4X5RA

Crystal structure of fimh in complex with a squaryl-phenyl alpha-d-mannopyranoside derivative
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
molecule keywords Protein FimH
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x5rA00
1ZE3H 4ATTA 4CSSA 4AVHA 4XODA 4AV5A 1N12A 1N0LB 2JMRA 2XG5B 3BWUF 3JWNE 1TR7A 2JTYA 4J3OH 4XO8A 4CSTA 2J2ZB 5ABZA 5AAPA 5JQIB 3RFZA 4X5QA 2VCOA 3BFQG 1PDKB 4XO9A 4XOBA 5AB1A 1KLFB 3SQBB 4AUJA 4BUQA 5IQMA 2WMPB 5FLUA 5F2FA 5FS5A 3JWNH 4AUUA 4X5PA 4J3OF 5IQOA 1UWFA 2XG4B 4XOCA 5LNGA 4XOAA 3BFWA 4AVJA 5FWRA 4AVIA 4AVKA 3MCYA 5FX3A 4AV4A 3ZL2A 2W07B 1QUNB 3JWNG 4J3OG 5CGBA 3ME0B 2UY6B 5F3FA 4AV0A 4AUYA 4LOVA 4CA4A 4X5RA 3ZPDA 1KIUB 4XOEA 5IQNA 2UY7B 5AALA 3ZL1A 4X50A 5LNEA
chains in the Genus database with same CATH superfamily
5E4AA 4HV8B 1JYXA 2IDFA 2IQ9L 2QQLH 4HG4J 1BQHB 1Y18B 3OMNB 2Z92B 3VXRE 4V1DE 4Y88A 4UTBH 2AEPL 2HFFA 2J3SA 5CKGA 5CEXB 3GBEA 4JFYA 4LSTH 4L8CB 5KSUB 4HGWB 3QCVH 2JJTA 3C09C 1G6RB 3HNVH 4EN3C 2Q9OA 4HKZA 1N0XH 4QRRD 4PLKC 1V7NH 5C0IA 4QO1A 4XI5D 5E8EA 1YLBB 2D7MA 2AEWA 4ECNA 3MJ7A 4W9LC 3SDYL 1ZTMA 5J56B 3SDCD 1DL7L 2XKUA 1ZE3H 1AOZA 4E9VA 4UDUB 3T04D 4PBDA 5F89B 4U0RB 1AS8A 2D0HA 3EYVB 1NCDL 5MENE 4JQIA 3SDAD 4CVZB 3QIUC 1F90H 1T5WA 3JWDL 5CBAB 3L9RA 3M7OA 4H1LH 4P46D 3OHXA 5L7XH 1NM4A 3CDGB 4HT1H 4P3CL 4PJXE 5E8PB 1QPKA 4N20A 1TQVA 2I5YH 3RUGB 5EEWA 3DOHA 4WI0A 3CSBA 1NCBH 1FG2A 1VADB 4YSSA 1HC1A 3ABKB 3UMTA 3P3UA 2VAAB 2PETA 3KLDA 4I88A 5IVXA 2O6CA 1HHIB 3K72A 5AKTA 3WNOA 2YD3A 2XTJB 1PDKA 5DMGC 3V4LA 4DZ8A 3GKWL 3HCVB 2FBRA 5J3HD 4Q58C 3UIZA 5E94A 1JPEA 2VDOL 1OCWH 3CFEA 4LLQA 3HZVA 3F65A 1YCSA 5CLXA 3NIDF 4G8EB 4ONFH 3QUMA 3BP6B 4HOXA 1CBVL 2DYRB 1NPUA 1UM5H 3QIUD 2BNQB 3UIYA 2OMYA 1LYQA 1F2XK 3QH3A 2Q7YB 1DVFA 5JDSB 5E24E 2G9KA 1C5DB 2JH2A 3QSKB 5IFJA 3PQYB 4R97C 5ADOL 5C3IA 3DTXA 3MRDB 6CGTA 1AR2A 3MBXL 3A4AA 3L4CA 1ZS8A 5F1NA 2PPAA 1M7UA 3HN3A 32C2A 3VI4A 1JGUL 4Z7UE 5GHWL 5MERA 4WF7A 4BYHA 4NI6A 1I7UA 2FTAA 5ALBH 4AEEA 3JTSA 2GY5A 4KKAD 3FS9A 5AW9B 2X28A 3INUH 4PJEA 2R4SH 4XC1L 5DJXA 4CC0A 3U4KA 4RISH 1BGXL 2P5WB 4ZG1A 5ETUA 2YARA 1EA9C 2H2PD 5IFAH 1JDDA 2I60H 3TTYA 2K70A 3O8XD 4HZAA 4RX4A 1TKWB 1UWEH 1WK0A 4UQEA 4JFOB 4JB9L 3BQUC 4GXVL 2AI0H 5C2BL 4HUWA 4QRRA 1IZJA 3OQRA 1K4DB 3PWVA 2J4WH 4NZUL 4PJGB 4JY6A 4FXKC 4MA7H 5IBTH 4XN2A 5DURB 1KLFA 3ARBA 1R4XA 2CR0A 5EUOE 4WQOA 5TGBA 4YHKL 3T2NH 2IEPA 5FYJU 1X5KA 3HR5A 4K9EL 1Q1JH 1U3YA 4PMEA 4JHWH 2XG4A 5CFHA 2HSIA 1IBGL 4NAQA 2AV1B 2JFCA 4DGYL 4ELMB 3V6FA 4BFFA 3CN3A 4GIAA 1FQ9C 4IKNA 4Z7NB 4ENZA 1FDLH 4XWGH 2QLYA 1GRWA 3CVHL 3QDMA 2WGXA 5JIKA 1F3RB 4D0BB 1KJVB 2X44D 4MZ2A 4CNIA 3TEZA 1UZGA 4UBDC 3WTXA 4QRUB 2XPYA 1AO7B 2H41A 2VL5A 4H88L 3ARFC 1RJYB 3O2DL 2YOCA 2H5UA 2CQVA 3D34A 4JO8A 5DZNA 2ZJSH 2G30A 2WGNB 1J8HA 2BZDA 4B7LA 4I3RL 5F7FA 5T3XL 2JB6B 4YSCA 3MLVH 2GUYA 4PBWD 5SWSB 4YUEL 4EZMA 2VISB 3VG0H 5HI3D 4UIMA 5F0JB 3N44B 2MPVA 3H1ZA 1NEUA 1FBIL 1CO1A 2RGSA 4QHMA 5EUOB 4CVXA 1B4TA 3B6SB 2NDGA 3H9SA 4HJTA 4BE6A 1IE5A 4MZRA 3Q44A 5TGBB 3L7EB 4LXFA 3QWOA 1LDPH 3WHXB 2DY2A 1IAOB 4NXKA 5K1JA 5CLZA 1B2YA 3AAZA 4G9DA 1OTTC 3DJTA 2RFXA 5CUSL 2CBPA 3BH8A 3DSFL 1DVFB 1GOFA 4FYQA 3RPBA 3RIFK 5CINH 2F1EA 3DHJA 4I18B 4K7FA 4FQHB 5TF1H 3V4PH 3BEWB 4P06A 4W9ZA 1DBJL 4K71C 4TSCH 5I9QC 4BZ2A 3RX8A 3FQTB 3H6JA 1VDGA 4S1QH 4LAQL 3T3PB 2FSDA 4ZZKA 3M86A 5TH2B 5HGBB 4F2FA 2VL5B 4R4NC 3LS5L 4UYPA 4QLWA 2ADYA 1KJ3L 4HISA 4W9FC 2EXWD 2HTKC 3X1FA 2HT4C 3FMGH 3KPLA 1EGJA 5KAQF 1EO8H 3QEUA 4GG6E 5AVZB 4Z76B 2YPVA 5C0ND 1LD9A 1IBHA 4AGMA 5EZPA 4QDGA 4U33A 5DI8A 3SYCA 2K3TA 5KW9H 1HNGA 4KTGA 3FYEB 3T2LA 3NZHH 4CBZA 1FAKT 2GCYB 4X4ME 4XRCB 3P9MA 4M8VA 2HCZX 1HZKA 2WBXA 2F74B 2K8QA 2FL5B 5J1SC 4JPKL 4OLUH 3ETBF 3SDDC 4FQLL 1NC2B 1DJIA 1U8NA 3OHXC 3BD4A 15C8H 4GP5B 3QUXB 2D7TH 3SKOA 3SDCB 4TNWK 1ZGLP 1FCGA 4JFPB 4D8PB 3D8MA 2JB5L 2OYPA 4Y4FC 5F0PB 3BZ4B 3Q3GB 4RA3A 1H9VA 5L8KB 3PHOB 2Y1AA 2DWYA 3D18B 1TVHB 2A9CA 4BA8A 3LZFH 2Q86B 4G7SB 4WWID 4WW2B 2DKUA 2QVFB 2W0FA 4EQ3A 5D6DA 3KVDD 4XHQA 1ZHBB 5EZOL 3U4EA 1AIFB 5K33A 2QMKA 4AYFA 2ICCA 3GMQB 4M5YH 4QOKB 2GIMA 3EW3B 1ACYL 3QCTL 4ZUSB 5C0JB 3QXVA 1HU8A 2CCVA 1J8HD 1TETH 1JCKA 1OT4A 4NRYA 4QR7A 4YHMH 1IC5H 1KEML 5KSAC 5D70H 2HFTA 5LAXA 2NY2D 4HSQA 1OB1A 1ZLVK 5GISH 4Z0XA 5FYKH 4PI2A 2X6CA 1ET7A 2XZAL 4BCYA 2HTLC 4S2SA 4JUSA 1KB9K 3N50A 1HQ4B 5F7EL 3L95B 4I77L 4RGMC 1EWHA 1ZEAH 3CDYA 3ZL2A 4X6DB 5FR3A 1N64L 1YQ2A 2ATKB 5DT1H 4XVTL 1Z1WA 1DVFC 4HUXA 1IC4H 3RA7L 1JBJA 4OAWA 2P43B 3LKNB 5GZOD 3IJ7A 2JKXA 1QTYT 3BEVA 4NQCA 5EIIG 3V7AG 2EVFA 2DWSA 1T1XA 1NMAL 5J1TC 4GUPB 1A6TB 3PHQA 4QXUL 2ED8A 2ZYHA 2BP8B 2CO6A 3WNLA 2W1NA 2L04A 3QJUB 3RZCC 1MJ7L 2VITA 2BNRB 4MD4A 4RAVB 3C8KA 3SPVA 3TN0D 1IC7L 1T0MA 3IXAB 4ZMYA 4HK0A 8PAZA 3VXPA 4O9HL 3V5HB 3CFTA 3HI1B 4IKKA 2NXZD 2WVTA 4XX1G 1OB1B 3TNNB 4GEIA 4M5ZH 1NCAL 1D9KA 1A47A 3WHE1 1RUAH 5DYOA 1U8HA 4GQ9L 4G3YL 3CVIL 3PNWA 2GI7A 1ZLSL 1A1OA 3Q5TA 3W5NA 1GJIA 5TE7H 4NO3B 5I71C 5F71A 1J0ZA 3T0EB 1MFCL 3VFNA 4AJ0A 2FQGA 2P7TA 4K7PY 3TNMA 3FQRA 1DJWA 3T6ZA 1YYLL 2GJZA 4L8DB 2AMUA 3BVNB 1XB8A 5GGQH 2WLZA 1NL0H 1MIEL 1PEZA 3DX3A 3QDJA 4P2RB 5C09A 3RVTC 4XCEB 3UH8A 3B3BA 1FO0A 1KENL 4WUUB 4AEIL 4HU2A 1CLYL 2QELA 5ICZB 2LU5A 1X6LA 1YUHB 3P3SA 3VXQA 1XEDA 1GW6A 3RFZA 4AG4L 1ZWIB 1XGTB 1ZDQA 2OYMA 1HE8A 1LMIA 4NNYA 4JO4H 3PXLA 1FL3A 2JLLA 2DQMA 5IBUG 1P1ZB 5L2JA 3SDDA 1MLBA 5B4MC 2RCSL 3SDAC 2V2XA 4GIOA 2K7QA 4YGAB 5B3SB 4TYUA 1LEIB 2H32H 4EOWL 3VXSE 2XVKA 2VXQL 3MREA 3ZKXC 4F57L 4L4TB 4F7PB 2J6EH 2QZ5A 4R6UA 2DN7A 4C56B 5DLLA 3NZSA 4PP2B 4OGXH 1T0NA 1UH4A 4XMLL 3CD4A 3WN6A 5I6OA 1O5PA 2DIAA 3V95A 2WQUA 3VGEA 4DGWC 4PJAA 2KLTA 1V3MA 5KOMC 4FG0A 3VG9B 4L8DA 4H1LG 4OLZH 4NFCA 3DX8B 3JTTB 1NCDH 3WY3A 4JFYB 1AI1L 1JNHA 4PY7B 4ACPA 4PWKA 4LPXA 2DQCH 5F7AA 4Y1AB 2VMEA 4WJ5A 4KK6D 4Y4HD 3QR1A 5ID1B 5IIEA 5IB2A 4QF1A 4OM1H 4PIBA 4NQTA 1DBAL 1FZOA 1LK3L 3DBXB 3N04A 4KPHL 4MKMA 5C0EB 4HUXB 1AVAA 4PSPA 5J5EA 4Y5XC 2VN5A 5H35A 2HFEA 3B83A 4QKTA 4X98A 3HC4L 4KFZC 4HEPA 4L2LA 4ZQKA 2GW5A 5EF1A 5E6ID 2OMBA 1GY2A 4HLZH 4NQQA 1ZCRA 3NEOA 5EO9A 3KLHC 1Y1UA 3GSVB 4EIGB 5BVPH 2CUMA 3WNNA 2OPCA 2ZUYA 2DMBA 4OQ1A 3O6FD 4Y8AA 5D1ZB 3IJYB 5IBUB 1TCRA 4MNQD 2GBAA 4FXGA 2XVBA 3RUGA 5CZRA 3TH2T 3ARSA 1A6AB 3IFLL 4QXTA 4KITB 1M1XB 1K8DB 1BAFL 4E68A 4PJAB 5AZUA 4JDVA 2WXNA 1H5BB 4PRDA 1AZRA 3I02A 4G42B 3CWGA 1P7KA 4IIQC 3HS0B 1KTCA 2BJML 5DUBA 2ZYSA 1MWAL 1KGJA 1G1CA 2G60L 1OPGL 2W9EL 4P2QB 3IPFA 2NX5D 4G5ZH 5E23A 4UAHA 1GHFH 3MRJA 5D8JH 1J05A 5J9PA 5JLZA 4HCIA 2GJPA 4HOWA 3J7HA 5C97A 3MV9D 1SMOA 4RMSA 5L2KA 3NUKA 4E5XG 1BFTA 1LE5A 1JXJA 3WKPA 2BVOB 4NZJA 2O5XH 4P23B 3NJLA 3CZLA 3ILDA 3QJHB 2MJWA 3PWNA 3VWKD 5BCAA 2VDMB 3AS3A 4XPFH 2FHCA 1B9KA 4HAFA 3G08B 5GS0H 4KUZL 4MAUH 4MJ6B 3GSVA 1E6JL 3DA0A 3EJYC 1YMMA 3MOQA 1S7SA 5ANMA 1HH6A 3NVQA 2OK0H 4MVBD 3IRZA 3LRHA 1BD2B 2CU9A 4GRLA 5C2BH 1M3IA 4N1HB 4OV5A 3DSNA 4FERA 2F54D 3Q2CA 4LESA 2ZWLT 3SGKA 4MDJB 1JZ4A 2NUTB 4MBOA 4PJDF 1BXUA 5F1IB 4EBQH 1QBLH 3NRFA 5DJ8B 25C8L 3GINA 3CFIC 4XPTH 1TF4A 4JPIB 4G8GA 3FCTA 4XXDB 3GEWB 4G42A 1BECA 1KGCE 1W8NA 5KVDE 4OZ4A 2ZSVB 4LSPH 3MA9H 1FV1A 4NN5C 4ZUTA 5HYSA 1R5VB 4JZOA 4UCFA 3L4UA 3JV0A 1U8QB 5F6HJ 1U3NA 1DFBH 3ZDZE 1KJ2L 1JPSH 2FBJL 3UC0H 4P9HC 4XVSL 5BJTB 5MEQB 3VMPA 5ADOH 5IHHA 5FA4B 4LCCB 4K4KA 1EFXB 1KFGA 4HJGA 4PGBA 3EJJX 2R2EA 3QE5A 4CAGA 4GP4B 2A6KB 3O4OC 1R24A 2YEZA 1RJZA 1SZNA 1FNEB 4WTZG 5ID1A 3HZYB 2D7PA 1KIUA 4WCYH 3GSXB 2JXMB 3V0AC 1FNSL 1P69B 5LXGL 1KGWA 3MYZA 1VCAA 3TH3T 3QIUB 3HC0B 4M9OA 1MAJA 4X9YA 3MRFB 3ARFA 4CW1A 3VFVA 4ZO6A 3K4DA 1FSKB 5T3XH 1ND0A 3VGAC 1F6LL 4PP1C 3Q0HA 3VFMA 3VXSD 1QSVA 1KIPB 1I8IB 3M1BA 4B9GA 3OC5A 1AHWA 3CDZB 3HUJA 3ZDZF 4C56E 4YLCA 1ZMYA 2ICWI 2IV9A 1NDGB 2PYEA 2XXCB 3GI8L 4MS8D 2VDNB 4GXVH 1UQSB 3U82B 1UVQA 5EOTA 1BX2A 2VRQA 4HIIB 4ZPTB 1VEMA 3N9GH 1UJ3C 4JRXD 4GBXC 4HXBL 1U8OB 1SDYA 43C9A 5I6NA 3CC1A 4EUPH 4AMXA 1K8DA 4ZAKA 5BV7C 4EUPG 1XBRA 1A3LL 4N90E 1JF6A 4EDXB 5FDWA 1XH0A 4IRJC 1GYWA 2J8UB 1CT8A 4YX2H 1JGLH 5DRZA 4KQ4L 3MUJA 3IDXL 1IBGH 4BRJA 2V2TA 1FYTB 1DJGA 3NIGE 1JMZA 1YNKL 2X3CA 5E4EC 3GRBA 3BWAA 1UACH 5ITBL 2UVEA 2X4SA 2WQRA 2DH3A 5KSBB 1E4XL 3QJFB 1NKOA 1U33A 4P5TC 3UGEA 5KOVC 32C2B 1QW9A 1CDCA 2MNUA 2NTFA 2ZF9A 5D2NE 2OMXA 3RPIA 4JJHA 3CE1A 4QNPF 4WHYG 2G0KA 1KXVC 2WBJD 5BUAA 4MJ6A 4FFWC 1RUKH 4OD2A 3S5LA 3RDTD 1BIIB 1BZ7A 1C5BL 3KWWB 2R7EB 1S9WA 3VI4F 1AQDB 1CK0H 2BMKA 3MAWA 5BO0D 3BUYB 1I4FA 2IBBA 1QVOB 3MRPA 5DO8A 4M1CC 4MWFB 1WCQA 3QJVB 4NYLA 1NGQL 2VE6B 2CLVA 3HC2A 5ICXA 4Y4KD 3STBA 3ETBJ 1J0JA 3UYRH 2HN7A 1R0AL 2J55A 1E28B 3LDBC 3GIZH 4RMQA 1QLEH 2YZ1A 2GIXA 4ZXBA 3FO2A 1K4CB 3FCTB 1N70A 3D69A 3CFCH 2J8UA 1OE1A 3WFCL 2XCMC 5AKVA 5FB8A 3PWVB 1EO5A 4JGUA 4TN9A 1MNNA 3ZE0F 1KBPA 1JWSB 4ERSH 2K0RA 3A6CH 2BNUA 4X5WA 2VLKB 3OR7B 4ETQA 3VX1A 1RZFH 1JPFB 2YGQA 1T21A 3QZLA 1XSIA 1CLOH 2EEDA 2FQEA 4Y4HB 3G5ZB 4DWHA 1WA2X 5MI0C 2VDMH 4MMYB 4YC2C 2F7IA 4M43H 2F9BT 1JZEA 3MROA 4LVEA 2DM2A 3EG9A 5KS9B 3U0WL 1BXAA 4UT6A 3P69A 1MUJB 4P4KA 1S9XA 3HZ3A 3AQDA 4HDIB 4YZFF 4ZO7A 5FXCH 1SVCP 2XZQH 1ODAA 1L9QA 4QXGH 3LRMA 4MA3A 3Q05A 4CW1B 1TVHA 5JPMA 2C1OB 3NJKA 1XCTB 4MXWH 3T0AA 2GITA 2YHGA 5JHDA 1YHPA 2X2HA 3IGFA 4QRUA 3SGDI 3WHE0 4DVBB 1LE9A 3ZL4H 1E8YA 5T5NG 4A63A 3MLRL 4M7LL 3UZQB 3ULVL 1D5XA 1M6OA 4ZFOA 1QWNA 1E4WL 4GQZA 2XOTA 1IQWL 5D1XD 4RAUA 3K80A 4IKLA 1DJSA 3NFSH 2FZ3B 3FZUC 3HE6C 1W2KT 4DQOL 3OKKA 3WFBH 4Z0XB 1BFOA 1JFHA 4P57B 1P7BA 3S8FB 4L9LB 3VXME 4J6RH 3GJFB 4NPYA 1DL7H 4KJPC 3BZ5A 4LCYB 4PJCE 4CN1A 3JWNG 1D7FA 1U8KA 3NIFE 4ZFQA 3S9DB 3D85D 3WV0A 2A6DA 4DUXA 4L18A 1QSFE 1DQLH 1FFRA 3FT3A 5D7LD 2N1KA 5TE6L 2WXIA 4YXHL 1DVUA 3GRGA 3PDDA 3QRGH 1HX0A 2IF7A 1ETZA 2W60A 1JNNH 3QJFA 3VI4E 4Z7UA 4G7VL 5BRZD 1ACYH 3QCTH 4YHPB 3CVIH 3QZNA 3SKOB 2CHZA 4UOW0 1FH5L 4LZKA 3B2UC 4BFIA 3HE6D 3I3BA 4HJJH 5C9KA 1PD6A 1NM9A 3UG4A 2CLRA 4ZUWB 4WV1A 3LD8B 3QVAA 4Y16D 4HBCL 2EVGA 2IQ9H 2QQLL 2AK1H 4YSTA 3BIBX 4KKNA 4K5OA 5EPMA 3QUZB 4G1MA 5D5MA 4D9RD 4HJUA 4A2EA 5H8DA 5GS1B 5IMKB 1KENH 5DRXB 4PRHA 1MW2A 5ICXB 3N41F 2XDHA 1I1AA 4MX7A 4JPSA 4R96A 2BLFA 4WI9A 2DD8L 4BCZA 3LKPB 2OSLA 3V0VB 3KHOA 3FSAA 2ZTBA 1DJZA 2CWRA 4XNYH 4LP5A 2FEEI 1DJHA 1E27A 1XF4A 5D55A 2EIJB 1P4LB 3MRQB 5KANG 5FCSH 1TTFA 4X99B 3UPAA 4UQCA 5FF6A 2A9MH 2HVKA 3QQ4B 5GRJL 4ZXBC 3T4AC 2APVA 1S5HB 1WHOA 3GXFA 3OQ3B 1FYHB 1UYWH 4I3GA 4QY8B 3BH8B 3K3QA 3NP4A 1H8OA 2W0FB 3AW5A 5EZJA 1DQDH 3FBKA 5BXFB 2X6VA 4IK7A 1H9DA 5GGRB 5LHDA 2LR4A 1NAMA 3L6FB 1A7OH 1UGKA 1URZA 5I1CL 3V6FB 4U7KA 3H85A 4HG4K 3CPUA 3QPQD 4NT6B 4C47A 2HJFB 5TE7L 2J44A 3C87A 4WGWB 1RJLB 4RETB 5DK2B 2PCPB 1LWJA 1KB5L 2YD4A 3KE0A 4ISVB 2TSAA 4AIZA 2C3VB 2XX1A 4OZHB 5TK2A 1KCRH 1MH5B 1SF3A 3VNYA 3VXMA 3CX5K 2VDLL 3ML8A 5B39A 4TNVF 4APQC 3HW7A 4G8FB 1RU9L 1UEYA 1CLVA 2Z8VC 5I2IA 4F27A 1TQCC 2I7OA 1GZQA 2PP9A 4AEIH 1YYML 4TLTA 3ZYZA 3OTTA 5DMKB 1JXGA 2Y6SD 2ARWA 1JPTH 3FFOA 2O5ZH 5IK3A 4I7ZC 3BESR 4XWGL 2WZ6A 3DVGA 4NKOB 1DYZA 2OS7A 3SDXF 1KBKA 3LEYL 1I53A 1MAKA 4WO4C 4KZCA 3U7YH 1IEBB 2BSSA 4GEJA 4XO8A 1OGTB 2ZUTA 3RJDA 9PCYA 4S1SH 3O6FB 5D1ZD 5EO1A 1U41A 2OMVA 2NX5E 1RLWA 2A9BA 4NLHA 1IIIA 1IKNC 3TWCL 1SYVA 4FNRA 4HKBB 3INUL 4G9DB 4Z7UB 3NRQA 4UTBA 4HA1A 4IEFB 4LRNH 4PJ8C 4PHZA 1EDHA 2WXLA 4I3RH 4RDQF 1WBZB 4YFLF 3V5HA 5JHDD 4GAYB 4WY7H 4BKSC 4HC1H 1OQOA 2F8OA 5GGSB 1SHMA 5D7LB 2AJ3A 4R8WL 5A1AA 5JOEA 4MNGE 4HFUL 4NENB 3O6MH 1NGWB 4MJ5A 4Z3GA 1Y7VA 3WMPA 5I0VA 4FKEA 1RZ8B 4U1GC 4RSYA 2HA1A 3VRIB 2BCKB 1AGCA 4JPWL 1I8KB 1M1XA 4PJ7F 4Q6YA 2Q0ZX 2EECA 4J1UA 1XGRA 4GO6B 1YVLA 1E5YA 3HR6A 4XH2A 2P8MB 4JO3H 4GQPH 5F70A 1FJ1B 4XPHH 3MV11 4P23D 4XB7A 2HMIC 2UZXA 4U1HB 3G9AB 3L9BA 1Q1JL 4K15A 4BFEA 2HXAA 1XXDC 4RVBA 2ZKHL 5DJAB 2HB0A 2ZOWA 5GXBB 1U6AH 5JO5B 4OF5A 4HUKB 5F7YC 1YEHH 2X12A 1UEMA 4D3CL 2YAQA 5IVOA 2AJUL 1OCCB 5IKCA 3P40A 3NIGB 3K1DA 3LNGA 3FTSA 4NJAL 1ZHLB 5HP5A 3V5KB 1NLDL 1CD0A 1T1YA 2BNQD 3MRRA 3MNVB 4U6XA 5J6GB 3FU0A 2UWEF 3FTVA 5MEPB 5EU4B 1OW0C 1KGIA 1FGVH 2WKLA 1JRHL 3VFUA 2FJFA 3OZLA 3KPRD 5C3TA 3THML 3MLVL 1OAKH 1RJCA 5HDBB 4MDJA 2PF6A 3UL4A 3H7BB 3GNML 3GBMH 1V8HA 3MCG1 4WWOA 2JNZA 1R1CA 2VUOA 1BEXA 2JKNA 1MJJB 3MLWL 4JFVA 3H3PL 1G6RH 5ANHA 4Q0XH 4U05A 4NZRH 4L37B 2N3JA 1ZGLB 4ANWA 4NLAA 4NRYB 2OW6A 5B39B 4ZUTB 5HYSB 3V7AE 1HL8A 4PPTA 3D50A 4JDVB 4NRXA 5F6HI 1ZTXH 2O5XL 4FFYH 4TUKH 2IWFA 1INDL 1CE6B 3V5DB 1NBVH 2WWOA 1UGNA 2ZXQA 1Q38A 5CINL 2WN3A 5IK3B 3ZIMA 4WEBL 2DQIH 3ASNB 5I1DB 2J25A 3I3DA 4HIXH 4MAYC 2EDLA 1MF2L 3E2HC 2HWZH 1PJWA 1NFDA 2EIMB 3N9GL 2V8MA 1KPUA 3K4ZA 5FGBC 3VXRA 4FMKA 1T6VN 4P0DA 5I5JA 2K4WA 4N4YB 1EPFA 3EJTA 3UAJA 1QBLL 4BBWA 5IG7A 1T2JA 4N0CD 1CQKA 3QDHA 3QQDA 1AQ8A 3EIFA 2HT3C 1I7ZB 4IEFA 4A2MA 5L2JB 1PCXA 5D1QA 5E8OB 1SBSH 3B5HA 5JPMC 1J18A 3GSNB 2PLTA 4N2EA 4OCLC 3FRPA 3SE4A 3WFDH 4YE0A 3FO1B 4FL4B 4RGOL 3UROR 1HEZA 3F3HA 3D5OF 4Q7DA 2FEJA 3S37L 4BK5C 2LV4A 4KKAC 2IOMA 1E4XH 4IDJH 3QJTB 4JKKA 2P8PA 5LCVH 5I0ZA 1HDMA 1G7LA 4WSGA 2WUBH 1K3IA 1CR9L 4JZJB 4DN4H 3BUIA 4HWEH 3Q2NA 4LF3A 4TUJB 1T7YA 1RK0B 5JW5B 4U2YA 4PUBH 2P80D 3CVCA 4N86A 1J0KA 2ESVE 1N0LB 2CXGA 4X2UA 2ZCHH 4MQXD 3VTAA 1SQMA 4XGZB 2EDBA 4C4BA 5AKSA 2A0LC 5GRWA 3RWFA 1GXEA 1B4LA 5FW7A 1A4JA 1DLHA 2Q8AH 2AXWA 3RPIB 4NHUB 4M9PA 1JNLH 4YSPA 4LEOA 2ADGB 3AQZA 5E6UB 4NO2B 3EO9H 3UX9B 4FC3E 4IDLA 3NIDE 1HHJA 3BPOB 1AG0A 3DUSA 3EOAB 1GGCH 1M57B 1ML0A 3V4VA 3BAIA 3FF8A 4H0HB 4N2NA 3W2DL 4B27A 1CDHA 2JKWA 5GZNA 1BM7A 1WT5A 3RPKA 4UOW1 2F8VA 2VMCA 5JNYB 2ZCKH 5C0AB 2X09A 5SWZA 5DEFB 1AHWB 1G5AA 5EF0A 4W9GC 3ZDXE 2CALA 3SY6A 2VE6A 4O2CB 1XTLA 4JX0A 3V0JA 3ZKND 2C7UA 4L8SA 2IV8A 4YH6A 3MFGB 3U6RB 1WFOA 1K2DA 3L4TA 4XB8A 1UACL 3X1BA 1NGYA 3FJTA 4HWBA 2IGLA 3AXHA 5T1LA 1GIGH 2QT6A 3DX2A 1R75A 3IPEA 3WDJA 4FXLA 5K9KB 3ZT6A 3CN1A 3EJPA 4X4YB 2A6KA 3ATBA 3MUGA 1IGFH 1GKEA 4XP4H 4PJCA 2DL2A 3KLQA 1F4XH 2WWKT 4GAJH 4AQEA 1FZKA 3PS6A 1OHZA 3KYKH 5F93C 2CJUH 4JJ5A 3VI3A 2ZE0A 4RRPM 4J6IA 4G8IA 2XVGA 2G2RB 1DQIA 1IM9A 1QUNB 3TO4B 2OMYB 3LY6A 5IZ7A 2XT1B 5IG7B 2ZOKB 2JKRM 2PXYA 4OKDA 1E30A 1C5CL 3SPJA 3K6FA 3L9EA 1CLZH 1XQ4A 2YAMA 5FYLE 5KAQG 2J2ZB 2P28B 3QUYD 4IOSD 4JCMA 4XAWL 1OPOA 1KEGL 1CICC 4IS6B 4R4FL 4XN7A 5AZ2H 4G1EA 3PWJB 3FUKA 1DQJA 4FTDA 1A4KB 1CLOL 5A6LA 5DU7A 4JG9A 4L1DA 3U25A 1LK3H 2V7HA 4P07A 4PRBB 4ZFFA 4XBPA 1OTSD 3QQ3B 4TLKA 1FYTA 1D3CA 2LE9A 1FHGA 2YO3A 1NGXB 1NCTA 2G75B 2JB6A 2P80A 1T0PB 1XF5B 3PP4H 4ZJ9A 1A6WH 1JZ6A 5ETUB 5LBSH 2X4TB 1HNFA 4G72B 1DBBH 3T8XB 1ZE3C 1KTKE 3AM8C 3HE7D 4D9QD 1QFPA 1QFWM 2MNJB 4NERA 1XSJA 3FB5A 1PYWB 2K3HA 5CJ8A 4LPWA 3N3EA 2EE9A 4F7MA 5JHMA 2HRGA 2OJZL 1WBYB 5CSZA 2IPTH 3CX2A 3T3ME 4NSKA 1P7QA 2J1XA 1BAFH 1E4WH 4H8WC 1BVOA 3AXLB 2BVOA 1OW0A 4FFVC 5DRNA 1SDAB 1YJDL 35C8H 4YIQA 2PTTA 2VLJA 5IB4B 1J5HA 4ZUVA 4Z7VE 5DQJB 3WIFA 4TSAH 2X88A 4Y5VA 2X6UA 1J5CA 1Q4NX 2QR0A 5EFIB 1OP9A 1T5WB 5KVDH 4UM9A 3SOTA 3IE9A 3RAJL 4DKAA 1KYDA 1U21A 3ML9A 1IFHH 5DS2A 3VFRB 3DOSB 2V33A 3BVWA 1USZA 2A9ML 1JWMB 2OX5B 3MOBL 4ZFOB 1AD9B 3NCYS 1T22A 5AQ0A 1CTMA 1N8ZA 5ECGA 3NK4A 5T5FA 3FQUB 1QBBA 4XP9H 1OE2A 1K2DB 3FOLB 3BGMA 4F15B 3K72B 3PUUA 1MQKL 2OQJA 4NCC1 2O6FA 3RZCD 1KIQB 4YHKH 4GO8A 1J8RA 5DZ9A 3VFTB 1JD7A 2R15A 4W4OC 4PJHB 2EZ0D 4APXA 5BUGA 1AGFB 3TONA 1VCBC 2IDUA 1DSFH 1JXFA 4PM1A 2FWSA 1XL4A 3A4DA 2B1HL 4ALAL 4Z8FL 3QW9A 3N44F 5T5NF 4OIIH 3LMJL 3R19A 4I1PA 1YNLH 2X6AA 1A4CA 3WTWA 2EICA 3NCMA 1ZLUK 3QWOB 4JFXA 4OFPA 3GSXA 2FJGA 3OKNB 4I5BA 1TTCA 2CLZA 1KGXA 4A39A 1ZA3B 5MP6H 5GQBA 1JD9A 2AGJH 3OXSA 4JPVL 4M7LT 1RAMA 1QATA 2AZUA 5I1KH 4YZFE 2AHIA 1M7IA 4MNGA 3D7PA 2VDKL 3U9UA 1AP2A 5KWYC 1R5WB 1TT6A 2QADC 5AB2A 4HS3A 1W72B 3CFDA 3DX9A 4G5ZL 4S1SL 3GRWH 1QNZH 3PGFL 5IREA 3C8HA 4AWJC 2C7FA 4LLMA 3RFZC 4LO9A 5D8JL 4JFDD 5I28A 5IEKA 1UHVA 3IDJB 2V7HB 5KSBE 1GZQB 3ZUCA 4W9KC 2VJ8A 2C4FT 1A5FL 3D0AA 1JGDB 4JFUA 3PJSA 1NMBH 5F7LB 2E4TA 4DGIL 5BQ7B 1FNLA 4XAKD 3LZOA 1IAOA 1HI6B 1KCBA 3GJFK 3L5WB 3V0FA 5F44A 4BQBA 5IBLD 3FSVA 1WG3A 3GMPB 2EC9T 3GMMB 4HGMA 4JPQA 4KRNA 4N68A 3VH8A 3MLPA 2B5IC 1CFBA 1P6FA 2J8UF 5IJKA 4P4RA 4KK8C 2VKWA 3X14B 4PGEB 3RWHB 3E38A 4RMTA 2F08A 4IJ3B 4V11A 5JOPE 4E0RB 4Q9RH 3IDMA 1BXXA 5CGBA 5KYXA 1YEEL 1P6WA 4Z0BL 5TPWH 3FQNA 3LN5A 2VXTH 3LNEA 1UKTA 4DPBX 4ELMA 3OAWA 1CGVA 1ZJBA 3MI6A 4I9WD 2J8HA 2WWKO 2XFXA 5IJKC 5DRNB 5KVGL 5GGSA 2GC7C 1AY1H 1WT5C 3JWNE 3KPMB 1KG0B 4IGBD 4MD5A 4N0YL 4J27A 5JR1L 5E8DL 3PHOA 2CHXA 4N2LA 3W3BA 5HI5D 4XMKH 3QQXA 5I17A 3W1ZA 5IHZA 4AW4A 1LD9B 2ZUUA 4XPBL 1HYRC 2FGWL 1ZSDA 3UJTL 3VFRA 2EVHA 2VXVH 4N26A 1CXEA 2X9WA 3VM7A 5TDNA 2A99A 2WIIA 2YLHA 2XTJE 3P30H 2OBGA 4XWOD 1RVFH 2Y7MA 2FIKB 3FU6A 3T3PE 2FL5A 3O4OB 1WCBA 1KMGA 5DZAA 3R4RA 2R8SL 4AEFA 4LPCA 3II2A 3V4PB 4UT7H 2R29A 4JVWA 2XWXA 2BK8A 5DMKA 3UG3A 2KC0A 3K6SA 1KYOJ 3CXHJ 2WKGA 5FLUA 5T3XD 2P5EE 4LLWB 1HL5A 3GNMH 1F97A 5B7FA 3P4OA 1YQVH 1AKJD 3MNWB 3PQYE 1JVLA 3L13A 3TVMA 3APFA 2ZT9C 1G7IB 4NZRL 3V0DA 2MCAA 4BUGA 4AT6B 3TIEA 4EJ1C 4PJ5A 3U7WH 2PN5A 2YZ8A 3QFDA 3UYPA 3CU7A 4N1CA 2CO7B 4K5LA 2CXKA 4X7SH 2NR6D 4ICXA 3L1FA 2EH8L 2N59A 4KRPC 4UTCA 1QO3B 4G9FE 5HHQA 1ZLVH 2BX5A 3KYNA 1IAMA 3BAYA 4PRHB 4OCRH 5IW1A 2QHRH 3LRSA 4UOJA 3A3YB 5FFGA 2GSMB 3SPHA 4OJFH 2XSKA 4JS7A 3IFOA 5KEZA 2LU3A 2OTUA 5EZLA 4G7YL 4YSAA 4J1UB 1IT9L 1YEFL 3N85H 4UIKL 3CZNA 5CCKH 2NY0B 4L0YA 2BFVH 1J12A 2BO0A 3G6DL 3PNWB 4Z9KB 2DI7A 2VR4A 1MEXL 4KKPA 5TE4H 2GHZA 2QQKH 4BZ2L 2Z35A 2EDXA 3GJEA 2C3HA 3MRHB 3UO1L 5DS1A 1CICB 1FL5B 2UV3A 2Y1YA 3ZZSA 4J3OG 1DDHA 4YSUA 1W0WB 4GFXA 4J3XA 3D06A 5IQ7H 4Q52A 3SE4C 5DZVA 3TBBA 1R19A 5DMGD 5J3HC 1ZV2A 4FNUA 1M71B 5AKRA 1KBVA 1U93A 4R7NB 2BNRA 2BH0A 3UTSE 4CC4A 5A16A 2PWGA 4ZD3L 5HGDB 2WNWA 3LVTA 2Z6FA 5FYJH 3Q6FA 4JQVA 5AW8B 3FUIA 2B59A 4N9GB 2VMFA 1AG6A 3UTPD 3GSNA 3V9CA 1B90A 4EI6A 2PCPA 1HHKB 2QSCH 5T8IA 4WNQA 4KJQC 1YC7A 4JFDE 4EKJA 1XB6A 1MLCB 1F1GA 3TBSA 2AAVA 2FWOA 3BIKA 5H2BA 4J12A 4XR8C 1KCSL 5JHLH 1MIEH 4KVPA 2HWZL 5DMJB 5A6IA 1M9WA 3KAAA 5D71L 2VM4A 4G6AD 3GXDA 4MX7B 3PREA 2ZPKL 1R47A 3BE1H 2AITA 5DJYA 3E0GA 1MNUH 3D12B 1QFOA 1RI8A 2ZXEB 1J9SA 1BP3B 1U8IA 1YNTB 5GSVA 3P11L 1DCLA 1PLBA 3MGTB 2GG1A 1CFSB 2Q7NA 5AVWB 3VB8A 4MMZB 2MTAA 1XGTA 2AQ3A 5AW1B 4B9FA 5EOQH 5E1HB 4TQIA 3BYYA 3OKMB 5GSRB 4JBSA 4B60A 2OM5A 4YDKH 4N0UE 4DT2A 4ZQTA 3NCEB 4LLVA 1B2WH 4AT6A 3ARFD 5HSFA 2B59B 3GTVA 5D5MF 4R0LA 2HFEB 4WFFE 1AQKH 4ZMXA 5GGRA 3OZ9H 4PHXA 4ZOEA 3WXWL 5IQOA 4C56A 1FORL 3EUUA 1QWHA 1RULH 3CIAA 3GFUA 5IR1B 5DSCA 4HU8A 3WL9A 2RMNA 2VZVA 3OF6A 4NQSA 5J4MA 3O0RL 4UV7H 1I8MB 4K3HA 1BYNA 2P5EB 1XIWA 3E6HA 4R4BB 5DVNA 5I76B 2DPKA 4M4RB 5EBGA 4Y0GA 1A6AA 2UUDH 4PTUA 2WP3O 3ZR5A 1MCRA 3S5YA 3VRJB 2YQGA 2FD6L 3P4MB 4JN2B 5KVFH 2NZ1A 2BY2A 3QR0A 3O2DA 4GKZA 5JPNA 5INCB 1CB4A 2D31B 2I7SA 4V1DA 3T0BA 9CGTA 3WFEL 4XB3A 3IN0A 1U8MB 5GIRA 4HBCH 3OMZA 1PAZA 2QEJA 3OXRB 2OFQA 1D6EB 5J12C 4AIEA 4CMHB 1GGBL 2E5EA 3X1GA 5E99L 4P49A 1BQRA 2BXYA 4IOIA 3FUMA 1GSMA 5DJDA 1O7DE 3WFHB 2CKBB 3KPSA 3QJHA 1QA9B 2MH4A 1IBDA 1WZ1H 4G8AC 5LBSL 5FFLA 3QFJB 5EZIH 1TQUA 3BZFA 2KZWA 3L5XH 4ALAC 2WXPA 1S3RA 5ITFA 5TDOB 4KAQL 2C9PA 5KSVB 2VDRH 2X4OB 1SEBB 1UURA 2VR5A 4X6CE 4Z7WF 3C5ZB 2KLSA 1XEUA 2VAAA 4OCWH 4RMVA 3IXTA 4L9DA 1CGSL 4L29B 3EJSA 4PJ7B 2F1BA 4M62L 3GLZA 2QPEB 5C09E 5KBPA 3HPJB 1D5BB 4QHKJ 3AY2A 3MRIB 2HRPL 4U6TA 3QO0A 4W1TA 2AQQA 4E42A 4BFGA 1MIML 4LOUD 3LD8C 3T0EC 1G4MA 3O6ML 1HTYA 4NBXB 1EMTH 3ZQ9A 4BHUI 1A4AA 3F8UB 2Y7LA 3UJJL 3ZYIA 4UNVA 4GSQA 4XTRD 5D4QA 4PWHA 1PNCA 4WU5B 3DX6A 2WCSA 3IJHB 5E6ZA 4GYBA 3RE0A 3TO4A 4F9PA 5E6SB 1NCBL 3U79A 4CBPA 1KC5H 2DM7A 4IW4C 2WMPB 5ISZA 4ZSOE 4UMGA 3WMSA 2H3NA 1MRDL 2AZAA 2QDVA 4OZHE 4UOQA 5HHOD 4X4ZA 3RZCB 2AFNA 4R7LA 5JMOC 3AREA 3OKDA 2A9NH 4M61B 1DBBL 3QZWG 4OFDA 3BP7A 2VDPL 4PJAE 3WL9B 4POYA 1MFAH 3S3JA 5I19L 3V79C 3O3DB 1KGCD 3AVEA 3MUGB 5HDBF 3SDCC 2GQHA 4P2RE 2B9BA 3A6BL 2IAAC 5L4FA 4KZDH 1WH0A 3RY5A 1T4KB 4UZSA 1J1XL 2K6ZA 5BRZE 3K2UH 5BVJB 5JA8B 3D39D 3P4NB 1FG2B 4KX9A 4YFDB 3MJ9A 2P42B 4AY0A 3MJ9L 4UAOB 1XSKA 4I1NB 2IBZX 2BSRA 4HK3N 3E3QE 5EWIH 5GS0C 1BF8A 5I30H 4OZIB 4PJIF 1A25A 5BNXD 1TTGA 5D7KE 4PRIA 1V3LA 3BUTA 2UWEA 2WOBA 5CJ5A 1JK9B 1JGUH 3B2VH 4W4NA 3BP6A 5KSAB 5M95B 1BQSA 1SRDA 1A02N 1ZRUA 2XV0A 3D07A 4MS6A 2VH5L 2WBWB 4FNLH 2ZD0A 1DLFH 1QSEE 4MA8L 1NSNL 2C1OA 2Y24A 2O6EA 3WKYA 4G6AC 5C86A 2NNRA 2MQCA 3IRPX 4PU2A 4JO3L 1YRKA 3QFJA 1KTLB 2D9QB 3UDWA 3CCHB 1FAIL 4WUKH 4C4KO 5AAMC 2PR4L 1MJUH 4KQ4H 2ZAHA 2JCCE 1E9PA 3D85B 1I1FA 4X6EA 3B7TA 4TULH 3S34H 1OEZW 4OGAC 4FKKA 1ILUA 4WGKA 4V33A 2Y23A 2N1TE 1ID2A 3C60C 1MI5B 1FV1B 3SO5A 1VKXA 3PHSA 1GOGA 2YN3A 1PSKH 3O3AB 1P5UB 1A9EA 4L4JA 4YSRA 3RNKA 2F19H 3PFUA 3WE1A 1BQHA 5BQ7A 4CVUA 2P24A 2XICA 2CHDA 2OQJB 12E8H 3NCYP 4ZS7L 3VH8B 3AT8A 4XMKL 4OT1H 1TO4A 4JPVH 4Q2ZB 1OGAB 2HFGH 2WO3B 3EBAA 1NTDA 4LKXB 3VO0A 4HKZB 1FVEB 4H40A 2FHFA 2JJSA 3DV6A 4G6MH 4UM8B 5C0CA 4ZUVB 3KPRA 4TTDD 3ISWA 1EUTA 3CMOL 2WXQA 3KLSA 1HZHH 2VYRE 3OKEA 2V9QA 4N8VG 3UG5A 3O45A 4X83A 1TJGL 4ORGB 5ISZD 3PWUB 2DLFH 4XPGH 3QZOA 3S36L 1ZHKA 4B9PA 5LN4A 4BFIB 2Q7AA 3GPEA 1KIPA 2CHNA 1MCLA 3O2DH 4N22A 3MLUH 2YGVA 1O6SA 2BC4A 4L5FH 4D94A 2WZ5A 1IM3A 3TWYA 4A1RA 3G5YA 1F4YH 1JN6B 1TENA 3IDGA 3NPZB 4N90D 4NS0A 1NMBL 2GJ6B 3K6OA 4Z7OE 2J57A 4DVBA 5CCHE 2D8KA 3QDJD 2V0AA 4FFYL 4PGDA 4TUKL 4QRFA 4FTVE 1QSZA 3AB0B 1RZFL 3WE6A 2DL9A 3RIFF 3LSOA 5EORH 1UWEL 3D33A 4A2LA 2J1ZA 4XN8A 4KV5F 2GB2A 2XWBB 6PCYA 4JLRB 1UFUA 3ALXA 3OX8B 4IHOB 2BW5A 3AQYA 3F2LA 3FPYA 3T77A 4RWYL 5LWYH 4NWUL 3WAKA 3SCMD 4KJQD 1GCYA 2XJKA 4LSSH 3HZVB 5DA4A 4BXVA 4FFVD 4NM8H 2PPCA 5K9QI 5L9DL 3BAJA 5EDXA 1HZLA 1K5NA 3F6LA 5KVGH 1T20B 2APTA 1N2RA 3ES6B 4JVPA 4MBRA 4KWUA 4RAHA 5D93B 3RWCA 3D2UD 4FFWD 5TF1L 4HD5A 3V4PL 1UXWA 1B0GB 5EIQA 4ENEC 4XNDA 4H5SA 4ODTH 3FSOA 3KPQA 3QEQB 3VNZA 5JW4N 3FFDA 5GJTL 1M9SA 4B7IA 4P23C 1JHKL 3OGCB 3L4VA 3Q3GA 3EDEA 3NEXA 1ILSA 3F00A 4X6DE 4AJWA 2PYEE 1OARH 2H45A 2WK2A 3ZZLA 4LL4A 1F56A 4NHCH 4DN3H 3UBXG 3B43A 2BFVL 3MBEB 4R3SB 4ZX3A 3P3RA 3NA9L 4DN4L 3EGXB 3FQXA 4JFDA 3MGAA 1F4XL 1CU4L 3K6NA 4UB0H 3QRFM 2CNZA 3L3GA 4Z7QF 1A6VH 4BFJA 1DBMH 1AHKA 4BKLA 4G43B 4X5XA 4LNRB 3IFOB 2I26N 5I18L 4I13B 1INQA 2IPKA 1J0HA 2EO7A 3L5WA 2PYFB 3SJVB 2UXTA 1WAAA 4FFTA 1U8OA 2CGYA 1IKFH 3O8XA 2ZWZA 3VE0B 2BNUB 5GGTA 3QHZH 2VQ1A 3DVIA 4GB9A 1XF5A 4LT7A 2JI1A 5EU7C 4U6VH 4UDTA 4A2DA 3SE3C 1G7QA 3KVPA 1JRHI 5JORA 4UNIA 3HHSA 3Q9QA 2JELL 3QISA 4KO7A 4ZS6D 3FQYA 2EUVA 2Z4QA 4NUJB 2RACA 3O6KH 5B1AB 5IMLB 4ABQA 5I1AA 3PABB 4NSKB 3MTRA 4TSCL 2VQTA 4QTHA 4JFPA 1TU2B 3PP4L 4D8PA 4MA1C 3S96B 1BEYH 2AC0A 5AOLA 3BGAA 1FE8H 3QIBA 2NY1C 3UTSA 5FYKD 3IVKA 4ZNCD 4UIKH 2F18A 1MFDH 2G3NA 2ZUQC 5B39G 1QFUL 3IMWA 3DX9B 1TXKA 1RFDH 1CN4A 1I8UA 4OGAD 3BUYA 3E9UA 2BP0B 4M1GL 4NM4H 4NQVB 5EU5A 2EE3A 5HHNA 2A4ZA 2DWEA 4L3EB 1ONQA 4YSOA 4UWQB 4JFWA 3TZVB 2MRYA 1BYPA 1TPXC 1KLGB 3AS2A 3B8YA 3VD5A 4YE4H 5B1CA 4ZFZA 2RA1A 2MHAA 1I1CA 1V7NL 2OTUB 5EZLB 4C4KT 2OAAA 5TD4A 5TQ2H 3GMMA 3HMWH 1OD9A 2BXZA 3OZ9L 3Q2WA 3WNJA 1G7MA 3P77B 2VC2B 5AYQA 5E2TL 4FJZA 5FYJL 4ANVA 4NO0A 1BD2E 4XCYA 1EERB 5GZND 5ICUA 5C0CE 2IFFH 4PJ5D 5AUMB 5C0GA 2YRLA 5HYIA 5I74C 4E41D 1KDJA 4BQCA 4EI0A 5JMRA 2DQJL 3N55A 2YEVB 3V6OE 3WTVA 1QI4A 2ZYIA 1OOWA 1JYWA 2XYCA 4ES9A 3PFQA 4K07A 3CZFA 4QHPA 4F7TB 1RJLA 5LGHL 5HYFA 2JLPA 3OKNA 5CGYC 2R29H 1S8DA 4Z78A 5C08E 3SB3A 4FLHA 3X17A 4NIYE 4LRIA 4KOBA 3NJMA 4OGQC 5DSCB 5EPMB 1A6WL 5CKAA 1R17A 1QTPA 1PZUB 2O93L 1JPTL 3BKJL 3X12B 4WFGD 3A21A 3KPLB 1XV8A 5AFAA 3QWQB 2CPUA 3VWKC 3DIVA 2BVQA 3NGBC 1EAPA 4GRWE 4BSJA 2CR3A 2ICES 2AEPH 2MEJB 3QIWD 3QNZB 4AXWB 3MRHA 1D9KB 2OXGA 2Y5TA 4P57A 1HT6A 3ABMB 4XO5A 3QR2A 1A1OB 4MNQA 1T7VA 1XFPA 4LMQE 2EYTA 3TP4A 3T6VA 4LEEA 3FF7A 4MNHA 1AQKL 1KGYE 1QACA 5I16A 1U8IB 1YNTA 3IB4A 3BT2L 2WLIB 5FPIA 3I6LE 2MPAL 1FIGH 4UU9B 3L7EA 1DN0A 3HE6B 3TF4A 5FEBA 2A6JA 2WOYA 5HHVL 1IGJB 4RAVA 3AY4A 3SPVB 4KOCA 5LBGA 2CUAA 2G2NA 4M56A 4HMCA 3RNQB 1IC0A 3LJ3A 1TEGA 1P4BH 1GYAA 3GC3A 4KMTH 5CCGE 1PNDA 3HOGA 1AIFA 1A4BA 2QV4A 2F7PA 4LSQL 3D3VA 4XZUB 5DYFA 3RIAF 2PP8A 2VDNL 2OP4L 3TV3L 4AJYV 4H8VA 3ZRSA 2F58L 1S7WA 3KGTA 2WZPD 5KYWA 3IS0X 3US9A 5KVMC 3O3EB 2Q6WB 1B3IA 2BY0A 2DQUL 3OJMB 4L4TE 5D1QE 4AUJA 2J4WL 3GKWH 2VXTL 3U9PH 1VGKA 1IL1B 2VDOH 4NQEA 5AVUB 2ZX6A 1KLGA 4O02H 5JIQA 1QSFB 2EYTB 3V4VH 1I9JL 4DVRH 3HN5A 4JFSA 5AB9A 1NEZA 1QQDB 5E8DH 1N0LA 1IVTA 1IEBA 1CICA 5D6CB 3F7RA 5HXMA 4ZNEE 1DP0A 1NH6A 2EKJA 1MG2C 3I50L 5IESH 4AG4H 2A7BA 4Y4KA 3PL6D 1R33A 1M7DB 1JHLL 4QOKE 5GGVY 2FEDD 2LAAA 4FQ2L 5G4MA 4AMWA 1Q0XH 4WI5A 2F1AA 5FCUH 1QBMH 5GHWH 1CFQB 3MV9B 2RCSH 3DUSB 3JV5A 5IROA 3KWXA 3HG1B 4F7CB 4Z3HA 5ACLA 4MRBA 1QHPA 5EA0L 2FT8A 3WFHA 4Y4KC 2XZCH 3O2VH 1MXDA 4XVJH 1LP9A 2BP5M 2UZIH 2YD0A 4XMLH 1RKRA 4YOKA 5IFAL 3MDJA 3ZSTA 4AEHL 4XPAH 1MCWM 4S1RL 5AYUH 2EZ0C 4DPAX 3SO3C 1CYGA 2F54B 3JWDC 3JTTA 3RWEB 3L3JB 4U1IB 2X70B 3DUUB 5JHAA 3WUWG 3NCJL 3Q8FA 4UQ3B 5J6HB 5LNDA 3BH9A 3LB6C 2Y6TE 1H5BA 2WQAA 4PRDB 4JZJA 5FC9A 4U7MA 5BJTA 2QJDA 1OF2A 3DBXA 1A21A 5DUBB 4Y19B 2J1YA 1OK0A 3L1OH 1WIOA 2GVYA 4UUJB 1XGQA 3NGBB 4UQ2B 3KPSB 3DRTB 3MXWL 1B0WA 3UEQA 1JSYA 2JIXB 3KNBB 4HIJA 1NFDF 1IBBA 5C8JB 1T2QH 3ZOAA 2C1PA 3UPRB 4OJYA 1M05A 2EXYD 2XVLA 1A3RH 2NQDA 3OAZK 1IAIH 4TQPA 3IAQA 4M7ZC 2FO8A 1TQCB 4RSVA 5JW3L 1EJ6A 4G7YH 5ILTH 4HKJA 3U2SB 3BISA 3PRZA 1Q94B 3KDMA 3KL5A 1CC3A 5TQ0H 2Y72A 2E8YA 4YDJB 3QPXL 5GJSH 5CEZD 1S7SB 1RIHL 4DEPB 3NAAL 4JFED 4W9DC 4ADIA 3ZE0E 1KT2B 3UYOD 4YHZH 1X9UA 2DQEH 1F58L 4GLRH 5I6KA 5E9DB 5DJ2A 4PFEA 5HDWA 2E59A 3DHMA 5GZOC 3MRIA 1MWAH 1ZIAA 1C1EH 3UC2A 4P46C 4M48L 4N5EC 3B4NA 1A65A 5TK4A 1FBIH 2FR4A 1AYRA 1R3IH 4TQ8A 2DYPA 1H19A 4X9HA 1JNHB 4PY7A 1IGTA 1X5HA 5AW0B 5F1OB 4C54A 3MV7A 5GGVH 3KH4A 4CL7A 3L8QA 2ZUQB 2YPVL 2ADFH 4LVNB 1X5AA 5IVXE 4QD2E 1HN1A 3OR6A 5SWQB 4AYMC 4L0PB 3C9NA 1UD8A 2MQ3A 2Z91A 3F7VB 3ASWA 4XX1E 4MXVE 1NGPL 1HH6B 5C0DB 1KB3A 1DANT 2CE6A 3O6LL 4FLRA 5BOZG 1EVTC 4YIQB 1EJOL 3S35X 5C2UB 1HILA 3DYPA 4RWYH 5DGRA 5ESVA 1KLUB 3R8QA 3RFZB 4P5TA 4U6XB 3B34A 4B9CA 1UUSA 1N67A 4EVNA 1JZFA 4F91B 3TFBA 3W0WA 5LGYA 3QZWA 1GIGL 5BW7C 3V8CA 1LP9B 1HESA 4U1MA 1C9SA 4WV1C 3VFOA 4LHUB 3S4SB 2J2ZA 5EULV 3MACH 4JANB 4QRPB 2A83B 1OSZA 1BDYA 4DF9A 3OGOE 4YO0B 5IP4A 5EOTB 4HH9A 2GTZB 4PH8A 2KT6A 2FNBA 1UWXK 5FB8B 4XVSH 3RTLA 3SE6A 3UZEA 1SY6A 5D2LF 2ZIDA 3HPJA 1CFVH 2AV7B 4GMSL 2Y7OA 3HNSH 5I73B 1VKXB 1NFDE 2XBDA 4YWGH 3L1EA 1TJGH 4KZEH 3VXTB 1N9PA 5D7KD 3QT2A 5FDWB 3PDGA 3ZE1E 4WCYL 1LO5B 2XG5B 5D6DC 5CJXA 3HC0A 1RUKL 5AVQB 1B88A 2LAGB 3ARBB 3DIFB 3ECUA 5INCA 1I7RB 1EHAA 3U6XA 5I0WA 1DQVA 4DW2H 3EBHA 5E6IB 3F7LA 4HDIA 4HSAC 2FH6A 3MLXL 4YHLH 2FRGP 3LZFL 3SDXA 1HHJB 4X6CB 2VN7A 1CVRA 1JFQL 3E7JA 3L3DB 3LRLA 5EU3A 5F7DA 3UTZB 1EEZB 1RSFA 4XMTA 2YFNA 1J48A 2EXSA 5DJDB 4GRLB 1T66D 2N56A 2Q87A 1LO3H 5DRWA 2LQRA 2ADIB 4JREC 2R39A 4PCSA 2YAFA 1O6SB 1HCVA 3C6LC 5DR5L 4U3CA 4YN3A 1BLIA 3RBGA 5JW4R 2NW3B 1XH1A 3DMMA 2Y69B 3K1KC 1NCNA 1BVKB 5T1KD 2Z8WC 4XNQB 3C6SA 2W95A 4NN6B 4I2XE 3QDME 3OM3B 1X5GA 4MKTA 3BYTA 4HS8H 1J5IA 2DWXA 4ELKA 3VRLE 4PN6A 1D6VL 1NPNA 3Q9PA 3FT9A 3CFEB 4OF0A 3RVTD 5JW4M 4I77H 3L4YA 4M6OH 1WAEA 5KANI 4RFNC 5TDPB 4DKDC 1KN2L 1EAQA 4N9OB 5F21B 5HGHB 4X0NA 2A0LD 4JRWA 3BKCH 2A6DB 4QXGL 3HBGA 2VM9A 3X3FL 1N12A 3O9WB 4PWFA 1P4IH 2Z31A 1DFXA 1OLLA 2ZWYA 4KJWD 3VRLF 4GAAA 4NOBA 4QJ4B 5DQJA 1VFAB 1BWMA 4JRFA 1GS8A 1OY3B 5ALBL 4G6JH 3WD5L 1WJ3A 2YA1A 2EE2A 1YSOA 3P9WB 1VA9A 2Y6SC 3T0XA 4DFHA 5E2WH 4OBRA 1PEWA 4DQOH 1BQLH 2UYLA 1QI3A 4XMXA 3SOBL 3EDFA 2FEDC 2ZX9A 2Y5EA 1UZ6F 4ZXBB 1BM3H 3TEYA 1WZKA 3P73A 4M1DL 1LE9B 2IFFL 4DP8X 4TTGA 3OJ2C 4FZ8H 1WVZA 1IQDA 2AI0L 4MDIA 2UZPA 4MJ4A 4Q9BA 5D7HA 3UJJH 4TL5A 3RVXD 5C9JB 1D5ZA 2DQCL 3FB8A 4HGKC 2XN9D 1T89C 2FIKA 5L4JA 4GP8B 4ODVH 1AXTH 1ANUA 1CZ8H 1CD1A 4LDCA 2RTTA 3WLBA 5CMAA 3ZDYF 4FHKA 2VXQA 3TPKA 4MJIA 1GTNA 2WO2B 1E4JA 1EUUA 2HTLD 1OAUL 4R84A 1UOVA 3RRQA 3ILEA 4C58B 1NDMB 1Q9OB 4JFXB 3KPSD 4YGVA 1Q8MA 5AZEH 5T3ZH 1HI6A 3VGFA 1PZDA 3ATFA 2XQYA 2IWGA 5T3ZD 3DBSA 3RKPA 4JO5A 1UASA 4HKXB 4KK5D 3D39B 1F1AA 3ZDXB 3VW3L 1KWKA 3ZHLA 2D2CC 3QFJE 3OB0H 5GRYA 3LOWA 1J1XH 4F8NA 4B9KC 1JNJA 5DVLA 3HI6L 3QDGB 2DQGH 4GRWF 3SDDD 5FO9B 5EFIA 4CDGC 7FABH 4P3WA 4OCWL 3MFFB 5E0FA 2Q86A 4NT6A 1JJUA 1S7UB 2DD8H 3LN9A 1Y0LA 4F37K 1HXYB 1YMHB 3FUJA 4I18A 4K7FB 2PYFA 1ADQL 2DWDB 3S98A 3BPLB 1MXGA 4KKLD 3SJVA 1K5WA 5IV2A 4FQXB 3W39B 1MDAA 4QI3A 4XNYL 4ZPVA 3R4DA 4MHHI 3B2VL 4AVKA 2R0KH 3MPCA 4M93B 2AVFA 4DP6X 1HYSC 2CK0H 2X2IA 3DDGA 2PMZA 2VH5H 1TKWA 4TPRH 3U46B 3ARGC 4M7JH 1QZNA 4PP1D 4NXSA 5JORB 1OVZA 1QKZL 3FKUS 4HC1A 5HTSA 1K8IB 4FJ6A 5TDPA 4Y4HA 3FT4B 1TZOA 2F61A 3U30C 2HT2D 2BIHA 3ZO0A 3EYSL 2GJJA 1QPXA 3VGHA 1A7OL 1X9QA 1KLFB 4N0CC 3O9WA 2MCG1 2NY0C 1QWUA 4XHJD 2VZUA 3Q48A 4CJ1A 1A2YB 3V2AR 1FVDB 3FCSB 4UT6H 3CU1A 5E6IC 2A9NL 3G6JA 4HJJL 3CSPA 4IQHA 2FJGB 2HG5A 4WO4A 3T3PF 3E1F1 3CPLB 4LRIC 1MFAL 1HE7A 1P6AB 2EXTA 2OMWB 3VYOA 4GMTH 4R5XA 3FHEA 1C5DA 1AAJA 2ITCB 4N6RB 2PTTB 3BIAX 5IB4A 4LVHB 1RP8A 1RU9H 1FFOA 1TSHA 3ZRFC 4EI6B 4JE0A 4R2GB 1YYMH 1FPTL 1SJHB 4AM0A 3S5LB 4OLVH 4UM9B 2P4AB 4I2XA 3VXUD 4G6ML 3V6OC 3TNNA 1BBDL 2WYZA 3MYJB 1MRFL 3O8XB 4P2OA 2ENQA 4J23A 2X1WL 1C8QA 1AMXA 1XZ0B 1L0XA 3LRSB 3DXAA 3PL6B 4FQ2H 4L48A 1K8IA 5JOFA 1S9YB 2QHLA 3LZPA 3WJLC 3EYOB 2VZ1A 3GSQA 1YEIH 2VDQB 1Z7JA 2EIKB 2YD9A 4FQCL 1UYWL 2Q3XA 3B2UD 3DGCR 2WUCL 3FU8A 3I3EA 4N2KA 2IWEA 4L8BA 1E5CA 3RGBA 1T83C 4O4YH 3DSFH 1QI5A 5GS0L 5FO7B 4AVIA 1BSIA 3QWRA 2IG2H 5EZOH 3ESVF 1KY6A 2NY5H 4KVNH 5L0QC 2GSGA 4WI2A 4FFZL 5HPOA 1FL6B 3IU3B 2AQTA 3PGCA 4I5BB 5C0BE 1D5MB 2ODIA 5PAZA 1AH1A 1FNGA 1AFVL 1UB5B 3ZRCC 2R1WA 4Z7QE 1E4HA 3PHQB 4XMPL 2VDKB 4X5QA 5JHDB 4P59L 1RXLA 1J86A 2JJUA 3H7BA 4A2FA 1QRNA 3O2WH 3VQMA 5F7HA 1GS7A 4LCVA 2E9WA 2GAZA 4RDQG 4H2CA 1O7DC 1UKSA 1E2VA 3FH5A 4M4RA 1I1AD 5EG6C 3ZX1A 3QUGA 3MUZ1 1ZLUH 3RURA 4ABWA 3MNZB 3ZMNA 1BAWA 1A3RL 4QRPD 4X9BA 2A77H 5CWSA 4N8VB 4J7RA 4R90L 1EGJL 2R0WL 3EYOA 5EN2A 2XN0A 5EBMA 1MCNA 2B0SH 3PWPE 2V3FA 2ZSWA 4HIEA 1XB3A 1P7HL 3EZJB 2MSPA 1F3JA 3J8F7 4PJFE 4YR6A 15C8L 4IOFD 4YDLC 5E1AB 4QXUH 1FNSH 4JM2C 1CU4H 4UB0L 4HKBA 4H20L 4BFOA 1KTDA 4XVJL 5IIEB 2DQEL 2XWDA 5I1LA 1DBML 1WFMA 1AD0B 1IC7H 3MZTA 1AS7A 3KPPA 2ZOTA 3U4BL 5KYXB 4L3EE 2HKHH 2P45B 4XNZB 3QZPA 4XPAL 3F62A 4E9QA 3UYRL 1U3HC 3VWJA 5IWLC 4YDJA 3VXUA 4GQ9H 3HI1A 4U4IA 2BCKA 5HJDA 1ZWIA 4PGCB 3RVUD 4MXVF 1S7VB 4F7CA 2BS71 5DWPA 1MHEA 3NH7L 1R3HA 4ODSL 1E43A 4OVVA 2AQSA 4JFZH 4MVBC 5GRUL 3S0PA 1KEMH 4WSKA 5J13C 3ZK0A 1TJIH 4D7PA 4H26A 4NM8L 5IVXF 1CDGA 5HHXH 5HDQL 5T1KB 3W56A 2UY6B 3MUHL 3PXJA 4TF4A 3N91A 2DWEB 4M00A 4FJYA 5I0DA 2FR4B 1B0IA 3MGTA 5JYMA 1BZEA 4W70A 4ZMQA 4GPVA 1TTBA 1IJ9A 2VL4A 1H3GA 4YR6B 4M6NH 2J5WA 3F04A 5EEVA 2GCYA 1URIA 5E8NB 1IC4L 1WV7T 1I3RB 3TBWB 2ZUSA 1BIHA 3B9VA 1E5BA 4NJAH 5ICZA 1AE6H 1CIDA 1OZTG 4JZNA 4FCAA 3VXRD 5DC4B 2E46A 3MKGA 3DYMA 4U6YB 4XCYB 4CC1A 1PJ9A 4DO6A 4OZGA 1AZVA 3U6XS 1A7QH 3FU7A 3IPBA 4P9HL 2XU9A 1X9LA 4N8CL 3ZKMC 4LHUD 3ARUA 4ZUUA 4AM0Q 1KJ2B 5ICYB 1T1XB 3S3SA 4LOUC 4TM9A 3KD4A 4PV1C 4NRZB 3EBGA 1WP6A 4LHUG 2MIZA 2MNWA 3NFSL 4PJ9B 1EHXA 5HHPA 1LEIA 1SOXA 3QUHA 4HHAB 4FNSA 3H3PH 5D7LE 1UB5A 2YD2A 1R0AH 2CBMA 3K0YA 1TEFA 4TTDC 4WW2A 5DMIH 3ZE1F 5LJYH 1E42A 5I6LA 1ID5I 1JZ8A 4QRPA 5DUPL 4GO9A 3FN3A 1NWPA 3VXNA 3WUWB 4BSVB 4GG6A 2X4OA 4GBXD 3B9AA 3D39E 3B7UX 4NKDA 2X9ZA 4P8QA 2ZXWB 2FATH 2JVUA 1CL7L 5DLML 4OF8A 4M29A 5K9KA 3T0EA 1QYGL 4N8VA 4XNUH 4AV5A 3QHTC 5EO0B 3C75A 5E8NA 4O5LL 1EHKB 5B1JA 3B7YA 4P5MB 3ZDYE 5C0BB 4B97A 5A7BA 3MX0B 1TITA 4MMXC 3ISRA 2L7UA 3IDNB 1KY7A 3DVGB 3LXCA 4QXVA 3CMGA 1L6XA 5KYYB 3GQFA 2XV2A 4U6HB 4F20A 1I7ZA 4ZOCA 4GAFB 2A4CA 3WLWD 1UJTA 5EIVA 1WA0X 3O3UN 3VXQB 1INEH 3GHPA 3SDXB 4GUOA 3Q1SL 2VDRL 1RFDL 2X4UA 1PZ5A 2WO4A 1MKFA 1KUMA 1U93B 4FADA 3HAEB 2FX8H 1S7RA 1A66A 3OWEA 4FABH 5IUCA 3K0WA 4NO2A 4B6ZA 2RH0A 4JM2A 4BFBD 1BMZA 3H56A 1G84A 4V2BA 4L0ZA 4ADJA 4UQAA 4HQQH 1J1OH 1KBWA 4QT5A 5ANMB 3AG3B 4G5AA 3WFBL 3MRLA 3VGAB 3QEHB 5L0QB 3EGSB 4XCCL 1LO4L 4LASL 1YO4A 3AB0C 1YECH 5SWZB 4JDZA 4ODXB 1RZ8A 4E9TA 1MIMH 1ZIBA 2H32A 1W91A 2VXUL 4IU2A 4F5CA 1SMDA 3PWPD 4ZOBA 4LQFL 4ZSOA 1EMTL 3WGUB 1H3TA 4LLDB 3EAKA 3QXAB 4HUUA 3LVEA 3GI9H 2ZCHL 4ODWA 5FGSA 3P4NA 1VFUA 1J10A 1GMIA 3QO1A 1L9PA 1XR9A 4FHBD 4W81A 3IJEB 1O5DT 1SM3H 5I9QB 4JKNA 2VDNH 4Z7AA 3TCTA 2YAOA 3LPPA 2B3RA 2EYSA 1NBYA 1V10A 1MN4A 1UATA 1T80A 3A23A 3EDKA 4YDMA 1BW8A 4MMZA 3WCYA 5I1GH 4KJYB 5KUKA 4AQ1B 4KNUA 4L3FA 2WJ5A 3RZCA 2Q2LA 1KZQA 3RGVA 4IU3A 1WEJL 4KXAA 1U4FA 2BOCB 5ESQA 3LHPL 3LIZA 3T2OA 3ARVA 4JM4L 4NC0B 4JM2B 1MCFA 4KZDL 2VSMB 4NX0A 3S4SA 2EO1A 1MFEH 3UTZA 5IF0A 1JN6A 3IDGB 1EAJA 4ZI8A 1ZHNB 3SE3A 2DQFA 2H8PB 2HVJB 2XXMB 2GTZA 3N41B 1KPRB 3IBOA 4WDIB 5AZEL 1W9XA 1YYCA 3HEIB 2Z4TA 5T3ZL 3ZJAA 3AG1B 4F8OA 3B2MA 2BOLA 4Y19E 3NMEA 1OXYA 5FHAH 3T09A 4XE5B 2Y0SA 1SNRA 4UV4H 3T0ED 2XLLA 1F4AA 1X4XA 2NNAB 1IGCH 4UTBL 1CFMA 2IAMD 2FO4B 2ENJA 1DVFD 1E4KC 1EZVY 4LF3B 2I9TB 5BW7A 3I6GB 3T6WA 5IT2L 2GI0A 4LIQE 4Q9QH 1QD0A 3F7YA 3KYKL 3TWCH 4APXB 3BH9B 5F7UA 3L2MA 3LRKA 1FNEA 3CQQA 2LGNA 1AO7E 3VWJC 5IWLA 2CUIA 1K4DA 4MMYA 3E9TA 2UZIL 2KERA 4JFTA 2VABB 2L8AA 1MVFA 2Z91B 3F7VA 4W9IC 5INDB 1RZQA 3BHBA 5BOJA 2CA3A 4AEHH 1MHCB 4YHYC 4KXZI 4LSQH 3E8VA 3QXDB 4NHUA 3ZDZB 3GXIA 2BOCA 3G9VA 5ESQB 3SBPA 3EJCA 4JREB 4QRSB 1KELH 3ISYA 1G6VK 2EAEA 3OLDA 1WFJA 2WZPA 5AG8A 4UTAA 2BP3A 4MCZA 1KGUA 3QXTA 3TBTB 3OKDB 3KW7A 4H7VA 5FKAB 2AJXH 1A3QA 4GW5B 2Q3AA 4C56D 5EO9B 2P8LA 5I8KL 3MCKA 1R5WA 3X3GL 4YVUA 1U58B 4WW1B 1T7ZA 2R7EA 2X1PA 1UENA 2G3ZA 2FX7L 3FB6B 2KH2B 3LKOB 2Y2YA 3KBHE 3VXOA 1Q9KB 1T2QL 2WLJA 5F88A 2HFGL 2DJMA 5FWQA 4QRQA 3GBLA 5AENA 2Q10A 2Y3AA 1HHGA 4OIIL 3DURA 4D0DB 3IDYC 5D9SB 3F01A 2L7EA 1MSPA 5SWSA 1T5XB 4RESB 2KBGA 5KBLA 3P02A 3FT4A 1EZSA 4BDVA 4Z3FA 1Z9MA 1A1MA 3TT3L 1L0YA 2ZOUA 1KIQA 2CRZA 3H55A 4A2GA 3VI3B 4EZJA 4R7XA 1BZ8A 2E9GA 4RFOH 2X2UA 3E8UL 3HB3D 4K3JH 4MCYA 5SV3A 4N3UA 3G04A 1NDMA 1Q9OA 3HHMA 1F58H 2L3BA 3ULSB 1NOLA 1CF8L 1IEHA 5E2UL 2J71A 3KBFA 3KXFE 4ETYA 4WJKB 5HVWA 5C07A 1B4RA 1LK2B 1SFDA 3A5VA 2PO6B 2X38A 5K9QG 4Q97A 2ADGA 3OG4B 5F96L 4A37A 1QBAA 2I27N 5CJQL 1HWHB 1PZ3A 4J3BA 2FECL 1WBXB 3GMNB 5MENB 2X0UA 3II3A 4EVNB 2MTPA 3LV3B 2YPVH 4XNQA 4K7PH 2B1AL 4X7CC 5EMYA 3FW6A 3FQXB 4JL1A 5DUML 4IGBB 3MVSA 4NUPA 1A3LH 3EADA 1J9CT 2QQNH 2OMUB 3DKHA 4FQPA 4RX4D 2ISDA 4UQ9A 4HOMA 1P84K 3BRDA 3IE4A 3IJ8A 4OFKA 3S4SG 1IAII 1KB9J 1NCGA 1TMQA 1JGVL 2A83A 2V2WA 2Z8RA 2OR9L 5KTEL 1MOEA 2NDFA 1AO7A 1T20A 3EJZD 4OCNC 1N18A 4IBYA 3V4PA 2EYRB 2PW2B 5D7IE 4XVUC 1PZSA 1Z0NA 1ZD6A 4LLUA 3MJGX 3PPSA 2VR7A 1BFVH 1A9VA 5ABDE 2CBQA 1JAEA 4X4YA 4LLWA 3WEBA 3S2AA 2MWCA 2AAAA 3FCBA 5E95B 4P4KB 4MXQD 5DC9B 1MCBA 4K9EH 4WI3A 4DGUA 3QWNA 1WE5A 2BNQA 1DQML 3OZKA 4JFFB 2F5BH 4JHWL 3ZQWA 4BFRA 3DPBA 1FF5A 1WS7A 2HP4A 4N0FA 1EZUA 4G8IB 1QX1A 4GRMA 4WTZA 2DBLL 2FGWH 4RZCA 2I25N 5DD3H 1CQYA 3N06B 3UP6A 2VDLB 4WO4B 1WWCA 3B7RL 4IDJL 1HCZA 1S8DB 4OD2B 4OGZA 1FNGB 4Z78B 3G5YB 4HAKA 4N2OA 5HYSG 2X42A 2AXJA 4ZW8A 1LWRA 5MERB 2RD0A 1MQ8A 2WLHA 4LCCC 4JRXB 1CI5A 1N5AB 3ARBD 1L9MA 2E56A 2WQXA 4ZMNA 3CDCA 3MRMB 3H42L 1Z0MA 4OQTA 4AIZB 1EVUA 2H6OA 3U1QA 1U58A 4WW1A 2EIDA 1RL1A 2BZCA 5AALA 1EXUA 4A6YB 2C3WA 4JKLA 5J89A 3BO8A 4DOHE 2XWJA 2FX9L 2Q1EA 1QUPA 3O6FC 4GG8B 1ITCA 5DJ0A 4KKZA 1VERA 1SHWA 2C4XA 4I18C 2VLKA 4EMZA 4D0DA 5BZXA 5D2NC 2DW5A 1QR1B 3RWHA 1KXHA 4PGEA 1FVDA 3FCSA 4ZFZB 5DEJA 2X9YA 5JOFB 2GEEA 4QRRB 1BPLB 3G5ZA 1BVNP 3GMOB 5E1AA 1IMHC 5DR5H 1SN0A 1CVSC 3BSZA 4RGNE 2F53B 5C07E 4YSQA 1Z9OA 1A7PL 3L1GA 3OAZH 3TJPA 2WV3A 4NOFA 3ZE2F 5FYLD 4JHBA 1AGBA 5AAWC 1P4LA 3MRQA 1MFDL 7TAAA 3TURA 3GXNA 2VOTA 4KNTA 4CGUB 4H8PA 4WK4B 4WV1B 4Z77B 1U8NB 3LN4B 5E0QA 3W5MA 2BVTA 2YD8A 1H5BC 1MFBL 4TVPL 3VMNA 4WK0B 4OJFL 4KTEL 4IRJD 2JCCB 4MCMA 3GHEH 2JTDA 3M07A 3IKKA 3LS5H 3E6FB 2A77L 2R0LH 3FONA 3K8LA 2VXVL 4FNQA 4KO9A 3MTXA 1CGWA 2JCWA 3QULB 1HOEA 1H0DA 1BIIA 3AFLA 5I73C 3TFKD 1WWAX 2Z65C 1BG9A 3CVHA 4NUGH 1E5ZA 3OWRA 4K3EL 4LNRA 5DI8B 4YC2B 1PY4A 4DPRA 3TXAA 1EHLH 1UA3A 4KC3B 5CD5D 3F05A 3UO1H 1AJ7L 4HD9A 3QEGH 2IXQA 2NR6C 1JXKA 3D3VE 3MNZA 2ARJB 3P9LB 4LLYB 2XKNA 4X7FC 3ULUC 1I85A 4KU1A 3LQZA 5DCCA 1AGDB 3AU0A 4W9HC 4AXWA 3TNMB 4Y7MA 5D7SH 4CN4A 5F6IB 3SOBH 5K59F 5CLTA 2F53A 3CJJA 2D7TL 2LVEA 4CU6A 1EXGA 1FN4B 5D7JC 3T6QC 4OFIA 1GGTA 2WBJB 3EF4A 1KULA 5GZOA 2GJ6E 3VQLA 2AQNA 3KYOA 4NUMA 3U2IA 2ALAA 4EI5C 3DO3A 2HZHA 4NN7C 4Y2DA 2YUWA 4KI1A 4MD5B 1M2VA 1OM3H 3RGVC 1WWBX 1AC0A 3LQAL 5DXWA 4I2XB 3TJHD 3VD2A 1LEKB 4JO2H 4AL8L 5D4HA 1HYSD 3GTTA 1QP1A 4R26L 1XWVA 1MNUL 4OCSH 1B6UA 3ZO9A 3AWGA 3U9WA 4RMUA 3K5RA 1AHMA 2FLBT 2VZSA 3NDZE 4JFFE 4I3SH 1C12A 1U0QA 1VZIA 2DEYX 3DVNA 3EJZC 3BQVA 4Q56A 5BZDA 1UXLA 2NY3D 4F2ME 2VUKA 3B37A 1CXLA 4ZFGH 2XPZA 2XXFA 3VVWA 3K2IA 2W07B 5GRJH 1XO8A 4GSDH 1E5UI 4NO3A 2NSQA 4OSUL 5DHEA 2EEXA 5D7EA 3VFPA 3NPSB 5K9JL 2D7OA 1XMWA 3FYIB 4WI4A 2GJZB 3WDIA 5CXPA 4KMTL 1X4YA 4PJ7E 2FQFA 5IB3A 1X7SA 1PVHA 1Z5LB 5D4JA 3QPQC 4XNBA 3TPUA 4BQ6A 1G87A 4N24A 1RULL 2VWEC 2AMGA 1BREA 1XCWA 3F5WA 5SWZD 2Z93B 4PW4A 4P2YA 2RB8A 5GRVK 2QSCL 1S7RB 4HJ0D 1WWWX 4XCNA 5DJCB 3ZHNA 4LOFA 1OAXL 3T3MF 4PV9B 2XN9A 2QSQA 4PB9H 5K39A 3IGAB 4X6FB 1TZGH 4KROC 1YN6A 4U1KA 1QYGH 3PL6C 3FRPB 1UM6H 1CE1L 5ABAA 1GGUA 4B95C 2AJYL 1PLGL 3TZVD 2V9RA 4U49A 4GI8A 3VYNA 1MCJA 2P47B 3EFDH 3KW8A 3AGWA 5EUKB 2VLJE 1S78D 4G7QB 4NNXA 5BQDA 2OMNA 2B1HH 2QVTA 4JE4B 5E9NA 3T0VA 5IQMA 4ZTPL 2V5SA 1WS8A 2AJUH 2VDQL 1ZT7A 3RYMA 1XH3A 1MFEL 3QO1B 1QBML 4ZUUB 3P4MA 4LEBA 1J8KA 1UD2A 5DJZB 3OB8A 5F9DC 3OR6B 1CLYH 1ZXKA 4YDIL 5F9WC 3FTGB 3CK0H 4NFDA 1XF4B 4ANKA 3I85A 4ATTA 5T1LD 1ZLWK 2IALB 4XC3L 1MAML 1RZIB 1EK3A 4HHAA 2DI8A 2AQPA 4UQ2A 3LDBB 3BKMH 1CXKA 3EYUH 5DS8A 4P5KA 2WYIA 4LLAA 4Y16B 4AH2B 3WXWH 3RAJH 2X6BA 3PGDB 1UWFA 1S3KH 2UX6A 3V4VB 5DQ9A 1RD6A 5ISZB 1MHEB 4TRPL 3MOBH 2VXQH 3IETB 4HK0B 4JDTH 1LO2L 5CD3B 1BQHG 1KCKA 5FW8A 4IBSA 3UGXA 4H8UA 1HSAB 5MEND 4GKSA 5HJ3B 4YS4A 2ED9A 3IFNL 3O3DA 2E6QA 3HRZB 1F18A 2AANA 2Y06H 3FUDA 4JFEB 4ZO8A 4P05A 2ORBL 4PJ5E 4OZHA 5JZ7D 5KVFL 3DGDA 2P8MA 1JF1B 1L7TL 2Y22A 1N6QL 1DO5A 4EKXA 3NYKA 4Y19A 3IDNA 1F4HA 4G8GE 3UCQA 3TH4T 5DVPA 1WUZA 2HKFH 4PJ7A 2WYHA 3DO7A 4P2AA 4GS7C 1OCOB 3ILQD 4XMPH 4HIEB 1KB5B 4NP4L 2VABA 4MLSA 5BZZA 2CK2A 4ZMTA 1MCIA 3T2NL 1Z2KA 2QGDA 3CBKB 3LCYA 5JR1H 1KOAA 5HDOA 3QXDA 3RDJA 4ZQKB 1SBSL 2XIIA 4LKCB 3KXFA 3K7UA 5MP6L 3NAAH 3CXFA 5I0YA 1W0WA 3I9PA 2WXFA 2RR3A 5KYUB 1O9ZA 2R51A 5DQ9B 3KYMA 5FHAL 5HGAA 1VEOA 2PXYB 4HX1A 1J9RA 4EIUA 1MRFH 4KRLB 3FB7B 5FX3A 3WKQA 1IE4A 1YEJH 2WQVA 4AKQA 3OG6B 5DJ2B 3QFGA 4JDZB 2YLKA 5CBEA 2H6UA 2WVSA 3Q6FB 2QPFA 1G6RL 1GC1C 4FG2A 2Z9TA 4HLZG 1XR8B 1U30A 3S6CA 2K45A 3WKMH 1A7BA 2X4PA 2DMKA 5K9OA 1MJ8H 2H9GA 3VQ1C 1DEDA 2X4NA 1U9KA 2ITFA 3VXSB 3O9WD 2H1PH 3LKSA 4NQXA 3APNA 4RISL 5HHOE 4FYTA 43C9B 4PWJA 1QSFD 1INDH 2D9CA 4XO3A 1F8TL 1AR1D 3MLYH 3ZVVA 4RGNC 5CHNB 3B3IB 3EOTL 1CE6A 2V4LA 2LFEA 2XZZA 1SHXA 2YPLE 2ZSVA 4K94L 3UTSD 4P2RD 1MCWW 3FXIC 5I1DA 3OKYA 1LE5B 4MA8H 3NH7H 5JHLA 3QI9C 4JCLA 1HIMH 3CIQA 3QQ9C 1RZGB 1SVZA 1O75A 4KTYA 3ULUD 1D6EA 3NTCH 4QIRA 3BMWA 1OCZB 2B4CH 4XMWA 2BNRE 2EIZA 5INDA 3WSQH 3EBIA 2O72A 1BLNA 3VACA 4MZIA 5HPMA 5FLVA 4JJOA 5IFJB 1T1ZB 4E5XA 3ETSA 2ZQKA 2AXFB 3X11B 4KZ0A 3R1GL 3UTQA 3MNMA 4LAQH 2CR6A 3BP7B 2IADA 2MKLC 2AJVH 4MB4A 25C8H 3LV3A 1LDSA 4F8TA 3EGSA 3OSKA 2YD1A 2X4NB 2X1OA 3FMGL 5F72S 1JPST 1LJMA 2ADIA 2FJFB 3QORB 1N5YH 1HAUA 2ICEC 1JCVA 12E8L 3T0EE 2EEBA 4PJEF 4UM9D 4AQOA 1Z9LA 1BZDA 1NUGA 4YNYA 2CJ3A 5DVKA 1X6NA 1ES0A 1NMCC 2EDDA 1DQJB 2CJUL 2HLFC 5I8EA 1QRKA 5EBLB 3RX7A 4MCNA 4TUJA 4LLUB 3ZZ1A 4PGBB 4OI7A 1IJNA 3CN2A 2CRIA 5DVMA 2NOYA 3ROLA 3DIFA 1F6AB 4AE1A 3OR7A 4YSDA 4ETQB 4WKXA 3WJMB 5IM7B 1EV2E 4PJ8D 4P2QE 1HHIA 4BK8A 1NIFA 5FO8A 2J5LB 5M7QA 2RALA 3BDYL 3ZTNH 2ZKWA 3KR3H 2OL3B 1RHHB 3UBGA 1AIZA 3RX5A 3P0VH 2BVUA 1NSNH 4MJIE 3RWJB 1MVUA 3S35H 4KHXH 4GKNA 3M1BB 5DUMH 2FGZA 4ODUA 3KPRB 2XG4B 2QQNL 2WQ8A 4CJ0A 2FATL 5KYUA 2WMPA 5CBAA 5DURD 4EO5A 3RY6C 3SEPA 3NJFA 3N0AA 1Y1DA 3QJSB 2J7LA 2I32A 3QQDB 4WU7A 1Y0LB 2EDWA 4JRXA 5HJBA 2HUHA 2V5RA 3SGJA 3ETTA 5LNEA 1BPVA 3RP1A 1MHPH 1XR8A 1CTOA 3AWEA 4Y16C 4BJLA 1MWAA 1U8LA 2JKTM 3FOMB 5GISL 3VD3A 1LQSR 1O6TA 3EHBD 3FO1A 5EC1A 3N42F 2GJ6D 4PI0A 5FK9B 3P11H 3JVFC 5EU6E 3U1SL 1AACA 3G6DH 4MWFA 2QPDB 2EUXA 4Y1AE 2W65A 4WKZA 4L9LA 4EPSA 3U46A 3VTMA 3I9AA 2ZCZA 2Y7NA 2BRRL 1U91B 1L4IA 5FUCC 4QNPE 5ITBH 5DD3L 3NDYE 4JUTA 1EFXD 2J5LC 1N0XL 3ARZA 1E8WA 3D3VD