1ZDSA

Crystal structure of met150gly afnir with acetamide bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
335
structure length
335
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGGNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title A rearranging ligand enables allosteric control of catalytic activity in copper-containing nitrite reductase.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 87
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1zdsA02
3NJJA 2IDFA 3X1NA 2BP0A 3BQVA 4YVNA 3EH4B 2AZAA 2HX8A 1KDJA 5D4IA 2GIMA 1AACA 2Q5BA 2QDVA 3OMNB 1KCBA 2FQDA 4A2DA 4A2FA 1JZHA 4DPCX 3GXUB 2GC7C 2W88A 4NB7A 1AOZA 4Q89A 2YAQA 7PAZA 2XU9A 2PP9A 4YSTA 3FSAA 2UXGA 2PCFA 5D4JA 4E9SA 1SDDB 2JFCA 1PCSA 1PF3A 1URIA 2PPDA 5PAZA 4BWTA 2LLNA 3QJVB 4HCGA 4KO6A 3FU7B 1OCZB 3WI9A 2XWZA 4UF7C 3FS9A 4JHUA 2GHZA 1PNDA 2UXFA 4DPBX 1DYZA 2VM4A 3IN0A 3QJQB 4G7RB 1L9OA 2FT8A 1A65A 3ASOB 4N4YB 3T9WA 4K9JA 2HXAA 3NP3A 4YSSA 4GY4A 3ABKB 2DWTA 1BEXA 4NERA 1J9TA 3ZX1A 3FYIB 3MBWB 9PCYA 5A7EA 1JXDA 1AQ8A 3FSWA 5AKRA 4WTQA 3AG2B 2FQFA 3OD3A 2X87A 3S3BB 3H56A 1GYCA 3HB3B 4G7SB 3TA4D 4AKQA 4NAJA 3PPSA 6PAZA 3KW7A 2FWLB 1NDTA 3UADA 1WS7A 1AANA 3AG1B 4MFHA 3IEAA 1ZDQA 1NINA 4EF3A 4P5SA 4DP6X 3NJGA 1NIFA 1ET8A 2BWDA 4QKTA 2FQGA 3AG3B 5I6LA 1ILUA 2QPDB 4DPAX 3T6XA 2FQEA 1OE3A 3S3CB 3UGEA 4HALA 1X9UA 1PAZA 2HX7A 1SHXA 2A3TA 4KO7A 2XXGA 4BWUA 1F56A 1AZNA 1MDAA 1FFTB 2ZOOA 3QQXA 3PAZA 3UABA 1PMYA 1KBWA 1MG2C 1V10A 1CYXA 1OOWA 2J55A 2UXVA 1NWOA 3NJHA 4E9YA 2BP0B 3NSYA 4DP8X 2DY2A 3NT0A 1KGYE 2HLEB 2XV0A 5I6OA 4M4RB 4KOBA 1PZBA 1UATA 3NSDA 2Y1AA 1GY2A 8PAZA 3H4HA 3X1FA 1PY0A 3ABLB 2EINB 4X4KA 1GS7A 5I5IA 1CYWA 3QJRB 3FU8A 5F7AA 1ADWA 4G7QB 1BYOA 2OV0A 2BO0A 3JT2A 3S8GB 5F7BA 1A4BA 1EHKB 2VMJA 3X1EA 2PP7A 2VM3A 1I53A 4G71B 4YSUA 1L9SA 1FWXA 3CVDA 3WNIA 2Y69B 2ZWNA 2IWEA 3T6VA 4M3HA 4DP7X 2R7EA 4GP8B 3DIVA 1TEFA 4WKXA 2I7OA 2FTAA 1NIDA 2VW4A 3NJNA 4FAAB 1W6LA 3IE9A 2VW7A 1BAWA 1L9QA 5TK2A 2AANA 4AKOA 1AS6A 1BXAA 2RACA 1BQRA 1ZDSA 2YQBA 4AI7A 1A8ZA 2FJSA 2UX6A 1WA2X 1ZPUA 3CG8A 1OF0A 3SBPA 1SNRA 3WKPA 1JXFA 5D4HA 1L9PA 2XV2A 3X1BA 1CC3A 2EILB 4JHVA 1ASOA 1NIEA 1NZRA 1ZIAA 4UAHA 3QJSB 2AFNA 1JERA 2IAAC 3PCYA 4HCFA 3T6WA 2YAOA 4BXSV 4A2GA 2EIMB 1E67A 1KV7A 4HCIA 4QLWA 3FSZA 1XB8A 3OM3B 3OQRA 3D12B 3PLYA 4HAKA 5B3SB 3ZDWA 2PPEA 4YSDA 1ASPA 1NPJA 5TK4A 2FT7A 3MX0B 3EH5B 5B7EA 2GSMB 1XB6A 1HAUA 2MTAA 1E5YA 3AY2A 3CDZA 3ERXA 3GDCA 2VSKB 1HFUA 3NSCA 2XVBA 3IN2A 4L0PB 1GSKA 1W6WA 1JZJA 1XMEB 3NYKA 2YAHA 4GXFA 1RZPA 2XUWA 4G70B 5EHFA 1JZIA 4KNSA 4BDVA 1XB3A 2YAEA 2PPCA 1AIZA 3OMAB 3NJLA 1WA1X 1OV8A 2GI0A 3DKHA 4YSRA 3PAUA 3AG4B 2HRGA 2XYBA 1GY1A 4JKNA 4YSPA 1NTDA 3DTUB 3EHBB 2CBPA 4E9QA 2DV6A 4E9RA 2XLLA 4KNTA 1KCWA 1EZLA 3GYRA 3PAVA 1J9RA 4YSAA 5I6KA 1CURA 1L9TA 1QNIA 3S8FB 1SF3A 1A3ZA 2JXMA 2VN3A 1V54B 3FYEB 2CALA 3SBRA 3G5WA 2MRYA 3X2QB 4BK5C 4E9VA 1PZCA 4HZ1A 2R7EB 3NJMA 1VLXA 2WSDA 3RYMA 3T71A 3HEIB 4E9WA 1GW0A 1PNCA 1NWPA 3WKQA 3SBQA 3FQ1A 3V9EA 3FQYA 3BVDB 3NJIA 5LDUA 3EH3B 5I28A 4A68A 1E30A 2ZXWB 1AZCA 3TU6A 1FA4A 2CCWA 4A2EA 4YSOA 3T6ZA 2H47C 1J9QA 3QPKA 1T5KA 3TBBA 3CZUB 2GB2A 4AX3A 4HHGA 2Q9OA 4CSZA 4E9TA 2WO2B 2YAMA 3ZIYA 2CUAA 3OMIB 2BW5A 1SFHA 2CAKA 1WA0X 3AZUA 1GR7A 4HIPA 3IBOA 1IC0A 1JZFA 2VSMB 2TSBA 1J5CA 5AZUA 2W8CA 4A2HA 4W1TA 4RH4A 4GP5B 2HX9A 5FC9A 3CDZB 2IH9A 1PZAA 5PCYA 5B1KA 5I6NA 5I6MA 3UAAA 1NIBA 1R1CA 1AR1B 2YAFA 3ZBMA 2J56A 3WIAA 4N8UA 5B7MA 3ABMB 1B3IA 4PCYA 4KOCA 2X88A 2BZCA 2DYRB 2EIJB 1M57B 4DP1X 2XX1A 5B7FA 1BQ5A 1KBVA 3FU9A 2IWFA 4KO9A 5B1AB 2XXFA 4BDVB 1TKWA 1OCOB 2YAPA 1OCRB 4KNUA 1BQKA 1BXVA 1RCYA 2JKWA 1MZYA 1E65A 2BP8A 2HZHA 1SF5A 6PCYA 4UANA 2CJ3A 2IDQA 2N0MA 1J9SA 1QLEB 5E9NA 2HRHA 3KW8A 3X1GA 2AZUA 4G72B 1ETJA 1A4AA 2WO3B 1OE1A 1AZRA 2BHFA 5B1JA 4AKPA 1GS6X 1JVOA 2P80D 1NPNA 2QDWA 2DYSB 2XX0A 1TU2A 1ASQA 1IKOP 1ID2A 1WS8A 2EIKB 2I85A 2I7SA 2H5UA 2GC4C 3AW5A 3L45A 4GP4B 2GBAA 4YSCA 4DP5X 4KO5A 3FQ2A 2IWKA 3WG7B 1PLCA 1L9RA 1SHWA 3NJFA 4TXVB 2BW4A 1KDIA 1NIAA 2IDSA 5B1JC 1IBZA 4ZK8A 2UX7A 4YVUA 3FSVA 3SQRA 1JXGA 3QJUB 3N2JA 1JOIA 2FNWA 4P5RA 2BZ7A 4F2EA 1MG3C 1SDDA 2IH8A 3NP4A 4DP2X 2VW6A 2YARA 3CVCA 5IY5B 1X9RA 3CVBA 2IDUA 1CUOA 5I26A 1N68A 1IUZA 3NSFA 1OE2A 5AFAA 1JZGA 1V55B 3FT0A 3FU7A 4DP4X 4FA7B 3C75A 2IDTA 2ZONA 2PPFA 1AAJA 3PXLA 3EF4A 4HHWA 1JZEA 4W9ZA 3ABGA 4E9XA 2FT6A 3UACA 4CSPA 4YSEA 3FPXA 1E5ZA 5I6PA 4BWWA 4F2FA 2B08A 1GS8A 2BWIA 1N70A 1PLAA 4A66A 2J5WA 3S3DB 2XV3A 4GYBA 1JVLA 1MZZA 1AZUA 1OCCB 1W8EA 3NJKA 3TBCA 1DZ0A 1ET5A 2DWSA 5ANHA 1KYAA 7PCYA 1IBYA 1TEGA 2QT6A 1AS8A 3H4FA 1AS7A 1WAEA 4A67A 1ZIBA 4YSQA 3V9CA 1J5DA 1NICA 2PLTA 1AG0A 3JTBA 4F7KA 2TSAA 2E86A 2YXWA 2OCCB 2NRDA 4YL4A 2QPEB 2BP8B 1A4CA 1AZBA 2OJ1A 1SFDA 3ASNB 2PPAA 1RZQA 4PAZA 4Q8BA 2P80A 2YXVA 1ILSA 3UAEA 1ET7A 2H3XC 2PCYA 1YLBB 3FPYA 4DP9X 2AVFA 2PP8A 5B1BB 4ENZA 1M9WA 1SJMA 1ZV2A 1HAWA 1RKRA 1M56B 3N55A 2B3IA 4AZUA 5I5MA 5I5JA 4DP0X 3WNJA 1PLBA 3QJTB 4BXVA 1AG6A 1BXUA 1BYPA 3U25A 2J57A 1QHQA 2UXTA 3TASA
chains in the Genus database with same CATH superfamily
4CA4A 4LGRB 2HJLB 3QO1B 2YQ2A 3QDJD 1CLZH 3L2LA 1O6VA 4K8RH 4M3KB 1BQHA 1EIBA 4JDZB 5ANME 1ZA6A 4TQEH 4RQQB 2FJFB 2DRUA 4LPVA 5D4IA 1KCUL 1T7ZA 2QDVA 1DQQA 5IB5A 1SEQH 2FR4B 4N9GA 4DPCX 1S8DA 1FZMA 2BDNH 1K8DA 4ZFGH 4UQIM 2ATKA 2NXYB 1CDHA 3HRZB 3VDCA 3DGCR 3PXHA 2AXGB 4TTGA 4GIPD 4MA8H 2XC8A 3QXUA 4LBEA 3ARTA 1GZHC 2OMWB 4FG6D 3SD5A 4JPKL 1PF3A 1URIA 5LXGH 5KW9H 2EYTB 2XYCA 4UI2A 1NDGB 3MU3A 1UJ3A 3ULVD 5HHNB 3FU7B 4XPHL 7FABH 4RLDA 1UM6H 3L5XH 2VT0A 2CDFB 4MYWB 4DTGH 3S88H 1J5OL 4TTDC 1EH9A 1X6LA 3VXSE 5EBMB 3DETD 1SLVA 4GIOA 2EUXA 1T5XA 1T4KB 2E7HA 5CCHE 2D03L 3LEVL 4H25A 2HXAA 2N7BA 4XHJC 4Q97A 4HKBB 4Z7UA 1BD2E 3ABKB 3VWJC 2GUYA 5FLUA 4WI4A 2YRLA 5FYKU 1A6AB 1S9WB 1BX2A 2H4EA 4N25A 4XB3A 4MS8D 4QRSA 1P1VA 4TNFA 4EUPH 3UXFA 3VM7A 4LCWA 5T5FA 5L4IA 2Z7WA 4J3UA 1KT2A 5KOMC 4AMKL 4JFUA 3WTXA 1J1OL 4OLEA 4PN6A 2WWMD 3GMRA 5IHUL 2A9NH 2IEPA 5DWUL 3CPLB 4JANB 3IAGC 3PQYD 1NKRA 3KW7A 5CIPH 2Q87A 6PAZA 4P2RD 5LQBL 1FG9C 3DBSA 5HHOD 1R33A 5EEUA 2WWOA 2EKSB 1DBKL 1C5BL 4JX0A 4OI8A 2EDBA 4BKLB 1A6WH 1KFAH 4NIKB 1WAAA 2N1TE 3PL6B 5BV7H 1FIGH 1AGCA 2K7QA 3I6SA 3LZPA 4S1QH 4PRBB 1I8KA 2QPDB 4ODHL 4DPAX 4H0LC 4CN1A 2VCOA 1TDQA 4YHNA 3CFCL 3CVHL 1T4KA 3FCBA 4CBZA 3RTQA 3P02A 1X9UA 2CO7A 5FM8A 1KCUH 4MA3A 4FFWD 2PXYC 4MCZA 3OSKA 4ZTOL 2F1EA 1KGXA 4XAKD 5EIQA 4R0LA 4BSVB 1AGEB 1WFTA 5C9KA 2CHXA 1T6WA 1E8XA 2MH4A 2MCMA 3UAJD 2FB4L 1ZT7B 3D39A 1UWGL 1A1NA 3G6AA 2OMTA 4OSUL 1NWOA 2X1WL 4JPKH 1MHHB 3TV3H 1YRKA 5BRZE 4DP8X 4ZFFA 1TJHL 1MJUL 1N6UA 1I31A 4XPHH 4JPSA 4J2XA 1MFMA 4PRDB 3TA3D 1HDMB 4OD3L 1XGTB 1J5OH 4XWOD 5JPMC 4KJYA 5JO5A 3DHUA 3B9KB 4CJ0A 5I5IA 2LLLA 1S9YA 1JUFA 1OTTC 2D03H 3LEVH 3D5OF 4FXLA 3QYCA 5IHBA 3DTXB 1E27A 1E3FA 3A3YB 2YS4A 2G9HA 1OW0C 5IFJB 3QIWD 1PKQA 3O3AB 1EZVY 3WIIL 5JDJA 3LD8C 3MV7E 5I1LA 4F9PC 4NEHB 4N6RA 1GKOA 4PVNA 5KSVA 4AMKH 5SV3A 4EZKA 4NCDA 1J1OH 1AYRA 3GXNA 1I1RA 3CU7A 2E4FA 1ZWIB 4BFOA 2CNYA 5IHUH 5DWUH 1TCRB 2ZWNA 5I82A 4DP7X 2J8UB 5LQBH 4LCUA 1U3JA 4DQAA 3EOBA 4J1UB 3QXTA 1H6UA 2IJ0C 3HZKA 4FMFA 1INEL 4YZFF 5F89B 4FAAB 1DBKH 1C5BH 1N0XL 2VW7A 1HKLL 4G2AA 5AYUL 2O5YL 1N6VA 4PJIF 2W9EL 3OVUB 5DQ9B 5CJ8A 4FRWA 2UY6A 4LDEB 2ICEA 3BHBA 1XGTA 1BVLB 4HKXB 5CD3A 2WNKA 3G08A 4LRIA 1MH5A 2I26N 3CFCH 4LESA 3RILA 3CVHH 4K7PX 1L9PA 3SE8L 4P49A 4ZD3L 4ZTOH 1MCDA 1ASOA 2WN3A 5FGRA 1OQXA 5B39A 4P06A 1XCTB 4DO5A 2FB4H 1SXZA 1OSPL 1UWGH 2XSKA 2CO1A 4OSUH 5J5EA 2BHYA 1ND0A 1FPTL 4JDVA 1MJUH 1MI5D 3OGCA 2EEDA 4DEPC 3X12B 3PIQA 3ZDWA 2C26A 1WFJA 3VA6A 5E6IA 2LU4A 1KIPA 1RZJC 3MX0B 3QIUC 4HH9B 4LLYA 5ANMA 4OD3H 4WF7A 3AB0B 5I1HL 3MTRA 4RRPM 5DA4A 5I73C 1HHKA 2QADC 1XEDA 3QWRA 3FCTB 1RHHA 2RAMA 3MR9B 4OF7A 4HKXA 4WK2B 1OLZA 3HG0A 4XZUA 5DGQA 4PP2B 3WIIH 4EDXB 5CEYA 1B0RB 2WP3T 4EN3B 4N0FB 3U48A 2OL3L 4Q14A 1COBA 3K5SA 3Q8EA 4X9BA 4QHKJ 1EJOL 5GHWL 3TESA 3ULAB 1KXVC 3O6FD 1THCA 2CHZA 4LDLB 4WHYH 4M43L 3BP4B 1SXNA 3LNIA 1I1AC 4JY6B 2NY3C 2K78A 4K3EL 4HMDA 1DQJB 1NCOA 2ROXA 3BKJL 1INEH 2VR5A 3HE7A 3K3QA 5TH2B 1RV6X 4JLRA 1N0XH 1HKLH 5AYUH 2FNBA 2O5YH 1QEWA 3MMEB 5JIHA 5C08A 3EDEA 4D9LL 3QIBC 2W9EH 4FLRA 1BD2A 4U1MB 1DE4B 4EIZC 5IMMA 1E4HA 2WNWA 4W68A 1ZAGA 4X6DE 5CN1A 1IKNC 1XEUA 3DSFL 5HXMA 1AHWC 4BV1A 3G5WA 4QAMB 1EWHA 4PG9B 4F7TA 4BK5C 3SE8H 1FFNB 2ICWJ 4P4RB 1I1YB 3S37L 4RMVA 4Q9QL 3QNZB 2YMTA 3SE3C 2PYFB 4WW2A 1F02I 5DD0L 1B0RA 4PRHE 2AK4A 5TDNB 4AYID 2VMDA 4HP5A 4ZODA 2WY3B 5E95B 5C7ZA 4XBGB 3S4SB 1SOXA 2XVKA 3FQNB 2Z9TA 1FPTH 5GS2D 2UZXB 3FFCE 1VESA 3QEHB 4ATTA 4FTDA 4U0RC 1NOAA 1F45A 4FMKA 4A2EA 4JHWL 3DJSA 2IH1A 2Z65C 3H42L 1KJ2A 4MRCA 2H47C 4KRPD 5I1HH 1ZGLA 3AGVA 4B50A 1F4YL 4NUJA 1RL1A 2MNUA 3OV6A 1P9MA 2GB2A 3K4DA 3QXAA 3VNZA 5I8KH 1O7VA 2ZUTA 4LOUD 3UTOA 1G7IA 2YEVB 4JRYD 1ACZA 1FYTD 4NC2B 3SO3C 3BD3A 5D7LB 3IBOA 1K72A 1F00I 3HR6A 5J1SC 1IC0A 1KJVA 3AUVA 3BEVA 3BI9X 3ISWA 5AOKA 1NFDF 2OL3H 5M95B 3NUKA 3ZW3A 1Z9SA 2VDKL 3C5ZA 1R0AL 1EJOH 5GHWH 4WI9A 3C60D 5C0NC 1TVHB 3EHBC 1N3NB 2YA1A 3OKDB 4M43H 4AIOA 2F53E 4RSVA 5B1KA 5I6NA 4HFWB 4XX5A 3GRGA 1CO1A 3EDFA 2Q76B 4K3EH 3HMWL 2IQAA 4X83A 4AK2A 4X4YB 2J56A 2AKRA 3BKJH 4FFVD 4MZ2A 4YFLF 4KTGA 3G6JB 4D9LH 5KYNA 4DOHB 4PGCB 4RGNB 1UKTA 1KBVA 3FB8B 4Y8DC 3DSFH 4TV3A 5LXVA 2XIBA 2B1OA 2ZP8A 1G9MC 4K73A 5HVFB 4M5TA 2MTPA 3ARFB 4ZFZB 3S37H 4Q9QH 3S96A 2J88L 2WXKA 4F5CA 3GINA 5DD0H 5E1QA 5ITBL 3LXCA 3MUY1 5AOJA 4L4VD 4ESKA 2R1XB 5L0QB 1JHLL 2F8IA 3T0XA 2QVTA 3UTZA 2X1XR 3IF1A 1KTKE 2HRHA 2IMNA 4Y1AE 3NPZB 1DCEA 3B4NA 5GSVB 5JHDE 3V5DA 1B0GA 3RX8A 1D5BA 2AJYL 4XXDB 4H8VA 4MNQB 3BDYL 5T1MB 4JHWH 3H42H 1N4XL 2HG5A 2J6EA 3KWVA 4ONHB 3LVEA 5F6IC 3UZEC 4EMZA 4KFZC 1LMIA 5EBWB 5GSRB 5IB1A 3RJQB 3WKML 4BFBD 3LRGA 2BNQB 4HDIB 4L8DB 4I2XE 4YSCA 3MROB 4HIHA 4KO5A 2CK0L 4TLTA 1AOHA 3DPBB 3UTTB 1R9FA 1Y18A 2V7NB 5BS0E 3E80A 4EI5D 4P04A 4DFIA 5EWIL 2IPKA 1KDIA 3PNRB 2VDKH 3CFIC 4NCC2 1R0AH 3HUJE 2AERT 3TBTB 4CVZB 1G9ML 4MQXC 1NGYB 3BWUF 2M2DA 3MRLA 4KH2A 4Y4FC 3F58L 4P5RA 4X6FA 3TN0D 1E90A 4QHNA 3KAAA 4TNWF 5MEOB 3NH7L 1WC7B 2FWOA 2YARA 3HMWH 3PJLA 5I17B 5EIIA 2HCZX 3NSFA 4MWFA 4A7VA 4AW4A 1INQA 3IM1A 4XMPL 3F01A 1AHKA 5D1QA 4KKBC 1RJYA 3A47A 1FJ1B 2PPFA 4QT5A 1SVZA 2X4OB 5HDWA 1MAJA 4IHOB 2ENYA 5EUKB 4E9XA 2VLRD 1AHMA 3HPJB 1GGBL 3GS7A 3L4TA 3UG5A 2B3RA 2PYEE 2YWYA 5F7MC 4D9RE 2IAND 2J88H 4PJDE 2NTFA 5CCGE 4MBOA 3S3DB 1HQ4A 4R7VA 5ITBH 3TBCA 1CT8A 1MXGA 1DEEB 4JFFD 4CVUA 1XGUB 4L8SB 1FN4A 4JQVC 4MSWA 2WBJD 3FCSB 1PZSA 4IMKC 2OZNA 4NQEE 2Q1EA 1DDTA 3ORJA 3K8MA 5T1KB 4OIIL 2AJYH 4P2AA 4LEBA 1SBBA 3FB6A 2ZSVA 1IAIM 3BDYH 5I17A 2ITFA 2WCSA 2OZ4L 4X6DA 3UJIL 4NZTL 1X5AA 3KWWA 3FDWA 4KY1L 5AW9B 1N4XH 2BVTA 2YD3A 4PLKD 3QXDA 1E5BA 4ZUVB 3WKMH 3QI9C 2KKQA 3D2UD 4DP9X 4X6CB 4X5LA 5I15L 4N2EA 2A83A 2JK5B 3VTMA 4PRHA 2HAZA 1BGXL 3GRWA 3BQUB 5EWIH 5I5MA 3HMXL 1G9MH 2APBA 3FFCA 4L9DA 3RGVA 1QHQA 2ZXCA 3NA4A 2CDEB 2X10A 3F58H 4HWUA 4IGBA 4QR7A 4BK8A 3NH7H 5IF0B 5JIMA 1XF4A 5BQDA 1FNHA 3BCFA 5HVHC 2ZUUA 3CX2A 5ICXB 2NPLX 2GIXA 2JSFA 4O02A 3LIZA 4QNPE 1UACL 5DJYB 1KXTA 5FYJL 5IEKA 1IM3D 2XWTB 4K07A 4XMPH 1WD9A 2GJ6E 3DMMC 1CDGA 3QWNA 3RDTC 1DJZA 3E3QC 1UD5A 1SLWA 3QHFL 4ODWB 3NACL 1NC4D 3CHOA 4H8WL 4JO5A 4D0CA 1GGBH 1SDDB 1UH3A 1PVHA 1KY7A 3V0FA 4X0NA 4HKZA 3Q5YA 4ZFOB 2OBGA 1TZOA 2F53A 5E8EA 1CD1A 1OCZB 3T3PB 5EZIL 2BCKB 4ZUTA 1CICD 2H32A 3MUUA 5C2UB 2PR9A 3QJQB 4NNXA 2A6DA 5GS0D 4BFIB 3AS0A 3EJTA 2ZOLB 4OIIH 5AW3B 3NP3A 4IRSA 3AREB 4FQXD 1F4WL 2OZ4H 2DQHL 4Y2OA 4QWWC 3UJIH 3VJ6B 3AJ7A 4NZTH 1V05A 4FERA 1Z3RA 4KY1H 1U3HB 4RVBA 2WVSA 4JHAL 2EDTA 4PGDA 3U46B 3JWNG 2PABA 2WP3O 1BAFL 1T0NB 4RMSA 1UVQB 1JWSA 3QQ4B 5I15H 3QUYD 3N41F 1XXFC 3T0EC 3II2A 2K6YA 4UUJB 1BGXH 4XH2A 1EUUA 5DDHB 3UADA 3VXRE 2FJUB 1BPVA 3IEAA 4Y1AA 4JFHE 3IPFA 4LSDA 3UPRA 3QDMB 3HMXH 3W39A 3T8MA 5HHQB 4U6TA 5I1GL 3F7VA 3G3LA 2XWDA 3PWVB 4NO3B 3SKNB 2D0FA 2OR9L 3FRUB 1YEGL 4HWBL 4MNGE 4CN6A 5J4MA 1I1CA 5GGTA 5D1ZA 4J6IA 2DM7A 3LH2H 1VERA 1UACH 1QD0A 4MDIB 3VWJD 3X13B 5FYJH 3V5KB 2VN5A 4KO7A 3NAAL 4I2XA 5ENWB 4GB9A 3VJ6A 4AQ1B 3T65A 1A7RL 3HTLX 4Q6IC 4IKNA 3QHFH 5IMLA 3QQXA 2AJXL 3D18A 4PGEB 1LJMA 1RJZA 3GSRB 5DHVA 4H8WH 1GIGL 1XZ0A 3NIFB 1F13A 4FJYA 3HUJA 3US0A 4F7EA 3SGKA 4FKHA 1G1KA 1R6VA 3OKOA 4QTHA 4MJ5B 1T6BX 1LD9B 3MGOA 4AC2A 5EZIH 1BM3L 2NT1A 2JQAA 3IDNA 5J57B 4JCWA 3WDIA 1OKEA 3MJ9L 1MF2L 4XX1E 2YHGA 5IFHL 4NHCL 3K5RA 1T7XA 1CYWA 1YUHB 1BG1A 4R5VA 1F4WH 5JR1L 2DQHH 1OGPA 4H1LH 4OAWB 2PXYD 3HAEH 5F70A 3KVPA 4JHAH 1RZIA 5JIQA 1BAFH 2PYEA 4JUSA 4ZX4A 4JE4B 3WLWC 1LWRA 5CZKA 4M1CC 4PJDA 4G71B 4X5XA 1KTRL 3MV8D 1CYGA 2UZYA 1FZJB 1KBKA 4HYTB 1NAML 2EYSA 1CFTB 2RH0A 2Y69B 3CBJB 4GBXB 4M3HA 1IL1B 1IBDA 2Z8RA 4OGYL 3OR7A 5D6CB 2CH8A 4U7SA 2BNRB 4NKIL 3N91A 3R8BB 1O0VA 3NJNA 3IE9A 2AANA 1KYOK 3D06A 2H9GB 3VMPA 5I1GH 4MMZB 1SGKA 3HHRB 3KEHA 3QJZA 2OR9H 4HWBH 1YEGH 3AS1A 5F7LB 1LDPL 3WUZA 1QSZA 4HJJL 1ZPUA 5CN3A 3HZMB 1HE8A 1HILB 4FYQA 4LLUA 4Y19B 3ECQA 1FLTX 3GXDA 3II1A 2IADA 1TNMA 2VUYA 3NAAH 3O2VL 4AQEB 4CMHC 2JKJA 4ZMWA 4XBEL 2VR7A 3KEDA 3RWIB 1Q0EA 2VRQA 1JERA 3KDPB 4QRPB 2AJXH 1Z0MA 2YAOA 4BXSV 1BFSA 1MCEA 3TIEB 1GIGH 3QBTB 3HBPA 2DMKA 3GMPA 3OKEA 3GDBA 3QUZB 2ARJB 5CGYC 3U1PA 3WIFA 4AV4A 4AXWA 4ZS6D 4GJTB 2VXVL 3PLYA 1H6TA 4YN3A 4GBXA 4EOWL 4D0DA 5B3SB 3DJ9A 4EN2A 4PWJA 1BM3H 1H3XA 2FVNA 1N64L 1ZANL 4B9ZA 3MJ9H 1MF2H 2RHEA 4CKVX 5DJ8A 3AY2A 2WINB 2X4RA 5IFHH 1QNZL 5IHZB 3RWJA 4WUUA 3JTTA 2GJ6A 4IS6B 1REIA 5KZCB 5JR1H 2Y07L 1S5HA 5IJCC 4NQSA 5E00B 4PRIB 1HWWA 3BUIA 3CXDL 4Y5YC 3N6YA 5D7KD 3QH3B 5DFAA 5DHXB 3EGDB 3IU4L 3VFWA 3U4AA 2J5LC 1NAMH 1YMMD 2Z31D 2PPCA 2WBWB 3O4OC 3F12B 3VE0B 4RIRA 1D6EA 1FE8L 4OGYH 3MA9L 4XN7A 5EEYA 2FD6L 2IV9A 4A1RA 4NKIH 4TVUA 4XRCA 3DO3A 3IPEA 3VWKA 2CBPA 5E6ZA 3D05A 5E4EC 3L3DA 4H20L 2WQ8A 1LDPH 4HJJH 4PCTA 3MGAA 2CJSA 2VN3A 4WTWA 5KBKA 2MRYA 2D31A 1E42A 1FVDA 3GQFA 3O2VH 2CNZA 5EZOL 2WSDA 2FEEI 4XBEH 5KVMC 2VDLL 3MLTB 2Y7SA 4XPFL 3ZIMA 4PJ9C 4E9WA 1U8KB 3MBEA 4FTVB 1OP4A 3IETA 3N44F 1Q90A 4CU8A 1QSEB 3ARWA 4L3ED 3QZBA 5BW7C 1YNTB 4UM8B 4KV5E 1N5AA 4ZO7A 1ZKAA 1LEGB 3TURA 2NY3D 2VXVH 1KSRA 4EOWH 4JHZA 5D5MF 1PAMA 2NXZB 3JWOC 5FM5O 1M7IB 1E30A 1ZVYA 4ISVB 3TBVB 2B9AA 2ZXWB 5KJ4A 3T8XA 3QRFM 1N64H 1ZANH 2VZVA 2WOYA 4YSOA 5D7JA 2NY6B 2FX9L 3QIBD 2EJ1A 1T5KA 1T66C 2B8OT 5E5MB 2Y06L 3VDBA 2Y1VA 3CZUB 1AKJD 32C2A 3IXAB 3OJVC 1TO5A 1Z9OA 5F6HJ 2XN2A 2J72A 3CN1A 3ULSB 1ORQB 4PMFA 5MERA 2VDPH 5K69A 2Y07H 4ZMPA 4N90E 3GJFB 4GQZA 5FGBC 2NNCA 4H0HB 5FGCE 3ME0A 3CXDH 1JZFA 2VAJA 1KCKA 2WD0A 4P5KB 2X12A 2OMXB 3KWUA 4NENA 2E59A 2W8CA 2ICCA 4A2HA 1MVFA 4Y5XA 2AQ2A 2YD0A 3IU4H 4OD1H 3ZKMD 5JOPD 1OB1A 4J4PD 3C6EA 5D1ZI 5CSGA 4X0KB 1FE8H 3UAAA 3MA9H 3VTTA 4RSYA 2BVEA 3ZMRA 1H15B 2FD6H 2JJVA 4JKWA 1YNTA 1BJMA 3IDJB 5GS1B 1OGAE 4RMTA 3JBG7 1B3IA 3T4AB 4D8PB 4E5XB 4IBQA 3WIHL 2AQTA 2Y25A 1E4XL 2BVQA 4N2FA 5EBGA 3V79C 5AKTA 2AJUL 1BQ5A 4H20H 2CO6A 3LAFA 1I8AA 4HK0A 2GAZA 1HL4A 4NN6B 2V9RA 3C6LC 3JWOL 1F86A 4M56A 1U42A 3V6BR 2JIXD 2KDYA 4MA1C 4FN0A 1L5GB 1H6EA 2A5UA 5EZOH 1D6VL 1I9RL 4YBQC 1I75A 3K0WA 1HQRB 5I8EA 5ICYB 1Y7VA 2VDLH 2HN7A 5LB1A 1F58L 4NAMA 4XPFH 5T33L 3ULVL 1B4LA 2OMXA 4ONOA 2R0KL 3BPOB 5CR8A 4I48B 4NT6B 1QLEB 3MKGA 4OCMC 3QUMA 4ENED 4ANXA 4NUMA 3ZU8A 1F1GA 3WD5L 3SGDH 2FX9H 3C2AL 1KCSH 2XBZA 3BWUC 3DI3B 1NPNA 2Y06H 1ASQA 1ZLEA 2R2BB 2F7IA 3KCPA 1GH7A 2XJLA 3BVNB 5HYJE 1XTLA 5C0JB 5IVXE 3THML 1L9RA 4ES8A 3ARDB 4JFED 1TZGL 4MD0A 5HJBA 1PDKB 1U91B 4UBDD 5CN2A 1M05B 2JI1A 2HT3D 2QPUA 2D73A 2X4UA 3IPBA 1RK0A 5B1JC 3VFMB 4APQA 4HC1L 1CGVA 4YVUA 3WFCL 2VZ3A 3GLDA 3ARQA 1EZSA 2JQZA 2VTFA 5KSBA 4H8PA 2BP5M 5C0EB 2ITCA 1X9RA 2KYIA 4CMMA 4IYKA 2AEPL 1BQHG 3IDIA 1JZGA 3G5YB 3WIHH 4LCCB 1Q0XL 2C9VA 3D4CA 1E4XH 4DZBB 2AJUH 4FNRA 4BH8A 2VLLB 2ZWSA 4M8QA 3KGUA 4Y7OC 4JJ5A 2YD7A 1BFVL 3JWOH 3VNYA 1YEJL 3CLEL 1AGDB 4L3FA 5K39B 3KXFE 1V7ML 3BSGA 1YC7A 1E0OB 1TQWA 2ZKYA 1X9LA 4YGVB 4NKOB 1D6VH 1I9RH 1ZSDA 4PTUB 2NUPB 1ACYL 1J1PL 3ESVF 4JMNA 4BE6A 1F58H 5T33H 3ULVH 2JJSC 1DSFL 3O3EB 1NFAA 2BSTA 3F2LA 1DUZA 3F85A 2R0KH 4Y9EA 4KI5F 4U49A 2CSPA 3V6OE 3SPJA 3L3OC 4PJ6A 1GOGA 2NW2B 2K3HA 1G7JA 2R0ZL 4J3OF 4KQ3L 5BZWB 4OLWL 2PLTA 2YD2A 4FS0A 2HFFB 4X2UA 4G8EB 3WD5H 5C0DB 5I16B 2NRDA 3VGFA 4I9XA 4JO8A 2VC2L 3C2AH 2PO6C 5AVRB 1U8JA 4W70A 4CL7A 4CGTA 3NBNA 1FGVL 4KDWA 1OEZW 4PJFF 3MZGB 2YXVA 1SOKA 3FQXB 3VRIB 1GTNA 2BXYA 5KN5B 1JGVL 5CNHA 5B1BB 3VRLE 1M1XB 4ETQA 2BSDA 3L4WA 4G8IB 5JIIA 4GW4A 1S9XB 5C0BD 3THMH 5EF3A 3CC5B 1TZGH 5DO8A 2G0LA 1HEHC 1X4YA 1N26A 3ESOA 4HC1H 4JFDE 2AS5M 2WN2A 4KK6C 1MCCA 3P77A 4IEFA 2G4EA 3WFCH 2MKWA 4LIQE 1CIDA 3TASA 1SM3L 2WOBA 4F2ME 3EO0B 3TH2T 1KGJA 3SCMB 4HEPA 3EH4B 4HKJA 2ZUXA 3D48R 4URTB 2AEPH 4EEEA 2ADJA 2VIRA 2Q5BA 5CP3A 1Q0XH 1ED3A 1OGSA 4HIEB 1JZ7A 3M88A 3Q6GL 3V4UL 5FECA 1VACA 1CK0L 5GZOA 3QI9D 1BFVH 1TENA 2JKXA 4S1SL 1YEJH 3CLEH 4N1CA 7PAZA 2XU9A 5EU6B 4AENB 4ALAL 1V7MH 5CCKL 5KVDE 3CZJA 4E9SA 2Z93B 3OHXC 3RAJL 5KYUB 3W9EB 1ACYH 1J1PH 3QAZB 3GSXB 3ILEA 4HCGA 1DSFH 5MENE 3DA0A 1WPCA 2Y5EA 1EFXD 4NN7B 5G5DB 3U30B 4DVRL 1DYZA 1OGAA 4KJPD 3BD5A 3OQ3B 3WEXB 1LP9B 3O8XA 1P6AB 3EYVA 2R0ZH 4KQ3H 4F7CA 4OLWH 5H2BB 3BXNA 2VJXA 4V1DD 1K85A 1G7HA 4KROC 4WWPA 2YPLE 5ADPL 4UQ2A 5CP7A 3KPSD 2VC2H 4NERA 2XA8L 4FFTA 4AOFA 1FGVH 1YPZE 5B3JF 1R3LA 3MNVA 5DI8A 1HVXA 3DX9A 3RDTD 3NK3A 4HSCX 3BPCB 3TH3T 1XH0A 5F97E 1FAIL 2DQFB 2FQFA 1JGVH 3E38A 3QAQA 4Q9BA 5FCUL 5E8OB 4NFBA 3MOQA 2XWBB 1KXQE 3DO7A 4G7SB 5KSUA 5EBLA 4NUPA 3ZZ1A 5FPIA 3FB5B 1MWAL 1WS7A 4Z7IA 3UYOD 5AENA 1ECYA 9CGTA 5ITFA 1FNSL 3RWFA 3N1FC 4TUOA 2UZPA 5FKPA 3JVGC 3W57A 4M5YL 2V9QA 1UZGA 1S78C 4ZUWB 4IIQC 1SM3H 3AAZA 5DT1L 2CM5A 3N50A 2XHNA 3NPSC 1D9KC 3D33A 5DJZB 4ABQA 4DO4A 3MRDA 3DGGA 3H9HB 1EDYA 2CIIB 4KXAA 5T1LD 5ACLA 5I0VA 3CX5J 2P8MB 3C9NB 1TPXB 5E6UB 2OK0L 1IV8A 1OIOA 2J8UF 3MGTA 2YPKA 5EO9B 1XCQA 3Q6GH 2MCAA 5EU5B 3V4UH 2RQEA 1CK0H 2XPZA 3F5WB 2ZOOA 4S1SH 5B39G 4IU2A 4CSTA 2DIJA 1MVYA 1PEZA 4DKTA 2BHUA 4ALAH 5CCKH 1CYXA 4TKWA 3EJCA 5F72S 4GRLB 5E8OA 1SXCA 4MAUL 5KS9E 3NJHA 4OZFA 3RAJH 5J6GB 1TJXA 1JGIA 1I8LC 2H0JA 2N59A 3H2PA 4Z7VB 1KPUA 2DDQL 3H9SA 2GW5A 3ABZA 4DVRH 3QUXD 4C4BA 2MOVA 4IOSA 1X5FA 3L3IA 2CO4A 7TAAA 3FOMA 1BF8A 4X4KA 5I6XB 5DZPA 4NQUA 2W65B 5DJZA 1T03L 2CXKA 3P2TA 1XGRB 2OV0A 5FA3B 2X6CA 1M7XA 2IH3B 3PGCA 4LEEA 5ADPH 5F7BA 4G8GE 4KK9D 1INDL 2XA8H 2C34A 1PG7W 3GSQA 3QEQD 4JAMB 3L7EB 4ZQKA 5I1KL 3COOA 3R1GL 4PR5A 4QOKB 1J12A 1F3JA 1MFUA 3RVVD 1FAIH 3NIGE 5FCUH 3MNDA 4LDCA 2VISA 1MSPA 3AXLA 3KM2A 1MWAH 2H8PB 1T0MA 1FNSH 2FTAA 1UC6A 3BYYA 3QEUA 3V6OA 4OQTA 5GRXG 1KTLA 4QAWA 5E6YA 4IW4C 2DL9A 2ZJSL 3EGSB 5D7IB 2ZKXA 3GMNB 5DT1H 4I5BA 1BQRA 4Z7NB 4KKQA 5F88A 3DUUB 5AB2A 3AXHA 4NO2A 3HG1A 4L1LA 2DN7A 1SDAB 1BVKA 3EUUA 5DLLA 2VMFA 1JF1A 4OZHE 4BIKA 1CN4A 1AIFA 2OK0H 4LSSL 2YZ1A 4LVNB 4P46A 1AXIB 3A6OA 1I8MB 3P11L 1NMAL 4JHVA 2QSVA 3ARGB 4IQHA 1QHOA 4OUUA 3B8YA 1CD9B 4S11A 3K72A 4WFED 4QRRD 3TNMB 1HK6A 5GGUA 3LKRA 4QOKA 4MKTA 3TEXA 3OC5A 4MD4B 2G9KA 3I6KA 1OP9A 2WYZA 4MAUH 1OCWL 3PGFL 2NY4B 1XGZA 2J1KA 3MRIA 4JFDA 2EXWC 3FUKA 2FSEB 5GS2H 3QPQD 1CTOA 2CPCA 4WI0A 3MCG1 3WO4C 4F2MA 2DDQH 3M17B 3UIZA 4P23A 5B8CC 4LBAA 2JB5L 3UMNA 3GSOA 3ERXA 5D7IA 3GMNA 1HFUA 4HUUA 4KUCD 3W0WA 3CTTA 4L0PB 3VFPA 1GSKA 1NGXB 1T03H 1IC4L 1KLGB 1N9PA 3ZDXE 4RMRA 3RVUD 2APTA 1E8ZA 3GI9L 2Y4SA 2BVUA 1INDH 1E43A 3QDJE 1E5UI 2EXYD 4WDIB 1DHKA 1DLHB 5T3ZE 5I1KH 3R1GH 2CCVA 1FO0B 4WO4B 1JNHB 1ETA1 1RLWA 3MLYL 2B39A 3RIFF 1JV2A 2GQHA 3GMLB 4MXWL 4AVKA 1AXTL 5MENA 2OTUB 3R06A 4O2CA 1T80A 4X50A 5D9SA 3DVGA 4DUVA 2Y0SA 2Q7YA 4FQJL 4XP1L 1IEAA 2C4XA 4XMKL 5CKGA 2J2ZB 5GIRB 4PJBA 3KLHC 1LWHA 1IAOA 5FX3A 4DHLA 1NTDA 1GZPA 2ZJSH 4R96A 2H0PA 1EEYA 2DV6A 3ARBA 3IKCA 1FH2A 4KNTA 4WV1C 3W5MA 2GHWB 3NMEA 3PAVA 4MJ6B 4OI7A 2NTSP 1F4XL 2YN5A 1DBAL 3MRFA 4M6NL 5JZ7D 3CXHK 1YPZA 4LAQL 3BAWA 3HA0A 1N0LA 4FG4A 2KZ1B 4K71B 4LSSH 1PZCA 4UDTA 3P11H 1NMAH 3NJMA 2R1WA 3OKNB 4P57B 4BZ2A 1KXQA 2IDCA 2JCCE 3P1VA 3PWLA 3TWYA 4R4ND 5CD5C 3BPLC 4WDIA 3G6JF 1OP5K 4GRMA 1TTAA 2WCGA 3BUQA 4PEEA 3WKQA 3WO3B 5J3HD 1OCWH 3PGFH 4FD0A 3SBQA 2GIYA 2PKDA 4S2SB 2CLZB 3VYNA 2Y3AA 3MODL 5JW4R 4XN2A 3D0LB 2ZX9A 1AMXA 2WZPD 2ZUQB 4ZXBB 1EAJA 3PQYE 4UOJA 2JB5H 3DXAD 4P2RE 1BP3B 1J9QA 1DQLL 3HVDA 1NCAL 4PJHB 5HHOE 4EBQL 5AALA 4HHGA 4LDOB 1BQLL 1UUNA 4NAQA 4UINL 5IK3B 1IC4H 4LQ1A 2X2UA 2W0FB 4AH2A 1CWVA 1KNOB 3GI9H 4OIAA 1IJNA 4ADIA 2WXLA 2YUZA 3VXMD 5HI5C 3F65A 3QT2A 1Q9KA 3INOA 3MLYH 4F7MB 2Y5TA 1FL5B 2D3NA 5IUSA 1I1FA 3GNML 4MXWH 4NC1C 5K59E 3CDZB 2IFFL 1AXTH 2CGRL 4XAKE 5IROD 3VXPA 1U95A 2EVIA 2WMPB 1URLA 4ES9A 1MFBL 2QQLL 5F3HA 4FQJH 4MX7A 1O7SA 3WIAA 4XMKH 4P5MB 3GXIA 3QORA 5AYTA 1NCBL 3APFA 1VKXA 3LRHA 4HIXL 1PBYA 3PJSA 2C5DC 2XX1A 1F4XH 4G8GA 1DBAH 4M6NH 2P8PB 1XGQA 3HS0C 3WEOA 3MJ8A 5J0BA 2CPUA 5HYSG 4KY2A 1JPFB 4P0DA 5HI3D 2XPGB 4NIYE 5DZAA 1AC0A 3SOBL 4KX8A 2P3YA 4PJCE 1PW3A 2P8LA 3Q06A 5CHNB 4A37A 1GMEA 4KTEL 1WLHA 2O93L 1EEZB 2BNUB 4CNIB 3EJYC 4M4PA 1DQKA 1QBML 2DKMA 2WGXA 5AVVB 3SY0B 1QSFA 1QLFB 2AZUA 1QOKA 3LEYL 1DVFB 3BP5B 4G5AA 3QG7H 4UNVA 2MPAL 3RWEA 3MODH 2Y7QB 2BHFA 4B9IA 5L2JA 1GS6X 1RZGA 4K5NA 3OAUL 4OZHA 1NGWB 4Y89A 1Q9WA 4BKTC 5H35A 1DQLH 4ODVL 1NCAH 4AYFA 1XVSA 4FKKA 4NZJA 4EBQH 1IZJA 3DHJA 4ANWA 2X9XA 1IKOP 1BQLH 1ID2A 2EIKB 3AW5A 3D25B 4UINH 4WQOA 3BKYL 2LGNA 1OY3B 2ZNWA 3K71B 1YNKL 4QTIL 1TTFA 1UXSB 3EBGA 4NWUL 5DLML 2CD0A 3QULB 1R3KA 2EC8A 4G42A 5I66A 2QSQA 3GNMH 4KXZH 3RQ3A 3ZTCC 2IFFH 3EYSL 2CGRH 3RVTC 1U92B 3KYMA 2R69H 2BNUA 4YXKL 1MFBH 1SQMA 3QNFA 2QQLH 5AQ0A 3WENA 1DVSA 1HNFA 4X6CF 3ZRCC 1U58B 2BSED 3PHQB 1IUZA 4WY7L 3UG4A 4ANVA 2B1AL 1NCBH 4HIXH 4LSUL 5E8NB 3UYPB 4KI5C 3NCJL 1DQIA 1MI5E 3ZE1E 2NXYC 3L4YA 1WIPA 3QO0B 1EJ6A 3HRZC 3PXLA 4PGBA 4FQHB 5F8RC 2WVVA 1X5YA 2F15A 4J3OC 3DX8A 2E7LA 2ADIA 4R3SB 1QPKA 3G9VA 4CSPA 2F74A 2UWEE 2YMXL 3LQMA 2AXFB 3SOBH 4PJXA 3MQIA 4A66A 3B9AA 4ODXB 1F2QA 1P7KA 4KTEH 1BZEA 2R0LL 1QBMH 1MCIA 5D1XB 3GBMH 1ZIBA 1PGRB 3RBSA 1BWWA 4H5SA 2NY2D 4P5TB 2L7JA 3RZCB 3LEYH 1CXHA 5KSAC 5JXEA 1AXSB 2MPAH 3VCLA 5E4OA 2XRAL 2OCCB 4O2FA 3DBXA 4N5ED 2QPEB 3FTXA 1TNNA 3V7AE 2JLPA 3DUHA 3OAUH 4OY9A 2R2HB 3B6SB 3VD1A 4GS7B 4LCYA 4ODVH 5AG8A 1ZE3C 2Q7NA 3MRRB 2Q2EB 1ZHLA 3U2SB 2B4CC 3H53A 4A7GF 2QKSA 3FN3A 3FMGL 2JCCA 5AD0B 3BKYH 2HUHA 1YNKH 4QTIH 3WE6B 1P4LB 2YKLL 2W92A 3AS2A 4LEOA 4DVBA 1S7TB 4WJ5B 5HYFA 4NWUH 1IU1A 5DLMH 4GIAA 3FU3A 1R3HB 1TETL 2G5BB 1VADB 4BH7A 3RNQA 3PP4L 4YHPA 4EUPG 3BIAX 3BWAA 2SEBA 1BREA 1UJTA 4MXQD 5HYQA 2E76C 1NUNB 3EYSH 2CIKA 3N0PB 2NNFA 4JFWA 2F19L 1E9OB 2J3SA 2OLDA 5FK9B 3KLQA 2N56A 3D87B 4TVSa 3IJSB 4YXKH 2F8XC 3PQYA 5KVGL 5DK0A 3ESPA 3GS0A 4WY7H 4M4RA 5E4AA 2B1AH 5HHOA 1Q1PA 4KGLA 4JKMA 1U8MB 2BK8A 4LSUH 4XO9A 1SMOA 3NCJH 3MA7B 3VXSB 3LX9A 1FFPA 4H8UA 3MJGX 2YAQA 4F9LC 3MRRA 5CILL 1NH6A 3FUFA 4MJ4A 4KKLC 3DIFA 4U6XB 1KCLA 5FFOA 1H5BA 3RUGE 4G9DB 4IBUA 1YN7A 2YMXH 3B2VL 2ADGB 2NZIA 3B37A 5F0JB 3VH8B 2FL5B 4KFMA 1MJ8L 1JPGA 2VWEE 3EYFA 4MAYB 1WO2A 4JRYE 2ENQA 3WI9A 1CBJA 1D7DA 2NNRA 2FYYB 1FYTE 3ZKQD 4PJAB 4KK6D 4EQ2A 3K80A 4PD4J 4W4NA 1FQ9C 1KF9B 2R0LH 3CMOH 3CXFA 3LEXB 4G7RB 5KYYB 3B9KC 4EDWL 4PS4L 2Z4TA 4M7KL 3T9WA 5CEZD 3E0GA 2ZXBA 4FXGB 3ZUNC 3L5WA 3FHEA 2XRAH 1RSFA 3MREB 4N0YH 4KKAD 3VFTB 4KKCD 2HFEA 2ZOUA 4UQAA 4H8QA 2VZSA 4GAAA 1M9SA 3UBFA 5IV2B 3FMGH 4ICXA 4WKZB 3ARXA 3N3EA 1R4XA 4PJCA 1MCSA 4XN4A 1MRDL 3RL2B 3HB3B 3VYPA 2YKLH 1WDAA 3LCYA 1NGPL 5EZLB 4GKSA 1IX2A 2N4IA 1TETH 3P0GB 2WXJA 4J3OH 3PP4H 4XOEA 2IBZY 4TNGA 2BSSB 1U8IA 4PJEA 1CCZA 1SDYA 3KPPB 2CKBB 5AW6B 4PJAA 2F19H 4LP5A 4XAWL 3OJDA 3P3SA 1XF2A 5KVGH 5BRZB 2F54B 4ZJ9A 5C8JA 4L4VE 5KYYA 3UGEA 4LLDB 1S7WA 4F1ZA 1XF1A 3TEZA 2AVGA 2QKIB 1XD1A 5IKCB 3GPSA 4CC4A 3EDDA 4BWUA 4QHPA 4QXTA 3H54A 4YDLB 1D5ZB 1QZ1A 3QJHB 3T04D 4BKSC 4I88A 1R47A 1R3JB 1BIIB 3P2DA 2CG9X 5CFAA 4FKEA 3PV6B 1LLAA 3EFFB 1PMYA 5CILH 3TLRA 1BG9A 1AGBB 3EBIA 4ANUA 1SMAA 3W11D 3B2VH 1YN6B 1MJ8H 2BP0B 3MV7B 2VN4A 2XCMC 4JJOA 1W91A 5EZLA 3BSHA 4GG6F 5E9DB 1X9QA 1SJHB 3KCWA 1N19A 5ID0A 2Y1AA 3AB0C 4LHUD 1X5GA 4TPRL 4EDWH 1WZAA 4M7KH 4PS4H 4QYOB 3BP7A 2V5SA 4GAJL 1JDCA 5I76B 1MI5A 4XNQA 4JFQB 4KPHL 3REWA 4PV9B 1BYOA 3ETSA 4RGOL 1O9VA 2O30A 1P1ZA 3BZFB 3S8GB 1H3WM 1NANI 1U3ZA 2IPUK 1L6XA 1W72L 1AE6L 5EN3A 3O45B 2X0VA 1SJEA 4EN3C 2UWEA 4DQOL 1IGTA 4AYGA 3POCA 5DURB 4J12A 2OXHB 1TJGL 4KHTL 4ZZFA 5H4YA 5CZXC 4BQ9A 2DTML 2I9LA 1DEDA 1X7TA 1UQSA 1NGPH 2HJKB 4GSDL 4WU5B 2R7EA 4WFGE 2IVFC 3CFKB 3LQZB 4UV7L 5EUOE 3U7AA 3TVMB 2VLRE 2DQEL 5CSZB 2V5RA 5C9JB 1BAWA 1L6ZA 4H26B 2Z35A 2DEWX 2JELL 3AM8C 2IANE 3D69B 1L4IA 3O6FA 2RACA 4PCKA 5DZVA 5AVYB 4XAWH 4LVHB 4ODUA 4AI7A 4MDJB 3BAYA 3OR6A 3FFDB 3TIDB 1FNFA 4JFFE 3ILDA 1LO2L 2ILLA 2AQ3A 4LU5L 2Q6WB 4NQVB 2X53A 4PRPD 2HH0H 4UT7L 4ZAKC 2XN9E 4RFEA 3FT4B 3IDMA 2G2NA 4N2GA 5ESAA 4D94A 3FUJA 4XPGL 4LEXL 1HOCA 4ADJA 3FQWA 4JQXC 1E67A 4QHUB 1R34A 4IJTA 5BUPA 4ACPA 3D1MC 1S7RB 5HYSB 1HH6A 4Z7QB 1RP8A 3A6CL 1T3FA 2E27L 4B9FA 2W81C 1NC2B 2QGCA 4JPVH 1R5WB 1OARL 4LKXB 4X6EB 3WFBL 2GSMB 2P49B 2C3VB 4OFDA 1K8IB 3O4LB 5EC2A 1L9NA 4TPRH 4GUPB 3MNWB 2XXMB 3NSCA 5JHLA 1YEWA 4GAJH 4RNRA 1Q94A 4KPHH 3GXTA 4R9HA 4RGOH 5LGJA 4PY7A 2GTZA 4PFEA 1YSOA 3KYOB 3QDGD 5DXWA 1Z0NA 4D9QD 4I4WB 4PVLA 1W72H 1IAIL 1AE6H 2V3FA 1F0LA 3RPKA 1T21B 3UTQA 4WAFA 5L2KB 3ATBA 4PS7A 3VG0L 4DQOH 6FABL 2WXGA 1TJGH 4KHTH 3SDDA 1XB3A 2YAEA 2DTMH 3ES6B 1MY5A 4LLQB 1MPAH 4GSDH 3M1BA 1FZOB 2VAAA 4FCAA 3U0TA 4LPCA 4UV7H 3WL9A 1J0HA 1VEOA 4XX1G 2DWDA 2HRGA 3VFSA 4C55A 2GTWA 1C16B 4WNQB 3EFDL 4X5RA 4U1LB 4E9QA 1MFVA 3FUNA 2JELH 1YAIA 3FCGA 5GRUL 2LU7A 4LKXA 4RGNC 5BO1L 4FYTA 5SWSB 5AB9A 3BRDA 2WLYA 2VDML 5FB8A 2BRQA 3MZTA 43CAB 1LO2H 2YMOA 4WTZA 4ABUA 4NQXA 4LU5H 3VXUD 3PDGA 1MEXL 4UT7H 2QV2A 1AP2B 4ERSL 5EFIA 2OX5B 3SKMB 5L0QC 4XPGH 1B88A 4LEXH 3SB3A 5DA0B 5E23A 2DI7A 1KEML 3QK0A 5FF6A 5C0AD 3O2WL 4AIZA 4M61A 5IQ7H 3A6CH 1YDPB 2F58L 1S3KL 1UM4L 5EZJB 1P4IH 1T20B 3C87A 2CM6A 1OARH 3EGXB 4L4VA 1QRND 1EGJA 4LPUA 3VFRB 3WFBH 4I9WD 4BUQA 1ZOXA 2YFNA 1Q9OB 2YXMA 4LSPL 2E9JA 4HPYL 3M07A 3PHOB 1K2DB 1JHTA 4FMVA 1RPUA 5KYWA 1ZXKA 2X3CA 1IAIH 1WA0X 2GK0A 3ECBA 4LGPB 3WLBA 4ZOBA 4U31A 2O6CA 3VG0H 4LLVA 3MSPA 6FABH 3MRKA 4GEIA 3L9RA 3NCWA 3QEGL 4PY8J 4JG1L 4LSQL 1WT5C 1WEJL 3KBEA 1LYQA 2H6UA 1TQCB 2OMVA 4JKPL 3DX3A 1AR1B 2BH0A 3CDYA 4L8CA 1TQVA 1J8SA 3ZZSA 5FKAB 3TZVD 5I8OL 4H8HA 3ABMB 1A6UL 2WTOA 3EFDH 3VXNB 3F04A 1R24A 3STZB 3BVXA 2DYRB 5I1EL 3QZOA 5GRUH 4DP1X 4EUPB 3UC0L 2ZOTA 5BO1H 3TN0A 3VFRA 3L5IA 3LIUA 4JM2D 3L1OL 4TUKL 2VDMH 1P4BL 5FAAA 5JHDB 1U4EA 3IMRA 2YD8A 1JFHA 3IJ8A 3KPMA 1MEXH 2ICWB 2ZCZA 1P5UB 4PS3A 5CIPB 5HI5D 3HC0A 5JPNC 5IGXL 3RE0A 4ERSH 3ZRFC 3WJJA 4F37K 5EUOA 4BUGA 4UM9B 1WBYB 1J9SA 3I6LD 3QFJB 4P2QE 2VLRA 5BV7B 1JYNA 1KEMH 4MCYB 3TO4D 3BZDA 3S37X 2IANA 3O2WH 1UUSA 3MV8E 5BS0B 2F58H 1E4KC 1S3KH 1AZRA 2SODB 1W9XA 4TSCL 4GT0A 4C56D 4JFFA 1YG9A 1N12A 5IOPA 1I7RB 4A7UA 3A4AA 2VZOA 4LSPH 1CE6A 2XN9A 3JXAA 1JPEA 4HPYH 2I85A 5DRWA 1AO7D 1A4JB 4KXDA 1FYHB 4IRJB 3EO1A 1QZNA 2VLKD 2W9LA 5KVGE 5ACZB 2AV1A 2XG5A 3UGXA 1WCQA 1YO4A 1HXMA 3BQUC 5IJKA 2J71A 3L81A 3O9WB 3QEGH 4OFVA 4WFFE 4J8QA 4JG1H 4LSQH 4JUTA 1WEJH 3B5HA 3W9DA 3SQBA 3HKFA 5K1JA 4JKPH 1KB9K 1MG3C 1XF3B 5IREA 4DP2X 1DANT 3MRNB 4OIBA 2JKRM 3QUGA 2IDUA 4YX2L 5J12B 1N68A 5I8OH 1M7DA 5H94A 1A6UH 4HEPG 4GFXA 2CHDA 3GBNL 1WFIA 5I1EH 2VQ1A 1PX8A 3M86A 2P52A 2E0PA 3UC0H 2PF6A 2ZONA 3HN5A 1SEBA 3BSZL 3FAWA 4TUKH 4NQEB 3BGFB 1P4BH 1BOGB 2KZKA 3EF4A 2NR6C 2V7HB 4B0MB 4HIIA 5DFVC 3FQUA 3CZSA 5HD8D 2JJTC 2NY1D 1A6TA 4NKMB 1DQTA 1H19A 4ODTL 4BWWA 4RMUA 1EBPA 5IGXH 3KLAA 1KB5L 3FT3A 1JVLA 1OCCB 3SDCC 2CDGB 4XP9L 2YGOA 1G9NC 2DWSA 4XMUA 5ECJE 3OBAA 4FP8L 4NQDE 5KOVC 1SYSB 2GUOA 1AS7A 5IBTL 3HE6C 1V5JA 2DTSA 5D7KE 5CCJA 2BINA 2AJSL 3O6LL 3CVHB 1K4DA 3AREC 2E86A 1YMME 4HJ1A 4TSCH 4U1KA 4GQ9L 1NMBL 2A4EA 4YLQT 1U3HC 3JQOB 3Q48A 4JFYB 1CICA 4BSWA 2Q7AA 4OGXL 3OXRB 3TO2A 1G43A 4YBHA 5IVOA 4IOIB 3R4DA 1SJMA 1LP9F 1JNNL 3N55A 1UWEL 3QJOA 2E9IA 2ALAA 2ZKWA 1CFSB 3ATDA 3EJRA 5FW7A 3V10A 3QNYA 1JI2A 5DTFA 3DUSB 3CFEA 3CHPA 1BXUA 2VZTA 4Q4IA 5FDWB 2R83A 1EO5A 3QUYA 3US9A 4YO0A 1GZHA 4Y4HB 1BVZA 4URKA 2O5XL 1JZ6A 3RTQD 4YX2H 4J39A 2XQ0A 1G9NL 1YYML 4U05A 4UIMB 4P48A 4L3EE 3CVHA 3Q6FA 3GBNH 3H7BB 3B9EA 4A2DA 1BQSA 4AQ1C 1AJ7L 1EX0A 1T6VN 4LFHD 3AADB 1ZLUH 3BSZH 3ET9F 4XR8C 3ZL2A 2R4RL 3R4RA 4Q89A 1E9PB 1MJJA 2ITEA 2IALA 1WWAX 2PCFA 4UTBH 4GSQA 3TWCL 3VWJA 4GXUN 4ODTH 3MRHB 3QJVB 4OZFG 2XTSA 5CLWA 1KB5H 4FNSA 1T22A 4XP9H 4G6AC 1OZUA 4MMXC 3UP6A 4DPBX 3C8HA 4HG4K 3IN0A 4FP8H 3PL6D 1TYEB 5LBVA 3ALPA 3KPOB 4TOYL 3C5JA 5IBTH 4Y88A 3UYRH 3ZYOA 4K7FB 3VXRB 5JOPE 2AJSH 3O6LH 3AABA 4A7SA 2ATPB 3DOSA 2Z4QB 4GQ9H 3EJZC 1EK3A 1NMBH 3KLDA 4HJUA 2ZCKL 4PBDA 4OGXH 1U8QA 4A6YA 2W38A 3WHE1 5A7EA 1VSCA 2BERA 2PETA 3MJ7B 4MNGB 4WTQA 3TOPA 4YJZL 2OFQA 3JWDC 4OGAC 2DIBA 3DRQA 2KHAA 2HLFD 4ZW6A 4U33A 1IRAY 1NEZG 3LPWA 2PXYA 1JNNH 4AV0A 4QJ3B 3MLRL 1UWEH 2WKOF 4FI6A 4P2QA 3Q05A 2HT2C 4HZAA 3HAEG 3LKOA 1MIML 3HZ3A 3Q44A 5C0GB 3ZTDC 4Y5VB 5DZ9A 2M1KA 2G3XA 3P4NA 3RWCB 2WANA 1B0IA 4I0PB 4L3CB 3MV8A 2E56A 1JGEA 4MMZC 3LKNB 4O51A 5F1IA 4Z78A 3CFJB 1ILUA 1W0WB 1FNGA 2O5XH 1QQDB 2WBKA 3FUDA 3HG4A 3GIZL 5ICZA 4WWKC 1G9NH 1RPKA 1YYMH 4NDMA 2VE6A 2YPVA 4LKCB 2Y72A 3HC3L 4V11A 3OKMA 3F3HA 5KAQG 1AJ7H 3VFVB 4JL2A 3VI3B 5FS5A 5JPMA 1GYUA 2OL3B 2WXRA 2R4RH 1FFTB 1U30A 4NQCB 5DQDL 1N59A 4B9YA 1TITA 3MRMB 1JK8B 4ABWA 4AJWA 3DOIA 4L37A 4PJ8B 3GHEL 3TWCH 3GSWA 4YAQA 1DZBA 3QUZC 2H6PA 3T1FB 4Z7NF 1OW0A 2FLMA 3DX7B 3Q3GB 1B4JL 5F7DB 2H41A 3NT0A 4MB4A 3QQNA 1NL0L 1QUNB 4N87A 2VL5A 3PWUB 3KDMB 5DMIL 5E6ID 1QYGL 4F9PA 1M6OA 4YHOH 3QP3A 3GSVB 2YQ3A 5SWQA 3H3KA 4TLKA 4JFEE 2YUWA 4PVBA 3ABLB 4TOYH 3QWRD 2QQKL 4WNJA 2O4EA 3PDDA 3QJRB 4XN5A 5DD5L 4K5MA 1PZUB 1RZ8B 3QIUB 3FQTB 4G3YL 5KVFL 2DLGA 4LKCA 2ZCKH 1F3DH 2YBRB 3T4YA 2F2HA 4B0MM 3ETBJ 3CHRA 4G1MB 4M93B 1ADQL 4FNPA 1I3UA 4PB0L 2JQMA 2J1WA 2IWEA 3WNLA 3MLRH 3PP3K 3UO8B 4NQDA 4AG4L 3POHA 4ORZC 1QI4A 1MIMH 2W60B 3FKUS 5BRQA 2FE0A 5C08D 3AT9A 3PWUA 2DAVA 4X7DC 2OP4L 3GSVA 1YMMA 2G60L 3ML8A 1ZDSA 1T1XB 4JPIA 4KDTC 2DOCA 4B9GA 3T1WA 1X5XA 4AQ8A 3GIZH 3M45A 4WFHD 4FL4B 5LN4A 4K94L 1ZRUA 2YD9A 1A1OB 2CMRL 3HC3H 1ZPLA 3FN0L 3IAPA 4K4KA 3R7QA 1ZIAA 3BH9B 2AK4D 5DQDH 1AHWB 3CZFB 4Z3TA 1HNGA 5B38B 1IC1A 3GHEH 3AQZA 3KH3A 3PY9A 1B4JH 2Z1KA 3WHE0 4X6BB 4HAKA 1NL0H 4U6HA 4ZOEA 2NXZC 5DMIH 1DDHB 1QYGH 4YSDA 2HRLA 3T5WA 1DN2A 1KTBA 3RWDA 3TPUB 4MNHB 2XIDA 1JZ2A 3LB6C 2MTAA 3GDCA 3SYCA 4FQIL 4L3EA 2QQKH 4IBSA 3PNWB 5DQJB 1I1AA 3IN2A 3T77A 1CLVA 2KUTA 4DZ8B 5DD5H 5AVXB 4TUJA 1FVCB 1NCGA 1T1WB 4MQSB 4NKDA 3ARZA 2DZEA 2R23A 1JZJA 4U0RB 2G2RA 4G3YH 3MRBA 3QWOB 5KVFH 1NQBA 4TVPL 5DRNB 3GSUB 4GXFA 4QRBA 4CADB 1LO5A 2AJVL 2P5WA 3QIBA 2VL4A 1L0XA 1R5IB 3CV5A 1YMHB 2BPBA 4UTAA 4ZSOE 1IKNA 1ADQH 2YIHA 2P42B 3FZUC 3QSKB 1OHQA 5E2UL 4HU8A 2GBVA 4PB0H 2VQTA 4BK5A 5CM1A 4PJHF 3VSQA 4QF1B 4ODBD 4OZGB 3SE3A 4AG4H 4Y2DB 4OF0A 5HGBA 5GS1C 1X5JA 4R8WL 3T4AC 4RA0C 1BBJA 1CXEA 1KN4L 3EHBB 1WWWX 3G5ZA 2OP4H 3QR0A 5DJ2B 2G60H 4EXKA 3A22A 3BGMA 3L3KB 4AYSA 4Z7UF 4YR6B 1DCLA 1SPDA 2HMIC 5LGYA 3RWHA 4NN6C 2JXMA 3PNWA 3FTSA 5TDOA 5E94B 4ADGA 4GKNB 2NY7L 4K94H 3S3SA 3FO1B 3VI4A 4LO9A 2CMRH 2X70B 3DK2A 5D7LD 1MKFA 3FN0H 3FNKA 4V1DE 4NO5B 3CC1A 1LE9A 3N9GL 4GSRA 1KGWA 5TFSL 1S7QA 3KPSE 3AROA 2FX8L 3BPOC 1E4WL 1NWPA 2JIXA 1CI3M 1A2YA 3K6FA 4LAJH 1K4CA 3VFOB 3O2DL 1JWMA 5IM7A 3FQYA 5FGCB 2BMKB 1AY1L 1JGLH 1B6UA 4M7LT 3NDYE 4JFXB 3D51A 5EULV 4MCNA 1QHPA 1Z5LA 4MJJA 1GL4B 3VSTA 3VD2A 3MRJB 4X7TB 4GRWE 3V0GA 5I1JL 3CUPA 1DBML 4X8XA 1F6FB 4FQIH 4ODSL 2NYYC 4YPJA 2XTJD 3NFPB 4HLEA 3L3KA 3ZTJG 5IB2A 1AQDA 3F62A 1LE5B 2FK9A 5DEZA 1M6UA 3TBWA 1SFHA 2XIIA 1JZ5A 4OFPA 4TVPH 5F6IB 5TE7L 3ARFD 1NFIA 4HIPA 1SXSA 2AJVH 2UY7B 1TZHB 4G11A 3HZYB 4U2YA 1OAUL 5DHYB 3H1ZA 4W1TA 3M7OA 4RH4A 4IU3A 5E2UH 4JCLA 3JWNC 2C1OA 1RK1A 1QFHA 2A4ZA 2QQNL 1T0OA 1TEYA 3ARPA 3H7LA 3II3A 4J3WA 5I6MA 4IKLA 3GKZA 4YBLB 3TBSA 3TNNA 5TQ0H 4JFEA 4N28A 1BVOA 2KH2B 4R8WH 4I18B 4MNQD 1KN4H 5D1QD 3SPHA 2UVFA 3IMVA 5I2IA 3T0EE 4OV5A 4ZG1A 4Y4FB 3E9TA 2YFOA 3KGRA 2QGEA 1GXEA 4Z23A 5CFHA 4BFGA 1OSEA 4GW1A 5B1AB 2H1PL 2XXFA 2BNQD 3OX8B 1FL6A 3AGWA 4OGZA 2NY7H 4XNMB 3V4PL 4UILL 3RPIA 2BOCA 2AEWA 3NJVA 4JZOB 4GKZA 3KGSA 3UZEA 2OAAA 2EH7L 3N9GH 3OKLB 3FXIC 4UU9B 5TFSH 3LJ3A 1Y6MR 2XPYA 2FX8H 1BPLB 1E4WH 3QEQE 5ECGA 2BIMA 4R4BA 5HYJB 1RIVL 3GIVA 3O2DH 3NG5A 5IVXB 3Q5OA 3VXTB 1P2CB 1AY1H 4R97C 4KH9A 5EF2A 3NZSA 1FHGA 2EP6A 2FH6A 2H45A 1UXMA 4Y9BA 1ONQA 4G1EB 1PCXA 3JYBA 5HGHA 1DBMH 2OZ4A 3W1ZA 4LSVL 4ODSH 1TU2A 2W07A 2NNAB 1C9SA 3VMOA 5EEVA 3DV6B 1OK0A 3UAFA 4PRHD 4AVIA 2V2WB 1U8CB 5C0CE 1KGIA 5TE7H 2PTTB 2GCYA 5CWSB 1WHOA 4XB7A 1ETZA 3NJFA 5D70L 1OAUH 3BZ4A 4FULA 2WLLB 5JW4Q 3RGVD 4G80B 2HLAB 3KXFB 1EHLL 2BZ7A 2QQNH 4I3SL 4JRFA 2OSWA 3TJHD 3VUAA 4WFEE 4QRRE 1E8WA 3CVBA 3NEEA 3L6FB 3SCMC 1MFNA 2X9YA 2Q0ZX 3LV3A 1NEZB 5LG6A 4IK7A 3IDGB 5LLIC 2GSIA 1OTSD 2Y1YA 3E6HB 4H1LB 4PJGE 4EI6B 3HAEB 5GZNC 3VD4A 3D4GA 5F71A 5JW5A 4IMKA 3QW9A 4F57L 5CU9A 2O6DA 2APXA 3BAEH 3V4PH 2FT6A 2EICA 4UILH 3P40A 3G7TA 3PWPA 4POZD 4EI0A 3DMMB 5D72L 2VUKA 4HUWB 5HGAB 4UQ3A 1GS8A 3QAZC 3MBWA 2EH7H 2WLIB 2FECL 2XV3A 5IB4A 1W8EA 3QC6X 3QI9A 1N2RB 1OSZB 5F96L 4JK0D 4JZJB 1Y0LB 4NN7C 3U30C 1ZT4A 2JKLA 1ACXA 4G80A 4MLIA 1RIVH 4M9PA 2E8ZA 4JE0A 2Q10A 5IHLB 4XO8A 2W94A 5HVWA 4XCFL 3JWNH 3LY6A 3OG6B 2FUQA 2OJ1A 5A1AA 2PPAA 1UYWL 3IDGA 1S7XB 3CPUA 3NCYP 3PABB 2IWGA 4LSVH 3STLB 2X4PA 4K3JL 4DSYA 1ET7A 4UMSA 3SKOB 4FXKB 5GGRA 4V1DA 2YK1L 3IU3A 2Y22A 4WW2F 4O4YL 3JV6B 4P07A 2FZ3B 4A7QA 3KPSA 4P2OC 1MCWM 1MHEB 2XNAB 4XXWC 5D70H 5BOJA 2PTUA 1RZKC 2WSKA 5I5JA 2QTVA 3AMLA 5DUJA 3RDTA 4GI8A 4CC0A 4LNRB 3WFZA 2C1PB 4Y9GA 4KX9A 2IBBA 1KTDA 1EHLH 4I3SH 3BVVA 2UYLA 5D1ZD 1USQA 1PYWA 3LKPB 4FFZL 4PV8A 1BFOA 4HWBA 3BVWA 4MB3A 1GOFA 2GIMA 4U1SB 3NTCL 2DQCL 2NW3B 4U2ZA 4Z0XA 1A7QL 1T1YA 3U83A 1U3HD 1LK3L 4QGYA 3EYQC 4XVSH 2JJUA 2O6FA 3OF6D 3TM6A 1IILE 4F57H 4N0UB 1TFHA 1SZNA 5C0IB 2EE2A 1YEEL 4Y1TA 4E2OA 8CGTA 3DXAE 1NAMB 2YPLB 5DFWH 5FEBA 1KIQB 2CHNA 4AUUA 3AUWB 5PAZA 2LLGA 4OD2B 1QO3B 3S5LG 4PU2A 5DZNA 3MRQA 1MNNA 4UQCA 1U8NB 5F96H 2BVPB 1NGQL 4NUGL 4JR9L 3WUWB 3VXME 4LNRA 3L95B 4PW4A 3RX5A 4FEMA 2GFBA 1KG0A 3ELAT 4XVOA 3T0EA 3GSNL 4M29A 4L2YA 3U7WL 3MUHL 4H7VA 5L88L 4ZS7L 4XCFH 5K9OA 2H3KA 2EVHA 5CJXA 2J43A 1UB6B 1UD3A 1UYWH 4WTXA 4OZ4B 3RIAF 5CZRA 4JFOB 2DWEA 1OF2B 4J6RL 4K3JH 2BXZA 1AQ8A 3LNGA 1QP1A 2MNWA 4UDUA 3GMMA 4CJ1A 1XIWB 3IFPA 4TQPA 4HX1B 1SXBA 2YK1H 3AXIA 4GLRH 5HJGA 5TF1L 3UC2A 2X87A 3ECWA 4O4YH 3TFKC 3U36B 5D6DC 4TQHA 4BFKA 2X42A 4UNTA 4M00A 4W6WB 3U6XS 1NDTA 2BRRL 1KV3A 4JY5L 1J5HA 3IDUA 3NK4A 3V4VB 2DBLL 1CE1L 4Q6IA 5I1CL 5FA4A 1KZYA 3IRZA 2EUWA 2XBDA 2XG4A 3KNBB 2AQRA 3GRBA 5KS9B 3BN3B 3IRPX 4JO3L 3RGHA 1BZOA 3V7AG 4FFZH 1U8OA 4G5ZL 3D0AA 2VDPB 1MNUL 1HYSD 4LVNC 3NTCH 2DQCH 4UT6L 4HJ0D 3LN4A 1A7QH 3LYRA 5LAXA 4GUOA 1LK3H 2A74C 3ARGC 1ZK5A 4NZUL 3IVKA 3VRJA 4JBSA 5C0CA 3K6SB 1BZQK 2RFXB 1YEEH 1BF2A 3TPKA 3ZPDA 4ZYKA 4CMHB 1XMWA 3CBRA 1PQZA 2NY4C 3RGBA 4GBXD 1IM9B 3U36A 1ZGLP 4PJ5B 4PJIA 2HT2D 2BNRD 4L9LB 1KULA 4R5TA 4Y16B 1CF8L 1OXYA 1WF5A 3ATFA 1NGQH 4NUGH 4JR9H 2EYRA 2GJZB 4YXHL 1JE6A 4QY8B 3X11A 2K6ZA 3NQKA 4WUUD 1PY0A 3FQ4A 4RAUA 2IAMB 3ILQD 1GS7A 5F1NB 3NCBB 1PX3A 1VCBC 3FU8A 3GSNH 3U7WH 3L5HA 2VRAA 4J7RA 3ZE0E 5L88H 2EZ0D 2X4NA 4P2CG 1A4KB 4XCYA 4Z7OE 4ZS7H 1NCHA 1A4BA 2NY0B 1LQBC 4KMLB 5J6SA 4AM0Q 3X1EA 4J6RH 4XP6L 4Z7QF 4PWGA 4WO4C 1ROCA 2AV7A 4QRPD 4AGMA 2ZF8A 1I3GL 4MTMA 5TF1H 1BWMA 3RBGA 3Q8AA 35C8L 5LNDA 3LRSB 5IUCA 2BRRH 4B95C 4JY5H 43C9A 2X4QA 3DECA 1GGIL 2DBLH 1CE1H 5I1CH 3L3HA 4PJ5A 1XAUA 1FFRA 4GH7B 5TK2A 3ZKND 4MJHA 5D2LB 3LN5B 1ZLSL 3BEWB 3F64A 4LCVA 3CG8A 4JO3H 4WWID 3WJLC 3C8KA 1HXYB 3V0VB 4G5ZH 1EZUA 1Q9LB 1MNUH 4NLAA 5D4HA 4K71C 3X1BA 3JV0A 4UT6H 4WTZG 4P4KB 3R19A 3X3FH 2A73B 1YHPA 3VSUA 1JL8A 4NO0B 4NZUH 4H88L 5EN2A 4RDQF 4N9OB 1M42A 2ZSWB 2ITDB 3PGDA 2NDFA 5D4QA 15C8L 4JQIA 3ZDXB 3L48A 2YC1A 3RRQA 5A2CA 3FSZA 1A25A 3QDJB 4Y5YA 4ZZKA 3GJEA 4NQTA 5TK4A 4YXHH 3EH5B 4ZXBC 3EOTL 2VXQL 5J1AA 2BSCA 3P9MB 4JN1L 3US1A 3ZR5A 2H26B 5JNYA 2WKGA 4HZLA 4UQBA 5HPMA 3E6FB 1OLLA 2VN6A 2XACC 5EC1B 4B6ZA 3NYKA 2XKSA 1HHIB 1OGTA 1I82A 3JTSA 4P2YA 4LF3B 5DEFA 4XP6H 1UFGA 1I4FA 2V5MA 4GAYB 3B83A 4M7LL 2R1YB 2ZOKA 1I3GH 4FTVD 5DRZB 4FXTA 2OYMA 1AC6A 35C8H 5GQBA 2FHCA 4KMQA 3V6ZB 3HFML 2Y9RT 1GGIH 1B9KA 1FFQA 3PAUA 3WNMA 2VDNL 4FLQA 2C3HA 2ZAIA 4PJ9A 5GGRY 5IG7B 3K6IA 2TAAA 4TLSA 2NY6D 5EO1B 3WIHA 1U8HB 3BN9D 1ZLSH 3AACA 1DSYA 4P3DA 2R4SL 5BW7A 5IIEB 2D0GA 4APXA 4IHBA 1AGFB 1HEJC 1NFDA 1P5VA 2ZWKA 1KPRA 4X9FA 1JPTL 2DJ4A 1C1EL 1HL8A 2X4SA 3KYNB 4OZIE 5CEZE 1WIOA 4XI5C 3MV9E 4P2RB 4H88H 1BLNA 2Z92A 1SYVA 3FONB 5FUZH 4GUCA 1YY8A 3FZUD 2R9HC 1L7TL 15C8H 1M71B 4MD5B 2QFPA 5DMGC 5ESVA 4PREB 3FTGB 5FGBA 5DRZA 2W95A 3U0WL 3CHSA 2HT4C 2F9BT 4E0RA 3MPCA 2NX5B 5GRVK 1IFRA 4PP1C 2VQUA 4HV8B 5DHDA 1DUYA 3P9LB 4HIJB 4FA8A 3EOTH 1ERNA 1SQ2N 3L3GB 2VXQH 5ILTL 3MRGA 2OMUA 4JN1H 3ROOB 1HCVA 5IW1A 2Q9OA 3REVB 3RVXC 1AZVA 2F7QA 1LTXA 4DCQB 3F7PC 4XVUC 3I9GL 1WVZA 5EPMA 1C12B 4APQD 3Q2CA 1UB5B 1CB4A 1I9IL 1A6PA 4M7LH 2OTWA 2B59A 3HUJF 3C6LA 3GXMA 1G7MB 3V55A 3TA3B 2Q86A 1N18A 2HUEA 1BSIA 1GC1L 1MCWW 3CDGB 2JCWA 3F7YA 4ZDHA 3HFMH 4AEIL 4Z7WE 3L2MA 4WSKA 2R2CA 3CFBA 2VDNH 5CMAA 5I1DB 5FHBL 1JGDA 4J8RB 4PCYA 1O5DT 1G7QA 5A2AA 1CFNA 3QIWB 2VC2B 4HIJA 5DK2B 5DD3L 2R4SH 3IDXL 4BDVB 4YHZL 1GMIA 1ZT1B 2WXQA 3QFDB 1S7VB 4NYLA 1WBXB 5E2WL 2M26A 4DGVL 1JPTH 3REVA 5A6LA 3D08A 1T83C 1C1EH 3CGTA 4ZPTA 2BP8A 3UZVB 1CGTA 1XX9C 4ZMYA 4LK4A 3ARDD 3IJYB 1IEBB 5T3XD 2HSIA 1QX1A 4D0BB 4N8VA 3WAKA 4GOSA 1L7TH 1JN6A 4LASL 2JWYA 3RLSA 3U0WH 1HZHL 4P5TC 4U1HB 2GYSA 3GB7B 4XN8A 5BVPL 1LO3L 4WRLA 5B1JA 1JVOA 4ZMLA 1L3NA 1J11A 2WK2A 3H6AA 3S5LB 5ILTH 5T5FH 1A3LL 2DKUA 1AQHA 3WGUB 1X5MA 2XICA 4BCYA 3ZMNA 2CBQA 4GP4B 3B2DC 1M2VA 4DP5X 1I7UB 2OYLA 1DQVA 5CJBA 5F9AC 4AL8H 2IXQB 1J0YA 3FT2B 5KWYC 1T2XA 1T7VA 2W9DL 5K33A 1I9IH 3IS0X 2GY7B 4U7MA 3RPBA 2R2EB 5E8PB 5I1IL 4PRPE 1QW9A 1JXGA 2VSCA 3QJUB 5I8CA 4N2LA 2CGYA 1GC1H 4JGUA 3UH8A 4AEIH 2XV6B 2P9RA 4WGVB 1H9DA 3K2KA 1WBZA 1D3CA 5FHBH 4HU2A 4QNPF 3U6RA 5MI0B 2H3NB 2JJSA 4FA7B 1MRFL 5GZOD 4W9HC 3FUEA 2JE8A 1OWWA 2XWJB 5DD3H 3IDXH 3VFNA 3L3OA 2WTRA 3HE7C 1HOEA 1IC7L 3P4OB 4HHWA 4YHZH 2VZ1A 5DJ0B 4G8AC 4W9ZA 5E2WH 4DGVH 4WI8A 3SYOA 4LT7A 3GMQB 4KMTL 4NFCA 2PO6A 2F6AA 4N68A 4O2EB 1MWAB 5J9PA 3SGJC 1A8JH 2ZG2A 5A16A 3G5VA 3G5XA 3AQYA 3QDGE 1OGAD 5C3TA 1GZQA 2MHAA 3SEPA 3ZHNA 4D9QE 4UWQB 3O8XD 4LASH 4C4UA 3SBWC 1SOSA 2BS71 1WZ1L 4WW2C 2N1KA 1HEZA 3CJJA 5E6RB 1HZHH 1NICA 3UG3A 4RGMB 1WH0A 4FXGC 4OM1L 4XMVA 2GBUA 4Y4KB 3EFOA 4AYEC 2FO4A 5BVPH 1LO3H 1EAOA 5ERWA 4LXFA 1ZVSA 1ZHBB 3B1TA 3ASNB 4PAZA 5BQ7A 1A3LH 3B2UC 2WLNA 1RMFL 2CLRB 1KB3A 2YD1A 2IGLA 3K1KC 4OF6A 1FV1A 2NDGA 4B5EA 3CD4A 3PREA 4KROB 1N8ZB 1PZ2A 5GRWA 3P30L 3TTSA 3MV9A 4A55A 2PP8A 5EU6D 1WGVA 1M9WA 1P84K 1OSYA 2K7PA 3HB3C 3LKSB 3O3DB 4N6QA 4ZMQA 1ZHNB 1A02N 5FM5M 1G7PB 2BIPA 5HDRA 2X4TB 3V0AC 2W9DH 4LLWB 5IB3A 1QLRB 3O3BA 2BVOB 3WNJA 2OR7A 3VXUE 4TF4A 2HKFL 5I1IH 3IJ7A 2Y6SD 3KHQA 4GINA 1GVIA 5HGGS 2VYRE 3RUGB 4KRPB 4X99A 5C07B 3V5HB 5DJDA 3OHXA 3C5ZC 5AKVA 2NYZA 2QKIC 4JRYB 1HC1A 3GFUA 1DJSA 1KPVA 2NCEA 4G59C 5DS8A 4BE5A 1KCBA 1MRFH 4YDLC 2V2XB 5C0AE 2GC7C 2YZ8A 1U8PB 2G75B 4LOFA 4YFLI 1IC7H 4AQZA 2FJGA 4CVXB 1QRNE 3QQ3A 1X5LA 4UOZA 3C60B 2AHIA 4I9WE 4ZUSB 5D4JA 4KITB 2XTLA 1HL9A 2C3WA 1GPOL 3MNZB 1IGFL 3QUKA 4IOFC 4KMTH 4DF9A 4KNQA 3E7JA 2IQ9L 3H9SD 5E1AB 3MBXL 1JZDC 3LZNA 3TFBA 4FA6A 2XWZA 2VR8A 4Z7WA 3TS8A 4IOSD 5I19L 5E99L 5DD6B 3TF4A 4U6YA 2I9TB 1WZ1H 5ABAA 1A65A 2VSDA 2F61A 3KPQB 1S7SB 1KYDA 4K5OA 4HULB 1J87A 1OT2A 1VFOA 5JORA 4HJGB 1EAQA 5E5LA 3S48A 3TONA 3T8VA 4KZCA 1FG2B 1RMFH 4IIQA 2I60L 5E24E 1D9KA 2V2XA 5F3BA 1JHKL 2NQ3A 3P30H 4YL9A 5JIDA 3QG6B 3ILPB 4GI6A 3UZQB 3H56A 4GRLD 1ZTXE 1TQBC 1WCBA 5FOJA 4ELKB 3SDAB 2CGZA 4X7SL 3TVMC 2B5IB 2HKFH 2GJRA 3WFHA 1VGKA 3D85B 2C7UA 1WIUA 1ET8A 2A99A 3DJTA 1EAPA 4Z3FA 3HG1D 4G9FE 4LVHC 1IIIA 4U3XA 5FV1L 4DW2L 4EVNA 1H6FA 4R26L 5AAPA 1IGYA 3CN3A 1I8LA 4NC1E 2PCPA 3I6LE 1OAXL 2J1XA 4P46D 5CZVL 4WK4B 3HR5A 3DRTA 5IJVB 1F56A 5EOCJ 5JQIB 1F6AB 5DSCB 3N1GC 1OAJA 3N04A 4Q9RL 2XN1A 4QOKD 4WI6A 4EI5B 3PAZA 3DSNB 1KLUB 1HXKA 3FULA 3QZWA 3TT3L 1X4ZA 4EIGB 1ZS8B 3BKCL 1BEYL 3QNXB 2BS8A 4OJFL 2J55A 1DJXA 1IGFH 4PRPA 2ZYSA 5EO0A 3HFFA 5T5NF 4HWEL 4IK6A 2IQ9H 3D9AH 4Q2ZA 3MBXH 1AO7E 4ZTPL 3NFNB 3OWRA 5CBAB 3BGAA 3BAXA 5I19H 2AMUA 2J6EL 4MJIB 5E99H 2VLKE 3ZOAA 3HI6L 1YC8A