZKA 1JPEA 4X6CA 3F04A 4GS7C 3QIBC 3AM8C 2Y3NA 4A6YB 2EEAA 1PKOA 1CXFA 1TCRB 4Q0XH 3D3VE 3HHSB 4IEFB 3BYTA 1OIOA 2NQ3A 4NZFA 5CZVH 1OWRM 2NW3A 1OB1A 5HYJD 4N0CC 4B97A 2OBGA 2YKLL 2WN2A 3QARA 3C6LA 4W9EC 2JTYA 4X9IA 5HHVH 4OV5A 3VFRB 4QXUL 4PLOB 1IGMH 5CR8A 4FQLH 4NNYB 1DFBL 5IMKB 2VIRB 4YXKH 1BQHB 1C1EL 3HS9A 5T1KA 4LGPB 1C7TA 4XVSH 3OGCA 3BKJH 4JFEB 3QJRB 1HH6B 1LDSA 3M8OH 4ZTPH 2C4FT 4ODHH 5F7UA 3HCVB 1EHLL 1LP9F 1KBGH 1A6WH 2O4EA 4A7VA 4Y5YA 1UD2A 4JM2C 3GLZA 5KVGL 3FTYA 1SY6L 1G5GA 4NWTL 2APVA 3BZ4A 4NHCL 1TO5A 2V37A 2ZUYA 3HEIB 2WIMA 4WO4A 4XMVA 3U7YL 5IFJB 1DDHB 4HIEA 3EJTA 1CFVH 5IOPB 3EYQC 4EN3B 1WIUA 1NKOA 2V3EA 5CJ5A 3H54A 4YDIL 4J6IA 4QRUA 3A4EA 1IM3B 2PWGA 1UENA 1EHXA 1MREL 4S1RH 4MJHA 4C56E 1UD4A 3GMRB 4PV1C 1F4XL 3Q1SL 5GRVL 4S0SD 2FT6A 3UTZA 4CDGC 5JIIA 1A7OL 2V6HA 3TBTA 4WW1A 5ISZE 4RGNC 1P6WA 2I69A 4MSWA 4F1ZA 2ZXAA 4PH8A 3WHXB 4XB8A 1S7XB 5LBSH 3T0BA 5DJ0A 3WFBH 1FVEB 3FB7B 1ES0B 3JWNE 2ADJA 2IBGA 3L3IB 4IS6B 3VQLA 5TF0A 2YXMA 1BV8A 1SN5A 4HSQA 4LSTL 2HAZA 4EOWH 3GYRA 1XIWC 3KVDD 4PW9A 5KWYC 2X1OA 4DUVA 4L1SA 3F5WB 2WVTA 3O4OC 4UUJA 4M1CD 1AQKH 3FU9A 5E9DB 3QULB 2CBOA 3EYVA 3K6SA 1H3WM 4I0PA 4LKXB 5I73B 3EJYD 1RULH 3GRWA 4UU9B 3WNOA 5D5MF 1JNNL 3KDMB 4LCCC 3T2OA 5FV2A 4Y88A 4QY8B 1E2WA 1P5VA 1Z9SB 4G1MB 1XBRA 1BYNA 4M48H 5IW6B 1EZVY 5FYJL 3RWDB 5K5YA 3QWRA 1EHAA 4OFDA 3RAJH 3VXTB 3BAEH 4KJQD 1U2CA 5CZKA 3GFUA 5DJYA 3DETC 4LDLB 5EBWA 1RJLA 5GGQH 3S36H 3ZOAA 3IDIB 1ND0A 1TMQA 3SZ6A 5ITBH 4M7JL 3QT2A 4N3TA 5I6MA 1IGTA 1VFUA 2EE3A 4NI6A 1U58B 5IESL 1M4KA 3MA9L 4HS6B 3B2VL 3GUTB 1BAFL 2CRMA 4JFOA 5CJXA 3QC6X 3LS5H 2C9XA 2V3FA 1M6UA 4RGNB 4PRPA 2FATL 3GMOB 1GC1C 3FFCE 2CIKA 2MNWA 4OLVH 4TVUA 4MNQB 1A2YA 5I18H 1IFHL 3JYBA 1FORH 4J3XA 5KVFE 1C5CL 1EZSA 3NTCH 1SDAB 3PWJA 4GB9A 3VI4B 5LKNA 2WXHA 1AGBA 4WUUE 2JCCF 4TPRH 1XIWB 4MNGA 1OSZA 4OZGB 3NCBB 5JXAL 1SUHA 4UBDD 4OF7A 4YHOL 4TQEH 3N40P 1WCBB 1CLVA 1MHCB 2ICWA 1AZBA 1QR1B 2ADIA 2HFFA 4MWFB 1DVFA 5HHMB 2YPVH 3MRIB 3VFWB 1M7IA 1YY9D 5CLZA 4BHUA 1W16A 1M2OA 4H5SB 4X4MA 3PG2A 4LCCB 1Z5HA 3EGXA 4UOJA 4Y1SA 2DQGL 3MO1B 3RNKA 2OR9H 2BSCA 3Q6FA 1QNZL 5HYJA 5H94B 1J0KA 4I1PA 2BDNH 1J0ZA 3PWNA 2C9QA 4IRZA 4YPJA 1C5DB 4OGXL 5IMMA 3LRHA 5SV4A 1ZS8B 1FP5A 2UXFA 1WBYA 3P3TA 4MXWL 3OKLA 4HUWA 2FEJA 4NLAA 1UZ6F 4WNQB 3D69A 4YBHA 2Z92B 1JPSH 2C3XA 2HRPH 2RA1A 4YDZA 4F3FA 5KVEL 1CVSC 5JOPE 1AI1L 4QHKJ 2Z8RA 1CGSH 4JFYB 1MCHA 4BQ6A 4GI8A 5EZJB 4XMKL 4KITB 1MZZA 1CL7L 2N56A 4HVBA 1DJIA 4J7RA 1GHFH 4R84A 2LQRA 4NN6C 4PRBB 4HC1L 3DRQB 1U8LA 4OCNC 1N0XL 1XF5A 2I7SA 4DKAA 4KZEH 1WIOA 4JM4L 3TC9A 1Y7VA 4JO8A 4PJAE 1G6RL 1H3UA 1MOEA 3EHBB 4JPVL 5EZIL 1ETZB 3FFCD 4KK9C 4X0KB 2F61A 3QZBA 4C47A 3EUUA 2BHUA 1AHWA 4WWOA 3QUXD 4FTVD 4F5CE 5LGYA 5C3TA 3B9VA 4P46B 4XNUL 4R4ND 3IFNH 4Z7UA 5DVNA 1G7MB 2DLHA 1J9SA 5JXED 2O6EA 4WUUD 4FLRA 1DBBH 4PRIB 3O2DH 4QXWA 2Y7OA 3DTUB 1OAXL 3DX8A 5IHZA 2DJMA 4NSKA 3B5GA 5JDSA 3CSGA 2OCJA 2P28B 4JZNB 5T3XL 3TIDB 4HKBB 4Z7VE 2NDFA 2PO6D 4XXDB 4HG4J 4AGQA 4WTWA 3TPUA 1GZHC 4JG0L 5ADOL 1A4JB 4LKCB 4LHUD 2FEDC 1KPUB 3TFBA 5GRUL 4MCNA 3P30H 1J9CT 1YJDL 2ZIDA 1RU9L 3MFGB 1A65A 3S98A 4ZTOH 3VX1A 2XRAH 5HVGB 5KAQG 3U30C 1HWGB 4H4NA 4WI3A 1DFXA 4UM9A 2O5YL 5HY9B 3INOA 2ZXEB 3Q9QA 1BFOB 2J1ZA 4JZJB 3UL4A 2WWKO 1MAML 2R0KL 3QAQA 2D31B 4UTBH 1DQML 2V5RA 4AJ0A 4LCWB 1KGJA 5JW4Q 1FNFA 1GJUA 5HDBB 3AS0A 3PWPA 2GCYB 2HT2C 4Y5VA 4NN6B 5K39B 2X09A 3MV7A 1UM6L 3X11A 3MBED 3HAEB 2YPLB 1H3TA 3QJZA 2KLRA 4ZUTA 1UEYA 4NQTA 3ARBD 3B56A 4GP8B 4BCXA 4EVNB 3TZVA 4BRVA 4PGBB 4A2MA 2P24A 4GSUA 4QHUB 1J88A 5D7LD 4A7GF 3IXTB 2W88A 2GKIA 2OMBA 4XCEB 3QXWA 2G9KA 5DHEA 5ESQB 2YXVA 4XCFL 4XMPH 2AJVH 2KHAA 4MXVE 5D7SL 4BWTA 2CDEA 1HHKA 2F74B 4YR6A 4IOIB 4N2AA 3SB3A 5D1XD 4BWUA 1GPOL 3MOBH 5FFLA 4Y4HD 4BQ9A 1L3WA 3FZUC 4B9GA 2WZ6A 3ULVL 3RZWA 3GSNB 2UUDH 2ZKYA 1JN6A 3OZ9H 1S7UA 4F9PC 1J5CA 4A2GA 4HDIA 3GSQA 2V3DA 2XIBA 2ARJB 4CL7A 2G0KA 4IK7A 1EBAA 5LGJB 3U30B 1O5PA 3LN5A 3OC8A 5HHXL 5AOKA 2CH8A 4OLZH 3RYMA 4PJHB 4G6KH 2NDGA 4BZ1H 4K7PH 1GZPB 2NX5E 3GC3A 3HS0C 3TBYB 3K72A 3WTVA 3M1CA 3V55A 3N43F 1R46A 3BC9A 3QDJA 5JPNA 1FH2A 2Q76B 4WGVB 5TF1L 2ZXDA 1U8KB 4LCUB 3F7YA 5CEYB 2CDGA 4KOBA 3SZKC 2GI7A 4EDWL 5JIMA 3BP6B 4HXBL 2TAAA 2PPAA 5LO7A 1T1YB 2GYSA 3KD4A 1CZ8L 3FMGL 2NR6D 1YO4A 1HZKA 1A8JH 2KZKA 3FRUA 2BINA 3EW3B 1H5BC 2AMUA 3KGTA 4PREB 4IKLA 2HVJA 3RB7A 1NAMB 1FL6B 1FYTB 3DYPA 3HB3C 4OGZA 4HOZA 4GT7A 4M62L 3VFNA 5AVQB 5K9KB 4AQ8A 2J12B 2P1YA 2TSAA 3EUDA 3ZL1A 2JJWA 1LL1A 4HJTA 4JO1L 2IDTA 4TSCL 5DC9B 3UZVA 3VRLF 1BQHG 3E6FB 4M5ZH 2FX9H 2P43B 4JW3A 1LK3H 2WXOA 2GTQA 3CHRA 2ATPA 2Z64C 3MV9B 4ZT1A 2PPFA 4X7TA 3QDMD 1RP8A 4O00A 3UTTE 2W65A 1G4RA 4P23B 3CC5B 1MCDA 1WTGT 2BHZA 5ILTH 4OW6A 1JCVA 3ILPA 5I74C 2IG2L 1MFEL 2QMJA 1LM8V 2A9NL 5FGCE 4D94A 4ZUVB 4ZMXA 3VWJC 4LVHC 3ZDZB 4S1QL 3BDXA 5DS8B 5IM7B 2BVQB 1W0VA 3EBAA 1XZ0A 4I3RH 4R2GD 1EXHA 4X98B 4HIHB 2CLZB 1AGFA 2HH0L 1DQDL 4ELKA 3E3QE 4FEMA 3KEHA 3WTXA 1E3XA 3RPKA 2LU4A 3INUL 3WLBA 5I0YA 3GSRB 2LU5A 3ML9A 1G0DA 3MLXL 1JMZA 1XF4A 4HS8L 3V95A 4LHUA 1B3JA 3KGSA 4R7NA 1HZHL 3KCPA 3OWEA 2R29L 3ARGC 3BAJA 5J1TC 1O6VA 3BX7C 3QI9C 2WMPA 1SJMA 2EDEA 2P49B 2FJFB 2B59A 1H5BB 1YEHL 3BEVA 3WKMH 3BZEA 2Z31C 3MLSL 4D9LH 3S5LA 3OVUB 2G3ZA 5GZOA 2WVVB 5KJRH 2V9UA 4EI0A 5F9OH 4XE0A 2VLRE 2Y1AA 4EQ3A 1OM3L 4FA7B 4H8WC 4Z7WB 1ONQA 3QRGH 1THAA 4WFHE 1B9KA 3JWNH 3ZO0A 7FABH 1QBLH 1P7BA 4PG2A 4GAAA 3WLWC 4OJFH 1T66C 3CZSA 2NYYC 3FQTB 2ZNWA 4FC3E 5C0GB 3MBEA 3VW3L 3RZCA 1M05B 1OZTG 4KPHH 2HLAA 2HYMA 3I75A 1W0WB 3NESA 4Z5RB 4XCYB 5LXGL 2H41A 1BWMA 2F54E 2VAJA 3HZKB 4UILH 4NYLB 2F8VA 3IRZA 2Y6SC 5EOCL 3CC1A 3CH8A 1ZVHA 4NJ9L 3CPLA 5D7LA 3SE8L 3TEXA 3DHUA 2EZ0D 1OOAA 5I74B 3H0TB 2BC4B 3P2TA 3VWJB 1MI5B 4LVHB 5EZLA 3L2LA 1HESA 5EUOE 2BSBA 3V0WH 1TPXC 1YLBB 2VDRH 1N64L 1OSYA 2WXPA 1TEFA 3CU7A 3FQYA 3GJEA 3LS4L 3ML8A 5G4MA 5I76A 4KJYA 1T89C 5AOJA 3LH2L 4JKWA 1U8OA 3FFOA 5LGHH 3IMVA 4ZFGH 4YSQA 1T2XA 5C08A 3N42B 1IGCH 5KSVA 3QFDB 5CGYC 3ESPA 5CJOL 2DYPA 3OAYH 2NXZD 4HIIB 4AJVA 2K9FB 4AMKH 3F6JA 1IGJB 4L05A 1HXMB 5CIPA 4LFHG 4OAWB 3PL6D 1IVLA 2J25A 1KCLA 3FOMB 4L3FA 3TU6A 4MJIB 5DD5L 3AY4C 2VQTA 1FRGH 2WXRA 3HI6H 3T0VA 1ZHKB 1EEYA 1W8OA 4Y5XC 2XBDA 1NEZA 4V1DE 2WO2B 1ID2A 2AV7A 1CURA 1MCFA 2CLRA 4OF0A 1JZ2A 3J8F7 4D9QE 3MUUA 5KVFH 2ZT9C 2DBLL 1CR9L 1U8MB 5AW8B 2XV2A 5IR1A 1CD1A 3V5HB 3HUJB 2VLRD 2ODIA 4N8VB 4HKXA 3IAPA 4IDLA 3FUFA 5C0IB 1XGPA 5I71C 1OOWA 1K5NA 1N68A 4HOMA 1OP5H 4ONHA 4QF1A 4R90H 4UT9H 2J8UE 2IFGA 1IQWL 2WV3A 4Y19B 3EO9H 4DESA 1TVBA 1A0QL 1QHPA 3A6OA 2GPZA 4XR8C 2GJPA 3DRTA 3QUKA 4JM2F 2OZ4A 3WDHA 5BW7C 1DQQB 3LQAH 2WN3A 3AQYA 3GI8L 2F54D 1R0AH 4ZFFB 4OZIF 2JB5H 3DUSB 2PTTB 3CVHL 4NRXA 3O3EA 3K71A 3CCHA 3MFFA 3VXQA 5ICYA 1EFQA 3PGDA 1Q72L 3FB8B 1AFVL 4P2OC 4JFZL 1A9EA 3QNXB 1IBFA 4ZPTA 2HVKB 5J1AB 1B2YA 4APXA 1A22B 3BP5B 4UV7L 5E4IA 4M93B 1DUZA 1DBKH 4C54A 2AAAA 2B16A 3HBPA 4BFRA 4I3SH 3O41A 1IC0A 2VDPB 3U46A 5CEXA 2XN9B 3B2UC 2AITA 3ZZQA 25C8L 2DWSA 2EYTA 3O3AA 4W9ZA 4JJOA 2RACA 3DGGA 4OLXL 4XPGH 3FF8A 4HYTB 4HA1A 2VLKB 1GCFA 3VI4F 1HQ4B 3H42H 3G9VA 4J2QA 2YXWA 2YAPA 5AL8A 4FG6D 4UTAA 3C09C 1S5HB 1V7NH 4V1DD 3ZMEA 4XODA 5LAPA 2FSEA 4YFLF 1U41A 3EOBA 4PG9B 2WIIB 1QP1A 2WXJA 4LLDA 5CLXA 4OCXL 1THCA 5DFWH 3WN5C 4E5XB 4ODWB 4ES8A 3L4XA 1UD5A 5EORH 2IH8A 1SEBA 4NX0A 1NAML 5IV2B 4L4VE 1UFGA 5EOTA 5I24A 3G5XA 1UD3A 1RUKH 3S35L 2XQYG 3N41F 3AU0A 3VD3A 3RFZB 2VZOA 3Q8BA 1PAZA 1L4IA 4ZAKC 1GGIH 2ZX6A 4KZDH 1TQTA 4FZ8L 3PDOB 4N0UB 1J5IA 2VLJE 3E38A 2HJLB 2F1EA 3QIWB 4M6NL 2XXMB 2Z65C 3BSZA 4P2RD 4EJ1C 2VR9A 4OF8A 1D5XB 1WA2X 4BH7B 1ZEAL 1QRNA 3UZQB 4AL8C 4BK4A 2IPTH 1UOLA 1TQVA 4TVPL 1ZLUH 3W81A 3V8CA 2CZNA 4RAUA 4AQZA 5FW6A 4LPYA 5AKRA 2Q6WA 1E9QB 3QFJA 4L3EB 2Y1VA 2LV4A 3HW7A 2EUWA 3VB9A 1EFXD 3BAXA 2XYCA 4IOFC 5F71A 2R83A 4JE4B 5FO7B 1F3JA 3PV6B 3OKEA 3PABB 4ZBJA 5BXFB 5LWYH 3SKJH 4FNPA 3EFDL 3VXNA 3ASOB 3TJEL 5H37A 3MNWB 3ZW3A 2CDFA 3SDCC 3PAVA 4OGYH 4PGCA 1NGZA 1NMAL 3IPFA 3PL6A 1TYRA 5CSBA 1KENH 3O9WC 1LE5B 3QUYC 4Q9QH 3HFMH 1R5WA 3QDGB 2HG5B 4K94L 5EBMB 3CHQA 3U0PA 4JDZA 4WWKB 4AWJC 2V2WA 4FLQA 1WP6A 4LARH 3TX4A 2J56A 3FQWB 2K7PA 5F3HB 1OF2B 1XR9B 2BOBA 3PP4H 3QO1A 2E5EA 1TJMA 1QG3A 4L4VD 3HE6D 4P57B 2YGNA 5LVEA 3II1A 3VXRA 3FQNB 4DOHE 4HEPA 1F13A 1YEFL 2VSMB 1FCCA 3CFUA 3HVNA 4QHMB 1L9QA 1TYEB 3QHTC 4CBPA 1JYNA 3NJMA 3OX8A 4XNAA 2A2QT 4GRLB 3VACA 2W07B 4Z7QB 4K4KA 4N2IA 1UJTA 5K9QG 4XWGL 2X9ZA 4Z95L 1P4BH 4JBSA 1IMHC 3WD5L 1JD9A 4WJ5A 1JV5A 5E1IA 4IW4C 3T3ME 2ITDA 1K3ZA 8PAZA 1TG8A 4D8OA 2WANA 2FTAA 1RFDH 1T0NA 4PGEB 1G84A 5BS0E 1S3KL 3RPIA 3MNVA 5HDBF 2WQUA 2Y24A 2HP4A 3TBVA 2YRZA 5CBEA 1XSKA 3KWWB 1BM3L 4WUKL 1OGAB 2DMCA 4U1IA 4ZUSB 2EDNA 3LKQB 3IVKA 1JIBA 1OWWA 2WCPA 3ZT5A 5F6IC 1X5LA 2V2XB 3HG1B 1TTBA 1E5CA 1FZOA 5GS0L 1G1KA 3VFTB 4KC3B 1RZJL 2CM6A 4QRRA 3BIKA 1INQA 1H8NA 4Y2OB 5J6GB 2ZOKB 3SDAA 2AEPL 2VL5B 1J7VR 4QHNB 5DQDL 5INCA 2ORBH 2WUBL 3IU4H 4Q9CA 3KGUA 3KXFA 5T33H 1WWBX 4FQXD 4M7LL 1GZQA 2GSMB 5J6HB 2W9LA 4PY8J 1PLAA 3O9WB 3QUYB 2YD5A 4JFXB 1KTRL 1LVEA 1CXIA 1VPOL 5CEZD 2RH0A 2MPAH 1X9RA 3GMMA 1QSZA 3O2WH 1FHGA 5MENE 4E9XA 5G4NA 3D52A 5CD3B 3KBEA 3CD4A 3VGDA 1QABA 2FECL 1T7VA 3QUZC 2DEYX 2QDVA 1FIEA 2BX5A 4FTDA 3SGJA 3U1SL 3JV4A 4QCIB 2VUOA 1BG9A 5D2NA 2J8HA 2FX7H 2JCWA 1YYLL 1VEPA 4YHIB 2I9TA 3KVQA 1MDTA 5TDNA 4RISL 3GB7A 4QNPE 1MWAL 2ED7A 3CNKA 2R2CA 2B1HH 3T0EA 2CA4A 4PRNA 3RVWC 3C8KA 3ZDXF 4Q8BA 1FZJB 1KJ3L 1MRFH 2J5LC 5KJ4A 3VU1A 2EH7H 4PBWD 3U4BH 5FUZH 3DX9A 3H1ZA 3ZE1E 1PEZA 4XAWH 4LDOB 2COQA 4FMVA 1NBYB 3RGVA 3QUML 4IRJD 2F7PA 5D8JH 3S48A 2WLJA 4P2QB 5DRWB 4MZIA 5E51A 5BS0D 4JFVA 2X2IA 5D1QB 3PPSA 4K3GA 2DAVA 6FABL 4JFPA 4P2RA 3LRMA 4AMWA 1QSED 2DQHH 3GMQB 4FHKA 1FNGB 3DYMA 4FFWD 2XN2A 3ZYZA 1XX9C 2CR6A 1FH5L 1R3HB 1CLOL 5IMOB 4Z3JA 3REWB 1OAZL 5IBUB 3DECA 3EJZC 1PX3A 1CXKA 3FO1B 4MAYD 1BLIA 4JDTL 3BKYH 1X5ZA 3NN8B 4D3CL 3O6FA 4ELMA 5FGSA 5HHNA 4RFEB 4ZO8A 3R7QA 4ZNEE 3V4VA 1NLDH 4WNSA 1B6DA 2H3NA 4NZUL 2AEIT 1NWPA 1X5YA 5E1AA 4AXWB 5DYOB 4CMMA 4HSAC 1JXDA 5HHPB 3UJTH 4AIEA 3BFWA 4NGHL 3RGHA 4QRQA 4QGTA 5DHMC 3UO1L 5D93B 2ZKHL 1FZMA 1YN6A 2DQFA 5I1CL 2FJGB 1BVNP 2VXUL 1TNMA 4UMSA 1HSBB 1Z9LA 1VERA 4HBQA 2XWBA 1NCJA 3V4PA 2ZOOA 4JY4B 2ZUTA 2WUCH 3RVUD 2GUOA 3SY6A 4XHJD 3R19A 3Q8CA 4H8HA 4WGKA 3RL1B 4YS4A 4F7CB 1SDDA 2RALA 4Q0XL 2G5RA 3U0WL 4X6DE 1ECYA 5GS1A 1QQDB 2MKWA 4JN1L 2YAFA 5DD3H 3FQUA 3DIFA 1NJ9B 1WD8A 4HU8A 4G1EB 2GBTA 5C0JA 1HINL 4QRPE 2XKNB 4F91B 2WSPA 4ONFL 2A5UA 4HD5A 1PMYA 5D7IE 1KLFA 2R27A 3WFDH 5GQBA 5DJDA 3ESUF 2G2RA 4W9CC 4GPVA 1BCIA 1OP9A 1RK1A 1G7IB 1I7UB 4MA7H 1XR8A 5CZXC 1M42A 2BS8A 4XBEH 3TT1L 2IANE 4ZMQA 1AHWC 5GHWH 1JZ4A 2BSED 4HHWA 3PQYB 3ZN6A 1O5DT 2X40A 4HIQA 4KFZC 2HT4D 5SWZB 5DT1H 4B60A 1F3RB 4RSYA 1U36A 1MG3C 3BD3A 4G72B 5EU5B 3TO4B 2MTPA 1EEZB 2BWIA 4KTEL 5EC1A 3ZKMD 5EEXA 1FFOB 1H15B 3KWUA 3K6FA 4LSSL 3ET9F 1EMTH 3NIDE 3MJ9L 3D2UA 4EI6A 1L9PA 2PCPA 3FT2B 3IJYB 4M3JA 3WFHA 1BXAA 3DXAB 4YN3A 5A7BA 3JWDL 1WFOA 2F8IA 4PRAB 1BDYA 2IQAA 2CUIA 3FUNA 5TH2B 5FR3A 6PAZA 1UCBH 1G7HA 2VOTA 4Q9RH 4M1CC 3WXVL 5IEHB 3UGEA 1A6UH 3DSNB 5ESVA 4KFMA 2QQNL 3QXDA 2VXQA 1U8NB 3GXMA 3X3FL 3BMVA 4Y4KD 1SJHB 4X6CE 5J9PA 4W9IC 2MFNA 3ZUCA 1TJHL 4DO4A 4O2CA 4Z1PA 2Y6TE 1QLRB 1CXHA 4Y5VC 3GK8H 1Q38A 4PP2A 4KJQC 1DN0A 2WLNA 4QRPD 4MMXB 5D2LA 2BCKB 4WI9A 1EAJA 1IKNC 3FT4A 3TBCA 3AADB 5DMIL 1LQSR 5EBLB 1IIIA 1U2HA 1FZKB 1TETL 2VAAB 3RL2A 5F7WC 3SYOA 1A25A 2D03L 2WCGA 2BVOB 3WL9A 5KVDE 2P8PB 4PWGA 2MCMA 3PXLA 4E5XG 3KLDA 3T3PF 2R1YB 1LO5B 2IAND 4QOKD 3M45A 1M7UA 2YQBA 4YHYC 2YPKB 4N20A 2I7OA 5KYXB 4O02A 1HOEA 5CMAB 4WK2B 1NC4D 2A9AA 4GQPH 4ANXA 2A9BA 3L45A 3FSAA 3QR1A 5CNHA 1UKTA 4PJBA 1UACL 4P3CL 3DHMA 2ARWA 3BT2L 5GJSL 2O5ZH 5C6TH 1YNKH 2F08A 3D3VB 3JWNC 5I1IH 2ERJC 1J18A 4IKIA 4UBDC 4OGQC 4OLVL 1HILA 5BRZD 3RWCA 2R2HA 3T4YB 1I9RH 3ZBMA 4BFGA 1WWCA 2VISB 3MCKB 2QFRA 1FORL 2NY2D 4PJ8B 1FFTB 3SKUD 2XIDA 3GZPA 5F1SA 1KEGL 2RIKA 1YVLA 4EI5D 4LDCA 5L8KB 4FGMA 3FOLA 5GGTH 2HLEB 1GA2A 4NDMA 5LCVL 2VXTH 2R7EA 5IFAH 4FQCH 2G4GA 4OUUB 1XGUA 2FAUA 4GP4B 3FQXA 3ZIMA 1GL4B 2D4DA 2OYMA 3N44B 5C0RH 4CADA 4X7SL 5IB3A 4UQEA 2H26A 1YMHB 1JHKH 3DLQR 1S46A 3W1ZA 1V05A 1H6UA 2JV6A 2NNXA 1HN1A 2JELH 1WRFA 4OSUH 4F7MA 1FQ9C 4PGZA 3QZNA 4Z0XA 4H1LH 1ICTA 1YEGL 2AI0H 2WYHA 2R2EA 2VTFA 3M86A 3WNKA 2E9GA 4DFIA 1Y1DA 4GKNA 1IEAA 4MCYB 4EIBA 5KSBE 2Q3ZA 4FABL 4KVCH 3MYZA 5FO8A 4NPJA 4C56B 4XN5A 5CEZH 2BW5A 2RD0A 2O72A 3S88L 3CXDL 4HUMB 3DUHA 3MV11 4W6WB 5E9NA 3L5IA 4FYTA 4YDKH 1D3CA 3GRGA 4KNTA 5ISZB 2IAMD 4MX7A 3VYOA 3ZSTA 4MVBD 3VFSA 3ATAA 2P5WA 1W72H 1LXMA 4WFGE 2OMXB 4NKDB 3RA7L 3RVVD 4OFIA 4MASA 2NY0B 1X7TA 2DKSA 4G9FA 4YGVA 3WO3B 5FA3A 2QTVA 1GHFL 1CLYH 1YY8A 3U36B 1Q9OB 2BSEA 3FN3A 3QUXC 2IMMA 4L5FL 3FW6A 1PSKH 4MKMA 4MRCA 5TE6H 3BGFB 3AGWA 2ERJB 1TLKA 4R4NC 5JXEC 4GW1A 5FS5A 1PLBA 3MROA 1KFAH 3OHMB 3IGAB 4MD4A 2BP0A 4W6XB 2ARJQ 3F3HA 3MQIA 5AOMA 5KW9H 1JI2A 4QRTB 5JR1L 4YBLC 5FO2A 1BF5A 4IBQA 5C07D 3X1FA 3HNSH 2YAMA 1TU2B 1ASOA 2DIBA 4HLZG 1RJYA 4LDEB 4W9GC 3KH4A 2A6KB 2X4RA 1I1RA 3D18B 3LQAC 4PRPE 2EE6A 2XIIA 4X6FA 4JZOA 2XN1A 1YEWA 3L3DA 4PRHA 2VDRB 4TQHA 4TXVB 3J2PA 3RVTD 2X4QB 3GUFA 1NDMA 1ZPLA 1EJOH 4ZFZB 3L95A 3MCYA 5HDRA 2AV1B 5C71A 4XNYL 4BA0A 2Y07H 4L37A 3AZUA 3VFPB 4FMKA 4HCRH 3C5ZA 1MF2L 4N2NA 3AS3A 5E8PB 1ACYL 1IEBA 4RRPG 5FIEA 3VTMA 4ZTOL 4LVOC 2XRAL 4PG2C 3IAGC 1GGBH 4X8GA 4LSQH 4GSQA 4KAQH 4YZFE 5HJDA 5B7MA 5C2UB 4DTGH 3C60D 3D4ZA 3UYOD 5AZEH 3MBEC 4X4ME 4JHAH 3S4SB 5EFIB 4Y2DD 4QXVA 4I77H 3ARBC 4Y9FA 2J44A 3Q8EA 3TO2B 1JVKA 3U6XA 1HEZB 4BFOA 1JJUA 1HHHB 3FFCB 2I5YL 2F18A 2IH1B 1NMCC 2WTRA 4XAKE 2WBJD 3QUXB 4WFGD 3TWCH 4YXLL 3MRGA 1QBMH 2V7HB 5AW5B 3SD2A 4WUUB 4X2UA 1LEIB 3BH9B 4L1HA 3VXPA 5EF1A 3LDBB 3HZYB 1MFUA 1A7RH 2GTWA 1AIFB 5GISH 3TTSA 5D1XC 3D33A 5I1EH 2PO6B 3CXHK 1SFDA 4Y4HC 3GLEA 3HMWL 4YO0A 4J2XA 4RZCA 2XVGA 1MH5B 2BO0A 2X3AA 1CFSB 4GYBA 2NT1A 2BP3A 1MPAH 4ALAC 1A1OB 3LZLA 3X1EA 2GBAA 1JAEA 4U6TA 1R24B 4ODSH 3FB5B 3KPSA 3MGTB 5BRZA 2AJSH 4TQPA 3RJOA 3HNTH 3OB0H 1C16A 3QO0B 4R0LB 3D6GA 1RZ8A 2NUTB 5HBBA 5IBUG 3SDXF 4Z7UE 3G6DH 5ACZB 5FAAA 1ZTXE 4KRLB 2BIIA 4NO5B 2J2ZA 3N5AA 4N25A 1DO6A 4DCQA 2KZ1B 3OKDB 5HVWA 1NEUA 1E8YA 4PV9B 1ZHBA 3RTQB 3L4CA 2D7MA 1QI4A 5JHDE 1ML0A 2A9DA 4OLZL 2NR6C 1JDDA 3WS6C 3MJ6A 3GMPA 4FX5A 5KYWB 1ANUA 4Y7OC 3DSFL 4Z6AT 1DE4B 2QQQA 4CN6A 2C34A 3LZFL 4KBPA 1PG7H 2QT6A 4LIQE 1JGIA 4PJAB 3SHSA 3UPRA 1NMCB 1U95A 4YBQC 5HHQA 3KLKA 1GOFA 5F0JB 4G6FD 4U1KA 2F0CA 5HYQB 5T1LB 3SDDD 3G6JA 3ZHDA 4YFDB 5DJ8A 4XAKD 5E24E 3QUHA 2EE9A 3H6JA 3VA6A 5GPRA 1E8WA 4M4RA 1BF8A 3GT6A 5I75C 3D4GA 2JIXB 4OCRL 3JV6B 2NLJA 1VENA 2IPKA 4QKXB 2D73A 1Y0LB 1DHKA 4Y4HB 4GJTB 1U93B 1AP2B 1CYWA 1RUML 4X99B 3O8XD 4RMRA 3NZ8A 4LF3B 1DVYA 5AD0A 2BRRH 4PBVC 4Z7VB 4E9QA 4F7PB 3HE7B 4AZUA 2BSRB 5JQ6L 3KYNA 5AKTA 1BZEA 1G9NH 3DK2A 4I18A 4NP4L 3QPQC 2HPTA 1BFVL 3C75A 3DARA 4DP4X 4I2XA 3Q44A 4R2GC 2VLMD 1KJ2B 1ZRUA 2FYYA 4XNBA 4WTXA 1ZVNA 3CHOA 3V6OC 1DSFH 1FSKC 4YSSA 1D6VH 9PCYA 4PWIA 1OHZA 3V0VB 3MRHB 4Z3FA 4IDJH 5CUSH 3P3SA 5C07A 4AYDC 1Z5LA 1OTUD 2Z8WC 2EC9T 4GKSB 2ALAA 3W39A 1S4IA 2AABL 1WUNT 2BNRD 1IJ9A 2GJJA 4HKJA 5DO8A 5AB1A 1S7VA 2PPEA 4YDJA 3QJHA 1E4WL 1TZ8A 2H2PC 1KG0A 2AKRB 3TA3D 5A2IH 2FO1A 1L6PA 1KCVH 4YDNA 4AZ8A 4Y9GA 5JHDD 3ZTJH 5C0ND 4I1RA 1FVCB 1TTCA 4JDVB 3MMEA 4DN3H 2NUPA 3JVGA 3T1WA 1W15A 5A3ID 1W6LA 2ZONA 3O0RL 4H2CA 5AW4B 3UTQB 1M7DB 1GKEA 3N04A 3NJFA 1CF1A 3MV01 4L29B 3PCYA 5EEWA 1MIEH 4J8RA 5E03A 3WKML 3R8QA 3GXFA 3IU3A 5CBAB 4NBYB 4BKTC 5I75B 4FFTA 5B1CA 2VZ3A 2PW1B 2CXGA 3SO5A 1WAAA 3HLAA 1DL7H 4WGWB 4EUPA 1DR9A 1JHTA 2Q1EA 2HJKA 4OJYA 1ESOA 2EZ0C 4WHYH 5HYSA 3ENEA 3WUWA 1LWJA 3VFVA 2I07B 2MOQA 3PREA 1A6AB 4HUUB 2CBQA 1SEQL 4WU5B 3UROR 4R2GB 3TF4A 4KKCD 4U1GB 2ZYRA 1KTLB 2QKSA 1R3IH 1MCBA 3HJ0A 4XCCH 1A5FL 1EO8L 3BKMH 5FGBA 5MI0B 1B6UA 2CKBB 4LVNB 1IGFH 5DEJA 2EXWD 1ZT7A 2KDGA 3D0VA 4AE0A 1FNLA 2D7TL 1S6NA 3GNML 3SOTA 2NXZC 3HPJB 3NIFF 1U92A 2NX5B 1J5DA 1JS4A 2M83A 1E8ZA 5KVDH 3PL6C 2EO9A 5TQ0L 5FUCC 3B7YA 3IS1X 4F8NA 5JA9A 2PMZA 1JGVH 1I1AD 1RZGA 3KBHE 4CGTA 1ZLVH 4YHMH 2DV6A 1D5BB 1KTJA 3N85L 5GIRA 4BQBA 3VU2A 2HPOA 4KRMB 4GG6A 4ZXBD 4LGRB 1A4KB 1DQLH 1X5AA 4NPYA 4OBSA 4KTDL 1FVDB 2MHAB 2JKLA 2OSWA 1IGYA 3HI6L 1ZSDB 2ICEC 1S9VA 2OMWA 3B9KD 2WLHA 2DIAA 5FCUL 2MOGA 4PLJD 35C8H 1KB9J 3GBML 1IAOA 4FFYH 4OIAA 5I6PA 3QH3A 2IBZY 2VRAA 3LTVA 1VFBB 4X6BA 3T77A 4DP8X 2AK4A 2WZ5A 4PMFA 3UFIA 3VXMA 2UVFA 4LLUA 1SBBA 1K6QL 3T4AA 3UTTB 4FULA 5IQOA 5EPMB 1COBA 5FGCB 2PR4L 4NNXA 4F33B 3T6WA 5I1LB 1FN4A 1CYGA 1Q9KB 1VCBC 2JI2A 5DJ6B 4KXBA 5I66A 3RUGE 3MV8E 5F70A 1ZA6B 5DVLA 4AYEC 5DJAB 3DOHA 4PRDB 1YDPA 5I30L 1AGEA 3TH3T 4P05A 1F3DJ 4ZMZA 4NO0A 2C1OB 2X4PA 4HJGA 2B14A 2ZXBA 5FDWB 2WINB 5IJKA 1BVKB 4Q4IA 2DY2A 1JF6A 4WTZG 5C9JA 5I1GL 3X3GH 5E6ID 1FAKT 3WKYA 2JJTA 2GVYA 4XB7A 1BIIB 4QIRA 2K3TA 1P6AB 2AEQL 4AENB 4BZYA 4OM1H 3NCWA 4PCSA 2CHNA 3KM2A 3P9WB 3X17A 3K1DA 4I3SL 3EDJA 4FG6C 2B9BA 2W9EL 1QA9B 3I9PA 1SVZA 4N9OB 3W0WD 2ZWLT 3AG1B 5JPMB 1CGTA 2P42B 2Y7QA 2VLRB 1XD0A 3TBWB 3VYPA 3WS3B 1SYVB 1SXZA 4JG1L 1QZNA 2ICEB 4UIMA 2CR3A 4OLYL 2L4OA 4FXTA 4DVBB 1BLNB 1XH1A 1HHJA 2WBWB 3F64A 4R8WL 2A9CA 2JKWA 1B0WA 3QAZC 4FL4B 3N1GC 4W9LC 1BX2A 2PWFA 4LEXL 4TSBL 1GYUA 3OZLA 4QO1A 4KK5D 4D7BA 1UWXH 2F54B 1RIVL 4Z3TA 1BGXH 1ZA3B 3D30A 1BJ1H 4NZDA 4XPHH 4OBRA 2ESVD 3S7GA 3VGBA 4ELDA 5A40E 3FONA 4BGDA 3STBA 2IWFA 4M61B 2ZCHH 5EUOB 1PBYA 3UTPE 1GGIL 1MFDH 2VC2H 5EULV 4HXAL 4WKZA 1T2QH 1MFMA 2J4WH 4QHPA 3B9EA 3BEWB 2VZUA 1JK8B 4TRPH 5MEQB 2DPKA 5IHUL 3TBSA 3T6ZA 2QBWA 2APTA 3QWNA 5I2IB 2YJLA 4IJ3C 4R97C 2DDQH 2Y4SA 1KJ2L 1Z0NA 5GZND 1KEMH 4UF7C 3EYOA 3LXAA 4Z7NF 1KXTB 4JAMB 3O6LH 2G75A 4AK2A 4PY7A 2F58H 2C8NA 4G6JL 3D05A 2UZYB 1YC8A 5AUMB 1TYJA 2IPTL 1PKQE 2WKGA 3OJVC 1D5IL 2A6IB 2FVNA 2AQTA 1YEKL 3AWEA 3T0AA 1LO0H 2Y2YA 4V1DB 3LIZH 3HS8A 4OFVA 3WV0A 3ABKB 3KJ4C 1HK6A 2FGWH 4S0HA 4U1JB 2A1WL 3GHPA 1H3GA 1NL0H 1SLWA 2HB0A 1OAUH 2VZVA 5E8OA 3SKJL 1FL3A 5H35B 1RZIB 4NBXB 5DUJA 2YARA 4GSRA 3P9LA 4N0RA 1JI1A 4U6XB 2J8UB 1VGKB 3DTXA 4NIKB 3ES6B 4OLUL 5F97E 5JIQA 1GY1A 4YHNA 1BD2E 1XWVA 4RBPH 3CAFA 1KT2B 3F7PC 4HJJL 4HPOH 5T3ZE 1RHFA 4MJ4A 3HR5B 4IRSB 4CSZA 3MCLL 4F93B 3VO0A 2G3MA 3QZWA 4NNPH 4ODXB 4G80B 4ZUWA 4N0YH 4MD0B 1XXDC 4Q6IB 4HQQH 1E50A 3R0NA 1ZGLP 2Q9OA 2AS5M 4PGJA 1NTDA 2QR0B 1RL1A 4YL4A 3L1OL 4JO2H 2YAEA 4IJ3B 1ORSA 1PF3A 1HCYA 1TEGA 1PQZB 4BFJA 4B3VA 1ZTXH 3WIHH 3UG4A 4RX4A 1FG2A 3WNNA 2RQ8A 5JW3L 2DQCL 4HCGA 1DJHA 2VZTA 3PFQA 2NYZA 2OPCA 3KW7A 2CKBL 5IP4A 1UXWB 4GT0A 43CAB 3BT0A 5E23A 3FCTB 1PCXA 4BSWB 3ZTNL 2PP7A 4HK0B 4LQFH 5EO0B 5HJBA 1ULVA 4GY4A 3GSVA 1QEWB 4NN5C 3U48A 1YEEH 2FHCA 2Z7YA 3S6CA 2B15A 2WQRA 4KV5E 4LIQH 1RIUH 4BFBD 3KJ4B 4OZHA 4AEIL 1N6QH 4FQXC 4HJEA 3OSVA 4K07A 4MJ5B 3BUBA 1UM5H 5DVKA 4J3OD 1SXSA 2LTQB 1E65A 4A04A 3IM1A 4WEBL 2UXTA 1M56B 4U3SA 4YK4B 4LE8A 2IALA 1JGDB 2F53E 3B7SA 3IDXL 4L4VB 5KBNC 2H4EA 3UJIL 3HE6B 1NCOA 2W60A 2RAMA 3W0WA 3KEDA 2WO4A 5KSUA 1N7MH 4YL9A 4ODTH 3GIVA 1I75A 1NFIA 2UWEB 3E7JA 2VLJB 3QWOB 4G6ML 1HI6B 1JPST 1J9TA 1FWXA 1BD2D 3VCLA 1R5VA 3RQ3A 1X3DA 5T3ZD 3ULAB 5B21A 3B83A 3GDBA 4IKJA 4LL4A 3MAWA 5D1ZD 1HYSD 1I1YB 5SWQB 1K8DA 1WZLA 3BPNC 5DJ2A 3RWHA 3SJVE 4EDXB 2FX7L 4HEME 4NBZB 4DKEH 4IRJC 2WTPA 5B1KA 2ODHA 2ESVA 3D25A 4RAVB 1ETA1 3ZHFA 1HZLA 1KIQB 3PWUA 2RCSL 1DLHA 3OAYK 5E4EB 1TJGH 1FIGL 4JY5H 4QHLB 4FFWC 1FDLL 1KIUB 2YO3A 4PJAF 3LKOA 5D7KD 5IIEA 4XE5B 1NFDA 1OW0C 3R06B 4NN5B 3P0YL 4NOBA 1E6JH 3FCBA 3DX7A 3L5WB 1ZS2A 3L9EA 4AGOA 3LRSA 5FO9A 1FF5A 1E67A 3G5ZB 2X2YA 4MAYC 1OAQL 4PJ5E 4PJ7A 3OHXC 5E6ZA 4MQ7B 3AQXA 2FRGP 4D0BA 3EYFA 3ARFD 4P5MB 2C3HA 1M2VB 3BVXA 2ZICA 4TKWA 3AU1B 1IFRA 1AQDB 1R3LA 4DGVH 1QKZL 1OARL 1W72B 3PV7A 1OP5K 2F53D 2ZYSA 3AW5A 4D9RE 3LKPA 5T1JA 4BH8A 1ADQA 5L2JA 2UY6A 4QHKI 1I7ZA 1Q1JL 5GRYA 3UABA 4DOHB 5C92A 2JE8A 1GS6X 3QXVA 3JWOH 4QRRE 3NK3A 4ZI8A 1FA4A 5IEKB 4JQIH 4ZD3L 2X0WA 4I48B 4RNRB 1JNHB 3RVUC 3FRPB 2E8YA 1MQKH 3U4EB 4BSVB 4ZTEA 5D7EA 4PM1A 4MAUL 5EN3A 4PR5A 1B3IA 3MRFB 3QC5X 1W9XA 3QG6B 3T3MB 4IRJB 1XGQB 1A6VH 2BSDA 2ZCKL 2CSPA 2VYRE 4GW5A 2VDKH 5IQ7L 4HUVA 5BS0B 4K9EH 4OD3H 2JB6B 7PCYA 1DVQA 1Y07A 1MRCL 3TOPA 3AWFA 2BRQA 3OPUA 3IDJB 3MACH 2ITCA 1NIAA 3FUJA 4GAYA 4KDVA 2UYLB 3ILQD 3IFOA 2GTZA 4PJGA 4C83B 3KHOA 3PE9A 4KI5D 5BVPH 3NSXA 1Z9NA 3IWVA 1N9PA 4ORZC 5IVZB 5L4IA 1PIGA 3KPNA 1UJ3A 2HT4C 4O2FB 4UM8B 5AAMA 1MUJA 3ULSB 3WAKA 4EN2A 4ZODA 2BMKB 4YNYA 4XBPA 5G55A 1H0DA 1GGUA 4F7TA 2EUZA 3GQFA 1AR1D 4MXVF 4GIAA 4ERSH 1KN4L 1MFAH 4PJ5D 4PWKA 4NENA 5DS2A 1UYWL 4ZX3A 3ZKMC 4M9OA 4TLTA 3FUHA 5MENB 3SQOL 1TR7A 3DURA 4ATTA 4AV5A 1KCUH 5HGBB 5F93C 1DN2A 1SUJA 4FJ6A 3KPRE 5DJCB 4MJ6B 3IMSA 4XNXH 1AD9B 5D72H 2P9RA 3UAEA 3BD5A 4JKKA 5CP3A 5JORA 1NCNA 1RVFL 2FB4L 4XMZA 2BIQA 4K7FB 4CVWA 4WFFE 5EU3A 2DIEA 2KQNA 3BOVA 5AKSA 5KANI 4G8FB 1NDGA 2YA1A 4FMFA 3BQUA 4M43H 5CINL 1ZLSL 4S1SL 3EXJA 2IMNA 1MCPH 4Y1TA 4OV6F 4M1GL 1E27B 4Y4KC 1OQOA 3ZE1B 3SE3C 3FO9A 1LO3L 4XZUB 3NDZE 5B1JA 1TJIH 2OK0H 1BVLA 1EAPA 5I1JL 3U0TA 4G8IA 1KDIA 4PGDB 4MXQD 1UCBL 2XG4B 4J39A 1SHXA 1G9NC 1XH3A 3ZT6A 4L4TD 2X6VA 1BOGA 3AB0B 1Z9OA 2IOMA 1T5WB 2QVMA 4FFZL 2YAHA 2AEOA 2B20A 1GYWA 3FF7A 3MBWA 3MGOA 4GFTB 4ILDA 4PS4H 3KPMA 2X2UA 5DMKA 4N6RA 4ZFOB 5LAXB 1YG9A 5DEGA 3JBG7 3HC3L 2IDCA 4N1CA 2CRZA 2EIBA 3CUPA 4P59L 5HHOD 1I7TA 2RBLA 2E56A 2IADB 3P0VL 1QFOA 5D7JB 3PGFL 3BP7B 1IC1A 3D85D 3MJ8A 4L8SB 3J7HA 1XGRA 4FP8H 1IT9L 5JUEH 2FEEI 4PJIF 4Y9BA 5B22A 4KXZI 1HL8A 4F7EB 5I17A 1NCCH 2HRGA 2O6CA 3H7BB 1D5ZB 3DOSB 3MRMA 3ISYA 2X1WL 4CVXA 3O11B 3ALPA 1PPIA 3NCCB 1KCSL 2RGSA 3ASNB 4MQSB 4BFEA 1GRWA 4PJXE 3IDMB 2GFBB 2VMEA 1H6TA 4FQQA 3KPRD 5IOKA 4HV8A 4XMLH 1KIRA 2XFXA 4POZD 5IK3B 4R96B 4AY0A 3NP3A 1XCTA 5EV7A 1DP0A 1ZLWH 4EBQH 2NY2C 1HDMA 1AKJD 2EIEA 3BVNA 1JGEA 3MLZL 3KWTA 1SBSL 4KHTH 2YUWA 4EI5C 1LEGA 2OS7A 5EU6A 1H6EA 3NSFA 5DR5L 3R4DA 5CGBA 3E9TA 4X6DB 2BHYA 1YPZA 2PXYD 4OZFH 4XNZB 3CBKB 3VDBA 5F0PB 5DFAA 3IKCB 4MJ2A 3OGOE 2HKHL 3CN2A 3DX4A 3IJSA 4XC3H 2FO4A 3L17A 4FNRA 2NQCA 4QRPB 2ZXQA 1R34A 4QWWD 4RGOL 2YMXL 5HJ3B 2O6DA 2ZWZA 4LP8A 5D7IB 4PV8A 1SM3L 5JHLA 1ZIBA 4NS0A 1NCAH 4LAQH 4FQCL 1OCWH 5L7XL 1NMBH 4HHAB 2VXSL 1SFHA 4P4KD 5DD0L 5DUMH 5FWQA 1H19A 3OKOA 5J6SA 5A6MA 3AT8A 3RJQB 2IANB 2WQVA 5AW0B 5AZ2H 1XMWA 3X13B 1KMGA 2VDLH 1D9KD 3MLTB 5DO2D 4U1MA 3NBNA 4OSUL 3TN0D 1TMCB 1AC0A 4YSCA 2YGVA 5I1DB 5IQ9B 5DTFA 4UANA 1PZDA 4FQIH 5EF0A 2OL3L 4O51A 5F44A 4RIRA 4WI7A 1FL5A 1IZJA 3MA7A 3APFA 3RVVC 4G43B 2X6CA 5DI8A 2L7UA 3K2UH 1BMWA 5CSZA 3NIDB 4A39A 1PZ3A 1USZA 5B38B 3LPPA 4M6AA 2WWOA 3OD3A 5EUOF 4P2YA 1FO0A 5JOEA 1AZCA 2OW6A 4P49A 2Y0SA 4XRCA 2TRYA 3NEXA 1LP9A 5T3ZH 4AKOA 1W8NA 2RB8A 5GRJL 2F19H 3CSYA 4RWHA 1D7FA 4K2UL 1R17A 5I5JA 5LNGA 3VMNA 2QEJA 4ZPVA 4KNUA 3LZPA 5F7NC 43C9B 1R3JA 1W8EA 2EYSA 4Y2LA 1C7SA 4EI5B 3OR6B 4PJCE 1FJ1A 2AJYL 4FYQA 5L0QC 4RLDA 5J4MA 4HMEA 4JRFA 1O7SA 4F57H 3FNKA 2AQ2A 4X7FC 2VJ0A 2OMUA 4J1UB 2D7NA 1RHHA 4L8DA 3L3OA 4X6CB 5EIIA 1JWMB 4L0ZA 3LD8C 4IM8A 1Q9LA 1ZT4B 4IMLA 3L8QA 3QEHA 3RVTC 3AABA 2NY6D 3SQBA 4X4XA 4P9MH 1CVRA 1EHNA 1V55B 2NW3B 4MMZB 2J7LA 3D0LB 3QE5A 3ETSA 4OD2B 4FEIA 4NWUL 1I9JH 3JVGC 2AQ1A 2E6PA 3Q8FA 1BF2A 2HX8A 4EZJA 4TLUA 1C08A 4OCWH 1FE8L 1NCIA 1V27A 4BA8A 3I2CH 3C60C 5F7LB 1MHEB 2X1QA 4PWEA 3OGCB 4L4TA 1S7QB 3N40F 4Y2DC 2VN3A 2IAMB 4FLSA 1QPKA 5HGAB 4BZ2A 1GMIA 2CUHA 1I9IH 2DWDB 3HZMA 3R0MA 3WTUA 1RUAH 4N2KA 4B3EA 1HH9B 4M29A 4HJ1A 2WBJC 4KTGA 2YRBA 1UXMA 2R2BA 3BZ4B 4EXPX 2EUVA 3TGXA 5HHOA 2HX9A 5D5MA 4BXVA 1JHLH 5F6HI 2X05A 3KPOB 1CDGA 3V0HA 1F18A 2C7FA 4MFHA 4QRUB 4GINA 1FLRH 5IJVA 5IB4B 3S3SA 2IBBA 3EGSA 5E6SB 2CRIA 5L0QB 1U8JA 4GW4A 1IQDA 2R9HD 4NQDE 3OKKB 1QBML 4TULH 4XPBL 3CFBA 4LBAA 2OMVB 4ETQA 1EGJA 2QQLL 4L2LA 4ZYKA 5DF0A 2EDXA 3CWGA 3NOIA 4H8PA 3LD8B 3QEQA 2XY1A 1KB5H 1X7QA 3J07A 4PJFE 2CBMA 3ARDA 2MQGA 5FF6B 4AEFA 5FYJD 4M7ZB 4K0OA 3CSBA 5LN4A 5IY5B 5I0ZA 5K1NA 2PYEA 5DK2A 3MJGX 4JRXD 1MY5A 1T6VN 4ZO9A 3ATFA 4ZJ9A 4NFDA 3QEUB 4B9JA 3EH4B 4K5PA 4NAQA 3FQ4A 3C60B 3W37A 5KSBB 5GJTL 1L6XA 2B2XL 2R15A 3K6SB 4I0PB 1H8SA 2B1AL 4ZFOL 3KLAA 5D7HA 2EO1A 4OCSL 2Z9TA 3LEXA 4LRIC 2FUTA 3UDWA 4HISA 3WFEH 1B4JL 5C0CA 1BMZA 4ZW3A 5IKCA 4P9HH 4HS3B 1A1NA 2CO7B 3QG7L 1Z7JA 3PDDA 3MXVL 4YSTA 5IF0A 3BRDA 3VWKA 4APQD 1LE9A 1UG9A 1IC4L 2O5XL 3SDDC 2DZEA 1T04B 2JKTM 4LSUH 4QT5A 5AW7B 4UT6H 5B1BB 1B0GB 2NMSA 1DBJH 3CLFH 3FRPG 4M02A 5FECA 8FABA 4LLVA 3IJ8A 3LN9A 1U8HB 2R39A 5F7AA 5MEPA 1LQBC 2Q87A 1IGTB 3OAWA 1KIPA 4PWHA 4KX7A 5T3XE 3BRGC 3O8XC 1SHWA 5FDYA 4M56A 4MYWB 1GGCH 4NZRL 2X4OA 2BK8A 5IJKC 1GS7A 4MA1B 1SLUA 2J21A 4UB0L 2P5EA 4NQDD 4PRPB 2Q8AH 4JFDE 3QSKB 5I0DA 3KW8A 1G9EA 1PJ9A 4PJ9D 2WAHA 2E6JA 2VC2B 5K69A 1AHMA 2VNCA 4KK8D 1AGBB 4HIJB 4OTXH 1OTUC 3I6SA 4LBEB 2Z91B 5DZJA 1KGYE 3U7WH 5T5FH 4XO9A 4NUGL 3NH7L 5MEOA 5EUKA 5L2KE 2XDHA 1ZV9A 4TV3A 1DSFL 5F9JB 1L7TH 3ERXA 1EEUA 3KR3L 3UYRH 5HGDB 3VM5A 3TA3C 1DVFB 4G9DA 1M7IB 5M7QA 2J43A 4P3WA 1IM9A 3H9YA 3EFOA 2ZYHA 5C0NC 4UYPA 3SE4C 4AYID 4I85A 3Q6FB 4MBRA 3KPLA 4OLWH 3PWNB 5A3IC 4G6FB 4NRYB 2QGEA 2ZSVB 5D2LF 2J1YA 1E4XH 3GKWL 4IGBA 4YE0A 3EYSL 1WBYB 2MCG1 4GRMA 1ZMYA 4EZLA 1BZ7A 4H0HB 4HUWB 4ZW7A 1JNJA 2QPUA 4F3FB 2CR0A 1NGXB 5DVPA 4XP1H 3VTAA 2MCAA 4XN8A 4WU7A 2NTFA 1PLCA 4NLHA 4X7CC 3T8VA 1NIBA 4YX2L 4A55A 1DJYA 2FD6H 5BO0D 1OPOA 2VZSA 4U1NB 1CE6A 1MRDL 4LOEA 5T3XD 1AGCB 1MIEL 1E4XI 2G5BA 2EVJA 1F8TL 1U8LB 4UQDA 4NEHB 2E9IA 4J5VA 4KKCC 5GGRA 1MLCA 1PLGL 2PCFB 2QZ5A 3ROOB 1F4WL 4JFDD 3V4LA 2BIMA 2A3TA 4GG8A 2EXWC 2IH9A 1MJUH 4XCNB 4Z7UB 2J73A 4JRYE 3IPBA 1ZGLA 3C9NB 2J6EH 4HPYH 2WTOA 3IE4A 4UOQA 5AW9B 3QQDA 4Q56A 4BQCA 4A7GA 3DX8B 3BKML 3N9GH 4OB5L 3UG3A 1I1AC 2ICES 4NSKB 4PCKA 3GHEL 1IBGL 3LH8A 5L2KD 4DAGH 1IGFL 2FQFA 1JUFA 5JHDB 5IQNA 3TPUB 2X42A 4N4YB 2K70A 2OA9A 3M1BA 1Q0YL 4ZXBC 3ZZSA 3HN8A 1JF1A 3OLIA 2DL2A 3LNHA 3MKGA 1D7BA 4XH2B 4JRXA 5B39A 1GVIA 2AXFB 5T1DL 1CTNA 2GITA 1Q9WB 2DEWX 3KS0H 4TUUA 1SVBA 4ESKA 3VD0A 4QNPF 4X83A 4YHML 4UM9B 2OJEA 1U8QA 3BH8A 3B9KC 4HFWA 4P4RB 3FK3A 4PLJC 4QXUH 1ZDSA 3KLHD 5KTEL 3L16A 1DFBH 5E5UB 3ZE1F 5A1AA 2X4SB 2DWEA 2H2SD 3ATEA 3FT3A 4TM9A 4TUOB 3LKNB 3SIKA 5J11C 4GO6B 3ZTCC 3MNMA 4HAGA 3CZJA 3UC2A 1HC1A 4RDQG 3X11B 3AAZA 2XZAL 5E94A 3TNMA 1EHLH 3ULVD 3N06B 5D4JA 5KVGH 1SY6H 4NWTH 4O9HL 4NHCH 3FN9A 1U8IA 12E8H 1P9MA 2BS9A 3O3DB 2YSSA 3U7YH 2OTWB 1LNUA 4NQSB 1S7TA 3DROA 1N5AA 5MHSE 2PW2A 4GH7B 2WWMC 3T5WA 3RVXD 4GFXA 4G8GA 3CFCH 2GT9A 4YHPA 1MREH 2JLPA 5CD5D 4FLHA 1RZKC 5E6IC 5I16A 1VJSA 2F2HA 1F4XH 4K9EC 3UYPB 4DW2L 1U3YA 1G9HA 1XHHA 3Q1SH 3WEMA 1R1CA 1HHIA 1MEXL 2DLIA 3ETTA 2A99A 1A7OH 4AVIA 3OKMA 2H0EA 4CNIA 3EGDB 1J1OL 4FDWA 4L4JA 4LOVA 4ZXBB 4XX1G 1ZK5A 5DRZA 1S7UB 5FK9B 1H3PH 1HQRA 4LT7A 3K2KA 4HDIB 2XNAA 2XVBA 3CQPA 3GSQB 5GXBB 3RILA 5KS9E 1RLWA 4PJDA 3GSOA 3CFDB 3LPGA 3VGGA 2QVTA 2H32H 2F5AL 2HUEA 2NTSP 1SXNA 3PGCB 2FR4A 3GRWL 4LFHD 3B9KB 5DSCB 4LSTH 5LNEA 1AANA 1A14H 5J13B 3WJJA 4YXHL 1NGYA 4KKAC 1C12A 1N8OE 2BY0A 2CO6A 4X6DF 5AOZA 5IREA 2ATAA 3CDCA 4MDIB 1DLFL 5JPNB 1P1ZB 1KBVA 4KK5C 2EDHA 5J11B 2AJ3A 3F7YB 2CDGB 1QI3A 5B3NA 1W0YT 5C0AA 4JFQB 4QEGA 3RWFA 4PLKC 2A83A 2YK1L 4LNRA 1JNNH 4EXKA 4MA8L 1S9XB 2Y5TA 4LEOA 4QI3A 3FH5A 1AZZC 4OR1A 1OGSA 1G9MC 5E99L 3MLWL 1E9OB 3SGDI 5FYJH 3PS6A 3L5HA 1HVXA 2PPCA 4S10A 3EOTL 3EH1A 2X3BA 1UXLA 2CO3A 4KUCD 4PS7A 5BNXD 4A6YA 2PUQT 1TCRA 3OB0K 4IEFA 4M7JH 4ETYA 2DQ6A 5GZNC 2FL5B 1RLBA 5MHSD 5IESH 3N1FC 2WNXA 3MA9H 3LYRA 4NB7A 3GPSA 2J88L 1X4YA 4JO4L 3VFRA 3B2VH 2AK4E 2J4WL 4QTFA 2ATPB 2YEZB 5IMKA 1X5XA 2VIRA 4OI9A 4X7TB 2HCZX 1BQHA 2XXGA 3WYRA 1ECZA 3FU7B 4JFEA 1HH6A 1BEYL 2FATH 2JWYA 1KEML 3HCVA 3FO2B 3NCJL 1JWUA 3QS2A 2W91A 1IFHH 3Q48A 1C5CH 1W0VB 4AYSA 5AAPA 2HXAA 4GSDL 4QTHB 4QD2E 3F7QA 1WISA 1XH2A 5IFJA 1DBAL 2BIOA 4AGLA 5JXAH 1DDHA 2MQ0A 1L3NA 4YHOH 2W38A 3U9UB 3NVQA 4EN3A 4IRZL 3SPGA 3RDTD 1U8CB 1U42A 1GGTA 1IM3A 4WDIA 2FHBA 4IIQA 1OT4A 3GMRA 1I85A 5K9JL 4P46D 2DQGH 1UD6A 3BZEB 1CPUA 1D5RA 1OAUL 1QNZH 1ZXKA 5IGXH 1OEZW 4LESA 3MBXH 4PRID 2FIKB 4OGXH 5DVMA 1QATA 3QIBA 3P4NA 3MKKA 1MG2C 1G43A 1ONQB 1S7XA 3AM8A 4MXWH 3RUGB 3MV8B 4HPOL 1FVEA 3SPHA 3FB7A 4ZSOE 1ES0A 5HD8D 3UTSE 3BIAX 4IS6A 2EDBA 5JQIB 4M7KL 2QSCL 1E9PB 1AI1H 1W6WA 3ARVA 3RZCB 4HJ0D 4DO5A 5I9QC 4N0YL 3D5OF 3I75B 4XMKH 1CL7H 2JKRM 3H55A 4NO2B 5CWSB 4R6UA 5FEBA 2FJHA 4HC1H 2AJUL 1FFNB 1PS3A 4JO2L 2CPUA 3CHSA 1N0XH 4KY1L 1HOCB 2XI9A 1S8DB 5E9DA 1ZTXL 1T7YA 3B1TA 3G5YB 1G6RH 1OCRB 5I5RA 3DVGA 5FOBB 3KDMA 4JPVH 5EZIH 4XI5D 5ICXB 1AGDB 4G42B 4QY8A 2A9ML 5I76B 4JM2A 4LCWD 1CYXA 1A3RL 1Z9MA 4G1MA 4AV0A 4UYQA 2CCLA 4RMBA 4YLQT 3W38A 1CL7I 5IW6A 3RWDA 3VXTA 2X89D 4OZIA 4XNUH 2ZX7A 4J3OC 3TM6A 3RNQB 1OP3H 2XA8H 2CO2A 5A2AA 4LLQB 5KSVB 3IDIA 1B0IA 1T0OA 1HEHC 1ILSA 1OAXH 1AACA 1JDAA 1NINA 2XQBL 5CIPB 3QIUD 1U58A 2N0MA 3HMXA 5T3XH 1YMME 2N7SA 5B1JC 1JYWA 2R0WL 1FBIL 4HS6A 1MJ8L 4JG0H 4YSUA 5ADOH 3GUTA 4NHUA 1RUQL 5GRUH 1EEYB 1LILA 1YJDH 1IL1B 1RU9H 2ADFH 4PJEE 1ADWA 2G5UA 5D1ZC 1RAMA 2FX8L 2BP8B 1HYSC 4NQVB 2DB8A 2PTUA 3GMOA 1G5AA 2C7UB 2R69A 5DZPA 4MNQA 5I6XC 4R83A 5F8QC 5CKAA 1XF1A 4TVPE 3B5TA 3L7FB 5IR1B 3VI4A 4KH2A 2DJ4A 1QLEL 1EDQA 2VE6B 4WTQA 1NCWL 3H3BC 1MAMH 2R0KH 4OZFB 1JRHI 5KSBF 1T7WA 1K5NB 4FQ2L 5DZLA 5EU4B 3UTSD 1XIWA 1C8QA 1DQMH 3VH8B 5I9QB 1NZRA 2EVFA 4N2LA 2NT0A 4YVNA 5K1VA 3TV3L 1XVSA 1ZT1B 1TVBB 1BVOA 1WCBA 3QQXA 3GTVA 4KQ3L 1MHCA 3VVVA 1I1FB 1UM6H 1QR1A 1KTDB 3IJHA 4MWFA 4CJ1A 1PKQB 3MRIA 4P5KB 3H9HB 3K4DA 4H5SA 1O9ZA 2Y2WA 4LCCA 3K71B 3O3EB 5DRXB 3CCHB 5ICYB 3MO1A 3POCA 3ZMRA 5FCSH 5H94A 3L1GA 4UMGA 2WQSA 1E4KA 3LNFA 1N5YL 1C5DA 2NY4B 3ARFC 2DLFL 3BDBA 4H26B 1ZS8A 1U3NA 4APXB 5KUKA 2VDLB 4XCFH 3C5XA 2WNWA 4QRSB 1E6JL 5D7SH 3OLEA 5KOVC 3REVA 1SN0A 4JFFE 2W95A 3X1GA 4WNQA 1R6VA 4Z3HA 5AG8A 2Z92A 1FYTD 2HFGH 3VNYA 4BFNA 1ACCA 1GPOH 1MCOL 3DYOA 4DK3A 3RKDD 4I5BB 4JFYA 4K3EL 5ACLA 2DBJA 3RX8A 3BQVA 2W0FB 5EZJA 4R5VA 3ULVH 3FFDA 2L3BA 4GRWE 1YMMD 2EXTA 5I19L 2K3HA 1YNLL 1BD2B 1B88A 4DEUA 3DRQA 4GG6F 5A16B 2IDUA 2DLTA 5D1ZB 4JFHD 4H8VA 5E6UB 5JDJA 3EJCA 4ORGB 4B7IA 3LKRB 5B3SB 5HHXH 5I6XB 3P4LA 5IUSA 2R23B 5KUMA 4P23D 2A0LD 1ETZA 4X0KA 4AQ1C 4N26A 4Z3EA 1GOGA 3D50A 4TVPD 2YKKA 3Q3GB 3DX3A 4G7VL 5E8NB 1SEBB 4YZFF 3VG9C 4P46A 4FYSA 1G7MA 5TF1H 1U4FA 4N2OA 3OJ2C 4LCYA 1ORQB 4EDWH 1EJ8A 1XB3A 2IO5A 1CZ8H 3FMGH 3LHAA 4OFYD 4PSRA 1VACB 2BIPA 3X14B 3ILQC 1EIBA 4JZNA 1JPTH 4HKBA 4KI5C 3ZMNA 1ODAA 4XXDA 3NRPA 4KROC 3JQOB 3IKKA 1A4JA 4LKCA 4TNVF 5C0FB 3W9EB 3BE1L 4RETB 1T22B 1AC6A 3K81A 3VXUE 3NACL 1MY7A 4M62H 3K7UA 3WEBA 4F8LA 5D6CB 4AIXA 4GQRA 1AR1C 1K72A 3F2LA 4YDLB 5L88L 2JI1A 1TXKA 4JO1H 4TSCH 3GXIA 1WAPA 3F12A 3L1EA 3KG5A 4CW1A 3I3EA 4MNHA 4AYMC 1BFOA 4XVTL 3HUJE 4ANWA 5CN2A 4P9HC 4AVJA 2JH2A 2JKNA 1RZ7L 1AXTH 4KKNA 4LCWA 2IG2H 5K9OB 2A9NH 2GCYA 3RWEB 3MRNB 1UWXK 3JV0A 4S1QH 1IUZA 3OKEB 1BZ9B 4ICXA 3HAEA 2YPLA 4JQXC 4Q52A 3TA4D 4KO7A 2YOAA 2HH0H 2LFGA 3IWUA 5I8EB 1DQDH 4K9JA 4EVNA 4F2FA 4DP9X 7PAZA 4J4PD 4QHUA 2A73A 2WJ5A 2Y7NA 4AQ1B 2KH2B 2YD9A 4FI6A 3AUWB 3INUH 3QCTL 3IXTA 4O58L 3SJVB 1U21A 5FB8A 1R5WB 4XCEA 2RR3A 3MLXH 4MBOA 4XMWA 1WBXB 4HS8H 4JDZB 4N2HA 3VG9B 2NY3D 1XF3B 4MXQC 4KU1A 3BAYA 4P0DA 1HZHH 3P2DA 2R29H 3QO1B 1KB5B 3GGWB 1IC5L 3QYNA 2VLLB 2F74A 4PVLA 1INEH 1RZFL 1URZA 2B9AA 3HZ3A 3KHQA 3ME0B 1YEHH 4PFEA 5HVHB 1XSOA 2DD8L 2XA3A 2B8OT 2X4TB 4Z77B 3WAJA 1GZHA 4NO3A 3ZGIA 5GS0D 1HSAB 2J57A 3GSNA 1P53A 1RZQA 4FXGB 1QBBA 1OM3H 3DNKA 4CBZA 5C6WH 2QLYA 2X53A 5DQJA 4B41A 1P84K 5EEYA 4Y16B 4MD5B 2ARJA 3MVSA 5H4ZA 1AR1B 1CI5A 4WJ5B 1JV5B 4PJ5B 3MLUL 1J8HE 4MJID 3VXUD 5LGJA 1JFQH 2CG9X 2C5DC 4PJHA 4TNVK 5CF3A 3VW3H 3RPIB 1SLXA 5K93A 3OG6B 3R8BB 4N2BA 4ABVA 1GZPA 1OCZB 2XX1A 3FBKA 3TBVB 3SYAA 1PVHA 2IGFL 4D0CB 5LXGH 5E2TL 2XACC 3D39E 3B9AA 5L9DL 5EOCH 1KY6A 3AMKA 4NT6B 3THML 1F42A 4NJ9H 1RK0A 3LKSB 4TSAL 5IG7A 3SE8H 5CEYA 4LP5A 1JBJA 2EDTA 3B7UX 3BP6A 1T1YA 1FZOB 1TZIA 3NQIA 4OIFA 4GMTL 4POZC 2H3KA 4QRRB 4BRJA 3NRFA 4I8DA 4N0UE 3VD4A 3LH2H 1U91B 3QJFB 4PREA 2VKXA 3P11H 4JVPA 4Y19D 3R4RA 5D55A 4Z3IA 3H53A 1FL6A 1FYTA 3VNZA 1GZQB 1WD9A 2PPDA 4ANUA 2H6PA 2PXYC 3A6CL 4NKOB 4ZUUB 4NM4L 4NJAL 4RQQB 5CJOH 4FF9A 2MIZA 2XTJE 5AG9A 3GMMB 1MJJB 1CK0L 1MW1A 1KCRL 3TONA 1DJXA 3KYKH 5H2BA 3E6FA 1F2QA 4QWWC 5BV7C 1OT2A 1V3MA 4B9IA 2ADGA 3UDWC 5DD5H 1HXKA 1JZFA 1SOKA 4O2EB 5C2BH 5I28A 3MV9A 1IAII 2Q7AA 2X9XA 3TYGL 1KCBA 3CC5A 4P4KC 3VWKC 5KYNA 4PB9L 2QV4A 4F9PA 2H8PB 1U3ZA 4GP5B 5HDQL 4TN9A 1NC2D 2DBLH 2XN9D 1CR9H 4PRNB 5DS8A 2OZ4L 2BVQA 5IM7A 3EJJX 4A7QA 5I1HL 1D9KC 1I4FB 1HCZA 5DO2C 4QYOB 3TN0C 4OCLC 4X98A 4HIHA 2CLZA 5KANG 2FNWA 2VLKD 2XX0A 1AH1A 3GJFK 5EIVA 1J8HD 4IYKA 1JXJA 3S37X 1IQWH 4HWBA 3HS0A 3GSRA 4K8RL 4ZMAT 1SQ2N 2IGLA 1A0QH 1UEMA 2ZAIA 3NPSC 5LB1A 2VDLL 4U7KA 2EC8A 3SOBL 3GI8H 3STZB 2ZAGA 3D39D 2FIRT 3BWAA 3KPRB 1A64A 1E28A 3S0PA 3EDKA 3IGFA 3NIGF 4FQIL 4M4PA 3CVHH 5ENWB 3WCYA 4YLBA 4HCFA 4J8QA 4L8CB 2YUZA 2UXVA 1H5BA 1AKJB 1PZ2A 1I3VA 1AFVH 1QTYT 4JFZH 3K2UL 3F01A 2WVVA 4XMUA 4OKVA 2PXYB 5HHNB 3SY0B 4UV7H 3SYQA 3V4VB 3QIWD 2ZF8A 2H3NB 2F19L 2ZUQB 4FXLA 1ETJA 3VQMA 2JLLA 5E1AB 1K4DB 5EH1A 2ZKXA 4CMMB 3V4UL 2OSXA 4UTAL 1KGWA 3FQTA 3IDYB 2NY6C 1M9WA 1TZGH 1JTTA 1KB9K 1M05A 1NFAA 5JHAA 25C8H 4Z5RA 1W0WA 1YQVL 3CN0A 1GJWA 4XCYA 1AMXA 4OLXH 2Z8SA 3HZKA 2OR7A 32C2B 2ENPA 4NYLA 1S7WB 2AXJA 1SF5A 3E9UA 4P4KB 2XFGB 1OGAE 5I82A 3V4PB 1PFOA 3VWJA 1MI5A 4E2OA 5IFHL 2GUOB 3VUAA 3WGUB 2WLMA 3TN0B 1CT8B 5GS1B 4OCXH 4Q74A 2CU9A 1W80A 1NAMH 1PZUB 3BSZL 1AS8A 2CUMA 3QZMA 3VGFA 3S35H 1AO7E 1WFUA 3E6HA 1FHNA 4XP9L 3QFDA 2OCCB 2E46A 2IIJA 4HIIA 4M5YL 1JZDC 4FZ8H 1IGJA 5K59E 1WS8A 1HXMA 4F8PA 3LPFA 1NEZG 3H9SE 1TSHA 3QI9A 5DFVD 5DJDB 4PJXB 1NFDF 4WWKD 4KGJA 4M6NH 4MJIA 1X5KA 4X6EA 5AKVA 2CGYA 3RUGF 1ZHKA 1