5DC2A

X-ray crystal structure of a enzymatically degraded biapenem-adduct of l,d-transpeptidase 2 from mycobacterium tuberculosis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
352
structure length
352
Chain Sequence
DLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords L,D-transpeptidase 2
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
total genus 88
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dc2A03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dc2A02
4LZHA 5LBGA 4JMNA 4HUCA 5DUJA 1ZATA 5DC2A 4GSUA 3TX4A 3TURA 4QRAA 4Z7AA 3ZG4A 4GSQA 3U1PA 5LB1A 4A1IA 3VAEA 5E5LA 5DU7A 4A52A 3U1QA 2HKLA 3ZGPA 4JMXA 4QRBA 3ZQDA 2MTZA 4GSRA 4QTFA 4HU2A 5DZJA 5D7HA 3VYPA 5DVPA 4K73A 4LPQA 5DCCA 5DZPA 4XVOA 4ZFQA 5K69A 1Y7MA 3VYNA 4QR7A 5E1GA 5E51A 5E1IA 3VYOA 4A1KA 4A1JA
chains in the Genus database with same CATH superfamily
1CF8H 5LNEA 2FLBT 2JKLA 2W0FB 3B2PA 4WI0B 1A6ZA 2NXYC 2Q9OA 2R4RH 3HC2A 1PG7L 2UWEE 3JV6A 5IW6B 4A6YL 1XBRA 1BOGA 5G2NA 1J5OL 5EDXA 1HSAB 1N19A 1KDJA 1UA6L 3NRFA 4W70A 4Z7WA 1AANA 2AEPL 2Z93B 1LDPL 2HVKA 3FQRA 3U9PH 3X11A 4OCSH 1MCBA 5IQMA 4ODHH 1RZKH 2VT0A 1S8DB 4N8VB 3RPKA 4F15B 3QNZA 5FGCE 4B50A 1RSYA 4HPYL 4GAAA 5KUMA 4EPSA 1TTUA 1NUFA 4LKCA 4EXPX 1KXHA 4RAVA 1BSIA 3PHAA 1T0MA 3X17A 1A3LL 1Z66A 2O5XL 3HG1A 1P7QD 1KPRB 4GAFB 3KPMB 2VDPL 2DYPD 4F8PA 3QXWA 1PL3A 3BSHA 1KZQA 2PTVA 1NUDA 4BGDA 4QXUL 5IVXF 5DXWA 1CF8L 2OP4L 4ONGH 1S9KC 3L4XA 1P7BA 3ARBC 3QDMD 3W82A 3U2SB 2R4RL 1H3WM 5HGHB 5F7BA 3D09A 5FM5O 3GBMH 4KXCA 3V8OA 1UCTA 4DF9A 2QADC 3T09A 2D7PA 1TPXB 4XNXH 2WQUA 3U9PL 3LS5H 4OZ4A 2FWOB 4XBPB 4OCSL 3ULUD 3WO4B 2DW5A 1DBMH 1M71A 1RZKL 2A6KB 3HLKA 5E2VH 3RZCB 5HI3C 4KKBC 2JJSC 2UWEF 4HX1A 1ECZA 1NBZA 4GXUN 4YFDB 4AUUA 1I8IB 1PZ3A 2AQTA 3MGTA 4LE8A 5D1XA 3B2DC 5KYUA 1NCTA 4WTWA 5KVDE 4YSCA 4EQ3A 4ZAKD 3ZX1A 4YK4B 5GJSH 3O9WB 2IAMC 1F11B 4ONGL 3HN5A 3O2WH 1L3NA 5BZZA 4HXAH 3Q7JA 1U41A 2J25A 4RGMB 4OZGA 1U30A 2EDTA 4BKSC 2VMFA 1JGUH 4GRWB 3GBML 1OT4A 2V3DA 1AO7B 4MMZC 5L4MA 1A47A 1C08B 3PGDA 4XNXL 2QR0B 2D7OA 2AAAA 3LS5L 5TDOA 5JPNB 3MRPA 2WQ8A 3QJSB 1DBML 5E2VL 4JFHE 1UWYA 2LFGA 4U1MA 3JYCA 1W72B 5CHNB 4U0RC 2WNGA 2XQBH 2BVYA 3OKMA 3QFDB 1UACH 3SKNA 5CJXA 2BOLA 4LP8A 2CNYA 1BQHG 4PS4H 5GJSL 1KDIA 3LIUA 4OT1H 1DBJH 5L2KA 3B9KC 2NW3A 3V6OC 3O2WL 1DVQA 4HXAL 3QUYB 4GFTB 1CXEA 4I0KA 3MRMB 3LDBB 3N50A 1XX9C 2ZWYA 1JGUL 4W9GC 2H7WA 4XO9A 3VGHA 1ET7A 4MDJA 5DFWH 4J3OF 3MBWB 4PMEA 5B38G 2A99A 4UINH 4AUYA 3EYOA 3G6JE 3MBED 4RGNC 1VPOH 4N90D 3QWRD 5DQDH 4WVRA 2HB0A 5C0CE 2X09A 4ENZA 3SOBH 4XMKH 4ABQA 2XQBL 3OF6A 2ZX6A 4BCYA 1UACL 3UTTE 5E7FA 2OMVA 4X4ZA 5GGUA 3L4UA 3ULAB 1N6UA 4PS4L 3M1BB 2CO4A 3AY4C 4R4FH 3L3IB 4OT1L 3K8MA 4UTBA 3B37A 1B6UA 4ZS6C 4ZW3A 2KH2B 2B4CL 5HHQB 4ODVH 4B7LA 1B0RB 1H9VA 3DBXA 4MX7A 2ZOKB 4X80H 3V9EA 1TG8A 4APXB 2ERJC 4BRVA 3ILQD 3QIUA 3ZTEA 1G7JB 4XCCH 4Z7NF 3CDZA 3LSOA 3MGOB 1NZRA 1QOKA 3SKMA 4UINL 1IILE 3REVB 5KVGH 3SQRA 2OJZL 2C9UA 2AEOA 4PJXB 4WV1B 3ZE2F 4QRTA 5I8CB 5DQDL 4PYGA 1GTFA 1SLWA 2VXUL 5H35B 3SOBL 1COBA 4PLOB 4XMKL 2ISDA 4HV8A 4URTB 1A1NA 1U8OA 3D85B 3ZKXB 2BZDA 1LWRA 3IE4A 4M93B 4R4FL 2V2TA 4V1DB 5JXED 2Z8SA 4FMFA 3UBHA 2A6IA 3FUHA 1MI5A 5DJAA 4P46A 5DWPA 4IIQB 4MJ5B 1PU0A 1YDPA 2Z91B 4X80L 4K0OA 3UPAA 4OZFA 2K45A 3M7FB 3QIBB 3VB9A 4YDZA 3KYAA 4ZMWA 4FFVC 5FKPB 3ZTDC 1W15A 4U3XA 4XCCL 1KXQA 3GSUA 1OPGH 4PRDA 4PUBH 1D5ZA 3DETC 1SMOA 1R5WA 2UYLB 4HJSA 5KVGL 5E4OA 3HE7A 1NKGA 4HU2A 3P3TA 1BF8A 4WTXA 3RNKB 2AK4A 3FCTB 5CFAA 2TSBA 1IBHA 4P2OB 4RMWA 4XX1E 1WBZA 1TPXC 3VYNA 3S3CB 1R3HA 4UUJB 2JIXA 4NQXA 2DLGA 4L29A 2HT4C 3CUPA 3WO4C 3VFGL 4DP4X 2BNRB 3RZCC 2BSED 4AMXA 1F3JA 3FOLA 4QYAA 2DWEB 1GC1H 4UT6A 4YZFE 4ZDHB 2DBLH 4LSVH 4AIZA 4J3OH 4OZIA 1T66C 2GIMA 1GY2A 3QWOB 2GTWB 3EJYC 4MRBA 3BWUC 2H1PH 1KIUA 1ED3B 4OFIA 1OVZA 3JQOB 1R9FA 4LLQB 3GSNH 3DTXA 5MEOB 2YBRB 4YK4C 3O9WC 1OPGL 3N1MC 1A9EB 4GPVA 4PUBL 1A9BB 2NR6A 1N10A 1DBAH 1JGVH 3GZPA 3CPLB 1PNCA 1FNSH 4A7QA 4RGMC 2F0CA 3PPEA 4L8BB 1YEHH 4WDIA 1JF5A 1E8WA 4EDXB 1JMXA 4AEEA 1IGTB 5JPNC 1AGEA 3EBAA 4ODWA 1C8QA 5ISZD 2L04A 4QO1A 1GZHC 1GC1L 1BQSA 2LLLA 5B3SB 1B4TA 4LSVL 5DQJA 1O9WA 3ESMA 2H1PL 4IU3B 3BP6B 1J0HA 3JV0A 4OVUA 2MCG1 1JPTH 4HH8A 4PFEA 1D6VH 3BN9C 3HZMB 3GSNL 3KBEA 3EO1A 2BMKB 1PX4A 3CGTA 3L95B 4RMSA 3NCJH 5EUOA 1E2ZA 1AS8A 3TYGH 4J5VA 1DBAL 1I1AA 3F7PC 1JGVL 5HHOA 4L1SA 1KYUA 3VXQB 2IV8A 3X3FH 1JTOA 1IEAB 3DGGA 1FNSL 4ETQA 2R7EB 2YMTA 1QYGH 3OKKB 3QUYC 1OP5K 3LDBC 2F1EA 2XWRA 1T83C 2WW8A 3OHXB 5EO1B 3AMKA 2R23A 1G7LB 1WCQA 2H1XA 5KSUB 4WKXA 4Y8DC 5CZKA 3CZLA 3IN0A 2VO5A 2QQKH 5D7JB 1UTDA 1N5AA 1UT1A 3FFCE 5I18H 3T4AA 1I8MB 2DQUH 1VA9A 3RYMA 3VFWA 2R0LH 1FFOB 2BHZA 1S6NA 4XBEH 2GUOB 2EINB 1IBBA 4FQIH 1JPTL 1J48A 1D6VL 5LJYH 5JW5A 1JFQH 2DMGA 4I8DA 4DHLA 3NCJL 3N1FC 4IRJD 3TYGL 5BZDB 1XT5A 4L3CA 3VFSA 1YEIH 1RKRA 3X3FL 2PO6C 2WAQA 3DO7B 1I3GH 1UVQA 3S3DB 1VGKB 1WG3A 1QYGL 1PJ9A 3T04D 4Y2OB 2AHIA 5GIRA 3OR6A 1OSZA 1P5VA 4B9JA 4FYRA 2O72A 4MCYB 5F0LB 2OJEA 2WWKO 4PU2A 4XBGA 4MJ6A 2F54B 3FMGH 4XPFH 3L3JB 1DBBL 1KTDA 1NIDA 2JJUA 4LCYB 1B9KA 1P7KA 4PRIB 2WVSA 1X4YA 3QDJB 1Q9KB 1FV1A 1G1CA 2QQKL 3K2MC 4JB9H 4WV1C 5IK3A 3HW7A 4C58B 5I18L 2IQAB 3ECBB 1D7FA 3MR9A 2DQUL 4OIBA 2R0LL 4BFBD 4O58H 2C3GA 3VVWA 4FQIL 3ZHFA 3SDAD 2YN3A 1XQ4A 3ZKXC 1RZJC 3RUGE 1FN4B 1JFQL 1XO8A 3I85A 3BZ4B 1IE5A 1YMMD 3P40A 4I1NB 4M93C 2X3CA 3VD7A 4NRXA 1YEIL 5HDRA 4QHUA 4ETYA 2YAHA 2BWIA 3G6DH 3VFUB 4EQ2A 1ZGLA 1XF4B 4IIQC 1T5XA 2QSCH 4MNQD 3D4ZA 4L8SA 4POZC 4PRNA 1CDBA 4MHHG 2V7NA 2NOYA 3QIBC 4L8DB 4OFDA 5D70H 3TJPA 2DM3A 4ANKA 2HG0A 4TNWK 4HW6A 3RBGA 4Y1AE 1WBYB 2PW2B 3FMGL 2PCPA 3MPCA 4XPFL 1IM3D 3PWLB 4AZ8A 3ISYA 3FAXA 4PGZA 4KY1H 3MJ8B 2HMID 4XN9A 3A5VA 2ZKWA 1AHWB 4WW1A 3RVXD 2ITDB 1VLXA 4Q58C 3QPQC 4P2OC 5ESAB 4O58L 3OD3A 1I1FB 1P6WA 4IS6A 4AE1A 2DM4A 4N20A 3N3EA 1G4MA 2O26U 4JHWH 2BVPA 3JT2A 2KPNA 2R4SH 4Q4IA 3WELA 3GUTA 2NX5B 2GC4C 1F6FB 3QRFM 1AG0A 2P49B 4TV3A 3G6DL 4M6AA 1ZTXE 5AENA 4K7PY 3FB5B 2QSCL 3U7YH 1N6VA 3TO4B 1AYRA 4JFEA 4PRPB 5D70L 3TN0D 4I4WA 2DPKA 5AB9A 2YXVA 3NAAH 4NCC2 2A0LD 4KQ0A 1X7QB 2GCYA 5LN4A 2PPDA 2VLJB 4KY1L 1YG9A 4PGBB 4UT7H 4GFXA 3LN5B 1AYOA 5JIPA 3SE4A 4U4BA 3ROLB 1UXSB 4PJ8D 3JTTB 4K3HA 1GZQB 1B4LA 1B0GA 2Z0UA 4NN5B 4ZRGA 4YXLH 1HXKA 3DX7A 4N0UB 2XG5B 3DSNA 4JHWL 3MRGB 1BQRA 5LXVA 2XV0A 1P9MA 4YDNA 2I5YH 1RK1B 2R4SL 5CWSB 5FYJD 3H9ZA 4P99A 4NKQB 1UJ3B 5TQ2H 4JGNA 2WXJA 4OJAA 2VXQA 5HGBB 3HZKB 4U6TA 1A4KB 3RPIB 3U7YL 2XFXB 4W4OA 4XOEA 1FVEB 1FUNA 4XHJD 1H0DB 2EH7H 2ATPA 2YR3A 5FO7B 3FQTB 4JPQA 3LB6D 4HIJA 2CIIB 3DXAE 4QGYA 4QYOA 3VQ2C 5AVWB 1T21A 1JWMB 4P57B 1ZSDA 3I3EA 4J3VA 5FM5M 3V95A 3I75B 3OHXC 3QK0A 4LMQI 4MAUL 3X1GA 3GINA 1JL8A 4L9LB 4YXLL 1RPUA 3KEDA 1BIIB 1WT5A 4NYLA 2XZAL 3MREB 3WL9A 5INDB 3V6OE 5HYQB 3MNZA 2I5YL 2M1KA 5D7JC 1MZYA 2FYVA 2KS0A 4IBVA 5TQ2L 2V17H 4GBXA 1NPJA 3G5XB 15C8H 3T71A 3FU0A 1WSST 3NIGB 4PJ5D 1XH0A 1HVXA 3RDTC 5IMMB 5FYLH 5CIPH 1P2CB 4FQXD 2YD2A 1AGCA 4RGNE 2EH7L 2OCJA 4LNRA 3DLQR 3TP4A 1OL0A 4JJ5B 4HS6A 4R5VA 5CCJA 4PBXA 3ET9F 4UM9D 4Y5YB 2FEJA 2Q0ZX 2X4UA 3QQ3B 4GSDH 4HJGA 4M7KH 5HI5D 3AU1B 1T89A 3EOTH 1F18A 1D5IH 3NSXA 3S5ZA 2A73B 3OJMB 3VFPB 1C16A 1CYXA 4GSQA 1NCUA 1OK0A 5INCB 3VWKC 3VJ6A 1H6UA 3GBNH 4TVUA 1G6VK 2XQYG 4KUZH 2EACA 1K5NB 2R2BB 4MXQD 4K55A 2V17L 1IM9D 1E5AA 4H0GA 5ICYA 3D52A 15C8L 3MCLH 4ELKB 3L5XL 2HX8A 1T1ZB 1OLZA 4RSYA 5IVZA 2BOCA 3CDFA 5GZND 5FYLL 1X5ZA 4S11A 3I02B 1YUKB 3P4MA 1AGBA 5D6DC 5F1KC 2ZXBA 3RURA 2GI0A 3CXDH 2AV7B 3CMOH 3HNVH 4FFWD 3EDDA 4E5XA 5KG9B 5IB3B 2WY3B 1PX8A 1M42A 2CSPA 2DYRB 1EJOH 1WF5A 3GJEA 3QULB 2YSTA 5HTSA 2X1PA 3H4FA 5D72H 5GGRA 3TT1H 3VQ1C 1WUZA 4XNBA 3E6FA 4GSDL 2MQ0A 3D4GA 4HK0B 3VM7A 5EEWA 4PRHD 4V2CB 3EOTL 4A7UA 1JYVA 1D5IL 4YHPB 1Z7JA 1QW9A 4LHJB 5E24E 4IBYA 4OM0H 3GBNL 4PREB 4JM2D 4CU6A 1JYNA 4KUZL 1AHWC 4CAGA 1P5UB 2HFFB 1U58B 2AQNA 3LRSA 3X12A 4E9LA 3MCLL 4K7PH 1U93B 3CZFA 4ZW7A 3SN6N 4APQB 4Y19D 4YVUA 5ACMA 4D0DB 2CHDA 5E9DB 1ZHLB 1BYNA 1KLGB 3TX4A 5EU6D 1X5IA 2Y7MA 2VDLB 3CXDL 4ZFOL 4PJBE 4M5YH 4XR8C 1BEYH 1S78D 1FO0H 2IANA 1EJOL 4FXLA 2F08A 5BV7B 1W80A 4RMTA 5D72L 3TO4C 3LZNA 1I1YA 4YDJB 4UOJA 5DMKA 2WNWA 3BISA 3TT1L 1XF5B 2VR4A 4R0LC 1HCFX 4HHGA 1NMBL 4LXFA 4MD4B 4FEIA 5EF2A 2X42A 3KD4A 1DHKA 4QAWA 1HOCB 4ES9A 2VKXA 4HD9A 3IJ7A 5DJ2B 5E8OB 4ZZKA 3NCYP 3QXDB 5A1AA 4PWKA 8FABB 4JO1H 1W0VB 1I8AA 3DK2A 4XP1H 4I5BA 4JFFB 1D5BA 4H0IA 4Y4HA 5SV4A 3VFMA 2FQEA 4K7PL 4NN5C 4HIIB 1JRHI 4YLQT 2YPLE 4KJWC 2VMEA 3K2IA 3EYVA 1AIFA 1Y6MR 5BUAA 2ZSVA 1TR7A 1ZRUA 3MBXH 4M5YL 4DGWC 3QJVB 1VESA 4PJ9C 4E42A 1BEYL 1HSBA 1FO0L 3FU7A 4KRPB 3GGWB 3NCBB 1IAII 3AJ7A 5IQ9A 3GD1C 3RTQA 1AO7E 1KYFA 3DIFA 1ITBB 5HI4D 5JPMB 1G94A 4D8PB 4MJIE 4PP2A 3MRDB 4NAQA 2HFTA 3RIFK 5IHBA 3V4PH 4TUOB 1ZPUA 4ZMVA 3ES6B 4KKPA 2NQDA 3QR2A 4YN3A 1QATA 3QJHB 5T3XE 3OM3B 4JPKH 4JO1L 4XP1L 4JKMA 2I07B 4C4KO 5DD3H 5HJBA 4NZJA 2ZXAA 4GMTH 3QARA 3WE6B 3BFOA 3D69B 2VL4A 3SPGA 4L9LC 4K3JH 3DURA 1U8MB 3DOSB 3P9LA 1YY9C 4X5XB 1WFOA 4K15A 2OZ4A 4N8PA 1HNYA 4R96B 3B83A 3I6KB 1DJSA 1M56B 3BWUF 2XIIA 3EZ8A 2ZUXA 3L2LA 1S7WA 1RHFA 4JY6B 3NFPA 1FZMB 3GSQB 1CTMA 3GTVA 4B60A 4G80A 5ITFB 1XGPB 5JA8B 1T7WA 5HDLA 2I60H 2HVBA 3VSVA 3V4PL 3T2OA 2XBDA 3FU3A 4CN1A 4ZUSA 2BSTA 1RULH 4D94A 2ED9A 1SM3H 5EEVA 4GRWF 5FOJA 3ZSSA 5SWSA 2YAEA 3L17A 4JPKL 1M2OA 3NRQA 4CGTA 3EFOB 1BA9A 3LD8B 1QFWH 2H41A 5DD3L 2OTPA 3EGXB 3VTMA 5MHSE 1JGDB 3HB3C 4GMTL 2VLKB 1LO0L 2F5BH 2PXYA 4WWID 4PJDE 1A6UH 4K3JL 4ZYKB 3L48A 4NKOA 2E7DA 4PSPA 4GEJA 3CG8A 3FXIC 3SGJA 5ID1A 5CJQH 3MRNA 2XV3A 2EE6A 4K2UH 5IGXH 4K71B 1D5MA 4HUUA 4N2HA 2YAPA 2B5IB 2EDMA 3HG2A 1MPAH 4MA3A 3MJGX 3Q3GB 5IFAH 1ESOA 3D05A 4HETA 2I60L 2Z7WA 3W2DH 4L3EA 3S5YA 3GMPB 5AG8A 4PJXE 4NO2B 1RULL 1PD6A 3LQAC 1SM3L 4HIEA 1ZPLA 4M7JH 5KJ4A 4BJLA 5EMYA 1AIZA 3MUGB 1QFWL 2AJZA 3TZVA 2BSBA 3VXRE 3ARXA 2Y24A 2MJWA 3II2A 2F5BL 1A6UL 2GSGB 5KOMC 4P23C 2VDQL 3HAEG 1HJBC 3H9SE 1CDUA 2IH1B 1H19A 4WKZA 4NZDA 4UNVA 1UZ8A 2F7RA 2C1OB 4Z3FA 3V0IA 2R59A 5A3ID 3LAFA 5CJQL 4IMLA 5IGXL 1F6AB 1P5UC 4A1KA 2WNXA 4K2UL 2VL5A 1PKQA 2XRAH 1MPAL 4G6AC 4APQC 5C0BB 1YCSA 3QZOA 5IFAL 1OTSD 5HDBB 4QNPF 3UG4A 2VGLM 1LYQA 2XWTB 3W2DL 2Y5EA 3JUZA 2CHZA 4R9HA 1A21A 3FT0A 3HUJA 3E6HB 3QJFB 3E7JA 6TAAA 1HNGA 2W1NA 3DIDA 3QZNA 4FEMA 4JDZA 5DRZB 1MHCB 1QTSA 3CU7A 4M7JL 4ZAKA 3LNIA 3PDOB 4HUXA 5BV7C 3TEYA 1Q9OA 2BCKA 4G8IA 4LF3A 1X5HA 2D0HA 3RUGA 1IAOB 1KFAH 4GS7B 1SHXA 1EDHA 1GCYA 1MY7A 1QQDB 2DAVA 2VM9A 3QDHA 4PJXF 5C6TH 5C0DA 2NLJA 4U33A 1OGAB 2YPVA 4QRSA 3T1FB 5FA3A 4XE5B 2EIEA 1VRSA 1QA9A 3OGCB 3MHZA 4F2MB 1EO5A 2XRAL 3WI9A 2GJ6B 5KYXB 3RLSA 3TO2B 4GRWH 1ZLVH 6PAZA 4NO5B 3TBTA 2E7CA 2OSYA 1JK8B 1WWWX 3FOMA 5JORA 1I1CA 2MMXA 4MMXA 1DQDH 3SDXB 5I2IB 1LP9A 2JK5B 4GW1A 1CLZH 2Y22A 2X0UA 4CGUB 4F27A 1KJMB 2XCMC 4KRPC 2IFGA 5B38B 2HJFA 2FGWH 1URIA 3QRGH 1CD8A 5T3XH 4U1IB 2ZUUA 4BELD 1W72H 3TA3B 5IW1B 1CF1A 4G1MB 5E00A 2LTQB 1WZKA 1QBLL 2Z6FA 1KFAL 4FTVD 3FQWA 2X9XA 3MROA 1X5FA 3R06A 2UUDH 4GO9A 4U1SA 4WHYH 4AWJC 5HBBA 2LE9A 5AB0A 4J3SA 2G9HB 4FGMA 3T6QC 2EABA 2MCMA 5IWLA 5D9SB 2DF3A 4LO9A 4F91B 1T3FA 1QLEB 3N1GC 5CEXA 2RFXA 1U8CB 3LKPB 3CN1A 2GITA 2XV6B 5B1JC 1DQDL 2WIIA 2QKIC 2WVVA 5KJ7E 4OI7A 2JELL 1CLZL 4A2GA 3OG6B 3BZ5A 2V37A 5E6SB 1CJYA 1OW0A 2FGWL 3MNWA 3QRGL 2APWA 1W72L 3WFBH 1BXAA 5AAMA 5FGBA 4R7NB 3V5HA 4QXTA 4Q6IB 2G60H 3R4DA 4WJG3 3WNLA 4A04A 1DVSA 1JZFA 3MUHL 4GG6E 4QHNA 5D71H 1JGLH 5HYSA 3PWUA 3QXAA 2VMDA 4OJDH 4AQEA 3LD8C 3UDWC 5DTFA 2BIHA 1LQBC 1ZS8A 2PTTA 5TH2A 4W9JC 4G9FA 2ICWB 3RIKA 3HFMH 3DXAA 1O6SB 5FA4B 1IGCH 2NPLX 3C60D 2WCGA 1E27A 2D9CA 1BVLB 3CXHK 2NW2A 5EC2A 3EO9H 4K71C 3S7GA 2B5IC 6FABH 2QTVA 4P2RA 1SJMA 4TQPA 5JXEA 2JVUA 2OMTB 4F9LC 2VR7A 3AWGA 1TFPA 2B0SH 4YFEA 2G60L 1DJYA 1YNTA 1SUJA 4JQIA 2QSTA 1RZJH 3CDCA 5HXMA 1CLOL 3LKNB 4KJPD 4AI7A 3SCMD 3TIDA 5EEYA 4EZLA 1QRND 5D71L 1BF5A 2DRUA 1JGLL 3PLYA 2A1WH 2XA8H 3W9DB 1D3CA 5GRWA 3PWVA 2QVMA 4OKVB 4RAHA 1ZXKA 5D4HA 4FLOA 4FZ8H 2Z8VC 4P49A 3TXAA 2ZUQB 3IDGA 4KKCD 4NI3A 4NWTH 4JS7A 3JTSB 4PI0A 1JVKA 1CTNA 4N2EA 3RWGA 1A2YA 4L1LA 1D7CA 4UU9A 1G1KA 1R3IH 1XMEB 4Y9CA 3HFML 4G9DB 1IIKA 4N85A 1IGCL 3HA0A 1NFAA 2V3EA 4LAJH 3TH2T 2NY2D 4GO6B 2D31A 3EO9L 2VLME 3KDMB 4GMSL 6FABL 3VGGA 1XGQB 1A7OH 1DN0B 2YFOA 3SBRA 1GCFA 4Y16D 1R46A 1XSOA 2B0SL 1KBBA 1RZJL 1MVFA 4F7TB 5JLZA 2ESVB 3HPLB 1MFEH 3FH8A 1RZ8B 4P2QB 2A1WL 4TVPE 4EVNA 4KNTA 1KGUA 2YRPA 4GKLA 2LT9A 3M88A 4G5AA 4FZ8L 2A4CA 2C34A 2D73A 3UTQA 1TYEB 4OM1H 3BUYB 4NWTL 2P26A 3VE0B 4NC2B 3JVGA 4DP9X 4XC3H 4KK5C 1JHLH 1R3IL 5F1NB 4AQAB 2RTTA 3GRWA 1EMTH 5A43C 5D1ZD 1UD3A 5HHMD 5AW5B 1QG3A 4CKQA 1RIHL 2NY5C 2X6UA 2DJSA 2J8UE 2VLRB 3BGAA 4PVMA 1TTCA 4B5ZA 2ZYHA 4E9RA 4CC4C 2QEJA 4G71B 1OQXA 1J12A 1A7OL 3RWCB 2J8HA 3F64A 2WJ5A 3SGKC 3SD2A 1BZOA 2VLJE 4TMPA 4XWOD 4EI5B 1KF9B 1MFEL 1QLFA 1XEUA 2PNDA 5E8PA 3H6JA 4Q14A 3Q1EA 5IF0B 4H8UA 1TTFA 4GP5B 3MV9D 4LBAA 4OM1L 3TA3C 5BRPA 1MOEA 4ZMZA 3NDZE 2EDQA 4M1CC 2LTQC 3RB7A 3RWJB 2HKLA 2OMYA 2YMOA 3QI9C 4O5LH 3NACH 3T65A 4CNIA 1EMTL 4HPOH 3MA9L 1D5XA 5GGQL 1H8OA 3D3VE 5K9OA 1XL4A 4JLRA 4HC1H 2O6FA 1U9KA 3H85A 2AJ3A 4J3OD 5EULV 4ORGB 3RVUC 4FFZH 5I6LA 2WTRA 3RX7A 5D1QE 2ZNWA 4E9WA 5I19H 3WKQA 2OX5A 3LNDA 2FR4A 35C8H 2FX7H 4ZXBC 2IXQB 1O7SA 3FDWA 5H37A 4MCZB 1DYZA 5DHVB 3DX0A 4FQHA 3HZYA 4NRYB 4MD0A 3ABZA 1MNUL 4IRJA 1NCNA 3VDCA 5DJCB 2VDNB 5TF0A 4ANXA 3BWAA 3CSFA 2HWZH 3U0WH 4Q6YA 3MLVH 1KJVA 4KKLC 5KN5A 4O5LL 3NACL 1ODUA 4HVBA 1A6AA 4HPOL 4QWWD 3P2DA 3UIYA 3V0VB 1S3RA 4QLWA 5LBGA 3EFFA 1RJYA 1THCA 2XYCA 4X4KA 1X6NA 4HC1L 5CBAB 3KPSA 4ONHA 3GIVB 3WS6C 1AQKH 1CE6A 4BV1A 4BWUA 3GMOB 4FFZL 4IOIA 4LL9A 4TQIA 5I19L 4R97B 5GS3A 1IAIM 35C8L 2FX7L 2NCEA 4HKJB 3K6OA 3NCEB 1E5ZA 3SDAA 2EICA 2NXZC 4PWIA 2JCWA 3UPRB 4OIIH 2GJZA 1CD0A 1A5FH 1KMGA 3B5GA 4ZFGH 4DESA 3Q8FA 2DBJA 3U0WL 1OTUC 3MLVL 4LOUC 3ALXA 3KXFA 4H88H 4E9SA 4MNQA 4QRRA 1IGYA 2IH8A 1AVAA 3B5HA 1WE5A 1KTRL 5DEGA 4N9GB 2DS4A 4NQDB 4PY8J 2ZCLH 3VNZA 3UTTD 1FYTE 4YUEL 1AQKL 1XCTA 4RDQF 4HUVA 4HWZB 2X41A 3G5VA 1OLLA 2UX7A 3L7FB 4L48A 1OANA 1NC4B 1OCCB 1JIBA 4YHKH 3NQIA 5AW6B 5TDNA 2G5BA 3WFHB 5BS0A 3MZGB 5I6PA 4IRSA 1U4EA 3NIGF 4X5WA 4OIIL 3SE3A 5LXGH 3GYRA 3GSOA 1A5FL 5EBGA 4HG4J 3A47A 4ZFGL 3TEZA 2XX1A 3P3UA 3VXMA 4H88L 2E27L 1DQLH 1CO1A 4JREB 2ADIB 2QTEA 5EFIA 5EO0A 3MRHB 5L2JA 2ZCLL 4O2CA 4RQQA 4HZLB 2OMZA 3K6SA 1Z3GH 3IJEA 2VM4A 1QW8A 3ZTCC 2WWMC 2AQRA 2Z64C 3ARSA 2J7LA 2CBPA 3KPTA 2B39A 2YOCA 3I6LD 5IJCC 3I74A 4G1EB 1KIRB 4OGQC 2VSKB 1Z2KA 3BPCA 4X7FC 1W0WB 1V3JA 4DGUA 4CVWA 4F3FB 1HT6A 5EEZA 3CHRA 1MJ7H 4IBZA 4MLSA 3N9GH 1L9RA 3DC0A 2WWOA 3MVSA 1QNIA 2XA3A 3ML8A 4M29A 1L5GA 4XCEA 4GKZA 5AVTB 4BSVA 1ZVSA 2YQ2A 1V10A 2ORBH 1DQLL 5DA4A 4A1JA 2D2OA 4G2AA 1IAKB 3OQ3B 4D8OA 1IL1B 4HUCA 3ARZA 1XD0A 1SYSA 1E4XI 2BOBA 4LLMA 3RGVD 4JFFE 3FYEB 3DMMC 1A6TB 1Z3GL 5C0GB 3ILEA 5IIEA 5I71B 2Y3AA 4TNEA 3OV6A 2ATKA 4XT1C 5C0AA 1NIFA 5ESVA 1MWAB 1GS7A 4QRPE 5EU3B 1TENA 1BFVH 3P77A 4ZFZA 3G5YA 4KWUA 2CA3A 1XF1A 4PV1C 5LGHH 5MERA 3TESA 3VYPA 4IYKA 2GTZB 3U48A 2VJ0A 4Z77A 1FLRH 2AKRB 4PJ7A 4RH4A 1RSFA 2X2HA 3FBKA 1MJ7L 2FSDA 3MA7A 3BPLC 2EDLA 5E4IA 5GRVK 1KV7A 2AXGA 1AG6A 1JPFA 1Q72L 3CN0A 4DKDC 2ORBL 3HLAA 4WGVB 2E46A 1X7SA 4F9PA 4QRUB 1M7IB 4MZIA 3BO8B 3GNML 4FQXA 4JUTA 4TL5A 3SIKA 2P5EE 4OCRH 1KBWA 4F37K 2CK0L 3VXSD 1LILA 2ZYSA 4WI9A 2PP8A 4N6QA 3OMAB 3V7MA 4JPSA 1BFVL 3IN2A 2Q7YB 5LGHL 3UAJC 3CSYB 4LMQE 4J4PA 5AVSB 1YNLH 4FNTA 3WLWC 1OZTG 4KK9C 5F7EH 3ZHLA 5KOVC 4JNXA 4AXWB 1M3JA 4HA1A 2JCCA 4OUOA 1PZ5A 5DK0A 4AQ1C 3BGMA 1UWFA 1IM9A 3O3AB 4XVTL 1AFVH 1NWOA 3ASOB 2DQEH 4J12A 1ONQB 3QUKA 5H94A 4LPQA 5GZNA 4LFHD 3UEZA 3BXNA 4YHIB 5ANMB 3NZHH 2VITA 4KKRA 4YHYB 5HYJE 4OCRL 4B9ZA 4C56D 1BZ7B 5JDJA 2ZKYA 5HGGS 2DL9A 4GSUA 1KENH 2Y7QB 4U1LA 5FKAB 1Y18A 1HFUA 1A7RH 5B22A 2BNQB 1U0QA 1NC2D 5CSGA 4HUWB 4AEIH 3O3BA 3DHPA 3NK3A 4KO6A 2YD7A 3L13A 1KTLA 4PRHA 2MWCA 5GSVA 3LQAH 1YNLL 3THMH 2EVHA 5F7EL 4XCFH 4UV4H 2SEBA 3MV8B 1N26A 3IMWA 4JM2A 4RSVA 2I26N 1UWXH 3NJHA 1Q9LA 1AFVL 1TJHH 5FYLD 1YZZA 3BQUD 1OPOA 2DQEL 3PWPE 4X9YA 5LKNA 4Y19A 4ZODA 5FEBA 3VA2C 2KUTA 4MA8L 3NZHL 3GSXA 5IHZA 2YEZA 3F7YA 3QNXB 2BDNH 8CGTA 3S35X 2AXJA 3KBHE 4L4TB 3BH9B 4JFPB 1Z5LB 3WD5H 5ICZA 3PJNA 3BP5A 2H8PB 3CXFA 3O8XC 3OJVC 1CK0H 4ORZC 5J57B 1A7RL 1UKTA 1B2YA 4JREC 3P73B 1JZ4A 1QNZH 3X13B 3TTSA 2VDLH 3G5ZB 4AEIL 1LEIA 4C83B 1R6VA 4BYHA 1T2QH 1EAQA 4HAGA 1DUZA 3THML 4BH8A 5I23A 4XCFL 3VFNB 1ZA6B 3KS0J 2N3JA 5HDBE 4UV4L 2NXYD 5BV7H 3QIWA 3H0TB 1OSPH 4WJKB 4WY7H 4GLRH 3HG4A 4DKTA 1BCIA 4BSWA 3FUEA 1M7DA 1TJHL 1NGZA 4LLUA 1EZVX 1N0LA 2AJUH 1DJGA 2RCSH 4Z0XA 3TNNB 3QWQB 1XSIA 4R7DA 3RP1A 2QGBA 2KBGA 3SBWC 4QRFA 4Y1AD 1K8DA 2BDNL 4WFGD 1LWJA 1DZ0A 5BMFH 5GZOC 4NPJA 3WD5L 4L8CB 2NNRA 3ESUF 3U9UA 4LBEA 3WTXA 1CK0L 3FRUA 1C12B 4YOKA 4AGMA 3QNYB 4CSZA 4GI6A 5F7YC 1TVBA 4QRQB 2VDLL 2W07A 2DMHA 4PHZA 3R18A 5EWIH 3SYCA 1IFRA 4QJ5B 3W0WD 3U4EB 4P5TA 3T0DA 1XAKA 4X6CE 3IDIB 4YL4A 5BV7L 2V2WA 5D7LB 1DQQA 2RALA 3IMVA 3OR7B 1A0QL 4WY7L 2OXGA 5LG1A 4CN4A 3FU6A 4I7ZC 2CO7B 3HOGA 3ZE0B 1I75A 3LKOB 3EOAB 4YQXH 2YGQA 1LEKB 2QADD 1A7BA 3AREA 3OAWA 4N0CC 4X6DA 4BK8A 3FO9B 2AJUL 4L37A 2RCSL 1TJGH 2BNUB 4ELMA 1EBPA 2FX8H 1MCSA 1HIMH 3GJFA 4KZCA 1JZ8A 1MAJA 2C9PA 2HKHH 3DX8A 4KUCF 3D48R 4KKBD 5HDBF 5HI3D 5BMFL 2P5WA 4EOWL 1GW6A 2Y5TA 3BH8A 4XPBH 1OP3K 4JN2B 3A23A 1J8HE 4B96A 4DGYH 4PJGA 3VXUE 1ZSHA 3PWNA 5SWZB 3BAYA 2AEWA 3ARFC 3QEHB 2PW1A 2DQCH 2QBWA 5EWIL 2IAMD 1K5WA 3V4VA 1THAA 4QT5B 3H53A 4Q89A 2OKMA 1WZ1H 3QVAA 4AGPA 5GHWH 4JO5A 4YQXL 3EOBA 3CE1A 1KSRA 4YSOA 3R0NA 4DT2A 4HJ0C 2BXZA 1TJGL 1L0YA 3MKGA 2F53A 2FX8L 4KROB 1HIML 3NA9H 3MRCB 3EF7A 2M2DA 3L3HB 1L0XA 1GIGH 2HKHL 3JBG7 5I5RA 4NXSA 4Z8FH 2APVA 4HALA 3KAAA 5GPRA 4XPBL 3SDXF 1H15A 4DGYL 4WRLA 5E1AA 1CFTA 5DCCA 5ENWA 3ZE1E 1J0ZA 1HHIA 4C4KT 3VRLF 3IM1A 2DWXA 3A24A 4F20A 1OE1A 3HAEB 1T4WA 4JRXB 4BQ6A 1HX0A 1NCDH 2DQCL 4HLZG 2OXHA 4N2DA 4YHYC 2HT3C 3NIDB 4O02A 4XPTH 5BRZB 1NFIB 1EEYA 2G2NA 2N0KA 1G0XA 3B9KD 5FUOH 4I88A 2X7LA 5IVNA 4MA7H 2K78A 1HQRB 1OAKH 1WZ1L 1WCBA 5GHWL 5A40E 2M26A 2GG1A 5C0NC 4M6NH 3H3PH 1FNGA 1YMHA 4ZUUB 3HI1B 3LPGA 2V5YA 3ABGA 3NA9L 5HGAA 5M95B 4M02A 1GIGL 4RGND 5GSRA 4Z8FL 5I0WA 5AZEH 5DR5L 1MFMA 4HEMA 4J8QA 1NUNB 2BVOB 2Z7ZA 4LZHA 2H3XC 3M6DA 4HDIA 1N6QH 2VYRE 3BEWA 3GUFA 4IKKA 2HN7A 4ZUWB 3M1CA 1G7QA 5EC1B 2D0FA 3VG9B 3GMNB 5I73B 3LVTA 5AYTA 1NCDL 1QTPA 1MQ8A 4D3CH 1JMZA 4D9QD 3MRRA 4ZQKB 4XPTL 3WLBA 4A67A 3AUWB 5FUOL 3FCSA 4ZS6D 1A6PA 1JCVA 4MA7L 1ULVA 1EO8H 1OAKL 1H6TA 2YGPA 2WGNB 4EUPA 3RX9A 4WHTB 2IOIA 3TBVB 1YEGH 4M6NL 1WDAA 3FQNB 4ZSOA 4FE9A 4LGSB 2VABB 3A3YB 4XNQB 3AB0C 2A74B 5E2TH 1TEYA 4HZAA 5F7DB 3S2AA 3IMSA 4DOHE 4ZMQA 5C3LD 1JK9A 2ZCZA 1DFXA 2R1XB 4EI6B 4TN9A 5AZEL 3N43B 2W9DH 5CLWA 3PNWB 5DJZA 5DQ9A 1LHZA 4PWGA 3UPCA 1N6QL 1MJUH 1UOWA 4HJTA 5E23A 5FECA 1NEZG 2ZKXA 1Z0MA 5EPMA 4I77H 1IVLA 4AH2A 4PRAA 2YLHA 3KJ6L 1AQDA 1EDQA 5JHMA 5JHLA 2NY5H 4D3CL 3EYFB 4GUPA 4HSCX 1L0QA 3BVXA 3L16A 4IRZH 2MSPA 4WU7A 2Y06H 3BVNA 5A16B 3ERXA 1BG9A 2NT1A 5BQ7B 1C7SA 1YHPA 4K8RC 3KVPA 3CK0H 5DVKA 5JOFB 1QBBA 3BRFA 5DLLA 4FFVD 1PFOA 5EHFA 3ATFA 1ACXA 5BNXD 5IB2B 4NHUA 1NIBA 4JAMB 3DETD 2AJSH 3GO1H 5E2TL 1KGWA 3RY6A 3ZW3A 2YC1A 4H25B 4ENEC 3NCWA 4KK6C 3OMIB 3LH2H 4V2BA 3CSBA 2W9DL 2XDHA 2ZWSA 5E8EB 2XC8A 4B95C 5I6MA 1CURA 2ZUWA 3QFJB 1MJUL 4PV8A 3MUJA 1KBGL 3SDCB 4WF7A 5C0FA 3A6CH 4I77L 4JQVA 1ND0B 3Q06A 2HT4D 4NM8H 2R29H 3IWVA 4N6RA 4U1JA 4DKFL 3RZCD 4I1PA 1BMGA 1TTBA 3L3GB 3QR0A 4OF3A 5BRQA 4NQCB 1L4IA 4IRZL 2OW6A 1N9PA 4ZX3A 5CKAA 1QLEH 1T66D 5HVHC 2Y06L 3EJYD 3LY6A 4GP4B 2G3XA 1BMZA 3B6SA 5GGSA 2UY7A 2WXFA 3TCXA 4PJAB 3HMWH 1Z9LA 3VI4B 3CK0L 3U0TB 4PLNC 3CFJA 4UZGA 2HFGH 4FXKB 4HYTB 4UBDC 5TGBB 2NNAB 3D39E 3O9WD 3R19A 1ZT1A 3BT0A 3KLKA 3GMRB 4XAKD 3C5ZA 4X0KB 1INEH 5L8LB 3KBPA 3BFWA 1I3VA 5SX5H 3KLAB 3LH2L 1SXSA 1ZLSH 2QV4A 4UOW0 1I7RA 3D0LB 1JZHA 1MCOH 2UZYB 3PDDA 3SDYH 3CDGB 3EH3B 1AO7D 3F00A 3QDGE 4U2ZA 4XWGL 4LP4A 1S9YB 2VAAA 4M7LH 3A6CL 4G7VH 3H1ZA 4G72B 4PWHA 4KROC 2R29L 4NM8L 2JB6A 5AYUH 4A1RA 4MDIA 3AADB 5C0IB 2LU3A 2VQ1B 5EZPA 5B1KA 4JDVA 1FVDB 5T3XD 1QLEL 1N8ZA 3A22A 1L9SA 5F7WC 1DSYA 3CBJB 3HMWL 3N41B 4JY4A 1J18A 5SX4I 2ZXEB 3BN9D 4JCLA 2YSSA 3UAAA 5I0VA 3MRIA 3U1SH 1INEL 1QRNA 3S36H 2R2HB 5KBMA 3QUYD 1ZLSL 2EDXA 3D30A 3IJYB 5I1CH 1MCOL 3SDYL 3WAJA 1R5IB 1QPXA 3R0MA 5IVXA 2HG5A 4M7LL 3EBHA 4G7VL 5AYUL 5FW6A 1JXJA 5DD1H 3AXLA 4NIKB 2B9AA 2FSEA 3P9MB 3CXHJ 3TA4D 3IKKA 5EIVA 3CVIH 3N40P 1JWUA 2V5SA 1KEGH 1HHGB 4OAWA 3IDMB 4U1KA 3VQLA 4IOFC 1NGXB 4Y16A 3VG9C 4PG9B 5I73C 3STLB 5EZIH 5T5NF 5JMOC 1HHHA 2DD8H 4GKSB 5J1AA 3U1SL 1S7TB 4HUKB 2F68X 2WPGA 3VFVB 3S36L 1MFDH 4NC1E 1WZAA 4U6XA 5I1CL 1GXEA 5L7XL 1TMCB 1O7VA 3B2VH 1P7QB 3HN8A 3ZGHA 1CVSC 5IQOA 2J56A 1XR8A 2V9TA 5DJYB 4U4IA 4PJEE 1EEZB 2IEPA 5AEAA 4WW2C 2YXWA 5HYJA 2A74C 5DD1L 1MDTA 3QDMB 4JKLA 3KR3H 2I25N 4DZBA 4P3DB 3CQFA 2EKSA 4NCDA 1OP5H 4Z3GA 1XR9A 2MTAA 3BAIA 5LBVA 2FEEI 3CVIL 3PAZA 1QEWA 2VTFA 2JI1A 3Q9PA 2J73A 1KEGL 2HTKC 2WLMA 3IFOB 3D85D 3RVVC 1DBKH 4Z1PA 2RD0A 5EZIL 1EIBA 4GW4A 2DD8L 3MRBB 3GHPA 5ACZA 4YH6A 2ZUSA 4GQZA 4V1DD 3TL5A 4RAUA 4UILH 1ZAGA 3W5NA 3WV0A 1MFDL 1NAMB 2V5RA 4P3WA 4OLWH 3WN5A 3TEWA 2WQVA 3I9GL 3B2VL 3MV9A 4POZD 4K9JA 5DSCB 3QIBD 4NFDA 1FZOA 4XH2B 2KZ1B 2VXTH 3ZZQA 5JW4N 2WYZA 1T1YB 1Z9PA 3KGRA 4NAMA 3LHPH 5KBLA 3BRGC 3KR3L 2O61A 3FSOA 4MCMA 3QORB 3D12B 5HHPB 4LVHB 5A7EA 2DQIH 2EEXA 3VH8A 2FQDA 3CQPA 3QPQD 4P2OD 3VA6A 2HFEA 3SDCC 4BKTC 2KPWA 2IPKA 1J9CT 4YE0A 3GPSA 1FNEA 3C9NB 3FB7A 3DJ9A 1WFNA 2BNRD 3LXUX 1ZTMA 3U6RB 4FF9A 1JHTA 2V6HA 3GDBA 4MFHA 3ZR6A 4UILL 2OULB 2XWBB 1MUJB 4ISVB 5ES4B 5AUMA 1GOFA 4QRBA 4OLWL 1I4FA 4HEPG 2Z4QB 1BX2A 2XLLA 5GGVH 2HJLA 3QYMA 1VENA 3LN9A 1QSZA 1R3JB 5DHVH 2VXTL 3PQYE 2WO3B 4H7VA 1L6PA 1V55B 1NTDA 5D5ME 3LHPL 3SODB 1VIWA 5J9PB 1S9XA 1QZ1A 1NEPA 2J71A 4UT9H 1G1YA 2VDNH 4B27A 4X5RA 3DA0A 3BOVA 3IU3B 2YUVA 3BEVB 5FYKH 1I7TA 1BXUA 1FRGH 3TC9A 1JF1B 3QPKA 2GEQA 2W0KA 4ZK8A 1PDKA 1JF6A 3UTZB 2YK1H 4MKMA 4F7EA 3ELAT 1AMYA 3LPFA 4YSSA 3KWWA 4Q4EA 3MBEB 3KLDA 2OK0H 2WSPA 3WKYA 2EC8A 1IC7H 1UCBH 1Z9SA 3UBXI 5CNHA 2FL5B 2NDFA 5IBLC 1J10A 4JFXA 1A1MB 4PSRA 4DUVA 3NP4A 5GGVL 2XXMB 4AJVA 5DO2C 1CIUA 1BYOA 1NCBH 2WKOF 4BSJA 2KLRA 4ZX5A 2BP0B 3FTUA 5FUZH 4KITB 2GSIB 2MTPA 4XVJH 1KT2B 4UT9L 2Y6SC 1I7ZA 2VDNL 1B0IA 2LHAA 2PUQT 5IJKA 1NCCL 1MH5B 1PIGA 4BA0A 2HUHA 5FYKL 1FRGL 3HPJA 2FVNA 1SDYA 3LCYA 4WEEA 1X7TA 2YGOA 1FL6A 3S98A 1IFHL 5IEHB 1MIMH 1CB4A 3S96B 4LCCA 5ESQB 5C0EB 4DO4A 3OC8A 2B9BA 4HFWA 3UGUA 1F1GA 3DPDA 5D7JD 3RVTC 2OK0L 4R4BA 2OTWA 2X12A 1HHKB 2MCPH 1IC7L 1UCBL 4KTEH 5TE7H 4YHLL 5F0JB 5EBWB 1ZJAA 4PJCE 1HS6A 4LU5H 4WEMB 3RDTD 3EFDH 1T04A 5BOPA 3SDDB 2AMUA 5C08A 1IC4H 1NCBL 2F74B 2WWNA 3MV8E 4M4PA 2QVTA 1E9OB 3GZOA 5FUZL 2BW5A 4I89A 4Q52A 4AQ8A 3EG9B 4JKKA 3LN4A 4WAFA 1G5AA 5AVUB 4CVXB 4IBWA 1HL8A 1GZPA 4JFDE 2ALAA 5BVJB 3NQKA 4UMGA 4KI5C 3WU1A 3S3PA 5DI8A 2F54D 3FO0H 1JWSA 3KPPB 2KKQA 2MOGA 3HS0A 4JBSA 4PRID 5BUPA 3B3BA 5C8JA 3VWKD 3CCHA 4Y5XA 4U1NB 1P7HL 1KCWA 2MCPL 4V11A 4KTEL 4NPYB 3P4OB 1KBPA 1Z6JT 1G6RH 5TE7L 4I48A 4RFOL 4L4VA 3LIZH 2YA0A 2WXKA 4LU5L 3TVMA 2MIZA 1LD9A 3GMQB 3UYRH 4AYFA 3EFDL 2P42B 3BVVA 3BQVA 4N4YB 4JRYB 4AK2A 3BDXA 2DQ6A 1IC4L 3UABA 1SLXA 2PCXA 1XGUB 1QO3B 4JMNA 1TKWA 2ADGB 4TM9A 3NFNA 1RAMA 1B3JA 3RGVA 3U36B 1J87A 2VLMD 1YO4A 4HWUA 3WEXB 4AYBA 1HJCA 2Y07H 4DPCX 1EH9A 4TNFA 3GLZA 1UM6H 5F89A 2OYMA 4LLDB 4RMVA 1HH6A 5HJDA 3QZWA 2IV9A 3IXTB 5D7HA 4H26A 3UZQA 5I28A 1SOSA 4XMVA 3QORC 3H9YA 4LVHC 3NJXA 2X1WL 3FB6B 5T8IA 4TVPD 2BP8A 3CZUB 3LIZL 1MWAH 3QCVH 1BWWA 2P4AB 3UYRL 3ME0B 4NDMB 5JDSB 1VADB 3MGAA 4BFIB 3TM6A 2CDEB 4M61A 5KSVA 3ZG4A 5ISZB 1FC1A 5DDHB 5KVEL 2ZWNA 1WV7T 1XL6A 2XN9B 3L3KB 1BFOA 1JVLA 2NX5D 4G8GA 3V5KB 5BO0D 1DE4B 5GS2H 2Y9RT 5HJGA 4MS8C 3F12A 3TO4D 2NTFB 2VN4A 3FB8A 3MRFA 4PRPD 5DHMC 2IGLA 2W0PA 1CFNA 2CUHA 2DM2A 3P0VH 4FFYH 4MTMA 2Y07L 4CW1B 1KJ2B 1UM6L 2GK0A 3MLRH 3IDNA 2O30A 3MV7E 1U92B 4ODBD 2VLJD 5TDPB 4M1GH 3QUHA 4TLTA 2IOOA 3PIQA 1KIQA 4DVBB 5D7IA 5D2NB 3UP6A 4AM0Q 5A6LA 1UWEH 3BHBA 3L3OB 2VR3A 1MWAL 2P8MB 3QCVL 4CU7A 4G8EA 3CDYA 1GYUA 1SOKA 4LDCA 1YC7A 1DJZA 1A7PH 4IM8A 4MQ7B 2PYFA 4OKDA 5DS8A 3RBSA 3W9EB 4XN2A 4KJWD 3BPOB 3KS0H 1SXAA 2X4RA 5DJ0A 3H8NA 2OAAA 3ZT5A 4PGEB 1E7VA 1IKNA 3D3VD 1WTLA 3GLEA 2XXGA 4FCHA 3OJ2C 3BD3A 4MJJA 4DUXA 2JLPA 5JXAH 4C56A 5D2LA 3LRKA 3PY9A 4KXDA 4RMQA 3U25A 2A9MH 1N59A 3P0VL 2XSKA 1FL3B 2X4OB 1PCXA 4FFYL 4NZTH 5DYOB 1G9NC 4AKQA 3MLRL 3I2CH 3Q8EA 3TYFA 4QPEA 3GSRB 1FG9C 1NGWA 4PB9H 3BVTA 4M1GL 5KJRH 3ZE0F 1UUNA 1KCVH 5C09A 4OV5A 1ZEAH 2EC9T 1UWEL 3NZ8B 2FO4A 2ZAGA 3PHQA 5F3BA 1N2RB 3O2VH 1ZHNA 2FO8A 3B8SA 4YO0B 5D4QA 1A7PL 2ARJQ 5B8CB 3VYOA 5G5DB 1YY9D 1JV2B 1H8SA 2G2RA 1YPZE 4GY4A 4N2IA 4RZKA 1LL1A 4IGBB 3BQUA 1S7QA 4NO0B 5HHNB 1K72A 2O6PA 3S34H 2X4QA 2K4WA 4Z7VB 5E6IB 4Z7OE 2FT7A 4XO4A 2Z31B 4X9HA 4NHCL 1U8IA 2XIBA 3WJMA 3V0HA 5JXAL 1R5VA 1AP2B 5I1AB 3WKNA 1A4JA 3SDDC 2A9ML 2AVGA 4NZTL 2V5TA 4LIQH 3NOIA 2EE0A 1G7IA 4XN7A 1B9ZA 1HESA 1YMMB 4F7CA 3I2CL 4UWQB 3V8CA 3D2UB 1BPLB 1GKEA 2BPBA 3VMNA 5KJRL 5F3HA 1QSFE 1MREH 1SJXA 4AGQA 1ZEAL 3T2LA 3UTSB 1ICTA 1RZPA 3NJGA 3O2VL 3NJMA 3HB3D 1JUFB 1R34A 1USZA 5CJOH 4TUJA 2EJ1A 2OCFD 3FTSA 2YRLA 3KPNB 2FDBP 1JXKA 5C2BH 3S34L 4PGJA 4ABWA 4B41A 4DCQB 1JPGB 4ZFOA 4OW6A 5J13C 1JXDA 1PJWA 2FH6A 2WUBH 3VWKB 1TZIB 1MDAA 1FG2B 2ZX5A 4BIKA 5J6GA 3N06B 3HR5A 3LKQB 2F7OA 3NIDF 1YPZF 4LIQL 3GSWB 3U4BH 2CA4A 4PVBA 5IROD 4PLJC 4IMKA 2H3KA 4CADA 5GRJH 2GBVA 4U6HA 1MREL 4XODA 2W94A 4NQSB 4WO0A 1T22B 3HJEA 3DYPA 4YHOH 4P5SA 1WK0A 1BD2A 4MVBC 3W0WA 1S7UA 1F4HA 3HRPA 1WD9A 1U95B 5CJOL 2IC2A 4P23D 3U83A 3UAFA 4MBOA 1ZT4B 3JWOH 3P3RA 4UQ3A 3UJTH 1BM3H 3VCLB 3RI5K 2EEAA 1IRAY 4WUKH 2A83B 5C2BL 2XXFA 1M05B 5IMLB 4OTXH 1ET8A 4Y4FB 3DARA 3G08A 4JZOA 2BIPA 2WUBL 2O5NA 3DX3A 4PJIE 1FO0A 2WLLA 4G6AD 4M48L 4XCYA 4APQD 4PJEA 3VI3B 1SGKA 1IFGA 4N0YH 3BIAX 1C1EH 4BE6A 3IGFA 3LXAA 5E9DD 4BEIA 3QH3B 1F6LL 3ZO9A 1YVLA 2FRGP 4HOZA 1VAHA 4A2EA 1OIOA 1QHPA 1ZHBB 1MJ8H 5I16A 1PLBA 4WNSA 5GRJL 4J27A 3MNVA 1G43A 2DIJA 4BUGA 1NBQA 4YHOL 2VW6A 2IH3B 1AD9B 2IAMA 1XBDA 3ARDA 3AAZB 4MJ4A 4FNSA 5CJ5A 1OV8A 5C0JA 1LO2H 4QXWA 3JWOL 3UJTL 4ABUA 1BM3L 2DV6A 3C6LB 3N43F 1OALA 4WUKL 5AAPA 4EN3A 4OTXL 4MKTA 2HRGA 2LLGA 5D2NC 5I0XA 4KMQA 3L3OC 3GMLB 3FT9A 3L8QA 3VI4E 4QI3A 2PWGA 2BVQB 4JFFD 4L9DA 3BAEH 5C07B 1IMHC 2FD6H 4X9FA 3AACA 2B15A 4CVZB 4N0YL 2E7HA 4A7SA 4C57C 4XX1G 2OTUA 5DYFA 5CD3B 3BPOC 1INDH 3KGUA 1XGRA 1U8QA 4HKXA 4QRPD 1BAWA 1HQ4B 1VFUA 1MJ8L 3D25B 2EEFA 4LP5A 4LCWE 1KC5H 3V4PA 2WBJB 4KRPD 4YFLI 3VFRA 3OKYA 2AV1A 1EEQA 3DRTA 4JFOB 4PJIF 5TJWK 4BDVA 4PJ5B 2A6DA 3V0EA 4ZW6A 5KS9E 2X4PA 4IU2B 1T4KA 1S7XB 1LO2L 3HAEH 3QO0A 2ZOUA 3AROA 4IJTA 2A6JB 3CNKA 4EZJA 5JHDA 1EHXA 4R4ND 1OM9A 4L3FA 2WK2A 4G6MH 3EH5B 2OMUB 3L5WB 5IKCA 3U2JA 4UM9B 1ACYH 1FFNB 3ULSB 3BAEL 5K69A 2FD6L 1RJZB 3RB5A 3E38A 1A6ZB 5B8CC 1VACB 1INDL 4WU5B 1FPTH 4PB0H 5JIIA 4IGBC 4MB4A 2CRMA 1KXTB 4Q74A 2BH0A 3W57A 4Z7WB 1KC5L 2BWQA 5E6IC 3AWFA 2HVKB 3FQRB 3ZKSD 1XD1A 3GLAA 5F70A 2NCMA 3VI4F 4UDTA 5JQIB 2VLLB 4WSKA 1KGXA 3HRZC 3QNZB 1INQA 1YEDB 3F65A 4FKKA 4FJYA 4QIRA 4LSSH 4PG2C 2HVJA 1CCZA 2CBMA 1CIDA 3BVUA 2EYRB 3HG1B 3EO0B 4G6ML 4JZJC 4DO5A 3QQXA 1ACYL 4LPTA 3T0EB 2ZG1A 2W0FA 1FWXA 4WI0A 4YLBA 5DEZA 2BZ7A 2VLKD 5IW6A 1TDQA 1X5LA 3RKDC 1HSAA 5J3HC 4M4RB 1FPTL 4GXVL 4PB0L 5BOJA 2XPYA 2Z93A 2QFPA 1PBYA 4AX3A 2Y36H 1L9QA 1G0YR 4C47A 3HG3A 3EYSH 3OBAA 4GINA 2ZCKH 2X28A 4N8VA 5DC4B 1V3KA 3K91A 1PLCA 1M71B 4CKVX 5C7XH 3MI6A 4P9HC 4HX1B 1WA2X 4KV5E 4FN0A 4UI2A 4HCIA 4P3CH 3D18B 5MEPB 5EZOH 3Q5YA 3PHSA 3NSFA 4H44C 3KPMA 4XZ4A 3RWIB 4OH2A 3UFIA 4M6OH 3PP3K 1CFQB 5BW7A 1O5PA 3U2SA 2F19H 4ONFH 3WTUA 2HJKA 1K3ZA 5HGHA 5I1GH 5JZ7C 5K9JL 1QBAA 2R83A 4U7KA 4YHNB 2R1WB 4L5FE 4W9HC 3L81A 1ZDQA 1A9VA 2HSIA 2CO2A 5ICUA 3A6OA 4KXZH 5I6KA 2KZWA 2Y36L 2FWOA 1SY6A 3K3QA 4Y4FC 3GXPA 3ULVF 1QFOA 4GJTB 2FHCA 3EYSL 4DQOH 1OOWA 1XWVA 1TJMA 2A6KA 2ZCKL 4PS8A 3RZCA 1YN6B 3RX8A 3FQUB 5DD0L 2TRHA 5C0BD 1CDCA 4KUCD 5C7XL 1G7HA 3ESNA 4U1MB 4E9QA 3U1QA 5AW0B 3TFKC 2C9SA 5JUEH 3LKRA 5BJTB 2QPEB 4P3CL 4LOFA 5EZOL 2WCPA 5F7HA 3GXTA 2Y2TA 3OKMB 5F7NC 2AZAA 2K3HA 2LV4A 1ZDSA 3O0RH 1MLBA 3ATAA 3FUIA 4KI5F 1KOAA 3ZHKA 4DP0X 2F19L 4ONFL 1CXFA 3EBIA 3HVNA 3SJVE 5IESH 4KK5D 3TPKA 2QVIA 2HA1A 2IBZX 3C6LC 1OEZW 2C5DC 2AVFA 2VISB 4HH9B 1C08A 1W8EA 1MCJA 1SQMA 2XT1B 2QR0A 5CF3A 1O7DC 1H3UA 4OI8A 4HWBA 3V0DA 1SBSH 1ZOXA 1F02I 4AGLA 1F58H 3OAYK 4DQOL 3OKNA 3ULUF 3OKOB 4TNVK 5GXBB 1HEJC 1RL1A 3VX0A 4JHBA 3WNMA 5JUEL 3QJOA 1HYRC 3C75A 3QFDA 2IADB 2DWDB 3Q1SH 2WBJC 3O0RL 3VG0H 1EANA 3ZKMC 1MCKA 5CCHE 1F3RB 2N59A 3TA3D 4D0BB 3L4ZA 2DIAA 1RUPH 4M1CD 4DFHA 3QUYA 2OM5A 3B7RL 3VX1A 3WEOA 5IESL 2CAKA 3K8LA 3QI9D 1J8HD 4P2YA 1T83A 2VUYA 4G43A 3HN3A 2JKTM 4JQXC 4MX7B 3U0PB 3DPBA 2G4EA 1I9EA 4HMCA 4AUJA 4LNVA 1CD1A 3NZUA 5AW2B 3MBWA 1SBSL 4ZTOH 1F58L 3WXVH 1OXYA 3RVUD 1OAJA 2FCBA 2IVFC 5CEYB 2X0WA 4NFBA 3FQ2A 2X9YA 4R3SB 1ZLWK 1E40A 2XZCH 3G04B 5C86A 4ZXBD 2NY6B 3H7BB 4HV8B 3Q1SL 3QYNA 1JYWA 3VG0L 1BVOA 3AQYA 3GRGA 2ICEB 2WLKA 3O3EA 1HU8A 3L3IA 5F1IB 5L8JB 1S3KH 3NJFA 2V2TB 4YSUA 3ULVH 1WICA 2HT2C 1IZKA 5HHQA 1QI3A 4KKLD 1DVZA 5JO5B 2ZOKA 4F93B 5AD0B 2MQ3A 4APXA 3K74B 2YAMA 1NIEA 5IV2B 1D6EA 2A2QT 2WMPB 4OZHB 3TOPA 2E4TA 2AGJH 4ZTOL 2Y7LA 3V6FB 4A6YB 5MENA 3WXVL 3REVA 1IEBB 3HC0B 3LKSB 4WV1A 2AITA 5I8CA 3X1NA 3IK2A 3QEQA 5IT2H 4Q7DA 3L9YA 1S7VB 5H35A 3AVEA 4GT0A 2EXYC 2XZCL 2AK4B 3X1BA 1BOYA 3RVWC 2ENPA 1TEGA 4EAEA 1WBZB 1Z3RA 4LPXA 2NXZD 4QMEA 3AUVA 1R3HB 5PCYA 1SYVB 2JIXB 3T6XA 4RGOL 1M2VB 5I8EA 1U8JB 4V1DA 2DKUA 1QFUH 1S3KL 2ADFH 3CHXA 4FXGB 2D8KA 5IQNA 3ULVL 1OTUD 3QG7H 3BD4A 4FNLH 4LOUD 4ZTPH 4AIZB 4IIQA 2WGXA 2Z91A 4MJ5A 3O4LE 5EIIG 3NIFE 5F21B 3QIBA 2Q1EA 2WN2A 4BZ1L 3OG4B 3JZ7A 5D1XC 3DUSB 5FKPA 2F8XC 3TGXA 3TEXA 5B39G 3PJSB 2AGJL 4YBHA 2EE3A 3QO1B 3BUPA 1MF2H 1NAMH 4E68A 4TRPH 4JRYE 4PJFB 3MACH 5IT2L 1RUML 4X7CC 4HGWA 1FA4A 2H6UA 1UEMA 2CZNA 4HOMA 1KGJA 4XO8A 4X5QA 1BZ9A 3OKDA 4WDIB 1CI5A 2BNRA 2W9EH 5DVOA 2P8PA 3EJUA 1QFUL 2ADFL 1DQJA 1WO2A 5DK3A 3QWOA 3QG7L 3VGFA 4FNLL 1IV8A 4ZTPL 2NNFA 3ULUL 1ED3A 1QTYT 2C9RA 1RIVH 4C4UA 2O6CA 2ESVD 1N70A 4IBSA 2HH0H 3UG5A 3IGUA 4LLQA 1RFDH 4P2QD 4MASA 2YBRA 2R9HC 3BCDA 4FLRA 4WUUE 2YRBA 1A9EA 2APFA 1A9BA 4E41B 1MF2L 1NAML 4Z7UB 3ZDYB 3J07A 2WWMD 4TRPL 5EUOB 3CPLA 1HH9B 1V3LA 3ARQA 1BQLH 3JVFC 3HKFA 4OQ1A 3MACL 4YC2B 2Q6WB 1VEPA 3DGGB 2ZXQA 2RB8A 4KQ3H 4L8BA 2A9DA 2XN9E 5DZLA 2VKWA 2WLNA 5I24A 4F58H 3CZKA 5F9DC 2D7NA 2GYSA 1ANUA 3I84A 4PD4K 3KVQA 4M3KB 2W9EL 2GY5A 4R84A 4XP9H 4D7PA 4FA8A 1HNFA 3IDUA 5AVYB 3BGFB 3O41B 1VKXB 3LVEA 4M03A 1MCCA 2PYEB 3KPRE 1I82A 2WNKA 4NQEE 4TQHA 4IBUA 4IU3A 3BP6A 4BM7A 2WAHA 4N8UA 5AOIA 4E2OA 2HH0L 3EIFA 3HZMA 4G3YL 3UTOA 1RLWA 3H42H 1QFPA 2BMKA 3L95A 5EOTB 2WYIA 4X7EC 5JW5B 3RE0A 4HC1A 3VXQA 5CP3H 2I9TB 1F4WH 3VFSB 1BQLL 2R7EA 3OKKA 3FKUS 3UMTA 2APXA 4U6VL 1YSOA 4KQ3L 3DYOA 3VSTA 2KI6A 2Y25A 1BZQK 3GLDA 3RJOA 2N01B 5EO1A 3CMGA 2AFNA 4F58L 4YL9A 3MLSL 3STZA 3ZPDA 4A7GF 4Z78B 2OJEB 3G7TA 3DECA 3D39D 1U6AH 3PFUA 1F90H 5D7JA 3BI9X 4H1LA 2FYYA 2W81C 1I8MA 4XO5A 1TJIH 3ARYA 4KTYA 1FFOA 1NLBH 2FO1A 2GUOA 4XXWA 4G70B 2NY6C 3QDGD 4N1CA 2G9KA 2DICA 1TETH 5ALCH 3U6XA 5E0QA 3H42L 2I9LB 1TQSA 5BZDA 1QLRB 2CR0A 1TSHA 5CZRA 5I1DB 3SZ6A 3LNEA 5D4JA 3DO7A 2VC2B 1BFTA 5FYKD 4QHUB 3MU3A 4Y2OA 5FF6B 1C8PA 4C54A 2ZE0A 2YJLA 3M07A 4RISH 5JIQA 1J5IA 4ATWA 4MCYA 1PAZA 3GBEA 4PRNB 5FR3A 2BK8A 2WQRA 2CKBB 4NX0A 2DLHA 3L3JA 3WLWD 4KK9D 4LCYA 4AJYV 4PRIA 2J72A 2PCPB 1U6AL 5J89A 3QDJA 1Q9KA 1F90L 3VWKA 4ZOEA 4AZ8B 4EI0A 4YXHH 3K6NA 4BZ2H 3ARPA 2IQAA 4TQ8A 4CMMB 3HE7C 1GGYA 3QJQB 4LCUB 5GGTH 1G7PB 3SEPA 4E9TA 4WHYG 3BUQA 2Z9TA 1NLBL 4QOKE 1MN4A 3RTLA 3JWNE 2VRKA 2EIKB 3UTSE 1FN4A 1UD2A 5ALCL 3UL4A 4NT6A 5JW3L 4WWKA 5EF1A 4YPGB 1QWUA 2VDOB 5C70A 4FXGC 2DDQH 2UXVA 2UWEB 4NOFA 3UGEA 3VFUA 1XF4A 4NENA 5I1JH 1KYOK 4Z95H 4FOMA 1RCYA 4RISL 1LGVA 2R1YB 3CJJA 4NQDD 4ODXA 4V33A 3N85H 1WBYA 3OB0K 4I4WB 2PW2A 5B21A 3WIHH 3WTTA 4NNXB 1TQBC 2CGRH 3PWLA 1WWAX 3ETBJ 5BPPA 3MJ8A 5FGCB 2CBTA 2FB4H 4F7KA 1TJXA 4BZ2L 2NUPB 2R15A 1AHWA 1ES0B 3BSGA 4UQCA 5GGTL 2QQNH 4Z7VF 1WA1X 1FC2D 1NC4D 5ESAA 3ARGA 1CDGA 1I1FA 4P59H 3RQ3A 5KSBE 2K8QA 1B0GB 2Q3XA 2ZONA 3ISRA 4ZD3H 1OAYH 1D7BA 5F1SA 5KBKA 2NX5A 2DDQL 1DANT 2NY3B 2VUKA 3O8XD 4Y0GA 1NFDE 2PPEA 3TO4A 4JFUA 4Z95L 4PRPA 3ILPB 4FMVA 4NZRH 1CMOA 1UD4A 1AKJA 3DX4A 1CXKA 2C7FA 1X7QA 3N85L 3EUDA 3WIHL 1DZBA 3CAFA 1T0OA 4QKXB 5JOEA 2CM6A 2FB4L 3LN5A 4YC2C 3JZYA 3WEBA 4OF8A 5E6RB 2QQNL 3ROLA 1UXSA 1KJ2H 1ZSDB 3JTTA 4XNMA 1PFCA 4P59L 1QPPA 3LNFA 5IFHH 3RFZB 3DRQA 3CHPA 3MRGA 4ZD3L 1OAYL 1GRWA 5DURB 5H8DA 3WL9B 4RFEB 5GZOD 4Y9EA 5CWSA 5GS0C 1Z9MA 1ZANH 5AYQA 4UMSA 1UJ3A 1R3LB 2GQHA 3T4AC 4PLKC 5GQBA 1A4KA 2IDCA 1GSMA 1EDYA 4RESB 3RPIA 3EYUH 1FVEA 4NQQA 3ARRA 2H45A 3W56A 3D6GA 4ANUA 1D2PA 1ORQA 2F61A 4JO8A 4XP4H 3FQTA 5FO7A 1PLAA 3T6ZA 1WHOA 1ZHKB 3DNKA 4LNRB 1F3DJ 3BP4B 3VD1A 1JWMA 5JIHA 5T1JA 1NFDF 3P11H 4PV9B 4LSRL 2JJVA 3I75A 1R17A 4N0CD 1KJ2L 1NQBA 4O9HH 2Y72A 4L9LA 1F56A 4QHLB 3W81A 1BIIA 4ADIA 4P5MB 5IFHL 1Q94B 3MREA 1GKOA 5INDA 3VI3F 3UZEA 2HPTA 5GS2D 4Z3IA 4HXBH 4LB8A 3VJ6B 1DJIA 1CS6A 3DI2B 4W9IC 1EUUA 1QABA 3G5XA 4J2QA 5BUGA 3GHEH 2E6QA 1E42A 4JGUA 3EYUL 3ISWA 3QJZA 3F2LA 5IMMA 1CL7H 1P2CA 4PR5B 3FU5A 3ZRCC 4WK0B 1MCDA 1AGBB 4XP4L 3V5DB 4HBCL 4JJ5A 4D0CB 2ZAHA 3G6JB 1I31A 4N5EC 4FMKA 5TF1H 3W0WE 4OD2B 5C0CB 1G84A 3P11L 5KANI 2X6BA 2XFGB 4Y5YA 2RACA 4Z7WE 4N28A 4O9HL 2O5ZH 4HJ0D 4Z9KB 1EAPB 3AU1A 3UTTB 5KYWB 2VN3A 2LGNA 3IGAA 3FU9A 1TCRB 4LRIA 4NUJB 5D7KD 2LR4A 3B9EA 3DVFA 1K5NA 2R2BA 4HXBL 2XI9A 2I24N 1XVSA 4HAFA 3GHEL 4ELKA 1T1ZA 3HG1E 5IHUH 1CL7L 3CZFB 1P1VA 3I02A 4OLXH 3SPIA 4QAMB 2KC0A 4NC0B 5IROA 2HT3D 2AV7A 4F8NA 2DLEA 5KG9A 5IB3A 1OP3H 3S48A 1FGNH 4WWNA 5TF1L 3QULA 3V0GA 4BFFA 5C0ND 3LXCA 2BNQD 4P9HH 1VFOA 4BK5C 1HK6A 1KULA 2O5ZL 2UZIH 4HK0A 4OLUL 2ZAIA 4TS6A 3VTTA 3RWEB 2X3BA 5DD6B 2UVEA 3MV8D 3D9AL 4PREA 4DPBX 5IUCA 3SGDH 1P5UA 4GEIA 2HFFA 3WDIA 1ZGLM 1U58A 3D0VA 4Z7WF 5D1XE 4YVNA 4APQA 1XZWA 3E2HB 2VR8A 2JKJA 5IHUL 2OMBA 3MRLB 1NICA 1PW3A 4U6YA 4Y4HB 1AZZC 4NZ8A 5E9DA 1ZHLA 4D0DA 3OAZK 2XJLA 1IC1A 4OD3H 3BKMH 4GXUM 2F6AA 1NCWH 3RHWK 2YLKA 4KY2A 2ZSVB 4L4TD 4AVHA 1NLDL 2NY3C 3ASNB 4OZGE 4E42B 2X4NB 2MKWA 3DDFA 3RTQB 4P9HL 4YDJA 1ACZA 1XF5A 3DIFB 2UZIL 3FSWA 1EJ6A 1IGJB 3LMJL 3GM0A 1HOCA 2C4XA 1GYAA 5DJ2A 1I1RA 2FNWA 5E8OA 2BY2A 2E7MA 1UQSB 2J3SA 3QXDA 1MXGA 4U7SA 5K33A 3LHAA 8FABA 1W0VA 7PCYA 3D0AA 3VD4A 1MHHB 3O4LA 3IAGC 2WLIA 1XCQA 4ZJ9A 4X8GA 3LEXB 3QRLA 3CHOA 2CO6B 4K94C 1Q0EA 4FQLH 4HIIA 4XMWA 5TK2A 3RFZC 4G42B 3NZSA 3SY6A 1WT5C 3QP3A 3BKML 4OD3L 1NCWL 1RZ7H 5I74B 4ADGA 5L2KE 4FHJA 5E99H 3OLDA 1PY9A 2Q8BL 3FQ1A 1KB5B 3UADA 4XVUC 3BSZL 5JPMA 4D8PA 4DEPB 2ZP8A 3O0LA 3Q6FB 4K8RD 2G3NA 4GXFA 3PGFL 3MRDA 2P5PA 4TUOA 3ES6A 2AXHA 4G83A 5FS5A 3VGDA 5TE6H 2VSMB 4Z6AT 2ADYA 4Q9RH 1CGXA 2NZIA 1MHPH 3FRPG 4N0RA 2DM7A 5D7LD 4ENED 4KK6D 2QPDB 2BSTB 5JMRA 4OZGF 1TZHB 2I07A 2OMNA 1SEQH 3QQDB 4LLYB 1HILB 2EZ0C 1KTJA 3WE6A 4I0PB 3D69A 4IJ3B 4FQLL 3LQMA 3F5WB 1OM3H 1CR9H 1U8MA 5D6CA 1JSYA 3DOSA 4JFVA 4X5XA 5C3TA 2K6ZA 3K6DA 3Q5TA 3KNBB 3L54A 2Z3FA 1D9KB 3ZOAA 1M57B 2DWSA 1E28B 5TTRA 3KH3A 1TOXA 3I6KA 1RZ7L 3MV7D 4O00A 5E99L 2F8OA 1LXMA 1S2EA 1DN2A 3GJFK 5ID1B 3K72B 3K4AA 1RLBA 3MRNB 4JY6A 1FZMA 3GSQA 4BRJA 3K7UA 1J0YA 3ATBA 5ITFA 1XGPA 5HHVH 2WXGA 3BMVA 4GYBA 4JG9A 3T9WA 3CHQA 5SWZD 4MA3B 4AM0B 4LHUG 4AQOA 4O2EB 4P9MH 4UBDD 2M8XA 3TBYA 4EN2A 3QZMA 5TE6L 4Q9RL 1GOHA 3F01A 1UB5B 1MHPL 4N3TA 4NQEA 2Q20A 3FFCB 5FCUH 3C6SB 4HIEB 1NOFA 2QQLH 1SEQL 3UDWA 3EGXA 5JNYB 1SMDA 2H3NB 3TZVB 2VLKA 1N64H 3PL6B 4LDLB 4ZYKA 1OM3L 4KROD 1AOHA 3MJ9A 4MA1C 4PTUB 3S9DB 2VH5H 2EDNA 3KVDD 2X9ZA 3K80A 4JM4H 5I66B 2FQFA 4FL4B 4LVNB 5L4IA 3EJRA 4AYEC 1MI5E 1JZ3A 2Q86A 3MJ7B 5CIPB 3BRDA 5HHVL 4B97A 4DVRH 4F9LA 3B4NA 2D3NA 4YBQC 3ZDZB 3MJWA 1KXQE 3GMPA 1FVCA 4MAYB 4LL1A 2CK2A 5BRZD 5GRYA 4FNPA 2ARJB 4LLVA 5FCUL 3GSVB 4FQQB 2AK4E 2QQLL 1ADQA 4QTHA 5E8NB 1Q9OB 4NN7B 1NBYB 2EUVA 1N64L 3VD5A 5T3ZH 4MMYB 3RUGB 1ZV2A 3ETTA 4BZYA 5I0ZA 4NKMA 4B3EA 2JQMA 4JN1H 3ZTJG 2NXYB 2C1OA 5DRNB 4F5CA 4JM4L 1NDTA 1JD7A 3WNKA 3HZVA 3AWEA 4OLZH 3UC2A 4FQ1H 3D34A 4OZIE 1IAMA 4QRSB 3SQOH 4L4JA 1IQDB 3C08H 1TT6A 5C0BA 3E2HC 3MJ6A 4KJQC 4DVRL 2AJXL 4Y4HC 4IOFD 5E03A 2AS5M 2XWTA 5LQBH 5E6UB 3ZO0A 3QA3B 4B0MM 1HL9A 4IBQA 1UM5H 5EBLB 3E6HA 5GRZA 3QJFA 3TJEH 5IJBC 5CGYC 5DRZA 2W60A 4UZUA 1FAKT 1MHCA 3ZZSA 3NCFB 3BUTA 3BZFB 3RTQC 4OZHF 3V6ZA 2AQ1A 1IAOA 5T3ZL 4AKOA 3MOQA 1QQDA 2VZVA 2YD0A 4AC2A 3V7AE 3ARBB 4JN1L 1PGRB 3R06B 1LE9B 1OGAA 1BQHA 3MOBH 5I8KH 2QKSA 2IFFH 4H8HA 4U1SB 4OLZL 1JN6B 1PCSA 3DUUA 2YQBA 3OGCA 4FQ1L 3SQOL 3QG6B 4F2MA 1VF5C 3WY4A 3I9AA 1CDJA 4IRZA 4CC4A 2GJ6A 3C08L 3EGSA 3TO2A 4OSUL 5KYXA 1MAKA 2HTKD 1U3ZA 5E5MB 3WE1A 3VWJB 4M8UA 3RVVD 4HS3B 5LQBL 3SDXA 5I2IA 1UM5L 5EUOE 2JK5A 5LDSA 1PNDA 2GITB 2VB5A 2R8SH 1KJMA 1MCNA 2WVVB 5HHOE 5I74C 1D5RA 2GVYA 3TJEL 2YJQA 5B38A 1B90A 2D3LA 4S1SH 4U1IA 5CILH 4DEPC 3MNWB 4LCVA 3TA3A 3ZZ1A 1LNUB 2VQ4A 3DJTA 5IW1A 1DLHA 4XO3A 1VCAA 1SHSA 4G1MA 1EVUA 1QI5A 3FUJA 4PWJA 1WD8A 1WGOA 5FGSA 5MP6H 3V5HB 2EVFA 1KB3A 4PJFF 1HZHH 4DETA 3C8KB 1ECYA 1QSEE 2R29A 2ZOTA 3MOBL 2G9HA 4FP8H 4NB7A 1KN4H 2IFFL 5I8KL 5BZWB 2XU9A 1W2KT 5D9SA 3AXHA 2OSWA 1R33A 3PWUB 1CG9B 3ZDXE 1TVHB 4MMZB 3VUAA 4KKZA 4AQEB 5I17B 3SDCD 2V5MA 2L7JA 4I0PC 4IOSA 4IJ3C 2CO1A 4KMTH 2HZHA 1X5AA 3NEEA 1U8CA 4FD0A 3FTYA 3QJRB 3QUMB 2PXYC 1ZS2A 2EAEA 4X0NA 2LVEA 3TASA 3RAJH 1D9KC 1YEEH 3KPLB 2R8SL 4Z3EA 4EIZC 2J1XA 3DXAB 3JTBA 4WWPA 5EC2B 4S1SL 1S5HB 4DPRA 5CILL 4P2RB 2BSRA 4R7NA 1I3UA 2IALA 1BZEA 4Q6IA 4Z7UF 3QQNA 1RK0A 3WKPA 3JWDC 3OZ9H 5EUOF 1FCGA 3ZDYF 5MP6L 1HZHL 2IH9A 4FS0A 5L9DH 2X89D 1XF2B 4FP8L 3LX9A 1KN4L 1ZWIB 4LCWD 1FAIH 5BXFB 3WS6A 1A6VH 4NBXB 4K5NA 2Z8RA 4NNPH 1NPUA 3TZVC 3ZKND 3PL6C 4MS6A 4KMTL 4GT7A 3GEWB 1RP9A 2R2CA 1MVUB 2YFNA 3DUHA 2ICWA 4G7QB 4PCSA 4QCIB 5EIIB 4YHZL 1WIUA 1REIA 4R7LA 1YEEL 4RGNB 3RAJL 1LE5B 5FA4A 5E5RB 5B39B 1A1OB 4FL4C 4LVNC 2ZP0T 4F7PB 2PKDA 1SDAB 5IBLD 3A0OA 1BV8A 1MSPA 3QQ4B 2DWTA 3LPOA 4W6XB 1F42A 4BD4A 4LSTH 1ZT7A 1DFBL 3CWGA 4MAYC 1PVHA 1UT9A 3CSTA 3OZ9L 1QBMH 3LKNA 1A6WH 3IPFA 3T3ME 2PWFA 2Y6SD 3W9DA 1JNJA 1FAIL 3RZWA 4UT6H 4KXAA 3ETBF 1YQVH 1A6VL 4LCIH 2ERJB 4G6KL 5C2UB 4NNPL 3ATDA 3UTQB 5B3JF 2ZT9C 4HIHB 2HLFC 3S3SA 1KGYE 4N0FB 2NY7H 3BIKB 4LEBA 3U7AA 1DQMH 2VDKB 4JG1H 4WI7A 4G9DA 2R0WH 1EXHA 3RVTD 1K8IB 5LO7A 5EZLA 3B2XA 4U0QB 3KDMA 2PLTA 1IIIA 4CN6A 1XGQA 3MFFB 4AIEA 3ULVD 4JFEE 1DN0A 3DSFH 4MWFB 4LSTL 4M43H 1XSKA 3WIFB 4U1HB 1EZVY 4OJFH 1J5HA 2YKLH 1A6WL 4KAQH 4MMXC 3IWUA 2A9BA 2ESVA 3T3PE 2KLSA 3HPLA 2I69A 3CIAA 1OF0A 1UH3A 4P2QA 1ETZB 3AS3A 1QLFB 4XMLH 4TQEH 3DWTA 4NRZB 1YQVL 4LCIL 2E9JA 3BUYA 5DUJA 3I3BA 2YAFA 2EIZB 4KI5D 4FADA 2QSVA 3VE0A 4Y9FA 25C8H 2NY7L 4JFQB 5IHLB 5F1NA 3T8XA 3EDKA 1DQML 3CTTA 4JG1L 1L0PA 2FUQA 4PJBB 2EDHA 3BZEB 4HMEA 3Q43A 4TSAH 1SLUA 2VLRA 2YOAA 1XIWB 1T0NB 3ASWA 1NIAA 3JV4B 1Q0XH 3RWCA 2XTSA 3EHBB 1SXNA 4UNIA 3VWJC 2V8LA 3IDXH 2DIEA 4M43L 4ODHL 2OSXA 4OJFL 4AYSA 3GXNA 3P3SA 3L4TA 4F2EA 2YKLL 5B7EA 1RUQH 5HGDA 2ED7A 4KAQL 4EI5A 2FR4B 2WYTA 3KPOA 3EH4B 3OJDB 4YIQB 2CLZB 1EJ8A 3F84A 4OGAC 4I2XA 5I6NA 5GS0H 1TQUA 4XMLL 2ZJSH 3HZYB 4TQEL 5IF0A 1BVNT 4MD0B 1OW0C 5FC9A 4NQTA 1DEEA 1KXVA 4GW5A 1PYWB 4Y4KB 5AAMC 3RWJA 1HCVA 3TV3H 3BWAB 4B9FA 3SGEH 25C8L 2YPLB 3MNMA 4YSEA 4A39A 1UKQA 1BAFH 3QORD 1O0VA 4AENB 4TSAL 4PD4J 1IBDA 4FULA 4IK6A 3U6XS 1KGCE 5EU5B 3KPSB 1UXMA 4ORGA 1CE6B 1JYXA 1Q0XL 2AF2A 2J1KA 1Y07A 3L45A 4MJIB 5DGRA 3HG5A 5AVRB 4IOIB 3IDXL 2W92A 3SJVD 1S7SA 5ANHA 4YDIH 1RUQL 2IXQA 4ZI8A 4MCZA 5DHVA 5LBSH 3F05A 4HP5A 3HMXH 4NRYA 3RWFB 2PCFA 1KELH 1UOLA 5GS0L 1V8HA 2ZJSL 3ENEA 4MS8D 5DJ8A 3UX9B 2BIOA 3AQZA 5DJCA 4UT9A 2WIMA 4TLSA 5I1KH 3ROOA 4KH2A 3TV3L 1ZA3B 3OHMB 2CR6A 4PAZA 4POUB 4QRRB 5DUPH 3V0VA 4BINA 2CGZA 1BAFL 4XVSH 1PKOA 5DEGB 2KMWA 3B56A 3GIVA 4ZFFB 4GSXA 3QHFH 4E0RB 2VC2H 4MZ3A 3GMOA 2IWEA 1Q1JH 2WXIA 5JIKA 2XWZA 4F8LA 1BJ1H 2CJUH 5E4AA 4HUVB 4J2XA 1EFXB 4YAQB 2CKBH 4M5ZH 4HKJA 4YDIL 5E1HB 3VXNB 2P43B 1BQUA 3DDGA 5LBSL 4EBQH 2Y7NA 2G5BB 4PTTB 3HMXL 3ZMEA 3S35H 1KELL 2ZKHH 3IMRA 3F62A 1NJ9A 2AXWA 5DRWB 3T4YB 1JGIA 3BAJA 1J0KA 1JZIA 1NWPA 5I1KL 4PJDB 3PXHA 4WGWB 2VZTA 1XGTA 1T6VN 1FNHA 1DBJL 4HLEA 5DUPL 5FDWB 2PO6B 4NQDA 2XN2A 5G4OA 4XVSL 3N5AA 4GRMA 2VDOH 4FG6D 4WK4B 3N91A 5L2JB 1AAJA 2NZ9C 3QHFL 4O2CB 2VC2L 4AYID 5A7BA 1USQA 2K8MA 1UB6B 3IJEB 1Q1JL 5K59E 4HWZA 3PF2A 2CJUL