5DC2A

X-ray crystal structure of a enzymatically degraded biapenem-adduct of l,d-transpeptidase 2 from mycobacterium tuberculosis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
352
structure length
352
Chain Sequence
b'DLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Transferase
total genus 88
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dc2A03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dc2A02
5DVPA 1ZATA 5E5LA 5DUJA 3U1PA 5K69A 5E51A 4JMNA 5DC2A 5LB1A 4GSQA 4HUCA 3ZQDA 4LZHA 4QR7A 4K73A 4A1IA 4GSUA 5DCCA 3U1QA 3VYOA 4Z7AA 3ZGPA 4QRAA 5LBGA 4A1JA 4QTFA 4JMXA 3TURA 3ZG4A 3TX4A 3VYNA 4LPQA 4ZFQA 5DZPA 2MTZA 4XVOA 3VAEA 5DU7A 5E1GA 4A1KA 4A52A 3VYPA 5E1IA 2HKLA 1Y7MA 4QRBA 5DZJA 4GSRA 4HU2A 5D7HA
chains in the Genus database with same CATH superfamily
4DZBA 1IKOP 2BDNH 4IRSB 5EUOF 1P2CA 3EOBB 4I1PA 2HPOA 2DL9A 4HJ0C 1T04B 3SE8H 3P11L 3UIZA 3ZMEA 3OX8B 1NCTA 4U1MB 5ALCH 2J2ZA 3QYNA 1PEWA 1INQB 3CK0H 1OE3A 4UTBH 5DGQA 3PUCA 3KBEA 1CMOA 5JHDD 1S7XA 1AZRA 2HJFA 1RZ7H 1FLRH 3DV6A 4OF5A 4FOMA 3NRQA 1I3RA 2CGRL 2EH7H 1ED3B 3CFCL 4FMKA 5EO0B 3MRCA 2H2PC 4LVHC 3G5XB 1X5MA 1RK7A 5D7SH 5JHBA 1UB5A 4G8IB 4NQCE 1KGJA 4XCNA 4X8GA 5AB0A 3U7YL 2NPLX 3N42B 2HH0H 5GZOC 3MCLH 1JGEA 2BS8A 4WJ5A 1HZLA 4GSUA 4Z7OF 5C8JB 3U4AA 1XCXA 3HG0A 2HMIC 4PCKA 5GS1B 5KS9E 3WEXB 2FLBT 3APCA 3FRUA 2UVEA 4ELMF 3ZX1A 4AGLA 4H8HA 1SLWA 1ZOXA 2NTSP 2W9EH 3CIAA 4FI7A 4CADB 4EPSA 1OB1B 1DZBA 3HZKA 1OM3L 1YRKA 2PUQT 4L8DB 4GO9A 5KYUB 4IMLA 4PGDB 1TCRA 1R0AH 4LEOB 1J8HB 2CU9A 4OM0H 3VWKD 4RETB 4GLRH 5FYJH 5HDOA 1OTSD 1X7QA 3UTTD 1M7IB 5C0JB 4D3CH 5T5FA 1A6AA 5DFTA 1P0SE 2Z91B 1DVFC 4YK4C 3TCLA 4URTB 3D07A 1RJZB 2GHZA 2YEZA 1T6WA 3RX8A 5C0EA 4AE1A 1OCZB 2MWCA 5HDBB 2XWDA 4FNTA 2CM5A 1MRFH 5EBMB 5LCVH 1XXFC 2GYSA 4ELKB 1A4BA 3DXAE 3NJLA 5CJXC 5AYUL 3HLAB 4E41A 4OIFA 2VQUA 2WXRA 1CGTA 1DVYA 2FEJA 2P8PA 1E5UI 1Q94A 1C7TA 3MLSH 5EMYA 4P2YA 1RJYB 1S4IA 1YUHA 3RIAF 4OSUH 3B2VH 4YBQC 2O6CA 1R9FA 2Y6SC 1WCBB 4FZ8L 5ADPL 4QAMB 1RP9A 5C0IA 3V4VH 2VOTA 4I0CC 3TO4C 4RMVA 5CCGE 1H9DA 3G3LA 5DU7A 1MCWM 2APSA 5HHOB 1HHHB 2F19L 3BCFA 3MUGA 3PABB 1H5BA 1F42A 3SCMD 1XGRA 5J9PA 3WO4B 1DBKH 3CVHL 4O2EA 3Q2CA 1G1KA 4GYBA 3CX5K 3TZVC 5C6WH 2JQMA 3HAEA 4HZLA 1INDL 5JIMA 3WIHA 2A73A 2IIJA 4JKWA 5D93C 3QJUB 5BRZE 4N28A 4X5RA 5K39A 2NX5B 2X05A 1E2VA 1IRAY 1LO2H 1P1ZB 1TQWA 4JM0A 5TH2B 3SBPA 1DN2A 2ZJSL 3L3IB 1LL1A 4DZ8B 5KVGH 4UZUA 4MJ4A 1LD9B 4LVHB 2D7TL 2COQA 4GXFA 4PS3A 1I8MB 5D71H 3SPVA 5MEQB 43CAB 2FX7L 4MB4A 1L9SA 4J3VA 3QHFL 3HPJB 4HIIA 5CCKH 4P2QD 3RI5F 3U36B 2AQRA 4Y4FD 4J23A 4W9HC 5GGTL 3AU0A 4D9RE 1G9ML 5FGBA 3BPOC 5EEZA 1FVDA 2XZQH 5DJZA 4NWTH 3B4NA 2WMPA 3ECBA 3K6OA 5KVDH 4TL5A 3DK0A 5D7JD 3UYOD 2WVSA 2XZCL 2ZUSA 2AABL 2X9YA 3H4FA 4KKCD 3RAJL 4HC1H 1WFJA 2LLGA 3OKYA 4JRFA 5EEYA 1PZ2A 1ZA3B 4X4ZA 1AKJD 3QI9B 2KC0A 3V8CA 5AZ2H 3DUUB 3DIFA 4XVJH 3MUZ1 1SLXA 3OB8A 4DGYH 1T6BX 4UT9L 2L7QA 4GKLA 3OPZH 1UTDA 1RUQL 3U9PH 1WO2A 2FYYA 4HWUA 5GIRB 1LWJA 5K59F 5CKAA 1EEZA 4YXHL 4QXVA 3TBCA 2PPCA 3CVCA 4BK5C 4PJ8D 5GZNC 3ARFD 4YL4A 5HGDB 3NDZE 4NPJA 4MNGE 2QKIC 3O3EB 3F7PC 2WNKA 3CN1A 1P6AB 2EXYC 4FG2A 2H45A 1GSMA 3AXHA 5GS3A 4JFEB 1HOEA 3LVTA 2GW5A 3VFTA 5JTWA 2UUDK 5GGRA 1Z6JT 3GS0A 4C83A 3AT9A 1U3HA 2ATPB 2XN9D 4DP6X 1C08A 3M8OL 1M7UA 4F8LA 1E9QB 4JM4H 3FN0L 1OAQH 1D5XA 1CDGA 5HDQH 4BZ2L 4Y1AB 2VW4A 3IE9A 1UOVA 1IGJA 1KTLB 1OP9A 4N25A 5T1KB 2WD0A 5JZ7C 4Y5YA 1MCKA 2WNGA 1IMHC 1IT9H 3MJ9H 3O2DA 3TO4B 3GI9H 1PQZA 3OXSA 5G4MA 4W9LC 3P02A 5JIDA 3PHSA 2VDPB 4FULA 2Q7AA 5FB8A 3ZDYB 3QXDA 4PRNA 4FYTA 4Y4HA 3KW8A 1GGUA 3MRQB 4TUJB 4EN3D 1GZQA 4A1KA 2VDNL 3KVPA 2APTA 1OZUA 4IHOA 3RY6C 4HIXH 3TZVB 2ZX6A 3EG9A 1JPEA 2V17H 2VCOA 3CQPA 3D4YA 2DPKA 3Q2VA 5EU5A 4GOSA 1QLEL 4ZW8A 3VGHA 3D09A 5D93B 1T03H 4QRUB 1SUJA 2WK2A 4RQQA 2J25A 4OFYD 4NO0B 3NIDB 3UX9B 4TNFA 2IDFA 2CCLA 3NEEA 3O4LA 2WUBL 3GSUB 2E7LC 1LDPH 4P9HL 4EZJA 3D0VB 3MODH 4HHGA 1IQDA 1G7LB 3NP4A 3UBGA 3VXSD 3RVWD 2FCBA 3D30A 2YRBA 2RD0A 3T04D 5CHNA 3HNVH 4ZFQA 1G6RA 1OAUH 2Y1VA 3OKOA 1FIEA 1IC4H 4A2GA 3QR1A 2OSLB 5FOJA 4NZRH 3BVWA 5DJYA 5EBLA 3OKEA 3MNVB 5IB4B 1PG7W 3FO0H 1NCDL 5HYJE 4OU3A 4I0KA 5SV4A 2P5EA 5BV7B 4UM9B 3MLYH 2DICA 2QL1A 5F3FA 3ATDA 4TRPL 4HOMA 3GUTA 3HC2A 5TDPB 1MW0A 3RFZA 4FTVD 4PU2A 1IC1A 3F7YA 1YN6A 3ZIYA 1WVZA 3IKKA 4Z3HA 5K9KB 4RMBA 5ES4B 4BWWA 4JB9L 1ESOA 3GLEA 1UOWA 3TV8A 1IGCH 3PCYA 4A66A 4ZO8A 3UGXA 1CD8A 1LP9E 4JZOA 3QNFA 4FQQB 1QR1B 3SD5A 2OMYA 2PWGA 4BGDA 3EJYC 2GBUA 3MLRL 4JPVH 5CU9A 3L1OL 4H2AA 3TU6A 3OVUB 4N0UB 2MNJB 4PB9L 1LLAA 3HG4A 4XI5D 2BOCB 3A4FA 1Y1UA 1X5LA 1SMAA 2QKIB 4FFVD 3BEWA 1RLBA 4BIKA 2XCMC 2EDBA 2BM3A 3OHXC 1ZRUA 5DZNA 2SEBB 4WI7A 2Q86A 4W9GC 3TPUB 3ZYOA 3QCTL 1BM3H 1WSST 1MCJA 4R83A 4DPBX 4AEEA 4XRCA 5IVXF 1OTTC 3FFCD 4QCIB 5EOQL 3ZKMC 1WFNA 4FHBD 5FWQA 3ZE1F 4N87A 4XCCL 4G6MH 4OF3A 5EWIL 3G6DH 4OZIB 5K33A 2ZUVA 3GC3A 4N9GB 3PL6C 2ALWA 4Y9FA 2ZCLL 3FTGB 5DK2A 2QVTA 3QDGE 2XV2A 4Z7QE 2BWDA 3WS6C 3FHQA 1AR1C 1MCPL 3EH5B 4YMPA 4I3SL 4X4MA 3FTWA 5FHBL 2JKLA 5FA4B 2VDLL 2VLKA 1FO0B 2B4CC 3LS4H 3P77B 2KQMA 2DQDH 4ZNEE 3ZDXE 4IIQC 2DAVA 3DVNA 1W0WB 3JUYA 3WKQA 5C0DB 1JZ5A 2R7EB 2BSSB 3ZTEA 3GXMA 4H5SA 4NO2A 4J5VA 1ETZA 1D7DA 2VRAA 3QDME 2E7MA 4P5TA 4U6HA 1ND0B 4UMGA 5IB1B 2DLIA 1LWHA 2UUDH 1KPRA 1PEZA 2VE6A 4K5PA 1WG3A 3A4AA 2N0MA 1XB6A 1YNLL 2VISA 5J6GB 4FABH 4WUUB 3V52L 1OW0A 5FIEA 1GA2A 2X3AA 3FO1A 4HU8A 5EIIA 4GG6B 2XTSA 4H1LB 5IGXL 5JIQA 1CWVA 4F33A 3L45A 3PWPE 4RIRB 3MV7D 1KTRL 2FEEL 2FEDC 3DK2A 1VACB 4ZOBA 3S36X 5T1LD 1DQJA 2E7CA 4HPYH 4KTDL 3SY0B 3NJNA 2Y07H 1PZ5B 2LQRA 1KJ3L 1EPFA 1BVLA 1DBML 5F71A 5TE6L 3BRFA 4KPHH 5I6KA 4OCRH 3A0OA 1PY4A 1L5GB 3X1BA 3IJEB 3EDKA 1P1VA 1JWSA 2XPGB 2A9BA 1GGIH 3GSNA 2YC1B 4UQBA 2FEEI 1G9EA 3KYMB 1FORH 2D0HA 1Z9SA 1QUNB 3F58L 2VO5A 3RPIA 2IC2A 1N2RA 2CHWA 5LKNA 3EGDB 2NXZC 2I9LA 5INDA 5LQBL 1OAYH 2GABA 4TOYH 2PW2B 4OLYH 4D8OA 2QQKL 4PN6A 1XGYL 4NC2B 4OQTH 2Y24A 4TQHA 5DD0L 1HSAA 4Z95H 3IDXL 3RNQA 3OHXB 1XF1A 5H94B 3HR6A 5LBSA 4XO5A 2W59A 1KJ2H 2V8LA 2EP6A 1X6NA 2X1XR 1HQ4A 1BQLH 1TSRA 2P5WE 2WJ7A 3VI3B 3G5VA 3UROR 1W91A 2R2HA 3CHPA 4HETA 2VDMH 4PJCE 4QKTA 1DN0B 1TQSA 4M3KB 4MDRA 5DVKA 1DQDH 4YFLI 5F3BB 3OJDA 1CDCA 4DWHA 4WFFD 5BZDB 2DQIL 3D2TA 2YKLH 1L6XA 3PL6B 5HGGS 3F84A 3MV8E 2WZPD 3EBGA 3GNMH 4MQSB 3TM6A 3TYGH 1K2DB 4NHCL 5GGVY 1K8DB 4Q6YA 1AR1B 4PWGA 4M1GH 1TJIH 4H88L 3BP5A 5GS0L 1MHCB 2I25N 4HFWA 5DJ6B 1HS6A 4ZMVA 4P2AA 2R2BB 4JZNA 3MJGX 3FCTB 3TYFA 4BSWA 4IIQB 4A7TA 1CFQB 3SN6N 4CSPA 4QHKI 3SDYL 4DPCX 1KY6A 4JRYA 4UM8B 1JERA 4V1DB 1SJXA 1QTYT 1VADB 2QPSA 3ARDD 4O2CA 3A6BH 1IILE 4J3WA 3CHOA 1AS6A 3MXWH 4H0IA 1EFXD 4RMSA 1SJMA 4YO0B 2HN7B 3HW7A 4LSPL 4U1IB 4H7VA 1MWAA 1NDGB 3VXNB 5B21A 3PGFH 1T4KB 1N0XL 3MOBH 3VMNA 2JI1A 2XVLA 4YEEA 3O9WC 1NCBH 4BRVA 2KDYA 2DQEH 3HNTL 5GGVH 4M7JL 5IY5B 3AREC 4PG9A 4R7VA 4RESB 4PS8A 1AXIB 1L9QA 2HFGL 2D03L 4M62L 4QRAA 3IGFA 4NKIL 2ZP0T 4NUJB 1WBYA 3LRKA 5EA0L 3UAJC 2FL5B 3JWNC 3U0PA 4GUPB 4NUGH 1NFKA 2BCMA 2JCCB 4WQOA 2VZSA 4BD4A 4Z7NB 2RALA 43C9A 3LOWA 4MGXA 2XWBA 4AYSA 3LNFA 5HHPA 4KUCD 1MDAA 3FO2B 4YSEA 5DD1L 1FDLL 2RMNA 1LO0H 4WU7A 4GAJL 1Z32X 2NDGA 4GQ9H 4LSVH 3O2WL 1ZSDB 2ZKXA 1XIWC 4E9XA 3S98A 2NXZB 3IS1X 5IB5B 1EHKB 3KPRE 1J0HA 3INUH 4OIIL 1XF4B 2AZAA 4IU3B 2CHNA 3I6GA 4K2UL 5DC4B 5IBTL 2CLRB 4YNYA 4O9HH 3W56A 4GIAA 5KVEH 1YDPB 4NKQB 12E8H 3DA0A 2ZX8A 4MQ7B 2PYFB 1KLGA 4YVNA 3PWLA 2HRLA 3TT3H 3QNZB 4C4BA 1JZEA 4K4KA 3RL2B 3VRJB 3GXDA 1QRNB 3DX7B 1UJ3C 5T1MA 4KVNH 4X5XA 2JWYA 3DX0A 3NFPA 1Q1PA 4QNPE 3EJTA 5AVWB 1OSEA 3IJYB 3ZIMA 2AK1H 3LB6C 3OQ3B 2QTEA 1I8IB 2Z92B 5C0BE 4E42B 1H15A 4L9DA 1RD6A 2EDOA 2C9AA 3FT0A 3U0TB 5C0CE 2C9UA 3GJFK 3MKGA 1N0LA 2WKOF 1IKNA 4OZGF 4C59B 5FCUL 1SHXA 1IM3A 1QA9B 2BFGA 2H26B 4KTEH 15C8H 4LL9A 4TLUA 5T5FH 4JG0H 3WFDH 2QPFA 3MRDA 3NAAH 5IV2A 5FLVA 4ANWA 3H85A 3B3IA 3L5WB 4PJ5E 4XWOC 2HX7A 1DQML 4ORGA 1KNOB 2CDEA 3VVWA 2V3FA 3ZDYF 3BWUF 2NY4C 4YHMH 3U4BL 2EE2A 2CHZA 4P4RA 3MV9E 4KV5F 3M46A 3CSYB 4PRBB 5LHDA 1CLVA 3GMOB 3O9WB 4KDTC 1BZDA 4JG1L 4G8FA 3AREB 3EOAB 3DI2B 3TF7C 1U8OB 5EOTA 3EHBC 4P3CH 2GIXA 1TXKA 4YHIA 4M5YH 2BLFA 5EB9A 4L4VE 1J5DA 1IEAA 2H0EA 2ZP9A 3ISRA 4HZ1A 1PJ9A 4Z3EA 3WUWG 5HPMB 1PF3A 1RUAH 1XCWA 5IQLA 4NQQA 3SGEH 3S37L 1WICA 1G43A 3FUNA 3L4UA 4JNXA 1JVLA 3FFDB 4OUOA 3MGTB 5E1AB 4H20L 2VXVH 1RSFA 1U30A 4LVOC 3TNMB 4RCAA 3OXRB 2A9NL 5DVNA 5DDHA 3TC9A 4AMXA 1RZIA 3IDIA 2B2XL 1PZCA 1TVHA 3EFDL 3MTRA 4J3OH 3LNIA 1NUFA 4GP5B 2DMBA 2F9BT 4I2XB 4LLQB 4M93C 3QWRD 4FJZA 5A6LA 3QIBD 3L48A 1XIWB 2H3XC 3PWNB 4OCYL 3H0TA 3HAEH 2VDKB 5TK2A 1JHTA 3TASA 1ZANL 3WIHH 4P07A 3UXFA 2R69L 4B9GA 4NPYB 1WBXB 4L29A 4MCYB 4PIBA 2A6JA 1L7IH 4TLKA 1DDTA 2AAAA 4U31A 3MI6A 2VDQB 2YOAA 4OJDH 1TVBB 1U3NA 3RTQA 3E3QE 3WXWH 4NAJA 2VLJA 3GSVB 2ICWA 3TBTB 1TEGA 2NY5C 4OCLC 2EKSB 2OCJA 1F90L 2EDKA 3OAYK 1MJJA 1NJ9A 5FGCE 5KBPA 4MJHA 3EJZC 2J8OA 2YWYA 1F3JB 5HHVL 1G1OA 3GSOB 2B0SH 2YAQA 3MROB 5DEFB 1ZV5A 1YAZA 2AXJA 2CO7B 3GM0A 4LL4A 4X6DF 4H4NA 4WHYG 1UGKA 2NMSA 5GGRY 1YJDC 2DM2A 2YD6A 4PLKD 2P48B 3MREA 1PBYA 3VFSB 2YSSA 1W72B 4RGNE 3VTMA 3DIDA 3NZ8A 3R7RA 4NENB 1AP2A 2CBMA 2DQ6A 3WI9A 4ABWA 1UD3A 5A6IA 4F80A 4OZIF 1MH5A 3JWNG 3TIEA 1JVKA 2ZXQA 5JW3H 4OLXL 4LQFH 5JXEC 2D2CC 3UPAA 3LNGA 4GO8A 4PVMA 3QWOB 3V9CA 1U2CA 1PY9A 3AS3A 1NCGA 3FT3B 2ZOTA 3MRNA 4I5BA 2UXVA 2X1QA 3D18A 3OZ9L 1VFOA 3WTSA 3GXIA 5GS2D 35C8H 5I75C 2CRZA 1KBVA 1H8LA 2NY4B 1X3DA 4JFHE 3CXDH 4TPRH 5L4MA 4K8RH 3QEUB 3D08A 2YZ8A 1PLGH 3QEHA 3CHSA 2CCWA 5I2IA 3BFOA 2XUWA 3GKWL 1TSHA 4U7KA 2EEXA 4ZMXA 3EHBB 5DQJA 1GZHA 2LW3A 2MKLC 2AV7B 2IANE 1DCLA 4GBXD 4MMYA 3UTPD 3NTCH 2VGLM 3PREA 2HYMA 1YQVL 4EBQH 4GXUN 3EGSB 1A9EA 4KTYA 4UOW1 3AWFA 3K72A 3NPZB 1WIOA 5IQOA 4OLWL 3DJSA 4IU2B 3CDZB 3O2DH 4LVOB 1HNYA 3T1WA 3D33A 4K3JL 4AJVA 4KTGA 5D5ME 4YHPA 4GSDL 1J0YA 3HEIB 3T6ZA 1RZKH 4AG4H 1UT1A 3KPSE 4ETQB 5ISZB 2FUTA 1NUDA 2Z8VC 5I1JL 4K07A 3O8XD 3FNKA 3PJSB 2DDQH 4HWEL 4M93B 1G4MA 3H53A 3EXLA 1IL1A 2CLVB 3WMSA 3W2DH 1R4XA 1DO5A 2XYCA 4WI4A 1KFGA 2G2NA 5H4ZA 2HVKB 3WIIH 1I8KA 4HKXA 2BS71 3OGCA 1G7PB 2VDOL 2E76C 2BRQA 3SHSA 3QIWA 3EYVA 5B1JC 1R3KB 3JWOC 4KXAA 1JYNA 4PRHB 4LCVA 1GZPA 5FYKH 4FYQA 4N0FA 1I8UA 2B77A 4IRJD 1E7VA 3FQ4A 1DE4A 2NY2C 3UBXI 4YJZL 5ALBL 1G6RH 1VHPA 1XEDA 1L0YA 1FL5B 5ACLA 1N12A 1SXNA 2ED8A 3B56A 2YBRB 7FABH 2BNUA 1JHLL 3ILPB 4HIHB 4NUQA 4EZLA 2AHIA 4NJ9H 2WVTA 5I1CH 5D1ZA 5EULV 1GC1H 4MCNA 4JPKH 1ADQL 3BGMB 4JM2D 1A6UL 2PR4L 1ETA1 1WAPA 1BG1A 2JVUA 3I02B 2H4EA 3P0VH 3QPKA 5HVWA 1IO4C 1G5AA 4F37F 5LVEA 1F1DA 3B2UC 4BELD 1U8PB 5EN2A 5GISH 4I0PD 3MO1B 4NZTL 3QEGH 2AITA 1XGTB 1HCVA 3F6IA 3W0WD 2OMWB 3V7AE 4EI5B 5I6LA 3FULA 4EIGB 2C1OB 1JFQL 2WLIA 4BUGA 1FFNB 2KLSA 3WIFB 4GMTH 3T0EC 1HYSC 3PNWA 1G0XA 1XSKA 4S1DC 3L5HA 2Z4QB 3WFCH 2J44A 3TBSA 3Q8BA 5I75B 3HUJA 3MJ8A 1QSEE 1PX8A 3UTTE 2IWGA 1JHKL 2BVOA 3OAYH 4I13B 3UCRA 4B0MB 4Z7VE 2Q76A 4Z3FA 6FABH 4LSDA 5ITFB 1DDHA 3WAKA 5HTSA 1M05A 4IRZA 3BZ4A 3Q8AA 4R8WH 3FUFA 3O81A 2YUZA 2FB4L 3J2PA 5I74C 2RBLA 3UYRH 1TUPA 2OYMA 3B2DC 1KC5H 3Q5YA 4IEFA 4Z1PA 1MAML 3VFVB 3V4PH 1HOCA 4FTDA 4IMKA 3W9DB 3CQQA 4UV7L 3H2WA 5DJ0B 1W6LA 2I27N 2WKGA 5DUJA 3ULVH 1ZLEA 3SYOA 2OP4L 3ZE2E 4QKXB 1KENL 3W11C 2WSPA 2BW5A 2GJPA 1FL6A 1QACA 3N41B 2Y72A 5DZVA 3SKMA 3GSXA 2JCCF 3A47A 4QLWA 1GCFA 2FJFB 4BV1A 4Z7NF 4ZO7A 4JGUA 3VUAA 3T4YB 4MB5A 4HPHA 2PP8A 3X1EA 3BLPX 2E0PA 1FJ1A 2ENQA 1UXSA 1IKFL 4GUQA 1QFWL 2G3XA 1CDJA 1OCWH 5EZIH 2Z7UA 2ZKYA 2XXMB 4L1LA 2NY2B 4PIRF 4ELDA 1JZ4A 1S5HA 3SZ6A 3ABGA 3MUUA 4IRSA 2LR4A 4NAQA 3EOBA 4K23H 1IIIA 2YFOA 1T04A 1RFDH 2AJSH 1TT6A 2X1PA 3K8KA 4U1MA 3R8QA 4O4YH 3SIKA 4BQ8A 5HPOA 3FL7A 1TENA 1QFWI 2OJEB 1INQA 4WWNA 3WTUA 4MMZC 1KELH 4P2QE 4HSCX 3BOVA 2QFRA 5T3XD 4N5UA 5F93C 4N5ED 3IMBA 3V7AG 2HWZL 3MRBB 1ED3A 1OAKH 3MCKB 5EO0A 2XT1B 1AZZC 4YSDA 3G5XA 4MCZB 2A6DB 5CJOH 4ZW3A 1X9LA 3BAIA 4JQIL 2VMJA 4G8IA 1VGEL 4NSKB 4AZ8B 3R7QA 3HKZA 3T0EB 3PNRB 4YSUA 5C8JA 3BQUD 4WWOA 3LZPA 4IKKA 2VWEC 1KYAA 1M57B 1UH4A 4JQVC 4LGPB 1VZHA 5D6CB 5GS1A 3WEXA 2Y2WA 1TFPA 3U7WL 1G4RA 3KLHC 1XWVA 4GXVL 2KHAA 4XCEB 1HYRC 3S5ZA 1LQSR 2Y4SA 4CADA 1OB1A 4FQHB 3GUFA 4L8DA 3K2UH 1N6UA 5DK3A 1LEGB 5KYUA 1A5FL 4PGDA 1KBGH 1J8HA 4KMTL 4LEOA 1ZLVK 1UADC 3ECWA 3QC6X 4M8VA 3CXHK 5ADOH 1I9IH 4IS6B 2OLDA 3RPKA 5I74B 3V0IA 2FX9L 2O26U 1CLZL 5BRPA 5C0JA 2X4UB 1S9KC 3D1MC 4OZFB 2CALA 2ICEB 4MDIB 1Q8MA 5CN2A 2Z91A 2I9TB 5AZEL 3T6VA 4NNPL 4ENED 4KHXL 4JVUA 1RJZA 1P4BL 4KZ0A 3VI4F 1NC4B 2FRGP 2XN9E 5C09B 5C0FB 3RILA 3VG0L 4EE2A 5FOBB 5EBMA 3VFNB 3CQFA 4ELKA 1ZS8B 1S7QB 1C5CH 4FKHA 1KZQA 2E27H 4XNQB 5BS0E 3HLAA 4L4TE 4LEXL 1I1AD 1AVAA 3RIAK 2Y22A 1TJMA 4E9WA 3V0WL 2ICES 1RJYA 3KEHA 1OO2A 1E5CA 3ZDZB 3G9AB 5EF3A 3UEZA 1KLFB 1NGYB 5MEPB 3P4LA 2F0CA 2EYTA 1MWAH 2VDRB 4PJ9C 2ZXEB 4XPFL 3BISA 1WCBA 4NOFA 4Q9BA 3T3PB 1JPTH 4HISA 3QWNA 5HHOA 2A6KB 4UV4L 4GG8B 1HHHA 4YC2C 3SO5A 3CH1B 3PABA 2ADIB 2IWFA 4CGTA 1WAAA 1PLCA 3DOHA 4Z7AA 2VN6A 3F7LA 5C08E 5HHQB 4S10A 5SWZD 2J5WA 4JFXB 1FZKB 5T33L 2PMZA 4GT0A 1OF2B 5AG8A 3AITA 5C0RH 1B0RB 3HB3D 3ZHLA 4DO5A 3ESNA 4MMZB 2NX5A 4E5XG 1KCVL 5TH2A 1P1ZA 1CXHA 4DZ8A 3S36H 3L3IA 3RI5K 2DF3A 4N2AA 1LD9A 1EAOA 1XQ4A 1I8MA 4OKVB 3KPLB 4QHNB 5MEQA 2JELL 3SKJL 4JO2H 4NCDA 43CAA 1OP3K 3BUDA 1HX0A 3HPJA 4DKDC 2I32A 4ODSL 4JO8A 4JHWL 3L5XH 1JD7A 2ZXWB 5GZOA 1KIPB 4JKNA 4F9LC 4FTVE 2FYVA 1JV5B 1NBZB 2RACA 3ULUE 4PJAB 2BRRL 3C5ZD 5SX5K 5E99L 2ESVB 2NDFA 2BCKB 3F6LA 1ORQB 1T66C 3N85L 1QSFE 1CVRA 3DSNA 4YE4L 4E0RB 2GHWB 3WN5C 4LAQH 4XE0A 1ZA3A 3GMNB 3N40P 1NM9A 1WAEA 4QXUH 3ZTCC 3DUUA 3VD0A 5JQ6L 2IXQB 3R0MA 4TSAH 1TZGL 2OZNA 1X4XA 1XSOA 3FQNB 5GIRA 3E8UL 5JHLA 1T7VA 2MTAA 4WTWA 5CF3A 2WZAA 2OZ4H 4YDIL 3GEWB 4HD9A 3CFQA 1H3XA 1MIMH 2A9AA 5HGDA 3BD4A 3O3EA 4X5WB 1IUZA 1UURA 4GB9A 1FG2B 5F9OL 4G6AC 4AKPA 2FGWL 3B6SB 3TGXA 4DHLA 2EC9U 4JFEA 5CJXA 4XVSH 4FKEA 5DS8B 1CDBA 5DF0A 4TN9A 4L0YA 1MCIA 2ATPA 2AP2A 3GIZH 4BH7B 4HCRH 3BDYH 1JV2B 1TTRA 1JTTA 1E9QA 2YLHA 2WKOA 4WZ9A 1HK6A 4Y1AA 4EAEA 1QP1A 3P0GB 4B5ZA 1KTLA 5T1KA 3K1KC 4UTAL 2CO3A 3BZFB 1ZLVH 1O6VA 3DYPA 4H0GA 3SB3A 3V4UH 1GIGL 3TO4A 1JSYA 3SDXE 2J5LC 1D9KC 5AW2B 4EMZA 4MAUH 1BBDL 2WWKO 4YC2B 3S8GB 1PAMA 1IZKA 2BINA 1BEYH 1Q0YH 5IP4A 4TUJA 3MRQA 4CSTA 3D3VB 4NC1E 1I8LC 3WFEL 4BQ9A 4L1TA 2ETWA 2VO8A 1DP0A 1ASPA 4LCWD 3TZVA 1OGAD 4AC2A 1WWBX 2HTKD 5DJXB 4WNSA 5IFAL 4S1QH 1IC5L 2R0LL 3FMGH 1O6TA 2WTPA 3QXAB 2LU3A 4QRUA 4HOWA 2BHZA 3BUBA 4XHJD 4NO0A 3FSAA 1U42A 4ZMZA 3GSUA 3VXMB 3D0VA 4YHLL 4XMUA 2X4NB 4DGIH 1G7LA 3EH3B 3ALXA 3QQDB 4NQUA 4O00A 4KKLD 3VD1A 1HESA 5AOMA 5EORH 3G6JF 4JFQB 4AYGA 5DVPA 3VGDA 3HCVB 2HSIA 2OSLA 5ID0B 4U1KB 3HNSH 2DD8H 3KJ6H 3MNVA 1G87A 2CNZA 1QBLL 3AS0A 3IU4L 5IB4A 2I24N 2L7UA 4ODVH 1A6PA 1CFNB 4UM9A 3CVHB 4C4UA 4KJQC 5BJTB 3BKMH 4K15A 4GEJA 5MENB 5TDPA 3WN5B 3T2NH 2X0WA 2Y3NA 1S9WB 4ANUA 4M7LL 1ZTXH 5K9KA 2FQEA 3REVB 3BJLA 2AEIT 2EDLA 3KLSA 4P9HC 4XN2A 3JT2A 4K3EL 2DTSA 1CI5A 4WI8A 4FQQA 3O2VL 3UTZB 4URKA 3UG5A 5T5NF 1QR1A 1KGXA 4ONFL 2DIBA 4ZTOL 3L7EB 4XPHH 4N0UA 1I3GH 2GJ6E 4AGOA 5GZNA 4XGZB 3NJFA 2BOCA 3EFOB 1F4YH 2ZYRA 3D39B 3QUYB 1DSFH 2QKIA 5C6PB 2EIKB 1OP3H 1ZHKB 5E8DH 5C0ND 2ZOUA 1EIBA 2SEBA 3KPMB 3WKML 2ORBH 2QQNL 4HMDA 1MQKL 4PHZA 1UEMA 1Y18B 3TPUA 4ZMWA 1F13A 4UBDC 3AMLA 3DMMC 4TVPE 1WUNT 4IJ3C 5SX5H 1GJIA 3FUEA 3FCSB 4QCIA 3T6WA 3PGCB 2GJZB 4DVRH 1RPQA 3ZQDA 1PG7H 3CU7A 1AOZA 3PV7A 4OZIA 1AMXA 1SQMA 3OG4B 4YSAA 4ANKA 4N9GA 4K9JA 1B4TA 2A9CA 3N41F 3FTGA 1ZLDA 1MF2H 5D1QC 1Y7VA 2G9KA 3DETD 4PREB 2ARJB 5FA4A 4A04A 1FO0A 3EDDA 1EWHA 4OGXL 1D9KB 3P77A 3LXCA 2CUAA 3S2CA 3IMWA 3CMGA 1CVSC 4ODXB 4G59C 1OVZA 4PRPE 3ARBC 2JTYA 1BP3B 4WJG3 3RY6A 5C0DA 2F54B 4F7TB 2R7EA 2BSSA 1YAIA 4KRPC 2B1HH 3PHOB 1K4CB 4W4NA 1ND0A 1RZJH 2HJLA 1BIIB 2JH2A 4N6QA 5IB1A 2E7LA 3BT2L 4QRPB 4TMPA 4HG4J 1XD1A 2V2XB 4RIRA 5J6GA 3FT4A 3QIUD 4WUUA 4GAFB 3E9TA 4GRWH 1AO7E 2B5IC 2FT6A 1T0OA 5FHAH 4OZHB 3D2UB 3WFBL 5IHLB 4GG6A 3QORD 4H1LA 3TIDB 1OAXL 1MI5B 4Q4EA 2Z1KA 1QKZH 4C8XA 2LT9A 1N4XH 2G60H 2PKDA 2R0WL 3MLTB 4G7YL 5ENWB 3QP3A 2NNAB 1VACA 4F57H 3WCYA 5B1KA 1EJOL 5BNXD 1GYUA 3SY0A 5DD3H 3G08B 1PZ5A 1GJUA 2ADGB 3S97C 1HINH 1QLEB 3C5SB 3ZY7A 2ZUWA 3QQXA 1BVKB 1XEUA 2NY7L 1L5GA 3QG7H 4U2ZA 3IJEA 2W0FB 1IGFH 4YSOA 4JR9H 1H0DB 2GC7C 2DY2A 2JKNA 2XPGA 4GP8B 1V3LA 2VXQA 2YC1A 4L1HA 3KYMA 4OBSA 5C07B 4D0CB 4YVUA 1QUNA 4PJBF 2OJZH 2WUCH 1MCDA 4NZ8A 3RWJB 3V7MA 3EGDA 1F58L 4FGMA 5HVGB 1JP5A 3NJVA 4LHUB 1E5AA 2PW2A 3J7HA 1W9XA 4MLSA 4JREC 2N7BA 3QZWG 3BSZL 1AJ7L 4Y2DC 4P46B 3VGBA 5E7BA 1IM9D 3OHXA 2CQVA 5H94A 1WIPA 4F7PB 1ZGLB 5B22A 1EX0A 3DMMB 4GQZA 1Z0MA 4G72B 3UP1A 3DURB 3VI3A 2YOCA 2WQWA 1R47A 4OT1H 5HYEA 1DN0A 2Q8BL 1HH9B 5F3BA 2DB8A 3FQUB 2WVUA 5BZDA 2PW1B 1QWNA 3PL6A 2R29L 4AIOA 3AS2A 3NQIA 1K2DA 4LU5H 2R8SH 1O0VA 4W9CC 3WS6A 1DLFH 4RAHA 1K8DA 2W9DH 3N9GL 5D1QB 5K5YA 3BESR 3O6FD 5I1HH 1XO8A 1BFVH 1MHCA 1Z9OA 2BZCA 4TV3A 5DJ6A 1RURH 3HVNA 2R2BA 4IRZH 3FCTA 3ZDZF 5KS9B 2O5ZL 3GD1C 3HKFA 4IIQA 1J5HA 1AZBA 1CFQA 3ARBB 4OJFL 2JLPA 3QVAA 3ORJA 5ANME 4G6FB 1K6QH 2OR7A 4JRXE 4UM8A 4R84A 4AEIH 1HJCA 4V1DA 3TCTA 1VADA 1TTFA 5DHYB 3T3PF 1T0NB 4KRPB 5C3IA 2OAAA 1KZYA 3KNBB 4G8GE 4YO0A 1DBBH 3F65A 3UZQB 1A25A 1QATA 3BE1H 4U1IA 3KCPB 1NDGA 5HHMD 5BZXA 3Q43A 4M1CC 3STLB 3ESUF 3VXNA 1T4KA 4FQXC 3STZB 1MREL 2G30A 2B5IB 3DBSA 4F24A 1N70A 4MB3A 4J3TA 5F1KC 4Z6AT 3NGBC 4Z0BL 1USQA 2BZDA 1XAKA 4HEPG 4XBPB 5GS0C 4LHUG 3K71B 1S78D 2BVYA 4U1NB 3WG7B 4NUJA 2FL5A 3IBEA 2VC2L 4LSSH 4GUPA 3FU0A 5F7HA 3EKCA 4G7VL 1B9ZA 1MAJA 2JCCA 2WO2B 1NGXB 4V2BA 5IT2H 1JXGA 4CVXB 4M4PA 3OM3B 3QCVH 1U21A 5DRWB 2Y1ZA 4W93A 4TTGA 4DW2H 1OD7A 1WA1X 2YBGA 4GUCA 3T3MB 3FO2A 4F7CB 1EZUA 2B3RA 4MCMA 1UWGL 1E4JA 5H2BB 3OJVC 2I5YL 4PJAF 5JQIB 2ZP8A 5FGRA 3OMAB 4WFHD 3L3OC 5GGQL 4C57C 1SVBA 1ZSDA 5E6SB 4X6CB 3EDJA 5IB5A 4QRSB 4AVJA 2OCCB 4JREB 4JFYB 3F83A 1XF4A 5B4MC 4IU3A 2CLRA 3EGXB 3M7OA 3BC9A 4QXGH 3RGVC 1MFBL 1AHKA 3X3GL 2PYFA 3SDCD 1F18A 1I7ZB 2WWNA 3CPLB 4ZX5A 3LEVL 4XOBA 5BRZB 5E08L 3L8QA 3QNZA 4Z7UB 1G0YR 5D1XE 3RL2A 2XZAL 3VRJA 3N5AA 3QHZH 5BUGA 1QRNA 1T3FA 3DX7A 4DGWC 2AQSA 4FXLA 4OB5H 3JT0A 4XHQA 3UO1H 3IJYA 1ZA6B 5I0VA 2CGYA 1I8IA 2Z92A 4E42A 4HVBA 1V3JA 5EDSA 3PXLA 2XC8A 3TFKC 3U0TA 5EZOH 4NGHL 4MA8L 3D4GA 5GJTL 1GKEA 4LPVA 1A21A 5E23A 2BFVL 3FQ1A 1KCSH 4LPYA 3MRFB 3TN0C 5LBGA 3CNKA 1B2WH 4KOCA 1BLNB 4P06A 2XU9A 1QA9A 2H26A 2OPCA 1SPDA 3B3BA 2WXIA 2DQJH 3IKCB 3QPQD 2BP5M 4FCHA 4LHJB 4P9MH 4JFZL 3JWDL 4S1RH 5DJ8B 2J1WA 3IAGC 3L5WA 4BUQA 3BUYB 3QJQB 3QUML 4YHZL 1KNOA 3MR9B 2J1YA 2HKLA 4PP1C 2ZCHH 5J1SC 4PJDB 1KEGL 3D87B 3OMZA 4FQXB 4JO3L 3CSYA 4PRBA 5A2CA 4MTMA 4NBZB 1P84J 2IGLA 2BIOA 3GMOA 3O9WA 3Q6GH 2PTVA 4QUOA 3D4CA 2QLYA 2WKLA 3FUMA 3MRIB 3NGBB 4EIBA 1YEFH 3AREA 5CR8A 3EOAA 4F8OA 3TEZA 4QAWA 1U8OA 1EUUA 1QRKA 4DKTA 5KAQG 1U95B 4NC0B 3RWGB 3UAJA 3SJVB 5LDSA 2MPAL 5HPMA 1LK3H 1M2OA 4OFVA 1T0MB 4EOWL 1E67A 3O3BB 4LSTH 4ZD3L 1I8AA 3FFDA 3MGTA 1WK0A 5E1AA 4Z7WB 1FAIH 4N90D 4X98B 3TNMA 3W9EB 3OXRA 4CVZB 3GI8L 2EE3A 1SHWA 3BP7B 4N2MA 4RFOL 3SQOL 4I2XA 4LLQA 3L3OB 4IBYA 1XIWA 3PWNA 4K7PX 4MXWH 5CD3B 1NOFA 2ZCZA 4NPYA 3JUZA 5GGUB 5FUZL 4BBWA 1B4LA 1WBXA 4YHKL 2FBJH 4MCYA 3ZHNA 4UDUB 1JIBA 1YEKH 1E3ZA 1RULH 1TVBA 3RGVB 4LK4A 1INEH 4S0HA 4OV5B 2YXWA 4JQXA 3GSVA 1IGML 3TBTA 4CW1B 2EKSA 1D5BB 2FLMA 1T83C 3QQ9C 4KU1A 3VSUA 5B1BB 2HXAA 2JLLA 2EZ0C 4DOHE 5FLUA 1F3JA 3MROA 4KFZC 1BJ1H 3CLFH 5DEFA 2CO7A 5FWRA 4MQXC 3HMWL 4ONGH 4A1RA 3GHEH 2YMXL 4NKOB 2P46B 4H8WL 3VFSA 5AAPA 4UQ2B 1BYOA 1W72A 2Y7MA 4PD4K 2ZNXA 4NENA 4MA7L 3GRWL 3NFSH 1NMAH 1T6VN 1YO4A 1KBBA 2YD3A 3RWIB 3IFOB 5EHFA 3TN0B 4BH8B 4XC1H 2ENYA 5HYJB 1TETH 1OL0A 1JGDB 4HYTB 5BW7C 5F1IB 5JHLH 3QWOA 3FT3A 4UQ3B 1KB5L 2ZKHL 1ROCA 2P42B 3STBA 5B3JE 4MXVF 1B90A 1XT5A 5E9DD 3X14B 3QEUA 2Z35B 4KDTA 5I23A 2BSEA 2AV7A 2LAAA 3SE3A 2X4PB 1FV1B 1XH3B 4GSXA 1CL7L 3GTNA 3A3YB 1Z9PA 4EVNB 3G7TA 3EGSA 4JY5H 5DO2D 3RZCB 3SOBH 4OZHF 4X7FC 1A1OB 2G5RA 4K3DL 4IU2A 3CDZA 1U58B 4NP4H 1WBZB 5EV7A 1N59B 2CLZB 5J13C 5FC9A 2VDPH 1AQDB 1JF5A 5IUSA 2MOVA 2C8NA 5ISZA 4ETQA 4IBTA 1CL7I 4DESA 2ZSVA 1I7UB 2GJJA 1CJYA 3PJSA 3QDGB 4J8RB 5DQ9A 3SDAC 4BYHA 4Z7QB 1CXKA 2CLVA 3UG4A 1H9VA 4GI9A 2FGZA 2YGVA 4NQDB 3IDMB 2HVKA 4PQXA 3VX1A 1SOQA 5E4IA 4ZUSB 3HE7C 3C6EA 1G7PA 5DWPA 1YEJL 3EH4B 4A6YL 2VZ1A 3VRLE 1SXAA 4PRHA 3KGSA 5C0AB 3TOPA 3FW6A 4PJ7B 4F3FB 2Z31D 5L0QC 3TA3B 4GAYB 3DWTA 5DR5H 4AXWB 1B2YA 2HKHL 1XV8A 1WUZA 2Y06H 3MMEB 3O3AB 3P3TA 2YAHA 4FFYA 4LXFA 5CGBA 1MW1A 1FL5A 5JIPA 5T3XE 2YBRA 5L9DL 4POUB 3ILPA 4HIHA 1XL6A 3TJEL 5HHXL 4F37K 4KZDH 3ILQC 1HKLL 1KGCE 3BGMA 5BV7H 3MLUH 1P53A 4FL4C 4KROB 3U30C 1NLBL 3I02A 1SHSA 2JB6B 3TP4A 5JIHA 3QYCA 4R4FL 2YS4A 1U8PA 4LQ1A 4PBWD 2NY3C 1NIBA 2VNCA 2BVEA 1EJ8A 1CF8L 1S5HB 4AK1A 3MO1A 3N43F 1TTUA 1XGTA 4JDZB 2OMWA 4EI5A 3GQFA 2Y0SA 4A2LA 3BQVA 1BJMA 1WFTA 4WFEE 2C1OA 1XSIA 3HC0B 3HI5H 5LN4A 4BHUA 4NFDA 1FFNA 5JXEA 4TUUA 1S9YA 3VXRE 3WIFA 2QGEA 1K8IB 1CLOH 1JJUA 1IBFA 2PYEE 3FPYA 1KT2B 2Z8SA 4XBGB 1I82A 3DVGB 2Z4QA 4QRTB 5FAAA 2YQ2A 1Z5HA 1O75A 2K8QA 1IZJA 2P47B 4AEFA 5KS9F 1J8RA 3UFIA 2NY6D 4JS7A 1MJ7H 1TDQA 3P4NB 2R27A 5E1GA 5ITFA 4PJXB 3LKPB 3O6LH 5MHSD 1UZ6E 2PN5A 5CEZD 1RIVL 5ELIA 5L4FA 1H3PH 3RYMA 4Y19D 2FK9A 2PO6C 5ESAB 4V33A 2FD6L 2K3HA 3VFVA 3CLWA 3W9DA 4QMEA 1NBVL 1TJGH 2AXHA 2XQYA 4NO5B 4PGJA 1PMYA 1NSNH 3GHPA 5DJ0A 4P2RD 1HEZB 1FHNA 1T5WB 3S4SB 3BSGA 3C60B 4MXQD 5IVOA 5EZPA 1FO0H 2ZUXA 3PWJB 1PSKL 2BIMA 1AE6H 4GIPD 5J13B 4FNPA 2OJ1A 2OMNA 4B7IA 1U4FA 1X6LA 3VQMA 3MV8B 3KYOB 1FYTB 4WWKC 1A9BB 1AI1L 1U3ZA 2DQCH 5I6MA 5IJKC 4Q9RH 3SDAB 1RVFH 5HYIA 1Q90A 4FLQA 1RSYA 2NW2B 2UZXB 3C12A 3CFDB 3T4YA 3GBNL 3CSBA 3WL9B 4AIXA 5C86A 3NG5A 5DUMH 3V0GA 2APXA 4BFRA 5B1JA 1T5XB 5DURD 1GOHA 2MFNA 2B14A 4BKLB 2DMHA 4NBXB 3LCYA 3Q13A 3I9GH 3MUY1 4OI9A 2F18A 3RUGB 3RVUD 3V0JA 4AW4A 4H1LH 3SE4C 4JHVA 4JKMA 1SDDB 4FQCH 1X7TA 2FHCA 3WU1A 5AVTB 5F6HJ 4KKNA 1HIMH 1MCOL 4XN8A 3UBXB 2HKFH 3U30B 5KSVB 4QWWC 2VMCA 2OJEA 1O9ZA 3MRKB 1U9KA 2XKNB 3LRLA 5I71B 2P80A 3FK3A 5E2TL 1WS7A 4R2GD 2NY3B 4EI6B 4IK6A 4C56E 4DK3A 3MRBA 1XF5B 3O4LD 1KXQA 3BVTA 3MCKA 2ITDB 2R0ZL 4XAKD 1JCVA 3UJJH 4APQD 1TOXA 4MCZA 2A6DA 5DD5L 3UIYA 4ZK8A 2VXQH 1VEOA 3B9DA 1EZVX 3BSHA 4NSKA 4AZ8A 2JKSA 1C16B 1QNZH 1WV7T 2QKSA 3FYIB 4JPQA 4UIKL 3T0EA 1QTSA 3SBWC 3UBHA 4GAGH 1L9PA 2EDXA 3S4SG 4BQBA 1RP8A 5EF2A 3P2TA 4KI5D 1IC7H 4NQEB 5D6CA 4B9ZA 1JI1A 1HNFA 2E9JA 5BVPH 4NX0A 3FH7A 2P5ED 1QSZA 4XCEA 4FQHA 2F7PA 4Y7OC 1U33A 3N0PB 2QQLH 4XO9A 1LEGA 3R1GH 3MLZH 4MD5B 4YHYC 1BZ8A 3CLEH 4IS6A 4LDEB 5EC2B 1M1SA 2H1PH 3CFJA 4YFEA 1T89C 2KS0A 2IFGA 4OY9A 1AY1L 3C5JB 1NKRA 2PO6B 2X4UA 1XAUA 1L4IA 1MRDL 1BAFH 4MDIA 1HHKB 2ICEA 2I9TA 1ZHBB 1NEZB 3E3QC 2KYIA 1KBPA 1MPAL 3PV6B 1NC4A 4NHUB 3S35L 5ABDE 3CG8A 3QYMA 1A7QL 5ERWB 4CC4C 2X6VA 5C09A 5C0FA 3LHAA 5FOBA 4Q0XH 3RY4A 4U3XA 1WDAA 3VFNA 1S9VB 1ZS8A 1S7QA 2JB5H 1FG9C 2MCPH 4XNQA 1FGNH 4L8BB 4WWKB 3LEYH 3FZUC 2FE0A 4M1DL 4LCIL 4DF9A 5DZJA 4G9DB 1T20B 1BOGB 2YD5A 3EJRA 2QGBA 1KLFA 1NGYA 2EEDA 5MEPA 1J86A 4M3JA 3Q1EA 1G5GA 1NUGA 1DBJL 3PLYA 2D9QB 3QDJD 4M6MH 4MNQE 1SDYA 1N7MH 2TRHA 3SBRA 1BWWA 2OR8A 4LCWE 3U4KA 3MTXA 3R4DA 4X9GA 2A6KA 2HUHA 4GG8A 4AKOA 5I1DB 3CH1A 2ADIA 4M4RB 5FW7A 4WI6A 3IWVA 3PQYD 3TH3T 5HHQA 1SEQL 4JFXA 1FZKA 1DHKA 2AV1B 1OF2A 1YECH 3MLWL 1B0RA 4LF3B 2BOBB 4QHUB 2F74B 2Y36L 5JDSB 2F1EA 5AOIA 5BRQA 4MMZA 3CH8A 2F68X 4P5TD 4PY8J 4P2OD 3NIFE 3A6CH 1EXGA 3D0LB 1U93B 3QEQE 4U49A 3DHPA 4OKVA 2Z34A 3B7TA 3H9SB 3KPLA 4GFXA 4QHNA 3OZKA 2VR6A 3S5YA 2XTJD 3U6XS 1QMUA 4J7RA 3VXQB 1E4XH 5J3HD 1A64A 1KIPA 4KJPC 1FNSL 2X4RB 3LV3B 2XV3A 3N44F 4JN1L 5CO1A 1JV5A 2C4FT 1NBZA 1KCWA 3CIQA 2C9XA 4PJAA 4JQVA 5T3XL 4ZFGH 1C5DB 5L88H 2ESVA 4NWUL 1BF5A 2BCKA 1F0LA 3QFJB 1ORQA 4HJUA 3EO0B 3KM1A 4R4ND 2O93L 4OJCA 3T5WA 3V4VB 5I28A 4POYA 4E0RA 5F89B 3REWB 2VW7A 3ZZQA 3NA9L 1OTUC 4X6EB 3GMNA 4YHYB 1X7SA 4JFUA 1WZMA 2IXQA 2NQDA 3MHZA 1AQ8A 5D7IE 1GXEA 4AL8L 2ADFH 2IMNA 5KVDE 1NCJA 2Q10A 3C9NB 1YEDB 1LP9F 1RIHH 3FQNA 3L3JB 4JE0A 3KLQA 2YRPA 1O9WA 4D9QE 1O7DE 4L23A 3AQYA 4AQ1C 4JKKA 2UZYB 1E4WH 2BPBA 4MZIA 1E8ZA 1TLKA 3E1F1 3QNXB 2EINB 4X5WA 4G8AC 5GJSH 5BXFB 1FG2A 3IFNL 3ZR5A 3B6SA 1UA6L 3DX9B 3LHPL 1KWKA 5DS8A 5DEJA 4WFGD 5JXAL 1BQ5A 3MV11 2EDMA 3ZL4L 1WJ3A 4BH7A 2QQQA 1JV2A 3SD2A 5HDRA 3H4HA 5ILTL 5IJCC 2XIDA 4Z8FH 4K0OA 3BZFA 1ZY9A 2ZPKH 3KPQB 4L3ED 5KTEL 3L5JA 5E5LA 2VTFA 3ZZ1A 3RVXC 4Z7QF 4G6KH 1BM7A 4B3VA 5CJQL 1KN2L 5AQ0A 2RA1A 2YN5A 3EJJX 3MCG1 1C1EH 1Y0LB 4DTGH 3MRRB 2RR3A 3VWKC 1NAKH 3CXHJ 1DFBH 3D3VA 3HE6D 1MVYA 2IALB 3ZDXF 4JY6B 1K3IA 1VFMA 2N01B 2LE9A 1HN1A 3BVNB 1LO3L 3D12B 4G9FD 4PJ7F 5DJXA 4AUUA 4TULH 1AS8A 1ZLWK 3QXAA 3VNYA 3UJIH 1UA3A 5BOJA 3HRPA 1YMHA 3VXMA 3TF4A 1B4JL 3D9AH 3OKMA 2X4NA 3CDGB 3QQDA 4PJGB 1DSYA 1Z9NA 5GRVL 4B3EA 3WKNA 4M56A 1IAIL 2VERN 4JFQA 2VQ1B 3ZZSA 1EEUA 4C58B 3HCVA 3GM8A 1FBIH 2XIBA 3PUUA 3W81A 5ID0A 4XMWA 2VDKH 5D70L 4U1KA 4IOSA 2GPZA 4XBMA 5D7KD 4NZUL 1UKTA 5D5MB 3L08A 1MFUA 1CFNA 3CVHA 5BJTA 1T80A 4N8PA 1H8NA 2VDQH 4YGAB 5MENA 3WN5A 4XNYH 4WVRA 5M95B 1S9WA 5A2BA 4FN0A 3QCUL 2J8UB 3REVA 5CINH 2EYSB 2GSMB 1H8SA 2JK5B 4I85A 1Q72H 1XGPB 2IEPA 2D73A 2JXMB 4PCTA 5KBNC 1JD9A 3H7LA 3UTZA 1SNRA 2QSQA 4L1DA 4V11A 4OGQC 3SCMC 2G2RB 1BD2D 2ICWJ 5EBWB 1X5IA 3L7EA 4AQ1B 1LEIB 4PJXF 1RLWA 3H42H 3CK0L 4M29A 4XGZA 5SWSD 1MJ8H 3EFOA 3EZJB 1W72H 3MGOB 3D39A 1OF0A 5JHDB 2L04A 4ISVB 2XQYK 1ZHKA 5FDYA 3B2PA 3K0YA 2G4GA 3KPMA 5E24E 2IDSA 3Q9PA 1Y18A 4YDMA 4X7CC 2IF7A 2MQGA 1QABA 4ZMQA 4LASH 4YX2H 1I85C 1XX9C 3FCSA 4H8VA 4FNLL 3MCLL 3PGCA 2GJZA 4Y4FC 1ACZA 3CFMA 3LD8C 4UT9A 3MKKA 3H2PA 5B7MA 4NQTA 2PXYD 2BZ7A 4PREA 2AFNA 2ARJA 3KLLA 3QG6B 3WXVH 5B1CA 2BOLA 1D9KA 2R59A 3EZ8A 3FB8B 1R0AL 3WFZA 1M3JA 4E68A 4ODXA 1AIFB 3VWKB 3LS5L 1FFQA 2Z8WC 3AT8A 5FGSA 2OSWA 1I8LA 3RP1A 4WCYH 2F54A 1FVEB 2MCMA 4WLCA 1JN6B 4F7TA 1YYLH 2NTFB 2YMOA 4X9HA 2AI0L 2CR3A 1SXZA 2JV6A 3PHOA 1K4CA 5KSBE 1BIIA 1HEHC 4PJ8C 1J5CA 4QRPA 2Z6FA 4BZ2A 3GRGA 3ARFC 2V2XA 1JPFB 2DW5A 3II3A 4FQJH 1YYMH 2O30A 5ANHA 1MW2A 5AALA 1MFMA 4X80H 4TSCH 2V0AA 2OULB 4E9VA 3TEYA 3L1FA 1MZYA 4WO4D 4QTIH 1U91B 4OZHA 3D2UA 5EU7C 4O51B 2CR6A 6CGTA 4UQAA 2IH8A 1F6AB 3RVTD 3TIDA 3IF1B 3HZVB 1MI5A 3U1QA 1IAOB 2X09A 3H1ZA 4LP5A 1YEEL 3WYRA 5ENWA 3MLTA 5TPWH 3CFTA 2NNAA 1TKWB 5HJBA 1ODUA 2AVFA 3RNKB 2YPLD 2WQUA 5CUSH 2J3SA 3WE6B 3I2CL 3G08A 5LG1A 2YFNA 1EBAA 2ADGA 1KPUB 4R7DB 2WWMC 3C5SA 4KXZH 3SPHA 1BGXH 1IBYA 4RGOL 1JF1B 3PJLA 2W0FA 1WYJA 2NY5H 1NBYB 2ZG2A 1H0DA 1FCCA 1ZLWH 4EN3C 5J6HB 5C07A 4D0CA 1AQKH 3SCMB 3D06A 3IFPB 4I18C 3RWJA 4PVLA 4EUPB 1RV6X 4ZW5A 4LDOB 2JJSC 2YN3A 3D50A 4L2LA 4LHUA 4FQ2L 2XN0A 1IARB 4AX3A 4CMHC 1QPXA 5HI3C 1J0IA 2E7DA 4YXLH 3QISA 4P46A 1LO2L 4MKMA 2LAGB 1EAJA 3SDDD 4V2CB 4D94A 1CU4L 3FH8A 1U6AH 2B08A 1A3LH 3H6AA 4A7GA 5ICUA 1KN4L 2AK4D 3CFBB 1MFDH 4F7PA 1ZGLA 4K3HA 1M1XB 3BFWA 3DMMA 5EDXA 3RTQD 4NZFA 3RVWC 4XX1E 3DURA 3LRGA 3BPNB 4P2QB 1HH9A 4Y4FB 1RK0A 4U3CA 3FQUA 4JO4L 5JOPD 2PW1A 4HF5L 4NWTL 1UOLA 5KVDL 4L5FL 4IQHA 1QEWB 4BFJA 1CI3M 2BJML 4Q6IC 4QNPF 5FYKU 2F53D 2ENPA 4UT7H 2V7HB 5D1QA 2IAMD 4S2SB 3FQXA 4PWKA 4I77H 2F1BA 1MXDA 3D69B 4NCC1 1HL5A 1ZKAA 4PGEB 4KZCA 1UACH 2APBA 3L5IA 5KS9A 1U0QA 3U1PA 3ARBA 3ZL2A 4NDMB 1BMWA 3N50A 2MMXA 1R5IB 1UG9A 2X6AA 4OCXH 5C97A 2EE9A 5DHYA 4MVBD 1T0NA 5CZKA 3GZQA 1CBVH 3KNBA 4AIEA 2EDNA 4XI5C 2VKXA 3UZQA 4UZSA 4PJ8B 3KCPA 1HFUA 3CBJB 3KXFD 3ARFB 1PGRB 4OM1H 3STLA 3VU1A 5IIEB 1KJ2B 1ADWA 3CU1A 1N10A 3VXUD 4FFVC 5I1IH 3STZA 2V6HA 2A4EA 1Z7JA 1PY0A 4KK5C 4F7EB 4DN3L 3K5RA 1J5OL 3T6QC 3J07A 4QRBA 4NFCA 4XBPA 4EUPG 1UEYA 3E8VA 1B0GB 1A14L 3EYQD 4N90E 3K71A 4U1NA 3ZKSD 3O3UN 1PZAA 4LRIC 3DX6B 4HJ1A 4WHTB 3EIFA 2XFXB 2MJWA 3SY6A 3ZW3A 1CGSL 1NGXA 4XPTH 1AXSB 4M3HA 4CVXA 1UT9A 2Q8AH 4M8RA 3UMNA 5J1AB 2VITB 5DRWA 3MBXL 4KQ4L 1ZT4B 2OMVB 3WNNA 3LH2H 2G5BB 3QZLA 4F7CA 3OV6A 4JEGB 5D72H 3X3FL 5H2BA 5G4NA 5TF1H 1V55B 3IFLH 4B9PA 1XZWA 1EZSA 3AQXA 2OV0A 4RBPK 4NRXB 4POZC 5T3ZH 4G7QB 1AANA 2YARA 4EN3B 1A7RH 3CBRA 3TTSA 4HIXL 3S7GA 4I18B 1BG9A 4RA0C 1UM6L 4X6CA 4RX4A 2V17L 3B7RL 3LNDA 5CJ5A 4XVTH 4QRSA 3I50H 3P3RA 4JFYA 5LN8A 4CMHB 2R4SL 3R4RA 3LZQA 2QZ5A 2AJYH 1OPGH 3EGXA 4IDJH 4EXKA 3MODL 2A77L 2NT0A 1MVUB 2VH5H 5KYWB 3QULB 3VXSB 5HVFB 1I7ZA 3CPLA 5F9DC 3HNVL 2VZOA 5BRZA 4Z7UA 3VWJD 5K1NA 2VLLB 1FZMB 4AH2B 1KYUA 3MRJB 5CZVL 4NPKA 1ZA6A 5D1ZD 5KVEE 4Q6IB 5K1JA 1ET8A 3IDJB 4EIZC 5IMOB 4XVUD 1HILB 4B97A 1Q9LB 4YPJA 1OK8A 3ZMNA 5I18H 3ZE0E 3A23A 5FUCC 4FTVB 1OE1A 2W60B 5DD6B 3VSQA 3MRFA 1OAZH 4TQEL 1WHPA 4K55A 4I4WB 3QNYB 1BLNA 1IGYB 1E6OH 1Y07A 2I60L 1R17A 3ARUA 3IKCA 4JZJB 5D7HA 4OZFH 4JG9A 5DJ8A 3MPCA 2W07B 4WTQA 3BUYA 4O5LL 3MR9A 2XICA 1DJIA 3NIGE 4L1BA 4PJDA 4I3RH 4ZMNA 4LSUH 4FQXA 5E5RB 2IG2L 3KW7A 4F58H 2Z65C 4HH8A 5JPMB 4FERA 2EDDA 1KACB 3MRIA 4ZFFA 1S3KL 5EU6D 3PDOB 4N3UA 2BX5A 3RX7A 4DFIA 1U95A 4KKRA 4QIRA 5I8CB 3RWGA 5E6ID 3FFCB 2QHRL 1RAMA 3SJVA 1G7IB 2EUXA 5KYYB 2N3JA 2VDRH 1T0MA 3O3BA 3LPWA 1SDAB 3JWDC 2ZUUA 4E41E 2E9WA 4Z7WA 4X98A 1KGIA 5JOFB 2B15A 3W9EA 3L9BA 5GGSB 2H0FA 2Z1PA 4CGUB 3LS4L 4XPAH 4CVZA 3EYOB 1WITA 3BP7A 3H7BB 5D5MF 2WXGA 4OCNC 4YHNB 4Y4KD 5CAYB 1S46A 2CO1A 3L3OA 1GYCA 4NM8L 3S37X 2HB0A 1LYQA 4FX5A 3QJVB 5GGUA 2VC2B 4UDUA 4M61B 1QFHA 1X4ZA 2ZAGA 2ALAA 3IBOA 1NUNB 3GZOA 3MUHL 3RGVA 5JUEH 2E47A 4OV5A 2NY1D 4UT6A 2X4QB 3Q7JA 4FG6C 4CW1A 1D5BA 2H3KA 2ZX7A 2EH8H 4IRSD 3QZBA 4XZ4A 5KVFE 2GK0B 1NAML 2B9AA 1S6NA 1OLZA 1UCBL 1UKSA 3IGAB 3MV7B 3P9MB 1TU2B 1LXMA 3KWTA 4M8QB 3P11H 5T1LB 4ZMTA 1CK0L 2QSVA 4HUCA 4UB0L 2G3MA 2O1AA 4NKOA 3ILDA 2Y07L 5EF0A 4UQ2A 4NQSB 4RBPH 5IHWA 1MJUL 2GTZB 3OKLB 1BJ1J 3QRBA 1Z0NA 5HGAB 3DBXB 3RWIA 1WFUA 3IFOA 4KUZL 3TN0A 1E6JL 1YZZA 4AVHA 4BH8A 4HK0B 3QJTB 3S34L 5HYJA 2CGRH 2WTRB 1T21B 2XRAL 1QBAA 5DK0B 1KCRL 1JGDA 4G1EB 5HVHC 4AITA 4PRID 3DKHA 1WWCA 2Q3AA 4QRRD 5F1IA 4MNHB 2J8HA 4UQ3A 3GO1L 1SY6A 5F9WC 3U7YH 5MHSE 3KYKL 1CO1A 3KBFA 4P23D 4NCC2 1A66A 1ECZA 3IJ7A 2DIJA 2O6DA 4Z95L 5TFSL 4X0KB 3X14A 3VQ1C 1EHLL 5FS5A 2Z35A 2XVGA 2ADJB 3BCDA 4Z7VF 2GTWB 4TL4A 1OM3H 1J8HD 4P2RE 8PAZA 3KWXA 1SF5A 3HZYB 5D96C 4CVWA 3GXNA 2X4PA 1FV1A 1XH3A 2R15A 4TLTA 5DHVB 4NQCD 4EVNA 3N1FC 5BQDA 1Y7MA 3RZCA 1E43A 3GNML 3QDAA 3HPLB 1A1OA 2NCEA 1TJIL 1U58A 4KRNA 3WS3B 3MGAA 1WBZA 3HMXA 2D7NA 5I19L 1N59A 3ZE2F 2YEVB 5KYNA 1NCOA 5F96L 1AQDA 2YSTA 2D9CA 1I7UA 3QDGA 1V7ML 4J8RA 1RERA 4K94C 5AYUH 4KVCL 3V0DA 3C6LD 2HRGA 2IMMA 3SZKC 4JE4B 4NQDA 3IDMA 3ARDB 2C9SA 4BCZA 4ZO6A 1OAJA 1EFXB 4J3OG 4F27A 4BZ1L 5C0AA 3P40A 1TZHB 4F3FA 2OQJB 4PJ7A 4FFTA 3VGGA 3BMVA 4BXVA 1E8XA 1VAHA 4GAYA 3CDFA 3LDBC 3HAEG 3TH2T 1GCYA 5F2FA 3AROA 4FZ8H 4AXWA 3MMEA 5ADPH 2D7QA 3O3AA 2DQEL 1OP4A 1U8IB 1T83A 2HT4C 1QI4A 4KVPA 3DXAD 4KKBD 4FS0A 2CBOA 3OR7B 1KTKE 1WRFA 3SGDI 2F19H 3GJFB 5GRYA 2K1MA 3ARGC 2X4TB 1JCKA 3O4LE 4LT7A 4HDIB 3CVHH 3ULVC 1QWHA 4GRLC 4RVBA 2EE6A 2JB6A 3ISYA 1SBSL 1MWOA 4AQ8C 2CK0L 3CSFA 4WKXA 1ZEAL 3ZUCA 1GS8A 1CXIA 3D05A 2PLTA 2BP8B 1NWOA 1Z66A 2J12B 3B5HA 2NYKA 3LIUA 2ZJSH 1ONQB 1HE8A 2H2PD 1ZK5A 2N0KA 3QPXH 4KKQA 3HC0A 4TF4A 5HVHB 2P5EE 5HXMA 4FNQA 4PJEB 5BW7A 1K8IA 2FX7H 1XHHA 1VCAA 3QHFH 3QIBC 1KT2A 4XBGA 3U9UB 3RE0A 3ARVA 1I3VA 1JZFA 5GZOD 4XP6L 2ZTBA 1MLCB 3DVGA 3F12B 4QRTA 4AQAB 1MCFA 1G9MH 1M2VB 4JK0D 1CQKA 1DVQA 4WSJA 5D2LB 4AVKA 4ZFOL 2Y5QA 2XZCH 3P4NA 2AABH 4O02B 4PJXA 3RAJH 3LKPA 2R1XB 3NDYE 4XN4A 3D7PA 2FO8A 5D96B 2JKXA 3FUKA 5IMMB 2F2HA 3L4YA 4IKJA 3QZPA 4IOFC 1NEUA 5ESAA 1OV8A 4UT9H 3X13B 4FKKA 3IDYC 2E6JA 1RUQH 4NO5A 3VMOA 3QUZD 2AK1L 2EO9A 1BXVA 4KKAC 4D9RD 1DVFD 1HEZA 3U7AA 1T5WA 3S4SA 1NTDA 1MFAL 2GC4C 3C60A 3BVXA 4JKPL 4YXHH 5FECB 4PLKC 4XT1C 1CLYL 2YJLA 4KDWA 3PWJA 5J89A 4PD4J 1IFGA 3KDMB 4KNSA 4YSQA 3DOSB 3R19A 2WVVB 3EOYG 3C6SB 2EDTA 1YA5A 3CX2A 3MV8A 3KYOA 4R7NB 1FYTA 5I73C 1A9BA 5IBLD 1AC0A 3SDAA 2FBRA 3DVFA 4F8PA 15C8L 1MHHB 5T5FL 2NY0D 2EIMB 4JG0L 2NW2A 2C34A 2UZXA 3CFDA 3FF7A 1FFPB 2BNRB 3VXTB 3LZFL 3WL9A 4G83A 2UX6A 4X4ME 1RZ8B 2FBOJ 3M8OH 2VLKE 4P0DA 2EDFA 3H3PL 2OKMA 3MA7B 1G6VK 4BZ2H 1T5XA 4YBQD 4N2DA 2YQ3A 4YHML 1KTBA 2Y6SD 4OBRA 4BKLA 4E2OA 3LDBB 5IZ7A 4JRLA 1HXYB 4G3YH 2M83A 4HJGB 3VM5A 3SYCA 4UU9B 2YEQA 3RUGA 4FXKB 4JCLA 1MCEA 5I82A 2CIIA 1OKEA 1QNIA 4F8TA 3D25B 3OMNB 1MCQA 3AFLA 2ZNWA 1SDDA 4GBXC 3B37A 3V4PB 5I8KH 3ARGB 4HAKA 2CHDA 2VDNH 1DEEB 2H32B 3UAFA 3UBXA 3ZPDA 5KSVA 3X11B 3MRKA 4GRLB 4XMKH 1A7OL 2XKNA 2GSGB 4OCSH 3TT1L 3PY9A 3QUGA 3N1MC 1HTYA 1QLEH 2VXVL 4EI6A 4NO0D 1XF5A 2EDWA 4ZAKC 2ITDA 3QAZC 2WXLA 1WS8A 2WUBH 5J11C 2CDFB 1F56A 1AC6A 4P9HH 1GPOL 4XMVA 2QVMA 4G6JH 4HGMA 5JO5B 4RWYH 1DQTA 4XNXL 1X5FA 1C16A 1FZJB 5LAPA 4N22A 5BMFH 3IETB 4JMXA 3QIBB 1QOKA 4OLVL 4NZJA 3P30L 4LDLB 1CGXA 4FEMA 2QT6A 2Z8RA 3WIHL 5HSFA 4NQEA 5KVFL 2C26A 4UNUA 3BI9X 1G94A 5E8PB 4G43B 2E4FA 4GMSL 1NCDH 4OJAA 3QQ4B 1F4WL 5L4IA 5BUPA 4TRPH 3NFNB 2BH0A 3WDIA 3NJMA 4MD5A 4X9BA 2XWXA 4IRJC 5EC2A 3P4MB 4WNJA 5FO8B 3EO1B 4JB9H 4JFVA 3C5JA 2PO6A 3BVUA 4XNUL 1DJGA 5LGJB 1HHKA 3IDYB 2ID5A 3ZGHA 1ZHBA 1NEZA 3R8BB 3EUDA 2X3BA 3PV6A 4FI6A 4JM2C 4WFGE 3MLRH 4NHUA 4AM0B 4FHJA 5ERWA 4PB9H 3TEWA 5IMLB 4Z0XB 5I0ZA 1W6WA 1KXTB 3LPFA 1CGUA 2ARWA 2GI0A 1KGWA 3APMA 1CC3A 1S9VA 4H8PA 3FT9A 1T7ZA 2JIXA 4I0PC 4MKTA 4EKXA 5CEZL 4H13C 2XXFA 4L8BA 3ZTNL 4WWKA 5I73B 4TVUA 5IJKA 2GQHA 1M9SA 3SE9L 2AERT 4YDVB 1JDCA 3MRHB 3QCTH 1IAMA 1KSRA 3VH8G 4ZTPL 2K70A 2A9MH 5EF1A 4G9DA 1T20A 1MCBA 1BOGA 4X6BB 5J7CC 5EOQH 2WXMA 4HIEB 3GXTA 4XCCH 1EHAA 2Y1YA 1KG0B 1VKXB 3JZYA 4LOUD 3SPIA 2OTWB 2UY6B 1XTMA 3E2HC 3ML8A 3CXDL 4YDKL 5E4OA 3W82A 4RLDA 4X2UA 3T77B 3RRQA 2VN4A 5EUKB 4G9FE 3MSPA 4I3SH 5FHBH 3SDXF 5I1DA 3FB5B 3SE4A 4M4RA 1NIAA 3U6XA 4GBXB 2AJVL 3NTCL 2AV1A 2EJ1A 2VUOA 2X4SB 3SKUD 5D2NC 4EBQL 4LF3A 4QGYA 1OZTG 4NO3B 5I9QC 1VZIA 2BOBA 4QHUA 2F74A 5JDSA 3L2LA 1QLFB 2CSPA 5LCVA 3GJEB 4WNQB 4U6XB 4ZAKB 3QAZB 3D0LA 5FYLD 1U93A 4X9IA 5D7KE 4QYOB 4F2MB 5J11B 4AG4L 3H9SA 1YNLH 5E8EB 2UZIL 1KULA 3V52H 4G8EB 1KYDA 3R18A 3VXQA 4Z3IA 2WP3T 3FU5A 4QDGA 3TBWB 2DIEA 2X4RA 3LV3A 4ODWB 2BC4B 5GRXG 3QE5A 1C5DA 1J48A 4HS3B 3E6HB 4TUKL 3QFJA 5GRZA 5KBKA 1EZLA 4KNUA 1TZIB 3EO0A 1N8OE 2NZIA 3V4VA 1OT2A 3ENEA 5F89A 3REWA 3UZEC 4R26L 3QDMD 4KTDH 5EFIB 4FQ1H 4X6EA 4JFWA 3ML9A 5I16B 4FFWC 1KJ3H 4IRJB 1G6RL 1DBMH 2ZCKH 2OYLA 1AOHA 1T89A 1FC2D 4XB3A 2CRMA 5C71A 3C9NA 1YEDA 2VUKA 3K5SA 3NPSC 1JNHB 2DI9A 4JPKL 3QGVA 2WQVA 1JK8B 1MFCL 2YPKB 1G0DA 3EJYD 4PFEA 1QI3A 2UZYA 4JM2B 1RZGB 2DQGH 4GKSB 4F93B 1A6ZB 5LQBH 3BAWA 2BHYA 4CC4A 3QNXA 5T1DL 1PTZA 3ZT7A 2NUTB 1XGYH 1X44A 5BXFA 4I0PB 4N5EC 2F8IA 3DX9A 3IDXH 1MSPA 4YIQB 3W0WB 1KIQB 2IPTL 4AGMA 3HG1A 1VPOH 2Y7QB 2VXTH 2WLYA 4W9KC 2Y2TA 1OTTD 3B83A 4I89A 5EUOB 5FO2A 5LNEA 1RHHB 3KPTA 3BH9A 3WFCL 3BQUC 4AL8C 3TXAA 1NCCL 3BWZA 2DQIH 3E2HB 3KPQA 5L8LB 4CDGC 5C70A 4NHCH 3QO1B 1Y0LA 1GAFL 3MRRA 1R19A 2YUVA 5GS0H 5I8OL 3QO0B 2HG5B 1JPSL 2IALA 3FTXA 1MCSA 2EIZB 4JY6A 1VGKB 3BVNA 3KGTA 5D2NB 2P5WD 5E9AA 4C4KT 5I9QB 1HQRB 3KHQA 2TSBA 1BFSA 3KMDA 1JNJA 3TBBA 1LK2B 4FJ6A 3MBED 5IHUL 1NCWH 4LSPH 4BXSV 4ELMB 4PJGA 4PPTA 3CDGA 3GPEA 4LSRL 4AJWA 1N0XH 2VQ1A 5FKPB 3UZVA 4BCXA 4A2HA 1I1AC 2EUWA 2ZOWA 3HNTH 3NEOA 4M7JH 4L0PB 1A3RL 2NNFA 4IKLA 5IBUG 3RLSA 2H7WA 2ZWKA 2HFGH 4KUCF 5D5MA 1F86A 2D03H 4M62H 4NKIH 2V5SA 3L1GA 3MXVL 3WMQA 4AOFA 3O0RH 5EA0H 1YG9A 5K9QG 1ZXKA 2PTTB 4KKPA 5TDOB 5A2FA 1Z3GL 3A4DA 3ZRCC 2ISDA 2AMUA 4UT6H 2J8UA 2EYSA 4Q52A 2JK5A 1IQWL 1XGPA 3QJOA 3IWUA 5DD1H 2JXMA 1FDLH 4KH2A 1IU1A 4GAJH 5D2LF 2OMBA 1I31A 2APFA 2G2RA 5EBWA 4L3AA 3FQ2A 4AQ1A 3KCWA 1LEIA 4TTDC 4AUYA 5CD5D 1ZTXE 1HKFA 3MGOA 2VLJE 2WXOA 3FSWA 5F6HI 4OIIH 4AV5A 5JHDA 4IGBC 4ISVA 1ACXA 5AOLA 4K2UH 3EYSL 5JOPE 5CJOL 5IBTH 4S0SD 1NDMB 4Z18A 2PCFB 1ZGLP 3GSNL 3K4DA 3G5WA 3KLAB 4B96A 2J21A 1CE1L 1SY6H 2YD1A 2X6MA 4IBQA 1JBJA 2WV3A 3BQUB 1PFCA 3QIWC 4HWZB 2Z64C 3C5ZC 3ZN6A 1E65A 5L2JB 5AKVA 3V55A 2H41A 2K6ZA 3KPRD 3QG6A 5LBSL 5KUMA 4PYGA 4RMRA 3FB8A 3PWUB 3NMEA 1DUZB 1YEGH 1KBGL 3LZNA 3ELQA 4GEIA 1AIFA 1I9IL 3VWKA 3U25A 4ATTA 4GKZB 3G5ZB 3RA7L 3BRGC 4GKOA 1CDHA 3GBLA 1FVEA 4GW5B 3N06B 1JN6A 1VFAB 2MOGA 2NTFA 1Z3RA 1LQBC 1LHZA 5CZXD 3HS8A 2IQAB 2Y9RT 3H9ZA 1DQMH 1U3JA 4M48L 3HMXH 1JPFA 3BPCB 1Z9LA 1JMZA 1MNUL 3ZL1A 1C5CL 2O61B 2RJMA 1N68A 3U4BH 2JI2A 4HJSA 2WN2A 2X89D 5IB3B 5C0CD 1U91A 3C2AL 4O51A 2X10A 1CGVA 1F6AA 4MJID 1I1AB 5IG7B 3IF1A 3HZVA 1IAOA 4JG1H 5DWUL 3C5XA 4DKEL 5B39B 1ORSB 2EQDA 5AFAA 1DEDA 1TKWA 3UAJD 1ULVA 3MVSA 2VL5B 3ETSA 3D34A 3RNKA 4LCCC 1MWAL 3PHAA 3G5YB 3WE6A 4LO9A 4PJ5D 3KR3L 4GRWE 4UZGA 1NICA 1AZVA 1KPUA 4OLZL 3S37H 4D0BB 3TJPA 3FSZA 4U1LB 1JF1A 4H20H 3GK8L 4I48B 2L7EA 3O41B 2E8YA 1NBYA 4N2BA 1ERNA 2GT9B 4XTRC 3MV9D 4M43L 5MP6H 2A9NH 1CFTB 5JMRA 1R1CA 3GMRB 4XAWL 2B2XH 3NQKA 5E8OB 5J6HA 2HLFD 3EFDH 3SCMA 5EEVA 5SWZB 3B9EA 3IFPA 3S5LB 3FU6A 4EUPA 4XNDA 1HL8A 2J6EA 2G0LA 1XIWD 4ZTEA 3T6XA 3HB3B 4L4VD 1AYRA 5F7YC 3NSCA 4LBEB 1ZANH 1GRWA 4IGBB 1ZLSL 3S36L 1JWMB 3K3QA 5INCB 3ESPA 2H6UA 3T0VA 3CFBA 3I9PA 4PRAB 1M1XA 3HS9A 3WY2A 1F00I 4PY8I 1I85A 2HVBA 4KO5A 4LPTA 4P2QA 2DOCA 4W4OC 5FM5O 4Y4FA 3TWYA 4ONOA 1LDSA 1F90H 5D7LA 2HLAB 4AJYV 3RDTD 2WNXA 2X44D 3C5ZB 5E8NB 5KANI 4PM1A 2XQ0A 5HHVH 2DBJA 4HXBL 2R83A 3JV6B 2MKWA 2V7HA 3LB6D 4E9QA 3TLRA 4S2SA 1VENA 1S7RB 1K5NB 4RMUA 1OGPA 1PPIA 3PPEA 1P5VB 3D69A 3RIKA 1PNDA 4PGEA 4QXUL 5CCHE 5F97E 1AYOA 4PUBL 4QXTB 2DQTL 1GGBL 3CSTA 4AE0A 1JG9A 2C9RA 2X1OA 2QBWA 4NDMA 4N0CD 2CBPA 1R5IA 4R3SB 3ZKXC 3HUJE 1Q1JL 1DQLL 1PCSA 2ARJQ 1FI8C 3NCMA 4OQTA 3AXLB 1OARL 2F5AL 1SXCA 1SM3L 5EU6E 4PJ8A 3V5KB 4O58L 1MIML 4BM7A 4H0HB 1X5KA 1AAJA 3ESOA 3ARFA 3QUXD 5IIEA 3KH4A 1KJ2A 3MX0B 2ZWSA 2CPUA 5C0NC 3MLPA 4NNYB 4AW7A 4F7EA 1J11A 2NYZA 4R9HA 2AXGA 2JJTC 3S5LG 1B0GA 3KS0H 3VQ2C 4NUMA 3GIZL 2GUYA 3GKWH 4HUNB 1BHGA 2BSED 3EHBD 2R1WB 5GS1C 2OW6A 4WHTA 3DX6A 2BNQD 2XFXA 3QZOA 3FB7B 3JTBA 4LCCB 1SYVB 4P3WA 1AXSA 5AW5B 4YSTA 5F44A 1U4EA 5J1AA 2VITA 1PIFA 4YPGB 2K7PA 5IJVB 1ZT4A 1BLIA 2OMVA 3U48A 4LMQE 2C7FA 4N8UA 5L8JB 1NA8A 2G5BA 2MQCA 4IM8A 4J6IA 2EKJA 4JFHD 4ZZFA 2IVFC 3HFMH 4K3JH 3BP6B 4U1GB 1A4CA 1I1YB 4NRXA 4GSDH 1A6VL 3K8MA 4UOW0 4EN3A 4LRNL 1USZA 2Y7LA 3N3EA 2VJ8A 2X9XA 4I18A 3IGKA 2NNCA 3IXTB 5F8RC 2ATAA 2WSKA 4HWEH 1OGAB 5IVXB 2JJSA 3EJUA 3LQMA 2IAND 2X0VA 4S1QL 5GHWL 3H8NA 1WC7B 3P0YL 4HV8B 3AU1B 4NRZB 1CD9B 1Z5LB 2EEAA 2PF6A 4HAFA 5DXWA 5I5JA 4OFYA 2DYSB 3GB7B 3I6KB 4M5SA 2RH0A 2VDOH 3VGAC 4DGIL 4DT2A 1MVUA 2LU5A 5CLZA 5B3SB 1FP5A 1KYOK 5KYWA 1P4IH 1NGWB 2LFGA 3QULA 1IGIL 4JO5A 1EDHA 4XBEL 3VXSA 5LXVA 4P4KD 2IH1B 2R9HD 4KFMA 4KDVA 1TO4A 5AG9A 1KMGA 2VLLA 1FZMA 5ALBH 4AH2A 3KJ6L 3MRJA 2OL3L 1KB9J 2K6YA 4E9YA 3RFRA 1SJHB 1PCXA 3CVBA 3QRFM 1JHLH 4ODVL 4Q6IA 4WK2B 3M1CA 3IDJA 1DJHA 1KOAA 4XXWC 4N2LA 5IMOA 1N67A 1HILA 3MRMB 1Q9LA 2YMTA 4JFFB 3VU2A 1LJMA 2PR4H 1UZ8B 2PCXA 3CZEA 2D3JA 3T2NL 2O6FA 1E2ZA 2ITCB 2GVYA 2W60A 4FTVA 5ACZB 5DD6A 3BSZA 1Z2KA 3UEQA 1IFHL 4I4WA 3WO4C 3QNYA 4NZTH 1IGYA 4DFHA 3GKZA 4FHKA 5ID1B 2YK1L 4A6YB 3I9AA 5FM4A 4JZJA 3ZKXB 4NN5C 5CS7A 2EECA 4F15C 4UI2A 2GKIA 1JFQH 2OYPA 2W07A 2O4EA 5ESQB 4YQXL 1ET5A 2X3CA 2P8LB 4D8PB 3PIQB 2IQ9L 1J8HE 4AJ0A 5B3JF 1SJEB 3BPLB 5D7IB 1S5IL 5E8DL 2YRZA 1GMIA 1YVLA 4PJFB 5JPMA 5HHNB 3RL1B 5CSBA 1JHKH 1MUJB 1TITA 2BVTA 5IB2B 3PDOA 4M6AA 5TD4A 4IOIB 5I8CA 3TJHC 1TVDA 1HNGA 3FFCA 4LRIA 5HDBE 1G7IA 2FB4H 3LRHA 4NN6C 5HYQB 5KYYA 3TCXA 5CN1A 3VCLB 1ANUA 4WW2F 1ZHLB 1MAMH 3OAUL 3WTXA 4MMXC 4KJWD 3QI9C 3MNMA 4UV7H 5JOFA 1B0WA 5GGSA 3O6FC 1HVXA 1QSED 3EYOA 2OP4H 1XZ0B 4HIPA 4HU2A 2AQ2A 3IGUA 1JYWA 3H7BA 1RKRA 1FGVL 2V2TB 1BCIA 4YHNA 3CXFA 2DWDB 2EVGA 3HHSB 2CMRL 1E9PB 3CZLA 4RDBA 3QJZA 3ASWA 3TWCL 1RZJL 1NFDB 5HHOE 1CN4A 2AJXH 4ZI8A 4M61A 1YEIL 5FM8A 3AMKA 3VRLF 4AKQA 1WAAE 4JDTL 1ICTA 1QQDB 3QS3A 4OW6A 3VGAB 1J1OL 4BEIA 1IKFH 1S7VB 1QFWH 4XP9L 3ATFA 2X4QA 4YAQB 2NY2D 4D9LL 2FJGB 2QVKA 3DYMA 4G82A 1IEBB 2NSQA 1N4XL 5DFVD 2NX5E 1S78C 4N2FA 1SXBA 2KI6A 3MV7A 4F57L 3IGAA 3P9MA 1TU2A 3N55A 1C12B 4M8QA 5T1LA 5B7FA 3EO9L 4LAJH 4ORZC 2IBZY 4PJIE 4NQSA 2OX5B 3W37A 1YY9D 2P80D 2GTZA 3OKLA 4XPGL 5E5MB 1M7DB 5HGAA 3DBXA 4I9WE 3BWUC 3ZTJG 2R51A 4HK0A 1SMOA 2WTRA 4NBYB 1T21A 1ODAA 5DK0A 2YA0A 4G1EA 4GI8A 1OSYA 4NN5B 5KJRL 3WJLC 4F15B 2WUCL 4B6ZA 1E7UA 1VGEH 2VL4A 4MNHA 3ROLB 1HYSD 1MG3C 1QO3B 1E0OB 4LKXB 4YBLB 5EU4B 4LPXA 4XC3L 3GLZA 4YOKA 3ASOB 4PWFA 2JTDA 2D3VA 4B9IA 3WTYA 2E59A 2KZ1B 4X0KA 1N3NA 4ZFFB 3ZKQD 2ADJA 4A2DA 4BE6A 2GTWA 4QRQB 3SDCC 1BQRA 2ZYHA 4OT1L 5D1ZI 1A5FH 4Q97A 3HZYA 2QSTA 1XGQB 4HOZA 4GI6A 3ULAB 3WSQL 2MRYA 5DHVA 3LVEA 4KO6A 5BV7C 6PAZA 1REIA 5JHMA 4NN6B 3WTTA 3RJOA 1CLZH 1DJWA 2YGNA 2DYPD 2BY1A 2WZPA 3ETBJ