4X5RA

Crystal structure of fimh in complex with a squaryl-phenyl alpha-d-mannopyranoside derivative
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x5rA00
4XOEA 5IQOA 4AVKA 4XOAA 1ZE3H 3ZL1A 4CA4A 5F3FA 2WMPB 3BFQG 2UY7B 2JMRA 4AVJA 4XO9A 5AB1A 5IQMA 5IQNA 4X50A 4XO8A 3JWNH 1QUNB 5ABZA 1N0LB 4AUUA 4J3OH 5LNEA 4CSTA 5FX3A 5JQIB 4XOCA 4AVHA 4BUQA 3BFWA 2JTYA 1PDKB 5LNGA 3RFZA 3ZPDA 2XG5B 5AALA 2W07B 4X5PA 5FLUA 2J2ZB 4XOBA 4AV0A 1N12A 3BWUF 4AUJA 3JWNG 4AV4A 5FS5A 4CSSA 5F2FA 1KIUB 4J3OG 2VCOA 4XODA 1TR7A 3ZL2A 3SQBB 1KLFB 3MCYA 4X5RA 1UWFA 4AV5A 4LOVA 2UY6B 4AVIA 5FWRA 2XG4B 4ATTA 5AAPA 4J3OF 3ME0B 4AUYA 4X5QA 3JWNE 5CGBA
chains in the Genus database with same CATH superfamily
3LEYH 3V4UL 3EO9H 4TULL 1KJ2A 3JTSB 3US1A 2MCAA 1W8EA 2P48B 1KUMA 2Y5TB 1LNUB 2JKXA 1FAIH 4JW3A 2VLRE 3O81A 4BEIA 3EBIA 4HUCA 2BOLA 4GSUA 1EV2E 3SKMB 5E8NB 3WHE0 2G9HA 3EH2A 4DAGH 4ZFGL 2ALWA 1AOHA 3MRKA 5MEOA 4Y9EA 1XHHA 4Q9QH 4LHUG 1D5MA 3AUVA 1JF6A 1QQDA 1SEBA 2CMRL 2WCGA 4WFGD 3D2UA 5HTSA 4BH7A 4CILA 1T0NB 5H94B 3LPGA 4Y2DD 1A66A 2VR6A 5E6ID 2WBXA 4KUZH 2CUIA 3G9VA 2UVEA 4IIZA 3HZYB 1W91A 3VGDA 3A6OA 3TT1H 1FA4A 4ZSOE 2B5IC 5IVZB 4Q0XL 4XVSH 2R39A 1RUQH 4FQLL 2HJLB 2WIIA 4L1BA 3CFEA 4N1CA 3JWNC 4L0ZA 3HE6A 5ITFB 4J2QA 2PTTA 3TCLA 5IHBA 1WQVT 1NH6A 4FF9A 2VKXA 5EZLA 1YEIL 5CIPH 3V6OA 1I1FB 4QT5B 4AZUA 4IBYA 2H0FA 4B3VA 3JYBA 1VFOA 1VERA 3MROA 3ZKMC 4UANA 5E03A 4G6MH 1PBYA 3H8NA 1T03L 3MRIA 1MJ7L 1KDJA 4G8IA 1NFIA 1S8DA 4Q4IA 4XMUA 1URZA 3OKNA 2IDTA 4OM0L 1NCGA 1FYTA 4PJ9C 2P43B 4KV5E 1JFQL 3SY6A 1LEIA 1DVSA 5E9NA 1OP3H 4W1TA 2B15A 5MEQA 5BQDA 4XCNA 4H88L 5E8DH 1N3NB 3F7KA 1YEDB 3TT3H 4TVPE 1QYGH 1KXVC 1T83A 4NRXB 1I3VA 1HKLL 4L4VA 5AWNL 2P5EB 2DDQH 5MP6L 4R5TA 5JMOC 3QXAA 3IDGB 2FWSA 1M4KA 2VSDA 3AGWA 3D6GA 4X7EC 4WKXA 1EEQA 5FO8B 4LHUB 2WQSA 1MW1A 3FRPB 2VLKD 4B9CA 2QSCH 1BREA 1VFBB 5L4MA 1J9SA 4ZUUA 3MA7B 5GJTH 2VE6A 3V4VH 3CC5B 3T3PE 4PLKD 1A02N 1WISA 5GRUL 3FRUB 3L4TA 3S48A 2CE6A 5HI5D 2AEQL 2FDBP 5C70A 5CN2A 4OAWA 5EF2A 1YPZF 2XN9D 4KY2A 3X1GA 2XVLA 5D93C 3QARA 2NPLX 2ZSWA 2OYLA 5JHLA 2X40A 5F3FA 5FFOA 1PSKH 4LCVA 2PABA 1YAZA 5FM8A 2N1TE 3VGGA 3CGTA 1FG2A 4TSAL 5L0QB 3DV4B 2DQEH 4HJIA 5E1AB 3RDTC 5FYKD 3NRPA 5KSBF 1WAPA 2CDFB 2E9IA 5I8KL 5I1IH 3JUZA 4MD0A 4XXWA 4BXSV 2JB6A 1QOKA 1P6WA 1NPUA 3VWKB 3IRCA 5CD5D 4G3YL 2Y1ZA 5AQ0A 2F53A 2Q3ZA 4FG0A 2X5PA 4ONHB 2CWRA 4WEEA 5KJ7E 4OQTH 5KS9B 1MFEL 1URLA 3DUUB 1YNKL 4PGDB 1JVKA 2RACA 2E8ZA 2AITA 4KTEL 3H9SA 3RZCB 2BCKB 4PRPB 5GS0L 2QPUA 2IOOA 4K2UL 2J8HA 1PDKB 1SJEB 2H7WA 2KL6A 2VUKA 4M8RA 4P59H 4PMFA 3FH7A 4H26A 2NY1C 2IQAA 4IOFD 3IXAA 4WW2A 5BZXA 4QGYA 4X7TA 4LU5H 2XZAL 1NEPA 5HGHA 3IMSA 4U1KB 5D1ZB 5H4ZA 4OV5B 3UEZA 4YWGL 4PJAB 3LXCA 4WCYL 4TSBH 2BSCA 1IGYA 5DQJB 4GRMB 4RMWA 1IQWL 4JZJC 4BZ1H 3C8HA 4ZUSB 4CN4A 3FFDB 4I13B 3OC5A 1BQRA 2H6PB 3ARFB 3LZOA 4NSKA 4EO5A 4KKQA 1FVDB 1Y1DA 1QSEA 3GEWB 3NACH 5I66A 1CLOL 1L9QA 4I0PC 2WXQA 4HULB 4YX2H 3WJLA 4HUMB 3QRGL 4AL8L 4JFSA 1GYAA 1D6VL 2OMYB 3DSNA 5L7XH 3BRDA 5HVFB 3QUZC 3HCVA 4KKPA 3ULVD 3QHZL 2WYIA 5I1KH 3H7BB 1CTNA 4NJ9H 2VO5A 4U6VL 1K4DB 4QYOA 5AAMC 2XQYG 1UD3A 2LTQC 2HJKB 4PB0H 5FM5M 5A7BA 2UUDK 3CQQA 1P7QB 1DTUA 2YXVA 3O9WB 4YHKH 3VFTA 4AQAA 1T1WB 1NJ9B 4Y2OA 1X7TA 1BEYL 1WIUA 4TQHA 5CEXA 3LQZB 3C5SA 4OJYA 4UCFA 2YSTA 5GRYA 2DOCA 3HS0B 1MVUA 1ZMYA 3QQ3B 3GKWL 4YNYA 6FABH 3VW3L 3U7WH 5EOCL 3MNZA 4NQEB 3M17B 3RNQB 3DURB 4KK8D 4P5MB 4A7GF 4KHXL 3HS9A 3D4ZA 4YC2B 2CCVA 1AR2A 1G1OA 1N70A 2UV3A 3L3HB 4N0YH 5AVZB 1OF2B 1ETJA 3IJSA 1IGJA 5C7XL 1HTYA 4FXGA 4NJAL 4JDZA 3WNMA 4KZEL 2H1PL 5BO0D 2UYLA 3US9A 4F7EA 2XTJC 3V10A 1PGRB 4ZFFA 4WV1B 3EDDA 1AHWB 2BNQE 5J6GA 1U2YA 4P04A 1CCZA 3PABA 4XT1C 2A2QT 1AD9A 5HYSB 2SEBA 3CDYA 5LHDA 3QT2A 4L9LC 4B5EA 5DVNA 3T8XA 3S5YA 5KUKA 1U8KB 4XX5A 3VD7A 5FK9B 2FBJL 4NGHH 5IVXA 3FAXA 4JM2F 1AS7A 2C26A 3LPFA 3FN9A 3KM2A 4X6EA 1GGBL 4J4PD 5E5RB 3BJLA 4QRQB 3HC0A 1ZK5A 1G9HA 1P69B 4FMVA 4LKXB 1E0OB 4PJHB 2EYSB 3M1OA 2VIRB 5C0AE 3OXRB 2GJJA 3U0TA 3ZDYB 4R7NA 4IRJA 2D31A 3BGFC 5C0BB 1ORQA 3MGTB 2EVFA 3EOTH 1EQWA 3BQUA 3MCG1 4UT9H 4FTVB 4PREB 5CN3A 4GBXA 4UDTA 4S1RH 1RUPL 2J21A 5DJ6A 4QF1A 1R75A 3QUKB 3ZQWA 4E9RA 2ZUQC 1ASQA 3JWNG 1H3XA 5IOPA 2C9XA 4ZXBD 4R26H 1CFSA 4XP6L 3W56A 5D7IE 5GZND 3QZMA 4OF3A 1CJYA 5JW4R 4ATWA 5L8LB 5L2JB 4K9EL 2XXFA 4PWIA 2P52A 5CP3H 4QIRA 2QV2A 2OCJA 3CPLA 2FX7H 4FFVC 3W38A 1A0QL 2AJZB 2JELH 2N56A 4F7CB 1A1OA 3IJYB 2AK4E 4O58L 2AQTA 2AXFA 5EUKA 5F71A 1CFVL 5C0GB 4R0LA 1XR8A 4WW1B 1W9XA 4LVEA 2BY3A 4PP1D 1H15A 3VYOA 1A9EB 1T80A 4JJOA 4F92B 4QRRE 2XWRA 4C4KO 2CKBH 5AOLA 3ECBA 3ASOB 1CC3A 4OFKA 1QBLL 2V7HA 3MBWA 3WNOA 1T20A 2Q2EB 1WA0X 1HQRB 1JNJA 4K4KA 3ARTA 3MLTA 1CDYA 3KBHE 3HFMH 1JK8A 1R5WB 4XOAA 4HG4K 5EIIG 2FHBA 1ETB1 1ZWIB 3PJSA 5EUOF 3VDCA 3RVVC 4UQ9A 4XHJC 4YEFA 3KXFD 4DFIA 1CE6B 1C7SA 2K45A 3FB5B 2WUCH 3APNA 4PG2C 2W95A 2QKSA 2OR7A 3FHAA 3ETTA 4X8CA 4S1SH 1TZHB 3FQWA 3SGDI 1UACH 2HTLC 4EZLA 5EZIL 1EO7A 1X5ZA 5EN2A 4ODWB 2BP5M 4A7VA 2GUYA 3IDYC 4LBEA 4FQQA 3K3QA 2XTSA 3DYMA 1I1RA 1U36A 4PY7A 1ZHBB 3JTBA 4AUUA 4KJPD 3LKOB 1SUJA 1QFWL 4HD9A 1CTMA 4M5ZH 1VADA 2BVQA 4KMTH 4XNBA 4WJG3 5LAXA 3T2NL 1BM3H 2GHWB 2OTWB 1OP9A 1HL4A 1MFCL 5JPMB 1H3TA 3ARBB 3GIZL 4QHKI 1LK2B 3O0LA 2WAQA 5DEGA 5CKGA 3ZTNL 3FQTA 5D1QD 3WFCH 3FB8B 1S7SB 2HMIC 2PETA 3ZRSA 5IG7A 1U3HC 5BOZG 4HS3B 3VXSD 4ZMZA 3LEXA 4XC3H 1MRCL 5D7JC 2C1OB 4NCC2 4A67A 3WHXA 1Q1PA 1OGAD 5FF6B 4IBQA 3SDCD 3GO1H 3INUH 1KTJA 1IAIL 1F4XL 2X4PA 3ILPA 4WNSA 1QNZL 2XNAA 4U0RB 4BK8A 3OLDA 3DOIA 5IB4A 1PZUB 2NOYA 1PZAA 3PL6D 4CUCA 5L88L 1GSKA 1S7XB 5DHXB 4UILH 5DK0A 1XMWA 3C6LB 3HPLA 1XIWA 2ZX5A 1PLBA 3LNEA 2OXHA 4KV5F 2OR8A 4MA1B 2XFGB 4P05A 4PJ5B 5HY9A 5KAQF 1WHOA 4LLAA 4E9LA 4D8PB 4DGYH 1IC4H 3C5ZD 5IY5B 4WTZA 4U2YA 2YR3A 3UPCA 2EINB 2B59A 1Q1JL 2BSRB 4DO5A 2BNRD 3QIUB 1JV5A 2DY2A 2UY6B 4X5XA 4Y7OC 4U3HA 4MCNA 5EHFA 1Z3RA 3GXFA 3BH9A 1W2KT 1X7QA 4M29A 3BZEB 5GJSH 1MJJA 2FJHA 3W9DB 3LCYA 1AXSB 2D9QB 3H3BC 4QRPD 5AOKA 1TTFA 2J1WA 2XETA 3LB6C 4IOIA 3C60A 3ECQA 5JHDE 4Q6IA 1AFVH 1P7KA 1V7MH 1LXMA 3MRLB 5ACZA 4XO5A 3KPLB 3G5YB 3HLAB 3T0EB 2PWHA 1BZ7B 1B2WL 1GKEA 4Z7UB 25C8H 4S0SD 2XXGA 1WK0A 4NPYB 1GYCA 1SHWA 1IBYA 3T3PF 4NKOB 4L4TE 4BFBD 3NN8A 2DIBA 1SBBA 5DJXB 5GHWL 4XMTA 4ZS6D 1A4AA 3C08L 5D5MB 4YMPA 3WG7B 2PMZA 1BAFL 1IFHL 3B9KA 3NEEA 5GGQH 3PJLA 1RPQA 1YEEH 2EIKB 4Y4KD 3RVUD 1PY4A 1VEMA 5JNYA 5IR1A 1I7UA 1IJNA 2Q8AL 3TJEH 3V6FB 3NJJA 1R3IH 4FC3E 2YQ2A 2FATH 4I8DA 2QZ5A 3HNVH 2W91A 2X87A 4AQ1B 3NBNA 1TJXA 2W88A 2VMFA 4JG1H 5I30L 2M2DA 1ZXQA 4S1DD 2Y6TE 3QH3A 1O7SA 4OZHA 4YZWA 1MCBA 1E6JH 2WIMA 4IEFA 3VACA 3OKKA 4Y2NA 2PYFA 4R7LA 4KZDL 3CHXA 3V9FA 3X2QB 1KMGA 1IU1A 4R96B 4P48A 4M7ZC 5TD4A 3ILDA 4RBPH 1SYSA 4WEBH 2PYEA 4UTAH 4OFYA 4EOWH 2V2XA 5K5YA 4KRPB 4GRLC 4YL9A 3OMZA 5B1AB 1R4XA 1INEL 1G5AA 3SKJH 3P4NA 3GPSA 5HDLA 1UZGA 4TXVB 1JZ2A 1FN4B 1RULH 5ANHA 4MCYB 4X5WB 4JRYB 3LNDA 1UTDA 5CBAB 4HUNB 1XGQB 1M7DA 1CF8H 4HZLB 2XZQL 3STZA 4AW7A 1NBYB 1MFBH 3QDGD 3I3EA 3NABL 4LGPB 2B0SH 2EDYA 3GLEA 4LSRH 4ZOBA 3TO4D 3MRPB 2AQQA 2QDWA 4WU7B 2W0FA 3CCHB 5KYYB 2ARWA 1CFBA 4M62H 1FFNB 3QSKB 3MLYH 4OFIA 1QO3B 4ONGL 1VACB 1DR9A 2EEAA 1NC4D 3HUJE 2D03L 2XACC 4HPYH 4L3EE 2X10A 3D25A 1I4FA 4YDIL 1KN4H 3UTPD 3N04A 4KDWA 2NY0D 2YD7A 4IJTA 1TJHH 1U8HB 4P3WA 4RDQG 2IBZY 3MRBB 1ACYH 3SYAA 5JXEA 3SO3C 3L5HA 4DGIL 4XN5A 3H7BA 4K0OA 3K6OA 3MX0B 4GXUN 1GMEA 1URIA 1QSZA 4XNZB 2J12B 3DO4A 3OGCB 1Q0YL 4OFVA 5HI3C 3VUAA 3ULUL 3ETBJ 4M6OL 3OF6A 4UQCA 3BWAA 2NY4B 3EW3B 4YHLL 4JFOB 4IRZL 3P11H 1EZVX 1EO8L 1TJMA 2OMWB 4FGMA 4EIGB 1ZE3C 3G7TA 3K8MA 4Q52A 2O5XH 2ORBH 3V0EA 3FCBA 3TWYA 1KTDA 2XICA 1ANUA 2WBJC 3GSOA 4WEUD 3RIAF 3O6LH 1RIVL 1DQDL 3LDBC 1COBA 2FWOB 4X99A 2ARJA 5DLMH 4XCFH 2KERA 1OLZA 5ISZA 4NZTH 4WUUB 1H8NA 4S1QL 1IAKA 1NKOA 3MLSH 4Y5YB 1T5XA 2Q0ZX 2NUPA 3O45A 1T5WB 1HCVA 2VXTH 4N2EA 4JFFB 1B4LA 4NNPL 2Q3AA 3Q5YA 4I87A 6CGTA 4IRSD 5E08L 1I8LA 2A9CA 1S2EA 4F57L 5ID1A 3ZPDA 3IGAA 5CJOL 2MMXA 4HJSA 1AR1B 3DUHA 4IU2A 2VZOA 1HHKA 3P3YA 1MG3C 4APXA 4QMEA 3MCLL 4PRHD 3GKZA 4YHYC 4YE0A 1OQXA 1KNOB 5B1JC 1K85A 3AREA 3GXNA 1UJ3A 3E1ZA 3KPSB 2G4EA 1A3LL 1K2DB 4HHGA 4WWKC 3OZKA 4OIIH 1G4RA 5EOTA 4IMKA 3LQAH 4Y7MA 5BRQA 1U0QA 4KC3B 3O6FA 4FNSA 4HLZH 4YH6A 3DRQB 3WGUB 2V3EA 3FQ2A 1QTPA 4PHXA 4EDXB 2BWQA 4IS6A 5B8CC 2CA4A 1DBJH 5D7IF 1S7UB 2ATKB 3MBXL 1T1XB 3KYMB 1ND0A 1M05B 3MJ8B 4PJEA 5D9SB 1NAKH 3WKQA 4B9PA 1IFRA 1IC7L 1CLZH 2MQ0A 1PY0A 4PGEB 3GMLA 4G7VH 5F0MB 2ZXAA 3CUPB 3GBNL 5C0DA 1HK6A 2P5EE 1VZGA 4NERA 3LTVA 1BVOA 2PR4L 4EZMA 1M57B 4N0FB 2X4RA 1DFBL 2EIMB 1EJOH 1N5AB 1FL6B 2FH6A 2BVPA 4V1DA 1E3FA 4KWUA 2ITDB 3CDFA 4NN7C 2NZIA 1EZUA 2NTSP 1S7VA 2LFGA 3CDZA 1TFHA 1S5IH 3QYCA 5KVGL 1CBJA 3X3FL 4MB4A 2XWXA 4WHTB 1UM4H 4EE2A 3MRFA 4ZAKB 3A6BL 5IQ7H 5DYFA 5EO9A 3L95A 1FNSL 5SWSB 2Q87A 3IK2A 3BDYH 2QGDA 4W6YB 1QSFD 5F1KC 4JY6B 3IEAA 4P4RB 1PG7W 3WTYA 4S2SB 3BPCB 5AKTA 1QA9A 2ZPKL 2H32B 2VNCA 5I19H 3IU3A 3BAXA 5IB1B 2EXWC 2BP8B 2Y6SD 4PH8A 3HAEG 4DERA 5I0ZA 4LGSB 3MLZL 1KJ3H 4IMLA 3TVMD 3EDJA 3LH8A 2VITA 3G6AB 4P5TA 4OCYH 3A5VA 3D5OF 3T1WA 4OD1H 2XVKA 1GGYA 1N0XH 43C9B 1K5WA 3EIFA 5C0ND 1UGNA 5HHOB 5A3ID 1R0AH 2NY2D 2UZIL 2AJSH 4JHWL 1EA9C 1JHTB 1FFOA 3BX7C 2J88H 1P4BH 3WE6A 3E0GA 4L3CB 1VGKA 3GM0A 3IFLL 4DOHB 4XPGH 3RHWK 5C0FA 1MKFA 2HLAB 1UB5A 4XX1E 2YPLA 3OX8A 3UO1L 2O30A 4XN2A 5DRXB 4UOQA 5B39G 1TXKA 3WFBL 1SVCP 4P2OA 2Z1KA 5AW3B 4I5BB 1RURH 4PM1A 1HN1A 4JBSA 3MBEC 1EFXD 2HT2D 1P4LB 5CXPA 4J2XA 1JS4A 1NCAH 1BD2D 2P7TB 1PQZB 4Y9FA 4U1NA 5CGTA 1CYXA 2EAEA 4N0UE 3Q2NA 4ANXA 4OLYH 1F86A 5SX4I 1OT2A 1TUPA 2ATAA 1QFUL 4G9FA 5T1LD 3ISRA 5I6OA 1HSAA 5EOQL 5DQ9A 5TGBA 3L17A 3GM8A 1MAMH 1FQ9C 4KK5C 5GRJH 1ZGLP 1DBKH 4Z3TA 1N64L 3CLEH 4JFXB 4OJAA 3GUFA 5I9QC 3OKEA 3REWB 4L9DA 3T1FA 5EPMB 3JV6B 4LHQB 2WLNA 5CIPB 4PTUB 3LHPH 1D9KC 3W0WE 1CZ8H 3UBHA 4IKKA 1TTGA 3EGSA 5DUMH 3K6SB 1JJUA 4XPHH 3HHMA 3FW6A 2OTUB 1KN2H 4N2DA 4MMYA 3NJGA 2WQAA 2HFFA 2W9EL 4FQ1L 3U30B 4OKVB 3W57A 2HLEB 4XPAL 4ELMF 2YGPA 1B4JL 1JPFB 5FUZH 5KBMA 3EH4B 5EEXA 4EN3D 2V2TB 1UA6L 1WFOA 3BVWA 1L5GB 2RIKA 2F74B 1GSMA 1AE6H 3Q01A 3OHXC 1RJLB 4RAVA 1UA7A 4G6KL 2TAAA 3TJHD 4JEGB 1MFUA 4F1ZA 5C97A 1DJWA 1R19A 4NQCB 1D5IH 5C0AB 5SX5H 4OVUA 4B9ZA 1FNFA 5L4FA 1MCFA 4AGOA 2ZZUT 1BXAA 2Z93B 4CW1B 1SYVB 3NAAL 4URTB 4YVUA 1JPTL 3NEOA 4LCCA 1DE4A 1JG9A 5J13C 3Q6GH 3LRHA 5AZ2L 4EUPG 5CN1A 7FABH 2QMKA 2YPVA 4P3CH 2I24N 4HUWA 3ARUA 4HKXB 5D7IA 2RQ8A 5F9OH 1ROWA 3N1MC 3V4VB 4Z95H 4ANKA 3H0TB 3H9HA 1O75A 5F1NA 3QA3A 4HK0A 4YN3A 1CXIA 3QXWA 4XMVA 3UZEC 4WY7H 4NQTA 2CPCA 5JQ6L 3OXSB 2A99A 4XVUC 5CUSH 4M00A 3NTCH 1PZBA 4EKXA 2J5LB 1TCMA 4BGDA 1FL5A 3OAUH 5SWQA 1J86A 3D18B 2JTDA 2WSKA 1PZSA 4QRAA 3FT4A 3OKLB 2CLRA 5HI4C 4TNGA 1ETZB 4HEMA 4NM4H 3HMXA 2Z8WC 4IBSA 1YC8A 2X53A 2ESVA 4F2MB 2ZX8A 1QRNB 2LT9A 2QPSA 4XMKL 3MFGB 4PP2B 2CBOA 3SGJA 2J25A 2YRZA 3CZLA 1BXVA 4FNLH 3U6RB 1MFNA 1RMFH 4U05A 3GFUA 4KY1L 1PIGA 1QBMH 3HRZB 3CZKA 1KYOK 4GW4B 2CIIA 2Z64C 1J11A 4FFYH 3B8SA 3OKDA 1S3KH 3T9WA 4NUGH 2VKWA 1FPTL 1GGCH 1F1DA 4H4NA 2GBTA 4LSQH 1RUAL 1F18A 4AEHH 1QABA 2BNRB 2DW5A 4MQTB 4N87A 1E27B 5FECB 4UV4H 1A25A 4N9OB 4FQ2L 3SDAA 3QEQE 3G6JA 1L9TA 1KTLB 4LSVL 1BVNP 4PBWD 1O6VA 4M7KL 3WIFA 4UV7L 4FEMA 5E00A 4W9LC 4Z3HA 4IBUA 1ORSA 3UJIL 2DV6A 3IGKA 2Z31C 2YAMA 3QFJB 2PO6B 3QJTB 3NA4A 4I77H 4R8WH 3GSRA 3MMEA 3IN0A 4PCSA 5F6IB 1N7MH 2JI2A 1RZJH 3QNYB 2GC7C 2I07A 2P42B 2ADIA 3R0MA 1EAJA 4UM9D 5CR1A 3VD4A 1CFMA 5C08B 4GQRA 1N67A 3RWEA 2W0KA 3PLYA 3ZE1E 4NLHA 4OZFH 3ZTDC 2OBGA 5MEND 1KGIA 4HWNA 2F7RA 2ZD0A 2PXYA 3VXMB 4BFJA 5DURB 1BW8A 3CH8A 3Q43A 3CK0L 1C1EH 3JQOB 4YXHL 2G0KA 4Z0XA 1LILA 3KS0J 4N90E 3L7EB 2WOBA 1TYEB 3FQRB 2QADC 5DSCB 3H9ZA 2GJ6D 4F2EA 1Y7VA 3JZ7A 3VFRB 3RGVD 1F6FB 2L7EA 4KK9C 4PD4K 3IF1B 4B96A 5HGGS 1YMME 2MJWA 4FLRA 2FEJA 2E74C 2YARA 4DKEH 5ICZA 4XVTH 1CUOA 4X4YA 4G8GE 4RGNC 2A73A 2CO6B 5BRPA 4ELMA 3O3DA 1BFTA 1YUHA 3QJHA 1NQBA 3VSQA 4O5LH 5HGDA 4DPCX 3VFUA 2ZSVB 5IMLB 1OM3L 4ALAL 1T0MA 4N5ED 4K7FA 3EYSH 3QIBB 1HILA 3EADA 3QQ4B 4MTMA 4MMXA 1YEGL 4O4YL 1WFJA 4NHCL 3WLBA 1JVOA 5D8JH 5AALA 2VXQL 2XIBA 4WWNA 4FQXA 4HHAB 2CO4A 4ZTEA 5F7AA 4HGKC 5TE4H 2HT4C 1T5KA 3NFPA 1L7TL 5DMIH 1KGUA 4AT6A 2D73A 1LO3L 4Y1AB 3NA9L 2A83A 5CCJA 5I76B 3ABLB 2CJUH 4N2LA 4G8EA 3GBMH 2CHDA 5IROA 5HJDA 4NENB 3TO4B 3AU0A 5EDSA 2CO3A 1FNEB 5DYOB 4OB5L 4GEJA 5IESH 3WTSA 1GJUA 3BKJH 4XXCC 2IGFL 3UBXB 3M8OL 1OARL 4F2FA 2QSVA 2Q1EA 5FYKL 2VWEE 4X8JB 5EU5B 3RTQB 5I28A 2GTZA 4QEGA 3D07A 4MD4B 4P9HC 4OLXL 4GAGL 4LCWB 2HKFH 1DJZA 2NLJB 3NSDA 3L9EA 1F3JB 3DXAB 4E9WA 3AWFA 4UYPA 4G8FB 2NY0B 2BP0B 1MAJA 1KC5L 2F2HA 3WS6C 5I75C 3QAZC 2VDMH 3DVGB 1PG7H 1B6DA 2KC0A 4FHJA 1PLGH 2NSQA 4CRPA 1WBXB 2X6AA 1MLCA 2V8LA 3I75B 5IQOA 2V9RA 3HIZA 3LPWA 1Y18B 2C3GA 4OIFA 4TRPH 3QFDA 3X1BA 3O0RH 5I2IA 4C57C 4AQEB 1T4WA 4KMLB 1DBBH 3BPNC 4IDJH 1PZ5B 1RJZB 3WKML 1DVYA 3SJVB 1ZVYA 3UDWC 2B1HH 5C2BL 1BX2B 1FNGA 2X7LB 3NP3A 1IE4A 3GMRB 4WFGE 4E2OA 1VEPA 2Y1AA 4NQQA 1TTRA 4ZPTB 1ILUA 4I2XB 4Y19D 1PX3A 4DQAA 5LGHH 1NKRA 4EQ2A 4OW6A 4R4ND 4M3KB 5DEJA 5IK3A 3QHFL 2Y06L 4O9HH 3VWJA 2CKBB 3RWGA 4G43A 2C9UA 1ZVSA 4GUCA 2XWZA 4BQCA 3TIDA 3VFOA 4LPUA 1XH0A 1KXTB 4XNYL 4CVXA 2JTYA 5TPWL 1Q4NX 1ODAA 2YD1A 3WNKA 1JRHL 1MCLA 4LEOB 1F4WL 1DQQA 1MWAA 3GXIA 2OKMA 3A3YB 3BAEL 3KYOA 5D2NB 1N6QL 5IW1B 4GAFB 3UP1A 4XTRD 1A5FH 2O5YH 4G11A 3WXVL 4HEPA 3VGEA 1I9JH 4EMZA 1RJYB 2G4GA 5HYEA 4Z7OE 4G6FD 2VZTA 4J27A 4PRHB 1O9VA 1NANH 1ADWA 4TUKL 5EU6A 1GXEA 5I17A 5ENWA 2LVCA 3F8UB 3NDYE 4J3UA 1X4XA 2IAMD 4RMQA 5J57B 5AOMA 3RKDC 4L5FH 4L1SA 3G6DL 4MDIB 3QPKA 5BOJA 3QR0A 1EJ6A 1E5YA 3FO1A 4CC1A 2EYTB 4Z3GA 1CGTA 1H6FA 1E4XI 3VRJB 1SEQL 4I3SL 2VERA 5KVFH 4ZS7H 4Y5XB 5B1BB 3QC6X 1CR9L 3K2IA 3JTSA 4BYHA 2Y5TA 1LNUA 4LDCA 5CZKA 5AVXB 1E2ZA 2R0WL 5GRVK 2DZEA 3SKMA 2Q7AA 5E8NA 5T5NF 3BWUC 2APVA 3MA9L 4JR9L 4IOSD 5FWRA 3FUEA 1H9VA 2DBLL 4KXCA 3TESA 2FB4H 5KSVB 2EVIA 4OCRL 4YR6B 1T0NA 1JFHA 1L9PA 1DUZB 2E27H 2P5WB 35C8H 3HBGA 2UXVA 5H94A 2VLKE 1AY1H 4OGQC 2VXSH 1IT9H 3HZYA 1CL7L 1G9MC 5HYIA 5IVZA 3ZKMD 2LAGB 3RVXC 1DVQA 3ZO0A 1YO4A 1NIEA 4Z7QB 2HJLA 3ZZSA 4AGNA 2AXGB 1I3GL 2BVOB 5ITFA 1SLXA 3EO9L 3JWOH 1ZKAA 5B38G 2WMPB 4LMQI 5CEZH 1FAIL 4NM8H 2XN9E 3MXWH 12E8H 4PJ9D 4QT5A 2ZKYA 5J3HD 4ODTH 2VR9A 3PWPB 1AS6A 4DAGL 2J6WA 2NYZA 4Q9QL 1F4YL 2B9BA 4CVUA 1KYAA 1FO0H 2I5YH 2EDHA 2DKMA 4XP9H 2OP4H 4PCYA 5FYKE 1LP9E 2YD0A 3B2PA 2X6CA 5DZJA 1KXHA 4W9IC 3EH1A 4FYSA 4KUZL 5IF0B 4QCIB 4JJ5B 4X7SH 1F11B 1E5BA 4F33B 2MCMA 4G6AC 4B60A 1RUQL 1OZUA 1N3NA 3ECWA 3FT3B 4X7FC 3FFOA 1J87A 1YEDA 1QWUA 4NRXA 1LWRA 2DLFH 2NT1A 5HVHC 1DVFC 4LCUB 1EEZB 4YSUA 1FRGH 1M71B 2VZVA 3IDGA 4Q9BA 1M7UA 3D51A 1A3ZA 4XCYB 2RA1A 3N1QC 4G6ML 3UTSB 5FO8A 4LHUA 1H19A 1HESA 5C3IA 2BPBA 4G82A 2E59A 1VFBA 4Z7VB 3ZE2E 2X3BA 4C54A 5C07D 5BJTB 1I75A 4ZD3H 2Q20A 2UVFA 3MA7A 5EZOL 4DN4L 5T8IA 5GGRB 3CC5A 3KGRA 3WKNA 3FRUA 5E8DL 3QQNA 4XWGH 5INCB 1F02I 3BH4A 1QYGL 2RD0A 2R69H 3KPSE 4FP8H 5HJ3B 2A9DA 3DVNB 1AGEB 2DDQL 1AGDB 1MQKH 2BVTA 3FCUB 4X42A 1FNLA 1G7IB 3TV8A 3ULVE 5D7KD 3DV4A 4FQCH 4EBQL 2VLLB 5E1AA 2D7OA 4ATTA 5GGVH 5DGQA 3RWCB 2CDFA 3IN2A 4FS0A 4P2CG 2EILB 4A37A 3KVQA 2QSCL 4WWPA 3VWKA 1V3MA 1RZKC 5CU9A 1E2WA 4N8VG 3SGKC 4ETQB 1EDHA 4ONHA 3D05A 5DO8A 2NY1D 3V4VL 3ZJAA 5LG6A 4WO0A 5KS9A 3E8VA 2AEWA 3NCWA 3DUUA 1IAMA 4PGDA 1LE9B 2B77A 4BGLA 3MN8A 3L9RB 1GW0A 1EX0A 5DZPA 4GKNB 4MLIA 4BWWA 2BCKA 2XWEA 4PRPA 2H47C 3FBQA 3MV01 3RZCA 2K0RA 1PDKA 5F1IB 3U1SH 4DQOL 1AKJD 1KCBA 2IH8A 2DWDB 3HR5B 3CLFH 4IRZA 3GBEA 3B56A 3WEAA 1E8ZA 2CHNA 3ZTEA 4X4MA 5DFAA 5JZ7C 3P2TA 2YZ1A 5I1IL 4M5TA 4U1KA 1TPXB 3ZU8A 2Z92B 2NX5B 3ZE1F 4I0PD 3RL1B 4OV5A 2WNWA 4PJAA 1ULVA 3C12A 4OGXH 1JNLH 3QUZD 3MV9B 4QLRA 5DQJA 5IHUH 3P0VH 3EJYC 4GRMA 4DUXA 2QQLL 3ZZQA 1OQOA 1S7TB 1UD8A 4ZUSA 3FFDA 4OQTL 1WG3A 2H6PA 3ARFA 2XWJB 3DNKA 1IEBB 1FVDA 3SDDC 4EQ3A 2RB8A 3KBFA 1PZCA 3WJJC 1IM9B 5EWIH 5I5MA 2BVEA 1J8HB 2X4QB 2OMYA 1TVHB 3DHPA 3QW9A 5A2CA 2XKNB 4P59L 2VB5A 3QDAA 2A9BA 2H26B 1OEZW 1CD9B 3EZJB 2IJ0C 4ADJA 5IHWA 3LZFH 1K4DA 4HYTB 5MHSD 2CU9A 2HJKA 3GSVB 3APMA 1NFAA 2Z3FA 3BFOA 1P7QA 4J3XA 4F1SA 4FG2A 1Z9PA 1NCCH 3P9MB 3WFDH 3O9WA 1IVLA 2GSGB 2XWBB 1T1WA 3QCVL 1NJ9A 1NCUA 3T6ZA 3QUYC 4BZ2H 9CGTA 3LQZA 1UCBH 4FEIA 4M6ML 4QAWA 3CU1A 3AY4C 3J8F7 4FYTA 2XTJD 3HS0A 3ARYA 4B95C 3QQ3A 1PJWA 5I71B 4PS4L 3NACL 5E2UH 1BIHA 2KPNA 4NQEA 3M17A 3RNQA 3DURA 5CINH 4YX2L 4P5MA 2EIBA 3D09A 4R97B 3QJVB 5L7XL 2ICEC 3KAAA 3L3HA 2VW6A 5CO1A 2OFQA 5I1KL 4NJ9L 1OF2A 3BXNB 2YD8A 2EDJA 2QVFB 3L2LA 4ERSH 4WV1A 3FO0L 2A6JB 5ADOH 5T1KB 4HOZA 4XPFH 1AHWA 1WBZB 2YA0A 4J5VA 2ZWSA 3NCJL 4LP4A 3G04B 4YHKL 2XBZA 5LNEA 5JW4N 5HYSA 4XP5H 1XZ0B 2J4WH 1QEWB 3RGHA 5JIIA 3BYYA 4K94H 1U8KA 1SQMA 5FK9A 5HHXH 3AWGA 3U7WL 4U1GB 1NUDA 2W9LA 2Y1VA 4XNMB 5MENB 1OTUC 3GRWL 4N2HA 3DTUB 1QATA 4QRQA 3CTTA 3UJTL 2NW2B 4LKXA 1TETH 1QR4A 4PJHA 2EYSA 2VIRA 3DMMB 3OXRA 1N6UA 5FYJU 3L3OC 4MNQB 1GS8A 3QDJD 5C0BA 3MGTA 4K15A 1X5HA 3WEBA 4FTVA 4PREA 4YE4L 4P2AA 2C7FA 3ATBA 5GS2H 3BAKA 3A4EA 3QUKA 1A2YB 4GMSH 4HBCH 4FFVD 1KCSH 3GGWB 4C47A 3LN5B 4HJEA 1WFNA 2E47A 3EHBB 4U1SB 4NGHL 4L1DA 3LSOB 4HX1B 5L2JA 2AQ1A 2ZTBA 1BLNB 4MQSB 3GHEH 4NQSB 4XBGB 3VM5A 2R0ZH 2AJZA 3B6SB 4NN5C 4F7CA 3IJYA 3P30H 5D1QE 4HG4J 1DN2A 5C0GA 2J2ZB 4PY8J 5JHAA 1BVNT 4M56A 4WW1A 4RWHA 3EOTL 3VXSE 1KWKA 4UT9L 5C6PB 2FWLB 4TVSa 2VJXA 1CLYH 1A9EA 2BSED 1OGAE 2XV0A 5FDWB 2D7TH 3RVVD 3BI9X 4XHJD 1WD8A 3B3IB 2YXFA 4M4PA 2R9HD 1C12B 3C87A 5DS8B 2A6IB 4A39A 2ZXEB 1ZTXH 2WTRB 1ZJBA 4GT7A 5JW5B 1UXSB 1HQRA 1MG2C 2F19H 5D7HA 2HTLD 2JH2A 1XFPA 5HBBA 5BO1H 1IZJA 3AMLA 4KROC 4D3CH 1R5WA 2WNGA 1U21A 1ZWIA 3VXTB 4GINA 3D0LB 4NKDB 1CE6A 5GSVB 2JELL 1OWWA 3FB5A 4LNRB 4ZFZB 4MDJB 5HYQA 2WXLA 3JYCA 2A74C 2MQ3A 3W9EB 2BERA 2BNRE 3JSSA 4XMWA 4YDJB 1TZHA 4Y8AA 2Z0UA 2EDBA 2N4IA 3HTLX 5KVDL 1DP0A 1JGVH 4E9XA 4ODWA 4FRWA 4A6YL 3HBQA 3LQMA 4NKMB 5GGUB 5SX4H 1VFAB 4JJHA 4LESA 4QRPE 3RIKA 4AKQA 2CKBL 3V5DB 1ZHBA 2WXHA 4WGWB 2HMID 3H6AA 3L3GB 3LKOA 1SFHA 4YQXL 4LCYB 4FFWC 4ZZKA 1X5XA 2OTWA 1HX0A 1TMCB 1C5DB 5JPMA 4QTFA 3ARBA 1LK2A 1P5VA 4LRNH 2WQ8A 2AFNA 1IBDA 3CZEA 4WTXA 4HJTA 3ATEA 4KNSA 1MNUH 5E1GA 4HUVB 1S7SA 2WUCL 2W0PA 5D6DA 4HS3A 2WNXA 3S88H 1L3NA 4NQDD 3VE0B 2C1OA 4S1SL 1E4HA 1UACL 5I0YA 3NJNA 2OM5A 1BFOB 4MJID 4DETA 3S35X 4GOSA 4UTBH 3MUHL 3MNVB 1J1OH 4NO3B 1A4CA 1A1NB 1PKQB 2V5SA 3LIUA 4XPTH 1S7XA 3QG7H 1QKZH 4KMTL 4G80B 2GFBB 1FL3B 1Z9LA 1BM3L 2WQWA 3C6LA 3NT0A 3LX9A 4QTHA 4JO2H 4PJ5A 3PGDB 2BFVH 4TTDC 1AHMA 1P5UC 4D8PA 1J0JA 3LB6D 2WTPA 4DN3H 3WFCL 4LK4A 4WWOA 1Z9NA 3QEUB 1D7DA 2BSRA 3QIUA 4Z8FH 3N9GL 5GIRB 4X5PA 1GZHC 2WWKT 4XC3L 1WFTA 5IJKC 3Q8BA 1XSIA 3FSOA 3NSYA 3BZEA 5F9AC 1MIEH 3IDMB 2F1EA 2MNJB 1AXSA 3C8DA 4JFZH 3ZKNC 3QUMH 3GI8H 4DPRA 3INUL 4XMZA 1QFWI 3MLUH 3D33A 3P54A 4CC4A 1J1PH 4E36A 3TN0C 4P07A 4Z7IA 5KANG 1G0YR 3MRLA 1G9NL 3KD4A 3KPLA 4JVPA 3HLAA 3ZE2F 2GG1A 3T0EA 1JGUH 4UILL 1BZ7A 5EIQA 4Z7UA 1PX4A 4UI2A 5KTEL 4NPYA 4DKTA 5AW4B 3QDGE 4AITA 1IC4L 3D3VA 2ZCZA 4NKOA 4OZFG 4WI6A 3UG5A 3VM7A 1KCVH 4Z18A 4YPJA 2HX9A 3F58H 4WVRA 5DJXA 1ZSDB 5D5MA 3O8XC 1MHHB 3GJEB 3EBHA 1S6NA 4G9DB 4JQXA 4QHMB 4N2IA 5GJSL 4K5NA 1IAII 4I3RH 2HZHA 1ZS2A 2B8OT 3ULVF 1MW2A 2EVJA 3NGBC 3N50A 3V6FA 3QJRB 2HB0A 3EFDH 2DYPD 3SN6N 3S34H 1AFVL 3P40A 2DEYX 2XPZA 4G8AC 4F5CE 4V11A 3UTPE 3VI3E 2MQGA 3VSTA 2Y1YA 4AQ1A 5GZOA 1B4RA 4O02L 4B9FA 1RLWA 4PJ9B 3Q48A 4GRLD 25C8L 1JK9B 2BXYA 1I82A 2R8SH 2CR6A 3CFCL 3R19A 4HQQL 4APQD 4BSWB 2WTOA 1KIUA 3B5HA 1U8JB 3NPSC 1JWUB 5JIKA 4NZJA 4UT6H 3T3ME 1X9QA 2KDGA 4PUBL 5AZEH 4R96A 4M93C 5DJYB 5GGQL 4LLUB 1L9MA 3LVEA 2WXKA 1PZ3A 1J8RA 1JYWA 1XGTB 3BKMH 4DCQB 4K3JL 1E5CA 1P7HL 3TJEL 3MTRA 1ZANH 1FN4A 3WU1A 2XV2A 5FX3A 4MCYA 3JV5A 5C86A 2GUOB 4X5WA 4YSPA 4GP8B 4OI7A 2FATL 2ALAA 3HE6C 4JRYA 4BSVB 3L2MA 5CBAA 2AW2A 3TFKC 4DK6A 3B43A 3HNVL 1YQVH 3B1UA 5KVDE 1XGQA 5T3XD 2LAAA 1M6OB 5EB9A 4JG1L 3V6OC 1NBYA 2H2SC 5C0JB 3REVB 2RALA 2W9DH 4RLDA 3EOBB 2H9GA 1E6JL 1XR9B 1MVYA 1YC7A 2AJUH 3MRPA 4KXDA 3QUXB 4OZFB 1ET8A 4W6WB 1WGOA 4WU7A 5F7EH 3OG6B 5KYYA 1KIQB 1QHPA 1DYZA 1KF9B 1FFNA 3AT8A 4XNAA 4WEBL 2Y5QA 1QO3A 4XP1H 3U83A 4EOWL 4UTAL 5JIMA 1VACA 2MFNA 2D9CA 1N19A 4PBDA 4AV4A 3QPQC 1ZIBA 4F7PA 5JORB 2EXSA 5HI3D 1RULL 1PU0A 3RDTB 1DJYA 5F89B 1U8HA 3BESR 4PRHE 1RAMA 3MRBA 3LN4A 3QDMB 3RIFK 1DSWA 1DO5A 2VCOA 1Q94B 1T83C 5GS2D 3VMOA 1F8TH 4AYID 1CF8L 3PXJA 4H0GA 3OB0K 1MF2H 4WI4A 5LBSH 3MX0A 3QWRD 3ZT6A 1EVUA 1YYCA 2OI9C 3Q8CA 3UAAA 2B0SL 4H2AA 2GVYA 4LSRL 3OGCA 1U6AH 2APXA 3BZ5A 2WBJD 5I1LB 2CLZB 4CAGA 4Z0BH 4JFOA 1NCOA 2ZKWA 1IGTB 2J20A 2OMWA 3E8UH 4FABH 3O2DH 2YAFA 1HI6B 4XP4H 3MLYL 3CSYB 4NT6B 1AQDB 1HJCA 4XMLH 3ARRA 1CGXA 4GAJH 2L7UA 1SY6H 3AU1B 3LPOA 4JVWA 3WGVB 1KN4L 4C56B 3OJ2C 1UWXK 1TJHL 2X0UA 2FWOA 3IAQA 2IWGA 2WCSA 1ACYL 4RSYA 2EIEA 3VI4E 1KXQE 4KVNH 3PHQB 4XN9A 1N2RB 4WUUA 1X5YA 2WY3B 4Y5YA 1M2VB 1VCBC 1YYLH 1U30A 2WKOF 4YBLB 1YVLA 3E2HC 1T5WA 4J3OC 1VCAA 7CGTA 5CLWA 3UAEA 1C5CH 4JFFA 4LCIH 2H4EA 3PS6A 5IQNA 3GBDA 5EBWB 4PR5B 4RFOH 4RRPM 4WWKD 4UINH 1QSFE 2N1KA 3DIDA 3ETSA 2IH3B 3KR3H 4YGAB 5D7SH 1F0LA 4WI9A 1CICD 3BKCH 2O5XL 2ORBL 5KBLA 3B2DC 2VDMB 2OMNA 3O6KH 4X6CE 3EYOA 2WHVA 3QS2A 3U2SB 1UYWH 4XOCA 5DZNA 3EFOB 3O6LL 1KNOA 2J56A 2BIOA 2AEPH 4MAYC 3KPSA 1K2DA 5DLML 5ICYB 2JKIS 1XD1A 4KUCD 2F61A 4NZTL 3R7QA 4N28A 5AFAA 3MLSL 5KW9H 2ZKXA 3DRQA 4JREC 4WW2C 3WTVA 1FFRA 2VXTL 1IKNA 4EDXA 3MR9B 3QWNA 3V7AE 5HDBE 4URKA 1S7UA 2ATKA 3MJ8A 1T1XA 3KYMA 1BMGA 1M05A 2BH0A 5C0CB 4ESKA 2E7LA 5DDHB 5D1ZI 1B2YA 3WDIA 4HIHB 4YSDA 4PGEA 1I7RA 3CUPA 2JIXB 4H8UA 3MUY1 4FA7B 3ZDWA 3TC9A 4HFWB 4FQJL 2EE2A 2WXNA 1YJDL 3QZOA 3GI9H 4N0FA 1G5GA 1NFDB 2XTJB 3BZ4B 3ZYJA 1QUNA 1N5AA 1FL6A 4CGUB 1SRDA 2EXYC 3QUHA 4BELD 1BD2E 1ES0B 1NCNA 2ITDA 3WJLC 4OIIL 4XC1H 2ZXCA 3LQAL 4GYBA 1KLFB 2EXWD 2K9FB 4HETA 4WHTA 4B0MM 4AZ8B 3VU2A 4GQ9H 4ZAKA 3WFHA 1I1AB 2GQHA 5BUPA 3WXWH 5SWSA 1A6WH 4OZGB 3QEGH 3NJHA 1DBJL 2E7MA 5F7HA 4JY6A 4P4RA 4PRAB 1NAKL 1WSST 1BGXL 4S2SA 3BPCA 3MRNA 5HHMD 4M5SA 5BXFB 4RQQB 3SKUD 4G7VL 1T4KB 5IB1A 4TVPH 1CIDA 1PTZA 1HE8A 2BP8A 1T22B 3WAKA 5A43C 2DQCH 3AG3B 3QG6B 5F7NC 1NLBH 5E6SB 1JXDA 4Z7WA 1WA1X 1EJOL 5EBLB 3ORJA 2BRQA 1E4XH 3G6AA 4FHBD 3T2PA 2X9ZA 5DI8B 2QTVA 5LXVA 1ZCRA 5DHYB 43C9A 2PN5A 3FQXB 1L0PA 1S5IL 3W39B 1AZRA 1PCXA 5HHOA 4BE6A 3HZ3A 4OFDA 5B1KA 5IQ7L 3C75A 2JMRA 4WWID 1A47A 1JHTA 3TZVB 2XVGA 4L3CA 5ANMB 5DF0A 1Z3GH 4HKBB 3BDYL 4HMCA 5IFAH 2HLAA 1W0VB 1O7DC 2GEEA 1ID5I 3DC0A 3LZNA 4AYSA 4IBZA 5DRXA 1VB9A 5FGCE 2X1XR 1SQ2N 4DKFH 4KK5D 3D7PA 3ILQC 3N0PB 4JN1H 5I19L 2ZX9A 3NSJA 3S2AA 4I5BA 1LJMA 3TCXA 2OTPA 4JANB 3Q1SH 1KJ3L 1S9YB 2P7TA 2E5EA 1PQZA 1D9KD 2P9RA 2DWXA 5FYJD 2BY1A 5F7YC 2AV7B 3WFZA 4H8WC 2BSTB 4OCYL 1U8IA 4OD1L 1N0XL 4W9ZA 5ALBH 3RY6A 1B3JA 1U2HA 1YZZA 3H7LA 3E6HB 1XGUB 4OUUB 4JFXA 1R0AL 3KLKA 1VSCA 1Q9OB 3VXNB 1FVEB 3JV6A 5EPMA 2I25N 4N8PA 3WNPA 4PTUA 4R83A 2ICES 4IRJC 3NUKA 4P2RB 5M94B 1G7HB 2OJZL 2Z8RA 3ZMRA 2YS4A 4OCLC 1YDPB 1DEDA 4GBXC 1E3ZA 4PV8B 3K6SA 1FO0B 1UKTA 2OTUA 3I9IA 5EBGA 3B2VH 1BOGA 5D1XB 3SQOH 1RURL 4OKVA 4HCIA 4U1IB 5LCVH 1U41A 4D8OA 2F8XC 1HEJC 4DGUA 1JPFA 2X1OA 3OZLA 4LARH 4ORZC 5BS0A 1DBAH 4OLYL 1N5YH 4GG6A 5E2JA 1L5GA 2WZPD 3U6XA 2F74A 5GRJL 1MAML 3X3GH 1RJLA 3J2PA 1DBKL 2DYSB 5IFHH 3CLEL 3GNMH 4ZFGH 2F54D 3T65B 4JO4H 1ZVHA 2R4RH 4NQCA 5KBDA 2R2EB 5E7BA 3CVHH 3LHPL 2NXZC 1R9FA 4CW1A 4PGBA 2Z93A 4R0LC 1SYVA 5E7FA 3RX9A 1IZKA 2ZUUA 4OF7A 5AYQA 5DUML 3D4GA 3VGAC 4XPHL 3PWJB 1MSPA 1ZEAH 1KYFA 1WZ1H 4MFHA 1TLKA 4ABVA 2F6AA 3P69A 3H1ZA 4XVUD 3V9CA 2YQ3A 4FQLH 4PJFE 3ZOAA 2DQUL 4HKXA 1WZLA 1U3HB 5T1MB 2WWNA 5D7JB 4ZUWB 3FS9A 5FUZL 4ORGB 2WSDA 3EAKA 3H0TA 3HE7C 2WOYA 1IRAY 2BNUB 1IGCH 3E80A 1DQLH 4UWQB 2JV6A 5LGYA 1LYQA 2IWEA 3L45A 4E41B 5IWLA 2JKSA 3OXSA 2OV0A 3TM6A 4JQIL 4NS0A 4AM0A 1D5IL 1KYOJ 2K8MA 5AB1A 3VI3F 1T03H 1MJ7H 4Z78B 3T5WA 3D18A 2ZYIA 2E9BA 5AYTA 4U6TA 4OLWH 4OM0H 4ENEC 2CIKB 1BVZA 3OKLA 2OR9L 1ZLEA 3Q6GL 5DFVC 5MENE 4JO1H 2YQGA 3GHBL 1KCUL 5CHNB 1NCJA 4F2MA 2VERN 7FABL 3PQYD 5DZLA 1FZKB 1QRNA 2XYCA 1GY2A 3T3MF 4TLKA 2JXMB 4H88H 1X4ZA 4PP2A 4N2GA 5F9OL 4XBMA 2VQ4A 3PUUA 3U6RA 4WK2B 4UNIA 2Z1PA 2MSPA 5LUMA 4Z95L 4OLZL 1D6EB 4OQTA 3EJRA 5E6IC 2GJ6E 2KDYA 3HRZA 4KRLB 2ZCHH 4GW4A 1DCLA 2WJ5A 1YMHA 1GPOH 4XZ4A 4WY7L 3VXPB 1LO0L 1WE5A 4KNQA 2J3SA 4XPBH 1BAWA 1W15A 2AJVL 4GIPD 3UCRA 2Z31D 5JIPA 3A22A 1E27A 2X89A 4QDGA 5FO2A 5DEFB 3S3SA 3TBYB 5IIEA 4P23B 3SKOB 4N0RA 4L8BB 5PAZA 5JW4Q 2DMHA 1KTLA 5ICXB 3DRTB 4NM4L 2O6PA 4HWEH 1VFMA 3KL3A 4W68A 3EBGA 3KG5A 2E7CA 3IMRA 1UG9A 4GT0A 4KKBC 2AEQH 1DDHB 1I9IH 2D2CC 2PO6A 3QFJA 3RWHB 4FNLL 1OP5K 1RMFL 1RPUA 4BZ1A 3F7QA 3AROA 1XIWC 4DP6X 5L8KB 4AGMA 1UFGA 1QBML 2J6EH 1Z9MA 4PBXA 3CU7A 5AVRB 4JFWA 3HI1B 4FFYL 1XXFC 4FMFA 3QNYA 1S3KL 4NUGL 2GSMB 4TSAH 1GGCL 4HIIB 5FAAA 4LSQL 4GKSB 3S8WA 4PJ8B 4PD4J 4LLQB 5C08A 2Y24A 4XGZB 4L37B 3BUTA 1F58L 2QADD 1QASA 4UV4L 2ENPA 3VFGH 4FE9A 3I3BA 2AAAA 1DVXA 1EFQA 2JQMA 4IBWA 4MJJA 3U46B 4A7QA 3T6QC 1A14H 3VXMA 3C60C 1VEOA 3M1BB 1OO2A 2XA8H 4Q6IC 4RGND 4R5VA 3IDUA 3IGUA 4WZ9A 3GUTA 3L7EA 4X6BB 4GH7B 3FQRA 4KKRA 5DSCA 4R8WL 4WFED 4Y4FB 3VFRA 3LOWA 1FP5A 1H6EA 3IF1A 4K2UH 1N7ML 4MZ3A 3E7JA 2G2PA 5A2LH 1GW6A 2UY7B 3NIDB 5D7EA 5DJDB 4BFOA 2HG0A 2CO6A 4BKSC 2HT4D 4PLKC 5EC2B 5DRWB 2QPFA 1JXFA 3B9KC 4X9YA 2V6HA 3VI4F 2ZSVA 4WI3A 5IMLA 5F7WC 3N1FC 4YWGH 4LSPL 3MRQB 5GGTH 1BAGA 3QIBA 3WKPA 3QQ4A 5D7LD 1CXKA 5CLZA 4ODXB 2YJLA 2X88A 1LMKA 4MJ5B 3GWJA 4HHAA 2YXWA 3MYJA 1C1EL 1KT2B 4MA8H 2IADB 4Z7QF 1ERNA 1R5VB 1G6RH 2A5UA 2ZWNA 3OMAB 4KXZH 4JFYB 2VLJD 4PRID 3MV11 4Q7DA 3T8MA 4BQBA 2DICA 4PJBB 1CLOH 4MVBC 4Y1AA 4Y19E 5E9DD 5I76A 1T7YA 2EUXA 4JY5L 4G7YH 4NENA 5HYJB 4X6CF 3TO4A 4HJ0C 5KG9B 4PWJA 2ARJQ 4XVTL 2YHGA 1R47A 5DYOA 2W81C 3BVXA 1U3ZA 3UBXA 1JVLA 1XGPB 4O5LL 4ZX6A 4O2CB 4BQ8A 1A6VH 3SO3B 1E5UI 2AQPA 1TF4A 1XAUA 4X8JA 3EYSL 5EU5A 3RTQA 4G1MB 1QRKA 4LVHC 1EAOA 5FLUA 5E6UB 3NSCA 4MD4A 2ZJSH 2EC8A 3GB7B 1QG3A 1TIUA 4JFDB 3P77B 4LCWA 4M03A 1WPCA 2NLJA 5D8JL 4K8RH 1F3JA 3DXAA 1BEYH 2LVEA 2BP0A 5HDBF 3UTTB 1H5BB 1HHHB 5EDXA 5TE4L 5KTEH 3GKWH 4P99A 2VO8A 3DVGA 5DMIL 5EOCH 3HG4A 1WBXA 2QQNH 3GSQB 5D96B 4YFEA 4DW2L 3GBML 1THCA 2QLYA 1JPSH 5E2TH 3I75A 2EQDA 4Z9KB 1A64A 1UWFA 2YK1H 4NJAH 1Y18A 4KZEH 4DGVH 2HPOA 4DZ8B 4AQEA 4F37K 3BKJL 5CP3A 1PZ5A 1UZ6E 1RJZA 3SD2A 1MHCB 1ZSHA 4Z7VF 3SJVA 2VDKL 1BX2A 4FDWA 2X7LA 2IAND 3V8OA 2NCEA 3WNIA 1EZVY 4I48B 2HKFL 4PJIE 3ULVC 4BBWA 3GMRA 3JWNE 43CAB 4ZPTA 2EDTA 4KFMA 1BVKB 4I2XA 1KFAH 1GTFA 2FBJH 2VDML 2WC7A 5JXEC 1PG7L 5F1SA 1AS8A 4CMHC 2CKBA 1PLGL 3O41B 1I7TB 1GGBH 4G1EB 3K1DA 3MI6A 4AEEA 1QX1A 3ZTJH 3EUDA 1RZIB 4I1NB 2H2PC 3MRDB 3MLXH 2CDEB 2F58H 3WEMA 3HVNA 4TRPL 3LAFA 3O0RL 5FUOH 3TGXA 1CGSL 3BW9B 4IJ3C 4LEOA 5HHNB 5D2NA 1DBBL 4IDJL 4HK3N 4KVPA 3RKDD 2V3DA 5IW1A 1OAJA 2B1HL 1NGPH 1I9EA 5CD3B 1RJYA 1AIFB 4ZW5A 4AE1A 3BP7B 4S0TD 1FF5A 5B8CB 2PP7A 3RVWC 1A7BA 3ETBF 1SLWA 4XP6H 2OMUB 5JQIB 3MU3A 3VXUB 5LGHL 2DLEA 3DK2A 3PUCA 5LDUA 4O9HL 4BH8A 1IC1A 1INQB 3TONA 4MDIA 1E28B 1ECYA 3LPPA 1R5IB 1QI5A 1WTGT 5GRWA 3VRJA 1J5OL 1MCQA 5I74C 4Y5XA 1B0WA 1Z9SB 3MLPA 1JOIA 1Z7JA 4GB9A 4JUSA 1I8LC 1YPZB 4KQ3H 1UOWA 1F4HA 2VYRE 4LSDA 4NN7B 4BWTA 4UYQA 2DH2A 1W16A 1A5FL 2D3JA 2V9UA 3CXDL 4IKLA 1IO4C 3EDKA 1IQDB 3RVXD 4AIZB 1I9JL 4WQOA 1ILSA 1EJFA 2VUOA 3VVWA 3QYNA 5KSVA 1OAKH 2VDLH 1N12A 3OV6A 4YR6A 5BVPH 4PSRA 2P5WA 1DUZA 5I1CH 1QBLH 5KSBB 2WYZA 3AREC 1UJ3C 1THAA 2ICWJ 3D87B 4L5FL 3FB7B 4IMKC 4HIJB 5L2KD 4MJ4A 3BUQA 5C07E 3ZL2A 5C09B 1DZ0A 3MC0A 3O6FC 3RWFB 4YXLH 3HHSB 3ARDB 1JRHI 4QTIH 5KVFL 2AXGA 4ZS7L 2BVOA 3MXVL 2C5DC 2WMPA 4EI0A 4P0DA 3MNMA 5H4YA 1Y6NR 1OCRB 4EZKA 2KKQA 2K3TA 4AEFA 1B9ZA 5DZOA 5EZIH 5F1OB 4GW5B 1BQHB 3PWPA 3SB3A 2EUWA 3L54A 1IM3D 3KJ4B 1NCTA 4V2CB 3ZN6A 3UGEA 5D7KE 2E27L 5ECJE 35C8L 3AQYA 1QFWH 3AWEA 4HCRL 4R7DA 3WUWG 1U3YA 3B7RL 3DDFA 3QUMB 1AY1L 4KK6C 5IF0A 2EH7H 2VXSL 4QCIA 1DVFD 1IT9L 4JJ5A 2DM4A 4F33A 3S37L 2P80A 5HD8C 1HZKA 2GJPA 3VFMB 4UZUA 4PJFF 3MBEB 3UX9B 5F9WB 3TA3B 3FT3A 2A6DB 3EJTA 3SYOA 3WENA 2YMTA 5I16B 4AOFA 3EO0B 3SD5A 3D85B 5CEZL 2FSEB 5JDSB 1BMWA 3ARVA 4NM8L 1DQIA 3KCWA 1AZVA 1BZ8A 3ISYA 4L2YA 4LCUA 4ODTL 3V8CA 3VXOB 3FMGH 5I9QB 1EXUB 1LMIA 1I8KB 1M71A 2CK2A 3LD8B 4GIOA 2EUVA 1B9KA 4XCYA 1IAIH 3VFSB 3UTSA 1FO0L 3SPJA 3GXUB 4XP9L 2OP4L 3BN9D 3UMTA 1MPAH 3FU7B 4WGVB 1CL7I 1NC2B 3FUHA 4Z7VA 5AG9A 2FGWL 4BUQA 3AAZB 3GPEA 2HRGA 1EGJL 3OAYH 1W72L 2FO8A 4OGAC 2FQEA 3V9EA 1BZ9B 5I73B 2R51A 3B1TA 1CURA 2NSMA 2R29H 4MA3B 4MCMA 1VIWA 3L3DB 5INCA 5FWQA 4ZUVB 5ADPH 1OCWH 4PJGE 1DHKA 2ZUVA 2DLFL 4P8QA 5HJ3A 2IVFC 3K74B 4P2OC 1AGEA 4MYWB 1AGDA 3QIWB 1G7IA 2EDRA 1S46A 1XH1A 4YOKA 2VLLA 3NEXA 3RWCA 3L7FB 2WANA 2NR6A 3MZTA 5MHSE 2CRIA 2DQTH 1NWPA 3O4OB 1QZNA 3WUWB 1DQMH 2R23B 5J13B 4ZD3L 4ETQA 1IVTA 4JRXB 1VPOH 3AXLB 5DFWH 2A9NH 2WLZA 1I9RL 3SDCC 2DB8A 5AOZA 2AZUA 3LS4H 4HDIB 5JZ7D 5EV7A 4HPHA 3C08H 5JTWA 4XWGL 4W9GC 1NFDE 4HP5A 2XTJE 2ZXWB 3L9RA 4ZW8A 3DROB 4GKNA 2R69L 3BUDA 4FP8L 3EJYD 5F1IA 3MKGA 3DVIA 3PWUB 1VDGA 1MQKL 2DWDA 1UWYA 3HR5A 4DVBB 5AAPA 2D3LA 2GB2A 4OF6A 4JKPH 1ZHNB 3CPUA 2ENYA 2AEOA 4FQCL 2HLFC 4HXAH 3SDDD 5J06A 5GGVL 3T0XA 4NC0B 5D72H 3KPOB 2AANA 2Z92A 2NX5A 3RL1A 2OMVB 1PG7X 4AC2A 1ZPUA 3SE3A 1YY8B 2IFFH 3F04A 3FFCD 3MV9A 5IJVA 4QXUH 1LK3H 4QRTB 5CSBA 3MYZA 5F7BA 1S7TA 2QSQA 4U6YB 1K3ZA 1VLXA 1Q9WB 1P7BA 2X4TB 4UDUB 3WO4B 2XWJA 4F91B 1IEBA 2Q8BH 2FCBA 4JFUA 3ABMB 4L5FE 3QI9A 4MAUH 5B3SB 1IM9A 2JFCA 2EO7A 4LCCC 1UADC 5KBPA 2TRYA 1J8HA 2X4QA 1TVHA 2NY3C 3GTTA 4A66A 3CFUA 3BDXA 4E9YA 2C4FT 2XKNA 2IDSA 4GP4B 5KVFE 2H26A 1F1GA 3CLFL 2Y72A 4RAUA 1OCCB 3BUIA 2X6MA 4X2UA 2YA1A 2Q76B 2FH8A 4XO3A 1AO7B 5C9JB 3N43F 4NO0D 2OAAA 3GSVA 3QJSB 3WY1A 5CCKH 2Z91B 1UH3A 3RVUC 3QDJE 1NBQA 3MRRB 4ZO7A 4OGXL 1KIRB 3X12B 3P9MA 1AYOA 1UOLA 3QQ9C 5IHUL 2GSGA 3P0VL 2XWBA 3MUGB 5AENA 2JKJA 1NMCB 4ZI8A 3TURA 1HOCB 4N8UA 2D0HA 4IU3B 4NC1C 4HWBA 3ZT5A 2QV4A 3TCTA 2MOGA 1JN6B 4QHNB 5FB8B 3H53A 5HGBB 5A2IH 1QW8A 3CXFA 5DD6B 5EWIL 5KAQG 3NJFA 1WYJA 3DJZA 1OF0A 3PXHA 1BPVA 2CJSA 3F5WB 2XIIA 2PCFB 5A40E 3L48A 1O9WA 3ZIYA 2IGTA 1FDLH 2FUQA 2VRQA 5EUOB 3BXNA 3T0AA 4F7TB 1BIIB 5E70A 2IG2H 3BH8A 3LZFL 3QC5X 5F0LB 3SGJC 2FTAA 4K3DL 1ECZA 2A6JA 5AW0B 5T1KA 4CN1A 2VLRB 1WBZA 1NIDA 4FXKB 1OTUD 2XDHA 1NCCL 3G04A 3WFDL 2RAMA 3ZKXC 1CG9B 2LE9A 1XZ0A 2J1XA 4I7ZC 1B6UA 3HKFA 4WU5B 3WS3B 4W9KC 3U25A 1T1YB 1UCBL 4J3WA 4AL8C 2XPYA 3S5LG 4M6OH 2DIEA 5GPRA 5AAWC 4YHLH 1P2CB 5E2UL 4PJ7A 3MLRL 1BJ1J 4TMPA 3SDAC 5IT2H 5CINL 2BDNL 4XNMA 3L5XL 1M56B 2FJGB 5A2BA 4ZSOB 3EOYG 2NW2A 1HSBA 1U8LB 4TQ8A 1OOAA 3DMMA 4MNQA 4ERSL 3C09B 5ADOL 1C7TA 3HN8A 3V0VB 1HHJB 3I84A 3CLWA 3TYFA 5ABDE 3TPUB 2YD6A 1ZLWH 2BW5A 3ASNB 5DZAA 4RIRB 5T3XL 4PJIF 3S9DB 1A2YA 4XP5L 3GGWA 2J4WL 3DJRA 3I6GB 3LN5A 3MKKA 1D5ZB 2M8XA 4MSWB 3T8VA 1OTSC 4M7LT 5HPMB 1T7ZA 2ADGB 4K94L 2WVSA 3TU6A 2QGEA 5HHXL 5E08H 3OMNB 3LSOA 4HX1A 1BV8A 5LJYH 1J0YA 5D7LB 4ODHL 2CGYA 1BLNA 1RUKL 3MREB 3RP1A 1YYMH 4NQSA 4XBGA 3WIIL 1TETL 3BPOB 2B7DT 1AKPA 3B6SA 2CGZA 3R8BB 4XNUH 1HEHC 2GITB 5EZJB 1HKFA 4AJ0A 4J3OH 2J2ZA 2DLIA 5E9DB 3MACH 1CXLA 2L8AA 4NQDE 4JGNA 3KPPB 5FDWA 4PPTA 2XHNA 4TNWF 1BG9A 1KCRH 3C5JB 4HBCL 4UOW1 4MJIE 3B3IA 2XJKA 2YUVA 1KCSL 4LE8A 1QFPA 3HB3B 5DUJA 1C12A 5DS8A 2A6IA 5I75B 2WTRA 1SHSA 1VA9A 3DX2A 5JW5A 4DP7X 1UXSA 3MBXH 3S5LB 4LVNC 3UAJD 1NPNA 2HVJB 1IC7H 1E9PB 1AMYA 3LXAA 1NWOA 5IMMA 3NJXA 4MMXC 4F9PA 1RSYA 5JMRA 3VXTA 3D0LA 4FQXC 2WBKA 4KI5C 2R0ZL 4NKDA 5GSVA 2GCYB 5HVGB 1RQ5A 1NIFA 3PHAA 4LNRA 4ZFZA 3B7TA 4FFWD 4MDJA 5AW2B 4FA8A 3BPNB 3P9WB 4TVUA 2MTPA 4YDJA 3G5VB 4OSUH 5I6XB 2D2OA 1PD6A 4P9MH 5DMGC 3ILEA 1L0QA 3AB0C 4NKMA 5GGUA 1CLYL 5IROC 3X3FH 1VFAA 3UJJH 2ILLA 2D7TL 3VFVA 3V5DA 4W9CC 2GY5A 1FNSH 1BQLL 3L3GA 2X3CA 1O9ZA 4LCYA 1QFWM 1EAPB 3QCTH 1PYWB 5TE7L 3UBXI 4F8LA 1ZHKB 2F19L 2OL3H 2WLYA 3O3EB 4OZ4B 3DV6B 1C5DA 4HS8H 5BO1L 2ZPKH 4PWHA 4D3CL 4PRNB 3BGAA 1Y1UA 3WV0A 1REIA 2DJUA 1GYVA 1L0XA 3T4AA 2EUZA 2C9QA 3O4LD 4E5XG 2H6UA 4JFED 4DEWA 3VE0A 1EO5A 4LBAA 1WDAA 3G5ZB 4TTDD 3MV8A 1JGVL 3WAJA 1CYGA 1BFOA 2FUTA 4MB3A 2VUYA 2WINB 1TJIL 1MHPL 3MNVA 2UZIH 1A7PL 1L9SA 2IMNA 4UQ3B 5DC9B 1IAIM 4DP9X 4FQIH 4LLVB 1U8QB 4HKZB 3T0BA 4NO3A 2RCSH 1A1NA 1PKQA 2R2CA 3DIVA 4DFHA 4G80A 2GFBA 1FL3A 4KGLA 5C8JA 1JCVA 2A38A 3ASWA 4Y4HD 2VRKA 4CL7A 3PGDA 5F7DB 5AUMB 2YRLA 2X2HA 3CVHB 1IMHC 1PJ9A 2A1WH 2DMBA 2WSPA 4AENB 4NI3A 2A3TA 2HVBA 2LOEA 3QEUA 3US0A 4NPKA 5GGSY 1A3QA 5GIRA 3KMDA 3VMPA 3RGBA 2OZ4L 2IV8A 3A4DA 3S88L 3VWJC 1UZ8A 1XGYH 4U2ZA 1QFUH 3MV7D 1MCRA 1FIEA 4J3SA 3FT0A 5LKNA 3IDMA 4P2QD 3E9TA 3KPRB 1YNTF 3QDHA 4UTBL 1K3IA 4ZJ9A 3CSFA 4QHUB 5FYLH 5IB5B 1GY1A 1J1OL 3RVTC 3O8XD 2QL1A 2CO7B 3ARZA 5EORH 1Q9LB 3P4MB 4N24A 1CF1A 1QKZL 1MI5D 4PEEA 2JNZA 2X0VA 1WGVA 5T3XE 4IGBA 4JHBA 2Y7SA 4PJBE 4JO2L 4Q8BA 3FUDA 1HIMH 2EEXA 2AZAA 2W07B 1OTTC 5A3IC 5GISH 2BW4A 2MPVA 3VXRD 2HVKB 1ZSDA 3O11B 4UOW0 3S36H 4PJGF 4GUOA 4K71C 4Z8FL 1MHHA 3GJEA 1U95A 1PFCA 2VR8A 4G9DA 3WIHH 4QHMA 4N8CH 1USZA 4G7RB 4NBXB 5I5JA 1UA6H 1QFHA 3F7VB 5K69A 5L2KB 1MIEL 2JJTA 4JFZL 1MY7A 4Z77A 3GI8L 3MLUL 3D2UD 1SVBA 2DRUA 2AVGA 1J1PL 3K8KA 1F42A 3OPUA 1GR7A 2EXTA 3HMWL 2HTKC 1BM7A 4FFYA 5LDSA 1JGUL 2BNQB 3N1PC 3ZX1A 1IFGA 5I8CB 1N10A 2CD0A 3D4YA 2VSKB 1JK9A 4DO4A 1JUFA 2ZAGA 2YSSB 2GPZA 2KZBA 4CJ0A 2APFA 4BSWA 4MZIA 3Q9PA 4OJDH 5K9JL 1U8JA 1JWUA 3HE6D 4KQ0A 1NFDF 2K78A 3TFKD 3Q2VA 1WS7A 1CD8A 5DEZA 1E50A 4OF0A 3L9BA 4LLUA 5DJYA 2ZONA 1Z6JT 3GHPA 7TAAA 2H2SD 1AQKL 4BFNA 2F9BT 1XGTA 5HVHB 4I3RL 1E5ZA 3KHQA 4DCQA 3QPXH 4R2GB 3OJVC 5DUPH 1VZIA 2GTQA 4WRLA 1BBJB 1XX9C 4Q74A 1U8OB 2GUOA 3EFDL 4JPSA 2VW4A 4YDMA 1UWXH 3BVVA 3EDFA 3QS3A 5E5UB 5IVOA 3S34L 5T1DL 3LZLA 3C2AH 1IGMH 4A2GA 1M6OA 4BA0A 1KEGL 1FYTD 4AQ8A 4GW1A 3REVA 4EN3C 4D7BA 3L13A 5C0JA 2VAAB 4W9DC 3QPQD 2R8SL 3EOBA 1Q9KB 1ZLVH 3V0WH 1XR9A 3UO8B 2WD0A 1R46A 3QUXA 1IAOB 4OZFA 4E9SA 4UT6L 5TH2B 4XMKH 1NBCA 1TU2B 2ZICA 5AZEL 1J0KA 1KIQA 2ODHA 1NBZB 3KWWB 4OQ1A 4B97A 1KYDA 1FIGH 4PLOB 3P3SA 1ZA3B 4L4VD 1YY9C 4MDRA 3BKML 4KX8A 3DJSA 4M6NH 1ZANL 5JORA 4DPAX 3RDTA 2WNKA 2Y2YA 3K5RA 4NI6A 5E1HB 2NUTB 5F89A 4UOZA 3QDMA 4DIXA 2CDGB 4X4XB 3MJ9H 1Q94A 1YQVL 4D9QD 4QXTB 4UIKH 4FQ2H 3JWDH 5AEAA 4ABWA 2RFXB 1KYUA 4QRRB 1TQBC 3D8MA 4K9JA 4PS8A 5M95B 2Z4TA 4JDTH 3BKYH 1L9RA 2AJUL 4UV7H 5I1LA 5K9QI 2BS9A 5AVSB 5D71H 2B08A 1YN6B 3PY9A 4FL4C 3BD4A 5F0JB 5F7EL 4F8PA 1IGTA 1OOWA 1RV6X 2GY7B 3FCTB 4KKCC 1HI6A 3CSYA 1UT2A 4NT6A 1AQDA 1QLEH 1SF3A 4KKLC 1G6RB 4N9GA 4E0RB 2FEDC 4HALA 1DSFL 1QW9A 3AU1A 4C56A 1AP2B 2BSDA 3GTNA 4ZG1A 5IW6B 2GIMA 3HW7A 1BVLB 1GZPB 2YBGA 1TVBB 3X1FA 2F15A 2DAVA 1F8TL 1RHHB 3PHQA 4Q6YA 1MF2L 2F53D 2OMTB 4TS6A 1FWXA 1N2RA 1TG8A 5E4EC 2BZDA 3OR6B 3PP4H 1M2VA 1XBDA 1S7WB 4R4BB 3WKYA 5L0QC 1U6AL 4LP8A 4AK1A 1CQYA 3OAZH 1DJXA 5EBWA 4Z0BL 4PR5A 4MAYD 3O3AB 3O3UN 4J6RL 3W2DH 3E8UL 4G59C 2FIRT 3VWKC 3O2DL 4FFTA 4FABL 2DJSA 2IH3A 5HHME 1EIBA 5HDRA 1RU9H 4XMLL 5D4QA 3UIZA 4GAJL 1U93B 4JS7A 2Y7QB 4FLHA 3U2SA 3WBDA 1ID2A 3QZWB 3EFOA 5H37G 4ZX3A 4N86A 4TNVK 5E9AA 1KGYE 1KBBA 2PWGA 3B7UX 3CN3A 3KBPA 1OM3H 3RZCC 5ICYA 2I9LA 3IETB 3K72A 3HC3L 1F2QA 4O4YH 3QUYB 4OCSH 1YYLL 3ROOB 4AE0A 1NM9A 2V0AA 2EC9U 1WZMA 4MJ6B 2VXQH 4ZT1A 1C5CL 3BIAX 1HQ4B 3MR9A 4LCIL 4A7TA 5HSFA 1YEHL 3IFPB 1WO2A 2EXYD 5C0CA 2IF7A 4RFOL 5DDHA 3FTGB 3CIAA 4HIHA 4JKNA 4K7PX 4YBQC 1AGFB 3KR3L 5D7SL 2IGLA 4MS6A 3WL9B 2ICEB 2HH0H 2JIXA 3BKCL 3CDCA 4HWUA 2O5NA 4HFWA 1UT1A 5FC9A 3LKSB 3PFUA 5IBUG 3WFEH 3O6KL 1V7NL 3ARFC 2DBJA 2BWDA 3QQDB 3BZ4A 3RUGA 3BAYA 2IBGA 5DJZB 2N0KA 3M8OH 1OARH 1ES0A 1PS3A 4KPHH 3NIGE 5FYJE 2GBVA 4OJFH 5FYKH 1WAEA 3ZKQD 4WI0B 3PGFH 2K6WA 3TFBA 4JG9A 3SODB 5KW9L 2DEWX 5JHDB 1I1AA 4PW9A 4TQPA 4OZGA 2NXYB 1ZIAA 3E38A 2W8CA 4OZIE 3ZHKA 1KC5H 4X9BA 4X6DB 5HDOA 4I3GA 4PRAA 2DLHA 4TUOB 1H8OA 3MRGB 1PPIA 2VM9A 5BXFA 3O9WC 4RQQA 4OFQA 1BF8A 1T4KA 1E40A 2WO3B 2WVTA 5TK4A 1E90A 1FG9C 1T22A 3HS8A 4L4TB 1Z66A 1WV7T 3MO1B 4P46A 5A6LA 2A6KA 4OCMC 3GI9L 2DWTA 3HS0C 5E0QA 4YDKH 3MRCB 5EBLA 3BLPX 2ZAHA 4JFTA 1EUTA 5DI8A 4POYA 5DHYA 1MCJA 3FQXA 5FYLD 3ILQD 4YC2C 3W39A 5C2BH 3GMQB 4FXTA 4ZFOB 4GQ9L 5HJBA 1NFKA 4TNEA 1ZD6A 5BNXD 3F7YB 3TZVA 1EZLA 2F54E 2BWIA 3L9YA 5ANMA 2J1YA 3EH3B 3UPAA 4BQ9A 4HKBA 4UM8B 4WV1C 3ME0B 1P4IH 1P4UA 1AHWC 1W0VA 4PGCB 3B8YA 4ZTOH 3QHFH 4DEPB 2VDLB 4HCFA 4GSRA 3ULAB 4KU1A 5IUSA 1B0IA 2F7IA 4E9VA 2XV6B 4TVPL 4ZMTA 2I9TB 32C2A 3FHEA 3T6XA 3FHQA 3Q1EA 2DQCL 5CP7A 4XXDB 3TIEB 4JANA 4P9HL 1NLBL 3EFFB 1S9YA 4IRJD 3WY4A 1TYRA 3ULVH 1A4JB 1E7VA 3T77B 4CDGC 3HFFA 1E4XL 5SV4A 2AV7A 3MQIA 1F4WH 3BQUD 1LDPH 2DTSA 5KBNC 2BSTA 3BAEH 4GBXD 2YN5A 3DX6B 2F1AA 3KGTA 3QFGA 4KZCA 5AL0A 3E6HA 1XGUA 1Q9OA 4LB8A 1MLBB 3VXNA 1FVEA 4XBEH 2HP4A 1ZDQA 2DKUA 1OAQH 4P2RA 2RBLA 4PG9B 3F12B 5IFAL 3UTQA 3LNGA 5DC4B 4ZW3A 1KY6A 1YDPA 2JVUA 2B9AA 4PV8A 1JNNH 4KROB 3ZT7A 1FO0A 4DKFL 1CT8B 4JN1L 3ZSTA 4J8QA 4LRIA 1E67A 5D1XA 3IB4A 3V4PA 1KGJA 1PVHA 1W0WB 4U1IA 4I3SH 3PQYE 1JWMB 3Q1SL 2NXZD 4PG2A 2A74B 4BWUA 1J1XH 5DGRA 2V7NB 4RETB 5LNGA 1IKOP 3LMJH 2SODB 2FZ3B 3HUJB 3IGLA 5LWYH 2AJ3A 4UBDD 3LKQB 3DX7B 1WEJH 5DD5L 5I82A 3SY0B 3DHUA 2DBLH 4D7PA 3T65A 3DUSB 1BZOA 2R2EA 2V2WB 4WFFD 1TQUA 4XAKE 2O1AA 1PZDA 2HJFB 4FFZH 4W4NA 1VGEH 4W70A 1SBSH 3VG0L 4JKMA 4LPYA 2PWFA 4PJBF 4MNGE 3DHMA 1KPVB 3PWJA 1T04B 1UENA 4C58B 3PGCB 3RY4A 3D50A 3SQOL 1XCQB 2UZXB 1J9RA 1EK3A 2Z7WA 3GDCA 5LCVL 4JL1A 1U3HA 5T1MA 1U3JA 2RTTA 2X2IA 5D7JA 4ZUWA 1OCZB 2X2YA 4LARL 4ORGA 3BO8B 2GJZB 1DBAL 1JP5A 4ENED 3BHBB 3GRBA 2IAMC 1N5YL 4AV5A 1FORH 4JX0A 4NN6C 2BNUA 5DFVD 3KCPB 4NOBA 3X3GL 1U4FA 1H8LA 2OMBA 4OUOA 4V2BA 3GNML 3WE1A 4E41A 1RLBA 4M48H 4U1LB 5D70H 5DO2C 1F4YH 4YSEA 4JO4L 2R4RL 3FRPG 2R69A 2ZKHH 2NY6B 1RZ7H 3CVHL 4M5YH 2JCCE 4N2MA 4Z78A 1JMXA 5FHBL 1PL3A 5IJDC 2IC2A 2CIKA 5KYXB 4DH2A 1P5UB 2FT7A 1ZEAL 4JLRB 1WZ1L 2NW3B 3KNBB 5CHNA 1FZKA 1G87A 1NCBL 1XVSA 2JXMA 4RGNE 2DWSA 4S11A 2BOCB 4CA4A 1WCQA 2EDNA 2ZKMX 4JVUA 1D6EA 1UD5A 4DZBB 1L7IL 1MCSA 4WFEE 2KS0A 3EG9B 3ARBC 1IGCL 4AJYV 1DQLL 4OVVA 3BC9A 3IJ7A 2QLVB 5FPIA 3S3PA 4AWJC 2FIKB 4LZKA 3EXLA 1NM4A 5DJAB 4WTQA 3VXPA 1KWGA 4NBZB 5H8DA 4Y16B 4M4RB 3TN0B 4DWHA 1G9ML 1EAQA 4KKBD 3HZVB 5KUMA 3DYOA 2NCMA 3RWDB 1WFUA 1MIML 5DEFA 3TBYA 3ULSA 3U9PL 4P23A 4HCGA 4IDLA 1XIWD 2COVD 3SKOA 4L8BA 3VTMA 4OLWL 5IEKB 3MV7B 2BVUA 1CFQB 1GGUA 2EEBA 5ICXA 4NZFA 3DRTA 5EZOH 3KPQB 5D7LE 3QGVA 2IPKB 3QZNA 4JO1L 5J3HC 4DN4H 3UTZB 5DT1H 4RX4A 2VQUA 2EVHA 4XX1G 3CQFA 2QR0B 3RWHA 4QOKD 3ESPA 4GXVH 2VLJE 3BEVB 3CVDA 4PRIE 1KCKA 1A6ZB 4MA1C 5E9DE 5J11B 2ZX7A 1ML0A 2ZCHL 3A4FA 3RFZA 4FCHA 3HI1A 1GA2A 1XWVA 2ZUSA 1GPOL 3C60D 3R0NA 3S6CA 3UGXA 2WYTA 2FBRA 4UAOB 2PPCA 1D5XB 2ZAIA 4HIIA 5SWZB 1NGWB 4GKSA 4EBQH 4XPBL 2BY0A 4PJ8A 4LLQA 1MUJB 2FHFA 1T7WA 3QIUC 1B3IA 4ODUB 4XGZA 4L37A 2P8PB 5MI0B 1WHPA 2K7PA 3GSNA 3X11B 4KUCF 5T5FL 2F8IA 3U46A 4ZYKB 3KWXA 4HWEL 5JA9A 3OB8A 1D5MB 3M1BA 1JAEA 1RZFL 2K9UA 4CC4C 3SBQA 2CJTA 3CV5A 4P06A 3B9KD 4M93B 4X6BA 1I9IL 3GS0A 3QE5A 3KL5A 4HC1H 3C5XA 4Y4FA 3AFLA 5IHZB 4BZ2A 4AYBA 4PY8I 4WDIB 3RTLA 2X12A 2J6EL 1XH2A 4WHYH 5IKCB 2X70B 3EJQA 4DQOH 1JXGA 1WP6A 3DBXB 2C4XA 5DJDA 2IOMA 2BHZA 2VW7A 3CFEB 1MRDL 3L4WA 3RWIB 2IQ9L 5EC2A 3GLDA 3GIVB 5DRWA 1QACA 2YAHA 3KW7A 4JB9H 4JQXC 4MVBD 3VFGL 5KZCD 3MRQA 2HPTA 1AG0A 1OE2A 4GAAA 3MNWB 2R1XB 2JKWA 3MROB 4ODXA 3IJ9A 5IHHA 2QQLH 1A14L 1PX8A 3E6FB 4NO5B 4HJ0D 3UG3A 2IANE 2DLGA 2YPKB 2XA8L 1KT2A 4YHOH 4DP0X 2IADA 4JFPA 4XHQA 3EGXB 1R5VA 2OPCA 4GFTB 5HDWA 4G8IB 4JFYA 3WDJA 5GZOC 2B4CC 3NZ8B 2NNRA 3BVNB 2CRYA 4LFHD 3GINA 2PYED 2X4NB 4IKNA 4OFYD 4Y8DC 2Y07H 2YRPA 3U7YL 5AKRA 4DK3A 3WNJA 3VD9A 4N85A 4XCNB 3RJQB 4Z76B 1RZKL 5HYJA 5KG9A 1OAZH 5TF0A 2DF3A 2EVGA 1Y6MR 2DTMH 1XGPA 4N0UB 3WTUA 3P4OB 4O2CA 2Y7OA 2EADA 4OBRA 5GGTL 3D2TA 4L4VB 4C8XA 4KRPC 1JHKH 4G1MA 2WZAA 2AMGA 5HYSG 3GB7A 2GT9B 3QCVH 4JFDA 3P77A 5AD0B 3V0GA 2C7UB 2E4FA 2N7AA 2P26A 4M6MH 4MA8L 5CR8A 5EEUA 3UTTA 1HHHA 1H5BA 1G6RL 3ABZA 3ERXA 3W0WB 2YPVH 1AI1L 1U2CA 2QPDB 4PS4H 5CILL 3D48R 4AG4L 2IBZX 4MXQC 3AJ7A 4W81A 5FKAB 3CSTA 3GSQA 3FBKA 4EIZC 4G7YL 1HVXA 1OSYA 3KPRE 4OIAA 3HN5A 4ALAC 1J0HA 4RRPA 3HG1A 3IPEA 2GJRA 4WO4B 1SJMA 4DZ8A 5EA0L 3HC4H 5JXED 3RB7A 3NIGF 3FO0H 1XF3B 4P4KB 3RWJB 1MHCA 1A6VL 2VH5H 1GTNA 3MVSA 3NCJH 1UH4A 3D39A 3SE4A 2BIHA 2WXFA 3NCMA 3K91A 4CSSA 3SCMB 2ZJSL 5ACMA 3U4EB 4B53A 2H2PD