1ZDSA

Crystal structure of met150gly afnir with acetamide bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGGNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title A rearranging ligand enables allosteric control of catalytic activity in copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 87
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA02
1JZJA 1KCBA 4HZ1A 4G7QB 3D12B 4L0PB 3GYRA 1AOZA 1L9TA 3ABLB 2GHZA 5FC9A 1WS7A 3FU8A 2BHFA 1GSKA 4KNSA 1E65A 2XX1A 3FPYA 3FSAA 3CDZA 2IDSA 3NJNA 2FJSA 3TBBA 4YSUA 4BK5C 1GS7A 2UXGA 1XB3A 3L45A 2PCFA 2YAMA 4FAAB 2J55A 1ETJA 1GY2A 3QJUB 3OMIB 3T6XA 3TU6A 1QNIA 2FT6A 4KOBA 2J56A 2IDUA 4AI7A 3H4FA 2IWKA 5I6LA 4GYBA 2Y1AA 4YSOA 3V9EA 1ADWA 2BO0A 2BWDA 3AY2A 1SFDA 3IBOA 4BXSV 1EZLA 3X1BA 4HCIA 3DKHA 3NJIA 3EF4A 2NRDA 5AZUA 1BYPA 2BZCA 1ILSA 1ET5A 2W8CA 2YXVA 1A8ZA 2CALA 1ZIBA 2QPDB 2W88A 2QPEB 4DP7X 4TXVB 1XB6A 4BDVB 1XMEB 4YSPA 2IAAC 3MBWB 3IN0A 3T6ZA 2MRYA 4YSQA 1F56A 1GR7A 2IDTA 1L9PA 3ABMB 2ZWNA 2I7SA 2ZONA 2YAHA 2FTAA 4QKTA 2XVBA 4P5SA 1E67A 1MG3C 2UX6A 1JZIA 3ZBMA 5LDUA 1A4AA 1KDIA 1OF0A 1TKWA 3CVDA 3PLYA 3FU9A 1IKOP 1PLBA 3CVCA 1ZIAA 3SBQA 1ID2A 1JZEA 4AKPA 3NJFA 2P80A 1KBWA 5I26A 2DWTA 1NTDA 5D4IA 3S3CB 3FSVA 3EH4B 1J5CA 4G71B 3FQYA 3PAZA 1JZHA 3EH3B 3X1EA 1AZBA 3AG2B 5B1BB 4UAHA 1BEXA 4G7SB 1SJMA 3ZX1A 1NZRA 9PCYA 1J9QA 1IBZA 2VN3A 3NT0A 1A3ZA 3HB3B 1M9WA 1PNCA 1J9TA 1IBYA 3AG1B 4HALA 1WA0X 3OM3B 1MG2C 2VW7A 4HAKA 4DP4X 1A4BA 1AS8A 3OQRA 2IH9A 1N70A 1NIBA 3NSCA 1J9RA 2I85A 3SQRA 3NYKA 2EIJB 2HX7A 1ASPA 2FNWA 2E86A 3X2QB 1MDAA 1QLEB 1OV8A 2CBPA 4Q8BA 4KO6A 2PP9A 3GDCA 3FU7B 1PLAA 1ASOA 1PMYA 2B08A 2A3TA 4JHVA 1RCYA 1NPNA 1PY0A 3WNIA 1AG0A 1AZUA 4YVNA 2JXMA 1ET8A 1SDDB 2HZHA 4HCFA 1CYWA 5B1JA 1B3IA 1V55B 2H3XC 2YXWA 4F7KA 3QJVB 1ZPUA 1E5ZA 1WA2X 2AFNA 1NWOA 4A2FA 1BXVA 2BWIA 1NIFA 2BW4A 1SF5A 1SF3A 2HRGA 2YARA 2VW4A 4AKQA 5F7AA 2DWSA 3QJRB 4YSEA 1V54B 4A2GA 4BDVA 4E9SA 3PAUA 1PAZA 4KNUA 3HEIB 2B3IA 3ABKB 4E9TA 4G7RB 4Q89A 1HFUA 1ASQA 1FA4A 5B3SB 2VM4A 2ZOOA 4N4YB 4GP8B 1NIEA 3AG4B 4AZUA 1SHXA 1AZCA 2EIKB 1OE3A 4KOCA 4BXVA 1BQRA 4PCYA 2Y69B 3UAEA 3CG8A 4A2EA 5B7FA 3FQ2A 1KCWA 2GBAA 3IEAA 4NB7A 4DPAX 3ERXA 2YAEA 3TA4D 1JXGA 1CC3A 1PLCA 2CUAA 4M3HA 5I5MA 1RZQA 8PAZA 1KV7A 1W8EA 2J57A 4DP2X 2ZXWB 3KW7A 4CSPA 2HRHA 1JXFA 1T5KA 2GC4C 4KO9A 4YSDA 2FQEA 3PCYA 3NSDA 1KYAA 4NERA 3KW8A 3DIVA 5D4HA 5TK4A 2RACA 4N8UA 4YVUA 2UX7A 1ET7A 1IC0A 1JXDA 1VLXA 4JKNA 5EHFA 3ZIYA 3IN2A 3ASOB 2HLEB 2BZ7A 2YAQA 3FS9A 5TK2A 2PPFA 2XV2A 2PCYA 1SHWA 3NSYA 1JZFA 2PLTA 5B7MA 5I6MA 1CURA 3DTUB 4RH4A 4GY4A 1GS8A 2VW6A 3CZUB 4UANA 3WNJA 1BXUA 4YSRA 5I5IA 3FU7A 3MX0B 1AQ8A 2FQDA 1PZCA 1NINA 2GIMA 3NJHA 4DP8X 2Q5BA 2XV0A 2UXTA 2PPCA 1AAJA 4YSCA 3NJMA 5B7EA 4F2EA 2VMJA 4E9VA 5B1AB 4A2HA 2OCCB 2BP8B 3C75A 1AANA 3UGEA 3PXLA 3JTBA 2R7EB 2XX0A 2XV3A 3U25A 4GP4B 2DYSB 2XYBA 3OMNB 5I6NA 2FQFA 5IY5B 2AZAA 2DV6A 2DY2A 5B1KA 2EILB 2OV0A 2IH8A 3QJTB 3X1GA 2TSBA 4KO7A 4P5RA 2GI0A 1NWPA 2CJ3A 3UACA 2BP0B 4W1TA 1WA1X 1W6LA 7PCYA 5AKRA 1FFTB 1R1CA 2XXFA 2IDFA 2MTAA 1QHQA 2N0MA 1A65A 2H5UA 1L9SA 2YAFA 2TSAA 1GYCA 1GW0A 3GXUB 3CVBA 3EH5B 2CCWA 1L9RA 1GY1A 1NICA 4YL4A 2XUWA 4NAJA 1SNRA 1DYZA 4ENZA 3FT0A 3ASNB 4DP5X 3QQXA 3T71A 4KO5A 2OJ1A 4DP1X 2HX9A 2XLLA 3EHBB 1AR1B 4E9XA 1PNDA 1JVLA 2PP8A 4AX3A 4GP5B 3T9WA 1BAWA 3OMAB 4HHWA 3QJQB 4HHGA 3H4HA 4DPCX 3NJJA 3NP4A 2GB2A 4F2FA 1IUZA 2XU9A 1OCZB 3ZDWA 1NDTA 2WSDA 2AANA 5ANHA 4JHUA 4G72B 3S3DB 4E9YA 1AG6A 3FQ1A 3FSZA 4HCGA 4YSTA 1ILUA 1X9RA 3WKQA 3OD3A 3IE9A 2PPEA 2PPDA 1ZV2A 2HX8A 1L9QA 2WO3B 2VM3A 4DP9X 1RKRA 1ZDQA 2VSMB 3WKPA 1M56B 1MZZA 4AKOA 5E9NA 3FYEB 3PAVA 3T6VA 3UABA 1A4CA 1N68A 1PZAA 3G5WA 4WTQA 1X9UA 5PAZA 5D4JA 3NSFA 5I5JA 1BXAA 1JVOA 1J5DA 3WIAA 1URIA 2UXVA 2AZUA 1JERA 2Q9OA 2BP8A 1AS7A 4CSZA 3V9CA 2R7EA 1NIDA 1NPJA 1TEGA 1SFHA 2X88A 5I28A 3BQVA 1I53A 3AW5A 2QT6A 4HIPA 4BWWA 2XWZA 1TU2A 1TEFA 1PCSA 3X1FA 1AS6A 1OCRB 5I6OA 2GSMB 1JZGA 1OCCB 2BP0A 4UF7C 4GXFA 3N2JA 1OCOB 2FQGA 1MZYA 1OOWA 4FA7B 4PAZA 2GC7C 2CAKA 3UADA 3AZUA 3CDZB 4A66A 3AG3B 1E5YA 3PPSA 1CUOA 3NP3A 3QPKA 4DP0X 1AZRA 4E9RA 1SDDA 4DP6X 3TBCA 3UAAA 2IDQA 3BVDB 3SBPA 2QDWA 3QJSB 1KGYE 1ZDSA 1WS8A 3T6WA 2UXFA 3FYIB 4A2DA 1YLBB 3JT2A 5I6PA 3H56A 3RYMA 1BQKA 2EINB 2WO2B 5B1JC 4W9ZA 4A68A 2I7OA 1BQ5A 2BW5A 3S8FB 2P80D 2PPAA 1AZNA 1FWXA 4G70B 3X1NA 1AACA 1PF3A 3NJLA 1NIAA 3FPXA 4YSSA 4X4KA 1BYOA 4QLWA 1OE2A 4MFHA 4K9JA 3TASA 2IWEA 1AIZA 1OE1A 2LLNA 5PCYA 5F7BA 3S3BB 2X87A 1KDJA 1W6WA 6PCYA 6PAZA 1PZBA 2QDVA 1DZ0A 2YAOA 4A67A 2FT8A 5A7EA 2IWFA 4ZK8A 1J9SA 1KBVA 2PP7A 4YSAA 1HAWA 2DYRB 3NJGA 4DPBX 1XB8A 2YAPA 2JFCA 1CYXA 2H47C 2VSKB 4M4RB 1RZPA 2FT7A 3SBRA 3WI9A 2EIMB 1EHKB 1WAEA 2XXGA 4WKXA 1GS6X 1L9OA 2FWLB 2YQBA 7PAZA 2JKWA 4E9QA 2J5WA 5AFAA 4EF3A 3NJKA 3FSWA 4BWUA 3WG7B 2HXAA 1HAUA 1V10A 4KNTA 2AVFA 1UATA 3N55A 4BWTA 1E30A 5I6KA 1JOIA 1M57B 3ABGA 4E9WA 3S8GB
chains in the Genus database with same CATH superfamily
4HZ1A 2R1WB 4ZFFA 1AOZA 3HS0B 1V7MH 1HE7A 2NDFA 3DUSB 3S36H 2FJGB 2ODHA 3J27A 1NC4A 1NGZB 5DI8B 4GI8A 4XTRD 4J3WA 1BLIA 4MMYA 4PB9L 1X6NA 3FCTB 2YZ8A 2QR0B 2GJ6E 4X7DC 1QSFE 1QW9A 1NCCL 3FCGA 2EDYA 3CZGA 5DZVA 1K5NA 2PWEA 3A4FA 1G4MA 1TETH 5I6LA 5KSAA 4JY5H 3QDJE 4UTAL 1ITCA 4BD4A 4AG4H 3IFOB 4QRSB 1BVKA 2P9RA 3NGBC 4C56A 1Q9LA 4X6EA 1OAKH 2B0SL 1XIWA 2EC9U 4HXAL 2XPZA 4W9HC 1U6AL 1VCAA 3FU6A 3LZOA 3SQBA 4HCIA 2ADIB 4MNGE 3OMZA 4QHUA 4FNLH 4A7VA 3ZTNL 3BP5B 3WO4C 3HCVB 3DBXB 2O26U 4FZEH 3CXHJ 3OXRA 5AUMB 4BFNA 1NKGA 5I1HL 1N0LB 1MWAL 5KJ7E 3V4PL 4J7RA 4L37A 3MCYA 4KMQA 1XB6A 3L5WB 3V5DA 4UBDD 3C60D 1Q1PA 1BIIB 1XMEB 2G9HB 2XA8H 3FT4B 4YXHL 1EFXD 3TN0D 2NW2B 2QPSA 1DUZA 4GQRA 4IHOA 1CL7L 2I7SA 3V0HA 2R4SH 3HC4H 4YFLF 2X89A 3T0WA 4CC1A 3N44B 4X7FC 3ZBMA 4PJHB 2AMUA 3FTXA 4ZSOA 3WFEH 1UWFA 3KLAB 4K7PH 5ETUB 4DEUA 4FFZA 3D52A 3G5YA 4H2CA 1OLZA 4EKJA 1ZK9A 5I71B 2F7RA 1W72H 2VR8A 3D8MA 3VXQA 3WHE0 3ZE1F 3R4DA 5IMLB 1CLCA 1KBWA 2H6PA 1NUGA 4QXGH 4YDVA 1NTDA 3UDWC 4HYTB 1NFIB 4X8JA 5GZOC 1CD0A 2BIHA 5GRVL 4AVHA 5BO1L 3VYPA 3TM6A 1JNLH 3FQYA 4BH7B 1I1FB 4OI9A 1OZTG 4KK5C 3EG9B 2WBJC 3UPRB 2HFFA 3BEVA 4L18A 3QJXA 3OZ9L 5GRJL 4YNYB 5IVXB 5JDSA 4EIZC 1FUNA 1ZT7A 2BNUA 4G2AA 4FFYL 4L5FL 4L1LA 5DFVD 3GBNL 5C07B 1OPGL 5GS0L 2NX5D 4TUUA 5C08D 3U7AA 4HALA 2IAMA 2C1OB 1IGTB 1UQSB 1OB1A 3F7KA 2V5SA 3EFDH 3RL2B 1Y1UA 4XRCB 3NSCA 4DQAA 1KN4L 3Q2VA 1OT1A 2EIJB 1GYWA 4OGYH 3H54A 4WUKL 5BW7A 4ANUA 1CFSB 2L0DA 2F58L 1E9QB 1JSYA 1HHJA 3GDCA 4KO6A 1NBYB 3QDMA 3JYBA 5JW4N 2MEJB 2X6MA 3NIFB 4U1LB 4R0LA 2ZCHL 2NY7L 4WWID 1B4JL 2N7AA 3E9UA 2EC9T 4G43A 4PGEB 4ZMLA 1ETB1 5B1JA 1NCWH 3AM8A 1JRHL 3BH4A 4MZIA 3GZKA 1KLUA 1T4KA 4EUPG 1LL1A 1WA2X 2WQXA 5CINH 4ZS6D 3SDCC 2Y2TA 5E8OA 1BQUA 1QSZA 4WI9A 1ZMYA 2YARA 1SXBA 3RWJB 3KL0A 3VD4A 3B5HA 3WO4B 5F7AA 3DPBB 1D5MB 5L8LB 3EH2A 1NCDH 2GJZB 3QAQA 4GINA 5IT2H 4PJ5E 2B1AH 1SBSL 4WSKA 5KEZA 5KAQF 4BZ1L 1T1XA 4XR8C 4Z0XA 3KYNA 2VM4A 3VG0H 3OR7B 1E7VA 5LN4A 4RLDA 1B90A 3FU5A 4X9FA 4ZX6A 1SHSA 1TJGH 4I3GA 4WTWA 2IALA 4WCYH 3D2UD 2AJVH 4QJ3B 5HI3D 3U2IA 1I1RA 2YJQA 5I15H 1LO4H 5T1DH 5B7FA 4J3OD 4ZS7H 4U0QB 6FABL 4WJG3 3B2XA 4P5MB 4EBQL 3T0EC 2C9UA 2VL5A 1B2WH 1N5YH 5C0AE 1FVCB 1U91A 1W8EA 4LL1A 2XQYK 1U8OB 4CSPA 3ECBA 3V6OC 4F37F 2JQMA 5CKGA 1GGTA 2VLLA 4FQ2L 3RIAK 2H32H 3TV3L 3W5NA 1GW6A 2J1YA 3WFHA 4LF3A 2AJUH 2B1HL 1YEDA 2OXHB 2H26B 2WAHA 3ARBA 4LP4A 4HUVB 5BZXA 3SKMA 3L1OL 3JWOC 3O0LA 5AVSB 3UTPD 4JQIH 4PTUB 2YMTA 2WWKO 1MQKH 3MRIB 4RH4A 2KDYA 4PRHB 1E8WA 3EBHA 12E8L 1QABA 4MJ4A 5C0CD 4MSWA 4PJIA 1KXQE 1ITBB 4J6IA 4XVJL 2UXTA 1NFKA 2W1NA 2X2YA 4HLJA 5I24A 3T3MF 3VFMA 4XH2B 1F58H 2H0EA 2X9ZA 1E6OL 1SJEA 2O5ZH 2QTEA 4RMUA 3DURA 2XV3A 1A14L 4ZUTB 1TVBA 3LQZB 1T7WA 1X3DA 1CGVA 2Y72A 4AH2B 1GL4B 1KPRA 1HYSD 1A7PL 4FQXC 5EZOL 1BPVA 1QRNE 1GVIA 3MBXL 4QHNB 2CJ3A 2I9TB 3ULVE 1A2YA 1T89A 4F7EA 2A73B 2XXFA 4GSDL 4B7IA 1UWGH 4F1ZA 1SMDA 3BDBA 3L6FA 1AJ7L 4FXGB 3EJYC 4MX7B 5SWSB 2DBJA 2DQUL 5FK9A 5ACZB 5HGHA 2RFXB 4UMGA 3TT3L 4ZO8A 1Q9KA 4HIQA 1NCBH 3ZQXA 3VDBA 5FGBA 1L9RA 3RVXC 1HXMB 3VD0A 4JKPH 5EUKB 4RMTA 3AITA 3OG6B 1KB9K 3H9SD 2WSPA 4NKOB 3HKZA 5J11B 4HIIA 2R51A 1SPDA 3O2DA 4XP1H 4DP5X 1QBBA 4WO4D 4RAVA 4KO5A 4DERA 4E9XA 2WBXA 1FFPB 4UTBL 3WJJC 4YZFF 1HDMA 2W0FB 1HCZA 4PB9H 5GS0D 1SZNA 2XI9A 4MNHA 4LNVA 2J8UE 4GMTH 4XPHL 4G6KL 3CSGA 3EZ8A 2NNRA 2XHNA 1WEJH 2XU9A 4ZXBA 5DJXA 2PXYB 3N06B 3TO4D 3MODL 5HYJE 2Z1KA 1ULVA 1OXYA 1OAJA 4K5MA 3MRCA 3QEHB 3AMLA 2FO4B 2BY2A 4EQ2A 5DMGC 4UTAH 5IG7A 2F53D 7FABL 2VDNH 5JUEH 1C16B 4I5BB 3OD3A 5E8EA 4MMXB 2GJ6A 1H3XA 2B0SH 3UBHA 5KG9B 3QZMA 4UV7L 2ZXGA 3PWUA 4YR6B 5FYJL 2GSIB 1JNNH 4HPOL 1U6AH 5JOFA 3TF4A 1I1AA 2BZDA 4P5TC 1FGNH 4J1UA 3KMDA 3QUYB 3HPLB 2ICEA 3NTCL 5AKVA 5AYUH 3X3FH 5HDQH 1F8TL 5I1HH 2FBJL 4EOWL 1CFQA 3ARDA 3HLAB 4J3XA 4N2EA 4H8HA 3GNML 3N1QC 2H2SC 3RWHA 1KJ3L 1E6JL 3NK3A 4B96A 2YC1A 4PRPE 1IJNA 4MNGA 4BYHA 3DVFA 1JGDA 1NPJA 1PEZA 4JPQA 3B9EA 2KMWA 1VGKA 3B43A 3DXAD 4PD4K 32C2B 4ZO9A 2OTWB 4Y0GA 2GFBA 4PS8A 3MLRL 4QO1A 3PP4L 1T1ZB 4FDWA 5F89B 3IJ9A 2FIRT 4C4UA 2K6WA 4FQXB 4AYDC 4X4XA 1A6VL 3CFDB 4NM8H 4R96B 5SWQB 5GGUA 3MRJA 2O5NA 2Z1PA 2CAKA 3GBEA 3KYKH 2EKSB 4QGTA 3CDZB 4N2IA 1T21A 3HBQA 3M88A 3CFEB 1E4XH 2EYRA 3IJ7A 5ICXA 1MLBB 3FFCE 3MFGB 1QLRB 4WV1C 4N0FA 3CHQA 1BWWA 1U21A 2OTUB 4QXTA 3EOBA 3FUDA 3OZ9H 2IPUG 4IIQA 1OK8A 4EIUA 3QJSB 3SYQA 4HD5A 1BX2A 4LLDA 3HZYA 5DMKB 4WK0B 3P4OB 1OPGH 2MPVA 1CT8A 4WWKA 3IFPB 4ZTEA 2JIXA 3S8FB 2P80D 1JI2A 5I0VA 4POZC 3X1NA 3HJ0A 3ESPA 2DJSA 2CUMA 2XG4B 1KN4H 1NIAA 4XO9A 1QZNA 2DIAA 3LKNA 4XB8A 2FBRA 5CP3A 3SODB 3KPMB 5DS8B 2F58H 3RIKA 5DD0L 2IQAA 4GI6A 3EFFB 5IUCA 4RGND 2LLNA 5PCYA 4NJAL 3ZO9A 2FEEI 2F8OA 4L4TB 4N8VB 5ENWB 3BRDA 3KAAA 2ZCHH 1KJMA 1M1SA 3CPUA 3QWRD 4UQCA 1DVTA 1M7DB 4MDIA 5D1XD 4NKMA 3UYRH 5C0RH 3W3BA 4X7EC 1E90A 4NENA 4BEIA 5HGDB 3MLXL 5FF6B 1EAOA 4M1CD 3UP1A 5E2UL 4P5TB 1THCA 3JVFC 1MF2H 2CJTA 4P3CH 1ONQA 2BSED 4M7LH 2JJTC 1HTYA 5CP7A 1MCBA 2AABL 4LDLB 4NZJA 5EA0L 1YEEL 1FJ1B 3RLSA 5DURD 1HEHC 3DYMA 3KNBA 1FZMB 2P5WE 4OBSA 2ZOLB 3QI9A 4K3HA 2FE0A 3IMWA 3DJSA 3OZLA 3KLHD 4P2OA 4K71B 2LOEA 5DHXB 3EJQA 4B3VA 3DX4A 1IGJB 3MRMB 1M57B 1SOQA 5F7KC 3WJMA 3GBLA 4ONGL 4WU5A 4OF5A 4PJ5A 4LU5L 4QDGA 2DEWX 2HTLC 3WJLC 3APMA 2H1LM 2COVD 4ZQKB 1E65A 1NMCC 2E4TA 1RPUA 2E8YA 2DJ4A 3B9DA 2R0WL 5A2LH 2NX5B 3D05A 4HIEB 4NHCL 3S37H 4Z7OE 4UT9H 1EGJL 4NNYB 4RDQF 5JXAH 2UXGA 4WLCA 4PUBL 1MAKA 1NLDL 1GY2A 3F58H 3EGSA 3II1A 3HFMH 4XWOD 2YKKA 3H4FA 4ODSH 1W15A 3ARGD 4HWBH 3SDDD 3LD8C 4UQAA 3NIDE 1R3LA 1YNTB 2HG5B 2EUZA 3SBWC 1WZMA 1T0NA 5C0AA 4ALAH 4EI0A 5A43C 1DSFH 1MKFA 3TZVC 4ENEC 2AV1B 4ODHH 5FYKL 4EPSA 2Q10A 3QFJE 1CE6A 4GUPA 1PGRB 1NKRA 3E2HB 4ZT1A 4IMLB 3KLSA 2W8CA 4Z23A 5FYJD 1F3JA 4R4ND 1ZIBA 1HWWA 5D7LD 5GJSL 1IQDB 4L8BB 2C7FA 3QORB 3PPEA 1C5CH 2FO1A 2YEQA 1CXHA 2CLZB 1IKNC 5I82A 2BNRE 1GR7A 1PD6A 4Q56A 2EQDA 3Q2LA 2C34A 2PTUA 2VLJE 3P9WB 4APQA 3L5XL 4JHBA 1E6OH 2DZEA 3K2UH 4G6JH 1M7IA 2KHAA 3L3IA 2WY3B 2UX6A 3GSNL 3QJFB 4G8GD 4CC0A 3GGWA 1FC2D 1F1AA 1KXQA 2NZIA 4HS6B 4XO3A 3TBYA 5E8DL 3UTSA 1DJWA 4HJTA 1MVUB 3SBQA 1IGML 3QDGE 4G3YH 4N5EC 1ID2A 1JZEA 3MBXH 4KRMB 4QRPB 2J1WA 4LLMA 3CPLA 4V11A 5JHDB 3VXRA 1A3QA 2ENSA 1B6UA 4P23A 5IMOB 1K4DB 3FCSA 4GAJH 5HI4C 4M48L 4PRDA 2ZPKL 3OKKB 4GSDH 3BJ91 4GKNA 1JZHA 1HI6B 3L4XA 5C6PB 1N0XH 3HMXL 1S7XB 3BUTA 5BOPA 1NMBH 3IVKB 1I7RB 4NO0B 1EAPB 5KANG 2X10A 3CSPA 1QRNA 5TDPB 2VISA 2EE2A 1SJMA 3GMOA 1QVOA 3V95A 2WXPA 4B97A 4F8TA 3HI5L 2BNQB 4QKXB 2RH0A 3I3DA 4DGUA 5AAWC 4W9CC 3ABZA 5CZXD 3RVTD 3RA7L 1M05A 2IH9A 1PYWA 1BZ8A 5BZDB 3WIIH 4D3CH 3Q44A 2E86A 1MDAA 2KERA 1L0PA 2QVTA 4GQPH 1YDPB 2WYIA 3N42F 2XKNA 4FKEA 4XI5D 3R0MA 4FTVE 2V2TB 1SOKA 4UOQA 3BPCA 3MBED 4IRSC 1ZT4A 5IW1A 3WS6C 2AITA 5LXGL 3F5WB 4FXKB 5HYEA 4QI3A 4MRCA 4DN4L 4L8DA 4UI2A 4OV5A 5KBLA 1MJUL 1FO0H 1AXSB 1F4XL 1B0GB 1I8IB 1MWAB 3C6LD 5ACMA 4GPVA 3V4PB 5L0QC 4S1QL 4EN3D 4PWGA 1X7SA 2JQAA 4HPOH 3UDWA 5E1AA 3UYOD 5GZOA 1IAKA 1IGCH 4LNRA 1SF3A 3PL6A 3D39A 3JTTB 3KPOA 5E2VH 2NYYC 3QJRB 4H2AA 4MA3B 3B2PA 2F0CA 4M7JL 4PJEA 3R8QA 4EI5D 4DVBB 3UC2A 2EAEA 2XICA 3SPIA 3DRQA 5F0LB 2P46B 1HILB 2X4SB 3AREC 2CD0A 3KPSA 4G9FE 3EJUA 3I9PA 1XGQB 3SPCA 3VH8B 1JZ7A 5L4FA 2DEYX 3LKQA 4BXVA 1HL8A 4AJYV 1E3FA 4N2LA 2AXWA 3S5LA 5C0BA 1Z3GL 3ZN6A 4PRID 5EO0B 4PCKA 4PRPA 1ZRUA 3EO9L 4KK6C 5DQDH 3EYFA 4AGNA 4OU3A 1SJHA 4D8OA 3BZ4A 3ZYJA 2DLIA 1DVQA 2J57A 4LIQH 1ES0A 2Z31B 1YEKL 2F74A 1JGEB 4R84A 3O6LH 4KQ0A 1BM3H 3GFUA 1JHKL 1Q0YL 4KO9A 3QVAA 4PJXB 1KYFA 4W9DC 2HFEB 3WFDH 1RUQL 4CSSA 1X5FA 2GHWB 5D4HA 2RACA 2GTWA 4X80L 2OW7A 4BUGA 5I0WA 5EF2A 5FYJU 3H3PL 3TO4B 3SDCA 3MJ9A 5E08H 4K5PA 5DO2D 1EFQA 2QZQA 3NRFA 2JTYA 1TYEB 1IAOA 5L9DL 3SHSA 2JTDA 4OI7A 3BSHA 3FFCA 5BQDA 3SYCA 1RJZB 3DOSB 2VDPL 4ZW5A 1U8IB 5F7HA 1KTLA 1A1MA 2FEDD 5FYKD 4GKOA 3VFUB 1UOLA 1ADQA 3DX6B 3ESOA 2ZP0T 2UUDH 4ZX4A 3IDIA 2NYZA 1UA6H 4JL2A 3GJFB 4HMEA 5DD0H 4OFDA 4QYOB 1U30A 4BE6A 1I4FA 4KXDA 4NNXA 1AAJA 5GGTA 4ELKB 5DT1H 5KN5B 5ADPH 4HH8A 2KDGA 4WHCA 1NEUA 5L2KE 1OAYL 2EDBA 1RUAL 4HJ0D 4LPYA 2YO3A 3ZYOA 4QOKD 3BQUD 1DDHA 4AQZA 3T0EA 1QSED 4GIOA 3MV8E 1ZA6A 4JJHA 1KC5L 1JGVL 3Q2WA 3MRDA 3QFDB 1VKXB 3OJDB 1CXKA 5L0QB 5KBPA 2F1EA 4AQEB 2QVIA 3CFQA 3V6OA 3UAJD 5CCKH 3VJ6B 3MGOA 1NGYB 1CL7I 4IJ3C 4JNXA 4IRJD 3IM1A 2AK4D 5I5RA 2OJEB 5C2BH 4KMTH 5I1IL 3QIWB 1MHEA 1FVDA 1ZHNA 2AABH 4LBAA 4Y19B 1YEEH 1MCLA 5C0EB 4OLYL 2XWBB 3SKOB 5FEBA 4BZ2A 5KS9E 2CCWA 1NFDE 1MCWM 1BD2B 3LVTA 3EAKA 3D4GA 2AXGB 3T65B 3SY0B 4KHXL 3K72A 1CGXA 2YGPA 3O41A 5KSUA 4ONGH 3A22A 4A63A 3NFNA 2A4CA 1KFGA 4LU5H 3BHBB 3U1QA 1AE6H 3M1BB 2P5WA 3IKCA 3SCMB 5TE6L 4JFTA 2WNKA 2MHAA 5DQ9B 2G4GA 1JVLA 2WWOA 2Z9TA 4TQEH 3WIFB 1JIBA 3GSRA 4J27A 2IV8A 3BH8A 4A37A 4TSAH 4WFHD 5C0JA 3CK0L 4BZYA 4PUBH 4F8OA 4EO5A 2PW1B 5IB1B 2ENQA 5IGXH 1SM3H 1FAIL 2UUDK 4E9YA 3I75A 4KKAC 5A16A 4GRWE 5HDLA 5DD3H 4POYA 3RHWF 4I18C 2W07B 3FOLA 5KYYA 2XPGA 3IE9A 5HJBA 1U33A 1UJTA 2FX7L 5FYKH 4H25A 2HT3C 5D1XB 2VSMB 2RMNA 2ADGA 1CDJA 4AKOA 1PJ9A 2VLKE 1YMHB 1N68A 1PZAA 4E42A 4K5LA 4TVPL 2OMWB 2CSPA 3OKDB 2YRPA 1OD7A 1PVHA 4O9HH 1LO5A 3B2UC 5GJSH 1BXAA 2OSLA 2H45A 2X4UB 4L8CA 1JRHI 3VXTA 5JHAA 5HYQA 5H4YA 4LSQH 2APSA 2ZXAA 4DO6A 4J3BA 5J9PA 1NDMB 1BF2A 3R1GL 4F91B 2R4RH 2Q87A 4JFEE 1F2QA 3WJJA 3ARFC 4FG4A 3QXDA 4O2EB 3H9HA 5E8DH 4BM7A 2BP0A 1E50A 2TRYA 5BZZA 2BNRA 2HUHA 2H4EA 3MROA 5CM1A 1U8KA 2L3BA 2VLJA 4OFKA 1OM9A 1OW0C 3KLLA 4FCHA 4IJ3B 1FZKB 3M86A 3ZKMD 1KIQA 3AG3B 3GSUB 3OHXB 2WW8A 3RIFF 5KSVB 4NGHL 2PTTB 2YPVH 3MPCA 5D7IE 2F8XC 2NY3D 1QWNA 2B9BA 3L3OB 2QVKA 1X4XA 3GKWL 2O5YL 1DQQA 5KTEH 4WFFE 5GRUH 4F3FA 3VFWA 1S5HB 3FRPB 4PB0L 2BCKA 2BK8A 4JPKL 4LCYA 3GJEB 3SDDB 5I6PA 1BFOB 2X38A 3BVWA 4FNQA 3HI5H 3S88H 3BT2L 1TQUA 1FVEB 2J6EL 5DUMH 1I3RB 2NY0C 2I7OA 3JWNE 2DEXX 3LQAC 3LZQA 3V10A 3EDJA 2BERA 4KUCF 2CRIA 2FGWL 2VLRB 2ZWKA 3DV6B 1H3TA 2K3HA 3OGCB 2ITCB 4Q0XL 3RA7H 3RDJA 4H1LG 4M8UA 4L8SB 4EIBA 4QRFA 2IOOA 1ZSDA 3R06B 1TZ8A 3WEAA 1SOXA 2X9XA 3MV01 5ESQB 1ZVSA 2BOBA 2X40A 3TIDA 1S7WB 4LKCA 4N6RB 4NQDE 5CIPA 5DHEA 5EU3B 2LFGA 1AIZA 4M5ZL 4ZW6A 4NDMB 3BUIA 1FNEB 1TDQA 1DQVA 2WKGA 3FT9A 4KQ4L 1PIFA 3KXFE 1O6SA 1NCNA 1WAAE 3MCLH 4G7YL 2UZXA 4Y9FA 3TBWA 1VGEL 4I18B 1IGFL 4P46C 4HKJA 1AGDB 1BAFL 1UM6L 1LD9B 1F4XH 2XN9A 5HHOD 5ITFB 3RTQA 1KGXA 1JFHA 4S1QH 5DJCA 1OCWH 4KKNA 3NJGA 4S1SH 4N0UE 1MIEH 2OXGA 4G8GB 1PD0A 3O6KL 3RX8A 3MV9B 1IM3B 5DSCA 1S7RB 5T33H 1WIPA 3Q3GB 3IAPA 4LHUB 4WV1A 3ZLQC 1SRDA 3T08A 2QQNL 3FB6A 2X09A 2GPZA 2X3CA 4KRLB 3HAEB 2KC0A 2BH0A 1J12A 4NXSA 4GAGH 1LEIA 3K1KC 5C3IA 3P4LA 4EF3A 4BWUA 1S9WA 2UY7A 3NEEA 1V10A 1IIKA 4KNTA 2GITB 1DE4B 2PMZA 2DIJA 1J5HA 1AZZC 3CMOH 1J0HA 5I6KA 3WUWB 4E2OA 4Z8FL 1EXUB 1UB6B 3UL4A 5HGGS 2CCLA 2VDML 5D72H 2BSBA 5AOLA 2P8LA 3DDGA 3NFSL 3ARFB 2BSDA 1KIUA 3NFPB 3WKNA 4AGLA 5GGRA 4HC1H 4PPTA 1S3KH 2BHFA 5F72S 4KI1A 2EXYD 5FW8A 1PDKA 4BFEA 2HSIA 2DI8A 4FULA 3L4ZA 3TBBA 1QR1B 1N5AA 4YSUA 5LDSA 3ULVF 1YN7A 1BM7A 2E7HA 2D0HA 4Y4HA 3DETC 4BFRA 4OQTA 3QQ4A 4OD2A 3TU6A 2SEBB 1JHKH 3BVNB 5E4EC 2L8AA 2VDOH 5DRNB 5A2KH 4AWJC 4F92B 3CQFA 5MENB 3OKMB 5SX4I 2IWKA 3REVA 1VFBA 3GSVA 1RUQH 3TJEL 5BV7H 2J44A 4CL7A 1KF9B 4I4WA 1ZLEA 3BEWB 3HRZB 4HOZA 4KJYB 1TVDA 1C7SA 4KDTC 4LCWE 5F3HA 3GMMA 4XCNB 4X5XA 3IE4A 1KNOB 5I19H 1RSFA 4HOWA 3B7SA 3VFNA 4TUOA 3TX4A 2W88A 2QPDB 2J8UF 1LYQA 4UCFA 3PHAA 2J1KA 2YN5A 4D0CB 25C8H 3VXSB 1T20A 4X7TB 3GI8L 1A47A 2P5PA 5G5DB 4PJGE 4Z7NB 1DJIA 2CIIA 5D2NB 1XCQB 3U9PL 3GPEA 1JF1A 1U3HD 1A25A 1A6TA 2F5BL 3RAJL 1UT9A 2V6HA 4RETB 5FM4A 3WJLA 1JZ6A 3IMBA 1C8PA 1QTSA 2VNCA 4EUPA 2ICWA 3DHMA 3GRWL 4JFZH 5BJTB 3D4ZA 3HA0A 4WY7L 1I31A 2VDQB 1SY6H 1JGVH 2JJSA 3A6BL 4LVOB 4NO5B 5FCUL 5K9KB 3ZDXB 2CU9A 1INQA 3O9WD 2QQKL 5DC9B 3FB7A 5JNYB 4XN8A 4R5VA 1J8KA 2XA3A 3BCDA 4NRZB 4X6DA 5L2KA 1SXAA 3IT8D 3T6QC 1MI5B 2Z35B 2R2BA 4R2GD 4GRLC 5DK2B 4MJ2A 4HIHA 3MV8A 3MMEB 5CBAB 5IVNA 3JT0A 1SN2A 1J87A 3SBWA 4UAOB 3X1EA 4P2RA 3E9TA 2IANA 1W0VB 2FZ3B 2OYLA 4UNVA 3ARRA 3FUFA 3GEWB 1HYRC 1E2VA 1DBBH 5TFSH 3SDAC 3KH4A 3WAJA 5F1OB 3IWUA 2D7MA 1PNCA 1IBYA 4U7MA 3DHJA 2EEFA 3FO9A 1CXEA 3M1OA 3QUMH 1NFDA 1FH2A 3PGFL 5IREA 2HX7A 1ASPA 2EXWC 4DUVA 2CBPA 3GBML 2VZ1A 2VZOA 4PCTA 3UC0H 3WLBA 5D7HA 4U6HA 4TNVF 2JI1A 3O11B 2WZPD 3QW9A 2V7HB 3VGBA 4ZFGL 4FD0A 5E4EB 1F1DA 4PGCB 4ZFOB 3HHRB 5IB2A 1BQSA 1MY7A 2WQSA 1ET8A 4P9ML 3DO4A 2P24A 2V8LA 1CXIA 1PZSA 1TO4A 1BFSA 3QNZA 3KR3H 4YHLL 1WAPA 2V17H 4MNQE 3E6FA 1OOAA 4IU2B 3L7FA 1F11B 1KIPB 1F4AA 2DLHA 3B8SA 1GGUA 3OZKA 3GS4A 3EOTH 4U1KA 1U8LB 3ZMRA 4ELDA 1EZVY 4QHMA 5FO9B 1VFOA 3VFTB 3A24A 3GSNB 5D9SB 5FO7A 3CXFA 5I18H 3Q01A 1FA4A 1JDAA 3EDEA 3N1FC 5A40E 4IRJB 4Y5VB 4F37K 2XWXA 1A1OB 1M6OA 2JQZA 2F54B 4Y9CA 4XAWH 4N4YB 2VLKA 2YBRA 5AAWA 2BPBA 4X4ZA 1G9MC 2EIKB 3MR9B 3EYOA 4JM0A 1OE3A 1K6QL 1HXKA 4X9GA 5E8NA 3BUYB 4PG9B 5L7XL 2YD1A 1VEPA 1E4KC 3IJHA 5M95B 1XSKA 4ISVB 4JO8A 4RMWA 5D2LE 4K7FA 4AQ8A 3EGDB 1XDTT 4OCMC 3W9DA 4DWHA 1KT2B 3AMKA 1P6FA 4QHKI 1A5FH 5DJ6B 2BSRB 1RJCA 4JFEA 4GAFB 4JFPB 4IRSA 5TDNA 3BOVA 3BISA 2OMUB 4B9IA 3DMMC 5D93C 2D7TL 4QRRD 5JQIB 2AJYH 3L4UA 4PSRA 2WXFA 4WI4A 1JWUB 3CX5K 2ERJC 4OF6A 1BFVH 4FQHA 2ZYIA 4NUMA 3V6ZA 2GABA 2A74A 1DN0B 3ASOB 3GZOA 4JPKH 4NQCB 4XC1H 3RKDC 2ZD0A 5J0BA 3BT2H 4ZFZB 2J6EH 4D9LL 4CMHC 2PCYA 3L9BA 1XH3B 4LSVL 5D7IA 1N8ZB 3KWWB 2MNWA 5HHVL 3KYMA 3H2WA 4WW2C 1H6TA 4NBXB 4WEEA 5AB9A 3BO8B 3ZSTA 1X5ZA 4C54A 4Z7OF 2VE6B 1F90H 3AREA 3CXDH 4XP9L 2OZNA 4Q52A 3T4AB 4CJ1A 2VC2H 1DHKA 2ATPB 2DQFB 4JZOA 4M5ZH 3B2DC 2WP3T 1X7TA 2E6JA 2DWDB 3V0WH 4F7MA 1KPUB 3VFGL 3NIDF 1OY3B 5E95B 2BWQA 1MLCB 4G7YH 3QG7H 3QUXC 1T6WA 2A5UA 1YC8A 2DYSB 3X11A 3FAWA 1S8DB 2ZOKA 5B1KA 1QFUH 3V8CA 2DQCH 1A9VA 3C5ZC 1I8MA 3VRJB 4OLXH 1JPGA 1QFOA 3A23A 1WDAA 5CJQL 1YG9A 3NZHL 4OIFA 2G4EA 2W9EL 4MJ6B 1TUPA 3KXFA 3BIAX 3HE6C 4PVLA 1USZA 1WAAA 3LKRA 4W81A 3DVIA 3RWCA 5I30L 3PHOB 2QQNH 3GIZH 1QHQA 3ULUE 5G4NA 3GSOB 2IMNA 4PJ7E 4GAAA 3FTGA 1RXLA 2JELL 2Y7NA 4N0UA 4FQIL 4DW2L 3ELAT 1WUNT 2BHUA 2XUWA 3QHZH 2WINB 1IZJA 2NR6C 4NCC2 4Z8FH 1SNRA 3VFSB 4A2LA 2X2HA 4NQSA 3VTTA 2WLLA 3D87B 2YJLA 3QXAA 5D96B 4X42A 3DWTA 2EUXA 2WZ5A 3TNMB 1JNJA 1DEDA 1NC2A 2FJHA 4O51A 2P28B 3LIZA 4QTHB 3ROLB 5IB4A 4Z7UB 1HCVA 1HL4A 1IZKA 2AW2A 5C8JA 3B7YA 1I8UA 5C0IA 4AQ1B 3P2TA 3RWDA 2F7PA 3L3GA 1JYWA 3DHPA 4HVBA 1MAJA 4AC2A 2WXHA 3DMMB 2WSDA 5D93B 5KVEE 1TZIA 5IM7A 3QZWB 1FG2A 2OI9C 3X13A 1JNHA 2ERJB 3TJEH 3GS0A 4M7KL 1E0OB 3BIBX 2VDPB 3M8OL 4OGQC 1XF3A 4PJ9D 2CKBL 3B2VH 3D06A 5LXVA 4G42B 4MJJA 3KPQB 3V0VA 3DRTA 4BK8A 3ESUF 1GXEA 1JS4A 2UVEA 4OZ4B 4JEGB 5E1IA 1RKRA 2CHDA 2XWEA 2X4NA 4WU7A 4LDCA 1UJ3C 3ISWA 3HNSH 4C57C 3TEZA 5CJOL 1KLFB 3QPQC 4L3EE 1ACZA 2XC8A 2IF7A 2YR3A 4X9BA 3QNYA 1GGYA 1YJDL 2BVOA 1FYTE 2R0KL 2KLSA 1T5XA 3LQMA 1OARL 2DF3A 2E9BA 2BSCA 2CIKB 1LEKA 1CO1A 1GRWA 2RIKA 4P4KA 1AS7A 1T2XA 4CSZA 1Z3RA 3ETBJ 1QAWA 1SEQL 5T1KB 3VTMA 4KY1L 2Q8AL 3U9PH 4FQ1H 1THAA 2WQAA 4WI0A 1CXFA 2XWZA 1BECA 1BJ8A 1R3KA 5FB8B 1CLYL 3NG5A 5CZKA 3GRWH 4YAQB 3BYYA 3Q05A 1OAQL 4GFXA 4L9LC 3W2DH 4YDJB 3ZHKA 4J23A 4OZHE 1CDBA 5BS0B 2MOGA 2HVBA 3VWJA 1D6EB 5LGYA 1T66C 4UDUA 3EF7A 4G8FA 4PYHA 4PJGA 1MZYA 3RVWD 4JFDA 4PG2A 2GC7C 3REWA 2DMHA 1BVNT 3HE6B 4QF1A 3RL1A 4OUUB 2O93L 1CE1H 1N3NA 5I74C 4AV5A 1MHHA 3DSFL 1HVXA 1YY8B 1CDHA 5AENA 2OMVB 5B38G 3Q6FA 3QPKA 4H8UA 1BVOA 1E5BA 2X1PA 4PGBB 1UB5B 5AVUB 4QRTB 2VZSA 3TBCA 1FNGB 3IPEA 2OPCA 2GY5A 1U3ZA 2W5PA 3WN5B 2P8MB 3QRBA 4O4YL 1MFBL 1AR1D 3VXMB 2L7UA 3ZTJH 4AIZB 2ZCZA 3GB7B 2CJUL 1KLGB 4NJ9H 4F7PB 1T2JA 1UG9A 4AUJA 2VZ3A 1NBZB 5IJKC 1OVZA 4PJFE 4NN7B 1AACA 4ONHA 5DRXB 3B9KC 1LLAA 4CGUB 3DVNB 4FQQA 1CD8A 3US1A 1KEML 3QIUD 5IVZB 1BJ1J 1UUNA 3IMVA 3B3IB 4YK4C 5EEUA 2HFGL 4MJIB 6PCYA 2OI9B 1N4XH 5I1LB 2R2HB 2EZ0D 2EECA 2N56A 3AU1A 4DIXA 4A67A 3VI3A 1R0AH 4JGMA 3I9GH 5AD0A 2WB7A 1ZD6A 1JWSB 1AHWC 2EYSB 1YPZA 3VB8A 5DGRA 1U93B 2PP7A 2YXMA 1G7QB 5DZOA 2EE3A 2A6KA 1EV2E 1TIUA 1HAWA 1F3RB 3RPIA 1BPLB 2HB0A 2Q0ZX 1QTPA 3W0WB 3F7LA 3C5JA 2Y6SC 3K0YA 3FO0L 2YAPA 43C9B 5E5UB 1VJSA 5C2UB 1Z9LA 4LE8A 1AY1H 5KJRH 4KX7A 1JN6A 4NRXB 1F3DH 1W0WB 3MJ8A 5GGQH 3TBVB 2FWLB 3LRMA 4Y1AB 5CSZB 4MNQA 2VT0A 3FSWA 3SE4A 4IGBC 5IESL 3QC6X 2CBQA 1AYOA 1FDLL 4HKBA 4KV5E 4LPWA 2VOTA 3NQIA 4ZUUA 3WNMA 1MCQA 4U3HA 2PO6A 5GZNC 3DNKA 4H0GA 4L0PB 4J4PC 5G55A 1L9TA 5L7XH 4D8PA 3CHRA 4G7VL 1BBDL 1MQ8A 5I8CA 5FA4A 3FSAA 3T4YA 2IO5A 3FO2A 4PJHE 2JB5L 3IDJB 3MNMA 5LNEA 1CR9L 4UDTA 2D8KA 5J5EA 1FZOB 4S10A 3LEVH 1MJ8H 3HW7A 4JHWL 4MAYD 3D85D 1UXWB 3IJSB 3AGWA 4O2CB 3VU1A 5E4IA 1M3IA 2HH0L 4P46A 1QSFD 3QISA 4M56A 3SSGA 1NSNL 1NFDF 1HH6A 5HD8D 5D2LA 4MZRA 1RMFH 1NGXA 3DVGA 2R27A 3AY2A 5SWZD 3T09A 3BD3A 1WBZB 2LU3A 3FQXB 4HCRA 4QT5B 4D9LH 3K6NA 3FQNB 4LSVH 2NRDA 4KU1A 3VFOB 1VACB 1ZT1A 5GSVB 3W82A 3OR6B 3K8MA 1TVHB 4Z6AT 3HI1B 5C07E 5EDSA 4BFBD 4KBPA 4DP7X 4MMZA 4MXVE 2E47A 1BZ7A 3CZLA 4XP9H 4JJOA 4FGMA 4XMWA 3U48A 4JN1L 2AJ3A 2IWGA 5FKAB 3AXLA 3M17A 3KD4A 4N85A 5DD5L 2KZ1B 3DTXA 1IM9D 3E7JA 4XCCH 4V33A 4Y16D 4F15B 5LWYL 4HOXA 4MCMA 4LAQL 2HN7B 2JKNA 2A6DA 2LABA 1A1NB 1E67A 1NH6A 2QSTA 2XKUA 3I6GA 4OZFH 4YHPA 4YZWA 3NIFE 4HJGA 4XB3A 5EZLA 4E41B 3BVXA 3FH5A 2D0GA 3H0TA 4GBXD 4J3TA 3CVCA 4XBEL 4Z76A 3K6DA 4HH9B 5DF0A 3NZHH 3BZEB 4FP8L 4NBZB 3PIQA 3GMRB 3S3CB 5I16A 5EN2A 2V3FA 3DJRA 4B9KC 5SX5H 3D3VB 5EWIH 5D1QB 1TJHH 1LDPL 2VDMB 4FYRA 3K71B 1KN2L 4HGKC 2WIMA 4UZUA 4GKSB 5ICYA 5KVDE 2G0KA 2VERN 3EJPA 4KDTA 1IAIL 5C09A 2EXTA 3BXNA 3GTNA 3ZX1A 1V27A 1WBXB 4JY4A 1H0DB 3W39A 3UXFA 3VGEA 2AXFB 2R0LL 4HLEA 2X6AA 1GC1H 4HW6A 5HHQB 1IMHC 5DWUL 4LMQE 4UIMA 4YHYC 1KGUA 3HHMA 3F00A 3O4LB 4PJ7A 4LBEB 1IFHL 1MG2C 3OX8A 3O81A 2HPOA 3WE6A 2VXQH 3INUH 3OQRA 5EOQL 1FFRA 2R39A 2PNDA 4PWEA 4WJ5B 5GISH 2E6PA 4O2FB 1U8MB 3HZKB 5HVFB 2J25A 5AB2A 5D7IF 4QNPE 2KZWA 2YKLL 2B08A 5DWPA 2G5UA 2CNYA 4FFWD 3WNIA 5IR1B 2NLJA 1ZHBB 4K07A 1AZUA 1I1YA 2DI9A 3GM8A 4F33A 2HZHA 3RZCD 1B3IA 4UBDC 1V55B 1U2YA 3C60C 3FXIC 4KJPD 4OTXL 1KB5A 1VZGA 1WISA 2X2JA 4I9WE 3LN5B 3TN0C 3VO0A 1QEWA 4N0CD 2K0RA 4BQ6A 2BWIA 2FAUA 4GRLA 3IU4H 4JRYB 5AW5B 5IBUG 4ZMVA 4UQ2B 1LK3L 3G5ZA 5EBLA 4NQVB 2OL3B 3TYFB 2ZOTA 1BREA 3PWNB 4HA1A 1OSPH 5H2BA 1UOVA 3H7BB 5LCVA 1KCLA 3EDDA 3CBJB 1IO4C 4WEMB 3LZNA 4OZIB 2QFPA 5DJ8B 3SDAA 5IJVB 1WZ1H 1EUUA 1SEQH 3H9ZA 3DX0A 3C8DA 2WUBL 4X6CB 5C6TH 1WAAF 1M3JA 4A39A 4NQEA 5F1NA 1AZCA 5FGCB 5FOBA 3S96B 5I76A 2QSQA 1CLYH 4M3KB 3IJEB 1OAQH 1GKOA 3QG6B 2EIZB 5JO5B 2BFVL 1S5IH 3CQQA 2VXUH 3D51A 3CHSA 2Q2EB 1XGYH 1RZQA 5CD3A 1LE9B 4XN7A 5DFVC 1G7IA 3MRBA 1HJBC 3D0VB 1ORQA 5E2TL 2AI0L 3TBTB 5DVOA 1M9SA 1AO7A 1BSIA 4UQ3A 2JJUA 2FLBT 3THMH 1FRGL 5ES4B 4A7UA 1T5KA 1G5AA 1YUHB 3FU0A 4Y4KA 4CSTA 4OZHA 2J4WL 1EBPA 3O3AB 4KAQH 1T4WA 3S7GA 3ZTDC 5A2JH 1EXHA 5E6IA 1JXDA 4KK9D 1GJUA 1XR8A 2H1PH 3IN2A 4XN4A 1R3HA 5HHXH 1YEHL 4F9PC 2KI6A 3QA3B 43CAB 4HS8L 2ZF8A 1WC7B 5IHLB 1XWVA 4HF5L 4YHYB 2CJUH 4JB9H 5JW4Q 3HC0A 4L05A 4LASL 2EDKA 2FWOA 3VA2C 5I1GL 4U1NA 3G5VB 2Q7NA 3QJOA 3S48A 4Z7QE 2NNCA 1B0RA 5AG9A 5T1MA 4CKQA 5F9OH 2FQDA 3VVVA 2I9LA 3GKZA 3BDYL 3C6SB 3VMPA 5F44A 2DPKA 3P0VH 2F9BT 2HFGH 4M5SA 4X7CC 2ALWA 4MZ2A 4Q97A 4PJFA 5INCB 3MGTB 1E4KA 3CFJB 4P49A 2BOLA 5IWLC 2IH8A 4G59C 2W91A 5DHYB 1MW1A 1T04A 2NSQA 4Q4EA 4KO7A 2NY1C 5F7DA 2WYZA 4CKVX 4GSQA 1F4YL 4ZTPH 5IQ9B 4K9EL 2IDFA 3IXAB 1RZIB 2Y5TA 1DL7H 5EU4A 4YDIH 1EEZA 3OLDA 1EO5A 3TV8A 2A0LD 2F08A 4U1JB 1GW0A 4PJGF 2DQDH 1JXJA 2C3VB 4UT6H 3JV0A 3IFOA 1CLOH 1NICA 5IESH 2BIPA 4HUUB 4HXBH 4XMLL 1FDLH 2X42A 2XQBH 4WW2A 3U0TA 5CN2A 1FZJA 3UO1H 2R0ZL 2ADIA 3RWEA 3RHWK 5EORL 4LKXA 3QQXA 4DP1X 4HJSA 2YPLD 1LWJA 2CBMA 1KIRA 4Y7MA 4G7VH 4B9JA 1BBDH 1AR1B 5JMOC 1DQLL 3MNVB 5I8EA 4MA8L 3ZYZA 4QHLB 3V0JA 3NSJA 5FGRA 2Q8BL 4TULL 3MQIA 1XGUA 3EKCA 4AGMA 3HZMA 1RUPH 1WFIA 2X1OA 1JCKA 4I0CC 4Y88A 4R4FL 2R59A 2VABB 1TLMA 2JKLA 3QUXA 3FQ1A 3N1PC 3V4VA 1KJ2L 2HH0H 4J28A 3I50L 1P84K 2X05A 1QNZH 3IFLL 5GRWA 4LCUA 3C5ZA 1MH5A 2CUIA 4UB0H 2CHXA 1DANU 4LLVA 1XD0A 2GBUA 4N2DA 1XZ0B 3WKQA 1E3XA 5DR5H 1MCEA 3UG5A 1EZSA 2CDEA 3GLEA 4E0RA 4H1LA 4PGDA 1X6LA 4TQHA 1KULA 3MNWB 3MX0A 1R17A 2OMZB 1ZEAL 3F7YA 1KGWA 3VCLB 3OAYH 2BC4B 3KBEA 2NY4C 4QY8A 4X9HA 3ZGHA 2GSGB 1NAMA 1UD5A 4IYKA 5EU7E 4WVRA 5JMRA 2MMXA 4Z7WB 3UTOA 4UM9D 2CH8A 4G5ZL 5JPNC 4JN1H 5EU6A 5JIKA 1CQYA 4ZRGA 3RIFK 4R83A 1ETZA 2BRRH 2NR6A 4LCIL 5LBSA 5EEXA 3QIBD 5MEPB 4HIXH 4OCRL 5DLMH 3UZVB 3AW5A 1Q0EA 3G7TA 2YWZA 5GQBA 5EN3A 4N8PA 5DHVH 5IEKA 3QQ3A 4DT2A 3V9FA 1RURL 2I32A 4GUCA 3VMNA 2LFEA 3K74B 1LP9B 1JZGA 3TNNB 5C71A 1UH2A 1N6QL 5KVFL 2WXGA 4CW1B 2CO2A 1DSYA 2WXIA 1KEGH 2CXGA 3ULVH 3P3SA 4BA8A 2QHLA 3Q5YA 2ROYA 4K5OA 5C70A 3OKEB 2H8PB 4OF7A 1MAML 1AZRA 2CA3A 3CVHL 3NCJH 3QO0A 5EDXA 3NESA 1S9YA 5L88L 3FQRA 5CKAA 4JZJC 4MAYB 2A9AA 2QDWA 3RY5A 3ZTEA 3BX7C 4O02A 3KCPB 3LKOB 1DLHA 2R0LH 1ZHLB 3GMQA 4ZUSB 1EEQA 2WO2B 1Y07A 3SJVA 2X6VA 3SE9L 2X1XR 2BW5A 1LMIA 1NGPL 1SLWA 4W6WB 1IFHH 3LH2H 4YHKL 4QHPA 5SWZB 5ABDE 5D2LF 2FHFA 5EOQH 2DYPA 4Z7VE 4LCCC 3MUY1 4YE0A 2CKBB 3JQOB 4YIQB 5CLYA 3G6JB 3OAYK 4HKZB 1YN6A 2FYYA 1QATA 1CCZA 2NX5E 5C08E 3V0EA 1W6WA 1DANT 3KH3A 1JYXA 3BFWA 4XNDA 1CVRA 2FD6H 4ODTH 3NN8B 4FTDA 1L0QA 4WHTA 4R4BB 2WYTA 4L9LA 2CK2A 1WWWX 2WQWA 1S7QB 3KS0H 4BSWA 4X5RA 5E2WL 5IEHB 1CWVA 4L1DA 1YEGL 5MHSD 4YDLC 5JW4R 4U7KA 2J1XA 1QBLL 3IGUA 5ID1B 4R8WH 4U1SA 2NCEA 1AXTL 3FUIA 4QRBA 3UX9B 4M7ZC 2I07A 3DX9B 4G82A 4OH2A 4YN3A 4DPBX 3ECQA 1XSOA 1CGYA 3NJVA 4LP5A 3ZR5A 1RK1A 2FO8A 2F15A 1LK3H 3BP7A 4AEIL 2VSKB 4PJ8C 2MQCA 4GBXB 5FKPB 5I0YA 1TEYA 5HDBB 4UINL 2CZNA 3ZT6A 3V4UH 4U1MB 1GS6X 5HVGB 5LO7A 1SN0A 3OF6A 5BRZD 3U36A 5JPNB 1EH9A 5D6CB 5CEZL 1HQRB 2C9PA 3Q8BA 4YC2C 2O5XL 4X7SL 2R83A 2Y3NA 3X3GH 4A38A 5JW3L 1HHGA 1A7OH 2FL5A 1C5BL 1E30A 1G9NL 2DLTA 3O2WH 1KG0B 4LB8A 2LVEA 1NEZB 4X5QA 5IJKA 1LO0L 3HN5A 2H0JA 2LTQC 3MZGB 5D71H 4YHZL 3ABLB 2GHZA 3IDUA 3EYSL 4PLJD 4U0RC 5CZRA 3B9KA 3L7EB 2BFVH 2D2OA 2CGRL 4FADA 4IBUA 3CD4A 3O6MH 4RDBA 4L0ZA 2J8HA 3C8KA 5E2TH 3MA9H 3MRNA 2V2XA 3ULUF 1ETJA 3QEUA 3U7YL 1FRGH 1HH9B 1OB0A 4PJ7F 4EI6A 3UGXA 4FG6D 4ALAC 4ELMA 3WEXA 2G75B 3ECWA 1IBDA 4LPXA 4QRPE 2IH3A 4XWGH 5E00B 2HPTA 3QARA 2L7EA 1BLNB 1AHWA 1LMKA 3NDYE 4PR5A 2RQ8A 4RRPG 2OW6A 4YSOA 3V9EA 1ZTXL 1XCXA 1X4YA 3SZKC 1T3FA 4CNIB 1EDQA 2JXMB 1I8KB 3B34A 1YEHH 3OLEA 3K0WA 4LRNL 3BW9A 3ATDA 4RGNC 4HF5H 4PJDA 4DTGL 1UD6A 4HFWB 4NT6A 5F9DC 3AY4C 3UZEA 4TTDD 1BYPA 4OCWL 3RI5F 3MV7B 2NSMA 3WTVA 4FC3E 3BP6B 1ILSA 1ET5A 4G6ML 3ZK0A 1A8ZA 3F83A 3MCKA 5J06A 4C4BA 5C3LD 4PWIA 3FJTA 4V1DB 2O61B 1ZJAA 4I3SL 3UJTL 3VTAA 3K6SB 4P07A 1AFVL 3SGDI 1VADB 3ZKSD 1F00I 4QLRA 3UTPE 4YSQA 4G6AC 1G7JA 3S4SB 2ATKB 3GK8L 4JKMA 3TL5A 5HBBA 3IGKA 2MNUA 2GTZB 3EJTA 4Z7IA 2XVBA 3LJ3A 1WCBB 4HK0A 1MVYA 4J6RL 3D1MC 2MCPL 2EJ1A 5JIDA 1FGVL 1BGXH 1FNAA 2P8PA 4M7ZB 3FRUA 2O6PA 5JHBA 2DRUA 4RQQB 3D25B 4AE1A 2QSCL 4XZUB 5F9JB 3FSVA 1SDAB 2B7DT 1F4YH 1TYJA 4KJQD 3LRKA 3OC8A 1HKLL 3L54A 4JQXC 3SDYL 5LJYH 1K8IB 5F88A 4WUUB 2C5DC 2NW3B 1NCHA 2X3AA 4HHAB 3QEHA 2UYLB 3JZ7A 2FO4A 2MPAL 4YC2B 3T8MA 1U8JA 4FHBD 2CM5A 4TNVK 4Z3IA 4G7SB 2X3BA 3LSOA 3I9IA 5IROD 3MRLA 4XMLH 2B4CL 3BWAA 1A4JB 1ND0B 1VZHA 3QQDB 4TUJA 4AZ8A 5DJAA 4F8QA 4AQAA 4YEEA 1V5JA 2R0ZH 4JM2C 4YOKA 1ZA3A 2LTQB 3ARGC 1FL3A 4LFHD 1NLBL 2OZ4L 3EYQD 4N8CL 1Z9NA 3QUYA 3QZNA 4P4RA 2YLHA 4OM0H 2PWDA 1N70A 4MA8H 3VD2A 3P3RA 3FQUB 3WXVH 1KGJA 1OTSC 1EJ6A 2Q8BH 2CRZA 3V5KB 3H9SE 1QMUA 2B3RA 1HOCB 1YRKA 4MCYA 4NYLB 2WZAA 4JHVA 1NPNA 1W72A 4RGOH 1WO2A 1AG0A 4F7TB 4KDWA 3K4DA 3K6IA 3ML9A 4R4NC 1SDDB 3I50H 4L5FE 2EH7L 4QHKJ 2LT9A 5K39A 4D0BB 1AI1H 1N26A 3FTSA 3MI6A 3O6FD 2B77A 3UZQB 2EKJA 2ZSVB 1BA9A 2BJMH 1I7UB 2YXWA 1XH2A 3TPUB 3T0BA 1U92A 5JQ6H 4FCAA 5IIEB 2FEJA 2YD3A 3PQYA 3IDYB 1A6WL 3ZL4L 5SWQA 1RHFA 2B39A 2W38A 4GXUN 4PJFF 3UTZA 4AKQA 1TF4A 4TTGA 1BMGA 4KNUA 5GXBB 1KY7A 1U2HA 2F53E 3U4KA 2YWYA 3NACL 1XF4B 3GXTA 2PETA 4X5WB 4G5ZH 5B3SB 1ZHKB 3QSKB 3LEXB 3WS3A 2V7NB 1I1CA 3VRIA 2DBLH 5J89A 1QLEH 4JDZB 1HSBB 1RV6X 4O58H 3U4EB 2EDLA 1GJWA 1BZQK 3P4OA 1FNHA 2Y4SA 1AKPA 2NUPA 2NXZD 1RURH 4G9FD 3ULAB 3ERXA 1Q1JH 5CCGE 4N20A 5KAQG 1UXLA 1CC3A 2XG4A 3DECA 3GQFA 1JTPA 4WJKB 4NPJA 4DP2X 3HG1D 5DMYA 2MQGA 2ADJA 5FO8A 3L1FA 5TGBB 3W9EA 2R2EB 1AD9A 1QFPA 4TRPL 2B59B 1HEJC 5I1JH 5CUSL 5I1EH 5E24E 3PCYA 5IBLD 5JHLH 1CTMA 3KW8A 3CVHH 3KGTA 3L95B 1M7DA 5DZNA 1XBDA 3C60A 3LZFL 1XCTA 4R3SB 3HUJE 1EFXA 3HN8A 3TN0A 3STBA 3WFCH 5B21A 4JKNA 4X2UA 1WTLA 4KV5F 4Y19E 2HLEB 2Y1ZA 4XI5C 1D9KC 1A3LL 4DFHA 4HMDA 3N5AA 3K2KA 4JM2B 3MBEC 5I1KL 3V7MA 4NEHB 1NGPH 1FSKC 3DTUB 1YYCA 5EBMA 5DTFA 1JGLH 3WNJA 1WFOA 1RK0A 3N44F 3K80A 4TSBH 3KPNB 4PJHF 2E7MA 1NGQL 4DZ8A 5DZAA 3W5MA 1N2RA 1WFNA 2R1YB 1FZMA 3KWVA 4CDHA 5A6MA 2DW5A 4P2CG 4AIEA 1WF5A 1S7UA 2I60L 4M61B 1BVZA 3COOA 5E9AA 4WZ9A 1LE5A 3L3JA 4H40A 1R5VB 4JJ5B 1A9BA 5LGHH 1AANA 4UM9B 1RZFH 3SO5A 4Z7VA 5I6XC 2NMSA 1FE8H 4HQQH 2A6IA 5E2WH 3GUTB 5EUOB 1K9TA 2XYBA 3UBXI 5AB0A 2XFGB 2H32A 3NCYP 3ZOAA 2M8XA 2YPKA 5DEGA 1SYSB 4N86A 4U4IA 1U58A 3OAZH 4NKDA 1XCWA 2Q3AA 4RGNE 5C08A 2RAMA 2FATH 5F9AC 3ZE2E 4JFFD 2EIDA 3P9MA 3PV6B 4XPFL 3PWPA 2YD2A 3ZPDA 5EF3A 4MD4B 2NY2C 1SQMA 1FL6B 3DTDA 4ZMTA 1JTOA 4MXVF 5D1XE 4M8QB 1AGEB 3H53A 1Z9SA 4JQIA 4PJAB 3VGAB 4ZPTA 3GINA 3J07A 1YNTA 2O5XH 1T80A 1GY1A 3KDMA 4FZ8L 1G1OA 4H88L 3S3SA 1I9JL 1X4ZA 3A0OA 4I0PB 4NP9A 4DKDC 2AV1A 3O3UN 1E28B 2A99A 3NIFF 1GTNA 4OB5L 1VFAB 2OTPA 3PE9A 4YHZH 4LLQA 3F84A 5CMAB 1G1CA 3EHBB 2PYED 4IMLA 3C12A 4LLAA 1P4LA 4AJWA 3F7VB 4AIOA 1H9DA 1IAII 1TO5A 4HJJL 3CFTA 5DO2C 1RD6A 2GVYA 3QJQB 2JVUA 1CF8L 4C4KT 4G8EB 3P9LA 3P77A 1DBML 2HJFA 2ZG3A 3VWKC 3JBG7 1JZ2A 4G72B 2Z8VC 4HDIA 1UVQB 2PWFA 5DLLA 2ZWSA 2ROXA 3CVIL 1PZ5A 4UT7H 2LR4A 4JFHD 4GEJA 1MEXH 1UKTA 4DCQB 5KYXA 2ED8A 3MRFB 2HX8A 3QUKB 4ZMOA 1WIUA 1ZXKA 3CDCA 4XMXA 3D2UA 3LRSB 3N9GL 5DQJB 4DAGH 3GMPB 4HJ0C 4MD0A 5FCSH 3T6VA 3UABA 3BQUC 1QKZH 2WBWB 3OAZK 3R19A 2AS5M 3NSFA 3OC5A 3OHMB 2W94A 1JVOA 4I3SH 2XN1A 4ZDHA 2AQQA 3UJTH 1JERA 3IVKA 4QNPF 3MNDA 3VW3L 1EAPA 4HJUA 3UAJC 4X98B 4AEFA 5IQMA 1IEBA 4JX0A 1YYLL 4FFZL 3QWNA 4EDXB 2HJLB 5BRZB 1RQ5A 2VAAA 5I6XB 1FNLA 5FYJE 3IDMB 2B14A 5D7LE 2MCPH 2G2RA 1CFVH 2VO8A 5EZPA 1KMGA 5JTWA 1FGVH 5D7JD 4DGWC 1G84A 2V5MA 4Y5XA 2RCSH 3B5GA 3FO1A 4UTAA 5E0QA 4XNYL 3PUCA 3QQ9D 3CU7A 2LQRA 4DZBA 2NY2B 4A66A 4MCZB 2HG0A 3MJ7A 5BVPH 5HYFA 3CDGA 1FIGL 2DIEA 4G8GE 5C0CA 2ESVA 1SUJA 2G5BB 3PREA 4U6VH 5FLVA 1CLZL 2ZKXA 3F5WA 3UTQA 3ALXA 4G80A 1M2VB 2JNZA 1RJYA 1KTDB 1QFWI 2K3TA 1VFUA 1DFBL 3MU3A 3UAAA 1CZ8L 1TQBC 1KGYE 5ADOH 1B0GA 3VXNA 3RGVD 1RAMA 2HKAA 1H15A 1SYVA 4XN2A 4WFFD 1GZHC 5E94B 1QA9B 5AZ2L 4A68A 5IW6B 4YHIA 3I02A 3SD5A 3SDXA 1MJJA 3R8BB 2BVQB 2ZUWA 4M1GL 3MACL 2P48B 5ITBH 5KYNA 1QOKA 1KJ2B 1FNSL 4KVCH 5I9QC 1QWHA 1RIHL 1ZV5A 4KHTL 5AEAA 3H6AA 4A1RA 1BYOA 3QRGH 2YSSB 1OHZA 2JCCB 4KDVA 4ETQA 3C9NB 4PJBB 5F7BA 1CICD 2C1PB 4GS7C 2X87A 3RWIB 3V0DA 2QKIC 4RFEB 1OT4A 2K8MA 3FB8B 5F8RC 2FLRT 2UY6B 3GWJA 3HR5B 4F2MB 3DARA 2A83B 1N7ML 4Z5RA 4CVZA 5MEOA 2AKRB 3DO7A 4PBXA 4X0NA 2G2PA 4AYEC 1S7SB 2HLFC 1B2YA 3EO1B 4ZK8A 4KRPD 3TYGL 1KBVA 3H9SA 3HBGA 4NIKB 2E9IA 1A02N 3ZZLA 1H8NA 4FJYA 4K2UH 3EGXA 4XCYA 3ZDYE 3ZL4H 5AAPA 3QUGA 5CGYD 4PS3A 2CLVA 4WO4A 4Z7QF 4MJHA 1JZ5A 5K93A 4ANVA 3Q5TA 1Q0XL 3P0YL 4FA8A 1V3KA 1AIFA 3HE7D 3Q2CA 2WPGA 2UZIH 3PWVA 1EHLL 1IT9L 1VENA 1XMWA 4JZJA 4HPYH 2E7LA 1R3JB 1S9VB 2HXAA 1HQ4A 4FMVA 2AVFA 3A4EA 3S34H 2PCPA 3BYTA 5FW7A 3BCFA 4LHQB 2YSTA 2FX8H 3TTSA 5A6LA 1U8HA 4UYQA 3GHEL 5HJ3A 3S8GB 3RPKA 3D12B 4BRJA 2F53A 5CNHA 5D2NE 3KPRA 4LCCA 5KSBB 1L7TL 4HJ1A 5KYUB 4Y2DC 1H6UA 2GK0A 3PWLA 5IKCB 1J5OL 4NLHA 3UP6A 2PCFA 3VSUA 4ZMXA 4HKXA 5BV7C 2BY3A 1KB3A 2OSXA 4HMCA 1N59A 2QQLL 3EOAA 1HJCA 3WDJA 1K8DB 5EZJA 2DLFH 3H42H 4UZGA 1V7NL 1MCSA 4PRIE 2Y1AA 3LZFH 3QUZB 4LSUL 1DVFC 1OIOA 2NCMA 5D7SH 3IDGA 3OL2A 1TQBB 1YMMD 3DXAA 3QFDA 3QULA 4NC0B 4RDQG 3T2NL 2ZP8A 3JWNH 3O6FB 3F12B 3MZTA 3D18A 4PJ8A 5IMKA 2D31A 1MCOL 4M93C 2R8SH 1YQ2A 2F7IA 4QWWD 2BDNH 3W11D 4D9RD 3HUJA 1S6NA 2WLZA 5I9QB 4ESKA 3B83A 3QP3A 4TXVB 4Y1TA 5C0DB 3LNGA 3B5TA 4CVWA 1HHHB 3ZTJG 4YSPA 5F0PB 5D1ZD 2J5LC 4FYTA 4GLRH 4JFXB 5DD6A 2XWTB 4ONFL 4UT9A 3QCUL 3WD5L 3CFMA 1RULH 1AGFB 5CBEB 5FYKE 1INDH 1EEYB 2FVNA 3DK0A 4PP1C 1DFXA 1RZJC 3NMEA 2FBOJ 2WM0A 1TKWA 4WTXA 3S97C 3WL9B 2W95A 1H3WM 4HWBA 2VQ1A 4FJ6A 1URZA 2VDRL 2NXZB 3CSFA 2BIOA 5IB5B 3C5SB 4ODUB 2P80A 4PBVC 2Y3AA 3T77B 1L5GB 3HG3A 3OKLA 2O6CA 4TQPA 1EAJA 4AMXA 5F7UA 4WKZA 3L4YA 3V5HB 4QOKE 3VGGA 1RZKH 4CADB 1IC4H 1RZ8B 3KHQA 1QSEE 4F93B 4AENB 1RL1A 5JHMA 4NKQB 5H8DA 5E8PA 3UTTD 3O2DL 1NM4A 5AOJA 1DBJL 1G7PB 5KW9H 1H3PL 2CR6A 4RA3A 4YO0A 2WLYA 1BEXA 1DEEA 4GEIA 4JN2A 3WNKA 1QZ1A 5F9WC 4NRYA 4KITB 3AY4A 3QWRA 1CGSH 3ISRA 5GS2D 5EC2B 4YFEA 1HINL 5D1XA 3G5XB 4HAKA 5EBWB 1MNUL 1OP9A 2B16A 4HUKB 3T8XA 1KCUL 2CO7A 4Y2DB 4P2QA 5HVHB 4PY7A 1IC7L 4KZCA 5IV2A 2NY5C 5ISZD 4M1DL 1TMQA 3D0LB 2GAZA 1CF8H 4JM4H 2R56H 3MLPA 5AW1B 1P5UB 5T8IA 2XACC 2BSEA 1BOGB 1WGOA 3NK4A 4MWFA 5EPMB 1BVLB 4Y8DC 3D9AL 2I5YH 2CLRA 4NN6B 3NPSB 2XCMC 4IRZH 4MXQD 3U9WA 3IDXH 2X70A 4Z78B 5DK3A 3QZPA 1YY9D 1T1YA 2HJKB 2ZUYA 2CDFB 1S46A 3LB6D 4WFHE 1E5ZA 1F13A 3H2QA 4L2YA 3WIHH 4MBOA 1U3HC 1YEJL 3R18A 3QCVH 4RWHA 3CLFH 5I8KL 4OCSH 3LH9A 3K2MC 2BRQA 2EDHA 3E0GA 3TBSA 5HHPA 4Z7VF 1T1WB 1FZKA 3GO1L 1I9RH 5CD5C 4BDVA 4ETYA 4YS4A 1PAZA 2XG5B 3ABKB 1T22B 5FO2A 4TMPA 3WXWL 3JV6A 4G7RB 3U1SL 5LGJB 3UJJH 2DQGL 3MA7B 4L3CA 2RA1A 3P4NA 2YD0A 4OKDA 5CEXB 3EUDA 4EXPX 4W68A 3BAIA 4C55A 2IXQB 3VE0B 5KVMC 3ARGA 1LO2H 2HT4D 4AZUA 1USQA 3JYCA 4MDJA 5JR1H 3HN3A 4JO1H 4HV8A 3UAEA 1RIUH 1YA5A 2ENJA 1JFQH 1V05A 4OAWB 1TTRA 4NB7A 5TH2B 3TLRA 2VDKH 3KHOA 4M03A 4QRUA 1YNTF 4AJ0A 4YPGA 1N64L 2CUAA 2YHGA 4L8SA 3B7UX 4ABVA 1E9PB 4K94H 2BS8A 3BAXA 5LNGA 1FO0A 4DSYA 1L0YA 2PYEB 3KW7A 4X0KA 3ZR6A 4A6YB 1RI8A 4OZFG 2MOQA 5BXFB 3VXUD 5D7LA 4JFYA 3CSYB 1QSVA 1Y6KR 3FKUS 3DIVA 1JDCA 2X4RA 4NM4L 5GS2H 4I1NB 3UGUA 2H3NB 3BI9X 4TPRL 3DSNB 3GIVA 1ZGLA 1CZ8H 3EFOB 1C08A 3HIZA 3FFDB 5H35B 1LD9A 3MRKA 4AL8L 3U2SB 4FFVD 5LAXB 5B3JE 3ARUA 3OKNA 3B6SA 1A64A 3VACA 1K72A 5AZ2H 3KPLA 3LN4A 3N1GC 2Y06H 4PJCA 5GGRY 4Y4FD 3LY6A 3F6LA 4C83B 2X7LB 1PLGL 1LNUA 3FU7A 4NC1C 1JHTA 1I82A 3IXTB 2R69H 2GIMA 1A0QH 4KXAA 5IBTH 5IW3A 3OLGA 4JFVA 3ASWA 5F7EL 1UM5L 2CA4A 4Z7UE 4J3OF 1P7QD 4RISL 1IVTA 3BRFA 1Q72L 2VMJA 4E9VA 1FBIL 4FKKA 3UGEA 1KJVA 4KKCD 1MY5A 5AZEL 2ZX6A 2R7EB 4OGXL 1OGPA 2MH4A 4RAUB 2PYFA 2X4OB 4ACTA 3KDPB 5LNDA 3TYGH 1C1EH 4DKEH 1YC7A 1J8HB 4RMSA 5HYSG 3MFFA 4HUWA 2VJ8A 2X0VA 3CH1B 3QHFL 5F1IA 1KYUA 4DEWA 4CU8A 2HMIC 1NWPA 3DX8B 1CG9A 4E5XG 3RWGB 1OTTD 3PUUA 3GLAA 1Q0XH 2YEZB 3LDBB 5D7JB 1R1CA 1T5WB 2N0MA 3M45A 1HESA 4DGVH 3WTTA 3CFKA 1Q94B 5HHOE 4BKSC 1MRCL 5F8QC 3MREA 3FU3A 3WSQH 5EO1B 1XF2B 1R5WB 2OMXB 1D9KA 1WWCA 2XVKA 3BEWA 3CHOA 5KSAC 1JWMB 4XMPH 3MBEA 4RFNC 2CBTA 4TNGA 4IS6B 1XIWC 1QQDB 3C8HA 2H6UA 1P2CA 1RU9L 3C6LA 3RUGB 1L7TH 4EN3A 3ZKND 2Z91B 3HLKA 1XAUA 5IHBA 5CLXA 1ORSB 4GP5B 3O4OC 4R7NB 1MFMA 4W9KC 3TH3T 1F02I 2IEPA 3IJYA 5MERA 1K5WA 2EDTA 1K4CA 1NANH 3ZKXB 4EI5A 3RDTB 2Z7UA 1AG6A 4KQ3L 3AS2A 4NSKA 1ILUA 1CN4A 5SV3A 3IWVA 3SZ6A 3FCBA 1D5RA 4GO6B 1CICB 2GK2A 5CR8A 3FQTA 1OD9A 1A4KB 1I9EA 1MREL 1AHMA 3EYVA 4JPWH 4Y2NA 1PU0A 3FB5B 1RHHB 3T2NH 2X6BA 1T03H 2QHRH 3RURA 2FSDA 2VWEE 4XGZB 1MZZA 1IC5L 3C09C 4NRZA 3FL7A 3PGDA 3WFBH 4KRPB 4YHOH 4PRIA 3VXME 2KKQA 3NCBB 2YUWA 1AKJD 4RFOL 3VAEA 5I1AB 4U6XB 3SQOL 2WO4A 3ARDD 3MMEA 2OMYA 4X8CA 1IQWH 3DUUA 4L3ED 2M1KA 1MRFH 4JDEA 2R29H 1QBAA 4U3SB 1F6FB 1I85A 2BP8A 3JWDH 3QO1B 4P9HL 3T3ME 3UBFA 4B60A 3HE7B 3FQWA 1SLUA 4JLRA 4X4YB 3ES6A 4ZOAA 2JKIS 4ONFH 5HY9A 4ZMYA 1KB9J 2QT6A 4BFOA 3PJSA 3GXMA 5AG8A 2FCBA 5HHMD 3DX1A 1F6AA 1G94A 2P5EB 2XFXB 3QDHA 3U1PA 4KROD 3X1FA 2ATAA 3BDXA 4MJIE 5DYFA 4JZNB 1O9WA 4GXFA 2ICES 5BMFL 4ZFFB 4MXWL 4TVPE 1F4WH 4F58H 3BGFC 1EWHA 4N2AA 3VWKA 4A04A 3AZUA 3TOPA 2CPCA 3TO2A 1NC4B 5IK3B 3CSTA 4KTEL 4UIKH 3PPSA 4M5YL 3SKJH 1L9MA 3F2LA 2E3VA 2ZKWA 3MLWH 3OWEA 2YMOA 2VDLB 5HVWA 3L8QA 3OKOA 2F7OA 1DBJH 3RY4A 2W80C 1K5NB 5E51A 5KSAB 2V3DA 3I6KA 5DUPL 5GGVY 4Y1AE 1BVKB 4NOFA 4C56B 4QOKA 5B1JC 1AP2A 1F41A 1Q9LB 3AM8C 3BQUA 1BQ5A 5FOJA 3U4BH 4HULB 1QSEA 1S78D 1T7VA 4M6MH 1CDYA 1XIWB 1AZNA 1C5DA 2QSVA 2Q3XA 2CDGB 2G60H 2IPTH 1IILE 1D6VL 4KMLB 2VRAA 4WK2B 3SQBB 3GLZA 1NL0L 2NXYD 3W56A 4QHUB 1YEIH 3UAJA 3QZLA 3DJ9A 1DN2A 4M1DH 2P44B 3IGFA 4HX1A 2BMKA 2DQHH 3OXRB 1FLTX 4YL9A 1J8RA 3PHSA 4PGJA 3L9RA 1DZBA 2AK4A 1TR7A 3WY4A 1BEYL 4RRPA 5MP6L 4L37B 5I73B 1UZ8A 3L9YA 3N0AA 3V5DB 3C2SA 3C2AH 1G7MA 5DCCA 1CPUA 1CFTB 3GSXA 3C08L 3HUJF 3MR9A 2FJUB 2BHZA 1DUZB 2NOYA 1H8SA 1Z5LA 2YK1H 3BN9D 4IHOB 2AEQH 4PLKC 3UYPA 2IWFA 3ZXAC 2YPVA 4HETA 1TFPA 2OYPA 4LEEA 5JW5A 4PV8A 3O0RH 1J0IA 3LS4L 2EP6A 3G04A 4ZSOB 4ZD3L 3PS6A 1R6VA 2A9ML 5E1GA 4LLUA 4IMKA 5ESAB 3G5YB 2YA2A 4GQ9H 4IOIA 5F6IC 2OMUA 3QEQA 3VXQB 3IJ8A 2EIMB 4YDVB 2FB4H 2H6PB 3ZDZB 3QS2A 4X8JB 2DTML 1TSHA 2XTJB 2AP2A 4YBQD 4NUGH 2F68X 4P59H 1U8PA 3RVWC 1J8SA 1G6RH 2YD5A 5T1LA 1ZV9A 1UATA 3N55A 4BWTA 1AGBA 3BEVB 4MLSA 2K4WA 5LB1A 3HB3C 5JDSB 2OP4H 1KCBA 3ARBC 3VD7A 1ZT7B 4IKLA 2BNUB 3O2VH 3UPAA 3U6RA 4W70A 3JTSA 2JLPA 1GMIA 1XSJA 3LRLA 1GJIA 1N64H 3CDFA 2IAMB 1R9FA 4FOMA 2QGEA 1OB1B 1GS7A 3T4AA 5IQ7H 2VN6A 2YEVB 3D50A 2QKIA 2W0KA 5EZIH 3RI5K 1KBPA 4FAAB 1MRDH 5E0FA 1WFTA 1DQJB 2WWMD 1CBJA 4XMKH 4BQBA 4X5LA 1HHJB 1L4IA 4Y8AA 5AYQA 5TQ2H 1J7VR 3QDMB 5AOZA 2LAGB 3BPNB 4KNQA 2AJSL 2KYIA 1XV8A 1OF2A 4OCYL 1I7TA 3EH1A 4GMSH 1RZ7L 2UWEE 4HUCA 3H6JA 4OD1L 4R0LB 5AALA 4BIKA 4M5TA 4OCXL 1ADQL 5IZ7A 4HG4K 4DKFH 3EF4A 3MXWH 4QCIA 1FPTH 4E68A 3V79C 3BPLC 1T4KB 5GGTL 2GG1A 1JK9A 4KH2A 3IAQA 2YXVA 5ALCH 2BSTA 4OLUL 5E8OB 3ZVVA 4R90H 1IGIL 4TS6A 2NYKA 2CO4A 3O4LE 1DBKH 2N1KA 4HC1A 3KCWA 4XXDA 4FL4C 5DJZB 3RBGA 3QNXA 5CN1A 4FX5A 1FBIH 1T1XB 4Z0XB 3KYNB 5FGBC 2AXJA 2CHNA 2EDFA 3N41F 2XWCA 4CVXA 4AT6A 3FBQA 1FLRH 1QUPA 3N91A 3LIUA 4JPVL 5E99L 2IALB 3UTSD 3GI9H 3PLYA 4IOSD 5IP4A 4QTHA 5ALBL 2GCYA 4MA7H 1M1XA 3O8XC 3QHFH 3VSQA 3HZVA 3VXRD 1WT5A 5I1DA 3JWOL 3MLVH 4KKPA 4NHUA 1DJXA 4BZ2L 4H8WC 2WD0A 4ANWA 1X5KA 5A1AA 1CU4H 2VL5B 2ZXCA 3KJ6L 3P73A 4DUWA 1I3UA 5AL8A 4OR1A 1J5CA 5IFJA 3MLTA 1VPOL 2V9QA 1U91B 1DVFA 1QFWM 2ZYRA 4LEXL 4TUKH 4XOAA 4PVBA 3ECBB 1GC1C 1JMXA 1MRCH 1M4KA 2EO9A 2X1WL 3CBRA 4J3UA 4ZXBC 2VLLB 2NZ1A 1KCRL 2Z7ZA 3VFPA 5I0XA 2AK1H 4HSQA 5IHUL 3LXAA 1P4BH 3FSOA 5FA3A 2JKXA 3WFHB 5CILH 2DQJL 9PCYA 2CMRL 4OZIE 1YEDB 3HB3B 3MLZH 1M9WA 1IFRA 3ARBB 4X6CE 5HHOA 3TJHC 2EE0A 5HD8C 4FXTA 2GY7B 5DRZA 1HZHL 1I1AC 5FGCE 4MA1C 4GG8A 1YO4A 2UZYA 1JG9A 1ODAA 2FNWA 3FONA 2ICEC 3OBAA 4JO4L 4GXVH 1QRKA 3GHBH 1SY6A 4OZGE 1NBVH 4K3JL 4IU3A 3SKNA 3OJ2C 4MSWB 4PJIB 4KZEL 1Y18A 2BLFA 2D03H 3P69A 4IK7A 3EZJB 4IHBA 5GIRA 1M7XA 4ABUA 5JA8B 2ZICA 3ALWA 3VFMB 2AGJL 1KCSL 1SJEB 1MFAL 3FF7A 3GZPA 2ARJA 3DURB 1AQKH 1HX0A 3KYOA 3D39D 1TVBB 2HRGA 1GOGA 3BPLB 1RP8A 2WBJD 1KPRB 3QCTH 1R4XA 3TFKC 2DWSA 2WVSA 4RFOH 1V54B 3TVMC 5K1NA 2ADFL 1LEGA 1EMTL 1SEBA 4P04A 1M53A 4MZ3A 2AEPL 2BSSA 2ZAGA 3X12A 4Q89A 1DLFL 4JCWA 1HFUA 1A2YB 1HOEA 4ECNA 4F7EB 4PGBA 1A6UL 1NOFA 1DDTA 3RNKA 3WEMA 1S9KC 3L6FB 2B2XL 3QUMA 3U7WH 1FNGA 3ILPA 1J0YA 3AT0A 5FK9B 2CQVA 2A9DA 5K9QG 2VDRB 3TP4A 5HGHB 1UCBL 1Q9KB 3F3HA 4PRHD 1TTBA 5KS9F 1H6EA 4ZYKA 3MJGX 5EC1A 3T2LA 5C0BD 5FUZH 2LLLA 3ET9F 4YQXH 1UZ6E 4HWEL 4FQLL 4RBPH 3IRZA 3ZDYF 4CA4A 4HIIB 1EHXA 4Q9RH 5BMFH 4MXWH 4RAVB 3WMQA 4JBSA 1J1XH 4UNTA 1XX9C 4B9FA 2XRAL 4AL8C 1UD8A 5F6HI 1HDMB 1JV5A 2V0AA 4WHYH 3ZY7A 4MNHB 5A3IC 4XNQA 1RVFH 2W0LA 5AVWB 5KVDH 4