1ZDSA

Crystal structure of met150gly afnir with acetamide bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGGNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A rearranging ligand enables allosteric control of catalytic activity in copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 87
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA02
2QT6A 3PLYA 4E9QA 3NJGA 2WO3B 3ABKB 1M9WA 1NIFA 1GYCA 2H5UA 1WA0X 3WIAA 1ASQA 3N55A 1A4AA 4YSEA 3EH4B 5EHFA 3IE9A 2UXVA 2A3TA 1E5YA 2TSAA 1AR1B 4ZK8A 1WA1X 2DWTA 2X87A 3CDZB 4BK5C 1PMYA 1E65A 2JFCA 2BWDA 4DP1X 3X2QB 1CYXA 2GSMB 1L9SA 1OOWA 1JZEA 4GXFA 5I6KA 3UAAA 5I6LA 1GS8A 4E9RA 2IWKA 2BP8B 3NT0A 4E9WA 4E9TA 4KNSA 3D12B 1PLBA 3ABMB 3NJFA 5B3SB 1PLCA 1J9SA 2FQEA 2FT8A 2IH9A 2VW6A 4A2FA 4F2FA 3EHBB 4YSQA 5E9NA 5B1KA 1BQRA 4HAKA 3KW7A 3FYIB 2HX9A 2IWFA 2VSMB 4GY4A 3QJSB 3T71A 5I6NA 2X88A 1NZRA 2QPEB 1PF3A 4KOBA 4A67A 3DKHA 4MFHA 5I6MA 5I6PA 1KBVA 2PCFA 2EIJB 3PXLA 1NINA 4E9XA 2J56A 4KNUA 1KV7A 1J5DA 2HRHA 2VSKB 5PAZA 4HIPA 2XV0A 2BW4A 1IBYA 4UAHA 2XX1A 2YAPA 4WKXA 1BYOA 2FNWA 3T9WA 3ZBMA 5I5MA 7PCYA 1JZGA 3WI9A 3U25A 3UAEA 1PCSA 5D4JA 2XXFA 4AX3A 1KCWA 4HALA 4AKQA 3AG1B 3ASOB 4YVUA 2PPAA 3ZX1A 1BXAA 2XU9A 3PPSA 1BQKA 2W88A 3UACA 3WNIA 8PAZA 2FJSA 2VM4A 1KDIA 2ZOOA 1WAEA 3FQ2A 1SHWA 3FU7A 4QKTA 4DP6X 2BP0A 2IDTA 3NYKA 3CDZA 3OMIB 3S3DB 4N8UA 2AZUA 3AW5A 3MX0B 4BDVA 1BYPA 2MRYA 1AZRA 3NSFA 4F2EA 3OM3B 1MZZA 4TXVB 3QJUB 3CG8A 3UADA 1FWXA 5B7MA 1SDDB 3X1BA 3G5WA 2QPDB 1V10A 3QJRB 5IY5B 4JHUA 2TSBA 1MDAA 3NSDA 3UGEA 2PCYA 3X1EA 2I85A 4DP4X 2VMJA 1TEFA 1EZLA 1XMEB 1QNIA 2Y69B 4HHWA 2QDVA 2YAHA 2EINB 1JOIA 1NDTA 4FA7B 2CAKA 2PPDA 2H47C 2VW7A 1OCOB 2R7EA 1NIEA 2QDWA 3QJVB 5B1JA 1PLAA 4DP0X 3SQRA 3AZUA 1ZDQA 2VM3A 4N4YB 5D4HA 5I5JA 5I28A 3HEIB 1NPJA 1AS6A 2GC4C 4DP8X 3NP3A 3FT0A 1B3IA 2YQBA 5TK4A 5B7FA 3NJJA 1BEXA 2EIMB 4F7KA 1OE1A 2XUWA 4P5SA 3QJQB 3TU6A 1R1CA 2DYSB 3OMAB 2B08A 4UF7C 1NIAA 2PP8A 2UX6A 1QHQA 2IDQA 3PAUA 3X1NA 1L9TA 2JKWA 4YSOA 2XLLA 1ZIAA 4KO5A 3FU8A 2YAFA 5B1AB 3ERXA 1A65A 2HLEB 3T6VA 2P80A 1ET5A 3FS9A 3AG4B 1GR7A 3JTBA 4YSDA 1AOZA 4HCGA 2LLNA 1A8ZA 4YSUA 3T6ZA 2Q5BA 3EH5B 3CVCA 3NSCA 1PNCA 3FSZA 3T6XA 2UXTA 2XVBA 2WO2B 3EF4A 1CURA 3QQXA 1N68A 3PAVA 1WS8A 3AY2A 3AG3B 3DIVA 4YSTA 2DV6A 1J5CA 2XYBA 1CYWA 2ZWNA 1GSKA 2YARA 3IBOA 3N2JA 2RACA 1FA4A 1JZJA 1AG0A 3FQ1A 2Q9OA 1OF0A 4RH4A 3T6WA 1J9TA 3CVDA 1AZNA 1CUOA 2J57A 4KNTA 2PP9A 3ZDWA 4BWTA 4CSPA 4HZ1A 3BVDB 3QJTB 1GY1A 7PAZA 3V9CA 2ZXWB 4NB7A 1J9QA 2YAOA 1BXUA 3NSYA 1GS7A 1ZDSA 1JERA 3H4FA 2I7OA 4KOCA 3IEAA 4KO9A 1TKWA 5FC9A 1ASPA 1RKRA 4YVNA 1OE2A 1M57B 1BXVA 5B1BB 2H3XC 2VN3A 2FQGA 3S3BB 4W1TA 2OJ1A 1W8EA 2EILB 4NAJA 4A2EA 1SHXA 4YSSA 2IDFA 2IDUA 3S8FB 4PAZA 2UX7A 1W6WA 1JVLA 1L9QA 3KW8A 2BO0A 1URIA 2BP8A 3IN2A 1DZ0A 2P80D 3WG7B 1J9RA 2ZONA 3GYRA 2YAQA 1GW0A 3TBBA 1JXDA 3OD3A 4A2HA 2HZHA 1SDDA 3FSWA 2CBPA 1L9PA 1SF5A 1KGYE 4X4KA 4AZUA 1YLBB 3CZUB 1NIBA 1PZAA 2OV0A 1X9UA 3PAZA 5A7EA 2N0MA 1OE3A 1SJMA 4A2GA 4JHVA 1JVOA 1JZIA 9PCYA 3L45A 6PCYA 2AVFA 2GC7C 5B7EA 6PAZA 1ETJA 2GI0A 3WKQA 1DYZA 2R7EB 1L9RA 1NIDA 3PCYA 4E9YA 2CALA 5LDUA 2IDSA 2Y1AA 5I5IA 4Q8BA 1ET7A 2XV2A 2JXMA 4BXVA 4A66A 4JKNA 5D4IA 2FT6A 2VW4A 1AAJA 2OCCB 1PAZA 1SFHA 4GYBA 2B3IA 1NPNA 5PCYA 1KYAA 1I53A 5B1JC 4EF3A 4M4RB 2HRGA 1GS6X 1W6LA 2PLTA 2YAEA 4BXSV 1M56B 1ID2A 2GB2A 3FU9A 4E9VA 1NWOA 5ANHA 1PY0A 3JT2A 1ASOA 4HCFA 3WNJA 1AACA 1E5ZA 4DP9X 1GY2A 4L0PB 1IUZA 1ZIBA 2YXVA 1RCYA 4GP4B 1HFUA 1OCRB 3CVBA 2YXWA 5F7AA 4W9ZA 1AZBA 1VLXA 4DP7X 4HCIA 3OQRA 3SBRA 1E30A 3EH3B 1L9OA 3BQVA 3ABLB 3FPYA 1NWPA 2PPCA 3OMNB 3IN0A 4DPAX 1PZCA 3AG2B 3NJHA 4KO6A 1ILSA 4G7RB 1IKOP 1N70A 2AZAA 3DTUB 5I6OA 1UATA 1EHKB 4PCYA 1KCBA 1WS7A 4YSCA 2I7SA 1QLEB 2FQDA 2XXGA 1NICA 2J55A 3UABA 3GXUB 2J5WA 2NRDA 2CUAA 4NERA 4G70B 3WKPA 1PZBA 3NJMA 2CJ3A 1OCZB 3X1FA 3TA4D 1ADWA 2HX7A 4K9JA 4BWWA 1JZFA 4AKOA 1SFDA 3FSVA 1KBWA 5AKRA 1RZPA 1MG3C 3V9EA 4KO7A 2PPFA 4DP2X 1JXFA 4G7SB 2DWSA 1BAWA 2FQFA 1A4BA 3NJIA 1AZUA 4A68A 3TASA 1AG6A 3ABGA 4UANA 2AANA 3C75A 2UXFA 2XV3A 2HXAA 1XB6A 3NJLA 1WA2X 1JXGA 2UXGA 1NTDA 1FFTB 1ZV2A 4DPCX 2BZCA 1AS7A 3H56A 3S3CB 4A2DA 3H4HA 4DP5X 1AIZA 1CC3A 2E86A 2FWLB 2PP7A 1AZCA 4Q89A 1TEGA 2GIMA 4WTQA 2EIKB 1AS8A 1BQ5A 3SBQA 1PNDA 3NJKA 1AQ8A 1XB8A 1ET8A 1MZYA 3ASNB 2IH8A 2DY2A 3FQYA 4ENZA 1A4CA 1OV8A 3TBCA 1JZHA 5AZUA 1ZPUA 4DPBX 2CCWA 3NP4A 3NJNA 2BHFA 4BDVB 4GP5B 1TU2A 4HHGA 1IBZA 3FU7B 2FT7A 2BP0B 4GP8B 1ILUA 5I26A 3FSAA 4G71B 3RYMA 1HAUA 4G7QB 1F56A 2HX8A 5AFAA 1OCCB 2YAMA 5F7BA 2W8CA 1AANA 2GBAA 2MTAA 4YL4A 3X1GA 4QLWA 4YSAA 2IAAC 4AKPA 1IC0A 1X9RA 4YSRA 3S8GB 2BW5A 4BWUA 1E67A 1A3ZA 3MBWB 1HAWA 1MG2C 1SNRA 3ZIYA 1RZQA 1XB3A 3FYEB 4M3HA 4FAAB 4P5RA 3GDCA 1V54B 1SF3A 4CSZA 4E9SA 2AFNA 3QPKA 2WSDA 2BWIA 2FTAA 5TK2A 1V55B 1KDJA 2PPEA 2IWEA 2XX0A 1T5KA 2XWZA 4AI7A 4YSPA 2BZ7A 2DYRB 3HB3B 3SBPA 2GHZA 4G72B 3FPXA
chains in the Genus database with same CATH superfamily
4TUKL 1XF4A 4HJGA 5T1MB 3H3PH 4C56D 3HZMA 4XVTH 1ZA3B 4Q6IA 5KW9H 3NCBB 1NMBL 4YIQA 4QIRA 1LO2L 2V9RA 3D69B 2H5UA 1F90L 3BSZH 5KYXB 3D06A 4PS4H 5F7KC 1U6AH 4HF5H 4KKCC 2Z91B 4MB1A 1QA9A 3VI3E 5DD6B 3I2CH 4PJ7F 2J43A 2HN7B 3D39A 4R4NC 4L0YA 5FUCE 2GSMB 5DJXB 1U4FA 1SBSH 1T0PB 5CM1A 3U0WL 5MHSE 4XXCC 2WLLA 4PSRA 4J2QA 4G6KL 1S7VB 3UEQA 5AVRB 5H4ZA 3NJFA 1VRSA 4PJ5B 1UOVA 1OT1A 4X7DC 1H3WM 1KGCD 4HWBL 4PJGA 5DRWA 5EBWB 1MFNA 2F5AL 3HZMB 3K91A 3PDOB 2IWFA 4OLZL 2AXHA 2Y7OA 2X6MA 3VXUA 2VAAA 2X88A 1D7FA 1PF3A 1EFQA 1RUQH 1OGAB 3Q1SH 4OCSH 4WKZB 4Z7WE 4EDWL 2NQ3A 5I1JL 3TT1L 4MB5A 2YRBA 1FYHB 2EIZB 1YA5A 3FO0H 4XC3H 3MLWH 5HHOE 2H0EA 3DYPA 2ARJB 2H41A 3FQWB 1M2VA 1OW0C 5LGJA 1L5GA 5GS1B 4WFFE 2D3NA 1TTBA 4WJ5B 4GUPB 5HGDB 3DO7B 3N43F 3FTYA 5BW7C 2R1YA 5EBWA 4F1SA 4XAKE 4YPGA 1FJ1B 4CRPA 3HPJA 1A6ZB 1OEZW 2EDOA 1ZVNA 2EZ0C 2ADIB 5I1GH 4IGBD 2PPAA 3L4YA 4FYTA 3ZX1A 1XH1A 5IHBA 1AY1L 2I60L 4ZX3A 1LO4H 3F58H 4P99A 5IR1B 1U8IA 2GUYA 3OWEA 4Q4EA 1QEWB 1R6VA 4U1GB 2OBGA 4IIQC 5K59E 3NDZE 4HC1H 1YJDH 3RGVA 5ABZA 4OLYH 2A4ZA 4MJID 4WK0B 1U21A 1U41A 4N8UA 2AZUA 4JRYB 1I8UA 2OCFD 5FA3A 2C9SA 5BUPA 2DQMA 3UADA 3CG8A 4NKOA 4YBQC 5HTSA 5GS1A 3O4OB 3AROA 3BAEL 2ZF8A 5LBGA 3LQMA 4UWQB 1CE6A 4KGJA 3HZVB 3S2AA 2XNAB 5INCB 5C7XH 1Q94A 2P9RA 4JKKA 2ZD0A 2ADIA 4FQJH 2X2JA 5AYTA 4F8NA 1TQVA 4OZGA 4Y2DD 4KRPB 4HH9B 1BZEA 2Y69B 3O6KH 1Z9SB 2ADJA 2E74C 4W9DC 4G9FD 5HHME 3BVTA 5C0CE 2NY4C 3VTTA 5LQBH 4OLXL 1ZT1B 1T4KA 1NFIB 1Z0MA 2DWDB 1NGZA 3ZJAA 3GBDA 3KGTA 4JQIH 1IEBB 3BW9B 3H9ZA 3ULUH 4JRYA 5CFHA 3FTXA 4WU5B 4W9CC 5CP7B 2KLRA 2QQKL 3WHXB 4DWHA 3HEIB 3B1TA 3DSFL 5AALA 4M8QB 5D7KD 2YKKA 3FT0A 2F54E 3GI8L 1EXUA 1TPXB 3N6YA 3Q8AA 4RBPK 3SKJL 3BHBB 5IOKA 3HI6H 3FQRB 2ICWI 4PS8A 1XSJA 2R69H 4UZSA 1FSKB 5DD3L 1NIAA 2PP8A 5E4EC 2AKRB 4M1DL 2FE0A 4UV7L 1JHLL 1KJ2H 4YUEH 2VE6A 2XN9D 1P5UB 1RSFA 2ERJB 1NGZB 1XCTA 2CH8A 1YEEH 3D3VA 1L0YA 3PWPB 4QF1A 1A65A 2Y36L 4JZJA 3MLXH 1H9VA 3ZTDC 4S0TD 4L3EA 1DVXA 1SHSA 2BOBA 4NN5C 3VG0H 5I0WA 1SMDA 3ZL4H 5MEPA 2IPKB 3L3GA 5IEKB 4XHJC 3FT4B 3QEHA 2KPNA 3IGAA 4QTIL 2AW2A 3WMSA 1D6VL 1AC0A 2CPUA 4UMGA 1OM3L 3AFLA 2DKMA 2GJRA 2WO2B 1N7ML 2HRPL 4X6BB 1SBSL 1CZ8H 3SY6A 5IUCA 5DJ2A 5F0PB 4J27A 3FQRA 5I9QB 1NGWB 4ZFQA 1OO2A 1HWGB 1MHHA 2UZIL 2EEFA 4YSTA 1JDCA 2PO6B 1E8WA 4Z23A 1DSYA 1SVBA 7TAAA 3K6IA 3SJVA 3QHZL 3DURB 3UJJH 4KZDH 1H3VA 4U1JA 1IFGA 4D2NA 5C3TA 4F58L 2VE6B 4OGAC 2WUBL 4X5XA 3QARA 1WCQA 4OLZH 1F42A 1I31A 1NAKL 1WBYB 4DKFH 5E8DL 3VX0A 2Q9OA 4D0CA 3AMLA 4LQFL 1ZLWK 3T6WA 4ETQA 2YUXA 2VXTL 4ZOEA 3CVDA 2C7UA 2DH3A 3MJ9H 4J3OH 4OCSL 3EAKA 3MMEB 4HZ1A 2HG0A 2HLFC 3QJTB 4A04A 5D96C 1GYWA 2CSPA 1TTGA 2ZX8A 3P4LA 5E2VH 4IOFD 1MPAL 4RFEA 3FO0L 4NKIH 4N0UA 4KZEH 2FUTA 4Y2DC 4KO9A 5E9DE 3K4ZA 3DUSA 5DLMH 3V0HA 4FFYA 2IAND 2OMUA 2FQGA 3K5SA 3N1PC 1DN2A 5L6YL 4L37A 3H53A 2Z7YA 3PWNB 3RU8H 5DD5L 1T7ZA 5GGSA 2BSRB 5JHDA 2P7TA 3L5WA 2Z65C 2OJZH 4PGEA 1CF8L 1GYUA 2YOAA 2UZYA 4CN4A 3ILQC 2EDLA 4DQAA 4OZIE 1HE7A 4Q9QL 3J7HA 4CBZA 3VXSB 1RIHL 4TNWF 1KPUA 4OIBA 3DA0A 1Q1PA 1DQJB 2ZSWB 2NY1C 4KK6C 4UQ9A 2R8SL 3CLFL 3OD3A 4FC3E 3WGUB 4TVUA 1TZGL 2IWGA 3NN8B 4ZOCA 3ORJA 4GKZB 5IQNA 3D2UA 1G7MA 3T4AA 2F8XC 1H3PL 4N0UB 1TJIH 2GT9B 3VA6A 4EI0A 4H8WH 1X7QA 4NN6B 4OFYA 1LDPH 3DI2B 4CC1A 1E40A 1LO3L 4RMBA 3WIIH 2YGPA 5IBUG 2BSRA 1DBKL 3BT0A 2ENQA 4WNQB 2FATH 4ZAKB 4MAYC 2WXIA 5SV4A 3LKPB 4MXQD 3ZHKA 3M1OA 1TIUA 1KPUB 2BCKA 1UXSA 1TO5A 3J27A 4K55A 4QNPE 3PP3K 3WYRA 2XXMB 4OLXH 5J6GA 2CO7B 3P3SA 1UD3A 1KYFA 1W72H 2NT1A 2WZ6A 1KTLA 1KYAA 2GUOA 3E3QE 3WN6A 2X4UA 3VX1A 4PJAA 3D5OF 1QW9A 2AJZA 3FW6A 3D4ZA 5CSGA 4P57B 2BH0A 3EJZD 4AH2A 5DMGC 4E9VA 2AJSH 2WINB 1NA8A 1DQDL 1M7DB 3RWJB 3QCTH 4WFED 3QWNA 5CEZE 4P3CL 1MVYA 1PYWA 3P9MA 2HMID 4LP5A 2NYKA 3L7EB 3PL6A 3IK2A 1U8OB 4YDLC 4PD4K 2B7DT 3WUWA 2WN2A 1ZEAH 2B9BA 3DSNB 2LU5A 4PRHE 1IBGL 4Y4HA 1AZBA 1JWMB 3FTGB 1A4JA 2XBZA 2DQ6A 4XRCA 5LGHL 4JFFB 5LAXB 5MEND 4ODXA 3A67H 3BQVA 5KSAA 1TENA 2QTVA 3SHSA 2C1PA 4HFWA 1SXAA 3PUUA 4NQDE 3RWHB 1MCOL 3QA3A 3CX2A 3KPSA 3GSUA 1P1VA 5DJ6B 3CU7A 3DVNB 4NZDA 5IVZA 2O1AA 1UATA 1EHKB 3FXIC 4K0OA 1P84K 4DZ8B 5HD8C 5AL8A 1J0IA 2XXGA 1A7QH 3JWDC 4KUZL 1F6FB 4JQVA 4X6DF 3RWCA 4DVBB 1PYWB 3P9MB 5A1AA 4Z6AT 1MFEH 2IEPA 2GJZA 4JM0A 4I4WB 2Z8RA 3BH8B 2ADGB 4U7KA 4OD1H 4J7RA 5A6LA 1ZPLA 2O6DA 2OAAA 1I7RB 4LQ1A 5IFJB 2J2ZA 1MG3C 2ITEA 3G6JB 4OFDA 3KYMB 2VDMB 1JFQH 3WS6A 5JW3L 2I9TA 4GW5A 4YGVB 2IH3B 4E0RA 3CSYB 4OB5H 1VFBA 5KSAB 2C1PB 2VC2B 4LNVA 1AZUA 2K1MA 4OKVB 5A2IH 4BCYA 1WEJL 2R1WA 1TJHL 4WO4C 5JNYB 1I8KA 1TFHA 2OSLA 3CFBB 3DVGB 3REVA 4LMQE 4RVBA 1S7UA 3B9AA 4JO2H 4KQ3L 4ABWA 5IVZB 3W5MA 3A6CH 1TQUA 1CLYL 3H56A 3RZCD 4MXQC 3T65A 3N5AA 3MLZL 5CHNB 2D7QA 4J6RL 4DFHA 2R0WH 3MA7A 4O2EB 1FBIH 4CVXB 1NKGA 1QFHA 2ZNWA 4ELMF 1XBDA 1H0DA 3LVTA 3R0MA 4GQRA 2APWA 3NFSH 4PM1A 1CDIA 2JVUA 5BOJA 1JHKH 4O4YL 3UCQA 4D0BB 3AUVA 4CJ1A 4A2MA 3TLRA 2IH8A 4R26L 1JSYA 3ZKND 5GS3A 3FC8A 4G6KH 3T0WA 1KTBA 2DM4A 4HISA 1FG2B 5E2WH 3CZKA 4JANB 1E4WH 3NTCH 1V7ML 4EE2A 4P04A 1ZHLA 4BFKA 5AAMC 4OFVA 1IGYB 2H0FA 1CL7I 3CXHJ 4NJAL 5G2NA 2A6KB 4HV8B 3EKCA 1B9ZA 5IESH 5AYUH 2NY1D 3HC0B 3TNNA 3RWGB 5GGTH 1BFVL 4HUKB 4IHBA 1CCZA 3MBED 4HULB 2Q86A 4BKTC 5A43C 4Q58C 1XGTB 3GZQA 4TM9A 5DVMA 3W9EB 1YY8B 4XMKH 2W8CA 3CHSA 5F7BA 1NL0L 4P5TD 2VDKB 1H0DB 3CAFA 2C9RA 2MTAA 3O6LH 4JPIA 3V0VA 5BVJA 4BSWA 5IK3B 3MGTA 2VOTA 4M4PA 4KZCA 5DS2A 3D9AL 3OG6B 2YD8A 4W6XB 5K9KB 5KVFL 5DFVC 1S7WB 1U3ZA 4KI5E 1SVCP 3ROLA 2E76C 4JFHE 3RVVC 1RPKA 1CG9A 2DIBA 3HC3H 4GLRH 3DV4B 2X6CA 3P4OB 4LPXA 5D72L 3UBXI 4DQOH 4PI0A 4UM9A 1L0XA 4HV8A 4PV9B 2EDFA 3E1F1 2DQCL 3KYOB 5EC2B 4X5LA 2NY5L 2ZCKH 1N8ZA 4AEHH 3JV0A 2WZAA 4ALAH 2B9AA 4ZW7A 5ANMB 1R3HA 4H25B 2VDNB 3ZTJG 3ZGHA 1KLUB 2WB1A 4OV5B 3IMVA 5EOCH 1SXBA 4MDIA 5GGVL 3A22A 3E6HA 2DQUH 2EH8H 1C5BL 4Y16A 3SDCC 2VLJA 3NCWA 1DQDH 3VB9A 4JKMA 1H9DA 12E8H 3MJ6A 4M7JH 3SDXA 3SKMB 1BMGA 4U0RC 1OAJA 3WEBA 1BLIA 1CTMA 1KB5L 1YMMB 3BJ91 1TKWB 2E9JA 2WTRB 3RE0A 2XG5A 4L29A 3ARPA 1AHKA 4HG4K 3NIFB 4XN5A 4Q9CA 4L9LA 3M8OH 1EHNA 3I84A 4GSRA 3NUKA 1L9SA 4QI3A 4K7PY 1MFVA 3EOAA 1S7RA 3VM5A 2HFEA 1PW3A 2MSPA 3VQ2C 4ZPVA 3NT0A 1OAZH 5EU5A 3MRHB 5K33A 2J8HA 2HT4D 4R5TA 1QX1A 2NNCA 5J5EA 4FNUA 4AK2A 4JFHD 4YNYA 4AVKA 4Z7WA 4YIQB 3QXTA 2IQ9H 1HINL 1BQRA 2AJVH 5C7ZA 4QTHA 1JF5A 1FL6A 2LVEA 3GB7B 1LO5A 3QJSB 4OGZA 4YHKL 4WTZG 1KFAL 3IJ7A 5SWZB 4FQCL 2QPEB 4Y9GA 3LS4H 1CXEA 5LGKA 5D7SL 1NGPH 4ZQTA 2QQNL 2XN1A 5HVHB 3EYSH 4PGCA 3SIKA 3NCCB 2CQVA 1BQLL 1T1XB 1BGXH 5DQ9B 1J1PL 4HIPA 4ADJA 5JW3H 4NQCA 3M6DA 2FNWA 5TJWK 2R15A 5FHBH 3NZHH 4U1SB 2A38A 3B7UX 1OSYA 3UAEA 5JPMC 5HGBB 4HLEA 2GKIA 2WWKT 4KVCH 4IBLT 5T1KA 3FTWA 3MUZ1 3D85A 5J6SA 3PP4L 1CLYH 3GB7A 2E3VA 3RVXD 4OAWA 4YDVB 1TNMA 1IARB 4LSTL 3FO1B 4N0FA 1P0SE 5D1XE 1BD2E 4MX7A 5GSRB 4E5XB 2EIZA 2MTPA 3QPQD 1MAML 2DDQL 4UINH 2F54B 4MB3A 4BCZA 1SN0A 3COOA 4LL4A 2EDYA 2OMTB 1ZKAA 3ZYOA 4DUXA 1BYPA 4RGMC 2DEYX 5CKAA 3JQOB 3AQZA 3MUY1 8CGTA 1G1YA 4F58H 2CHXA 4QHNA 3G5WA 4XPAH 1UT1A 1VA9A 4X5RA 2WKGA 5CIPH 5D5MF 3SGEI 4N2MA 4AL8H 1HZLA 3IJEA 3NZUA 4CMHC 1WWCA 3O6MH 1QRNB 2I85A 3FH5A 5C0EA 3CVIL 2IV8A 3ARBA 3HE7D 3OZ9H 4BZ1H 2DQEH 1R5WB 1RZGB 3LXBA 5FLVA 3S37X 5CSZA 5AAMA 2NMSA 1RLBA 2WXRA 4JLRB 3W2DH 4WHCA 3MLUL 3WFEL 4HIHA 5FCUH 3RHWK 3TL5A 4PJEB 1IX2A 3APDA 2NNFA 5A16B 3VXUE 5B1JA 2PMZA 3ZUCA 2WNGA 5AW9B 4E41D 5A7BA 2VLJD 2WWMD 3U1QA 1ZDQA 2O5XH 3ARED 3OKEB 2YEQA 3C6SB 1FFQA 1WP6A 1ZE3H 3M17B 5ADOL 5I24A 1LEGA 1AS6A 4DO5A 3INUH 3EYUH 4LLWB 4ACPA 3OVUB 3DVFA 5DVNA 1XWVA 3QNZA 5K9JL 1F4HA 2PCPA 3SBWC 4AJ0A 5DJ8B 4LDLB 4WUUD 1E8XA 3IMBA 2JLPA 3H3BC 4AIZA 1TZGH 3VE0A 2JKWA 1YNLH 4QRAA 4NZUH 2R2HB 4WWKC 3L3JB 4AIOA 2WUCL 2PTVA 3MRDA 1ET5A 2HJKB 3GC3A 4J3BA 3IETA 2XN9B 1AOZA 4HCGA 1AGFB 1F6AB 2H6PB 4Z8FH 5AOIA 1F0LA 3LQZA 5M94B 3IDNB 1LEGB 1OCWH 1P4BL 3PQYD 3PUCA 3PNWB 3RWDA 1U4EA 2IAMD 5J1AA 3MUGA 3OSVA 3SZ6A 4B9YA 3MKKA 1OM9A 2V2TB 5GS0L 3QUXC 4L2YA 3PAVA 5GGRA 3AG3B 1L6PA 4LKXA 1N5YH 5FOBA 2G2RA 4DGIL 3GTVA 2G2PA 1WC7B 2BK8A 1XCTB 3IBOA 3N1QC 1NANI 5IB5A 1CTNA 3WIFB 3GBMH 1FNAA 3EFOA 5CKGA 1RFDL 2BFVH 3WTVA 1VEPA 1FI8C 3QEUA 4C47A 4F80A 4RAUA 2R27A 2XWRA 4KNTA 5BQDA 2ED7A 3ZTCC 2I26N 4FNTA 4AGOA 2J8UE 1ACYL 3RDTA 4YC2C 1FFPA 5D7SH 4UV4H 3VUAA 5CAYB 4X6BA 1J9QA 3ML9A 1XGQA 2VDKL 1WFTA 3NSYA 4PJ8D 1JERA 1J18A 3UJTL 1XF3B 3IEAA 3PABA 1BVLA 5KUMA 1J1PH 5EG6C 1WVZA 3HBZA 3EXLA 5IMOA 1FFOB 2BXYA 1ASPA 2GHWB 1CD0A 4ORZC 3WNMA 2DTSA 2VN3A 2WHVA 3QG6A 3ULAB 4U1NA 5E6IC 3WFZA 3IDGA 3DSFH 4HSCX 4A2EA 2ZWZA 5E1AA 3PHOB 1NOAA 5DMYA 1MRFH 4NPYA 2KZWA 3Q2CA 4KQ4L 4DF9A 4Y5YB 1QFOA 4QR7A 3V6FB 3EFOB 2I5YH 4MLIA 3QAZB 4E2OA 2IMMA 3FL7A 5IQ7L 2AJ3B 2ZCLL 5G4OA 1YPZF 2EVFA 5EA0L 3FSWA 5KTEL 4KFZC 5EZOH 1M6OA 4HDIA 5FKAA 4BH8B 3RDTB 2M1KA 1B0RB 5B38G 1MIEL 2XZAL 4L3EE 1IQDA 4OF5A 1NGQL 2JCCF 4XN4A 5JDSB 4MA1B 5BRZB 3EJQA 5F7DA 4B27A 2DJ4A 4XOAA 5EO9A 4HFUH 4DEWA 1QFWH 4LDOB 3B8SA 1G94A 3DGDA 4ZFGL 4DCQB 3UZVB 1SLVA 3QRGL 2H26B 4NGHL 4U1NB 2JJTA 2YA1A 4JFEE 2JSFA 2ALAA 1OM3H 4HJ1A 1DQJA 3DPBA 4JDEA 1ET7A 5D7JA 4ZTPL 3S37L 1JK9A 1MFUA 1F2XK 1KENH 4XWOD 5J11B 1BD2D 3MV8A 3ALXA 1DEEB 2VDML 1A7NL 1DFXA 2QSVA 5E8NA 4PJEF 3C5ZC 4XTRD 5TDPB 2MCPL 1AQDA 2FHBA 1QD0A 1W6LA 4OZFH 1HNFA 3B7YA 4M5SA 1K2DA 4XPFH 2VDQB 1UOLA 1P6FA 3BESR 3ESMA 3LN4B 1WBZB 3OR7B 3SDDB 4KK8C 1P5VA 4XP5L 1I9IL 3QO0A 1R75A 25C8H 2XY2A 3EW3B 3DX9B 1UFUA 4HJIA 4PI2A 3UYRH 4K7PX 3DPBB 5D7JB 5HHPA 3E7JA 4U1MB 4WUKL 5JHLH 2W0FB 2VZUA 4F91B 4XMTA 4NJAH 3B5TA 3ZDXF 3WN5A 2X4PA 3OQRA 5F96H 1XGUB 4LCCB 4QAWA 1RJZA 4YHPA 5GHWH 4IRJC 4G5ZH 1WH0A 2X4SB 1IT9H 2H1LM 2R0KL 2MQ0A 3UPCA 3IN0A 5KYWB 3ILQD 1AQDB 2Q10A 3QK0A 1IGIL 3NAAH 4N3TA 5L2JB 1XH0A 2D9QB 3RGVC 1WO2A 2GCYB 4KXZH 4XNZB 4XP9H 2X7LB 4C56E 1U8NA 3GJFK 2K4WA 2PTTA 3JWNC 3S3JA 3SPCA 1OSPH 4XMLH 1L7TL 5I76B 3T0AA 1WZAA 3K4DA 3HI5L 4R2GC 1A02N 1MRDH 3P77A 2GSIA 3EJTA 4W70A 1AC6A 1ADWA 4IS6A 4ZFOL 2WNWA 5HHPB 5I15L 3IXAA 1MVUA 3QUXD 2B3RA 4QXGL 1DSFL 1LWJA 3OKNA 4YS4A 5I1AA 4ISVB 1TXKA 4JRXE 4MS6A 2PPFA 4NO0B 4NAQA 4RGND 3NJVA 3X3GL 1KGWA 4P2RE 4NP4H 4R7DA 4P4KA 4WJKB 5E56A 3IPBA 4CJ0A 1KXVA 3ULVE 4XWGL 4NO2A 4F33A 3IDJB 3NACL 3ECQA 5KSVA 4UANA 4Z7VA 4H13C 3TZVC 2HFGL 2LQRA 5JQ6L 3NA4A 4Y1AE 5CEXB 2P5WA 1IV8A 2H7WA 2YWZA 5JUEL 5I16B 3K72B 5FGSA 3GSQB 1BLNA 4HUNB 4Z7AA 5BZXA 5DZLA 4WTQA 4D0DB 1GKOA 5D70H 5ID1A 5IKCB 5I76A 2FWUA 3ZKMD 2ZT9C 5ENWA 3D07A 4ZMAT 3MXVH 3STLA 3KLQA 3TPKA 1NC2D 2VO8A 1JNNL 4LK4A 5LXVA 1USQA 3FU5A 4UZUA 4YGVA 4NC1C 1MZYA 1NCNA 4WFGE 3KWWB 2HT2D 3UZEC 3H9YA 4KX8A 3B9KB 1D5XB 4R96B 3IDJA 2YK1H 3QAZC 3VXNA 3TESA 4ZJ9A 2YSSB 4BK5A 3CHPA 1AHWA 2HTKC 1KLFB 5IB2A 3KEHA 1A1NB 4RESB 4I0CC 4MNGE 3B3IB 3T65B 4O02H 4JMXA 3F7RA 1FDLH 4EJ1C 1UCBH 2X4NA 5I26A 3BVWA 5FLUA 3FOMB 1HAUA 3VXMA 4AVIA 5E5UB 1T1YB 5MENA 3HPLB 4L9DA 2ESVA 2IGFL 1KBGL 2B1AH 1R17A 5BS0A 3ELAT 3QEGL 4ZSOE 3P3TA 1WLHA 3FHAA 1T1ZA 1UACH 2IAAC 4YPJA 4PU2A 1DHKA 1FG2A 4QRQB 3D51A 1YUHB 2QQKH 2V3FA 3CFUA 3WFBH 1A0QH 3GUTA 1Z5YD 2Z31C 2ZOTA 4PHZA 2J6EA 5FM5M 1V54B 1J8RA 4A1RA 4AYSA 5HYJB 2K6WA 3SE6A 3HC4H 3L3KA 3TNNB 2FX7L 1V55B 3IFNL 2BVTA 1JYVA 1KLFA 4UDUB 1JFQL 4EN2A 4R2GD 5F1OB 3T6QC 1RSYA 5CSBA 3QPQC 4S10A 5DD3H 4EVNB 3MV9D 1W72B 1KWGA 3DETC 1E6JL 3ETBJ 1NBZA 1GL4B 3DOIA 4YO0A 1D3CA 1PAMA 3E2HC 4ZFFB 4ZTOL 3T3MB 5EF1A 1H15A 5DD0H 5T8IA 4AQ1A 2AMGA 5KOMC 2Q87A 5F7HA 1E5YA 4QRUB 4ZK8A 1SHMA 4F7EA 1UXMA 3EFDH 4IIQA 3ZR6A 1RU9L 4LF3B 4AC4A 4UM9B 3ET9F 2BWDA 1CYXA 1RIVH 2CGYA 3D4GA 1EO8H 4FMVA 3CVIH 3OZ9L 1TQBC 3PE9A 4LVEA 4RFNB 5ANMA 3S8WA 4XMPL 3R19A 3T3PB 3TO4D 5BVPL 5C6WH 2BC4A 3ABMB 3HG1D 4XVSL 3RIAK 1R3IL 4KDTA 4BZ2L 3W2DL 1QNZH 3BP7A 1AE6L 3MREA 2ZXDA 2OX5B 4MJ6A 4U6HB 3KW7A 4AWJC 5EH1A 4TPRH 4OU3A 4HLZG 3RPBA 5E8DH 4XNYL 4WRLA 4MCZA 1JPFB 1L6XA 1RULH 4XPGH 2COQA 5BW7A 3VI4F 3EJCA 5E7FA 3FMGH 4U1LA 2J56A 3N40P 2Z93B 2P5WE 2ICEC 4P5MB 1J5DA 1FAIL 2HFEB 4KKBD 4G5AA 3LHPH 4XWGH 3NIGF 3P73B 4CN6A 4FDWA 1X7TA 4Z7WB 4KHTL 4LAQL 3WI9A 5C1MB 3GHBH 4N8CH 5JQ6H 2IVFC 4H1LA 3VTAA 5ICYB 3GUFA 2BJML 2WNKA 3DXAB 3N0PB 3EDEA 4NRXB 5E08L 4Q9QH 3QQ3A 3ZDZE 5SWZA 1ORSA 4LVOC 3EADA 4N5EC 4GRWE 2P5PA 1BG9A 1GGBL 4UT6H 3L4VA 3PPSA 3IFLL 2R2CA 1HH9A 1U9KA 2YD0A 2FR4B 5EMYA 3OBAA 3QG7H 5I6XB 4JG0L 2VLRD 2E47A 4U1HB 4N20A 4R9HA 3TZVB 4M1CD 3B9EA 1ZSDB 2V6HA 4R7VA 4U3XA 1H3PH 1QSEA 5D7IF 3D39D 4IM8A 3QCVL 3Q3GA 3NSFA 1MZZA 1GMEA 3PU7A 1YMHA 2BDNL 2A6JB 3RVWC 3ZKQD 1NCTA 1YYML 3GXMA 1UVQA 4I3GA 3FULA 5C2BH 1QBMH 1CGSH 3QJRB 1Z9OA 5ICYA 3NSDA 4IIZA 3NIDE 3PPEA 3TNMB 3PWLB 4JZNB 4PJ7B 2FYVA 4PJ8C 3FU6A 4D7PA 2IPUK 2R39A 5DJDA 3A5VA 1KBGH 1EBPA 1S5HB 2B1AL 3ESNA 4GKNA 5KG9B 1QOKA 2FJFA 4TULL 5E94B 4FG2A 1EFXA 3HBPA 2WXJA 2EYSA 4UTBL 5FV1L 2IFGA 4CMMA 1QO3A 4ZW3A 1MWAL 5KN5B 4LCYA 4FGMA 3DIDA 1B3IA 1CU4H 2VR4A 1LQSR 4P3CH 3W1ZA 1UVQB 5FO8B 5KYUA 4YHZH 4UTAA 2OR7A 3VGAB 1B88A 3S4SA 1VENA 1PG7H 2E9IA 3NCMA 1A2YA 3UO1L 1HESA 3QBTB 2B08A 3O6FD 1WG3A 4ELKB 3BKCH 3PWLA 1IC4L 3PAUA 2OR9L 4MD5B 1L9TA 3QUGA 1P6WA 2CKBH 2E27L 3WLWC 4YX2L 4ZTOH 1C12A 4G82A 3EZJB 1KFGA 3AXIA 4YSDA 2NQCA 1X4YA 3KL0A 4J8RB 1TR7A 1MCIA 3VH8A 4Q6KA 4K71C 4FJZA 4WAFA 4LLWA 2ZG2A 4LHUG 3WEMA 1VZGA 4L4JA 5KN5A 3K8MA 3LKOB 2WOYA 3IRPX 3OLGA 2GFBA 2UXTA 3T6XA 1MCPH 2A77L 4FA8A 1KCLA 3ULSB 1VFOA 1F4WH 3NIFE 3A4FA 5T1LB 5ACLA 2NY6C 1T7VA 4QOKD 1JMXA 3IJYB 3D0LB 4QHPA 4JUTA 5BVPH 3BP6A 4NIYE 4N26A 2VDMH 1P84J 5ESVB 3VQLA 5IROA 2N1KA 2NY2D 2N1TE 2J25A 1ONQA 2JIXD 3OAYH 3K8KA 4GJTB 2NY4B 2NSXA 1MNUL 1T80A 3BEWB 3Q13A 5T3XE 2ICEA 5EZJB 4X5WA 2WV3A 2OZ4L 5DI8A 4HX1B 3GT6A 4XNYH 1M7UA 2Q8BL 2IQAB 4KQ3H 1TSHA 4MZIA 4P2RA 3CQQA 3TT1H 1IC5L 3MV7E 3QUZB 4NB7A 5FK9B 3ZKNC 1BXUA 4PRPA 3LKOA 1A8JH 1AR2A 1YVLA 2N7BA 4AYFB 3MLZH 1RLWA 1EIBA 3UGUA 1XVSA 3BUPA 1D9KB 4AT6B 5IB1B 1FL5B 2ITCA 2RMNA 3TCLA 4YGAB 1DVFA 3ULVL 4MA7L 4PLNC 2ZUWA 3NFSL 4NUJB 2OZNA 4IRZA 1WFOA 4H44C 1HDMB 4WEUD 2QADB 4K73A 4S1QL 1IT9L 3BEWA 4YHLL 4WWOA 2ITDB 4M8RA 1DDHA 2G3NA 3OPZL 5T1LD 3WXWL 3DHPA 4TQIA 1NFKA 2DLTA 5ITFB 3MRQB 2OMVA 3QZPA 4PW3A 1TQSA 4GAGH 1UQSA 4Y16C 1A1OA 2VZ3A 1NLDH 3SCMB 1ZVYA 2OV0A 3WTSA 1KWKA 3RVXC 1ZA3A 2EXYD 1PZ5A 4NCDA 2K8MA 3QCVH 5JPNB 2YUVA 3KYAA 4W4OA 3BRGC 3G5VA 3A6OA 2CUMA 4XMKL 2Q3XA 4PJDE 2Y6SD 4WK2B 2BIQA 4PJBE 3MRRB 5FXCH 3LZOA 4U05A 2EAEA 3MV8E 3DTDA 4RWHA 2FHFA 4EXKA 3UPRB 4YE4L 2WZPA 3TYFB 1DFBH 4ADGA 4U0RB 1OVZA 4LRNL 3HUJB 3VXPB 5D1ZD 2E8ZA 1DLHA 5GSVB 3R1GH 5JQIB 3EJSA 5DUPL 4IMKC 4L8DA 4K5NA 4K94H 3V0DA 1N5AA 1MY7A 2NZ9C 1PAZA 3O6FA 3AAZB 4N2OA 4JQIL 4UNIA 4I9WD 4AQOA 1E90A 4C56B 3VD4A 4PP2A 4ZI8A 1OTTC 3V5KA 4OCYL 1SDAB 1VFMA 1OGAD 2HRGA 3MBWA 1DVQA 4O2FA 4U3CA 2HVJA 2QZQA 3RTQC 2AS5M 1TVDA 1CXHA 1RQ5A 4OI8A 1WJ3A 2H26A 2X44D 2E6JA 3ARFC 4OR1A 3M1CA 4X0KA 4HKZA 1NUDA 1KIPA 1QLRB 1UXWB 4ILDA 1AACA 3BXNB 4JRXB 2XZZA 3VFUB 2HKHL 4PW9A 3UPRA 2AC0A 3AREB 5I19H 1T5XA 3BVNA 5F7YC 4MGXA 2YXFA 1D5BA 5BZDA 1M2VB 4JG1H 1FAKT 4AUUA 3QUMH 5CINH 5I30L 5CWSA 2V9QA 4L8DB 1KXTA 1IKNC 1EHLH 4EUPG 1L9OA 1Q0YL 4MD4B 5DA0B 1ZOXA 1E4KC 3FQNA 1ZHKB 3B2XA 1MRFL 3DROB 5D1QD 4JFTA 3VVVA 4IKNA 4FQPA 1LQBC 4NUQA 1ZHBA 2EACA 2V5YA 4TVPD 5AVSB 4YXLL 5BMFL 3TVMC 2HKAA 1JWSB 1VB9A 2H32A 1KIPB 1QLRA 2RH0A 2RQ8A 4N24A 4XNDA 3F8UB 2GK2A 4B9KC 2QMKA 4JRXA 2FYYA 3TVMD 3CBKB 4RMWA 4OZHB 1EO5A 2NRDA 3Q9QA 5CP3A 1NFDF 2D03L 2WGNB 1D6EA 1NMAL 3FJTA 1GGIH 3FU0A 2V9TA 3GMNA 4NKOB 3EBAA 3BQUA 3FAXA 3Q6FB 3LRKA 5F9WB 2ZICA 2QVMA 2JF1A 5KS9F 2WBJA 1JXFA 1ZHKA 2AXJA 4PWEA 3FB8B 2XQ0A 5DU7A 4NNXB 3ABGA 5KVMC 2VLKD 4ZAKC 1OT2A 2HP4A 3IE4A 2LLLA 3KL5A 3O2WL 2X7LA 2XV3A 3PWVB 5FB8A 1BOYA 2PTTB 3VMOA 4JPSA 4W9KC 5GGSY 3ASWA 2A6DA 4DW2L 1ZT1A 3T77A 2ZX5A 4QXUL 2FYYB 2FBJH 4AW4A 2WLYA 1AS8A 4LVOB 3LVEA 2P45B 3SBQA 2IGLA 1Z5LA 1U95A 2F1BA 1QI5A 3FCSA 1KLGA 3QORA 1WBXB 1MOEA 4XOEA 5IQ9A 3VDBA 2YEZB 4XBGB 4WI0A 4FI6A 3ASNB 4I2XE 3P4MB 4G6JH 5FOJA 3FQYA 1A4CA 5JLZB 1BVOA 5EU7E 4YHLH 2UWEB 2P3YA 1OAXH 4JPWL 3B83A 4R4ND 4DPBX 4GG8A 4GMTL 4KHXH 3SE4C 3SE4A 3HTLX 4GP5B 3SPHA 4G9FB 5F96L 4ZSOA 5I0YA 4D0DA 3BZDA 2TRYA 4PBXA 3T77B 3I6LE 5D4QA 2R0KH 3UZQB 1F56A 1ZMYA 3J07A 2AEPL 4GRMA 5DHYA 2C4XA 3O2VH 3MBEC 1EEZA 3MLWL 3OKKA 2G0LA 1RIUH 5AVVB 4LIQE 5J4MA 3FCSB 1J9CT 1FAIH 1GKEA 1YEGL 3BLBA 4V1DD 5B4MC 4ABVA 4HIJA 2BW5A 2JLLA 4XNMA 3U6RA 3WIHH 3LXCA 2R9HC 3HS0B 4P5RA 1S3RA 4WHDA 4QKXB 1SF3A 3BIKA 1A1NA 2AFNA 1R5IB 3B3IA 5JYMA 3QT2A 2FEDC 2DM7A 1CICA 3NEXA 2DQIL 2R56H 3H7BA 4G9FA 4RIRB 3SO3C 4B9JA 1T5KA 4IBSA 4TSAH 5K9OB 1RAMA 3CMOL 3F58L 4RZKA 3HB3B 1IQWL 3FFOA 1SY6A 3FKUS 1FVDB 3AU0A 5I1EL 5A3ID 3MFGB 3EO9H 3FO9B 4R83A 4JQXA 3MV01 4GRMB 5D1QA 5DHYB 3RDJA 4D0CB 5C0GB 2ZP8A 3NZ8A 1QUNB 5HDRA 2WUCH 1IAOA 3RZWA 2MOVA 4H0LC 4L8SB 2W80C 2OCJA 5HHVH 2XIBA 5ADPH 4JB9L 3DX7B 2MCAA 3V0GA 4NFCA 3S36X 2NY0D 3L3KB 3SE8L 2GPZA 1TQBB 5D1ZC 3HS0A 3Q05A 3BPNC 5F7UA 2X4OB 3BE1H 3ZRSA 2JFCA 2NY3B 4GINA 3S3SA 3QRFM 2WQWA 4I9WE 1FZOB 4L37B 2V7NB 5HGHA 1GVIA 3CVHL 3WFCL 1IL1B 5LG1A 4CAGA 1UGKA 3UAAA 3H7BB 2KI6A 2P24A 1W72A 3GSVA 3DLQR 4AQAA 1AGDA 1T0MA 2Y7QB 4X8GA 1F8TL 1NBZB 4BFEA 5AAWC 4YO0B 1W8NA 4HAKA 4LVNB 5TQ0H 1KOAA 3MRJA 3NZ8B 1A3LL 4A6YL 1ORQA 4HPYL 5C09D 2C9UA 3KPMB 3ZE1B 1JGEA 5J1SC 2YC1A 4GQZA 1KULA 3WTWA 2W59A 2Z8WC 3BSGA 3APNA 2HTLC 3DGGA 3HZKB 2NXYD 1CWVA 1TZIA 3DKHA 4MFHA 4P23D 5BS0E 2AQQA 4E9XA 1MJ7L 1R24B 1N4XH 2E7LA 3BPNB 4HWZA 4NNYA 4JRFA 2CUHA 3UTZB 1K8IA 3DNKA 2EE0A 2DMHA 3LIZL 3TJEH 2CIKA 5A6IA 1JN6A 2KS0A 1T2QL 4P46B 1BYOA 4OJFH 1D5IL 4X8JA 4UV7H 4JCMA 4LEOA 4PY8J 4YUEL 1JZGA 3T1FB 5GJTL 1MFAH 2EICA 3OXRA 3QRLA 4NO0D 5C3IA 4GG6F 1PD6A 2APTA 4HUWB 1HHHA 4L4TA 1FO0A 3MLXL 4AVJA 2CBOA 1M7XA 1I1CA 5F7LB 3MLYH 4DTGL 4GRLB 3L3OC 5T3ZD 3DXAD 4CSSA 1EAPA 2YC1B 5K1JA 2X4UB 1AMYA 2W88A 1MF2L 2FJSA 3TO4B 3E3QC 1T6VN 2XICA 3C5SA 3G08A 2DTML 4JCLA 3FSOA 4OJEH 4Z7NE 1N7MH 2P49B 2IANA 2F7PA 5B39B 3WIHA 3WJMB 3EDJA 3EJYC 4GRWH 2NY2C 3P73A 3RNQB 4F2EA 3OM3B 4TXVB 3ARQA 3V8OA 4U49A 1U8OA 1SXNA 3W0WE 1GZPB 4HZLB 2WLMA 3X1BA 3I2CL 1AO7D 3WUWB 1HHKA 3B6SA 4MXVF 5KVGE 3ZTEA 2H9GA 4BUHA 3LYRA 2TSBA 2R4SL 4FTVD 4HIIA 5EPMA 3QUZD 4PJBA 2XSKA 5LAXA 3QUHA 2FHCA 3C8DA 4XMPH 3RJOA 2D8KA 5JXAH 5IFHH 1JRHI 3MSPA 4JAMB 3BSZA 4CVWA 3IXTB 4CU8A 4JDZA 1YYLL 1NBVH 4QCIA 1MPAH 1UJ3C 2J21A 5TPWL 1AE6H 1OCOB 3DVNA 3MRGB 1EGJH 1PPIA 3TONA 2HPOA 1PLGL 4ZUSA 4PTTA 1J8HD 3KPRA 4BJLA 2FJGA 3VD7A 4DVBA 5I28A 1QLFB 3S3PA 1MLCB 2F15A 3SGKC 2YQBA 3HRPA 5MI0C 4ODHH 3ZN6A 4P5SA 4IRSA 3PGFH 1DBJH 3FUFA 2G5BA 3GHEL 1S8DA 2NCMA 1KTKE 1WGVA 3DYMA 2IH3A 4E0RB 4JHAH 4FFZA 1QR1B 1JL8A 2DJSA 3GSNH 3T4YB 4KV5F 4X80L 1INEL 4KO5A 5HVGB 3WFHB 5E9DD 3FQXB 5KS9B 4G5ZL 2AK4D 4M7JL 4Z3HA 1F6LL 2IAMB 1T03H 4E68A 3VM7A 3HCVB 2XIDA 4BK4A 1IGIH 3MRBA 4K5OA 2Q5BA 3FQUB 4UOQA 3CVCA 1PNCA 2AJYL 1HEJC 1VACA 4O2EA 4PJHA 4I18B 3GPSA 4XMWA 4CC4A 3EF4A 3O9WA 1A2YB 1QR4A 2K78A 4JL1A 4JHZA 1CURA 4ODVL 5FWQA 3HJ0A 3QPXL 3ECBB 5D7JC 5I82A 3WE6B 2F5BH 1G7IB 3N43B 1F8TH 5ID0B 1U8MB 2ZWNA 1LO0H 5FGBC 3VFWA 1HINH 3CFKA 3G6JF 1HZHH 1HL8A 2ARWA 3GNML 1FRGL 1XD0A 3SGJC 4WHYH 1A3LH 3VVWA 4HPYH 4A39A 3T0EA 4KFMA 3VH8B 4F27A 2WLIA 5J0BA 3Q9PA 5FYKU 2WZ0A 5HDBF 5B21A 3RWGA 2YKLH 3LPFA 3O0LA 5GIRB 3MTRA 2P5EA 4Z7UB 1UFGA 3F2LA 2FCBA 2ORBL 1M71B 1BMWA 5BRQA 2JJTC 3EYSL 3H8NA 1FVEB 2YAOA 4HKJA 4I18C 1KT2B 4I18A 4XBEH 3L9EA 4KOCA 4KJYB 3RVTC 1E27A 1T7WA 4JKPH 3KLAB 3KDPB 1FN4B 3R8BB 1M57B 4L3CA 3CFNA 1WZKA 1E4HA 3WE6A 4IOIA 5M95B 3CFIC 2AXWA 3SY0B 5I18H 3DRTA 1H6TA 5EZJA 1TCRA 3CFKB 4HBQA 4L5FE 3IVKA 3UAJD 5DF0A 3VFSA 1ZD6A 5FUZL 2P80D 4PV9A 5GZNA 1RJLB 3KYOA 4F9PA 1EZVY 4ZYKA 4XPHH 1YMMD 5IMMA 5D8JL 5T1MA 3T2NH 3QUZA 2ZWKA 5D7HA 1YLBB 2CDGB 5KSUB 4OV5A 3CZLA 1RVFH 3PAZA 1RD6A 5A7EA 1MFBH 2XYCA 5BV7B 3T2PA 4JHVA 5HYEA 1OF2A 5H37G 2R59A 3MRCA 4G2AA 1P7KA 3WO4C 2XWDA 2AXFA 2Y2TA 2UVEA 2F8OA 1GGIL 1MI5B 3R7RA 3QEGH 1ZLDA 4MMXB 4PWGA 1INQA 1HDMA 2Z8VC 5B7EA 2GI0A 5JHMA 4NFBA 2V8MA 4ZUUB 1CFQB 5ETUA 4KKLC 3W11D 5KSBA 3R0NA 2V2WB 1QI4A 3O6ML 3UMNA 5DRNA 4Q8BA 1BVKA 1UUSA 1BJ8A 1TLMA 3C60B 1HILA 4JY4B 4LOEA 4U6VH 5E2UH 3ZL2A 1N64H 4R90L 5GRUL 2AEQH 5CZRA 4N86A 4OVUA 4AG4H 3VXTB 1BG1A 2CDEB 2LABA 3KBEA 4G8GD 3SOBL 1G6RH 1XO8A 1S9XB 2GTWB 1B6DA 5IT2L 4BV1A 4YC2B 1ZT7A 2OTWA 5I8KH 4YEEA 3S5ZA 1T6WA 4L1TA 1FL6B 1PLGH 3IRZA 3P0VH 4TUKH 1KBPA 2A6IB 2WAHA 5I8OL 5D2LF 2WXLA 2Y5QA 3CHRA 3T8XA 2AXFB 1M3IA 3HHSB 4LSQL 5IVXB 2YBRA 1IC5H 1QRKA 4LU5H 1W0VB 2X70B 2X53A 3VXPA 1IUZA 3UTQB 5EF2A 1CFQA 5ETUB 5KSBB 1JZDC 1HJCA 3US9A 3O8XA 5GSVA 1HCYA 2NZIA 2VXQA 3GHEH 3HG2A 4RA3A 4ZX6A 1EBAA 1HH6B 4Y5XC 4FZ8H 1RZJL 2DMBA 4JFOB 1FHNA 2ZXQA 4IDLA 5AYUL 2V2XB 2VQUA 5T3XD 1CBVL 3M1BA 1Q38A 5F93C 3WNLA 5HGBA 2YA0A 3MRFB 5LNGA 2WTPA 5L7XH 1H8NA 2FVNA 2HVJB 4LOUD 1SQMA 4WI5A 3OMNB 4U2YA 3MA9L 4KO6A 5TFSH 2Z35A 4AZ8B 4BGLA 4BE6A 1V7NL 3HAEH 2FH8A 2JH2A 3TXAA 3WY1A 5IW6A 2ZOUA 1LE9A 2V33A 2BY1A 2F54D 3BXNA 1OY3B 2MOGA 1I1YB 1KY6A 2Z91A 4Y4FD 3ULUF 1NICA 2PNDA 4EI5D 2XWCA 3BIBX 1NCJA 3MLVH 4O58L 3DDFA 3HLAB 1G7JB 1D2PA 1HEHC 3MCG1 3PIQA 1PZBA 3AM8C 1V5JA 3QDGE 2GW5A 4K7PH 4JFXB 2V4LA 1T2XA 4H2CA 1A1MB 4CVZB 1BJ1H 1KXTB 3FT1A 1B4JH 5D1XD 1X7SA 4QY8B 3VFPA 3ZKXB 4XC3L 5CEYB 1B4TA 1CGXA 2CO1A 2ZKYA 5D6CA 1DBKH 3HNTL 5JW4Q 1TQWA 2NUTA 3RWIA 2FQFA 3HAEB 3OLDA 5EIQA 4X7TA 1U3HC 1UZ6E 2VAAB 3SE3A 1XZWA 1LE9B 5AW7B 4Z78B 3CFTA 1DVUA 4OGXL 4ERSL 4BZ1A 5KVEH 2BVEA 3BMVA 4GBXA 3C9NA 4MMZA 4JLRA 5FYKL 2JCWA 1IM9D 1T22B 4PLOB 3ARGA 1PY9A 3B9KD 3NQIA 5JOFA 4DK5A 3K0WA 3H85A 2N7AA 1OGTB 1UYWH 3I6GA 2Q0ZX 3BWSA 2DY2A 3ZHFA 5EFIB 2D7PA 1FZKB 3CFDA 5IFAL 3I75B 1L0PA 5KBKA 2PCPB 2HPTA 3RIKA 4ONGH 4WO4A 2NY3C 2WP3O 1AFVH 3KH4A 5JW5B 2AKRA 1I1FB 4Z3JA 1QABA 3W81A 2GAZA 2YOCA 4HHGA 5EZOL 1IBZA 2XFXB 4K7FA 5LGHH 3ILEA 4HGMA 3P11H 4K07A 4GBXB 5HD8D 2OTPA 3E2HB 1AR1D 4H0HB 4WFHE 3RYMA 5CLYA 1MCOH 1BX2A 2NTSP 4N2BA 4G1MA 3G7TA 3DMMD 1T1WA 1OAYH 1IGML 1TITA 1WBXA 4UB0L 5ALBL 3QUZC 4NO3B 2R0ZH 5BO0D 4DO6A 3ES6A 1BGXL 4TN9A 2SEBB 4JFYA 4QRSB 3RL1A 5FM5O 1GMIA 4ANWA 1HAWA 4F5CA 1HEZA 3FFCB 5FHBL 4JPKL 4KY2A 2F7IA 3B2VL 3IDUA 4I3RL 5IG7A 2ATPB 2QSCL 5TK2A 4N5ED 4S2SB 1P2CB 3U79A 2XFXA 2CRYA 4CW1A 4JFEB 3JXAA 3M7OA 4UQ2B 3GMRA 2BZ7A 2F08A 2F74B 3ZR5A 2ZYIA 4XP6H 3ARDA 3KDMB 1IKFL 2NY6B 4PJ8B 3VA2C 2GHZA 4G72B 2QKSA 5L8LB 4JGNA 1U58B 5A2BA 2WPGA 4XPFL 4RAUB 3GTNA 2IALA 1QI3A 3QDHA 1GCFA 2Y36H 5HYSA 1UWYA 1X5IA 2BOLA 1NCHA 1PD0A 5IQLA 1C08A 1I9IH 4K8RH 2G9KA 2OMWA 3BKYH 4YSEA 1PZSA 3Q2WA 5FF6A 1ODAA 4QXUH 3SDAD 4MA8H 1F41A 3BIKB 1F11A 3CDZB 3H9SE 1R5IA 2DMCA 3LEYL 5FCSH 3UC2A 5IGXL 1TT6A 2DQTH 4Y7OC 2V0AA 2AI0H 3IKKA 1FORH 4YDNA 1HN1A 3L5HA 3QZWG 4E36A 2CHNA 3ILDA 4OY9A 4CW1B 1FVDA 1X4ZA 4RGNB 5EU6D 1I4FA 2R2BB 2EC9U 1FO0L 1N0XH 2X42A 3QDGA 3ARDB 2OQJA 2FT8A 4KI5D 3V6FA 4YXHH 4I0PD 1UG9A 4R8WH 3VXMD 4MAYD 4IBWA 3G6AB 3M45A 4XN1A 3RX8A 1QUNA 1EJFA 3QZBA 4HIQA 1IAOB 2EC8A 1WUZA 3L3GB 3FDWA 4F7CA 1EGJL 2BS8A 3DYOA 2ZWYA 1TTFA 1VCBC 3D8MA 4APQC 3Q43A 2A9CA 5FKAB 3DX7A 2CK0L 4HW6A 1IFRA 3LMJL 5EO0B 5T1DL 1JYWA 4XP1L 4FF9A 4A67A 5LXGL 2J12B 3CFEB 5FFLA 4M1GL 4OM1L 5E99H 3MCLH 4YHNA 2BSTB 2ZX7A 3OLEA 2V7NA 4MYWB 4MBOA 2E8YA 4ODHL 4Y5VA 5K1NA 4BD4A 2VM9A 4U1JB 5PAZA 4HOWA 2QQLH 5FR3A 4WNQA 4Y9EA 5ECJE 4ZS6C 2XZQL 5FS5A 4OF7A 3L1OH 4MA7H 1JK8B 5TGBB 1WBYA 2ROYA 3NACH 5DTFA 1BIHA 4R7NA 1YNLL 3BFQG 4NZUL 1G7QB 3QE5A 1JG9A 2YGNA 2RQEA 4S1QH 4BUGA 3ROOB 4QT5A 1EXGA 4ECNA 4WIQA 1BIIA 3RDTD 3KVQA 4KXZI 1GHFH 1NUFA 1X5AA 2AJZB 2VLRB 4JVWA 4L8BB 4XE0A 2WAQA 3F7YA 2ZOOA 1VZHA 3O45A 1M7DA 3RWJA 4YHNB 2IDTA 3NZSA 3EYQD 4PVLA 4MA1C 1E3XA 1RUPH 1YNTA 3CX5J 5FM8A 5GS0H 3D2UD 3TURA 5FDYA 2MRYA 1AZRA 1F3JB 4P9ML 4X8JB 2UZYB 3LHAA 4F15C 2XWBA 1C8QA 4OW6A 2E5EA 3V79C 3WIIL 1SDDB 3MTXA 2QQQA 2QPDB 3B2PA 4LCWB 2ZSWA 1W0WB 4FS0A 4C4UA 3RJQB 3GJEB 2KDGA 3X1EA 4OI7A 2B59A 1CL7L 1XGUA 2VMJA 1E8ZA 1JV5B 1TEFA 3HS8A 4MMYB 2WLHA 4PLKD 2I69A 3HMXL 3MKGA 3FN0L 4NS0A 2BSSB 4PG9A 3O3EB 3GSOA 3BFOA 5E6SB 3L3OB 4MNGB 2NOYA 3X11B 3RWCB 1UOKA 1YNTB 5L4JA 1YYCA 1U8NB 2XQYK 2BFGA 5AVUB 1SYVB 3JWOH 3MDJA 1VSCA 1NPJA 4FFVD 1HHKB 5L8JB 4OQ1A 1QFPA 5C0ND 4ZW6A 2O6FA 4AMKL 1I7RA 3UP6A 4C4BA 1S7TA 2W9DL 4KQ4H 3N91A 1MVUB 2AEOA 3ZE0E 1HXYA 3A0OA 5HHXH 2J88L 1IO4C 3BUBA 5FO7B 5JXEC 5J6GB 2OI9B 4Q9RH 4XNXL 4UF7C 3PRZA 1F1GA 4X7SH 4X6CF 2LLGA 3VQMA 1RZ8A 3VWKC 4BQ6A 1WD9A 4N90D 1N2RB 3LRMA 4MAZA 1Q9LA 5GISH 3V0WL 4YSOA 3BWUF 4Y2NA 2ODHA 3RA7L 4UOW0 2ZYSA 4FJ6A 4LNRA 5D7LB 4FFTA 2DBJA 4LSDA 1LO2H 3BPCB 4B0MB 1AO7B 2CA4A 3FS9A 5I8CA 3CFCH 2BVUA 4ANKA 3K1KC 5T3ZE 4ZMLA 1QFWL 3BC9A 3K5RA 2LLNA 2FK9A 1LMKA 1D9KC 1DO5A 4NPJA 3EH5B 4JN1H 5CIPA 5ID1B 4HHAA 1J5IA 2L8AA 1CFTA 2B15A 1U93B 1JWMA 4ZNEA 1PG7X 4ZMOA 4YFLF 4XODA 2MIZA 4WGVB 3WD5H 2WQXA 1U0QA 1QR1A 3JTTB 2AMUA 1XF1A 1M4KA 1RZ8B 1R3IH 5FYLD 1IGYA 3N2JA 5KS9A 3T0DA 5KYNA 2A6KA 1YEFL 1KELL 1XGZA 1XZ0A 5JHDE 4C54A 3RFZA 3CC5B 3IRCA 1AO7A 1AG0A 2F9BT 2BIIA 3V6BR 2Q86B 3TS8A 3KYKL 2XDHA 4O02A 5M7QA 4XPGL 3DHJA 2Y07L 1GIGH 1N67A 1CQYA 1R3JA 2JI2A 3QISA 4JFED 1WD8A 4X6DB 3TV3H 1JXKA 2ADGA 5FUOL 3UBXG 3D25B 3VSUA 5CCKH 1KNOB 4PJCA 4EO5A 2OTUA 2VXVL 1F4YL 2EYTA 4R6UA 1A6AA 4M56A 2AXGA 5L88H 3UYRL 3U7AA 1LVEA 5LJYH 3HG4A 1H5BC 2I9TB 2AJUL 1YECL 2YUZA 3TEUA 4HU8A 3JTTA 3LEXB 2BLFA 3ZE1F 6FABH 1JHKL 2XQYA 1HJBC 5AW5B 1YPZA 5HHOB 3H42L 3OJVC 2DD8L 1GC1C 1W6WA 2GJ6A 3T0EB 5JNYA 3REVB 2WLIB 4AJYV 2QJDA 3TYGL 2ZF9A 3IN2A 3L9YA 3FT9A 2JJSC 5ANME 5TFSL 2CG9X 1MH5B 5AWNH 3DECA 5HHNA 2OLDA 3VXSE 3TF7C 1K5NA 4X6DA 3T08A 1NIBA 3ARYA 3U7WL 1E27B 3IDIB 1L7TH 2VRQA 3KLAA 5FHAL 3DX4A 4P23C 1G1OA 2AEPH 4Z8FL 1A7RH 1RJYA 3TBYA 4N8VB 1VGEH 4OCMC 4ZX4A 4JANA 3O6LL 1UD6A 3EGXA 3CHQA 4MTMA 3T3PE 2EIBA 3LEXA 3AY4A 2NQDA 3JYCA 4YBLC 2J1XA 4WV1B 4P5TA 4LSPH 4XCYB 2JTDA 1QWUA 1J0HA 1S7QA 1B2YA 3QDME 1RJLA 3MLTB 2HH0H 4JJ5A 4WCYH 2BIMA 4FQLL 3T5WA 1K72A 1RUML 4C57C 4APQB 5D4IA 4OZFG 2WXMA 2F5BL 1RL1A 2GBVA 3U6XS 4ERSH 5KVEL 3EG9A 4B5ZA 1B4LA 1SFHA 4AGMA 1GGCH 1E5UI 3EBHA 3GWJA 4U0QB 1LO5B 1LYQA 1FRGH 1OK8A 4X9FA 4HJEA 1M9SA 5I1EH 4XAKD 4Z7QE 2ZG3A 4UTBH 3GPEA 5IW1B 1MI5A 2NW3B 3JWOL 3MXVL 2DQUL 2EH8L 1C5BH 4PRPE 1PTZA 5ANHA 2Y22A 3HR5A 3QNXB 4X6FA 1JPFA 3V6ZA 3FB7B 4MA3B 2DLFL 3FU3A 1HHJA 5DRNB 4TUJB 1MJUH 1QSVA 1RZFL 2NXZD 5F0JB 4HUVA 3ARUA 4OCRL 4I77H 3MUJA 2ETWA 2B5IC 3EFFB 5EORL 4MXVE 5G4NA 1U8QB 1FNSH 1OB1B 3G04A 1ZRUA 2Z1KA 3C60C 4MDRA 3P0YL 4MBRA 4PRNA 5DMJB 4D8OA 1HQ4A 5T3ZH 1G9NH 3SDXB 4TQEL 3TJHC 3WAKA 2IGFH 1WZ1L 1PZCA 3N42B 3V7AE 3VI4E 4HOZA 1Z66A 1VJSA 4ZTEA 5L2KD 4UB0H 3ZLQC 1QA9B 2HFTA 5ALBH 4I5BA 2X28A 4X9HA 5DD6A 4PCYA 1P9MA 3D39B 1SPDA 4WI4A 3TWYA 1FC2D 1QUPA 5ERWB 4NQXB 2OMTA 4GSXA 2H6UA 5AOJA 2CUAA 1CD9B 1ZSDA 4J23A 4F3FB 4OD2A 1K5WA 3DPDA 1QSEB 1S7VA 3NCYP 3P54A 4QWWC 1OCZB 5GJSL 4Q14A 5F9JB 4MCYB 4OLVL 3FSVA 1IAIM 4IEFA 2NY6D 2JKXA 1BM3L 1SOKA 3M88A 4QHNB 3V9EA 1N9PA 1YMHB 2X40A 3RL2B 2VQTA 2WUBH 4DP2X 4FEIA 2W9EH 2R4RH 3GSNA 2BINA 3WDHA 1D5RA 1QRNA 2HFFB 4GIAA 4RRPG 2QFPA 5DRXB 1FGVL 1L7IL 4DAGH 5A40E 5A6MA 5JIQA 1AG6A 5J3HD 4M7KL 1S78C 3EGDB 4FXKC 1MCJA 5KW9L 2CWRA 4LSRL 4ATTA 4P2OC 3NOIA 5E2JA 1IGFL 3DC0A 3WBDA 2XC8A 3RTQB 3TV3L 4EDXB 1RK1A 3VWJA 3QO1A 2ARJA 3FQWA 1G7LA 4H5SA 4JFXA 3FH7A 2ED8A 1CXIA 1U8PA 5T5FH 3UTTA 1T1XA 2G5RA 4FLHA 2VLKE 5AB0A 1EFXB 3OKDB 3M17A 3FN3A 3FAWA 3EJRA 4HPOH 4FTDA 4QUOA 1QPKA 4U1SA 3TPUB 2L7JA 3A6BL 4BZ2A 4XP5H 5IHWA 4BKSC 4OLEA 4R3SB 1WPCA 3ESOA 5T1KB 2FLMA 2JJSA 1CFNA 2K45A 4YXHL 1J05B 1CIUA 4X6FB 3KWXA 5AZUA 3GS0A 4LRIC 1JCKA 2CCWA 2WWMC 3O0RL 1H5BB 4DOHE 5FKPB 4LSVL 1SOQA 3BZFA 5J9PB 5EIIG 2APSA 4AV0A 2FT7A 2R4SH 4UQCA 4WWKB 4E5XA 2JQAA 2IGTA 3CZEA 3MRDB 4R84A 1CDUA 1PJ9A 3EYVB 1U3NA 3IJ9A 4H5SB 4UBDD 5D1XC 4BZ1L 2G4GA 4XP4H 5AFAA 2YAMA 2B5IB 3LCYA 4OZFB 4WF7A 4LXFA 1L3NA 1VGEL 4BA0A 3IDNA 5DS8B 3HRZC 1MVFA 3IU3A 2CO6A 4PMEA 4Z0BL 3LB6D 2X1WL 4YDKL 2VLJE 1FG9C 3D87B 4DPRA 3L1OL 3M7FB 2DM2A 1IB5A 1UH4A 5AB2A 1JRHH 4JNXA 2JK5B 5I8EB 2W81C 5DQJA 4N8VG 4MAUH 1JZ3A 2KERA 5I71C 4YDMA 2WSDA 4QEGA 5IJCC 4KMTH 4LAJH 2DQGH 4FG6D 3BZFB 5J9PA 2VDLH 2WXKA 1XCQB 5ESVA 1XGYH 4OH2A 5DLLA 1ULVA 1X6LA 4GIPD 1E2VA 1K4CA 1T1WB 1BPVA 5FO9B 1S4IA 3RI5K 4IGBA 3H9SA 2C9PA 4Z3TA 5C0CD 7FABL 1NOLA 1WA0X 4HGKC 4LCWD 1CD1B 3ZO9A 1HSAB 2KQNA 4Z7WF 3WXVH 4ZUWB 4G7YH 4S1DD 4TQPA 1Q72H 4PJXF 5FFOA 4GBXD 4NQED 1HKLL 3F05A 1J8HE 1DQIA 3CNKA 5CN3A 2J6WA 3TN0A 4D9QD 2X05A 4ALAC 5KVGL 1J1OL 4ZD3H 3NDYE 2PWEA 1P5UA 5LAPA 1FNSL 1A5FH 3CUPA 3GMRB 3ARGD 4M6MH 2CDFB 3AACA 4Q4IA 4IRZH 3QPXH 4UIKL 5ESQA 3O6KL 5JIDA 4KNSA 1PLBA 5F97E 3TBVA 2Z31A 4TQEH 4LCUB 1TOXA 1EJOH 4WI3A 4XB7A 3VJ6A 3NRQA 4A2FA 1YRKA 2D0GA 3FT4A 4JMNA 1F6AA 5FO9A 3VD1A 4OF6A 1IIKA 2JQMA 1M6OB 4IGBB 3LNFA 4WNSA 4X98B 1S7XB 3ARXA 3FT3A 2VH5H 4Y19B 1HSAA 5DXWA 3UTSE 3PFUA 1ML0A 1BDYA 2YD4A 1CFSB 5JPNA 3DURA 4FXKA 1T2JA 5I6PA 3UTPD 3ZVVA 3H55A 4PJ7E 3QZNA 5CR1A 1TVBA 1IFHL 3CBRA 4MASA 3GLEA 3RJDA 2QHRH 3SYOA 2XQBL 2PWGA 2QR0A 3UTTE 2XN0A 3LH2L 4CU6A 1WEJH 3HC2A 4J28A 3KLDA 3ZZ1A 1HXMB 3VFGL 4XX5A 3OGCA 2VMFA 1IGFH 5D4JA 2OSXA 1A6WH 4H88L 2F2HA 1OALA 1AVAA 4AGLA 1ZVHA 3QJHA 3U9UB 2WANA 3SDCD 1O9WA 4KUCD 3ARFD 2ZCLH 2EE3A 3THML 5D8JH 3V5KB 3BO8B 2BSTA 3T2NL 1KDIA 4X8XA 2D7OA 4PJCF 4FNLH 3PYCA 3ULUE 1B2WH 3HG1E 4QKTA 4GMSL 4Y5VB 2E6PA 3NYKA 4RWYL 4OZGF 1IJ9A 3U2IA 1JTOA 3BGFC 1MUJA 4YMPA 5SWQB 1CT8B 1JK8A 2FZ3B 3BKYL 4HFUL 5E2WL 2FD6H 2MJWA 1OAXL 4JPWH 1J0JA 1FGNH 5CLWA 3Q8CA 1SY6L 3S97C 2VKWA 3LS5H 5K9QG 3RAJH 2DQTL 1JNHA 3QDJB 3U36A 1QTPA 4GKZA 1OARL 1PU0A 2OL3H 5HYFA 1MCHA 4NNPH 4XBPA 5AYQA 4MD4A 1NCBH 2L4OA 4EUPH 3BYTA 1UZ6F 2AEQL 5ES4B 3CHXA 4PJHF 5D7JD 1IQDB 4NQQA 2Y9RT 3SYQA 5I17A 2HLAB 1BVNP 1DQML 1YSOA 2VXVH 3KPOA 3IGUA 1CXFA 1KCRH 4Z95L 1PLAA 5JA9A 4KY1L 2D4FA 2HTKD 4JPVH 3SQRA 1EHXA 2AJUH 3BRFA 1ETZA 5JPMB 1KIQB 1KB5B 1NLBL 2JQZA 4LCWA 5CUSH 5CJXA 1ZK5A 2ZX9A 1NGXA 4PQXA 5KBLA 5LXGH 4P46C 1ODUA 4PWIA 3L5IA 1AZZC 3C5JA 5FGBA 2ADYA 1JNHB 4MJ4A 1I8IA 1WF5A 3FONA 1X5YA 2GUOB 1JV5A 3I74A 4JFVA 4EI6A 3C6LD 4F33B 4M6OL 2BNQE 3LX9A 1OK0A 2WBJB 2FGWL 5GGVH 1C1EH 2AERT 1NBCA 4DGUA 2WBXA 2P5WB 1MIMH 3QEQB 4WDIA 4K3EH 4YDZA 4KXAA 3PWVA 4ZO9A 4BHUA 5HI3C 3U4BH 3U82B 1TFPA 4IBZA 2BNRA 4PJXB 3T6ZA 1HKLH 4QWWD 4ADIA 1JI1A 2PETA 2XN9E 5A2CA 3KAAA 3FTGA 3STLB 4MDJB 3UERA 5GS2H 1A4JB 3BE1L 4JFFA 5KS9E 2X4PB 1FUNA 3GFUA 5IHZB 2DJUA 2BNUA 3QC6X 5LWYL 3W39B 3B34A 4WI0B 1Z9NA 2Y7MA 4W9GC 2ZG1A 1JNJA 1TTRA 2X4SA 4NQVB 3ETTA 2EDNA 1CYWA 5DFTA 3ZOAA 5LG6A 4RGNE 2YARA 4LE8A 4UT6A 5FYJD 3F5WA 4ORGB 2X9YA 5GZOC 3PAYA 5B1CA 1DJHA 2VLLA 3LZRA 1OTTD 4XO9A 1NFDB 3QQ4B 4X9GA 4CSPA 1F4AA 1IM9B 2BIOA 5IB4B 4RQQA 3LNGA 1HHIA 2NXZC 4MYPA 1G9NC 4OGXH 5IJVB 3V9CA 3WNOA 2GSIB 3ZDYB 1RUKH 4M8VA 4OBSA 2RCSL 4OT1H 4W9JC 4IU2A 1DQVA 1BQLH 1R0AH 1JPTL 1FL3B 4I7ZC 1RUAL 4NRYA 4E41E 5L0QB 3HFML 3SN6N 1VFBB 4M5YH 2X1QA 4LVHB 2RR3A 1YEHL 3JBG7 1I82A 3GZOA 1NDGA 2ZAIA 2Z4QA 2GQHA 3HHRB 1SHXA 1S7UB 1YCSA 3MODL 2R2EA 5B8CC 1JVKA 3RFZB 1NJ9B 1AP2A 2IG2L 5KSAC 3LOWA 1WAPA 1JFHA 4K94C 1CGWA 1KJMA 5D6DA 1MWAB 4WEMB 3MA7B 4QNPF 2X4QB 1WE5A 1R3JB 3Q8EA 1JD7A 4Y7MA 2OXHA 4WUUA 1MF2H 3U4AA 2AABL 1WT5C 2OR9H 1NCAH 3D25A 3EO1A 1A6VH 3ULVC 4TLUA 3HG0A 5JYLA 2ZTBA 4O02L 1PZAA 1E9OB 5AVZB 2AXGB 4JN2B 3MJWA 5EO1B 4YN3A 43CAA 3O9WD 1HKFA 2MQ3A 3N06B 2FIKA 3CV5A 1MCWM 5IV2A 4P4RA 2IPUG 2P46B 3JTSB 1OAYL 1C5DB 1ZHLB 3GMLA 6PAZA 3BD3A 1QBLH 2GJ6B 3B3BA 2HA1A 4Y19D 1Z1WA 1L9RA 1CE1H 3EF7A 5LDUA 1LNUA 1KN2L 1RH8A 2C8NA 2YRPA 2EDEA 1XH3B 5HYSG 5HHNB 1AHMA 2BC4B 1IGTA 3C87A 3L6FA 4ZDHA 4JKNA 4IMKA 1SJXA 1C5CL 3C6LA 3LKSB 2PW1A 4LLQB 1JE6A 1L9NA 3HPLA 4GYBA 1CICC 3D39E 3BI9X 2R29H 3HB3C 3U2SB 2O93L 4I48A 4M4RB 2OXGB 1KYOJ 1WZLA 1ORQB 3EZ8A 4M5ZH 2F7OA 3TEXA 3V4PH 2YZ8A 2A4EA 4QRQA 3BD4A 3VAEA 2OSWA 1KB9J 1H3XA 4BM7A 4V2CB 5DJYB 3GRBA 5CLZA 4K5MA 1TZIB 2ZKHL 1MJ8L 4JJ5B 1LNUB 4GP4B 5E8EA 3FTZA 5DLML 1G87A 2YQ2A 4H2AA 3I50L 5DO8A 3PGDA 5J12B 5E5MA 5MEQB 4WEEA 2NXZB 4HCIA 43C9B 4K5LA 5LDSA 1D5MB 2YQ3A 2ZUXA 3LKSA 4NUGL 2DN7A 1U2YA 5E8OB 1FPTH 1MIML 2VIRA 1EMTL 3UJIH 4KKZA 3QNFA 4OIFA 1NWPA 1RIHH 1WAAF 2OXGA 4DERA 2NUPB 1XMWA 5B22A 4YDLB 5HP5A 5G5DA 1EGJA 1QNZL 5AWNL 3IF1B 1IILE 4NBYB 5F0MB 4G6FD 1NLDL 3RQ3A 1JZ2A 2NDFA 2DZEA 4PJFA 2YD6A 3G08B 2IJ0C 4PGZA 2IANB 1UC6A 4JFDD 5SWSB 2J8UA 4BWWA 4OCXH 4N0UE 1A7RL 1SFDA 2YJQA 1KGUA 5EZPA 4DGIH 1MCRA 3Q6GH 3DX0A 2EXSA 5DFAA 2JJWA 3BP7B 3MREB 2BFVL 2JE8A 1G0YR 3BZEA 2H9GB 1JF1B 4I89A 3OB8A 4X6CE 1ZTXL 3DX8B 3GSWA 4JZNA 4PJ7A 3L08A 1J7VR 3C75A 4PJBB 2BRRL 1DZBA 1P1ZA 5JIMA 3O3UN 4M61A 5I1KH 5KG9A 3MR9A 1JHTB 5AG8A 4OFQA 1AS7A 1AIZA 1Z3GL 1BWWA 3QI9C 4N90E 4U4IA 4U1LB 4QRPD 4PJFB 2EIKB 1YY9D 3SYAA 3WS3B 2ZJSH 2VR3A 4HETA 3B1UA 3MZGB 1BVZA 4MSWB 2EDKA 3KVDD 3RL2A 4DVRH 2XIIA 4RISL 3DX3A 5C0NC 3GMQA 4NSKB 1R33A 3N04A 3D09A 3EGDA 2SODB 2DAVA 3BEVA 4OAWB 4YDVA 4N0CC 3S96B 1ORSB 1LL1A 1ZEAL 3BGFB 4A55A 5E24E 3JV4B 2AJVL 3T0XA 4BDVB 2KT6A 1A6VL 1TQCC 5HJBA 2QGDA 2CKBB 3PY9A 4U1HA 2QTEA 1U8PB 1RVFL 3B7RL 4OGAD 3BUYB 3V52L 1ZLWH 1A3QA 1T21A 4MQXC 3VI4A 1G9NL 3U0PA 4BE5A 3WS3A 2J5LC 5E03A 3ABZA 1AANA 1MEXL 2EXYC 2QADD 1PIFA 2IH1B 1KPVA 3L4UA 2WVUA 3WNPA 2IXQA 1U8HA 3BT2H 3CGTA 4GRWF 4JY6A 5L2KA 4V11A 4R3SA 3CPUA 3N0AA 1BQSA 2BVPA 1J05A 4M00A 5CGTA 1MG2C 1MWAH 1MRCH 4P2OB 4KKBC 1HZKA 1T0NB 4W9HC 1CK0L 1I3UA 4ZOBA 4N87A 5CSZB 5AZEL 2V17H 4A38A 3HHMA 5J6HB 3F00A 4WWKA 3JV4A 4YHZL 1WFMA 4RGOL 4HP5A 5CEZH 5ILTH 1DUZA 2VT0A 5GRXG 2R69L 1UWXK 4YHYC 2FB4H 2AQSA 1MAJA 5E94A 3LEVL 5I75B 1X5HA 1MW1A 5D71H 4XAWL 1C7SA 2K3HA 3RDTC 2VDNL 1HHGA 1J8HA 3P3UA 2Y72A 4LCYB 3BMWA 1EDYA 3MJ9A 3E38A 4GI9A 1VFAA 3LN9A 5DGQA 4QHMA 4JY6B 4AYFA 4N6RA 5H35B 1DQLL 5EHFA 1E3FA 4J6RH 3QRBA 2CHDA 1P4IH 3RKDD 2H45A 2DWTA 3WY3A 5LBSH 4X4MA 1EERB 4L4VD 4MNQD 2DMKA 5F6HJ 2B2XH 4LBAA 3QFDA 3EH2A 1U36A 2R2HA 4FFYH 4KRPC 1CFVH 2O26U 4QO1A 1FF5A 1ZGLM 3WTYA 3F7KA 4E9WA 1B0WA 5C0IA 5HDBE 5E0QA 1PLCA 1J9SA 4HWEH 2VWEC 3H9SB 2YIHA 1YYLH 1QSFD 2E6QA 4FFVC 3W3BA 2NY7L 3KPPA 3AQXA 1XIWD 4JRYE 4P8QA 4XX1G 4YHMH 3VH8G 4BQBA 1ECYA 3KHOA 4G80B 1NZRA 4JFWA 3QI9A 1G7PB 3W0WD 3G5VB 1KCSL 2G2RB 3I9PA 3UIYA 1KBVA 5CJQH 1SJHA 2ZQKA 1OF2B 5IB5B 3CUPB 3CQFA 3PJLA 4PWFA 2VSKB 2WQAA 3KXFB 1V3KA 3PGFL 1KF9B 4LBEB 5DHXB 4QO1B 5C9JA 2G4EA 2J72A 4LHUD 4XO3A 5GGQH 1NCOA 2XWTB 3IDXH 1ZLEA 4ABQA 4WKXA 5L6YH 4NN7B 2G60H 3EDFA 3GSNL 2ZUQB 4X5WB 3VXRA 5ISZB 3NESA 2HFGH 4ENEC 3X14B 5CU9A 1G4MA 1S6NA 4JZOB 1BBDL 5JZ7C 1T4WA 2MPVA 4P2RB 3MO1B 4YVUA 2DQCH 5AVQB 2EEBA 2XU9A 4QLRA 4B9IA 3BCDA 1S9XA 1LE5B 1MREL 3CH1B 4R97C 5EV7A 1D9KA 1EAJA 5EOCL 2J4WL 1A6UH 3A23A 3QWOB 2PCXA 4YLBA 1E0OB 2BOCB 4RISH 1PDKA 5IJKC 5I1CH 3T8XB 4NPYB 4Y5YA 3L5JA 4AEIH 3ZDXB 1LDPL 5IFAH 5MENE 4HOXA 1OAQH 3HKZA 4XO4A 4M02A 2AV1A 3DTXA 2XXCB 4Q97A 3ATAA 3F7VB 1R19A 5BJTB 1DDHB 3OWRA 4O5LL 1E4XH 1DJZA 2EECA 4HDIB 3RIAF 5ITFA 3QJHB 3QIUC 3VTMA 2HKFH 3V9FA 2HH0L 4JFSA 3EBGA 3G5ZB 3BO8A 5D2LE 1RI8A 1PZ5B 4UTAL 1W8OA 1M1SA 3KL3A 2DICA 1W72L 3POCA 1CVSC 1YEIL 3UZVA 1P9MC 2PPDA 4LCWE 4UT7L 2VW7A 1RUAH 3OHXC 2YD3A 1G43A 3ECVA 3P3YA 5E70A 3WEAA 3WDIA 3AZUA 1IZJA 4JHWL 2VM3A 4AITA 2VLME 3WOVA 4QJ4B 5FGCE 1A0QL 5EULV 2XKSA 2BNQD 1UM6H 3BKMH 1I7TA 3U36B 3QCTL 3F7VA 2V17L 3KG5A 3BQUB 4F7KA 3KPQB 1AKJB 3AUWB 1RZFH 4PGBA 4QY8A 1F3DJ 5E8NB 3VFPB 1TJXA 2BSED 5B39G 3TFBA 3SB3A 3OMAB 4C56A 4JG1L 4PJDF 3HBGA 1RHHB 1QHQA 5F44A 1C7TA 1U8LA 1ZANL 1N59B 4W81A 1K2DB 2FSEB 5GJTH 2DYPD 1ZIAA 3H3PL 4MJHA 5KYYB 1EK3A 3SO5A 1NAML 1QVOA 4LLMA 2HLEB 4KJQC 3QO0B 4EN3C 4J2XA 1UB6B 1RMFL 3DBXB 5K93A 2D3JA 3JUYA 4PVNA 3IJHB 2C7FA 4YWGH 2VL5A 4JM4L 2A99A