5DC2A

X-ray crystal structure of a enzymatically degraded biapenem-adduct of l,d-transpeptidase 2 from mycobacterium tuberculosis
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
352
structure length
352
Chain Sequence
DLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRPVAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L,D-transpeptidase 2
publication title Structural insight into the inactivation of Mycobacterium tuberculosis non-classical transpeptidase LdtMt2 by biapenem and tebipenem.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Transferase
total genus 88
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.3.2.-:
pdb deposition date 2015-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
A PF17964 Big_10 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 5dc2A03
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dc2A02
3VYNA 4QRBA 5K69A 3VYOA 4LZHA 4QR7A 5DZPA 4LPQA 4A1KA 5E1GA 3ZG4A 4A1JA 5DUJA 4JMXA 4GSQA 3U1PA 4A1IA 4HUCA 4JMNA 4GSRA 4QTFA 5E5LA 3ZGPA 4GSUA 5E1IA 5DCCA 5DU7A 5DZJA 5E51A 5LB1A 3VAEA 3ZQDA 4HU2A 4ZFQA 3U1QA 4K73A 5LBGA 3TURA 3VYPA 4Z7AA 5D7HA 1ZATA 4XVOA 5DVPA 1Y7MA 4A52A 3TX4A 4QRAA 2MTZA 5DC2A 2HKLA
chains in the Genus database with same CATH superfamily
2FQDA 2QJDA 3QR2A 2GC4C 3G5VA 4YFEA 2ZAGA 5TE7H 5I1AB 4C47A 4MX7B 3SCMC 2HA1A 1FH5H 1ZT1A 4N5ED 4Y1SA 3TWCL 4KTEL 5I8OH 1FO0A 3E7JA 3TBWB 1RIVH 1NCNA 1FORL 5KYXA 1Z6JT 4X4MA 3GIVA 3MLRL 1D2PA 3OJDB 1Z5HA 1UOVA 3HRZC 4JLRA 2YC1B 1L3WA 3SPIA 2G3ZA 3CVCA 3ARUA 3WDIA 1Q9LB 1IFHL 4KI5C 4G59C 2O5ZL 1NC2D 1F5WA 2B1AH 3APDA 3I75A 2BSTB 1EAJA 4UZSA 3U9UA 2QVFB 5CIPA 5IMKB 1A7QL 4PI0A 4I77H 1EDHA 3PIQA 2V33A 4LSDA 4WUUB 2D3JA 4PJDE 4QDGA 2QPFA 4WZ9A 4XNAA 3GUTB 3VD0A 1UD2A 1MAML 3T2NL 3JV4B 2HZHA 4JLRB 4XMKL 3WNIA 4R26H 3X13B 4AY0A 2EE2A 4HJ1A 5BJTA 1D6EA 1D5RA 4GW1A 2XKUA 3I75B 5FFGA 4PB0L 4WKXA 2MOGA 4YEEA 4RNRA 3U9UB 1E5AA 2DQHL 2VAJA 5TDNA 1RIHH 1FCCA 2ZX7A 2H8PA 3A6BH 5I8KL 4B9IA 4BFOA 3SDXB 3QQXA 1U33A 3L5IA 3CCHB 5KVDE 1XT5A 2ZCKL 1IGJA 1ES0B 2G5BB 3HRZA 3VD7A 2HT4C 2Q76A 5CSZA 2Y5EA 4H4NA 1JNHB 3NCYS 2COQA 3FTYA 4WCYH 2VSDA 4MTMA 4L9LB 2JB5H 1DLFH 4EUPG 1YEKH 3GBLA 4QUOA 2NX5E 4DO5A 1HL8A 3QPKA 2W38A 4GNKB 3GM0A 1NWOA 4MVBD 4XNMB 3FO2B 1JMXA 4R83A 4A7UA 5F6IC 3S37X 1UCBH 2Q76B 3V4VA 2ROXA 5CSZB 3IGAA 3MLYH 4A6YH 5DA4A 3H9YA 1J1PH 3T8MA 3WS6C 3VH8B 3GSNL 5F44A 2FO1A 3NSJA 1XH3A 3IPFA 1A7BA 3U6XA 1X7QB 3GQFA 2FWUA 3DGGA 4GRWB 3IJEA 3MMEA 3L2LA 5ADOL 4KHTH 3TZVD 2QQQA 4RGMC 5ALCL 4ZPVB 4I2XE 1OE1A 4PRDB 1WFOA 1IM9A 2VAAB 3FZUD 2NT0A 3O3EA 4OZGE 2AP2A 5KVEH 3PGCB 4GKNB 4KKLC 5KBLA 3X3GL 4XOAA 5DHYA 1XGPA 4U6HA 4GH7B 2P7TA 3ARGB 1XF3A 5L9DL 2CGYA 3ARBC 4MRBA 1I8MA 1SHSA 3IJEB 4ADIA 4CUCA 2RIKA 4GG6A 3MLUH 1ITBB 1LHZA 1N3NB 3GSRA 4QRTA 2ENSA 2GYSA 1W0WB 2WXIA 4Q58C 4QRQA 5KUKA 4FFWC 2PYFB 4X80L 1UZ6E 4KFZC 3S36H 3UL4A 4EZJA 1EK3A 3J07A 2YAEA 4E2OA 5F70A 1T0NA 4JZOA 3ALXA 1XF3B 1FO0L 4Q2ZB 1I8MB 4J4PA 3JV6A 3LSOA 4N0UE 2COVD 4OLUL 1GW6A 2WO3B 5DTFA 1MFNA 1AQKL 1FI8C 1M7IA 4JFFB 5EDXA 5A43C 1AZZC 4B53A 1F1AA 1QZ1A 3UPCA 1FFOB 4LVEA 2RQEA 2ZWSA 1OLLA 3KVQA 4JZOB 2YD0A 2AQ3A 4HG4J 1KJVB 2J6WA 3SPVA 2XG5A 5IP4A 2FX8L 3ARBA 2E76C 2VDLH 3O3DB 3ABZA 2OA9A 2ZPKH 3CBJB 4M6ML 3CFEA 3LD8C 4FDWA 1ECYA 1KTCA 3RX9A 1KIQA 4L29B 3ZQDA 1LQSR 3WSQH 4Q6YA 2MOVA 5DJ2B 2XQYG 3SN6N 1CFBA 3HJ0A 2VMEA 2XWBB 1ZS8A 2R39A 2XTJC 4X8GA 3C2AL 4BH8B 3UG4A 2ZF9A 3RNQA 3BRDA 1B0WA 1E4JA 5K9JL 4UDUA 2HPOA 3EOBA 3LN4A 4L2YA 5BS0A 5HYQA 2HFEA 3BXNB 3CZUB 1BMZA 3LQZB 3C5ZC 2CUAA 2R1XB 4BWTA 3O0RL 1I8AA 2WK2A 4FN0A 3SYQA 3EZJB 1ZA3B 4AENB 1OZTG 3VXUE 3JUZA 2AK4E 1SLUA 2DJMA 3GD1C 3KMDA 4APQD 1UZGA 3DECA 2EKJA 2WZPD 3BZ5A 4XO9A 3VH8G 5EU4A 3V4VL 5MI0C 3KDPB 4HIIB 4DOHE 3NCJH 4H88L 1DL7L 4PLJD 1WAAF 5MENE 2G3XA 4M5ZH 5C6TL 2E74C 3MNWB 4IBWA 1AR2A 2GI7A 2OZ4A 3QHFH 2FRGP 1KEGL 2E4TA 3SE3C 3L8QA 5HD8D 2I07B 3BGFB 3O4LD 4GEJA 5EV7A 5EU4B 3RVUD 1E5UI 1C12A 1J05A 1HH9B 3KLKA 4JO3L 2ZOTA 2RTTA 5DEGA 2HKAA 3TEXA 2H0FA 4LOUD 4M7LH 3SD5A 4PTUB 3CE1A 3V5HA 1A0QH 2F61A 4WFEE 5CKGA 4KNSA 1AZRA 2RFXA 3MRIA 3KCPA 3L4XA 5E1AA 4PJBF 3H3KA 4KMTL 3P2TA 5I73B 3ZDXB 3EYSH 5FEBA 2XSKA 1OOAA 5FM5M 5FGBA 4Z7UE 4WV1C 1MJ7H 3OHXB 1QFPA 2XQ0A 2PTUA 5CR1A 2C3XA 1GAFH 3LV3B 4PS4L 1XCWA 2OCCB 3HE6A 2CJ3A 3GB7A 3T2PA 4B96A 5AW7B 1NAKH 1UACL 3HN5A 3KS0H 5E1AB 1I9JL 1PDKA 1F2XK 4ONHA 2DPKA 2D7PA 2FSEA 1U8IA 2V9TA 3RWIA 2R8SH 1AC6A 3SE3A 1BSIA 3I9IA 5BOJA 2OAAA 3LEVL 1F00I 3AFLA 4EIGB 4HIJA 1IGYA 1ZV5A 3CLEH 4R9HA 1E6JL 3QXAA 1A1MA 3ZT6A 3GF8A 2WLZA 3WY1A 2NY1D 3PDGA 3HE6B 4D8PB 1XD1A 4JO2L 2OK0H 2OR9H 3JV0A 2GPZA 4W4NA 3O2DH 4YHOH 3SSGA 3WKYA 3H3PH 2J88L 4AQAB 1G94A 1U30A 4EI5C 1CL7H 1WRFA 2IAAC 5T3ZL 2BWQA 3UTSA 1F4WH 1A14H 1KIUA 3FU5A 3K8MA 1TJMA 5I28A 1A1MB 1AZNA 5C0EB 1SOSA 4PWGA 1HL9A 3NYKA 1EQWA 1XSKA 1D5IL 5GIRA 1DUYB 1Q9OB 1M05B 3N42F 3O11A 4LNRA 4UCFA 4BKSC 2GSGA 2KKQA 4CVXB 4HG4K 1DSFL 4V1DD 1IM3D 4YHZH 3TIDA 4BSWA 2KZBA 4NNXB 1MFDH 1BZEA 1I85C 5CCKH 2VERA 3ESPA 3L9YA 4Z7IA 4YJZL 1W9XA 2W60A 3HG1A 4GAGH 4WWKA 3EH4B 5FA4A 2BRRH 1TJGH 4N1CA 2Y25A 5IBLD 4XHJD 2CBMA 1FWXA 2CRYA 1YPZE 1G7LA 1PW3A 5ILTH 4E41E 4AM0A 3EJUA 4O02A 2AEPH 5EHFA 5KYUB 2K6ZA 5TK4A 1E3FA 3HB3B 3ZUCA 3JYCA 3GSWA 4IRJB 2VLJB 3CHPA 4RLDA 2BVEA 2BIQA 4L3EA 1OANA 5F7LB 3GJFH 4FP8H 2N01B 1NIEA 5EA0L 3ME0A 3ULUC 2WB7A 3NA9L 4NQEA 3V6FA 4Z7OE 1KACB 2BIPA 3ILPA 4PJAA 2E7CA 4AM0B 1S7WA 4O02B 4HX1B 2ADJB 2FBJH 3VXOB 3FQWB 3ULAB 3EO1A 3HOGA 2OZ4L 3E6HA 4MB4A 5CEYB 1NZRA 1JJUA 2GJRA 4TNFA 1KV3A 1FSKC 4IRSC 1JDDA 2ZUUA 3KXFB 3IJHA 3ME0B 3MV7D 1QWNA 4IBVA 4BFRA 2X4TA 5BUAA 3QYCA 4GMSL 3ILPB 4BK5A 3AG4B 2WCGA 1WCBA 3DROA 3EO1B 4I0PA 2Q8AH 2NNAA 1E4XL 3E6HB 3ESMA 4FCAA 4OFKA 4PTTB 4WUKL 5ETUA 5AYUL 3Q1SH 1JF6A 1OTSD 2X3BA 1QO3B 5IEKA 3ZKSD 4JG0L 2LE9A 2NY6C 1C5CH 3P30H 3GMOB 2XN0A 3T6QC 3UYRH 3R4RA 5L88L 2X4TB 3D4YA 1QYGL 2J5LB 3ESNA 1QWHA 1EANA 5HYSB 1AGCA 1M6UA 1CQYA 1P5VA 4FXGC 1A6AB 1WCBB 4DPBX 5KOMC 1BZDA 3NIDB 3KHOA 3TO4A 2EH8H 3RZCD 1MNUH 4L8BB 3RAJH 1XCQB 4YC2B 4N2NA 3EGDB 5IEKB 1A3RH 1BOYA 1R1CA 2X4NB 4YDJB 3NT0A 4GQ9H 3SOBL 4JANB 2PCFB 1KGWA 1RZ8A 3MNVB 5T1JA 4XP5L 5F0PB 5HYJB 2YGPA 2ZSVB 1BVLB 3GBNL 4R84A 3MZTA 1OSYA 3J27A 1UXSB 5SX5K 1N8ZB 2XV0A 1QVOB 2P43B 3TO4B 4HAGA 4XR8C 1T7ZA 1HYSD 4YNYA 2ALWA 1SVZA 1GJWA 1QATA 3CFTA 3SIKA 5HI4D 4LGPB 5KG9B 4RA0C 2JTYA 5KW9H 1AD9A 1CK0L 4Z1PA 3FFCE 2YSSB 4RAVA 3RKDC 3BAIA 1QSVA 2FO4B 2Z64C 3KL5A 1CJYA 4I88A 4ABQA 1FG9C 3BKCL 2NOYA 1B4LA 4YNYB 1JGLH 1FL5A 2UWEB 2OMZA 3AUVA 4CSZA 1TCMA 5JQIB 2WQVA 2X1WL 1FRGL 3U48A 3U2JA 3B8YA 1CL7I 2A9DA 2AQ2A 3U36A 1XH1A 2R0LL 4UTAH 3HAEB 5D1XE 3U0PA 4S2SA 4PJHB 4UQBA 4KZEL 3BYTA 4RMRA 4XCFH 2DDQL 4O02L 2P45B 5HHOD 4ODHL 3GIZH 2OPCA 3QQ4B 1Q0XH 4PGZA 3VD1A 2BIOA 5I75C 3ALPA 3QZNA 1KG0B 2K0RA 4NN5B 4NKOB 2O6EA 5TPWH 3BPNB 3NQIA 3KEDA 3WO4B 4IBLT 4GO6B 3U0PB 3A47A 3OAUL 2ZWKA 2XKSA 2OL3H 3O6LH 4JFDA 5JO5B 2PWFA 4KO5A 1MFAH 3MRHA 3ELAT 3BO8B 2HRLA 1Y1UA 1WIOA 3N50A 2R29H 2P5WA 2ZX6A 3CXDL 4G7YH 1DBKH 4BFFA 5EU6E 3IMSA 4XCYB 2K78A 3OJMB 5D7LB 4MXWH 2G9HB 1EEZB 2UV3A 2VUKA 3GMNA 4XI5C 4GRLC 4X6DA 3DHJA 4LASL 4IBTA 2NYKA 3LEYL 4ONFH 3ZE0B 2IOMA 1QQDB 3R1GL 3K6NA 3P11L 5DJCA 5CGBA 3VI4F 1S3KL 4OJDH 2GK0A 2NQDA 3Q8FA 4OB5H 5E7BA 3FB6A 1C7SA 2J56A 3IJ7A 4U1LB 1AE6H 1OPGH 5HYSG 4U3HA 1IAMA 4FTVE 3RUGA 3I50H 5FYJD 4ERSL 1DBMH 1H8LA 1F4YH 3LQAC 4X6FB 3RHWF 4DKEH 3ULVD 3M46A 4QY8A 2DI7A 1ZIAA 4L2LA 4NSKB 5CWSA 4KXCA 4QF1A 1CDJA 4D0BA 4G3YH 4BV1A 3L3IB 1O6TA 2RGSA 4M03A 5CCHE 3TLRA 1DJXA 4MVBC 1HCYA 2CO6A 1KDIA 2OXGA 2Y24A 3D7PA 3KWVA 3CZLA 4W4OC 5IBUB 3RPKA 4PRBA 2DLFL 4Z7VB 3NPSB 4DKFL 4HMDA 2Q7NA 4LESA 3NABL 1RUQH 2APTA 4XVOA 4GRLA 5L8LB 4GUOA 3G08A 1OM3H 3WMSA 1WC7A 5A2CA 1JRHL 3H2WA 4NC1E 2NMSA 4OZIB 3D3VA 3F01A 4EDWH 3RY5A 4Z76B 5JOPE 1J5HA 4PJ5A 3MRJB 2OM5A 3KPMA 5E5RB 4C56D 4TTGA 2ETWA 4PJDF 4Y19B 3RY6C 3R18A 4FQQA 2F8XC 4OR1A 2GFBB 2AQRA 5JW3H 2BCMA 4PRPE 3FBKA 3WY2A 2OP4L 2GT9A 4N9GA 4F91B 4P23D 4G2AA 1CI5A 1P7HL 1DBAL 3I3EA 3X2QB 4IIQB 4K5MA 4XPHH 4AC2A 4PJ5B 1PZ3A 4AYGA 3SKOA 5CLZA 1DVFB 1BJMA 1U58B 1IL1B 1FLRH 1YN7A 2CAKA 3BDBA 4G8EA 5F9OL 1AXTH 2IDSA 4HHGA 3X1BA 4HXBH 1ZHBA 3HAEG 5EN2B 5EO1A 4AUYA 1GZQA 4TRPL 5CEZE 1TSHA 4W9DC 3WN6A 5GGQL 5T1MB 1KLUA 2GT9B 4HLZG 4N9GB 4A38A 2X09A 4UOW0 4I8DA 2AAAA 4YUEH 4D9LH 2CZNA 3H54A 4ZUVA 4ZXBA 4GBXA 3MBXH 4ZS6D 4PREB 1WCQA 4PQXA 1YN7B 1PIGA 1FGVL 2ZWZA 5DVPA 1ZHBB 4GW4B 5EEXA 3AB0C 2ZKYA 3QORD 4UIMB 5EZOH 1CTMA 1LDSA 2H26A 2Z0BA 3BVXA 5K93A 2BRQA 4PHXA 4ZUWB 1JF1A 4Q9QL 4R2GC 2R2BA 5E8DH 1JDCA 4J2QA 2CDFB 1K8DB 1BZ9B 4GBXB 2NXYD 2AABL 3MX0A 3S3CB 1XF4A 4YHKH 1OWWA 1P4LB 4XMLL 5DVLA 4Q9BA 4XBEL 4XNYL 5E9DB 4BCXA 1IEAA 4CL7A 3WJLA 3V95A 2CLRA 1U41A 3D52A 2DQFB 4ZMLA 1MF2L 4IHOA 4LVNB 4WFGD 4OZGF 1KGIA 1JF1B 1AIZA 4MQTB 2R2BB 4XBPA 4Y4KA 3T4AA 2E9JA 2WUBL 1MCHA 3VI3E 3OPZH 5BVPL 3AREA 2OQJB 3QDMA 4I5BA 2P1YA 3MX0B 4NB7A 1J9SA 3TL5A 2OJZL 3V7AE 3OR7B 4A1KA 4J7RA 1JDAA 5I74B 4G6JL 5IQ7H 1S8DB 5F3BB 4TNEA 5J3HD 2XZQH 1YYLH 2CLRB 3PGDB 2VL5B 4K3DH 5I30L 3MRLA 4MNGE 1A4AA 4U6VH 2PN5A 4JKNA 4K73A 3OKMA 4P4KA 4WHYH 1J8KA 3QIWC 4UINH 2Q20A 4JQVC 1UZ6F 1Z9OA 3AREB 3CX5J 4LOVA 4ZFZA 1I7ZB 2YIHA 2FX9H 1R5IB 3EJYD 3HI5L 4JQXC 2CHDA 5IBUG 3L4YA 4AK2A 2XX1A 4HS8H 3EO0B 3VYNA 4APQC 3EJZD 2J72A 3S37H 2D7QA 4JDTL 5I30H 5GGVL 4I9WE 4L8DA 3SDDB 5DC0A 3SPCA 2XVGA 1WF5A 3BZ4B 1G7PB 2W94A 3TBSB 3H7LA 4N0CD 3IU3A 3NJMA 1PKQB 1HZHH 3N06B 3HPJB 5AVXB 1BREA 2W81C 5IR1B 3FOMB 4JRYA 4AIZA 3G04A 1CU4H 5AOIA 3MJGX 2XTSA 2KLRA 2NUTA 3MSPA 3RL1B 1U0QA 4DP1X 1P7BA 4ES9A 4XXWA 3P4NA 1BVKA 1AGDB 3RVUC 5ELIA 2XZCH 1UA3A 3EDFA 4NQCE 4NZUH 4WUUD 3CN0A 3LQAL 1TNNA 3QIWA 5ENWA 5F1NB 4KY1H 1I9IL 1NGXA 4Q14A 5IFHL 1KJ2H 2V5RA 3DSFH 3PWUB 5I71C 2DY2A 1LVEA 2JJTC 5JA9A 3MXWH 1PQZB 5F1IA 1NEZA 3FQ4A 1SDDA 4G6MH 2XI9A 4KHXH 4UYQA 1I53A 4F5CE 3DIFA 2R23B 1YJDH 2ZCZA 5DJAA 4QNPF 4G80A 1BEXA 1JGEA 2IV9A 4XX1E 1T1YA 2DQTH 3QUYC 4L1DA 2E8ZA 3S7GA 3V5KB 1NGXB 4LXFA 4AXWB 3RQ3A 2FH8A 3KYNA 1OP5H 8FABA 1M1SA 2YUZA 3GSOB 4LLWA 1ZANH 5DDHA 3UDWA 3TGXA 2OX5B 5IB2A 1QSFB 2LFGA 2NDGA 5F1OB 5GZOC 1F11A 2BERA 4TNGA 5DZJA 2G4EA 4HJGB 1N7ML 4PWKA 3AMKA 1NKGA 3IM1A 5CILL 4YL4A 3RGVA 2EEXA 2R83A 4Q6IB 4Z3EA 4JHAH 2MPAH 3VDAA 2FATL 4EBQH 3O3BA 3ASNB 4OM1L 3T09A 3JYBA 3Q2CA 4X99B 3U9PH 1ED3A 2JJTA 1FNLA 3CWGA 2ARJQ 4F57L 3MBEC 5HPOA 3C8HA 5D55A 1A3QA 4X98B 1X4XA 3RGVB 1NCHA 3NCWA 1MFCL 1Y18B 1JERA 5IOPA 3QUYA 4JY6A 2VZSA 1NH6A 2FWSA 5T5FH 1A4JA 3CGTA 1NICA 1JYWA 1T20B 4PN6A 1LO4L 1R0AL 4U6YA 3IDNB 4PS8A 2LTQB 5GXBB 1JI2A 2PYEE 2CCLA 2B4CH 2H1PL 4U1HA 3T0EC 4M61B 4ISVA 3ARGD 3W39B 1FVCA 3TTYA 1GC1C 3TTSA 4LLYA 5C9KA 4N2AA 4Y88A 3O2VL 3OR6A 4ZO8A 1QP1A 1V3MA 3GRWH 1W8EA 5F7MC 1W72H 1ACYL 1JZHA 1TFPA 2X53A 4R7VA 2ENQA 2F5AL 4MA8L 4NEHB 2OJEB 4PGBB 2BWDA 4U1HB 4WI8A 2OMXB 4TL4A 5EEUA 3IMRA 3TJHD 4UQAA 1ROCA 2DICA 4V2BA 4LARH 1N70A 1IE4A 3IFPB 3WL9B 1WZKA 3ARDC 3W11C 4NHCH 3KWWA 2C9XA 3FU8A 3GMLB 1W0YT 3TCTA 4WRLA 3CZJA 5ABAA 1WA1X 3CX5K 3FQ1A 1YVLA 2Z0UA 3OLIA 4AMKL 2ATPA 5INCA 3AS3A 5D7KD 5DQJB 1JHLH 1TQBC 4JCLA 2ZWLT 2XNAA 2VH5L 4HJSA 4ZTOH 1LO5A 1Z0MA 2DM2A 2OTPA 5IQNA 4MJ2A 3T0EA 2VN7A 2BZDA 5F7FA 3QWRD 1AJ7H 4KI5E 5CFHA 5CJXA 2IPUK 3DRQA 3FCGA 5CF3A 1CGWA 4M7ZC 3E38A 5AVUB 4MQ7B 4XPGL 3NDZE 2HVJA 1N64H 1QUPA 3L1EA 4YBQC 3UP6A 4CU8A 1NIFA 5F7AA 4MXQC 3P0YH 4PV8B 2BP0A 3MRRA 3EYQC 3W9DA 1PD1A 1HSAB 3FQTA 3CBKB 2BZCA 1A6UL 1J9CT 2NY0B 3OKKA 3DRQB 5PCYA 4NNYB 1T6VN 1NFIB 3ARDA 4LSVL 3RX5A 5C07E 1X3DA 4MCZB 4ACTA 5T3ZD 2VZTA 1OAKL 1HJCA 3EJRA 4N2BA 3L2NA 2DD8H 5ECGA 5E56A 1COBA 2WQ8A 2YAFA 1S7VB 3GHBL 3VMPA 3ZYJA 4FC3E 3E8UH 1J1OH 1YPZF 1JFHA 1N9PA 35C8H 3MRRB 2EACA 3MRNB 1HILB 4WFHD 3GJFB 1RHHB 2P8MB 2FJGA 2JH2A 1ASQA 1OT4A 4M6NH 4XCEA 4KU1A 3PWLB 4UMSA 3OGCB 2TAAA 4YE0A 5F93C 4CGTA 2YEZA 2PR4H 5E2UH 5D6CA 4NENB 2QLVB 4W6YB 1DP0A 4JFEE 2WBJB 2BX5A 4HHAA 3M17B 4J6RL 4UOZA 3BSZL 3FU7A 1A8JH 3ZLQC 2VXSL 4JFUA 4NKIL 5BUPA 3WFBH 1SJHB 2L7QA 4PW4A 4Z7OF 4G1MB 4V11A 1HYSC 2BO0A 2ADIA 3MJ7A 4O9HH 3V55A 2ZQKA 4KO6A 1BQKA 4N2LA 1EH9A 4I18A 5AFAA 3GPEA 4NZFA 5E2VL 3S5LA 1XF2A 2YEZB 5D6CB 3DUUA 3IF1A 3CSFA 4N22A 3TT3H 4TUOA 5EEYA 4G6KH 1RERA 3BH9A 3NFPA 3P4MB 4NXKA 4XE0A 4ANXA 3FU7B 2ZICA 3ARTA 4N0FB 4ACPA 3QHZL 1KIRA 1WIPA 3ZTDC 4O5LL 4WF7A 4FERA 1S7TA 2FCBA 2G0KA 1SMAA 4ELMA 2OTUA 3ZGHA 1K5NB 4MCYA 4XOCA 2UUDH 4OVUA 3GI8L 4DEPB 3NCBB 5DFVD 3VQ1C 3SPHA 3B7YA 1EJOH 4H8PA 1TVHB 2LAGB 3DUUB 3L6FB 2ZWNA 3JSSA 4TUOB 3WN5B 3BH9B 5JDJA 1UQSA 2FQEA 1YG9A 4NWTL 1ADQH 2N7SA 4DZBA 1XWVA 3ISRA 4ANVA 1TEGA 1PNCA 2WZ5A 2EDYA 4K0OA 1I1AC 4JFQB 5D72L 1K2DA 1EEQA 2H41A 4NUJB 3SKJL 4PB9H 5K1JA 1RXLA 5C70A 1GJUA 3DX6B 3QG7H 3KAAA 4M5SA 5IHUL 5IWLC 2B2XH 4DP0X 1NCAH 5I0VA 1R34A 1C5BH 1UQSB 3NJLA 4HK0A 4MA1C 5CR8A 5E99H 2OS7A 2HKHH 5DJZB 3BP7A 2DYPB 2ARJA 4X5WA 4XMZA 5F89A 5B21A 4MMXB 3VB9A 3BAWA 3KPRA 4Y9EA 1N4XH 3NACH 3AS1A 1X5MA 4TVPD 4RWHA 3HE6D 4WEMB 2WVSA 3PE9A 4YBLB 4DTGH 5D1ZI 2I69A 3GUFA 4HK0B 1RZGB 4P04A 3P9WB 4HS3A 4OBRA 2V2WA 2P5EE 3CUPB 1FC2D 4FQXB 3DDGA 4P0DA 1BPLB 3T8XB 1JYNA 5KN5A 3BSHA 3VFPB 1BQLL 2Q2LA 2WXQA 4AWJC 2KHAA 3H0TB 4D9RE 3WXVH 2P9RA 2UY7B 2QZQA 4WGWB 4NC0B 5FV1L 1OD9A 2VDRH 4JHZA 5GHWH 3L48A 4NX0A 2V2TA 1KTDB 5AEAA 3RHWK 4ABUA 5DQ9A 5IWLA 1KJ3L 4YQXL 4HUMB 3ULVC 4AIXA 1JXKA 4R7LA 5F3HA 1UB6A 2IXQA 1Y1DA 4AYDC 1NBYB 3LHAA 2AGJH 5AOJA 5J1SC 3UTSD 4NCC1 2GJZA 2XTJE 4C4KO 3L7FA 2JKLA 4ADGA 2E4FA 3WTYA 1U8QB 2LAAA 1XFPA 4L0ZA 4Z77A 2DM7A 3DSNA 2DLGA 4DVRL 4PLKD 3WE6A 3GLAA 4A1RA 1E3ZA 5EZIL 4B9YA 3NDYE 5JNYA 3BAJA 3T2OA 1BG1A 4XMPL 1E8XA 5E5UB 4AZUA 5AKTA 1UM4H 3ZKND 4F7EB 1FL6B 3HB3D 3IK2A 4WKZA 3LKQA 1BCIA 2GJZB 2XWRA 4H5SB 1WK0A 4IRJD 4PIRF 2ZOLA 2VLJD 1D6VL 4DN3L 4TPRL 2DBLH 2PCYA 4MKMA 5E94A 3UO1L 4NGHL 1E5YA 5CO1A 3WHXB 3F65A 4DP8X 3EKCA 3AAZA 2EVGA 1FIGL 3LZFH 3WJMB 4XPFH 5TDOA 4NFBA 1JSYA 3QK0A 4LVHB 4POZD 7FABL 4NQVB 1N10A 2FX7L 3PG2A 3VFWB 4HH9B 5C86A 2ZOLB 4P23C 4PLOB 1YNTF 2DH2A 5TQ2H 3GI9L 3EYUH 5GS0H 1MG3C 3F7VA 3KYKH 1F86A 2ZNWA 2R2EA 3KXFD 4WU5A 1MZYA 3B2VL 1SPDA 1RZKH 3QGVA 4MB5A 1ZVSA 5K1VA 4AGMA 3K6DA 2MNWA 2YPVA 3GTTA 1FQ9C 2ESVA 4GUPB 3ZGPA 3W37A 4XO4A 1B4JL 1YN6A 4WJ5B 2F1BA 3NTCH 4JJOA 4NZTH 3F7VB 3QZWB 4PFEA 3S97C 1G9EA 4OLZL 2JQZA 4WU5B 3VSQA 3DTDA 1NOFA 1T2QH 3REWB 3PQYE 1WEJL 2ESVB 1BXXA 3LH8A 4OCSL 5C2UB 5ES4B 4GB9A 2JFCA 1BQHB 3EYVA 1T0MB 4N0YL 1E5ZA 3VFUA 2J6EA 5C2BL 1YN6B 4KK9C 4GS7C 2WNXA 4DZ8B 4AE0A 5D93B 3DXAB 1MAJA 1MWAH 3NCEB 1PG7X 1NLDL 1G1CA 1KCVL 1OGAA 1WISA 3RGHA 1Q0EA 5F7EL 2OBGA 4H26A 2HT3D 5TF1H 2W0FA 4F3FA 5JDSA 2N56A 3HG1E 4JE4B 2Y36L 3VXTA 1JV2A 4R7NB 3IB4A 1IBHA 5HYJD 4WEBL 1VRSA 1PU0A 4P5TA 1KYUA 4DGIH 2VXQH 1S7UA 3VSVA 3BWZA 3BZFA 5D1QC 1ORQB 5I17A 3W0WB 3TO4D 1RULH 1P2CB 4K3EH 3ZTNH 1K8IA 3P3RA 2YBRB 4ONOA 5FO7A 1OGAB 1CGVA 3F04A 3B9KB 3MRDB 4KUCD 2H32H 1OAQL 2GJ6A 3MROB 5JDSB 5A7BA 2FB4H 3BGAA 4TL5A 3VXTB 3IDGB 2ZYRA 4L3EE 3SKNA 5LXVA 5J1TC 4MZIA 2ICEB 2QGDA 1AR1C 3L1OH 4GQRA 5HY9A 3NSDA 4UIKH 1R19A 4X6CB 3F7KA 4POYA 1HC1A 2NY7H 1S5HA 4NQEE 1IGTA 3DO7A 4FQJH 4YLQT 1RK1B 3ATAA 2H47C 1BP3B 3EJYC 5DXWA 2O93L 3EJZC 4X5XA 5IFAH 3HN3A 4N1HB 3SKNB 4AL8H 4Z7WB 3KEHA 5DGRA 3DX7A 2BSSB 2HX9A 4GSRA 1B0GB 1CICB 3DJZA 4RIRB 1I7UA 5JYLA 3HUJB 4X83A 3TCLB 5IG7B 2YZ8A 1ZCRA 3RWDB 3TA3A 2VCOA 3DO7B 3SJVE 3SO3B 3TVMB 1GS7A 4MAUL 4N0CC 2X89D 3MRCB 1WS7A 1NFDE 1HVXA 2BOCB 3GMQB 3FOLA 4AT6A 3WKMH 3ARSA 3W2DL 2VL4A 1JGUL 3MGTA 1MRDL 2L3BA 2Y7MA 5LGHH 3ULUE 4TSAH 2VR8A 3X17A 4F7MA 1KCKA 1UG9A 3CC5A 1HU8A 1MIEL 5JHDA 2BY1A 4L1HA 2UXGA 3FT0A 3N40P 1WSST 3DVFA 3Q2WA 2BVOB 3QH3A 1BJ1J 3QYMA 1HKLL 4WIQA 3UH8A 5D7LD 2YGOA 5BZZA 1M2VB 1SJEB 5IMLA 3FT4B 3LH2H 2N0KA 1FZOA 3G6JB 5T1KA 3F7YB 2LU5A 2YPVL 1CZ8H 3FQNA 3OF6A 4LLDB 5JW4R 3QZWG 2V17H 5FO9B 2XJLA 2D2CC 1NGZB 2QGCA 2LFEA 3O3AB 1IV8A 4E9RA 1XMEB 4R90H 5FHBL 2FD6H 4B7IA 4DETA 3BWAA 3QXTA 1B0RA 3V52L 2QKSA 3KBPA 5IEHB 3LPOA 4XC1H 3UROR 5IMLB 4X6EB 1BQHG 1UA6H 4MHHI 5F8RC 3X14B 2WLHA 4G8FA 1SHXA 4P46C 3WTVA 1Q8MA 1WUNT 4L9LC 3LXUX 5HI3D 2PP7A 3IJ9A 4FF9A 4KDVA 4K3HA 4L48A 4DGWC 3X11B 2X5PA 4BQBA 2J6EL 4FS0A 2F15A 4PJFE 1NPUA 4L4TE 1XR9A 3OXSA 4PJEE 2AJYL 2OSLB 1CB4A 3CNKA 2KQMA 2UY6A 1L5GB 1SYVA 1UXWA 1VZHA 3QUMH 2AJXL 3US0A 2IGFL 2YPLA 3FF7A 4PUBL 5JXED 1RAMA 3D39E 2OJ1A 3D33A 4PAZA 1GRWA 3B7SA 3UG5A 4QRFA 2BSRB 3N41F 5FUZL 4DKTA 3DBXB 2B59A 1XR9B 4Y19D 3WEXA 4UQCA 3DYPA 2WXNA 4JQIH 2AI0L 3B2UC 3U30B 3P0VL 4MJIE 1T7WA 4R4FL 4DN4H 3WJJC 1CXKA 3K4AA 2HJKB 1FZMB 1SYVB 5GJTH 5J57B 1XXFC 2XPGB 2C3GA 3N0PB 1QSEA 1BYOA 4FI6A 3L3DB 4P46A 3ARGC 1ACZA 3QEQE 4U1GB 4E9QA 3BQVA 3FUDA 1TTBA 4PJ5D 2F7QA 1B88A 5IMMB 1DVFD 4JFDE 2Z7YA 1ERNA 2WP3T 5FCSH 1PY9A 1TU2A 5IQ9A 9CGTA 4B3EA 2EZ0D 4AV4A 1TF4A 2OFQA 3AQDA 3EADA 4HOXA 5IVXB 2FEEI 1F8TL 1RZPA 1HN1A 4Q4EA 3HE7C 3RFZA 4KVNL 3OZ9H 1JWUB 2KQNA 3BZDA 1YQVH 2D2OA 3TJHC 4BFBD 1ZJAA 3Q6FA 5EU5B 1YEIH 3WLBB 1J5CA 2KERA 4JDEA 4AV5A 3L4TA 4UV4L 5IBTH 5TH2A 3AXLB 4OD3H 2WBKA 4LHUA 2Y0SA 4R4BB 1AACA 1JZ2A 3RFZB 2NXZC 4NO0B 5TJWK 1Q0YH 1XGYH 2O5YL 2OSWA 4H20H 1AQDA 4F2MA 1TZHA 4OQTH 2XWEA 4FXKC 4GBXD 3LKRA 4RWYH 4JFXA 3FHEA 2VO5A 3FN9A 5DR5H 2UXVA 2BY2A 2G2RA 4F80A 2I26N 1QNZL 2WLLB 5E9DD 4HULB 1T89C 5DRWB 1VFBA 3AZUA 4WHYG 4HBCH 3UIZA 1R3HB 1DEEA 2AJSL 1HZLA 5DF0A 1LP9B 1OB1A 3L5JA 2QDWA 4P2CG 1G6RB 2YFNA 4NO5A 4BZ2H 3I6GB 3L2MA 1BYPA 2PPAA 1HL4A 1RUML 1ADWA 1T7YA 2FH6A 4O2CA 3KL3A 4OFQA 2RA1A 2ICCA 3ZPDA 1F3RB 1D5ZA 4HJEA 3ECWA 4E0RA 1TOXA 4FYRA 1VFBB 2J8UE 3D69B 3PWJB 3RDTC 2EDWA 4O2FB 4BFIB 2E59A 4UT9A 5C0BB 4HA1A 4Y4KD 1BLIA 2VM4A 5E70A 4RMQA 3WY3A 3ARED 1OCRB 2BC4B 2DWSA 4O2CB 4AEIH 5ALBH 1ILSA 2VB5A 2PTTA 2F08A 3FUIA 1WWWX 1C1EL 1DFBL 1JHKH 1MRFH 4MA7L 3IE4A 2FL5A 4WFFE 3R7RA 5I16A 4WJKB 4A7SA 3FPXA 4OLXL 1Z2KA 4NQSB 4U3SB 5GJSL 1TZGH 3D4ZA 1T89A 1FYTE 4LLVA 5A2FA 1QRNB 1PEZA 1ZGLM 43CAB 1F6LL 3QP3A 5DZVA 3SDDD 5DC4B 4WW1B 4DUXA 3IFNL 3OAWA 5AVQB 4WI6A 1P5UC 5HHQB 2DMCA 3EBAA 1ETJA 1H3PL 2EDEA 4QO1A 2WKOF 4IDJL 3QC6X 3ROLA 2FL5B 1BW8A 5DJ8B 1KN4H 4G5ZL 2HH0L 4KI5F 3UXFA 3BDYL 1A6VL 3QCUL 2WYZA 3P0GB 5CJOL 3RDTA 4OZFH 1G7JB 2IQAB 1A9BB 4EVNA 4PJIB 3A3YB 4ELKA 1JZ7A 2PCPA 1QABA 4S11A 5A2JH 3QQ9D 3U7WH 3ESVF 2NYZA 1INDL 3MBWB 1HHIB 1YEGL 4DPCX 4WHTA 1KYDA 3HHMA 2K70A 4KUZH 4G42A 3IJSB 3IAGC 2EABA 5DUJA 3OHXC 3FTSA 5K9KB 5D96B 2CHNA 1VZIA 5GS2H 4ELKB 5DJ6B 5J8OA 4OUOA 4JM2C 2NNCA 4LF3A 4LPXA 5E95B 2A83A 2AJVL 3T4YA 2A5UA 4LP4A 3ABKB 1QSFD 4HIQA 2YGQA 3UZQA 4LAQH 4E5XB 5DJXA 2FQFA 1MCWM 4F15B 5HGBA 3APCA 4ATTA 3IRPX 1P4UA 2ZXDA 2VLKB 4GAJH 4A63A 4OV5B 1NGYA 1KXTA 3S35L 3SDAC 3AC0A 2CHXA 2YN3A 3H42H 1F3JA 2A83B 3QVAA 5I6MA 1G6RL 1EGJH 3H1ZA 4HUXB 3EF4A 5DHXB 1R5VB 1LE5B 3IGFA 3SQBA 3LKPB 2JJVA 5J1AA 5EORL 3I6LE 5IB5A 2HJFA 3BZEA 5ANMA 4BUQA 4C58B 1V3KA 3FH7A 3ZTEA 3GXNA 2A4CA 3ZL2A 3V79C 4OAWA 1ML0A 4OV6F 2DIJA 2WUCL 3P73A 3RGVD 1W0VB 1XCXA 2Z92B 1QTYT 3LMJH 3QSKB 3SDCA 3T0VA 5EFIA 1Y6NR 1XZ0A 2IH1B 3FQXB 4YK4B 4XMUA 2RB8A 3RI5F 2QQKL 4Y4HA 4AQOA 3O2WH 3QNZA 5CFAA 1ULVA 2HJFB 4E9LA 4XCCL 1MY7A 3ZIYA 4DQOL 4OAWB 4KJYA 3BFWA 5CZVH 4JRYE 4PLKC 1S9KC 5KSBF 2EAEA 4FG4A 4UT9L 4YDVB 3EOYG 3G6DH 5L2KB 4CU7A 5KANI 1T04B 2BHUA 1H5BA 3L3KA 3ARXA 1K3ZA 3KG5A 1TR7A 1BIHA 4S0TD 2IV8A 2VZUA 3HB3C 1V8HA 3QNZB 4HK3N 5F88B 1T66C 3QIBA 3IWVA 1IQDA 1DQDH 4UF7C 3UCRA 4WW2C 4IRJC 4YSTA 1X5AA 4XP6L 2BNQE 2CK0H 3WTSA 1KJMA 4HKBB 4F58H 1Y07A 2W07A 3O8XC 4YDKL 3D51A 3UBXI 4BGLA 1XMWA 1YEHL 4H25A 1HL5A 1E30A 5C09E 1DVQA 2TRHA 4PJXE 2SEBB 1QI3A 1TZIB 3L3KB 4XN5A 1BVNT 1X6LA 1A6WL 3L4VA 4XP9L 5HYEA 3CZNA 4Y4FB 3P4OB 1RLWA 2L7UA 4OF8A 3UC0H 4Y5XA 4P99A 3ZU8A 1HZKA 1MN4A 5I6OA 2E7LC 5A2LH 4ZMXA 2ZXAA 2N3JA 2A7BA 1LO0H 2F9BT 3HFMH 5SWSB 3O4LE 4HFUH 3DKHA 2DI8A 5E4OA 5J06A 2IGLA 2E27L 3I9GL 4NRXA 2BJML 2PXYA 2FAUA 1J5OL 1JTTA 1VEPA 1G43A 3MJWA 5CCGE 1PZUB 2KZWA 2X4OB 4QOKA 3BVUA 5AAWA 3C8KA 3TFKC 5DMKA 1F2QA 1KYOJ 3QJZA 4Y5XB 3W1ZA 4M62L 1V27A 2NY0D 4UI2A 1YEFL 5J6GB 4UAOC 3O8XA 4U31A 3GS4A 5DS8A 4R97C 5E24E 4J8QA 4Y2OB 1Y0LB 5EUOE 3CDZB 5DGQA 25C8L 2N1TE 1KGCE 1VB9A 2PXYB 4P2OC 3WFCH 4E5XG 3VWKA 5LXGH 2V8MA 4OCRH 4O58H 5IVOA 5EU3A 1FBIL 3KPSA 4PRIB 1A4KA 2VZ1A 4AYID 5DMKB 4HUVB 1OAUH 4YC2C 4K8RL 3WDHA 1MEXL 1KZYA 3HLAA 5L7XH 4L1SA 4YXLH 5DZNA 5AZ2H 3PXHA 4J3OC 5ESQA 4Q9RL 2E7LA 1MHHB 3W5MA 4JKMA 5GRWA 2XFXA 3WGUB 5BZDA 2WQWA 3F6IA 1OF2A 1RURH 2WBJD 2YZ1A 5DFWH 1AD0A 4JG9A 5DQDL 1O5DT 3EBHA 2J4WH 4UUJA 1F0LA 1A4KB 4HFWB 1P1ZA 1T5KA 4UDTB 3IN0A 3HNTL 2WXGA 3HLAB 4YMPA 1WBYB 2HLAA 3KYOB 4FZEH 4F7TB 3DUSA 5EOCH 5ESQB 2YSTA 5DZOA 4H8WL 4TV3A 2YXFA 4FJYA 5JPNB 2E86A 2Q6WB 1AQMA 1F41A 1SOQA 4XRCA 3I6SA 4FQLL 1AD0B 2A2QT 5L8KB 4YXKH 2AW2A 4UUJB 3SE9H 3CMOL 3EYFB 4P2OA 1SEQL 1HEJC 5L2JB 1IGMH 1P1ZB 3OSKA 2AITA 1U9KA 3N6YA 5I1HH 3RE0A 1CWVA 1DQKA 4EI6B 3D87B 1E40A 4IRZA 4YSAA 4DVBA 2EIZB 3GMPB 1YY9C 2VR4A 3IDXH 4M48H 3T0EE 3MRQA 5HP5A 5B1JA 1L7IH 4PJ9B 1JHTB 1LO3L 3CVIH 4K7PX 2B1HL 1CQKA 3BW9B 2B7DT 3GZOA 4XPAL 3FF8A 4ZSOE 2F58H 4M1CC 1IGCH 4K94L 1F18A 2NSMA 4WTQA 4XCNA 5DD6A 4JKPH 5AG9A 1A7OL 2CO7A 1HXMA 5AW4B 4ZX3A 3VXME 5T1LA 1LILA 2QELA 1G4MA 2D3NA 3WCYA 1DE4B 1CDBA 2CBQA 5GS3A 4X4YB 2AQ1A 4NQXA 4JJ5A 4FI7A 3MYJA 4HD5A 2VITA 2IH3A 3VFRB 4J39A 4UYPA 3FHAA 5DD6B 4LL4A 1QD0A 2VDKL 2CO7B 1KEML 1KFAH 1MRCH 2BCKB 5T1LB 1N6QL 3D18B 5F21B 5EMYA 4HK3J 4GKSB 1CVSC 1FZKA 1IC4L 4XP1H 3GKZA 3WFDH 4NQXB 4F20A 4IBUA 2B39A 2Y6TE 4FQXD 2HSIA 1E8ZA 3UPRB 2IH3B 4L9DA 3T77A 4GI8A 3KPRD 3VGHA 3QWQB 3V0WH 2X4UB 3PJSA 5IB1B 1WAEA 3U1QA 4ZODA 2VDNB 3HCVB 3UPAA 4I1RA 1GL4B 2BHYA 4CC4C 2VIRB 2EUWA 4HEMA 1FZKB 1NSNL 4YHLL 1IZKA 4PBVC 1NGQL 2FWLB 3OB0H 5D2LB 2ZWYA 3H7BB 2VN5A 3LQMA 3SYOA 3T77B 7TAAA 2DWEA 1QFWM 2DLHA 4XP4H 1PG7H 1PZDA 3VNZA 3V0AC 1GZPA 1U3ZA 4K71B 1YEEL 4UT7L 1KYOK 1E7VA 4OIIH 5IROC 4Q74A 5I1CH 2CNYA 3QNFA 4Y16B 3NCCB 4ODTH 3NPSC 3DVNB 3CFMA 4NPYB 3FRPB 2XWZA 3WDJA 1T22B 2APWA 4DHLA 1QW9A 1NFDF 4KKAC 4MHHG 2HPTA 1XSJA 4AYFA 1L9QA 1ZK9A 4G8IB 4OZHF 1S9VA 3QXWA 2DWEB 4FULA 3CIAA 4HS6A 4UB0H 5FPIA 1IKFH 4YR6A 3NPZB 4NJAL 1GZPB 3QG6A 4L4VA 4OKDA 4QRSA 2YXVA 1DVSA 5F3FA 1IRAY 2A0LD 3ULUF 3JVGC 2V7NA 1EVTC 3EFFA 1YNLL 3RJQB 1S78D 4B95C 3P9MB 4LSTL 4XPTH 4QHLA 5DUPH 3AW5A 5E00B 5J12B 5C0ND 1FVEA 3NIGE 4N2KA 3LRMA 2YAHA 3RVVC 4YR6B 1SLWA 4IIQC 3LEXB 4ENED 1HEZA 4JGNA 3HC4L 4TQEH 4HWZA 3GSQA 1Y6KR 2EZ0C 2FWOB 3WNKA 4A37A 2V4LA 4NLAA 4IRZL 5IFJA 3PAUA 4ZFOA 3TEZA 3QQDA 1CG9B 5I1EH 4YLCA 4YVUA 2WLMA 4M3JA 1RHFA 2GTQA 1FVEB 2EDFA 1G9NH 1RJYB 2Y1AA 5D4IA 4DESA 5BV7B 2NTFB 1VENA 2XZAL 5ID1A 4N90E 1EHKB 1EFQA 2DIEA 3MLZH 4GMTH 4KKCC 4IMKA 4UQ3B 5H37H 5JLZA 5CU9A 2WWMC 4HWZB 2KZ1B 3MLXL 3G6AA 43C9A 4TS6A 3PGFL 2ADGA 1ZTMA 2ESVD 2X9XA 2PPCA 4L5FL 3QQDB 4PJFF 4FD0A 4TLKA 2VLLA 4TQPA 1R3JB 4X8JA 1BBJA 2VDOH 1AFVL 4MZ3A 2VXTL 3RWCA 4PJEF 3VUAA 2ICWJ 4LKXA 1U8KB 5C7ZA 5HJDA 2VN3A 1Z0NA 2C8NA 2H6PB 3DXAD 4KQ4L 4M6AA 5ID1B 2IALA 5LDSA 4U6XB 1R3IL 5SWQB 5JLZB 3T6XA 1Z9LA 1N5AB 5I8CB 1IX2A 3DI3B 4PSRA 1RFDL 4OJFH 2O4EA 4NPKA 5DJ0A 5GRJH 1G9MH 1F56A 3DLQR 4FZ8H 2VZ3A 1A7PH 4QIRA 2ZP8A 3A22A 3MA9H 1HHKB 3RRQA 3W0WD 4LKXB 3V0FA 2JI1A 1TIUA 4QXGL 2IALB 1OGAD 2WCPA 4IQHA 3B9KD 5J6HA 3TYFA 3AT0A 1JGVL 4RMBA 1NL0H 4KVCH 5I74C 3VG0L 2OSXA 1VZGA 1O75A 3U0WL 4N3UA 4A6YA 4P5TD 4ZO6A 1JPSH 4PW9A 3OKEA 2BOBA 1D5XA 1FN4A 5T33H 5KSAA 3CHOA 4UOW1 5J6HB 1ZHLA 4WTWA 5FGCE 4RAUB 3TYFB 4H2CA 3MCLH 5A6MA 5INDB 1BGXH 3ULVE 5FKPA 2WVUA 2CLZB 4KK5C 3FRPG 3NGBC 3Q8CA 2IOIA 3GZKA 4HEPA 4HWEL 4PJGE 3SKUD 2DJSA 1EEYA 2L0DA 1T5XA 4PG2A 5AENA 4QRBA 1CICD 1D5XB 2WLJA 3SDDC 5GGUB 2DJ4A 2WXKA 2AJZB 5DK0B 3FH5A 5KSAB 5I18L 2PW2A 3HNSH 3TVMD 1WTGT 4RZCB 3ML8A 5LAPA 2H6UA 5BXFB 4LCCC 4PRHB 2DQIH 2PW1A 4ELDA 5TE7L 3VYPA 4XH2A 4AW7A 1Z3RA 5FYKH 1TJHL 1GTFA 1NCWL 3JUYA 1PD6A 4M43H 3UZEC 2QTEA 3QNYA 1HXYA 4TNWF 3GLZA 3VACA 4KAQL 1P4IH 4NUQA 2H5UA 3BPCA 4OGZA 5I8OL 3BWSA 4LSPH 3TA3D 1PLAA 5D4HA 4C56E 1EO8L 1RV6X 2GUOA 3V6OC 3GMRA 4UQ2B 4AW4A 1RIVL 2EINB 5FOBB 2D3LA 3IJYB 1FFNA 4N2HA 4UTBH 3QEGH 4JHVA 5BV7L 2VDQB 4Y1AB 4Z78A 1A1OB 4J1UB 2PW1B 1JV5B 1KCBA 4TYUA 3VJ6B 5CLWA 3JZYA 4XH2B 3UGEA 5C0AA 2QDVA 5IQOA 4Q6KA 4LLMA 4FNSA 2IANA 3ZL4H 3JWOH 5EF3A 2B1AL 4XZUA 3EDDA 5AWNH 1EXHA 1JE6A 4Z7NB 4ZFOL 3PS6A 2IWKA 4FEMA 2J8UF 1SJMA 5DEJA 1NUGA 3RJOA 2K8QA 1FFNB 1PLGL 1SXAA 4U2ZA 4I77L 1JWMA 1KY6A 3S8FB 5IHZB 1S9YB 5FFOA 4PJ6A 3QS2A 3P02A 2EYSB 3MUGB 4LCCA 1XL6A 1O9WA 4R26L 1V7MH 2P4AB 4IEFA 1A5FL 1RUKH 5AVWB 3FUJA 2VN4A 5LWYH 1U3JA 3TH2T 3UZEA 3QPXL 1XAUA 2I7SA 3TYGL 5T8IA 2YXWA 3S8GB 5ISZA 1QBML 3A6BL 4Q6IC 1JWMB 2IADA 4JFVA 4LLUA 4FNPA 1GMIA 3RU8H 1WVZA 2H2SC 3H3BC 4Y9CA 4EDXA 4YHML 3OQ3B 1Z9SA 3DK2A 4L1LA 2D7TL 1BDYA 3WHE0 5DMIL 3WNMA 3Q8BA 4YFLI 4CJ0A 1UXLA 1EXUA 1NGPH 2VISB 1HOCA 2VXUH 2BLFA 1D9KA 5IHWA 1CFQA 3F8UB 4LK4A 5D5MB 1JGDB 4WCYL 4AEEA 3PLYA 5CN2A 3FH8A 3ZDYF 1SRDA 3MAWA 3FRUB 3SDYL 4Y5VC 4HP5A 3RI5K 5D1QE 3AXIA 5DD5L 1MHEA 2V7HA 3WBDA 2J1XA 2R2HB 3MRKB 2WKGA 1SOXA 3SQOH 1UCBL 1GYVA 4HIXH 1EXUB 4NO2B 3ILQD 1J87A 3MLYL 4A6YL 2YPLD 1V10A 1ZE3H 2AVFA 3HR6A 1CFQB 4JRXE 3I85A 1MW2A 1T1ZB 3SYPA 1F4XH 4FGMA 1TJIH 2XN2A 2Z6FA 4HZLA 5G5DA 4BH7A 3AADB 3L9BA 4NWUH 4DKDC 5KBPA 1A4CA 1QFUL 4PV9B 4W9IC 4UQ9A 3V6BR 1LO2L 1MHEB 2QBWA 3DV4A 4D3CH 4L1TA 4JGJA 4W9CC 4XNDA 4F37F 1FVDA 1F1DA 4A7QA 4MSWB 5FCUH 5JHDE 3CFBA 3ARFB 3VE0A 5KVEL 5EH1A 3OJ2C 3V0DA 4IKJA 4FQIL 2MQGA 1QLRB 1YYCA 2VJ0A 2D0GA 4WI3A 5G55A 5JW4Q 1DZBA 5BRQA 3VVVA 5JHMA 2Q86A 5KANG 3PWNA 2WQAA 3MXVH 2E6PA 2JXMB 2DQEL 3MLUL 2VNCA 4FL4C 2VDQL 4AOFA 3CZSA 4X5RA 3C5JB 4WK4B 3I84A 1L4IA 4IKIA 2QSCH 2IGTA 3EH3B 4NN6B 3IJ8A 3UOAB 4FFYH 3GGWA 2AANA 2F53A 3ZKXB 5IVNA 2K45A 5M7QA 4U1KB 3S36L 2B14A 2EE3A 4OKVB 2J8OA 1HINL 1YRKA 2O5XH 3UBXG 3DJSA 2C3VA 1MQKH 4JCWA 1UADC 2ZXBA 3SZ6A 3QXDA 3ZY7A 2Q86B 3JWNH 3T0DA 4GG8A 4ZYKA 2HXAA 3HA0A 4WUUE 1A6ZA 4IGBC 3PRZA 1MI5B 1MH5A 1SM3L 32C2A 3DX2A 4FQ2L 4OSUH 5F9WC 5E08H 3PHOA 1OTTC 3EUDA 3VXQB 3GGWB 5LDUA 3PABB 1FHGA 3IDMA 4F8NA 1HDMB 1UJ3C 3MJ8A 4M8RA 3HMWL 2PP9A 4OD2A 4HQQL 1KFGA 3VWJC 2C3VB 3HI1B 3ZX1A 4B0MB 3NSCA 3SD2A 1WT5A 3IFOA 4PJBA 3O2DA 4EO5A 1RZJH 3V0HA 2N7BA 3CFKB 2EDMA 2OMBA 3JWDL 1CFNB 1XGRB 5DT1H 4R4ND 2RBLA 2ZPKL 1QOKA 1XGZA 2LABA 4HOZA 1FAIH 3GXUB 4JZNB 4OCXL 1RU9H 2K7PA 5C0BD 5C0JA 4ODXB 3D08A 4UNTA 3WSQL 2VDPH 3FO1A 4JRLA 3QI9C 2A1WL 3MZGB 1NDTA 1U8NA 2PETA 2X4QA 4J3BA 4PJBB 1P9MA 4BHUI 5GRUL 4HCRH 1UB5A 5E2WH 1DSYA 5LBVA 2XWTA 5J13B 1QRND 4GKLA 4IGBA 4PJXF 1N6VA 3O9WA 1CGYA 3WFEL 4CA4A 5C0JB 5KEZA 1UJ3A 4NCDA 3ETBF 2OYLA 4LDEB 1FHNA 4IS6B 1F6FB 5CHNB 1AZVA 2EDKA 5I0WA 1UB5B 5FW7A 1JN6A 3FPYA 2BFGA 1AGFA 1CD9B 2F74A 4RMVA 3JTSB 1DJIA 5ICUA 2OMVB 2YK1L 1RJLB 1PCSA 2NUPB 5AAMC 3U7AA 4YDLB 1H3VA 2FYYB 3RBSA 3QI9A 3NCJL 3OL2A 1MPAH 2J1YA 4M5ZL 3WKNA 2F8VA 1MDTA 2A6JA 4G1EA 1AGFB 5J11C 4L18A 1YMMA 3DPBA 4RGOH 5EUOF 3D9AH 4S1QH 3MV01 3RTQB 4XNBA 3NJFA 3DX3A 4KDWA 3BVNA 3RVTC 2LU7A 4KDTA 3N42B 4MJ5A 4IJ3B 3SOTA 2AJ3B 2KS0A 2BPBA 1DJYA 1JPGB 1XIWA 3FO0L 1CIDA 4P57A 3OB0K 5GGTH 1SLXA 3GHEH 2BVQB 1MW3A 2HWZH 5HTSA 1IAIM 2LVEA 3EYSL 1Z5LB 5I23A 3MQIA 3IWUA 5ESVA 4FXTA 5IT2H 3VXSA 2VLKD 2EEDA 1MJ7L 3BVNB 4JFFE 5EIQA 4JM4H 4G6AC 3VMOA 1XCTA 3NRFA 3H4HA 4BIKA 4WI0B 2VSMB 3T0BA 1HQ4B 3CPLA 2QGEA 5L4IA 1UWXH 2AERT 2C3WA 4Z3JA 4R0LC 4ZMQA 15C8L 4K9EL 1BXUA 1WBXA 4JY4B 3CSYB 4JDVB 1UXMA 3DURB 3NCYP 1TG8A 2ZX8A 3AG3B 3HZKA 2EDJA 2CKNA 4XBGB 3QJTB 5DRXB 1O6SA 3MTRA 3QIUA 4M93B 1CGUA 1UEMA 3CPLB 2Q10A 1IQWL 1HIML 1UWYA 1QLEB 4NM4H 4WO0A 2ADFH 4YHOL 5GQBA 3H3PL 3BKJH 2Y7QB 5EU7C 3MLVL 2BW5A 2DAVA 2UYLA 2GCYB 1KY7A 3TP4A 2PO6C 4DO4A 4XVSL 2VM9A 2YAPA 5CMAA 3T3PB 1I8IB 2DWDA 1M6OA 3RG1C 5L2KD 5A7EA 1NUNB 1DEDA 2DQGH 4TSCH 3ULSB 4ZUUA 3U25A 1ZT7A 3NZ8B 3QDJE 4WFHE 4GIPD 5I2IB 2YUXA 3HI6H 4HF5L 4YHZL 4QHNA 5I6XB 4R0LA 2Z4QA 1MFDL 3L9EA 4GAFB 1DQQA 3BKML 1GGIL 4IOIB 4UM8A 5EZLB 2F5BL 2UYLB 5HHNB 1FNSH 1N6UA 3OLDA 3B43A 1OSPL 2DWDB 1M6OB 2WAQA 1U92B 4UZUA 2BRRL 2QVKA 2W9DL 1KCWA 3CSGA 1BF2A 2WCSA 1IC5L 4LVHC 4FMFA 5J56B 1AS7A 5B3SB 5DRZB 1F13A 4AGQA 3R19A 4Y4FD 4RRPM 4D2NA 4PY7B 1N2RA 2AEPL 2X38A 2EIDA 3C6LB 1HQRB 3KBEA 4RGNB 5HGDA 5JW5B 4RMSA 5E6YA 5ABDE 2WJ7A 3I6KB 1VKXB 4GP8B 3U6RA 3VCLB 4ENEC 5DA0B 5IMOB 3LKOB 4KRLB 4NFDA 2PO6A 3FHQA 2W0LA 3NSXA 4PJCB 5SWSD 2B8OT 3FUHA 3CK0L 1HI6B 4FP8L 2ZUQB 4D0CB 4NRZB 4U1JB 1U8JB 2OL3A 4Z7QE 1L9RA 4PG9A 3ZO9A 2UZXB 3F62A 1MG2C 4K7PH 5EPMA 1R4XA 5EOTA 2XT1B 2VMFA 3VXRB 4TUJB 2X4PA 3ZDXE 2ZTBA 1H3GA 3UJJH 4GFXA 4PP1D 4OF6A 5B39A 2IWFA 3EJQA 5ANME 3FCSA 1KTLA 3BP4A 3A6CH 4P5MA 1GPOH 2Y4SA 4PRNA 4RMTA 2PXYD 3QUXA 3NZUA 4CBZA 2NQ3A 1RZFL 4QPEA 2BH0A 3F12A 4OD1H 2FIKA 1RVFL 4P5KA 4Z6AT 4PRID 1JD9A 5D93C 2Y22A 4Y2DC 2FNWA 1NC4A 1KSRA 2R56L 2X4PB 1MREL 4PW3A 2WXFA 4FQCL 4NOFA 1P7KA 4OU3A 2A9NH 5F6HJ 3BP4B 4XODA 4M1GH 2AV7A 2NT1A 3QS3A 4PRNB 3R06A 3F83A 5CGYD 2R1WA 3K71A 3V7MA 5MERB 5F9JB 2XA8L 3F12B 2FIKB 4P5KB 4G8GA 5C6PB 4TVPE 4MNQE 2P80D 4DNLA 1PZ5A 1WHPA 2CGRL 1MJ8L 4JO4L 1QLEL 3ABGA 2W65A 3ZW3A 5DFTA 1E9QA 3B9KC 4K5OA 4PYHA 1CPUA 4TMPA 2EH8L 3F5WA 1ZLWK 1V54B 4C83B 5SWZB 1EAPB 4DW2L 3NIGF 3IKCB 3NIFE 2C9VA 5C0RL 3E9TA 1YNKH 3KLLA 5AG8A 4ZDHB 3KPLB 1ACCA 3NP4A 1AKPA 3L5HA 3DVGA 4P2QA 1I4FA 2WMPA 3TURA 1OARL 1PZ5B 3AU1B 1GSMA 3GK8L 3LRSA 3VI4A 4JFHD 2G75A 3GZQA 1JZ8A 2CKBB 1OP9A 2YGNA 3HC0A 1T21A 2IPUG 4GQZA 3MI6A 4FI8A 2CM5A 3U2SB 3K46A 3NJHA 4NCC2 3AT8A 4WTZA 1FPTL 2JKNA 5EC2B 1FIEA 3VB8A 3ES6B 12E8L 1KIPB 5JZ7C 4HUCA 1UM5L 4BA0A 5KYYA 2K4AA 2G75B 1KN2L 3SO3C 5AKVA 3TVMC 5HVGB 4KTDL 3FUNA 1U95A 1R75A 3O6FB 1OGSA 2UVEA 4ZW6A 1I1FA 4AQEB 4AJYV 1LK2B 2DBJA 5DHVH 4QOKE 1T4KA 2X1XR 5I1JH 4LSRH 4TNWK 3RP1A 4JGUA 3HS0A 1SZNA 3MA7A 4QEGA 4S1RH 2OSYA 3BIKB 5KYYB 4LVOC 2YQ2A 5JXAH 4RX4A 1CFTB 2BP8A 2DEYX 4P07A 4HPOH 4X8XA 3EO9H 4Z5RB 3FONB 4URKA 1QA9B 4XCFL 4IOFD 1NCIA 3DOHA 1KGXA 3ROOA 4PJDA 5T1LD 3KPSE 2I25N 4RFNB 2Z93B 4BSVA 3MA7B 5DC9B 1J0KA 3L54A 4Z8FL 1WQVT 5D9SA 3HPLB 1NGWB 2B5IC 4FFVD 2LVCA 3CFUA 3H9ZA 5T3XE 2J1ZA 3F7RA 3QCVH 4HMEA 1HAUA 1P1VA 4FNQA 1NUDA 4K9JA 3ROOB 3I2CH 4ORGB 5F1SA 5E1GA 2MCAA 5CBAB 4FYQA 1TEYA 3IU4H 4N8VG 1XD0A 3RA7H 2B9AA 4M6OH 4JHWH 2ZNXA 3ULVF 1JZ4A 3C5SA 1AZCA 1VFOA 4QHKI 1JGIA 4PJGF 5G2NA 3VRIB 1T03H 1JXJA 2IPKB 2YMTA 5EIIA 2HX8A 3LIUA 3FQUA 1MCLA 1WPCA 1AMYA 2V2XB 1PX8A 1G0XA 1WD9A 3AS2A 3N55A 4Y16D 5E8OA 1SDYA 3T5WA 1G7MA 4OB5L 4KRNA 4U3CA 2K6YA 1MCKA 2WQRA 2XWJB 1CLVA 2Q2EB 2GIMA 1N0LA 1JK9B 3F6JA 4RBPK 5DHMC 4DP9X 4G43A 1ZWIB 4AKQA 4YDNA 1ACXA 1GIGL 3VX1A 2J21A 4ETYA 3UZVB 4PEEA 1F4YL 3RL2A 3VFTB 1UD5A 2GIXA 2ZKHH 1UFGA 4Y0GA 3UJTL 4KRMB 1FJ1A 4FNTA 2V5YA 4UILH 5HYJE 2ZOUA 1BOGA 2NX5B 2Z8RA 2MPVA 3ZRCC 3L5WA 4B97A 3CVHH 4AKOA 1LLAA 3VFVA 5FYJH 1HH6A 4I2XA 1YZZA 5L4JA 1YJDC 1S7XB 4OZGA 3N44F 5A2IH 5D7SH 4U1GC 1RUQL 4IW4C 2ORBL 6CGTA 2YMXL 1ZGLA 5KVFH 1NBZB 1H15A 1T3FB 4JPKL 1BOGB 2BK8A 3WV0A 4F37K 4G82A 1CXFA 3FQYA 3NJVA 4PS3A 3Q2NA 5CXPA 5E2TL 2UWEE 4I4WA 3B7UX 3QO0A 1SJVA 4OFYD 4B9GA 3MO1A 4ODBD 2Z7ZA 5JW3L 3AWGA 4BFNA 4FFZA 1H15B 2X3AA 3GBDA 4QYOB 3W38A 3S98A 1KJ2A 3ZZSA 4KTEH 5C3IA 1IILE 5BW7C 3ZR6A 3BKYL 3RX7A 3LN5B 1HHHA 1FORH 4J3TA 2DV6A 5AUMA 4N0UA 4KFMA 5GGRY 1IT9L 3L3OC 1LDPL 3X3FL 2PMZA 2EDHA 3CFQA 2QQLL 4JFZL 3B34A 1B90A 3GTVA 3BEWB 1JPFB 3KYMB 4PM1A 2A74A 3P77B 4K23L 3L3GA 1IFHH 4HEME 2O5ZH 3KPNB 3DMMB 2EO9A 4FA6A 1AXSB 3FU3A 4UANA 1L0XA 4XWOC 5F0JB 5KUMA 5MEOA 5I5IA 2DOCA 3MBXL 1A7QH 3OKDA 5TGBB 4OZ4A 5AUMB 1QEWA 2B4CC 1VACA 3D25A 3J2PA 4MD4A 1MAMH 4QAMB 1I7RA 3BVDB 1ZLSL 3T2NH 1Q9WA 1TPXC 4XMKH 2A74B 1KXVC 1I3UA 1DN0B 3LB6C 3Q8EA 2CIKB 3A4EA 4W68A 4BXVA 4IJTA 5D7LE 3KLSA 1KLGA 3RX8A 1MY5A 3MRMA 4PB0H 3RWHA 1GGBL 1II4E 2GSIB 5MEOB 1CYXA 2IH9A 5D1ZC 4A2MA 3T1FB 3ZE0E 5BW7A 1QEWB 3Q0HA 4YHKL 3GSXA 2XXCB 2CHZA 1BM3L 2AQTA 4YHNB 2ZUWA 3DIDA 5F96H 5KVDL 1U93A 1UZ8B 4M7JL 4YSRA 5EEWA 1FL3B 2HN7A 4LZKA 4W6XB 4HJIA 3RWHB 5T5FA 2LLGA 3GBMH 2KL6A 2VRKA 4LFHG 4N20A 1SF5A 3RB7A 5F7YC 3FUFA 2IPTH 4AGLA 1DJGA 1AZUA 3TPUB 1NFKA 1X5YA 1E27A 3UAJA 2Z8VC 4JFOB 1I8LC 5IQ7L 3QQ3B 3QFDB 1F6AA 5AD0A 1YYLL 3NP3A 4XO8A 5KSAD 2BVPA 2JKIS 1KPUA 5J9PB 2HN7B 4KNQA 1YAZA 4GT0A 3VFMB 2XPZA 4Z7VE 2I7OA 4NUGL 5B4MD 1XH0A 5FYLD 1W72A 4BRJA 4PRHD 4F1SA 1UWGH 3QFJB 3AXHA 4A1JA 1YMHB 3GSNH 5MENA 3N2JA 1ZVNA 4HS8L 2KMWA 4RDQG 4ZS7H 3VXUB 5HGAB 2AK4B 1HHJB 2NSQA 1IEHA 4L3AA 4NS0A 5ADOH 1MJJB 1N0XL 4ALAL 3IMBA 1KPUB 1NCCH 1CIUA 2BIMA 1J8RA 1LXMA 4LCWE 5ALCH 4Y19E 1VF5C 4OIAA 1U3HB 4MWFB 1KLFB 3B6SB 1M3IA 2YRBA 3ZKMD 3PUCA 3DRTB 4Y1AD 4LPYA 5D6DC 1M1XB 1W6WA 2CO2A 4JZJC 3PNWB 3X3GH 1HZHL 3TNMA 5BUGA 1R6VA 5DO8A 5K5YA 3JZ7A 1MIMH 1CD0A 4MJHA 5L9DH 1V7NL 3PDDA 1MKFA 2J55A 2VDPB 1VADB 5EF2A 1I8KA 5JUEH 1I8LA 4WO4C 4YZFE 3BQUB 5BZXA 2YAMA 3DETC 3T6WA 3RWFA 3WEAA 3HZYB 3N04A 4GP5B 4BINA 1VGKA 3BOVA 3N3EA 4PY8I 3UX9B 3MHZA 4FFZL 4KY1L 5IM7B 3KR3L 4LRNH 3WTWA 1QBBA 1P84J 1MQ8A 4WENB 2IAND 5FR3A 4TTDC 4F15C 1X5KA 2JTDA 4K2UL 1KGYE 3EJTA 3MXWL 1JVKA 1EO5A 1X5IA 3LZOA 4S10A 3FTGA 4Z7UB 2O6CA 4EOWL 3M1BA 1O7SA 2VM3A 4HHWA 1WFNA 1AQKH 1HYRC 3ET9F 3NCMA 4H44C 3K6SB 1YJDL 1JK8A 3MJ6A 4FQ1L 4H13C 1H0DA 4RAHA 2VLME 2XOTA 4JZJA 4W1TA 3MOQA 1O7DC 1T5WA 3BX7C 1U8MB 1IAOA 3NAAL 3T1WA 1CD1A 2X70A 3RB5A 2FX8H 3CH1A 5IW1A 1EFXA 3NUKA 5EBLB 4LPWA 4ZTPL 5E9DE 1U3YA 3ESOA 1FGNL 4M6MH 4QRPA 3BPOC 5C0FA 3QJRB 2OXHA 1H0DB 2B0SL 2A6DA 1AI1H 4L05A 4GXVL 4JHAL 4JGMA 3N91A 1W8OA 4KO7A 5I82A 3BPLC 3EHBC 4EBQL 3OKLA 5IW3A 2VJ8A 2KYIA 5HDQL 3U9PL 4NI3A 2P26A 1GJIA 2QVTA 1NCDH 4JUSA 3C2AH 2NR6C 1HX0A 3AVEA 4ZPTA 3NJJA 5K9JH 3WEMA 4KKZA 3BN3B 4OW6A 2YEQA 4AJWA 4IM8A 2YMOA 4QWWD 5E6IA 3IXTA 8PAZA 2ED7A 3CTTA 4Q52A 4PYGA 3ARFD 1YPZA 3O0RH 3VQ2C 4E41A 1C8PA 1EX0A 3MOBL 4LOFA 4NZRH 3FTUA 3HFFA 5E5MB 3LDBB 3JWNG 3H6AA 3ZOAA 4GRWH 1FNGB 3OTTA 1F3DJ 4UQDA 4DK6A 1ADQA 1XVSA 2GY5A 3IXTB 1YC7A 4HKZB 3WS3A 1BD2B 1M57B 1W72L 5FB8B 1YPZB 5DVOA 4QCIA 2JV6A 1PKQE 2VT0A 5DJDB 2NZIA 3QUHA 4N85A 5C6TH 3TIEA 1QTPA 5KYNA 2NR6A 1KEGH 2MNJB 4C4BA 4M8UA 4MDIA 2ED8A 3EF7A 4KRPB 4PRAB 1ILUA 1SVBA 3F85A 4HCIA 4YGVB 5ISZE 3GJEB 4JO3H 5L4FA 4BKTC 3V6OE 1D7CA 4XXDA 2Q7YA 5KS9B 2MCPH 2WVVA 5DK2A 4NHUA 3RYMA 5FDWA 1S4IA 1ORSA 4ZTOL 3INOA 3BN9D 4PP1C 1NQBA 3HZMA 5HDBB 4ANKA 2F7IA 4GOSA 3U4KA 4MDIB 1BVZA 4U4BA 5ERWA 4YSSA 1Z1WA 4KJWC 1RZIB 2XWXA 3C60A 1OTUD 2Q7YB 4PS4H 5F9DC 3RWEA 5EF0A 4AQ8A 4I0CC 2F19L 2OYKA 1W2KT 3QJHA 2EIJB 5KTEL 2IEPA 1UACH 7CGTA 3NRPA 1SOKA 3BRFA 3T9WA 2B16A 2PTVA 1QSFE 4FNUA 2IWGA 4YHYB 5CBEA 1J0IA 5DFAA 4NAQA 3SKMA 4CVWA 4NLHA 5DC2A 2H3NA 2OMYA 3N40F 4WNQB 1UOWA 3RWEB 5GS0C 3IGKA 2DD8L 1HHGA 1UA7A 1P4BL 2CBPA 3CDYA 4P5RA 1ID5I 4JO2H 5I8EB 2AXWA 2NZ9D 1RZKC 4LP5A 3Q1EA 2G4GA 35C8L 1OPOA 2J88H 4APXB 5JPNC 1R46A 3N1MC 4P3WA 3B83A 3V0GA 5ESAB 4M6NL 5T3ZH 3UG3A 3VGBA 2H3NB 1DDHA 4K7FB 4H8HA 1EPFA 2MH4A 4GYBA 4ILDA 4MMZC 3FFCA 5H94A 3SZKC 1D5IH 2CH8A 4K3JH 5IZ7A 4Z7QF 2E0PA 4XC3H 1DSFH 3MUHL 3S96B 5HHVL 2BMKB 1PPIA 1PZ2A 4LEOB 2DLEA 4R96A 3SYAA 1CR9L 3EGXA 5FHAH 2WTRA 1DVXA 2VKXA 3ZDXF 3WNNA 3SGDI 4PJ9C 3CU1A 2MCG1 1CFVL 1S7QA 4Q8BA 4KXZH 3MTXA 4G6KL 2OTWB 4EEEA 5IJCC 2P8LB 5DSCB 1YEJH 4C4UA 3LYRA 1NPNA 2J73A 1C8QA 5D1XA 4CN6A 3LNIA 2CUMA 2F54A 4JM2F 2EIKB 1BIIB 4YAQB 3I9PA 3KNBA 1E65A 1CE1L 2WTRB 3PP3H 2C1PB 1A6TB 4JPVL 4TOYH 3GRBA 1EJOL 2LQRA 1IIIA 4KX8A 1NAMA 4RVBA 3ZQXA 4XN1A 3OBAA 3KBFA 4U4IA 3NA4A 4MMZA 3EOTL 5EA0H 5BMFL 2XVLA 4HV8A 2YA0A 3NA9H 4NZDA 2ENYA 4C4KT 2B20A 1KNOB 2NY4B 4CVZA 3FCBA 3GT6A 1D3CA 3QR0A 1TZOA 1TQUA 1XIWD 2OZ4H 4ZAKC 4CDGC 2VABB 1TUPA 2B2XL 4HJ0D 2Y2YA 1LEGA 2ZCLL 1NAMB 3ZJAA 5AB0A 3S0PA 5EU6A 1C5BL 5E99L 1YNTA 1MWAA 4NNPH 1B2WL 3VXNA 2EVIA 1VFAB 3WOVA 4HV8B 2NY5L 5DD3L 4MAYA 4BWUA 3QNXB 4GMSH 4LAJH 1AMXA 4CVZB 3BCFA 4AL8C 4E36A 2RJMA 1BWWA 2DQDL 2OCJA 3VQMA 1E4XH 4A7GF 5FO8B 4QTIL 2XRAL 4WUKH 4PGCA 1ZATA 4JG0H 2FT8A 4OCMC 1OP3H 2CJUL 2MWCA 4MAYB 4Z0BL 2BSED 2EYTB 5L88H 4K71C 1QYGH 2X6UA 2X2JA 2H32A 1L9OA 4K15A 1CGXA 3ATBA 2F1EA 1NBCA 4G9FB 4I48B 1XX9C 1KCRL 2X0VA 1H8OA 5JPMB 1E2VA 2YD5A 2YD7A 3E9UA 3PV6B 4ZAKA 1YDPA 3AS0A 1SEBA 4YXHL 5TQ0H 5I1GL 3QO1B 4JB9L 4M3HA 4PGCB 1URLA 4FTVB 3W3BA 3QDGA 6FABL 5D7JA 4WW2F 3SOBH 5F7HA 1XF5A 1ANUA 2OI9B 3OKOB 1IFRA 4U7SA 1PYWB 2OW6A 3BHBA 4WSKA 2QADD 1THCA 4XP5H 2QZ5A 3GHPA 1R24A 4WTXA 4AUJA 3GBNH 1YMME 1PEWA 1J10A 1Q72L 2BS8A 3K2KA 4WWNA 1DUZA 2C5DC 3GC3A 3EJCA 1KWKA 2LLLA 2PP8A 1QFWL 3ECUA 5J12C 1UM4L 5ICYB 3C6LD 1TTFA 2R4SL 3KPPB 3MRBB 1DANU 4PRPA 3II3A 3OC5A 3VM5A 1VERA 1CK0H 1LM8V 3LS5H 3MCYA 4L8SB 2JB6A 5B38B 2CIIB 1ASOA 2EDBA 1EXGA 1TNMA 4LKCA 3UAEA 5I15L 1U4EA 2ATKB 4XNUL 3BKCH 5CGTA 1TMCB 3FO9A 2ITEA 3VXSE 4N4YB 3K2MC 3LZPA 1QUNA 1WWBX 2OMWA 5D4JA 3UYOD 1F42A 4XPFL 4ETQB 2JKXA 4U1NA 3S2AA 4BK4A 1FRGH 1AG6A 3BRGC 2NCEA 3AQXA 2R0LH 5TQ2L 3TBVA 1AANA 1C5DB 5GS0L 3HHSA 1JZFA 4N28A 3D85B 4Z95L 5DD0H 5AYTA 3NK4A 2SODB 4CMMB 2QV2A 5DHDA 4KZEH 4KZDL 2XKNA 3N1GC 2DDQH 4O02H 2HTKC 4ODHH 3U4EB 2LU3A 3QAZB 4OH2A 5DEFB 1KPVB 1E50A 1RK0A 2VQ4A 3WLWD 1M7UA 2NY3B 4MQXD 1NAML 5F7DB 4P4RB 3CJJA 1S5IH 3NTCL 4ZUTB 2FUTA 3II2A 3OAUH 3H9SB 5HHPB 1AHMA 3MYZA 3KW8A 2XKNB 5I1DB 4DAGH 1T2QL 2CO4A 2JQMA 1RK0B 1UT9A 4CC0A 1AP2B 2MQ3A 5JORB 5AW2B 1KBKA 4RFEB 3CXDH 4O00A 4D0CA 1WP6A 5CZXC 5DLML 1KTKE 3QA3A 5SWZD 1NUFA 4KUCF 4FQHA 1MWAL 5BCAA 3HEIB 3B3BA 5EDSA 2HRGA 1CLYH 4KROB 1U8LA 2XETA 4LASH 4WLCA 1NCBL 2BSDA 3L17A 5EBWA 5C0CE 3R1GH 2TRYA 2BNRB 3P11H 1M71B 1A3LL 1S3KH 3MR9A 4IU3B 5FKAB 3QUMA 2R1YB 2WJ5A 1WA0X 4QHUA 3RWFB 5IK3B 1N18A 4LRIC 2UWEF 5F2FA 3HNVL 3ZTNL 4K3EL 4ERSH 3HJEA 3L3HB 5KYWA 4JQIA 3BAXA 5CP3H 3VI3B 2JI3A 3LKNB 4RETB 1U6AL 2P49B 5EU7E 4P48A 4QXUH 1UGNA 2IBGA 2X44D 2FB4L 3MFFA 4PWEA 4EN3A 4UNVA 4PJHF 4QHUB 5ITBL 4HYTB 3PAVA 4M56A 4MZRA 3L1OL 2DMHA 4MNGB 5AB2A 3O6FD 4RFOL 5B4MC 2NY7L 2FECL 4LSQL 3TN0B 4DKFH 1E4XI 5ACZA 4PJ8A 5K39A 2XTLA 3NABH 4G8AC 1J1XH 2GITB 2LGNA 3INUL 4F33B 2FR4B 2VTFA 3FK3A 5C1MB 1E9OB 1CGSL 3PL6B 2YR3A 1BAFH 4P2RB 5GSRA 4L3CA 5H2BA 2VLRB 3J7HA 2QEJA 4LOEA 4ODWB 4D9QD 3B2PA 1MW0A 2QR0A 3X12A 2AQPA 5B38G 4XGZB 1SFHA 3WNJA 1FNFA 4QJ3B 3C08L 4NQCA 5K39B 5JR1H 1TETH 5M95B 3Q7JA 3ZE2B 5IB4B 2W1NA 2L04A 2OP4H 2ZG3A 1WFUA 2P8PB 3PFUA 2MFNA 4NQDE 4YSUA 1SYSA 3DOIA 4V33A 1H6EA 3QORB 5JOFA 1G6VK 4HUUB 4L3CB 1DBAH 1K5WA 4PR5A 1DHKA 4OM0L 3WKML 2JKTM 2XQYK 1UKQA 3ZE0F 4AQ1B 4PV1C 2V3DA 3PWPB 3X12B 2LU4A 5F9OH 3CZFA 5DJYA 4LIQE 4F5CA 2AKRA 3LNFA 3UYPB 4Q56A 2JJSA 4G8GE 1OAXL 4ZTEA 5GZNA 1AGEB 2RH0A 5CEZL 3V9CA 3CU7A 4KJQD 1B2YA 1SYSB 4RH4A 3R0NA 3HR5A 1S7RA 3IMWA 2GB2A 1QSZA 4GXUN 1ZLVK 4ZMOA 1KT2B 1H8SA 2O72A 3EOAA 4OUUB 4BZ2A 5IJDC 1MJUL 3IGLA 4QTHA 1GR7A 1FGVH 1G0DA 3BGMA 3CZFB 5DMJB 2AKRB 1FAKT 2V17L 4JY5H 3HBZA 3SQRA 4Y5YB 4I3RL 2Z1PA 3GSNB 4OFVA 1N59A 2IAMA 2FD6L 2P44B 1VPOH 4Z7VF 1WBZB 2YQBA 3DXAE 4Q9QH 3G5XA 3HR5B 1OT1A 3PDOA 5IJKA 4XC1L 4BWWA 3Q2VA 5GRYA 4QRRE 2AABH 2ZXGA 1FNEA 1BX2B 4PU2A 4OZIF 3BGMB 4IBYA 5B1KA 4XBEH 4XNYH 1JNLL 3UEQA 4N9OB 3UBFA 3GDCA 2NX5D 1DCLA 3ISWA 1MF2H 1TCRB 4R3SA 4R5TA 5E8NA 4QI3A 3NG5A 4JN2B 5DMYA 1IKNC 5JHLH 3H2QA 4ODUA 5J4MA 4MKTA 2E6QA 2AQQA 3Q6GL 4ZMZA 4JRFA 1EZVX 5C0GA 2GIYA 2OJZH 2PCXA 1FNEB 3G5VB 2HRPH 5F7BA 4DPRA 1ECZA 1OP4A 3DX0A 3QUML 3APNA 2PYEA 3LNGA 4G6JH 4Y9GA 1LNUA 4YZFF 2CK2A 4F92B 1NMCB 1ZT1B 2P24A 4J2XA 4R3SB 3DX9A 4FNRA 2XJKA 1FO0B 4ODUB 3BISA 3ZO0A 3Q5OA 4JVWA 3ARFC 3CFDA 3ORJA 4JQIL 4OZFA 4WGKA 4JMNA 2HT2D 5C0GB 5KYXB 3GIVB 3Q3GA 3FUMA 5D71H 5GJTL 5DVMA 5C8JA 2Z7UA 3VD9A 4Z7WE 3HVDA 2NW3A 1LNUB 4HIEA 3DTUB 4HD9A 2ENPA 4JDTH 3GXDA 5GGVH 3SCMA 4ODSL 1UH2A 3P3TA 5CIPB 3VD3A 3O6KH 3WHE1 4HDIA 1MCOH 5IVZA 1PKOA 3PIQB 3E3QC 4ZUSA 1JYVA 5C8JB 4I1PA 2WYIA 2WKOA 1Q1PA 3DMMD 3EFOA 4HIEB 5MHSE 5BJTB 1D6EB 4GW1B 1M53A 3SCMB 1CGTA 4HIPA 2H6OA 1YEIL 2VC2B 3RDJA 3RGBA 4RNRB 4YGAB 4UM9A 3A4AA 4TXVB 5GGRA 4XBMA 5TDNB 4JFYA 4Y2LA 2H8PB 1HTYA 1R33A 1I9IH 3NJIA 5BNXD 3TV3H 3K4DA 4WI2A 1IGJB 1Q0YL 3MU3A 1XGYL 3HRZB 3ARPA 1DJWA 4H20L 3CHSA 3IN2A 3FB8A 3AWFA 1EGJA 1JRHI 4Z0XA 4TSBH 3SY0A 4UT6A 4XAWL 3NOIA 4UM9B 1U36A 5C07A 4WK0B 2Y07H 1GOFA 1JAEA 5I5RA 2VUYA 3E2HB 1IC7H 2NNRA 4D0DA 3LVEA 4NQQA 3IE9A 2JCCA 3B4NA 4QLWA 2Y7OA 1AO7E 1MFBL 5B1CA 4QJ5B 2WXJA 1T0PB 1CDGA 3CN4A 4XX1G 3LPFA 2AQSA 2Y1ZA 3V4VB 4BZ2L 1WDAA 3KLHC 3FUKA 3IGAB 4NT6A 1N7MH 4R8WL 1QHQA 1ZEAL 4FG6D 5CILH 5C07B 2H0PA 4U1SA 5A40E 4A39A 1XH3B 1U2CA 4JFEA 1X9UA 1QR4A 2EC9T 5AW3B 4D0DB 1XH2A 2FATH 2GUYA 3DGGB 4OM1H 3MMEB 4NC2B 4AEHL 3H6JA 3TT1L 3B2DC 2WINA 2CR0A 1FFPA 1K9TA 1Q1JH 1EVUA 2VE6A 1IM9B 3O3EB 3IKKA 1IC0A 1KC5L 2BNUA 2QMJA 3QFJD 5E6RB 2MIZA 1A7NL 3IEAA 3P9LA 4GAYA 4NT6B 5E8PA 4F57H 3JVFC 3UAJD 3CBRA 5DHYB 1G84A 1XGPB 2ITCA 4U6HB 3VXUD 2AK4D 2P7TB 4JFEB 3WS6A 1MFCH 3HBPA 3QISA 1PZBA 3D05A 3RNKA 1U3HD 4IKNA 5JMRA 2EIBA 4GXFA 4GG6B 1B9ZA 4HPYL 1WFIA 3GSRB 3O81A 1LO4H 3OG4B 3QT2A 4QRTB 1R0AH 2YJLA 2ICWA 4QRQB 4YHIA 5F6IB 4GAYB 2Z91A 5E8PB 2H1PH 2BVYA 3IYLW 4M4RA 3NSYA 4P9HL 2X2YA 3CN3A 3GINA 3UTQA 1ONQA 3TJEL 1T0NB 1SXNA 1UH4A 2P3YA 5J7CC 3RTQC 4LEXL 3O2VH 3H53A 1RD6A 3BQUD 3JV6B 3LSOB 5KSBA 4XN8A 4TUKL 4YPGA