4X5RA

Crystal structure of fimh in complex with a squaryl-phenyl alpha-d-mannopyranoside derivative
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x5rA00
3ME0B 2W07B 4XODA 4AV4A 4X5PA 4XOBA 4XO8A 4AUUA 4AVIA 2WMPB 2UY6B 2VCOA 3JWNH 4XOAA 5FX3A 5IQMA 4XOCA 5FWRA 1QUNB 4X50A 4AVKA 4J3OF 5IQOA 1N0LB 4CA4A 5LNEA 4CSSA 5FS5A 3JWNE 4AV0A 4J3OH 3BFWA 4LOVA 2XG5B 3ZL2A 3SQBB 1N12A 5AB1A 3BWUF 2JMRA 2UY7B 5CGBA 5JQIB 4CSTA 1UWFA 3ZPDA 2J2ZB 2XG4B 4XO9A 5AAPA 4AUJA 1KLFB 1PDKB 5F2FA 3ZL1A 4X5QA 1ZE3H 5F3FA 3MCYA 4AUYA 3JWNG 5IQNA 4AVHA 5AALA 4X5RA 4BUQA 2JTYA 4ATTA 5LNGA 4XOEA 4J3OG 4AV5A 1TR7A 3RFZA 4AVJA 1KIUB 3BFQG 5FLUA 5ABZA
chains in the Genus database with same CATH superfamily
2X4NB 4JG5A 3MO1B 4R0LB 4JJ5A 1PKQA 3AU0A 1XCWA 4UWQB 3HE6C 2CRZA 3OZLA 1HOCB 2WXFA 1GC1C 3WEOA 1MEXH 1WD9A 4QRRB 3V6OC 4L3EB 4M1CD 1B0RB 1S7QA 1VACB 1CL7H 1X5AA 1MCEA 1F13A 2Z93A 1QWNA 2X10A 3P3SA 4AVIA 5C8JB 2WXQA 4KRPC 1FYTD 5GGUB 3DVIA 1JZ3A 1IRAY 1VFAB 4JQIH 4KI5D 4MCYB 1CGSH 3NGBC 4Y4KD 5I1DA 1PS3A 5FYLE 3MRFB 2GIMA 1LK2A 3TZVD 4OU3A 2BNQE 2HB0A 3BHBA 2X7LA 4YDLB 3NCYS 2JELL 2DQGH 2UZXB 1HCFX 3F12B 2EVGA 1RZ8A 1X5LA 1XCTB 3QQXA 1CXIA 3KCPB 4E0RA 3HE6A 3BAXA 2OCFD 1R1CA 2BIPA 43C9A 4AZUA 1HQRB 3V6OA 1T03L 3MCKB 2EABA 3TIDA 4Z6AT 3NFSH 1VEMA 3ARGC 1L7IH 1G87A 4ZUWB 4DK5A 2IGFH 4FNPA 4EDXB 3U6RA 1JV2B 2VZVA 4WU5A 4ZMWA 4NJ9L 1T5XA 5BRZE 4J3OC 2F7QA 2FBJH 3KS0J 4M7ZB 4XPGH 5JXEC 4HJJL 5DEJA 2QMKA 1Y6KR 1YN6B 1YY8B 4QTFA 4HAKA 1T83C 3EUDA 3Q01A 5HGHA 4KVPA 3T0XA 3TT1H 4B9IA 4ZFOL 5E9DB 4PVLA 1CXEA 4Y5XC 1T5WA 1Q1PA 3BH8A 3B8YA 1FZKA 2F7RA 3I50L 3VXTA 2GK0B 2Y2YA 2XBZA 5DRWB 3KPTA 4RCAA 5CM1A 4F7PA 3P0VL 4AXWA 2RQ8A 4EIUA 2OJEB 2MKLC 1RUAL 2L3BA 2WP3O 1RURH 1MFEL 2JKWA 3KYNA 1OQXA 5JHDD 1WTLA 4LSDA 3H9SE 1YAZA 3BZ4B 1U8NA 4IRJD 1XGQA 2EDNA 4R83A 3MX0A 4POYA 3U0WH 1OT4A 4LCVA 1AO7D 4TPRH 3K81A 3MGAA 1MJUH 3TEUA 4X7TA 3F7PC 3QYNA 1OARH 3OZ9L 3O11A 3MOQA 2ZICA 4YHNA 4MNQB 3GXIA 4AMXA 3NIGE 2Q0ZX 5J06A 1BQKA 1T83A 1JIBA 2AVFA 4A7QA 5I8KH 3H42L 3JV6B 4AM0B 4Y5XA 2VDQL 5ERWA 4CADB 2FIKA 2GSIB 3I2CL 4P3DA 2XZAH 3CLEH 1B2YA 3N40F 4PHZA 5GGVY 5HJ3A 5LN8A 4D0BA 2DQHL 3M7OA 3PAZA 4JRYA 5DMKB 5KSBA 4OR1A 4MASA 5IBTH 1GC1H 3IXAA 4QRFA 4WI8A 3GSXA 3T0BA 3MACH 4KHXH 1WHPA 2VDLB 4JBSA 4QXTB 1A3LL 5E6ID 4Z8FL 3AS3A 3K6SA 3EFDH 1JGVL 1CK0L 4P9HL 1M1SA 5C0BA 2YRLA 4JUSA 1LEIB 4EPSA 1ND0A 5IGXL 4L0YA 4NP4L 2WBWB 4PRDA 2AJ3A 3PWNA 3CXHJ 5KOMC 4K7FA 4LOUC 1Z5HA 3IDYC 2VLRA 3NAAH 2IWGA 4EOWH 2DLTA 5E70A 1HHGB 1MHHA 2DS4A 4FYTA 5BW7C 4EI5B 2VDPL 4WCYL 1CS6A 2VT0A 1ULVA 2Q3ZA 4HJIA 3LOWA 1N26A 5I1GL 4KK9C 2AITA 4GRMB 4MMYB 4YLCA 1RSFA 2WY3B 2NY3D 1MQKH 3CFQA 4OLWL 5AOIA 3NCFB 1F90L 2QQNL 3QGVA 4J3OH 4ONHA 5T1DH 2X28A 4EIZC 5AAMC 1P4LA 2LAAA 4WI7A 1ACXA 1IAOB 4LEXL 3DJTA 3BE1L 5CBAB 1B4JL 2OW6A 4HK3N 4JDZA 3MRRB 3OR7A 4Q6IA 5FB8B 2NYKA 2WQVA 4XRCA 1EFXD 5FK9B 3BKJH 4S1QL 4HHGA 4W81A 3PV6B 3DUSB 5HJBA 4MMZB 1U58B 5ALCL 3F58L 1MREL 43CAA 2V9TA 3PFUA 1DUYB 4TUKH 5L8LB 4OH2A 1VEPA 1T0NB 1LHZA 1S6NA 1JGUL 3QORC 5C9JB 2HWZL 3E7JA 1F58L 2VLME 4K2UH 1XF5B 4N90E 1BA9A 3S35H 3O4LE 1F3JA 2FX7L 4RSVA 5AAMA 5GRWA 3RFZC 1PVHA 1RJCA 2QVIA 3FFDA 2JK5B 5GISL 4D94A 5ACZA 2X2UA 1OCOB 3TBSA 4WI3A 1G0XA 4MX7B 1HH6B 2BZ7A 3NCEB 5IP4A 4LLUA 4LRNL 2P80D 3NCJH 5DJDB 3POHA 5DJYA 2IOIA 3P4OB 5MEQA 3FH5A 3JYBA 4ELME 1NCGA 6TAAA 5F89B 1NMAH 1Q94B 1E6JH 3CXHK 3BGFC 3SOBH 2XNAA 3BEVA 1B0GB 3D2TA 4ZS7H 3BAEL 1IEHA 4HUVA 5CILH 1D5RA 4WUKH 5C0CD 5EUOB 1ODAA 3S37X 1ZA6B 5C9KA 4KTGA 2QSQA 4LLQB 3WE1A 2AQPA 4G1EB 4PJ7F 2VTFA 3RFZA 3WFDH 3OXRA 3UPRA 4RRPA 4YL9A 1ASQA 3UTPE 4DGVH 2RGSA 5E6SB 5D7LB 5BNXD 2EXYC 4XCNB 4LAJH 2E9GA 4OFYD 4MNGE 1I4FB 2Z7ZA 4PB0H 4YSCA 4G5ZL 2L7JA 2GBVA 3X1GA 3BAKA 4H8UA 4PI2A 3K72B 4FFWD 4PREB 4FQQB 5LGJB 1DFXA 3AZUA 1B9ZA 1WS8A 3D50A 4GBXC 3T2NH 4DQOL 2AXWA 2APWA 3KE0A 3RZCB 4C4UA 3PNWA 4RMRA 2B5IB 4GSQA 1AY1H 5D5MF 5JDSB 3SB3A 1PZ5A 1JL8A 4R26H 3COOA 1S4IA 2YBGA 4FTVD 4AG4L 4FXKC 4UQDA 1MCPH 3QULA 2UZIH 1V10A 4K9EL 1D5ZB 3PL6B 1GGBL 4F8NA 1F11A 5E00B 4HOXA 3D3VB 5J56B 1MCRA 4JHWH 4DCQB 4Z3EA 5BRZA 5KSAD 1KN4L 2X6CA 3L4WA 3WOVA 1ZRUA 3WMSA 2WVUA 2JH2A 3E38A 3UYOD 4UOW1 1KTCA 4GBXA 4JHBA 2ZX8A 2JI3A 1N3NA 5IV2B 5KYUA 4URTB 4DP1X 2NCEA 1KUMA 4WI9A 4YDZA 4PRPE 4AYGA 3MZGB 4WHDA 4KK8C 1SOKA 1HWWA 2HPOA 1LNUB 1KXTA 3DXAE 3GPEA 2HVJA 3QNZB 4JFEB 4MS8C 2BPBA 3C5SB 3WHXB 4Y2DA 3NQIA 5FYJH 4J2XA 1SRDA 4I8DA 2R69L 4OKDA 1YNLL 4JAMB 4A6YH 3T8XB 4PCSA 3R8BB 4D8PB 1A7RL 4DUVA 5KVEH 4JFPB 4CL7A 1HS6A 2FX9L 3F2LA 1M6OA 1ROCA 1JRHH 1RIUH 3PQYB 5IFJA 3APDA 2LGNA 1A4CA 1YNKH 1X5KA 1G6VK 4OKVB 1ZY9A 3W2DH 1KGCD 2Z35B 4U2YA 1DQJA 1B90A 1QSZA 3SY6A 2WYTA 5FYLH 5TD4A 4YVNA 2OX5A 3UC2A 5AALA 1TCRB 1Z9OA 1GOGA 4Y4FB 1E2VA 3LH9A 1AZCA 4HCFA 5FV2A 4BQBA 4DN3L 4ZUUB 1JHLL 2BHYA 3IDIA 3P0GB 4LASL 1G7HB 1YRKA 4N0FA 3UBFA 1UJ3C 2YD7A 4RMWA 3NCYP 1YNTF 4WEBH 4IRSD 3NTCH 4G6FD 3CXFA 1RCYA 2WQWA 3DROA 2KPNA 2HRHA 3MNVA 4PN6A 4PLKD 4E5XA 4Y2OB 5HGDA 5LCVL 1JNJA 3MROA 1WFUA 3HG2A 4JY5L 2HRPL 2FIRT 3O2WH 2BP0A 4ONFL 3DVFA 3BKCH 1BAFL 2XWTA 1M2OA 4YK4C 4OCRH 2YAHA 3ULUF 4X6EB 3ZE0B 1RHHA 4TV3A 1EZUA 2FECI 5DJAA 3QUYC 4YAQA 5AKSA 5LDUA 3FQUA 4LCIH 5F8QC 1I1AD 4WNSA 5FKPA 3TEWA 3K2UH 2C3WA 2BVOA 3E3QC 2F0CA 3SDDC 1Q9OA 4I5BA 2B59A 4NI3A 4FG6C 3DX7B 3MXVH 4XMTA 1R3JB 3RHWF 2FATH 1AE6H 2IDCA 2ARJA 4IGBA 1E5YA 4C4KT 5JHBA 2SEBA 5IM7B 5A2LH 4B41A 1JGDA 1XF2A 2YUVA 4FN0A 3FQ4A 1EH9A 1H6EA 5D1ZD 3DPDA 1HCVA 4LQ1A 5GGRB 4Z76B 4A68A 2X9XA 1AI1H 3BWUF 3ASWA 3FK3A 3L3DA 3NABL 1EUTA 3FOLB 1C5BH 1EDYA 2VMFA 2OI9B 1QNZL 3HG1B 1NKRA 3SDDA 1FC2D 4H0LC 3FO9A 2AS5M 4EN3B 1MN4A 2HKAA 2XG4B 4HUMB 2PCFA 4JFHD 4K71C 4LLAA 2JKTM 1QSFD 3O4LA 3FT2B 2WHVA 1IJNA 3Q2WA 3ZBMA 2WXPA 1DYZA 1MZYA 1OSPH 3MSPA 1IUZA 5EO1A 2XPZA 3VQLA 4U1IA 1NDMB 1GYCA 1X5XA 4RFOL 1H15A 5GZNA 4JFFE 1BBDH 5HHVH 4M93B 3ISRA 5L6YH 1G1OA 4FC3E 4YXKL 4UZSA 4OIBA 3AC0A 4LSQH 3HCVA 3H4FA 3MRHA 3SSGA 1N5AB 3ZTJG 4NFBA 5F21B 3K74B 1CLCA 1NCOA 1MLBA 5INDA 1Q72L 4HUXA 1DJYA 1VGEL 2AQ2A 3CZLA 5ID1A 2X1PA 3GEFA 1OAKL 4N3UA 3DHUA 3JQOB 5B39G 1AVAA 1RUPH 3BWUC 1PZDA 5HPOA 1MRFL 4W9JC 2K4WA 3K46A 1IT9L 4WFFE 3UJTL 5JXAL 3P4NA 4FKEA 1KB5B 3C2SA 3NN8B 1E4XL 2D0GA 4MQ7A 3NDZE 3UZQA 2VH5L 1TXKA 1OT2A 2H2PC 4YBLB 4DPAX 4WHTB 5GS0L 2V7NB 3HG3A 4JM2C 1TFHA 4AYSA 4XVSH 2DL2A 3ECQA 1AANA 5GRUH 1N0XL 4KI5F 5F7EH 4MXQC 3TN0D 1DHKA 2X88A 1NGPH 4M62H 4FQLH 5ISZD 4D9LH 5BVPH 2YPLD 3VFRA 4APQD 1FGNL 1FN4A 1HNGA 2J7LA 3OKDB 4Y1AD 3S5LA 4DERA 1U8IA 1N7ML 2FD6L 1C12A 2C3HA 5EH1A 3QW9A 1A6UH 4XH2B 4JANB 4R90L 1IM3B 2ADIB 1Q0XL 4ANVA 4ANXA 4PJ9C 5J13C 3R06B 3NRPA 4JM2A 4UQ3B 1QSEB 3GFUA 1WD8A 5JIIA 3D30A 2WUCH 4HALA 3O8XD 1GAFH 1ZS2A 2AJZA 3VXPA 2A6IA 5T1MA 5BMFL 3CLEL 4Y19E 3UO8B 1A6WL 2H6PA 2VC2B 3AXLB 1S5HA 1A8ZA 4ZAKC 4PRPA 2CUAA 1QP1A 1U3NA 2FLBT 4N0YH 1GW6A 3DTDA 5IBTL 1KCUL 2VAAA 1KACB 2ZXCA 3DXAA 4HKZA 5DO8A 4WFHD 3IXTB 4J6IA 4LSPH 3MRGA 4Y4KC 2UXGA 3II1A 4PJ9A 3X1BA 3DTXA 3CZJA 4PJXA 1NGWB 2VLKB 3DO4A 4FZEH 2V37A 3UTSE 2ROXA 2LT9A 3ARQA 2Y6SD 2BNRB 5GIRB 2CPCA 5CINH 5IR1B 1WGOA 5L9DL 3J27A 1DJZA 4WEEA 2CR6A 2PYEB 1OTUC 3LRGA 3MR9B 2X1WL 4ZAKA 2E7HA 2JB5L 2EDLA 1F4HA 2HJFA 5DFVC 2YZ1A 3CC5A 4XC1L 1A6TB 4JZOB 1H8NA 3ARSA 5CHNB 3BMWA 1NCWH 1RD6A 2VMDA 4IDJH 1MRDL 4LLVA 3ZYOA 3FYEB 2XWJA 2NY1C 1IEBB 2Y06L 4M02A 2WZPA 3CFBB 4BWUA 5BS0A 1Y1UA 3O3DA 2CLRA 2CDFA 4L3CB 2Q7AA 4YGVA 5T1DL 3JTTA 2G2PA 1A4BA 3O3EA 3WFZA 3CGTA 3H9HB 4LEBA 1M2VA 5I8EB 1C5DA 2APFA 3MLXL 5D7JD 2W0FB 4Z95L 4JFVA 4DO6A 2XDHA 4JK0D 3FKUS 4FG4A 4N20A 1FIGL 5T1KA 5IEKA 3L3JB 4JFDE 1BMGA 2OPCA 3G6AA 1HXMB 5E2WH 5E1QA 3JV4B 1NH6A 3F7LA 4P5TB 1UXMA 3MLSH 3ZL4L 5HHMB 1UM6H 3Q5YA 3WS3A 4DTGL 3X3FH 1QTSA 4G70B 2RJMA 1G6RL 5CJ5A 3DVNB 4LRIC 3B3IB 4CGUB 4NN7B 3AQXA 1U8PB 5JTWA 5L88H 3MLZL 4P3WA 4MVBD 4AC4A 4GIPD 4A2GA 5DWPA 4NKMB 1BP3B 3SPVB 1ORSA 3FBKA 3KPMA 2FNBA 6FABL 3ZHLA 3QXVA 5C09B 3LEYL 5ADPL 4JB9H 1IGMH 4ZW3A 1FV1B 2FEJA 5CEYA 2V5MA 2WVVB 1L7TH 1NMAL 5BXFA 4M03A 1MPAL 3MNWA 3T9WA 3IDGB 2PW1B 2EDTA 3POCA 5EF3A 2R2HB 1FCCA 4OGYH 4LRIA 4LGSB 1D5XA 3QNXB 1M9SA 4P4KC 1ZPUA 1JI2A 4KROD 4CVXB 4OUUB 1HDMA 5F8RC 4P2YA 2F1AA 2GIYA 1EEZB 1EHKB 3HBZA 5AL8A 5FHAH 4WTXA 3T0ED 1BDYA 3IJ9A 3MBWA 3PXJA 4TVSa 3WXWH 3RURA 4PJCB 4F7KA 2IADA 3BGAA 5IREA 3WYRA 2JCCF 1AZNA 5CN3A 2CJSA 4HCRA 2R27A 4YDKH 1NLDL 2WLHA 3QIBD 2YLHA 5AB0A 2BRQA 5IQLA 1F45A 3N44B 2R8SL 1SEBB 5I1IH 4ZFGL 3QDJB 5H37G 2CA4A 1MVYA 4ELKA 4S1DD 1MQ8A 2PF6A 1ZJBA 2IPUG 3UTTD 5HI5C 1AOZA 4IU2B 3V7MA 3G5XB 3O6LH 1QLRB 3DO7A 3N5AA 1D2OA 3IKKA 5E51A 1YEEL 2DYPD 2OTUB 4MJJA 5HGBA 5E4OA 1CFQB 2QHRH 1DZ0A 1GS7A 3ZQWA 4YHLH 1VF5C 5E2JA 1T04B 2FL5B 5ABAA 2OZ4A 1QRKA 4Z7WB 3EO9H 4YFEA 1BX2A 4M1DL 5IWLC 2UZIL 3SYCA 5E8DH 3IETA 3C9NA 2XQBH 3NIFB 4XGZA 4W9DC 1HI6A 2FCBA 2X9YA 3EOTH 5F97E 2A5UA 1Q9LA 5DF0A 3S4SG 5E8EA 3PGCB 4JG9A 2BSRB 3GB7A 2PWEA 4NAQA 1L5GA 3WEMA 2GYSA 3NA4A 3SBRA 5K9OB 3GGWA 3CFUA 1DN0B 1GOFA 2BFVL 2GEQA 4H0GA 4KUZL 2XWBA 4IMLA 5C0GA 2HG5A 2D7TH 3STZA 1WC7B 4LLYB 3DX2A 4EBQL 1ZPLA 4P2CG 5M7QA 5IF0B 5C0RH 5FCSH 5IWLA 3SQOL 3RPBA 1W91A 5I18H 3RX8A 3LV3A 2EEFA 4ZSOE 3HC2A 4IOIB 2Y7QA 1HHJB 2XVLA 4M1GH 4ZW6A 4A6YL 4F2ME 5ES4B 2NXYB 3MTRA 1KIQA 3K91A 5KVEL 3UZVB 1T2JA 1YC7A 4MXVF 5IHLB 5LXGH 1S7SA 4JHVA 3QWQB 3QQ3A 3GMLA 4YLQT 2VDRB 1HNFA 2GT9B 1IGCH 3HB3C 2BCKB 1GGCH 1NKOA 1ETB1 4GRLD 1O9WA 5FO9B 5EZLA 2X6AA 5DZVA 3HS0A 2EVFA 3BEWA 4X4ME 1GYVA 3EBAA 2EZ0D 1WYJA 4DK3A 3U36A 4Y19A 4G1MB 2D7PA 5AL0A 2CO7B 1IKNA 2QPFA 4RGMC 2ICWA 3CFNA 2OZ4H 4R7LA 3ET9F 3CVHB 1XF4A 4G8AC 5DJ2B 1Q9KB 2IGTA 1RJLB 1SXZA 2VXVL 3GSVA 2EDMA 4LB8A 3CLFL 3DVGB 5BV7L 3DUUB 5F0LB 5INCA 2EC9T 2LU7A 3MJ9A 5E5LA 3MV7B 1BCIA 2NMSA 5ESVB 3TU6A 1WICA 1GH7A 2H0JA 4HJ1A 4HKBA 5IVOA 4OZGB 3UTSA 5E2VH 3RIFK 4JCWA 2JJSC 2F2HA 3GTTA 2W65A 1IQWH 5EEZA 2Y5QA 5FFLA 3T3MF 1JZ4A 5CD3A 4P0DA 1NMBL 3HE7C 1A4AA 2IBGA 4PP2A 3GHBH 4E42B 2YA0A 3L16A 4Y8AA 1AHMA 3HVNA 4POZD 1AC0A 1NJ9A 4XTRD 3WTWA 1Z9PA 4HJ0C 3LS5L 4FDWA 4ZOBA 2AFNA 5DZOA 4AYEC 4PRHD 3S9DB 2F9BT 4IOSA 2XY2A 4OD2B 4G9FD 3U9UB 2PYFB 3FFCB 4GO8A 3C8DA 2EDWA 1FNSL 4JRYD 4LSRL 3VCLB 5DU7A 1KTKE 4HKJA 4QRTB 1AYOA 3IRZA 2A9DA 4F5CE 3II3A 3FU7A 3VGEA 2WBXA 5EU6B 4E41E 1UACH 2UZYA 3HE7A 2YBRA 4IK7A 4WDIB 1TVHB 4JGNA 4JL1A 1TR7A 1JXDA 5CN1A 4H1LB 2ZAIA 3KG5A 3L08A 4PRNA 4JPWH 3P3TA 4DPCX 1SMDA 4FMVA 4YHOL 3V0DA 2Y7NA 1SFDA 4NUGL 5CJQL 1IC7H 1HILA 3P9LA 3VG9C 1NANH 4XMLH 2D0HA 4Q2ZB 4XODA 5D6DC 1ZSHA 3ZKND 3PPEA 3MUGB 2EH8H 3MJ9H 4NERA 4H0IA 2NPLX 3S97C 5FUCC 3DPBB 3QFJB 3ILEA 5C0DB 3BZEA 1OGAE 3SHSA 3T77A 5CZVL 2KPWA 1HYSD 1ET7A 3MCLH 1ZKAA 2XRAL 3R1GH 3L4TA 4X50A 4BH8B 1JS4A 4DNLA 4GKNB 2WO2B 5I19L 2F68X 2P28B 1RQ5A 5DVOA 2R2BB 2BZDA 3AM8A 1OTTC 1TTCA 5C92A 4K3JL 3V6FA 4N2EA 5DHXB 4HZLB 3JWNE 2R9HD 2AI0H 5D6DA 3V0IA 4PUBH 1YEJH 3RKPA 3KXFA 4QHUB 1A7OH 4BKLA 5IJBC 3KR3L 2NY4C 2R1XA 2X4RA 1O6TA 4P2OC 1DEEB 1C08B 1EX0A 1ZHLA 5C08B 1TF4A 5TH2A 4OD3L 3UMNA 4BA8A 3O2DL 2QV4A 2CJUH 4HBQA 2OMYB 4YSRA 5HYJB 4AYDC 2WC7A 1S9YA 1OKEA 5EO0A 4Y16D 4HIIA 3DURB 4PFEA 3JWDL 3L81A 4OM0H 2YD0A 5EN2A 4AQAB 3KPRE 4J3TA 3TCLA 4JDVA 5TE6L 1BWWA 1IGJA 4ZO6A 2APBA 3EBHA 1LO0L 4R96A 4C56B 4JZJB 1MFAL 3CH8A 2AV7B 4L3AA 4JE0A 4N6RB 4NSKA 3RTQB 1DE4B 4S1SL 5B3JE 4PY8J 3ZSTA 1OIOA 4AQOA 3L4YA 1IBZA 3WIFA 1MFBH 4G5AA 3KPSE 2ZCHL 1C7SA 4Z7UA 1Q0YL 3AMLA 4J4PA 4JRXE 3RI5K 4ZD3L 3RY6C 1KJ3H 1CBVH 4HMEA 4ZFOB 3ZVVA 3VW3H 2CKNA 1A3ZA 5E94A 3L7FB 4UOQA 1QLFB 4ZJ9A 1U3ZA 5DJZB 5DZ9A 3DHMA 3K1KC 1NC4D 1SYVB 5KJRH 3U6XA 2EH7L 5I1KL 2I9TB 3BN9C 4EQ2A 3GMNB 3P73A 2XQYK 4H25A 3E2HB 1RVFH 1SOXA 4S0TD 3TP4A 5C0ND 2AJVL 3PJSA 5CBEB 2HTLC 3HUJB 4HLEA 3ULUL 4Y89A 1HAUA 4TVPL 1RK0B 4NAMA 4HV8B 4WAFA 5HHQA 3BO8B 5FO8B 3B2UC 1L9TA 5E6ZA 3GXTA 4FXTA 3FT1A 3GSQB 3EJQA 3RY6A 4F2MA 1CN4A 3V9EA 2B1HH 3JZ7A 5L8KB 1DSFL 1MCCA 2DQTH 2VDQB 2Z31B 2BNQD 4P23A 4CILA 3FH8A 1EK3A 4K7PH 3ZTNH 5ABDE 2X2JA 3LMJL 1WAAF 3NIDF 1F4WL 1QOKA 2VERN 1A9BA 4XOCA 5FF6A 2YAQA 1R9FA 1CI5A 2FUTA 1MRCH 4MJ6B 4OVUA 3L54A 4PWJA 4LPCA 1JWMB 2NLJA 4LPWA 4LU5L 2FQDA 5BRPA 4BBWA 1UWYA 4X4MA 3LKOB 3CZFA 2Q3XA 4CKVX 1NOLA 2OXGA 4JKKA 4F92B 5K59E 5D6CB 1UYWH 4RSYA 5D7HA 3WFHB 3RG1C 2FJGB 4PJFF 3ZX1A 4M43L 1G9MC 3GSNA 1VAHA 2ZPKH 3MV11 4PQXA 4U1HA 2ZP9A 2CAKA 5LAXB 1XD1A 2BHFA 2RACA 2DD8L 3WS6C 5IQ7H 4Y2DD 3QXTA 1PGRB 3F65A 1CICA 2R1WA 2E86A 1I3UA 1ZS8A 4HOWA 5ITBH 4HDIA 4HJSA 1UWEL 3H9SD 5HY9A 5CKAA 1BPVA 5E2WL 2VDPB 3AREA 1CUOA 4S11A 1HKLL 1YPZF 4PWHA 1DBMH 4TTDC 3TPKA 3X14A 3FRPA 5B3NA 1OGSA 1TZGL 4PJAE 2PP7A 2VW6A 5HI3D 5A16B 3EYVB 4GKOA 2NTFB 3ASNB 3FB8B 1JOIA 1ASOA 4OLYH 1OAYH 1VPOH 1OM3H 5HDBB 4BWWA 5FIEA 3FQTB 2HKHH 1UKQA 2XV0A 1E5BA 1P7QA 1OAUL 2NX5B 3WS6A 3ECBA 3BP5A 3PWPA 4M4RA 5BPPA 4ETQA 4F15C 3ARUA 3FTWA 1F0LA 2DLEA 3VTTA 3RP1A 3QXAB 5IK3B 3VUAA 3U6XS 1CLYL 5A3ID 4CW1A 1E50A 3CFMA 5DHVB 2FBRA 3RWGA 1IGIH 2B9BA 4Y5VC 1IAIH 2IG2H 35C8H 2EE3A 4NRYB 1VADB 4HAFA 5DRXB 4HXAH 2V5RA 4NO2B 4U1GB 5EBMB 3UCRA 2PTTB 3QUHA 1HEJC 4AV5A 7FABH 1V7ML 3HAEG 2Y6SC 3NSXA 1MG2C 1WVZA 1JZJA 3MOBL 1CD0A 3GSNH 4WI4A 3QQ9C 3WUWB 5D4JA 5TFSL 3WKYA 2O6EA 3IFPB 2OMXA 4QWWD 1L3NA 3LPFA 3QIWB 5I2IB 3EJYC 5DD3H 3FRUA 5JLZB 1EHAA 2RCSL 3MN8A 3EJTA 2XA8L 3RVTD 1KENH 4NQVB 1V54B 3GK8H 2J8UB 2XPGA 4JN1H 4DZBA 2Z8RA 5DQDH 3MHZA 1OGAA 1BJ8A 2DWTA 1U3HD 5DSCB 3UZEA 4HIXH 4M4PA 1E4KC 3F64A 3F7RA 1OAQL 4XBPA 1KBPA 1U8CA 4I2XE 5ESQA 5IKCA 2WZ6A 1PQZB 2P5EE 3BPLC 1UM5H 4WSGA 3EGDB 5H8DA 3U82B 4IGBD 3VB8A 3ZTCC 1A6VL 2XKNA 1PSKH 1HHIB 2V9UA 2B14A 5H2BB 3VRIA 4YHLL 1VKXA 5E7BA 2NY5H 3BPCA 4KQ4L 1TLKA 4CNIB 5IZ7A 4FLHA 4NO0D 4WVRA 3ILPB 1JV5B 5IJVB 3GUFA 4HLZH 2BOCA 3MYZA 4N8VB 3KWTA 2MPAH 4JFZH 4I3GA 3ZZLA 1KC5H 3HJEA 4PJHA 3HPJA 4FNSA 3N41F 4QRBA 2PCPA 2V9QA 1ZVNA 4PB9L 5GGSB 3UTQB 1XEUA 2VW7A 5E8NA 1E4KA 2ORBH 5EDSA 2HH0L 3E6HB 4RWYL 5I66B 3TFKD 2VLMD 4WI0A 3VVWA 3WSQL 3JTBA 1HJBC 4N90D 2V3FA 3HR5A 4PJ8D 1JZ6A 1FNEB 2VKXA 3K8KA 3LN5A 1GIGH 4XXDA 4UV7H 1QLEL 3DTUB 2QTVA 1KJ2B 2WQ8A 2XQ0A 2FO1A 5HHPA 3US0A 5GPRA 1MFMA 1QHQA 3QJSB 4KRLB 5GZND 3RTLA 2Q1EA 4P5MA 5AWNH 2WUBL 2VMJA 3O3BA 3CN4A 1NL0L 1AR1B 3RRQA 3V5HB 3RA7L 3WTUA 3WJMB 1BVKB 3KPSA 4X9HA 3ARFC 2ZOKB 4KROC 3CZNA 4K55A 2VN4A 2K6ZA 4JRXA 4GOSA 4JY6A 5K1VA 4FHKA 3S6CA 2WIIA 3HN3A 1PIFA 4OY9A 5I0DA 5EC1A 1RMFH 5CLYA 2E5EA 1ZLUH 2QLYA 4HIHA 1LEKB 4I77H 4BFFA 4JFTA 5CMAB 3UJJL 4O58H 4U1SB 1GKEA 4NQSA 4X0NA 3RGHA 3UTPD 3OKNB 1WLHA 4FFZL 4RAHA 2OMTA 2VM4A 3H7BA 4YFDB 2RB8A 3WI9A 4EEEA 3E9TA 2UYLA 1UEYA 2H47C 3AU1B 5D1XE 2ZKMX 2HA1A 2A9NL 4MSWA 4TNEA 4MAZA 3VRLE 5GRVL 1GGIH 1JMXA 1U3JA 1Z9NA 3IF1B 1QSVA 4E9VA 1D7BA 2WINB 5AG9A 1YEDB 4IM8A 3TH3T 1MAML 1KSRA 3ZDXF 3WU1A 4NCC1 3KDMB 2QADD 4MDIA 3PAVA 4P46B 4ADIA 1TYEB 5EA0L 1CT8A 4DGYL 1K4DA 4IRZL 3ZSSA 5E5MA 5BO0D 5DQJB 3W0WE 1MCBA 3ZE1B 5DTFB 2CO6A 2IMNA 4XP9H 3BVUA 1WBYB 3GHBL 4OZHE 5KEZA 3SDCC 3GLEA 4GG6E 4CBPA 1TPXB 4PGDB 4AJYV 1EBAA 5B8CA 4O02L 3ULVE 2ITDA 3MJ7B 4X8JB 3K0YA 1OHQA 3D9AL 4FLQA 1YECL 4FP8L 2DQIL 2ITFA 5J5EA 3V0HA 1I3RA 1SEQH 3TBYA 2OP4H 1OSZB 5C7XL 2LHAA 2C5DC 2PCXA 2WTOA 3HLAA 1ZANH 4OV6F 5DHYB 1T6BX 2OR9L 2EXWD 1DJSA 3U0TA 1TTGA 1S8DA 1MI5B 1S7RB 1UACL 2MCMA 3SJVD 4FNLH 1RZ7H 5KG9A 4EKJA 1QVOA 3CSYA 3GMPB 4Z77B 5SWZA 1I1YB 3SDCA 4POUB 4ZMAT 3L5XL 5JW5A 3B7YA 4KJPD 2ED7A 1FAKT 1UWXK 3HKZA 1KNOA 5F96H 3MV01 2H2SD 4XMPH 2P42B 1W16A 4JQXA 1EZVY 2XX0A 4K94C 4N2OA 2CUMA 1N0LA 4KKRA 1AHWB 3SPCA 3MRQA 3T3PF 3KHQA 4APXB 2NY0B 3VFSB 4XN8A 5I6NA 5TK2A 4NFCA 3P11L 4U4IA 1S7UB 3I6LD 3VU2A 5A43C 3ZRSA 3QI9B 1JDDA 3FL7A 4OFIA 1BVLB 5EIIG 5J9PA 3NDYE 4MAYC 1JPTL 1NC2D 2VJ8A 2VJXA 4MNHB 4FQJH 1DCEA 1LXMA 4L05A 3HI6H 1LLAA 2OCJA 3BZDA 4B9JA 4A2EA 1EDHA 1I9IL 5IB3A 4G6JH 1XF3A 1FDLL 5AW0B 3U9PL 3B83A 3KYKH 4U6YB 3DYMA 2TSAA 4LKCA 1I31A 1KCVH 3L1EA 3I6SA 1NFDE 2VYRE 1J18A 4TUJB 3QCVH 2YHGA 1PAMA 2ENJA 1B2WH 4BE6A 4CMMB 1UOLA 4P2RE 3BD3A 3CBJB 5F7HA 1QG3A 4N2IA 1I8IB 2CJUL 3BP4B 1WUNT 2ADFH 4PLOB 1J86A 4JL2A 4RNRA 2W07B 1BZQK 1BLIA 3GKWL 1QFPA 3RWEB 5B38A 2P46B 1ORQB 4XPAL 2HX7A 5T3ZH 4D0CA 3VMOA 1FE8L 4ZX5A 4F8TA 4GW1B 5BZXA 2BERA 2ADJB 2H4EA 2P5EA 2WKGA 4NDMB 5A2BA 2I85A 3NJNA 5EZOH 3BH9B 5GRJH 1MLCA 3RVUC 5MENB 4KXDA 1DANU 1OW0C 3MRMB 4MA7H 3V0VB 3U25A 2XTJB 4XPHL 1U8QA 1HEZA 5F1OB 2NZ9D 1JK9B 2ZSWA 1HL5A 1EAQA 3D85B 3TC9A 5CU5A 3CQFA 1MWAH 4A39A 3OLDA 2WXOA 2VISA 2C1PA 1F4YH 4LOVA 1TEGA 4Z7VB 3TJHC 3ZKNC 4UAOC 3VD4A 2XN1A 1QI3A 3EUUA 3SDXF 3RJDA 5I1EH 1ZVYA 1WZMA 1D9KD 4K94H 5A2IH 4O9HL 1CFVL 2CR3A 4ORZC 4GG8B 1CGYA 5DYFA 4DEWA 5A2AA 3MLTB 4RGNB 4B50A 2HCZX 1OW0A 2CIKB 3VXUB 4F7CA 2FGWL 4NQEB 3NT0A 1OVZA 4P59L 3TCTA 3K71A 1MW2A 1U6AL 2DQCL 4JJOA 4Y0GA 5LBVA 1OD7A 3KVPA 5LKNA 1Y6MR 4JFFD 1XGRB 4RISL 4XZUB 3QEUB 4N9GB 2OTWB 1GPOL 2B15A 1OCZB 2B1HL 5MP6L 2WXNA 3BDYH 2A6KA 2JKXA 2CDEB 3GSOB 4E9RA 4MB4A 2XOTA 2YZ8A 1P1ZB 3MPCA 3TXAA 5IW3A 1AGCA 2VRAA 3M88A 3BVNB 1NGXB 4RIRA 2P26A 4GXVH 4A37A 4A2LA 1S7TB 4N8UA 4ZFFB 2GC4C 4Y9GA 4AYID 3FAWA 3P0YL 3MBXL 3QHFL 3FZUD 1WZKA 1U30A 2X4SB 4QPEA 1S9WA 3IMSA 5JZ7C 3VXSE 5D2NB 4HC1L 4AW7A 3B3BA 4Q9QL 1YMMB 4WFFD 4MJHA 1EJOH 1XGUB 2F1EA 2VLLB 2H32B 3DBXA 3DI3B 3TO4D 4XAWH 3W39B 5HHOB 4V1DB 1BFVL 3BWZA 4AENB 3Q5OA 4HWZB 3ZQ9A 1E7UA 3HNSH 3O0RH 5D1XA 2Y1YA 2F58L 5ICXB 5DDHA 4QYOA 4MDRA 2ZX5A 4PG2C 5JUEL 1M7IA 3RL1B 3SKJL 2BVTA 3GJFB 3ARDB 4X5LA 3ULVC 1ZWIA 4BSVA 3IMRA 3C5ZB 3GDCA 3Q8EA 4N28A 1FVDB 3MFFB 3QG6B 1FZJA 3ZDYE 5IHBA 4F1ZA 1T21B 4L9LB 3BQUC 1CFTB 4HBCH 3S36X 1ZIAA 3H9ZA 3OGCA 4WUUE 4X7SL 4FQCL 3UADA 2IPKA 3ARGB 4XZ4A 3W0WA 1UQSA 2BC4B 2G75B 1CG9A 1UXSB 4U1NB 2J20A 2YWYA 3ECWA 4X8GA 3RE0A 4OZHA 2OL3L 1X9QA 4Z7QB 4O2CB 4JGUA 2WWKT 3Q2LA 4GG6A 1KIPB 3P2BA 3AUVA 4XN7A 2W0PA 3DX9A 2UXFA 4PG2A 1SDYA 3PUUA 1JPSL 5EEUA 4PYHA 1DLHA 3A6OA 3P30L 1DBKL 3VX1A 4YIQA 2DQEL 1SOQA 3IBOA 2E7LC 5C0NC 3BQUA 1JNHA 1G7MB 5MI0C 1DQQA 3LN4B 3ZIYA 3PWLA 5FGCB 2V2TA 4ZI8A 2NY2D 2OCCB 4R7XA 1TQVA 5HJGA 3NK4A 4UQIM 4W70A 1G6RB 2EYSB 3SE8H 3D6GA 3FQNB 3IBEA 4ZXBD 5AFAA 5JOPE 1TU2A 4BQ8A 4GI8A 4L5FE 4FEMA 4QXUH 3UTSD 1T2QL 4RZKA 1CZ8H 4MCZA 1RPQA 3NIGF 5AKTA 3C87A 2F5AL 1S2EA 1VGKB 4HH9A 4HPOH 2HPTA 4BYHA 5EBWA 3MV8B 5F6HJ 3SKNB 5DMJB 2E6JA 1MDAA 5HJDA 1UADC 2VDOH 4AGPA 4WHYG 1IC1A 3DX6A 4J3UA 4NOFA 1PDKB 1FCGA 4A63A 1JXFA 1DQML 3QJHB 1G0YR 2Q10A 2OQJA 1WFNA 2V6HA 1I8KB 1WCBB 1BZ7B 4ZUVB 4PR5A 3CAFA 2VN6A 4YGAB 2NNRA 3MRNA 2VMEA 1MCOL 4CJ1A 2XIDA 2L7EA 1G9ML 4ZX4A 1F8TL 4M7JH 4O51B 3D05A 5D70H 3GZPA 5EF2A 3RUGF 2K8MA 4PJBE 3QNYA 1NFDA 3W57A 4CVZA 5CWSA 1G7PB 4JFDD 4KNSA 1RUKH 2PO6B 3ULVH 2HVKB 4GINA 2HFEA 4GAFB 3N9GL 1BFOA 4OJFH 4P06A 2O6DA 3APMA 4NHCH 2YD3A 5HHXH 4P2RA 4UUJA 3UEZA 4MQTB 3VNZA 2F53B 4DESA 4TULH 1R5VA 2WN2A 2KDYA 2N1KA 4Y1SA 3PU7A 4G43A 4JFSA 3CXDH 1PX4A 5TPWH 2ESVE 4A7UA 2ETWA 1P4BH 2NOYA 4GS7C 1KCSL 4OF8A 4F58H 5DJ0B 4LCWB 2R0ZL 3QUZC 3AACA 4XO8A 4MD5B 1AD0A 5ETUA 1JERA 3D39B 3ETTA 3N2JA 4B9KC 4ODUB 4WW1B 2RFXA 4N8PA 3UIYA 3VA6A 3WE6A 1TVBA 3HI5H 5FECB 2B4CH 1LD9A 2P4AB 1RZFL 2DKMA 1UD4A 1HWGB 4N4YB 1JK8A 1FZOA 5F1NB 4PTUA 4PWIA 2CLVB 4LL1A 5JIHA 4JPKL 1FP5A 1MH5A 4KPHL 2DYSB 5IFAH 4KTDH 3BWSA 3DSNB 4F57L 3RWHA 5ICYA 3QORB 3RWCA 2J8HA 4Y9CA 1ONQA 5EU5B 3U7YH 2P44B 5EEYA 2W5PA 3G6JE 1PD6A 3QUZA 3TF4A 1KWKA 4S1RH 3TBVA 3OJMB 4MJID 4HMCA 4L3EE 2XG5B 5ITFB 4B9ZA 2NNCA 3KWVA 1TQCC 4M5ZH 3GXDA 5DUJA 5DLML 2RTTA 3T8VA 3IJSB 3WJLC 3B9AA 4OCXL 5F0PB 1XH2A 4WK4B 4NZDA 1ZHBB 3QZWB 2WZ0A 3S96B 1BZOA 4M5YH 4TL4A 3QHTC 2ZYIA 5HPMA 3GS0A 1L9PA 4N3TA 2J5LB 2VRQA 3N42F 1RUMH 1UWFA 3AAZB 5E6YA 4ELMF 2PXYC 4FQXC 3L4CA 4IIQA 2NSXA 5I0ZA 2ZXQA 2WNKA 2GY7B 1A22B 3OJ2C 3LKPA 4BFIA 3CHQA 1TJHH 5HYSB 5KSUA 1IGFH 3AS0A 5ANMB 2H3XC 3HBGA 1SOSA 3T2QA 4JFQA 1U91A 1AMYA 3S3JA 3WV0A 1WISA 4R8WL 4KK6C 4J5VA 2X6UA 4J4PD 4Y4HB 1TQTA 3VSQA 2I60H 2BHZA 5D8JL 5BV7B 9PCYA 2FO8A 2IDSA 3RU8H 1U92B 1YN7A 4IEFB 3O4OB 4YFLI 5IQNA 4Z0XA 4N0RA 2OMUA 4JPVH 2PXYA 4FQXA 4AQ1A 4WWOA 3TTSA 2VJ0A 2Y36L 2Q87A 4F37F 4RESB 3GBDA 5E9DE 2EEDA 3T8MA 1SEQL 2CIIA 5AYUH 3VGBA 2R0WH 2D3NA 1SMAA 2WZAA 2BW5A 2YQBA 4AVJA 4H20H 2P5WA 2BOBA 4G8GE 4QRPB 3O6FA 3S8WA 1J1OH 3QO0A 4FXKB 4TQIA 5FA4A 3VXQB 1UM4H 2WTRB 4DEPC 3MJGX 4WUUA 5IMOB 2CGZA 1XGYL 4P23D 2PPEA 1LDPH 3GRWL 4EVNA 3MOAH 1C9SA 1WE5A 4PJ7B 1OK8A 2IV8A 2UX6A 1QUPA 3D48R 4Z3GA 2EIZB 3UG5A 3GMQB 3DMMB 3V0WH 3V4UL 1I8UA 3CPLB 1C7TA 2WLIB 3KJ4C 4JHAH 4I7ZC 3VXRB 4DK6A 3CDZA 3ALXA 4MMXC 3DRQA 3AVEA 4N2FA 3KAAA 4WGVB 3B9KB 3NJMA 4WV1C 5DQ9A 4MYPA 3TS8A 3P54A 4WFEE 3SN6N 3ZMEA 1AKJB 3DETC 1MHPL 5IOKA 1R5WA 5DD0L 4CKQA 3KPLA 3NFPA 5HHNA 4YDJA 3VH8B 2DLFL 3LH2H 5T3XE 5I8CA 1UZ6E 3GBNH 1A3QA 3I74A 2R23A 5D5MB 2AK4B 1Y18A 5J3HC 5IMLA 3GUTB 1DVYA 3W3BA 1CICD 1N6QL 4WO4C 2Q2EB 2XQYA 3PP4L 3QCVL 3IS0X 1KB9K 2MCPH 4K23H 4G7VH 4LCYB 3ARED 1SPDA 2H1PL 2BP3A 3F62A 4MA3A 2PUQT 1BAGA 1MELA 2FX8H 5JPNC 2DWEA 3X11B 1A7QH 1CVRA 2FB4L 3QAZC 4GUPB 3US1A 1EGJA 2E4FA 4PW3A 1FORL 4RLDA 2X12A 5AOKA 3OAWA 2B2XL 1KY7A 4QRUB 2UVEA 5H35B 1CC3A 5CP7B 1W9XA 4FXGC 5KYXA 1XIWB 2X4OA 5T3ZL 3FSWA 5I15H 2CGRL 3ZHKA 3FO1B 1UJ3B 4OFQA 5ALBL 4NC0B 2WBJC 3VWJC 2Z0BA 3MLWH 3HMWH 1WBZA 4WO4A 5EZOL 3U30B 1QTPA 5MERB 1CL7I 3MJ8A 4PJDF 3EOYG 1PZBA 2HRLA 4XCEB 2IAMB 2OMWB 4WRLA 3AY4C 3NFNB 4OF0A 3TM6A 3ZO9A 3TNNA 4E41D 4ENED 1XAKA 3VNYA 1O5PA 4HUNB 4KO7A 5B7EA 5C07E 4ZZKA 5KYYA 1JWSB 4N0CC 2ZWNA 2OSLA 4FYRA 4XMKH 4LEOB 4CC1A 4QNPE 1X5MA 3Q6FA 2E27L 1I1CA 4YK4B 1DFBL 1MWAL 5EEXA 3NBNA 4J3OG 4F93B 3GMOB 4AGNA 4QHNA 2X5PA 3LEVL 4HWUA 1M1XA 3UGXA 1TZOA 1AGEA 2RBLA 5EOCH 4JY4B 2WBJA 1AQDB 4M8QA 2ESVA 3VWJA 5I74B 3QA3B 5FOBA 4X4YA 4MA8L 1BHGA 1H9DA 1NCNA 4F9PC 2ZKHL 4R0LC 2EDHA 1I85C 4UQ2A 1G9NC 2C7UA 5FKAB 1OGAD 4L5FH 3BISA 4YBHA 1JZ8A 4L4VE 1XSIA 3VQ2C 3CG8A 1KEGL 4NP9A 1DCLA 4NHUA 2Y2WA 1X7TA 1YNTB 4ZOAA 1HHHB 1K8IB 1PMYA 1EGJH 1EO7A 3KW8A 5I76B 3RBSA 4P9ML 4TNVF 5DJ8A 4ORGA 4JO2H 5EUOE 1AQMA 4KHTL 4LHUA 2WN3A 4HFUH 4FQHB 4U1MA 1IQDB 3U4BH 2CDGB 1T7YA 2NXZC 4YDLC 2EECA 4L1LA 4ZMQA 1SUHA 1XB3A 2X4NA 5D7SL 3MO1A 2J1WA 2K3TA 3PYCA 4MZ2A 3G6JA 4K71B 3FB5B 3MQIA 2JLLA 2WLLB 1I85A 4L3EA 3R19A 1B0RA 1UA3A 1E4HA 4KJWC 2EJ1A 4K5MA 5C8JA 1NLBL 3O45A 3D7PA 4BGLA 1TUPA 4Y2NA 5GGUA 3OAUL 4M7ZC 3MUZ1 7PCYA 3KPRD 1CIUA 1RIVH 3I85A 3GHEL 4UIKL 1VFAA 5DA0B 2VE6B 1F1DA 4IBLT 2YPVA 1C16B 3MRFA 2IFGA 4CBZA 4FFVC 2ATPB 3M6DA 1UCTA 2E8YA 3AUWB 4NC1C 4QXWA 3M1BB 4XWGH 5D72L 3TT3H 3F12A 2UZXA 1XXDC 1YY9C 4L8DB 4F33A 5JHAA 1GCYA 3KCPA 1EIBA 4UI2A 1AXTL 5FM5O 1ZT1B 3MCKA 4ICXA 3KPSD 2CCWA 4LGPB 3WFBL 4O00A 4LLMB 2BVYA 3D3VE 4JRXD 5EWIL 4ZUWA 4EDXA 1JV2A 2LQRA 2NQ3A 3TCXA 3U7WL 1P7BA 1EMTH 3S34L 3P9MB 4MBRA 4GRWH 4HOMA 4G7YH 1BAWA 2HTKC 2O1AA 4J3SA 4PV1C 4W9GC 1HXYB 1YN6A 4WQOA 1YY8A 3ZGIA 4AMWA 1A7PL 5CJBA 3ARBD 4R9HA 3WMPA 5E9DA 1FH5H 1Z0MA 3REVB 3UPCA 5JYMA 3VGFA 2GK0A 5DRWA 4XHQA 1Z3GH 4JFEE 4HULB 2WYIA 4JG0H 4I0PB 1HZKA 4F7MB 4M6NH 2OJEA 3UDWC 4XOEA 4YE4H 5C0EB 4G8GA 2IF7A 1PG7L 3BZ4A 4HJUA 1S3KL 1B6UA 3U1SH 4D9RD 2BXYA 4KV5E 4NZTL 3GLDA 4KTEH 3PQYE 1D5IH 1SXAA 4MNQA 3I75B 5LGYA 3MNDA 4OBSA 2C1OB 2KERA 4HPOL 1T4KB 3VXMD 3AQYA 5IVZB 2ILLA 3JV6A 4AM0A 2ZCZA 4JFWA 15C8H 2J88L 4CADA 2XZZA 2GSIA 3AABA 3QAQA 2YPVH 1I8LA 2FBOJ 3CSTA 3WIHL 5MEOB 2GY5A 3MRIB 4YEEA 4XNBA 1I1RA 1GGUA 2G3MA 4PBWD 1JFQH 4W6WB 5GJTL 4FI6A 4RRPG 5DMKA 3UDWA 1BMWA 1FYTB 4EI5C 5IBLD 2EE6A 4QXTA 4Y4KB 2OMVB 4LDCA 4GT7A 5F44A 8FABB 2OSXA 4PIRF 3TZVB 5IEHB 2X3BA 1BM3L 2I5YL 3GI8L 3OKKA 3BFWA 3CBKB 1LEIA 3MBEA 2Q5BA 4OD1H 1A6ZA 2VDML 2YS4A 4K8RC 1UATA 2IEPA 1X9UA 2F74B 2A77H 4EXPX 3ZE0E 1J5CA 1HHGA 3TV3L 1K6QL 3EFFB 4HHAB 4MMZC 1NIFA 4EI5A 3UYRL 1N4XH 3KLHD 3U2SB 2W9EH 4F9LC 2AKRB 1IFRA 4X5WA 3SODB 1IAMA 2LTQB 4MMYA 4XMXA 4ALAH 4C54A 1RKRA 1T0MB 2G2RB 4CC0A 1PY9A 4OQTL 5CCHE 4D3CL 1KFAL 3B2XA 1IAOA 2NY2C 5JHDB 1KPUB 3KGRA 4DW2L 3WDJA 1HL8A 2GHWB 1BLNB 3GM0A 1AO7B 2VQUA 4LVOB 5FK9A 2BIMA 4U49A 1J8HD 1EAPB 3K8MA 3PV6A 3DUSA 1S9XB 4MMZA 1U58A 4OIIL 5E4EB 5F93C 4F9LA 4BWTA 4OGAD 4Y2LA 1DUYA 1YEIH 3HG1E 1T0NA 2BVQB 2DEYX 5C9JA 1QLEB 2VDLH 2YD9A 1XF5A 3HC0B 3ISWA 2EVJA 2Y7MA 4UBDD 5DURD 3MXWH 4ILDA 5K1JA 5T3XH 3QS3A 4E9LA 1H8SA 2XXCB 2JK5A 2OK0L 4BZ1A 1HH6A 2G2NA 4XNMB 4XVUC 3CK0H 4OCMC 2YGPA 2EP6A 4NO3B 5IMKB 3UYPA 3HNVL 3WXVH 3BD5A 2P8LB 4NKIL 3P4OA 3LAFA 5E6IB 1ITCA 3OR6B 4L4VA 5E99H 4FCHA 2PNDA 5F89A 1Q94A 1NIAA 4HWEL 1VIWA 2VLJE 12E8L 1AJ7H 2AV1B 2CJTA 3H7LA 4L8BB 1XTLA 2P5ED 2OSWA 2IXQB 1B0GA 2ED9A 3CH1B 1UZ8B 3RDTD 2VM3A 3H6AA 5EUOA 1ZA6A 1FJ1B 3RZCC 1NIEA 4LLQA 1IEAB 4M48H 4BEIA 3MA9H 4G1EA 2B16A 4TNWK 1JF6A 4DGIH 2XKUA 2WQSA 4WU7A 2YEZB 1G1CA 4PV8B 3KMDA 5ACMA 3ZMNA 2HJLB 4CA4A 4XCNA 1JRHI 3IU4H 4K8RH 1I4FA 2OJZL 4H26B 1YYCA 2NY3B 1B3JA 1XZ0B 1NCTA 3H3BC 2IO5A 2F15A 2Z65C 3K72A 1N12A 1PY4A 4FQQA 1MCJA 3B2MA 4FFYL 3H85A 4PREA 1M7DB 3V6ZB 5LGJA 1BQHB 2R0WL 3AWEA 1Z1WA 2EDQA 1VRSA 3V7AE 2FYYB 3VFPB 1Q1JH 3KYMB 1VZHA 1I8MB 5D71L 3I9GL 1BXVA 1BXUA 5JDSA 4A67A 1CTNA 3NCMA 3D12B 4OZFB 4TOYL 1EFXB 2E46A 4OIFA 3GJEB 5KZCD 3LZPA 5FUOL 2KKQA 1SY6L 5C70A 4XCCH 3BCFA 4IBYA 3QDGB 4O02B 1D5ZA 3PL6A 3LS4L 4UOW0 3ZZ1A 2ZYRA 3KGTA 1DR9A 1E28A 1DBAL 1JZEA 4BZ1H 5E00A 4XI5C 1UWXH 4YBQD 3D3VA 1P7KB 1QSEE 3GBML 4OCYH 3LKQB 2E9IA 1AMXA 2AERT 4PGBB 3V8OA 3DSFH 5F3FA 2JCCB 2CCLA 1O6SB 1PG7X 5IV2A 3QHZH 2BSED 5JORB 2VZ1A 1R47A 4H8VA 1MCHA 4NKDB 1DDHA 4F91B 3CDGB 5L2JA 2ZUVA 3QNZA 4JFEA 4OVVA 5IT2H 3WHXA 4Z3FA 4I3SH 5D1XD 2NNFA 4Y4FC 8CGTA 1UD2A 3QCTL 5DO2C 4JAMA 4Q4EA 4HQQH 5L4MA 3D4YA 1YYLL 1KT2B 1HWHB 2VLKE 1OALA 4KKQA 4TNGA 5DS1A 3T8XA 4D8PA 4DKDC 3BIAX 4FNQA 4JFPA 2DIEA 5CEZH 3CV5A 4KX9A 5C0CB 3WEXB 5JW4N 3NACH 4UT9L 1TEYA 2BNRE 5I17B 4Z1PA 4NNYB 3PQYA 3JTSB 2YKLL 3FUNA 4XBGB 4XPFH 4OCSH 4KDVA 4KK5D 3W81A 2COQA 2J43A 5LQBL 4OKVA 3W0WD 2D7QA 1OAXL 2Z35A 3KL5A 3LQMA 1FNLA 1S9VB 3KBFA 1RH8A 3UO1L 3INOA 3HMXL 4GO9A 1BVOA 3D0VB 3QQDB 3UAAA 4F24A 5B21A 1BQUA 5E56A 1TCRA 2D4DA 4Y4FA 1I9EA 3B2PA 2BP8B 3RWIB 5I15L 5CJXC 3BGMB 2DQ6A 4LEEA 3FDWA 2IOMA 3MTXA 3GM8A 2X6VA 4M7LL 1QWHA 1TKWB 1SUJA 3L3KB 4Q74A 2GBUA 3EOAB 2AHIA 4XVTH 3HHMA 4NWUH 5FGSA 1CFSB 2KQMA 3BDBA 4FTVB 4CSSA 4M7KH 5DD6B 3THMH 3WKML 1JYXA 3GWJA 4Y2OA 3CFTA 5CZXC 2X2HA 1XGTB 3S5LG 4N8CL 1OP5K 3C6EA 2VMCA 1KYDA 4LPXA 4XNXH 1YEFH 4RBPK 3UOAB 4X6EA 4B7LA 5AZ2L 3S3SA 4AGLA 1Z9SB 4RMBA 4RX4D 1YQVH 1ZIBA 2R56L 2APSA 3G9VA 2OI9C 1MFDL 5J6GA 4L2YA 3ZPDA 2V3DA 3SE9H 1DLFH 3DX7A 4EN3C 4LVHB 2ZNWA 1R3JA 1GR7A 1SJHB 4M6OL 1CYXA 1MJ8L 3FPYA 4V33A 4O4YH 5IM7A 1P69B 5E0FA 1HHKB 2CWRA 5DD5L 1KV7A 3HNTL 2WXRA 5JR1L 2QQKL 1SBSH 2AP2A 4UZUA 5F7AA 1KLGB 5EOQH 5DFTA 5GGRA 4Z76A 5CUSL 4M93C 1FUNA 4IJ3B 1J8RA 3FOLA 3ZR5A 4HUKB 1JNLH 4P3CH 2EDYA 1EZLA 3T3MB 3VG9B 3HG1A 5IROD 1AZZC 3UAJC 1EJ6A 2K3HA 4PJCE 2P49B 2EDXA 4EN3A 2XG4A 3FHAA 2G4GA 2YGVA 4B95C 2JTYA 3FU6A 5DZPA 1ZLSH 4Z3JA 5I1CH 3FT2A 3A5VA 1PZAA 1AIZA 3MRCB 3FCTB 3ZU8A 5F7DB 4N26A 4L4TE 2A9ML 3VRJB 1N10A 2N3JA 1ZSDB 3LKSB 4WWPA 1NDMA 1LQBC 4WWNA 2NSQA 3EGSB 1J5OH 4AT6B 5D1QD 4R84A 1L6PA 4IKNA 3AADB 3O41A 3T0VA 5L0QC 2FYVA 2XACC 4IRSB 3SDAC 2VLJA 3VM7A 2NT1A 4I9WE 4ZQTA 1N5AA 2EIKB 1MJ7L 3F7QA 3BKYH 3BSHA 4BCXA 2QZ5A 1YYMH 2AEOA 1MCKA 1W6WA 2NY4B 2L0DA 5FDYA 1FLRL 1JSYA 4M8RA 2OYPA 1SVCP 1NCAH 3V0GA 1W72L 4W9HC 2I7OA 3LNIA 3D0LB 3BMVA 1A1OA 2AGJH 4F8LA 4ABWA 4IHBA 4AEIH 1HE7A 1O7DE 3IFNH 2V2XB 1ICTA 1KB5A 1I1AB 2W9DH 3NN8A 3QRGH 3UC0H 1RULL 4QD2E 1IAKB 1CF8L 4WHTA 3WNLA 3VD0A 1KGXA 2V7NA 1TJGL 2IOOA 4WKZB 4E9YA 3T4AB 3AGWA 1U42A 2V2WB 8PAZA 3WELA 3FQ1A 2OXHB 3SCMD 1Z3GL 2DLIA 4AYFB 1JBJA 3CHRA 5HD8C 2YXWA 3ZE2E 3EJZD 2MOGA 3WEAA 4AKPA 1A2YB 5D1ZB 2BY0A 3O6ML 2XVKA 3OKDA 2MH4A 2OL3B 4TYUA 2YGNA 1G9NL 3NJGA 4R3SB 2X1XR 4KO5A 2R0KH 4XH2A 5F0JB 4JANA 1AOHA 1IM3A 1BEYL 1LQSR 2ADIA 2ZP0T 3IU3B 4KTEL 4HS6B 3R06A 1EV2E 1KBWA 3PABB 4U7KA 3SE4A 4AQZA 1ZEAL 3QUXD 4EIGB 5AAPA 3DRTB 4UQ3A 1QSEA 2FE0A 3VI4E 4P2QE 3KL3A 3QRBA 3RIAK 2Y5EA 3Q9PA 5G5DB 2AJYH 5IBUB 5J57B 1I9JH 3ILQD 1YEGL 3ZT6A 4EUPB 3KBEA 4U1JB 4H2CA 4JPIB 5FA3B 3VXSD 2Y5TB 3LNDA 1CLZL 1FNHA 1WIPA 3AXLA 1MDTA 3KLAA 4G8IB 3PDDA 3T6XA 3QPQD 2FJHB 4N0UB 1TDQA 4NUPA 1JXJA 3ZK0A 1T0OA 1WA1X 3IXTA 5G55A 3Q6GH 3R7RA 3T08A 4ZPVB 3QEGH 4G3YH 4IJTA 1NGWA 2CBPA 2VLKA 4ZPTB 3EYSL 3I3DA 3QCUL 4TSBL 1KB5H 1CD1A 1LO3H 4OZGE 4YO0B 5K1NA 2HT2D 1XCXA 1MXDA 3O6FD 4G2AA 4IBTA 2BNRA 5GIRA 5IR1A 1OWRM 2QPDB 2BIIA 4LSVH 3DX0A 5I6XB 1DVZA 4N2MA 2PYEA 1UHVA 3ELAT 3MR9A 3RJOA 1NAKH 1B9KA 1YCSA 3VGAB 2TRYA 3STBA 4XWOD 1ED3B 3L1OH 1WPCA 2AK1H 4Z7OE 4X9IA 1U2HA 4JZOA 1I9RL 2XZCH 5CHNA 3RBGA 4NIYE 4ACPA 4FQIH 1NFAA 1W2KT 1IEBA 2R83A 3CFBA 1NEZB 1DQDH 3HC4H 4NN7C 1VFUA 4W1TA 3TN0B 4L3CA 4FABH 5ISZB 2A38A 2X42A 2XWDA 3TVMA 1I7TB 5AB9A 3H9HA 5I8EA 5GS2D 4AGQA 2W0FA 5EU6E 4APQB 4Y1AB 3SYAA 2VKWA 1L4IA 1ZT4B 3FUFA 2K1MA 4KQ3L 3L3JA 5TF1H 2UWEE 3DJ9A 1HXMA 3OKMB 4QJ5B 1EXUB 4P5TA 1OF2B 3BVDB 2VC2H 1X5JA 2XY1A 3VXOB 1E90A 3X1FA 2HMID 2APVA 1AXSB 2AAAA 4JGMA 4JZNB 4FMFA 1QQDB 2Z91B 3EO1B 1A7NL 3HVDA 1HZHH 3DVNA 3B3IA 3PHQA 4PJAF 4UTAL 1R75A 2VDLL 3EDFA 1OOWA 2AXJA 5D7KE 1U8PA 2L7QA 3O8XB 4MAUH 4HUWB 2MOQA 2D31B 4NJAH 1RIHH 1WFMA 2ZUTA 1XBRA 4NKMA 5CD5D 1RZKH 3SPVA 1ACZA 4PG9B 5F9OH 1QYGH 2PP8A 4AQEB 1RJYB 4DO4A 1A6AB 1RUQH 4FZ8L 3QZPA 4OGXL 4PJFB 4X9GA 4L1BA 1IFHL 4F15B 3S8FB 2CH8A 5E5UB 1FV1A 3MLYL 2BK8A 3F85A 4CRPA 2WVVA 1ZLVK 1XDTT 4M5TA 1AH1A 4Y5VB 3Q13A 3IDGA 2PW1A 3TA3A 5CCKH 2R2HA 2IV9A 4H7VA 4ODVH 4X6CE 2GITB 5IHWA 4JN2B 2HT4C 3QNXA 2K45A 1R3HB 1T6VN 4OUUA 1KBGL 2A73B 1CDUA 3KPNB 4YHZH 1EEZA 3NSDA 1ADWA 5AQ0A 3WAJA 3L4UA 4YC2C 3IB4A 1YJDH 3GJFK 3N91A 4ZTOH 1IZKA 2P52A 4PJCA 2ALWA 2Q8BH 3S3BB 5HYJE 3QPXH 1OPGH 5KVFH 1CURA 3C08L 3BAIA 1WA2X 2J73A 1N6UA 3OB0K 4GKZB 3KM1A 2NYYD 2WTPA 4PRIE 1SEBA 2QSVA 3N1PC 2QGEA 2ZQKA 3QDJA 4JO3H 1XB8A 2KZBA 1L9OA 4QHKI 5TQ0H 1PLAA 2FSDA 5T8IA 5AOZA 4IU2A 1Z6JT 3G5XA 5DA4A 2NDFA 5D7JB 2ZJSL 1CFQA 4YHKL 3JBG7 4ZYKB 3B4NA 1VESA 4GH7B 1N64H 1T04A 2FL5A 4KI1A 4Z7WA 5E8OB 2EDJA 2VXTH 5ECJE 4ANWA 3LXCA 1R5IA 3KLSA 3WUZA 2NXYC 3H0TB 4UT6L 4R97C 4QIRA 4WJG3 5DUBB 2BSRA 3M46A 1FL5B 2XN9D 4RAVB 4TF4A 5GGTA 1UVQB 4J6RL 1PW3A 2HYMA 1E3XA 5K9OA 5TE4L 1DN0A 5EU7E 5T5NG 4OJEH 4FQ1L 5JA8B 2BSSB 3QJXA 3WAKA 2WYHA 4TSCL 3EOBB 4HZ1A 4UT7L 5E9NA 4LLYA 3L4ZA 2Q7YB 4PP1C 1NDGB 5IF0A 3NMEA 4DIXA 1JF5A 2H3KA 2VR4A 4HIPA 3LRLA 4YMPA 2A4ZA 1HHJA 1O0VA 1RZGB 3E80A 1L9RA 5AB2A 3TWCL 3GF8A 1FRGL 1WJ3A 4RA0C 5GRZA 1WHOA 3UZVA 3OMIB 5CEZL 4FJYA 2VOTA 3FPXA 4ATWA 4XB3A 3WL9A 3TEXA 4KROB 2QT6A 2VN5A 4PS4H 4LNRB 4NNPH 5KYWB 2A1WH 1PZCA 1KTRL 4GNKB 4I13B 4KJQC 2J2ZB 1JTTA 2GT9A 5FO9A 3VI4A 1CXHA 2EO9A 3KBHE 3N41B 1RHFA 3NZUA 3WO4B 3DHPA 4GMTH 3FO0H 5DFWH 1QKZH 1YHPA 3E1F1 5JYLA 3TJEL 4BQCA 3EYUH 4G1MA 3GZOA 4N2BA 2CO7A 1AQKL 3UXFA 4Q0XL 2BY1A 3CVHA 1NANI 3IFOB 1RJLA 4MXWL 3UTTB 3DVGA 4NBXB 4FQ2L 3D52A 2VQ1B 3VX0A 4YSEA 5E9DD 5C1MB 3DUUA 3GMRB 3VRLF 4UINH 4ZFQA 5E0QA 3MV7A 5ESVA 5JQ6H 5IJKC 5KTEL 1UCBH 1HVXA 4EKXA 4OZGA 1YVLA 4G8GD 1IM9B 2V33A 3FF8A 1ZHKB 4GSXA 5GGTH 3BI9X 1P53A 4BCZA 4K3EL 3TIEB 4K4KA 2WWOA 3C60D 2WB7A 3L3HB 3OX8B 3B5HA 4FE9A 5TQ2L 4G6AD 1YEHL 2ERJB 3A6BH 4X99B 4E42A 4OZHF 4U6XA 3R4RA 4YVUA 3V8CA 3DK2A 1DQLL 5AZEH 4RMVA 1OB1B 1E9QB 2BNUB 1FHNA 4IBUA 2KHAA 2Q20A 2WKLA 4GY4A 3VD2A 2ZWZA 3SE9L 3X12B 5IJKA 5E08L 5J6HB 1UOWA 2VXQA 2YK1L 3U9UA 2PYFA 3FFCA 3CMGA 1P4UA 1SHXA 4HSAC 2AZUA 5JNYB 1E27B 5SX4I 4QRTA 5A6LA 2VDRH 3P2TA 4FJ6A 4WFED 5D4HA 3KWUA 4P99A 5EU6A 4ONGL 1N19A 2HUEA 4WDIA 3L5HA 1QUNB 1FFPA 5EOQL 4H1LA 3ZDXB 1A66A 1KXQA 5T3XD 4ISVA 5C6WH 4XP4H 5DVKA 2FNWA 3MMEA 1A1NB 1NGZB 1RZ8B 4E0RB 3MBED 1LTXA 43C9B 5IY5B 1Q90A 3CVHH 4GRLB 1J5HA 2EAEA 1BIIB 4ERSH 5I82A 4UILL 3H3PL 1ZHNA 4NWTL 5GGVL 1QPXA 3WY3A 3IJHB 3MUGA 4U3HA 3BIBX 2VITB 1EAJA 1NCCH 5IBUG 5DC9B 3IS1X 4EUPG 3DPBA 3LNFA 3QFJA 1HH9A 2CHNA 4I48A 2GG1A 2JMRA 3L1GA 1JUFB 4PTTA 1FNGB 3ECUA 3K80A 5SV3A 4ZX3A 4H88L 1J5OL 3KPPB 2OFQA 4LQFH 5HDQH 1WQVT 2H9GB 4BFNA 4BH8A 4NQUA 1FZKB 2EC8A 4PWGA 1U36A 1UD6A 3VXTB 1NGQH 2R29A 3MFGB 5BOZG 4GMSH 2ENQA 4RMUA 2MJWA 2R2BA 4YDMA 3FHEA 3NUKA 5AZUA 4HZLA 4RGOH 3D0AA 3FUEA 4X6CA 3HC3L 4HS3B 1U8NB 5CU9A 3IPBA 4JZJC 5DZNA 5EV7A 1DEEA 1VEOA 4JO8A 1C08A 5C08A 2RR3A 1DZBA 3O11B 2WXMA 5C07D 2VXQH 4XE5B 4R5VA 2LE9A 1WEJH 4R4ND 2OMYA 5HYJA 3T3PB 2K4AA 2GUOB 5T33H 3RDJA 1JZIA 4MQXC 5CJOL 5DC4B 5F9JB 4FLSA 3DURA 4RDQG 3VDBA 1FC1A 2Z9TA 4AQAA 4P3DB 4YQXL 4H1LH 1CDJA 1X4ZA 4PRHB 4G9FB 1T66C 3AFLA 3K6IA 5EBLB 2VR3A 5A2KH 4KKBC 4C56A 4JZJA 1AGDA 2AV7A 5LWYH 5DZLA 3RTQA 2MWCA 3E2HC 1DE4A 3O2VL 4L4VD 5ABZA 2GFBA 3KLDA 4DJMA 3UP1A 1LGVA 2XWZA 3LPGA 5JHMA 5CZRA 3PXLA 4RMSA 1T80A 4R4FH 4LFHG 3WY4A 1GHFH 4YX2L 1QBMH 4JQVA 3EFOB 1H0DB 1W0VB 2YQGA 2E0PA 4NCC2 4NGHH 4ZFOA 1A21A 5HI4C 3BUDA 4XVOA 3L7FA 1QLFA 4K7FB 4RAUB 5KBPA 2XFXB 1FPTL 1OLLA 1E6OL 1MFNA 1U21A 2R29H 4R7NB 5DJZA 5FX3A 2ATKA 2R4SH 3S0PA 4A04A 1RZPA 1SYVA 3BUYB 2F54D 1NFIB 2I9TA 2CNZA 4TVUA 3GMNA 1VCBC 3IT8D 1NCDL 1CIDA 3OB8A 2AMUA 3VACA 3F84A 5CBEA 5D1QC 2FRGP 1OT1A 2JB6B 1RK0A 4HV8A 2QVFB 3BO8A 3Q6GL 1TTFA 4M9OA 5FO8A 2XC8A 4P9HC 4BQ6A 2BDNL 4AE0A 3GSQA 4ACTA 5BO1L 1SMOA 4K3DL 5KUMA 1F6AB 4YXLL 5HYEA 1DVQA 3QYMA 3EH1A 1E2ZA 2OS7A 2Z31A 1K4CB 4XRCB 1KXVC 2MQCA 3T04D 2FQFA 2AVGA 3ZE1E 5KS9B 2JELH 2ZOWA 4NNXB 2B1AL 2XXGA 1B6DA 1IAII 4MJ6A 43CAB 4L8SB 1JWMA 3NOIA 1CWVA 2MNUA 3D3VD 4Q52A 1T03H 4KY2A 4JFUA 4Y16B 3LKOA 3SDXB 5D6CA 1EAOA 2XV3A 3WFHA 4FQIL 1UG9A 3N6YA 1F3JB 2DI9A 2FJGA 3MUHL 5AG8A 4NJ9H 3WTXA 4H5SB 2EE9A 5LAXA 1GW0A 5DUPL 5MHSE 2E9WA 2HFTA 4DP4X 2VDMB 1Q38A 1KXVA 4JFED 1HSBB 3I50H 3L5JA 2NTSP 1GOHA 5TF1L 4X2UA 3P0VH 1RU9L 2XBTA 1A0QL 1RUAH 4GW4B 1MFEH 1TENA 4ZMNA 1SN2A 3FCGA 2FH6A 3LKRA 4U1GC 1HZHL 5A16A 4PJEF 3EYVA 1FL3B 3OZ9H 4K3HA 1I3VA 3FB8A 3B7SA 4IK6A 4R7DB 1SF3A 3B1UA 4N2AA 1NC4B 4JRWA 1XL6A 2DEWX 1KFGA 1CE6B 2O6CA 2VM9A 4ANUA 3H42H 2NX5A 2VDQH 3QIWC 3I2CH 4GAJL 4GI6A 4QGYA 3QQ4B 4UF7C 1KGYE 3QEQE 3QXAA 4C57C 2DQHH 3OAYK 3ARTA 1O7VA 2H1LM 3WKNA 5DHVA 3NZHL 4NRXA 3PNWB 4NRYA 5DRXA 1W8OA 1VADA 2DBLL 4IYKA 4NO2A 5EORL 5EBMA 2PTTA 1A3LH 2BNQB 2Y23A 2BY3A 2GJ6E 4KKAD 4U3XA 1KPVB 1D5MB 1JGVH 1CK0H 3QYCA 4P9HH 3KPOB 4YZFE 2BFGA 3C8KB 3WUWA 3RHWK 1C1EH 3IFPA 4PJGF 1X4XA 1PNDA 1K72A 2OSYA 5IGXH 4WLCA 1F11B 1WCQA 3QIWA 5I2IA 4NP4H 4WWKA 5JLZA 3OBAA 1I1FB 1CQKA 2X3AA 2E47A 3BP6B 2ITCB 1CR9L 2DKUA 2J8UA 4GFXA 3B7TA 3TTYA 1FAIL 4TXVB 5E2UL 4E9TA 5DSCA 2X0UA 2VDPH 3GSRB 3TESA 2VERA 5I1GH 2IWFA 1THCA 1PQZA 3EGDA 1XL4A 4PVMA 1NIDA 4OLWH 3S3DB 1HHIA 1F90H 3B1TA 2QQNH 2YXFA 4YR6B 5H2BA 4FTDA 4XBMA 3FT4B 3IKCB 3H9SB 1NINA 3QZNA 4CNIA 4LEXH 3ILPA 1JV5A 2J1ZA 3BE1H 4K9EC 4PJBF 4N8VA 1B4JH 4J1UB 4BDVB 5DD1L 4DPRA 3GXPA 1E42A 5HDOA 5F2FA 1OEZW 4S1QH 3JT2A 1AR1C 3IWUA 4DZ8B 3NIGB 3IJ7A 2XETA 5GGSA 3UTQA 1GTFA 5ALCH 3E6HA 4JDTL 1LVEA 4ES9A 1MREH 5I66A 2MQ3A 2FWSA 3TJPA 5DHVH 5J8OA 2BS8A 3OM3B 1JGUH 4HGKC 1JZHA 2FEDD 2HWZH 1F58H 2OX5B 4NYLA 1PKQE 5I24A 5EPMB 4RGNE 2FX7H 2DIJA 3JV5A 2UX7A 3BRDA 4X5XB 3VXUE 3QZLA 4NQEE 3D2UA 3S5YA 1YZZA 5GISH 5EZIH 5K9JL 5CP3A 4OLXL 4LRNH 2E7MA 2VLJD 4ZOEA 1Z7JA 3V5HA 3WJMA 1BVKA 1Y0LB 4PS4L 4N2HA 2ZOKA 3RUGB 5HYFA 1V55B 3BAEH 1IGTA 1I3GL 1DQKA 2HLFC 4P46C 2RAMA 3T65B 2EO7A 5I23A 5KYNA 3G6JF 4AMKL 2XWTB 5D2NE 3ZHDA 4XE0A 1LEKA 2NW2B 5CMAA 3ESPA 2J1KA 1JZ7A 5DMGC 2R69A 5HXMA 2Y4SA 4PD4J 1U3HB 1SLVA 1M05A 2BVOB 1KJMB 3AU1A 4PJ5B 2CO2A 3RILA 4HHWA 2B59B 1SLXA 1GZHA 1TPXC 4C47A 2WWNA 4QCIB 3BUQA 5B38G 3FO2A 2VDKL 4G5ZH 3IF1A 2WINA 3SKMB 2AEPL 3KDMA 1H3XA 4OF3A 4N5EC 4P46A 4DQOH 4NO0B 2XWEA 1RFDL 3EDEA 1DANT 1ECZA 2XTSA 4MBOA 1HESA 4W9ZA 5DQJA 1DO6A 5DTFA 4BQ9A 3ABZA 4IHOB 2Y0SA 4ODHL 4YSUA 1WBYA 2NR6D 3A6BL 3BSZL 4FCAA 4Z7QE 1E3FA 2VUOA 2D73A 1KJ2H 3W1ZA 4K9EH 4RBPH 1DUZA 1GGBH 3FO9B 4BHUI 5K39B 2YAMA 1K85A 3DARA 4MCNA 5CP3H 1J1PL 4PJ8B 1N5YL 1PZ2A 3V9FA 2DV6A 1AHWC 3NZ8B 3MJ7A 4X8JA 5EC2B 3ZDWA 1F6LL 1H3VA 1KN4H 3RZWA 3E9UA 4NZRL 4ODWB 2NY0C 4KXZH 1J05B 1ZV5A 1OSZA 1TNNA 3OAZK 1BXXA 3BP7B 3FCSB 3HI1A 3MLRL 2QKIB 4XAKE 5LCVA 5DHYA 4B3VA 2Z0UA 3K6NA 2VDRL 3N42B 5D9SB 3IGKA 4Y8DC 4XX5A 4AYMC 1S7RA 4ELMB 5KSBE 1R3IL 2LU4A 1HSAB 3CJJA 2XXFA 3B43A 3CHPA 3QI9C 4J3WA 3GMPA 4Z77A 3AQZA 3H1ZA 5DK0B 1U8KB 1I1YA 1MCLA 5E6RB 2KZ1B 3OXSB 4NRZA 2R69H 5BZWB 4U7MA 4PD4K 4ABVA 2DTML 1A7RH 2BNRD 1HX0A 3SZ6A 1U8OB 1AHWA 2FX9H 1AP2B 1FFOA 1FGVL 3MV8E 2VDNL 4U3CA 4APXA 5I26A 3VFSA 3G9AB 4MMXB 3DV4B 1S7UA 5BZDB 1ADQL 3AG2B 4N86A 1OGTB 4MNGB 4WV1B 1VJSA 3QI9A 2BW4A 2O5YL 4DO5A 3WTSA 3EXJA 5HDQL 1BVLA 2W59A 4KKLC 3ARZA 3HS9A 3NRFA 4MNHA 3QEQA 4M5SA 4QTIL 1OSYA 4DN3H 1SBBA 3DK0A 5IHZB 4NM8L 3TVMD 3ZMRA 2QADB 1JHLH 4H44C 4U6YA 3VFRB 1FN4B 4N87A 1GXEA 4WIQA 2AF2A 1KEMH 3RVVC 1CGVA 2ZCKL 2HN7B 3WDHA 4CMMA 3DOIA 3KVQA 4JREB 1S7VB 3UTZB 4P5TD 5JPNB 4AITA 4HEMA 4FFTA 1T89C 3SGEH 4Z7NB 4MJ2A 2F53E 4UQCA 1I8IA 5LCVH 4M3JA 2XTJC 3BP4A 4KU1A 4I89A 2ZOUA 2X53A 4JY5H 2HRPH 2WSPA 5AW4B 3WNMA 2W07A 4L4JA 4ONFH 5GS0C 4W9KC 1M7XA 5HGGS 3UBXB 3RWEA 3BVXA 1BAFH 1XQ4A 4FXGB 1P9MA 2OYLA 4QI3A 1ORQA 3IJ8A 3VYOA 2DLGA 4LCWE 2WGNB 1NZRA 3CUPB 4FX5A 4GW1A 2L04A 2ZT9C 2D7MA 3D39E 3QEHA 2HJKB 1RK1B 1U95B 4OBRA 4HKZB 1W72B 3L45A 3SJVB 2DM4A 3BH9A 3FONB 3P3RA 5MENA 1KTLB 4DGWC 3MRMA 4PLJC 1T89A 3TA3D 3N43F 2PWGA 4B0MM 3DX4A 2Q86B 2CMRL 3IK2A 1MFCL 1JP5A 4L9DA 5DJ6B 4TKWA 1JK9A 2P1YA 3D85A 3VB9A 3H8NA 2ICCA 4QNPF 1J0KA 4GP5B 1LL1A 3FN0L 2HT3D 1JF1B 3NABH 2NNAB 4Z7VA 2K6WA 2IH8A 1VFOA 2WIMA 5FYJE 3ILDA 1LO4L 1MJJB 2HJFB 4OM1L 2C4FU 1QNZH 1CD9B 1KN2L 2VL5A 1T1WB 5FM4A 3TYGL 5KUKA 2N0MA 5CGMA 4JCMA 5E1IA 4GG8A 4TMPA 3E0GA 2WVTA 5KVEE 3MLTA 4LLVB 5D2NC 4L4TD 1MF2L 1NC2B 2CIKA 3S37L 3VXUA 4NQEA 1T7VA 3O3DB 4M61B 4YGVB 2AC0A 1NM9A 3CFJB 2FJSA 2P43B 4GLRI 3BD4A 5FDWB 5LB1A 4XZUA 4RFOH 3QEUA 4N9GA 2MHAB 2OTWA 1ETA1 5I6LA 1ZTMA 3EHBD 4PJDB 4HUUB 5T1LA 2CDEA 3L2MA 4I9WD 4YXKH 3GSOA 3ARDC 1JVKA 3P77B 3RIKA 5JW4R 2P47B 3QXDB 1TZHB 3C5ZC 4PRAB 3WTVA 2NXZB 4HS8L 3BVNA 1HZLA 4ZFFA 1Q72H 1S7TA 4HT1L 1VGEH 3QIUD 4L9LC 3EYQD 3CDYA 5FFGA 4HVBA 1LP9F 1OAKH 5JDJA 2X4SA 3I6GB 5D2NA 2GTWB 1FG2B 3CZEA 3TV8A 4BIKA 1YMMA 4NQQA 2DJUA 1IBBA 1F1GA 2WZ5A 3HG0A 5E2TH 3C09B 1MRFH 1YA5A 1XGUA 1ID2A 2VLLA 5JXAH 1IT9H 3UJTH 2H32A 5HHOA 2YGOA 3W39A 2C3VB 4V1DA 5HDWA 4ZO7A 4AENA 2BRRL 4HWZA 3VSUA 1E4XH 4N2DA 2KL6A 2EIMB 2GI0A 4I0KA 2VH5H 5ICXA 3ZHNA 5IW6A 1XVSA 3VFNB 5GS0H 3EG9B 3RL1A 1WFJA 3F7VB 3GJFA 3IEAA 3ARDA 1J10A 3C5ZA 5LG6A 1QACA 5AKVA 4QRPE 4C83B 1AFVL 1CFNB 2GTZB 5BXFB 1FVDA 1N0XH 3DUHA 3IMVA 3MFFA 3QG6A 3V5DB 1T21A 4L9LA 1CFTA 1SDAB 1K5WA 1G5GA 1S78C 2WXLA 3C5JB 1PF3A 4BRJA 2O61B 2OA9A 2ODIA 1FGNH 3ARGA 2ZKYA 3O9WD 2BC4A 1HDMB 5EULV 2G75A 1AXIB 1N7MH 2FD6H 1UXSA 2G0KA 1P1VA 1DDTA 2QGBA 4HXBL 4FGMA 4PJ7E 4R90H 3RNKB 4DFHA 1S7WB 4K7PY 3FMGL 1Q0XH 4O2CA 2X4PB 4PS3A 5CZKA 3VGHA 3MBWB 1KIPA 5JXEA 1D9KB 3KVDD 3SYPA 1H6FA 2ATAA 3VFGL 3QT2A 2DF3A 4P2QD 3VXRE 2YD6A 3OVUB 4NQDB 3WN5B 4AIZA 1LO5B 2ZOLA 4G8EA 5LJYH 1ET8A 2W95A 2IVFC 4X7FC 4XPBL 1JE6A 4XVJL 5BMFH 5FGRA 1BEXA 3WN6A 1G7MA 1A6WH 4YHIA 1R34A 2PP9A 3D06A 1CB4A 4WF7A 1J9SA 2Y3NA 5I1AA 4JFFB 5CSBA 2VUYA 1NSNL 4WO0A 4TQPA 1WFTA 5B1KA 1G6RA 3BFOA 2EYSA 1ZLVH 1EVUA 1KCUH 1WZAA 3FQNA 3RKDD 4PGJA 5HGBB 5LXVA 3K5RA 1PFOA 1SVZA 3GTNA 4KV5F 1Q9WB 3KHOA 3BT2L 4DAGL 1XT5A 3TL5A 2ED8A 3GSWB 2H32H 2HKFL 1MCWM 4PCTA 5FCUH 1T2XA 2MQGA 2PPDA 1C1EL 3BZFA 4IW4C 2WWMC 4RQQA 2FLMA 2XJLA 1VGKA 1KV3A 5AW8B 1INEH 4MJ5B 3MV8A 5JIPA 3SKNA 4QLRA 4KJYB 5L9DH 3GJFH 2PO6C 1A14L 5CS7A 2XZQL 2WLYA 1WA0X 1PDKA 5CFAA 1ERNA 3TO4B 2JB5H 3QJHA 3OB0H 1WITA 1DVUA 5BOJA 5EF1A 1I8KA 1U93B 1WCBA 3B6SB 1BZ7A 3JWOC 3NPZB 4XC1H 4ZUVA 5TF0A 4W9LC 4OGZA 5KVDL 1SXBA 5AVSB 3STZB 1MRDH 2AEQH 2KC0A 2Y06H 1L9SA 3BESR 1KWGA 1ZE3C 2B39A 3S7GA 4IBZA 2XV2A 1YEWA 1IKOP 2WLZA 5CKGA 1IZJA 2RD0A 3LRSB 3UROR 1A64A 4XHJD 3VWKD 4QJ4B 1GMIA 1JNNL 3MLXH 2XVBA 4Z95H 1G7PA 2NCMA 2PO6A 4FEIA 2HVKA 2DWXA 3NEEA 4ODBD 1FIGH 2NT0A 2DM7A 3GMLB 3H56A 3ABGA 1ACYH 4AZ8B 2F53A 3GI9L 3NVQA 5GRYA 5BW7A 1FH2A 3ZL4H 3GKZA 3MYJA 4DTGH 2DMCA 3I02B 1M9WA 3E3QE 2FVNA 5D7KD 1G6RH 4LOFA 1CXLA 4AW4A 1KBBA 1ZTXL 3FSVA 3G5YB 2H45A 2RHEA 5DJ0A 4LCWA 3MLZH 2ICWB 1FF5A 4MD5A 4HOZA 4LBEB 3D39A 1J0JA 2K78A 6FABH 2MRYA 4WW1A 2NY2B 4E36A 4LSTL 5EZIL 2F6AA 5FECA 1G7IB 3LEYH 3R7QA 5ADPH 2A0LD 4ZXBB 2LOEA 3C6LC 3OWRA 2ROYA 3M1OA 4JMXA 4XMZA 2J5LC 4MWFB 3A67L 5F1NA 4UANA 2X05A 1XGPB 5AW1B 5ICUA 2QSTA 1BQLL 1MPAH 4QKTA 2CLVA 3TPUB 3QR0A 2CGYA 4LNVA 2WQUA 5HVHB