4X5RA

Crystal structure of fimh in complex with a squaryl-phenyl alpha-d-mannopyranoside derivative
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Protein FimH
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 33
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x5rA00
1N0LB 2W07B 5JQIB 3ZL2A 3MCYA 4AUYA 2JMRA 4XOAA 4AUUA 2XG5B 5CGBA 5FLUA 4ATTA 3BFQG 4J3OH 4XO9A 5FX3A 5FWRA 5LNGA 4AVJA 4BUQA 2J2ZB 5IQMA 5IQOA 5F2FA 4XOCA 2XG4B 4X50A 4AV4A 5AAPA 3SQBB 3JWNE 3JWNH 4J3OG 4AV0A 3RFZA 5IQNA 4X5RA 4XODA 4CA4A 1TR7A 1UWFA 3ZL1A 4CSTA 1KLFB 4AVHA 3ME0B 1N12A 3BFWA 1QUNB 5AB1A 2UY7B 5F3FA 3JWNG 3ZPDA 1KIUB 3BWUF 4X5QA 2WMPB 2UY6B 4X5PA 4AUJA 2JTYA 4LOVA 4AVKA 4XOEA 5LNEA 4XOBA 4AVIA 5FS5A 4CSSA 4XO8A 5ABZA 4AV5A 2VCOA 1ZE3H 5AALA 1PDKB 4J3OF
chains in the Genus database with same CATH superfamily
5EPMA 4N2GA 2A9BA 1ZHLA 3BN3B 4NQED 4A37A 4HUWA 1GSMA 2ADGA 5HDBF 1NM9A 4BQ9A 5J0BA 1JGLH 3QJVB 2PP9A 5DJ0A 4PVMA 1MAKA 1ROCA 1XL6A 3PGDA 4HCIA 4PRID 3W9EA 5CGBA 4X5XA 3WE1A 2R2BA 1DL7L 5BMFH 1GGYA 2WUCL 2EO7A 3TNNA 1HSAA 1FN4B 5IHUL 1DQTA 4QWWC 4EZKA 3U7WL 1E6JH 3FB6B 4F7EA 5TPWH 1HH6A 1A1NB 5L0QC 3UAFA 4HIXL 2P7TB 1USQA 1E5BA 1LO4L 4NNPH 1WFIA 1QFWL 2I5YH 3NPZB 3OF6D 2X1OA 1QRNE 1M3IA 5GHWH 1NBVH 3HR6A 4WSKA 1HT6A 4UQ9A 4Q9QL 3CFCL 5K39B 3GT6A 3FONB 3TEYA 4Y5XB 4HJUA 2NY6B 1A7QL 3TZVC 1BOGA 2DIBA 3UERA 2M1KA 1A9EB 4FFZH 5E70A 1KGUA 5L2KE 1E5CA 4YN3A 1YC7A 2J43A 3MJ9A 4O2CB 4WEUD 3Q6FA 4HSCX 3RFZA 4XODA 1QSED 2ZOLB 3DSNA 1BYOA 2HG5B 4KRNA 4K5MA 4YL4A 1BYPA 2GSMB 4B3VA 1JUFA 1OGPA 3BE1H 1AGEB 4PP2B 5AUMB 5K1JA 2E7LA 5C07A 4DGIL 1MI5E 2B1HL 1CICD 1H3GA 3T4YB 3D12B 2CO3A 3C2AL 1E8XA 1QI5A 4JHAH 2KKQA 5IW3A 3WEAA 2HZHA 4A66A 2B08A 1WA2X 3MOAL 1U21A 2Y23A 4GG8B 1ND0B 2DB8A 1K2DB 2BO0A 4MA7L 4LFHG 1HYSD 4FP8H 4Y16B 4YGVA 1FL6A 2P45B 4ODWA 1HI6A 3D9AH 4W6YB 5AKRA 1KJVA 4P2RD 4J12A 4NHCL 2EIZA 4YE0A 5DDHB 4Z76A 1X5KA 4PJGA 1G0YR 5CSBA 3EJUA 1NKRA 3ECBB 2WMPB 1R5VA 2V2WB 3FUIA 5FECB 2GHZA 1CDCA 3NRQA 2W95A 1GR7A 4LEXL 4GB9A 4LVHB 2L7EA 1T7WA 2VKXA 1A3ZA 1ADWA 3G5ZA 1YECL 1KY6A 1CWVA 4X4KA 1SDYA 3JTBA 4ANUA 2HFGL 3SGKC 4FJYA 3UPRA 3FOLB 3MFGB 4M3KB 3TBBA 1JNLL 3UZQB 1NBCA 2H9GA 1URZA 1JF1B 2PNDA 2MNWA 3NQKA 4AK2A 4C56E 3MLUL 4PREB 4B5ZA 3PHSA 1AD0A 4DW2H 1JK8B 3HI1B 1NLDH 3LKSA 3BXNB 4JCWA 1SN2A 1YEDA 3BEWB 1BEXA 3ZKSD 1EEQA 4XCEB 5D1XC 2B7DT 2UX6A 4MJJA 4OKDA 4ZMZA 3OGCA 2VDKH 3US9A 3UAJD 2PO6B 2DJMA 4F91B 2JKJA 2BS8A 5FKAB 5GSRA 5HHOA 5JUEH 1WJ3A 1PD1A 3GSNA 4QRPA 5E8EB 2FSEA 3WAJA 1X5YA 1MFBL 2IPUG 4TUJB 2BY0A 1HKLL 1IIIA 4HKBB 4OCYL 3TCLB 2OMXA 4BE5A 4F5CA 1DQIA 5TE4L 3HC4H 4PGZA 3UJTL 4WU5B 3HFFA 3VI4B 5JHLH 4J3XA 4ZMNA 4PRPA 4MDRA 4XP1L 4KY2A 3IKKA 1EAPA 1EXGA 4YFLF 1OM3L 4NHUA 4ZAKC 2DF3A 5DEGA 5GGRB 3K81A 2BC4A 5ITFB 3DJ9A 4R5VA 1M71B 1YYLL 3GGWA 3JTSA 2PPAA 2AQ2A 2CKBB 4TUKH 4GAGL 3RIAF 3PUCA 1ODUA 3TEXA 1GJWA 2VRKA 3ARSA 3W11D 3HC3H 2VR6A 1RK0B 4ZTOH 2XQYK 4I9XA 4MQTB 4BFIB 5I8OL 4D0CB 4DCQB 1KTBA 1UT2A 3KDPB 3LH2H 4WY7H 1MIMH 2G5BA 4UILH 4K3DL 1AXSB 1LEKA 3ROOB 3CUPA 1UVQB 3ESUF 5G4NA 5HGHB 4UNUA 4OGYH 2GEEA 4UNTA 4ZMVA 3W5MA 4E9VA 4G6JH 2Y36H 5LBSA 1ASPA 1KYOK 1NBYA 1TNNA 4RIRB 1D5MB 1OTUC 1AS6A 3WDJA 1MKFA 1IBZA 3EJTA 1CTNA 4KFZC 3INUH 4NC0B 3A23A 5F6IB 4QI3A 3QJSB 1A6WH 2NCEA 1KLUA 2V2TB 4V11A 5GS3A 4JN1L 1E3ZA 1T22B 3TVMA 2G4GA 4ZUTB 1QA9A 4PV9B 2DMGA 1II4E 1E4WH 4JFHD 4YHOL 5K9JL 1G9NH 1NC2B 3BGMB 3KPOA 3CGTA 3QEQD 3RB7A 1JN6B 4NZDA 3DSFL 4XVJL 2LVEA 2I27N 1NFKA 5CFHA 4MXWH 2FGZA 2ARWA 1O7DC 3U9WA 4XZUA 4XMPL 1J9TA 2FX7L 1PZAA 4WWKD 4X6CA 3EYVA 1OSPL 4BIKA 4M1DL 3T0AA 1JMZA 2DQJL 1OGTB 3H9SB 2FK9A 1GZQA 2VXSL 1JTOA 3LVTA 4KI5E 1PAMA 1LWHA 3LEXA 4XOAA 1OHZA 2AJYH 1PZ2A 1VKXB 4LBEB 1THAA 4GNKB 4NQCE 2CR3A 3LZFH 3WMPA 1VAHA 2O72A 5GS2D 1KCUH 4KMTL 4HULB 5SWSD 3QEGH 4M3HA 4JR9L 1HCYA 5IROD 2I32A 3AAZA 2MCMA 2XACC 2Z64C 1SMDA 2X6BA 2XKNA 4LGPB 4OCNC 3UH8A 2C5DC 1HNFA 2KZKA 1E5UI 3P4MB 3ARBB 3LV3A 2CM6A 3MTXA 4X6BB 4GKNB 3KJ4C 2QR0B 4JE0A 1OV8A 5F7FA 3MRJA 1JDCA 4MYWB 4I48A 4PGCB 2ZKHH 2BK8A 3E2HB 4WHCA 1AKPA 1JDAA 4XP6L 4LHUG 1IFHL 2ERJB 4JFQB 4DEUA 1LVEA 5AOLA 5DD3L 4JPIA 4ZO8A 1AQKL 4DQAA 2F9BT 2YARA 1Y18A 2X5PA 4HHGA 2K6YA 1I9RH 3FQ2A 2ZXQA 2IDQA 1MQKL 4GRMA 1I1AB 4A1RA 3EHBC 1VF5C 1R34A 3PWJA 5GRUH 2XPGB 1S8DB 2Q7NA 4F7CB 1ORSB 1UD8A 1W6WA 5C0FB 5J13C 5KS9B 1JXGA 1UZ8B 2G3NA 2UUDH 2XWDA 1SLUA 3MOBL 2OYKA 5E9DE 3CJJA 5KYYA 4HIPA 3UJIH 4OLXL 4WI3A 4L48A 3WN5B 3WTWA 4JHZA 3SPGA 1S9YB 2NX5B 2VISA 2EIEA 2YA1A 2FJHB 5ICZA 1NDTA 2VR4A 4X7CC 12E8L 1WITA 1LP9F 3HG5A 3K2IA 4XPFL 3BUYB 4NPYB 4WI2A 1VB9A 1KTLB 4M6ML 4YHYB 2R1YB 1T0MA 4NUGH 1JTPA 1XMWA 4OZHE 4YHIA 3K72B 1ZHBA 4LLUB 2E8ZA 1JFQH 3ME0A 4MJID 4FKEA 1BZ7A 2MTAA 1ADQA 5KN5A 2GITA 5FV1L 4Z3EA 3T1WA 5CN2A 4QHUB 4P2AA 4O02H 5TD4A 1M6OA 1A6VH 1IM3D 1FGVL 1JWSB 2QQLL 4GPVA 5ITBH 3US1A 2I7OA 2H0JA 2XTJC 1J0HA 5MEPB 1EMTL 1P84K 1KN4H 4YHPB 4EUPB 3MLXL 4AQAB 3BP6B 3V52L 3VXUB 4LPXA 4ORGB 2AXGB 2DKSA 4EDWH 4D9QD 3D3VB 3FYEB 1T7YA 3UTZB 4M5SA 5ADOH 3SE3C 1CGSH 3DROA 5DLMH 3Q8CA 4ETQB 1FP5A 3IMUA 1HQ4A 4N8VA 4ZYKA 3O8XB 3PDDA 4QJ3B 4UNVA 4ABUA 2KLRA 4W81A 2HTLD 3VRIA 5F7DA 3N0PB 2PUQT 3D7PA 4HPHA 3KVPA 5AAWC 1GA2A 2VITA 5IVXE 3BDYH 4I0PD 1UASA 2J8HA 4ODXA 1UXSB 3NAAH 1K6QH 2HPOA 5ESAA 5C1MB 1KGIA 5E00A 3F12B 1IKNA 3IK2A 3RWJA 3TNMA 4YDMA 1RLWA 5AW2B 5GZND 1HL9A 4HOXA 2YEVB 3NABL 3DTDA 4JAMA 1M42A 5IR1B 1HU8A 2GTWA 1BFOA 3QUYA 5TK4A 3L7EA 3DXAA 1JWUA 4XNBA 4Q6IB 3EFFB 3WE6B 5I1GL 5L6YL 1K5NB 2IWFA 3LPPA 5DVOA 1FGNH 4NQDE 5GGSA 4ZDHA 4PGJA 4A7QA 4G70B 3G6AB 1I8IA 3V0GA 3MGTB 4FNUA 1VCBC 3VYOA 3VXNA 1I3UA 1I9IL 1PLGL 1HILA 3ROLA 4AMKL 2GY7B 5CKAA 1EJOL 3RA7L 1R1CA 2F1AA 3W56A 4KXZI 3WFDL 1F11A 3BGFC 3P4NA 1MFMA 4M5YH 4TSBH 1CMOA 3IPBA 3UZEC 3UADA 3SBPA 1FYTD 3B56A 5FM8A 5KSBF 1C5CL 3R0MA 1NFDF 3WBDA 3GHEH 5DD0L 1TSRA 3BRFA 3DX9A 4PJ5E 3OXSA 1N8ZB 3CFIC 2FIKA 1PCSA 2YQ2A 1KB5L 2XWJB 3DV4A 3H4FA 3TO4B 5B39A 5KVDE 5IOKA 5C6PB 2CCVA 5IJDC 4YDVB 2VXUH 3ARGD 1KXVA 2J8UE 4YSCA 1RJYA 4Y4HA 4JM2A 2YD3A 5KW9L 4N2NA 2FYYA 5IESH 3UP1A 3L9BA 4WO0A 4AXWA 2WIIA 4LCCA 5DQ9B 3POCA 4IIQA 2VO8A 3T8XA 3H3PL 4KK6D 5F9WB 2J73A 3QFJE 4DGVL 1Q9OB 1CICC 3BLPX 3LJ3A 5JPMB 4KZDL 1MWAL 5D7IF 2X7LB 3MHZA 5C3TA 1CYWA 2HXAA 2D2OA 1LHZA 3L3DA 5L8KB 2DD8L 3AZUA 3C60A 4HAGA 3BSHA 1X7TA 3I9GH 4KUCF 3RGHA 3VFWB 4AEHL 3V55A 3IU3A 1F0LA 1HYSC 2C9AA 3N50A 2X4SA 4YL9A 1DQML 4B9GA 4P2OB 3L9YA 4M62H 1URIA 1FV1B 3L95B 4Y2DD 2R0LH 4XB8A 3AY4C 4O4YL 2F7QA 3TIDA 1KBGL 3ZRCC 3B7TA 4BFGA 1XF4A 1MRCL 3MREB 3D0VB 3BKMH 1RJLB 5DO2C 3KPRB 2I69A 1U36A 3OHXA 5KOVC 3HBGA 3EOAB 3LIUA 3VFTA 2EJ1A 1DE4A 1ETB1 4ZO6A 5GGSY 4CVUA 3APCA 5FGRA 3AXIA 1RJZA 1TKWA 5EU4B 1JNNL 3HOGA 4NLHA 2JLPA 5D5MF 4TSAH 1DDHB 5HVHB 1I8LA 1TR7A 3VQLA 3BP4A 4YEFA 3O6KL 4K07A 2NY2D 1ZT7B 4GH7B 4HFWB 2NY3D 2X4NA 6FABL 2X9WA 2WVTA 3TIEA 2OQJA 2JKRM 4M7KH 1B9ZA 4JDEA 3I3DA 5LNDA 3AQZA 3FSOA 2DV6A 3M07A 4Z7WA 1KLFA 5I1CL 2O5ZL 4GBXD 4R0LB 2E9GA 3GKZA 5AYQA 1BZEA 5HDOA 4G42B 1I1YB 3FFCE 1JGIA 4B9KC 1L7TH 1MLCB 2P80D 3JVFC 4MJ6B 4ADGA 1PYWB 3VQMA 1QRKA 1RZFL 3EZ8A 3UAJC 3V9FA 1FZJA 4M4PA 1ZHLB 4U1JA 5AD0A 4ANXA 1ZGLM 2AEPL 4I4WB 4G7YL 4PQXA 4XN8A 1KT2A 1A7PL 2NW3B 1PG7H 1VACA 2ADGB 1FCGA 4ZMLA 1CXKA 3C6LA 2A83A 3NJJA 5C08A 5DJ0B 3T0ED 5D2LE 3BH8A 3DNKA 3ZQ9A 2R2BB 1MHEA 2IGFL 3TNNB 1HSAB 3OKEA 4P2QA 4I89A 3MCKB 4X4MA 2ZG1A 2Y6SD 3KMDA 4X7FC 4PB0H 4F7EB 5JXEA 2KLSA 1RHFA 4J27A 3M8OH 4OSUH 4OQTA 4MCMA 4Q58C 3H3BC 4QR7A 3OB0H 2Y7QB 3LN5B 3TEUA 4JVWA 5TDOA 1YEKL 3QWNA 3UBHA 4PJ7F 1HH9B 4HIHA 2ZCLH 3HNTH 4KQ4L 1KTKE 2XYBA 3BVWA 4ODVH 4OZIE 2EKSA 1MJ7H 1B2YA 2YEQA 4JFFA 4DN4L 1QACA 5C6WH 1BOGB 1QNZL 5ECGA 3QJHB 5LHDA 1MCNA 3IDGA 2CHNA 1QFHA 2BNRD 4CUCA 4XVTL 5JDSB 1BXXA 2OJ1A 4N8UA 4NQXB 5T3ZH 1S7RB 4DEWA 1P69B 1T1YA 4JZOA 4LLWA 1IBGH 4PHXA 1JUFB 3NEEA 4UAHA 1HHHA 5C07B 3TH4T 1OEZW 2R4RH 2R7EA 3EUDA 2JK5B 3ZUNC 4ZQTA 5DLLA 2ZNWA 3QWOA 2Q10A 2FGWH 1XTLA 1OP4A 5E8PA 2CUIA 1FL6B 3TBCA 4ODWB 3PFQA 2ZP8A 4PJ7B 1KJVB 2EIBA 2EDOA 4R26H 3X1BA 3PDOB 4YHKH 4Z76B 2YXVA 4HSQA 4Y16D 4PJGB 5JTWA 1AC6A 1N8OE 2ADIA 3IGUA 3ZTJG 4F3FA 3AG4B 4JRYA 1R5VB 5DD1H 2Y7OA 4NUPA 4WWKC 1MCDA 1IGML 2J72A 1E9QA 3VFMB 1EAOA 4JPVL 3NIDB 4HWBL 1NAMH 3E3QC 4MD5A 3MGAA 4S10A 4YZWA 3G5ZB 2CBPA 4I2XB 4E2OA 5KG9A 4YPGB 2F7RA 3HN3A 4K2UH 5C7XL 1T66C 1RZ7H 3ABMB 4P07A 4PJDF 3U6XS 3UPRB 3MNDA 5F88A 4BH8A 1Q0YH 4Q6KA 1V54B 1TJIL 1CD0A 2AQTA 4MKMA 5IROC 5TQ0H 1JK9B 4OFKA 4HZLA 3I74A 1ML0A 2H9GB 3FU3A 4HH8A 4NPKA 1SZNA 1PX3A 1U93A 1VESA 5KANI 2AV1A 2V7NA 1IAKA 1Z9SB 5DHVB 1AD0B 3U79A 4JKWA 1MNUL 5GGTA 3RVUD 3LKSB 5EO0B 1ZWIB 1QI4A 5HDLA 1EZVX 1YPZF 2H4EA 3FT4B 4YK4C 1Q8MA 4TLUA 1LEIA 1Z9PA 3OGCB 5EZOL 1FO0L 5GSRB 5AG8A 2BSRA 3FU8A 5HHOB 2HMID 2GJ6A 3GSRA 1IBYA 3C9NB 5F3BA 4RGOL 3H55A 4RX4A 4UT9L 3V4VB 4QRPB 3VRLF 4HP5A 4XNZB 2FSEB 1OSEA 2YSSB 2RD0A 1GHFL 1LGVA 3CAFA 5BO1L 3U9PH 4BFFA 1NMAL 2P5WA 2E0PA 2H6UA 3OGOE 4E5XA 1ZV5A 3MBXL 2WVUA 1RUKL 1E43A 4ONOA 1DBBL 1J5CA 1OB0A 2G9KA 4G8GA 4PRPB 5JXAH 2OTPA 1UGNA 2D9CA 2FX9H 2YN5A 5I71B 3WHXA 4NHUB 4DZ8B 4PY8J 2WQWA 5CUSH 2MH4A 5IP4A 4HEPA 3CZKA 4M6OL 3MLPA 4UIMA 4KVNL 1FRGH 3GGWB 4FQJH 3CDYA 3L1OH 1G4MA 1BXUA 1YEIH 2XN9E 2FHBA 3BHBA 3DARA 1T0NA 3DRTA 5DJCA 2JB5H 1E4XI 1YPZB 5FO7B 4HJJL 3KYMA 4FA8A 4QRAA 5CLTA 1RPUA 4P5KA 4FQCL 2VDRH 4DK6A 4UIKL 2YAEA 1FNLA 3OMIB 4GUOA 4P23D 5CWSA 2YWZA 1JZ6A 4L9LA 1AACA 3UPAA 3ULUC 2J71A 1RHHA 2CDGB 3CUPB 1T2JA 2HJLB 2XQ0A 1HYRC 2GYSA 1C12A 1JHTA 4LL4A 1H15A 4X6DA 1U8JA 1J05B 1FH5H 1XR8A 1CR9H 1N0XL 4JUTA 4KKBD 4JO1L 1AS7A 4Z7VE 1HZKA 2WYIA 3JV6B 1JTTA 2FE0A 3MUGA 1Z5HA 2ZUYA 1T2QH 5L9DL 2G5RA 3NG5A 1KLUB 1WGVA 3GLEA 4WUUE 3HN5A 1QA9B 1VGEL 4QRTA 2XA8H 3S2CA 3GUTA 3MYJA 1DVXA 4PH8A 3CPLA 3KPOB 3ZTNL 2B5IC 4JQIL 2OBGA 1B90A 2FO8A 2NR6A 5I2IA 5I0ZA 4NQVA 3AS3A 3VFGH 1NC2D 2EP6A 4G2AA 4EI6B 1OARL 4XZUB 5CCHE 5JW4M 2L7JA 1XWVA 4X6CB 4U6XA 3EYVB 1P4LA 1E4KC 4I1NB 5C71A 25C8L 3WMSA 4LCVA 3P77B 5LB1A 4NJAH 3QORB 5BCAA 3P0VL 1QLEB 4G7RB 4I0PC 2VERN 1GZQB 2PWEA 1YNKH 3QH3A 4AUJA 3KLHD 4BSWA 3HG2A 3QQXA 1E0OB 4E41A 4HT1L 5JHLA 4XXCA 1XQ4A 5EZIL 5B39G 3H9SD 3U46A 4R7DA 3TU6A 5TDPA 1DHKA 2JJSC 4ZUUB 1UD6A 4JY6A 4IRSD 2XKNB 2A9MH 4IBUA 2AJZB 5D1ZB 1ZE3H 3UEQA 1CFQA 2ICEA 1T1XB 1J0ZA 1IQWL 1W15A 3UJJL 3CX5J 2OR9L 4F2MB 2XTSA 3WLBA 2TRHA 3WEMA 2IPTH 4I48B 1OAYL 3MLYH 1UCBL 2F68X 4HOMA 5FGCE 1A6ZA 2QGEA 3QG7H 3GTNA 4ICWA 4I3SL 3FQRA 4JPIB 4DP0X 2R2CA 1SVZA 1Y18B 4JKPH 4AL8C 5A7BA 4K5LA 2VABA 4D9LL 1ET7A 3WKML 2YD2A 2YWYA 4GRMB 1BVZA 3C8HA 3EAKA 2ROYA 3PP4H 1NAKH 2DZEA 2OKMA 2YKLH 5HGGS 3WUWA 3PWJB 3I9IA 5T8IA 1TJHL 1PDKA 3GI8L 1I1AD 4PV8A 4X80H 5E2TH 2QADB 1BIIA 1MF2H 2CALA 3H0TA 3NCJH 1E4XL 3FQXA 3DOIA 1KTRL 1TO5A 2QPDB 1FNSL 2R0KH 4OJDH 4OLWL 4FQLH 1HXYA 4AQ8C 2X2JA 4FFYL 3GZPA 4GKZB 3OJDB 2VISB 4MRBA 1NBZA 2HX8A 3ARGC 4CC0A 5ISZB 2B15A 4AENA 2OCJA 1SBBA 1UOVA 5ICZB 3A6CL 4DQOL 4OGXH 2NX5D 1CU4H 1I75A 1YYCA 4O2FA 4JY4A 3RVVD 1P7BA 2UUDK 3VXME 3X1EA 4GKSB 2G75A 1BEYH 1T6WA 1NGQH 3QZWA 1QRNA 4PCSA 4UDUA 3NFPB 4J3UA 5CEZE 2X4QA 5KTEH 4KK6C 4HCGA 4IBZA 1AGDA 1KPVA 4LCWA 5D1XE 4NM8H 4QPEA 3LOWA 3ME0B 3OD3A 4LARH 4NDMA 4WWPA 3ARDC 5KN5B 4EIZC 1D5IH 2DWXA 2GITB 3G6DL 3GS7A 5L2KA 3K4ZA 5BQ7A 2EVGA 1X7QA 4FDWA 1M6OB 1OY3B 4QOKD 1BOYA 1WC7B 4AM0A 4R97C 4ZXBD 4NWUL 4XNMA 2BJMH 3B1UA 4Z3TA 1WZMA 4Q52A 3WNKA 4Z7IA 2HWZH 3FW6A 1DEEB 4K0OA 2X1WL 3Q44A 1MI5A 3ARQA 2OM5A 3QHFL 5ESVB 4A04A 1WF5A 3MGOA 3QIBC 4XNUL 2A6JA 4Y2DC 3DOSB 5ICYB 5D9SA 5CILL 2ITDB 5CCKL 2AJSH 1HDMB 1CLZH 4BQ6A 3DROB 4X8GA 3Q8FA 3MRFA 1W0VB 5FB8B 1H8LA 1HQ4B 2XWTA 4N8VB 1IAOA 3V7AE 3D3VD 4G43A 4HXBH 3T2LA 3I6KA 4PRHE 1D9KA 5F0LB 3VRIB 2XBDA 5F7DB 4UCFA 3QRGH 4IMKA 3DTXA 1MFCH 3IBOA 3O8XD 5B38A 2X42A 2E7DA 3IGLA 5IVZB 3D09A 5BRZE 2ADFL 3RWJB 3OXRA 2NY2C 3S36H 3IDJB 3VXRE 5JMOC 3DYMA 1CZ8H 2WNXA 1A6AB 1F6LL 2QQKL 2XNAA 4B9ZA 1TFPA 1K8DA 3B83A 4ZOEA 1FNAA 4AK1A 2DYRB 4RNRA 1L9QA 4TXVB 1CO1A 2PTUA 3QUYB 4GBXC 3L7EB 3RX5A 4YS4A 1B0WA 1JWUB 2QBWA 5ADPL 3BZEA 5A3ID 4PJ8A 4ZMOA 3I02A 2VLLA 4OIFA 4R83A 4ZDHB 3REVA 3IFOA 4UQBA 1G7JA 1KJ3L 4J2QA 5BOZG 1B2WL 4C56A 2WLZA 4PJXF 4PLOB 4E42A 5DWUL 2IOMA 3ARVA 5EB9A 3ROLB 1HWHB 3HKFA 1FYHB 5AWNH 2NXZB 4L29A 4EOWL 3O3AA 5A40E 4C4BA 1A7OH 1O7DE 2KMWA 2BRRL 3CH1A 4EO5A 3JWNH 2D7QA 2B0SL 1DVFA 3DX8B 3O9WB 4O02A 2IF7A 2VDPL 4UOW1 3VAEA 1N59A 4NOFA 3AWEA 4WIQA 1E40A 5K59E 3RIFK 2Y6SC 1U8QA 3ZMNA 3DV4B 5F7KC 4XN4A 4OUOA 3X13A 2DL2A 1S7WB 1RFDL 2X89D 2AJXH 3GSXA 3NZHL 1MFVA 4U1LB 3GD1C 1TMQA 1RJYB 4DKTA 1B4JL 3CFJA 1X7SA 3B2DC 4JM2B 3TJPA 4OI9A 2X1PA 4PJXB 4GI6A 5I30H 1AZNA 4Y5XC 2WIIB 2DPKA 4LDEB 3AQYA 3ZE2E 1V27A 2LAGB 3T8XB 1FFNB 4KAQH 2RQEA 3BVXA 4GAFB 3HN8A 4GXVH 4LHUD 4J3SA 1N6UA 5EIIB 1IC1A 2OL3B 5E2WH 2AABH 3SBRA 5L4MA 1A02N 2UWEF 4XNDA 4YUEL 2H0FA 3MXVL 3IU3B 5IMOA 3IJYB 4OIIL 4UT6H 2LLNA 2VSCA 2X4SB 4U7SA 1J9SA 3P2BA 4PJHF 2JJWA 4AX3A 3QPKA 5DYOA 3QXWA 5KBMA 1NOLA 3TFBA 4QXGL 4Y16C 4NJ9H 3TIDB 3MRBA 3TA4D 1DFBL 1XF4B 4P2OD 4PMFA 4ELDA 5IGXH 3BPLB 3K6OA 3OHXB 1QP1A 4X5WA 3VFTB 4HUMB 3R1GL 2AJVH 2DQIH 2DLTA 3BD3A 3LNEA 3ZDYB 2EE6A 1KF9B 1RJZB 1TKWB 3KPRD 5CEYA 4PWFA 4DNLA 4TQ8A 4LVHC 1LO3H 1PD0A 1UFGA 1WS7A 1YY8B 3DUSA 3D4ZA 3BP4B 1LDPH 3CXDH 3LQAC 4HEPG 5IB5A 2UYLA 2HAZA 1USZA 5FC9A 4Z7OB 1JPFA 2Y1YA 4BZYA 1YMMB 3P3TA 4OF6A 3ZE0F 1XO8A 4LCIL 3TIEB 2OQJB 4KXZH 2NYYD 2Y0SA 5EUOB 4JDEB 2Q8AH 1MVUA 2ZOUA 3FSVA 4PLNC 4WNQB 4XH2A 2I25N 4LBAA 1NUNB 2DIJA 5GRJL 4FXGB 4DUXA 1OF2A 4HCRH 2VUKA 4X9IA 3RVUC 5KVFL 2F1BA 2W9DL 1VCAA 4CC4A 1J9RA 4TUOA 5L88H 2YPVL 3S34L 1C8PA 2XTJE 3LRMA 4NNXA 5IQ9A 3GB7A 3CPUA 4BZ2H 1BIHA 2CAKA 1FZJB 4PY7A 4U1JB 5AD0B 5BVJA 5GQBA 5L8JB 2HMIC 2NZ1A 3IDNA 3SGJA 5DJZA 5MP6L 4B50A 1X5MA 4Z6AT 2MSPA 4QTHA 5BV7B 5EBMA 1IM9A 1TEFA 2BWQA 5T1LB 2VN5A 4KUZH 3RDTA 4KDTC 3T65A 3EYOA 4AKOA 4I18A 3OKEB 2YPLE 4H5SB 4P2QB 5K9KB 5EU6E 2X3CA 5IB3B 3NCMA 3QJQB 4JFYA 4JB9H 4OLVL 4GG6F 4P9ML 1ES0A 1LM8V 4DK5A 5CJ5A 2ZYHA 4OT1L 3VXSB 4NQSB 4HIHB 3SKJL 5BW7A 1L6PA 1IL1A 2EKSB 1W8NA 4JFFB 1T1ZA 1OGAE 2COVD 5E9DA 1H3PH 2DM3A 3BAEH 2DMCA 1GYUA 4FFWD 3IDGB 3BCDA 1U8IA 3BP5A 3OWRA 2DICA 4N2HA 1A5FL 4X7TA 1RURH 3SE8H 3U4KA 4P23C 3RUGA 2NY7L 3HMWH 1T1YB 1N4XL 4LLWB 2DWTA 1H9VA 2XIDA 1PGRB 2NT0A 3V10A 4EAEA 3AUVA 1TTUA 4M5ZL 4KKBC 4RRPA 4N0UE 1MCFA 3BOVA 1CBVL 1NFIA 1MW3A 35C8H 2RFXA 4HJSA 2F5BL 1LJMA 3SPVB 2Y2WA 5BZDA 4FHBD 1AE6H 4YDKH 2R0ZL 5C07D 1DJHA 1YAZA 2ITCA 3RVWD 5IWLA 3MO1A 3VFPB 1SUJA 3IDYB 5T5FL 4G82A 4GG6B 4XNYL 1KYUA 4PRIE 2V9RA 5E6ZA 5EC1A 4U1GB 2IAAC 4MA1B 1SMOA 1KDIA 1M7DA 4WO4A 4S0TD 4Y89A 2WP3T 4F58H 3VMPA 1BPVA 2WZ5A 3RVXC 2ADIB 3W2DH 3W39B 4F3FB 1A1OA 1RY7B 3D48R 1I9EA 3KWWA 2VLJB 3QEUA 3BMWA 2Z9TA 1IAIL 2D9QB 3I6GA 3QHTC 4GRWB 5LXVA 4KQ3H 5FCSH 2QVTA 3DHJA 3KPMB 3L81A 3WUWG 1P7HL 1VGKB 4QNPE 5E2JA 4MD5B 3HJEA 2E7CA 1D2OA 5AYTA 4X5LA 3WTVA 3TBSB 3KLHC 1ID5I 4JFPA 1TITA 4FEIA 3VE0A 3PS6A 4AKQA 4NP4L 2D73A 4YDZA 3RWHA 2F1EA 4IU2B 2OJZL 3QC5X 3WTUA 2R69L 3ZDXE 3RVTD 2IFFL 1QSEE 5LGYA 2B9AA 2JKXA 1FWXA 1S4IA 4HZLB 4XAWL 2ZXGA 1TZGL 4L3AA 4MQXD 5A6MA 1I82A 1U93B 4TF4A 1M05A 1XIWA 1IAKB 2WM0A 2H3XC 5AAMA 2UX7A 1G4RA 2UXFA 4TPRH 3LN4A 2VWEC 1EERB 4P5TB 1LYQA 3I75A 4NZTL 2J1XA 3QZWG 1FBIL 3U9UB 4UI2A 4OV5B 3M1OA 2GC4C 5FO2A 3WIHH 2IH1A 2FEEI 4L9DA 5GIRB 4AGLA 4GMTL 3E2HC 4PJIF 2GJ6B 5F3BB 5ICUA 4PJBF 5DJ8A 5I28A 2VDNH 3RY5A 1MN4A 3VU2A 2ERJC 3AADB 4AG4L 3RURA 1Z3RA 1RI8A 4NQDA 5HHOD 4OF3A 2P5WB 4AL8L 5KYXB 4E5XB 2EH8H 3W3BA 4QRPD 1NM4A 1D3CA 3O4LB 5FW6A 1HHIA 1EPFA 4G8GB 1I1AC 4DO6A 2OZ4L 5EEWA 1MFEL 3UZVA 2L0DA 4PGBA 4XPGL 4BM7A 1Z5LA 4PRPD 4UV7H 1DFXA 4UIMB 5C09A 2EDLA 3BKJH 5F96L 1U3JA 4AJWA 2WKLA 1KGJA 5KBPA 4UINL 3BHBB 3ZHDA 2A6DA 1UENA 2ZCHH 2Z1PA 1K4CB 4HLZH 1FZOA 3KYMB 3WN5C 3CVHH 5ETUA 1L6ZA 4P5KB 3RVVC 5B38G 5AL8A 1E30A 2H1PL 2RTTA 1T6VN 5F44A 3TWCL 4W9JC 3T08A 5DJDA 5DZJA 1Q0XH 3O0LA 4PJBB 4TNWK 5LAXB 4JRXA 1A7RL 2J8UA 1MREL 2QSQA 3OKNA 1P7QA 2QMKA 4X6DB 2YN3A 1CYGA 1GOGA 1TQVA 5HJ3A 2W8CA 2TSAA 1EK3A 1E4HA 2B3RA 4OD3L 1F97A 3FO0H 5FUOL 4YHYC 1SDDA 2CRYA 1AGBA 5B1JC 4M6AA 3HG3A 2YFNA 3L4YA 4HHWA 3V6OC 1BVOA 1N7ML 5ILTH 3MV01 1RUMH 3QFJA 1WZAA 1TSHA 2J2ZA 4QRTB 4MX7B 2KPNA 2Q2LA 3MYJB 3TTSA 2OA9A 1S7XB 4GW5A 3CPLB 1NMBH 4CGUB 4D8PA 4GAYA 4LLQA 1NBQA 4Z78B 2QJDA 3TVMD 5I2IB 3B2UC 3KLDA 1WIUA 4PJCB 4NQVB 1T83A 5IEHA 2VDKB 4IGBA 3H6AA 1G6RA 4AJVA 2XV2A 3DI3B 1HHJA 5ESQB 3GRGA 2YAPA 3JWDC 4DAGL 4WVRA 1D6VH 3KPQA 4KOCA 3O8XC 5CR1A 4OH2A 4OKVB 5HGAB 3MLZH 3LDBB 1QKZL 3F7VB 2TAAA 4DKEL 3PWUA 4WW2A 3C87A 5TE6H 3GZKA 4R7DB 5I1LA 3SDAA 2ZONA 3SBQA 4FS0A 5LWYL 1JSYA 4ZUSA 3KYKL 3QUMH 2HX9A 3HZVB 5AOZA 4F27A 4JY6B 1TZIA 1BP3B 4ETYA 4H0GA 2ICEB 5C0AE 2NYKA 2C3GA 2OSXA 2GK2A 1SEBA 2O5YL 3MR9A 4Y9GA 2XWBA 5A3IC 4AH2A 3C6SA 5K33A 1UM5H 5AOMA 4X9FA 2CO6B 1IFGA 3RG1C 1A6ZB 4YLBA 1KJ2H 4O51A 4OGZA 4LOUD 1QFUH 4RGMB 3MBEA 3V6ZA 2N56A 5DVPA 4QTIH 4CADA 5ALBL 3WFCH 2YK1H 3ARTA 2LE9A 3FQRB 2AI0H 3LIZH 3PYCA 5CP7A 4IRJA 5E4AA 3FFCA 1P7KA 1WIOA 2LABA 1XT5A 2ZXAA 5ALCH 5DQJA 1SXNA 3CVIL 5L4JA 2OMTA 2OK0L 2CCLA 3EF7A 3O0RL 4NRXB 4KOBA 2DH3A 4QAMB 3NESA 4NKQB 1PDKB 1QBML 3W57A 2APTA 3WXVL 4PV8B 3VGEA 1P9MC 1BZ8A 3KLQA 3H0TB 3E3QE 4YH6A 4BGDA 3P30H 3LY6A 2WAHA 4X9BA 4HKXA 3WJLC 1LILA 5AZ2H 4RGND 1HXYB 4G8EA 3T6VA 4LVOB 5EIVA 4AJ0A 3Q01A 5D2LA 3AM8A 2VLMD 1J8RA 3B5HA 3RGBA 1KCRL 4WCYH 4A2MA 3TO4C 4AENB 1JV5A 3VCLB 4MA3B 1A9VA 1QWUA 1WQVT 3SPJA 1X44A 4GI8A 1ACCA 4O2FB 2XPZA 2W80C 4YX2L 4K23H 4L4VA 2AQRA 2ATPB 2MCPL 4GT7A 2ZXBA 2BVYA 1AHKA 3HS0B 4FZEL 4Y4FA 5D7LA 5SX4I 3QUHA 2W81C 3BESR 1W9XA 5CR8A 2APBA 4KVCH 2X6VA 4OZIA 1CFBA 2QKIB 2E9IA 1DVYA 4LCWB 3VX1A 3T3PF 2D4FA 4F7MA 4NDMB 3JBG7 5EZJA 2YD6A 4P5RA 1MCPH 1KCBA 5I1IL 3IJEB 5BQ7B 1ZKAA 5F9WC 4IYKA 1X7QB 1TETL 2PP7A 3JXAA 2ZJSH 1QAWA 5K9OA 4V2CB 5JPMC 2DQHL 4RMVA 5KEZA 3VFOA 1P4UA 1YRKA 3WNIA 2ZCKL 2JQZA 3Q5TA 1MJJA 4OY9A 4U1MB 3ZUCA 3EJRA 4R90L 1UKTA 3KHQA 4KO9A 2A6JB 5D9SB 1KC5H 3G6JA 1F2XK 4BFBD 1U8HA 4CMMA 4P2OC 4GSQA 3MRFB 4HV8A 2ZSWB 3MNWB 5E6IA 1DJWA 2XWTB 2D7NA 1VA9A 2ADJA 4G43B 3RX7A 4TYUA 4AYDC 2Y2TA 3I6KB 3WSQH 1KB9K 5HVGB 4D0BA 2DWYA 2FX8H 3DTXB 3MLVL 3F7YB 1OAXL 3VACA 5F3FA 4HXAL 1YEWA 4HMCA 5J11C 3HE7B 2JKIS 4XC1L 2KPWA 4FYRA 5IM7A 4A2FA 2EEDA 5J1SC 4YC2B 4JUSA 1OAUH 4NN6B 5CZXC 2OSLA 1Q90A 2XWZA 1LO0L 2R2EA 3ULUE 1XZWA 3LQAL 3QDMB 3WNMA 5C8JB 2XNAB 1HIML 3N91A 4Y5VA 5EOCL 3LEVH 3GMMA 4RNRB 5H37A 2LU5A 2C4XA 1UT1A 1UUSA 1T4KA 1CXFA 3KPPA 4K9EC 3T2PA 4CBZA 1CGXA 1LLAA 1TJMA 3I6LE 3IF1A 5E0FA 3I02B 2VLLB 3REVB 3IFOB 3QUYD 4K7PL 4R0LC 1RZPA 2HSIA 1CLCA 3DXAD 3ZXAC 4QXVA 5J1TC 2C3XA 4P3DA 4H1LA 5EEXA 5HHXL 1PZDA 4E42B 3DRQB 1X5FA 4RRPG 2VR5A 2APFA 5F9OH 4KHXL 3S37H 3APDA 4NAMA 1MY7A 1OSYA 2FJFB 3HG1A 5DCCA 3SDCA 4K94H 3QBTB 4YSTA 1WEJL 3MLWH 4Y19B 5E03A 1LWJA 1VFBB 2J6WA 3A6BL 2P42B 4FAAB 3CH1B 2FBJL 2CMRL 2OMBA 4YZFE 5I26A 5DGQA 1UWEH 4O02B 1FVCA 2NXZD 2OCFD 1RJCA 1N59B 3FFDA 4MD0B 3T8VA 1M1XA 1EFXA 3N1GC 2IADB 5EHFA 4TNGA 5FHBH 1LO5B 1WK0A 3IXAB 4HU8A 4RA0C 1SEQL 3HW7A 4RSYA 1XSOA 3VX0A 1F00I 3UOAB 3X13B 3MRIA 1I3GL 3TA3A 5F7YC 1NJ9A 1XH1A 1GAFH 1UD5A 1GC1H 3VXOA 5F7HA 3QCTH 3GBLA 3VXSA 1DLHA 2KH2B 3GSXB 1GJUA 2YSTA 3L3JB 3ZDZE 1J0KA 3VFRA 2WIMA 1O5PA 5F9JA 1JJUA 2Q9OA 3CFJB 4AEFA 3FO2B 4HUNB 2A74A 4FFWC 4K8RH 5GSVB 3O6LH 3RIFF 4Y4HD 3VA2C 4POUB 4Q6YA 1MDTA 5IW1A 3E1F1 4JM2D 2CKBL 2YAHA 2XN9A 1W0WA 3ZK0A 4DIXA 3BDBA 3JUYA 2X70A 1DLFH 3DX7B 3GLZA 3BMVA 5J6GB 3GWJA 2FQEA 2OX5A 3F8UB 1HINH 1R6VA 4NUMA 2R39A 4APQB 2MIZA 3RGVA 4HBCL 3OKYA 3F85A 2E7LC 2K45A 4PCTA 2NNAA 1I7UB 3Q8EA 4PS4L 4AIZA 2Y3AA 3VFNA 1EX0A 3CMOL 3UC0H 4Z7VA 2IAMA 2FSDA 1LEGA 3IVKB 1PY9A 2YXFA 2WYZA 1S3RA 5DYOB 2F54E 3MJ6A 3PCYA 4JVUA 2AJUH 4F7KA 3MRBB 4KJWD 2FBOJ 3LQZB 4W9CC 1PSKL 4ZFOL 5A2BA 5EO9A 1Z9MA 1OPOA 4WUUA 4RFOL 4X5WB 2NXYD 4NCC2 2BY2A 3D05A 3C12A 4HD9A 5LNEA 5TQ2H 2ZXWB 4B0MB 3FB8A 5CEYB 4LGSB 2XRAH 4R4NC 1QD0A 5KBLA 3P0YH 1RSFA 4GINA 1B0IA 2BNUB 2QFRA 2EIMB 2UYLB 2VZ3A 4FQ1L 4J6RH 4TQEL 3WFEH 2IJ0C 1EHLH 1ZPUA 3RVTC 5DMIH 4PIRF 1SHXA 2EEXA 5JHDE 2IBBA 2B2XH 4P0DA 4IDLA 4MQXC 1IGCL 4EEEA 1UD2A 1BJMA 4KXAA 4BK5C 2WB7A 1NCCL 1EZUA 4IJTA 1YMMD 4QT5B 1JXKA 3TV3L 3KLAA 4DP5X 1OF0A 1OF2B 2AAVA 4U7KA 5EN2B 1IZKA 3GXUB 4ODHH 4NKIH 4PTTA 4LESA 5I19H 3PWPE 1DBJH 1LMKA 4LGRB 1A4KB 2WCGA 4J1UA 1JWMB 1DSYA 1S7UA 4YGAB 5JMRA 5LGHL 3OLEA 5IQ9B 3VGAC 3HAEH 3QCUH 4DKAA 1ACYL 2YJLA 1ZT4A 3PHQB 3UO8B 5BVJB 3ATAA 3M17A 1U3HB 3N40P 5E1IA 5DJZB 5DEZA 3OQ3B 2P4AB 2GT9B 1XDTT 1IGFL 2ZT9C 4GUPA 3NIGE 5F1IA 5IQOA 1N26A 3AU1B 3QDJA 4OCWH 2XXCB 4OTXH 1IM9B 4G9DB 4QHNA 4XPAL 2NYZA 1SF3A 5HGDA 1QLRB 4XNZC 3C6LD 5EA0L 1RULL 4FFTA 2H32H 1DQVA 3E6HA 5C08D 3KYAA 1TMCB 4GMSH 5FLVA 5IFHL 1ZA3B 5T1LD 2EUZA 2P5EB 4WFEE 2HFFB 4MXQD 3U0TB 1WFTA 3CDFA 4P2QD 3C8KA 2RGSA 2QQNH 3IMRA 3CSPA 5I71C 3IMVA 1F1DA 1IGJA 1WD8A 2Q2EB 3F2LA 3KNBB 3UO1L 4L37A 3X3GL 5JXED 5HJGA 1IL1B 1WYJA 4OF8A 1L7IL 3IS0X 1T1ZB 5E9DB 2CUAA 3PGCA 1VFAA 3VXSD 3WIIL 2WXJA 1L0PA 3NJNA 1U8IB 3BP5B 4L3EE 4PJAF 4X7TB 5IFAH 3MN8A 3EDKA 4JFFD 1VSCA 3RUGB 3UYPA 3QW9A 4FHKA 2GUOA 1GS7A 5I1AA 4F1ZA 2XZQH 1W2KT 5IW6A 1UWGL 5JOPE 2YRBA 3QXAB 1QR1B 4ZG1A 2QPSA 4XO5A 3RILA 4UQ3A 3WI9A 1RUQL 1D7DA 1DYZA 2RFXB 3FT1A 3VXMA 2B8OT 4NZRL 5BZDB 1J87A 1J0JA 2OCCB 1G1YA 3H53A 2ITCB 2KLTA 2CM5A 4F7PA 1R0AL 5DD6B 1BVKB 1I1CA 4BD4A 1OTTD 2Q8BH 5C92A 4BWTA 4TVPH 5D1XA 4JLRB 5E8DH 3I3BA 3GUTB 2PCPA 4R7VA 1L3NA 2J4WL 5EC1B 1OZUA 4HCRA 3B2VL 3WJMB 3UL4A 4WO4B 2G2NA 3HPLB 5B7MA 3PJSA 4XRCA 2MOGA 2LFEA 1RU9L 4LKCA 4YFDB 7PCYA 1NQBA 3SCMA 4HCFA 4AKPA 3V5HB 2PETA 4MMYB 3QEUB 2HVBA 4HX1A 3CZFA 4Q4EA 2DOCA 4PGDB 4DHLA 1ONQA 4JRYD 3R7RA 1HC1A 1NIAA 2NRDA 1DQDL 4JFPB 2ZWKA 2UY6A 3VE0B 1X5HA 3JWDL 4ZAKA 5I6NA 3W0WE 3WHE1 3FN0H 4B7IA 5GGUA 1N64H 1NGYA 3B7UX 4BFKA 5I6MA 1SVCP 4WGKA 1QSFA 2VXQH 1JZEA 1Q38A 4PRHA 1N5YL 3JWOH 5EORL 4PAZA 3FUJA 2L7UA 2WGNB 1GOHA 1I7RB 1M05B 2V33A 4K3HA 3B9AA 5HDBE 5ERWA 5BRZA 1DL7H 3GHPA 2XJKA 3SSGA 2WUCH 1OW0C 5ABAA 1YZZA 2DEWX 5IHUH 2GSIA 3BUDA 5DEJA 2ILLA 2Y5EA 4Z1PA 3IMSA 1EGJL 3U7WH 2IH1B 3GMLA 4LOUC 4P5TD 4CW1B 1MCHA 2G2RB 1LO4H 3IAPA 2DEYX 2ZXEB 3BSZL 4OF7A 4FL4B 2YOCA 5DJ8B 4Q9QH 3CFCH 4UANA 5IQLA 4AGPA 2PW2B 3F6IA 4NQDB 1A7QH 2GJ6D 4ZNCD 4RX4D 1GMEA 4DVRH 4NZ8A 1G43A 2WYHA 4N6QA 1V7ML 4G5ZH 5FA4B 1CL7L 1NCTA 2NNRA 1SMAA 1T5WA 3ECWA 2P5WD 3WKNA 3EXLA 2B77A 2BP0A 2AEWA 4JW3A 5A2JH 4XBPA 4G8GD 1UYWH 1I3RA 5C09B 4WK4B 1TQWA 4KTDH 1YUHA 4DGIH 3N42F 4XB7A 2YUVA 2WO4A 4EBQL 4X99A 1QEWA 2A6DB 3BWZA 3FXIC 2YAMA 3C2AH 1FZOB 3ECVA 2EXTA 1PCXA 4IKLA 3AXHA 4JANA 4MA7H 5DS1A 4W9GC 2X4TA 2EACA 2BZ7A 1NAMB 5DJDB 2NZIA 3AVEA 5FFGA 4JRXB 4NHCH 2XWRA 4ZW7A 1AIFA 4OV6F 3HPJA 2WQRA 1ZTXH 6TAAA 1PG7W 1P7QB 3OKNB 3ZRSA 5HJ3B 4DEPB 1MSPA 2EDQA 1OGSA 1C16A 2P3YA 2FATL 4LEXH 1AGBB 1MJ8H 5H37G 3LXBA 1SYVA 1UM4H 3PL6B 2I9TA 3SHSA 4MZ2A 5EG6C 1YECH 1M56B 4QYAA 3NEXA 4TNWF 1U8LA 4JDTL 3QFJB 4LHJB 2FRGP 4JGMA 3ULVF 4RCAA 4GW5B 1XFPA 4BYHA 3PFUA 4H1LG 1RK1A 4RH4A 4LLQB 4NI6A 2R4SH 4P49A 5HI5D 2E6QA 1JNLH 3WV0A 3F65A 4NM4L 5IEHB 1RZJC 3V0AC 4IGBB 3VI4E 1M6UA 2WO2B 3N43B 1DANT 1M7UA 3OZKA 4RSVA 3OKOA 1RIVL 2NR6D 3MLUH 4HWUA 4TV3A 5CXPA 2Z4QA 1QQDB 4NP9A 5JNYA 5E4IA 2VQTA 4G6ML 4LOEA 2J5LB 3MSPA 5DJAA 1R75A 2HRPL 3CU7A 4PS7A 1D7CA 3PWUB 2OMYA 4MQSB 5I1LB 2IQ9H 1FCCA 2QDWA 3GF8A 3O11B 2R56H 1YEJL 4JRFA 1GPOH 4E41D 2ZX7A 5C0EA 1F18A 1TZIB 1IKNC 4AM0Q 2VLKA 1MFBH 1HKLH 4OCYH 4PMEA 1EUTA 1S9XA 2WSDA 3CLEH 3O45A 3UJTH 1WBZA 1SEBB 2D0HA 1FZKA 3C2SA 5F6HI 4YE4L 2YKKA 1INQA 2VRQA 5LG1A 2F08A 3H9ZA 5G5DA 1TVBA 2XWBB 3PU7A 1HS6A 4XP1H 4AH2B 2BCMA 1F90H 3AREB 1E2WA 1I85A 5EBWB 1OM3H 2VDRB 4BH7B 3QUYC 4AEIH 5KYWA 1BG1A 4K9EL 4LLDB 4RWYL 3C75A 1JI1A 2ARJB 1TU2A 4N0FB 1ZEAL 5ECJE 3K8LA 4X7EC 4IRJB 3V6FA 5CD3A 3FFCB 2WYTA 1P7KB 4JFZL 3G5VB 4TUUA 3UTSA 1U9KA 4Q89A 4S1SL 4EIUA 4NO0A 2C9VA 4JPWH 4XP5L 5DQJB 5C0IB 2OMTB 1KUMA 2VT0A 2ZUQB 2PPCA 2W0FA 2ZE0A 2CLVA 2NXZC 1A7NL 4XGZB 1A2YA 5G55A 1UWXH 3H3KA 2R8SL 2IALA 3UTOA 4K3DH 4OBRA 3F62A 2GJPA 2WKOA 4OCXL 4Y4KA 4IIZA 2XFXA 4PWGA 3TWYA 4AQ1B 3B2XA 15C8L 4G8EB 2IANA 1BBDL 3GZOA 4P46A 5MHSE 1S46A 3S5ZA 3DYPA 1AFVL 5LCVA 1EEZA 2J88L 2YPLA 2HT4D 3ERXA 1JV5B 5EU6A 1BLIA 1EO7A 4EMZA 4X0KB 1Q9LB 3HZMB 4C58B 1KEGL 2RA1A 4F37F 1QYGH 1KXVC 4L4VB 4OD2B 4PG9A 3GSVA 5LDUA 5I8EA 4Y1TA 4Y4HC 3L17A 4OCLC 4Y4FB 4JM2C 2HJFA 5IB4A 4FQ2L 2VWEE 1SXSA 5D7LB 3V0WH 1PX4A 4DGWC 3LMJL 5K9JH 4K55A 2VIRA 3DSFH 4OZIB 4XVJH 1NL0L 1PMYA 2CJUL 2LQRA 1OGAA 4BXVA 5K9QI 3D5OF 1QRND 3LKPB 4DO5A 4XMPH 5IMMA 3VNZA 1G9MC 4HWEL 3MJ9L 4H8UA 1OP3H 1OSPH 2A6KA 1VRSA 4LCWD 1ILUA 1VPOL 3HR5A 5K9OB 2DQJH 1H8NA 3ES6A 3FU9A 4YEEA 1YEGL 4OCSL 5L2KD 4MASA 2VXSH 1AANA 2COQA 3SIKA 1LQSR 2CBMA 1K9TA 1RIHH 1TLKA 3E9UA 5DVNA 1WS8A 3E8UH 4J8RB 1MJJB 1PQZB 4U6HA 4EXKA 1MUJA 3G6JB 1RZGB 4KMTH 4XNQA 1SPDA 5GXBB 3RWCA 1U8HB 1C5DB 4KJWC 4FYSA 4OM0L 3SN6N 1NUGA 1MI5D 5E6IB 2B59A 4HV8B 2M83A 5T33L 1Y0LA 1L0XA 2C34A 2WTPA 3IAQA 3LIZA 5LG6A 1NEUA 4D0BB 1MRDH 2Y7SA 3SQBA 2ESVB 2H8PA 3BYTA 3OHXC 3KG5A 3DGDA 2NX5E 2WXMA 1UG9A 4MAYA 4Q7DA 1IFHH 3T4AA 3GSOA 2DM4A 4RZKA 1DQQA 2VXTL 3HE7D 5DD3H 3RDJA 2R2EB 3I85A 2TRYA 1I8LC 3KXFB 3TASA 1GGIL 3NSFA 1DBML 5HI4D 4K3EH 1EEYA 2EDJA 4Y5VB 5D7KD 4PW3A 1B0RA 5CIPA 4HUVA 4NKMA 3GMMB 3OX8B 2A0LD 1R5WB 3K6NA 3MA7B 5D4IA 1WTLA 2AEIT 3IF1B 1AZRA 1WD9A 2C3HA 4JKMA 1E7UA 5B1CA 4GUQA 1XEUA 3ZPDA 1M3JA 3QIWA 4AYID 2Q76A 2BZDA 4P3DB 4H1LB 4OLXH 3H85A 5I23A 4HG4J 4PJ8D 3GEFA 2OYPA 2ZG2A 5FEBA 1A7BA 2B1AL 4URKA 3HG1B 5MI0B 3CD4A 2E9JA 3IEAA 4C56D 2NY4B 4AVKA 2HKAA 1PZ5A 3D34A 1B88A 4UV4H 3VXUE 1WV7T 5D1ZI 4XPFH 4XWOD 4B9CA 1KNOA 1UHVA 1X5ZA 3C6LC 1KB3A 3DIVA 1FVCB 2HKFL 1PF3A 1LMIA 2ID5A 1M1XB 1EFXB 3C08H 4LAQL 2EDHA 5BV7C 1QEXA 1Q1JL 5EOTB 3ZKQD 4B97A 2WTOA 1E28B 4U1NB 2MEJB 1DVFD 4MXQC 1ZMYA 5ACZB 2CK0H 3TA3B 1F4YH 1A3QA 1Z3GL 4N2LA 2P24B 1N70A 3IDXL 4R9HA 3MRGA 4OQ1A 3PXLA 3GXTA 4Y2NA 4AY0A 5KVGL 2EEBA 5JXEC 4RISL 2EZ0D 3A47A 3VFRB 2CGZA 4W4NA 1LO2L 2A74B 3R0NA 4Z18A 2CUMA 3BYYA 1AC0A 1NEZG 3QNZB 1JI2A 4L18A 4N5UA 1P4IL 2QGDA 5IW1B 3L2MA 3WFZA 3GBNH 3V52H 1X4XA 3V7AG 1YY9D 4X42A 1OKEA 4MSWA 2H2PD 3V4UH 1HSBA 1JYWA 3B7RL 1HK6A 5HXMA 5LBVA 3QDGB 3RWGA 5HYJB 1R33A 3QFDB 3RGVB 3QS2A 1IIKA 1TYRA 1PVHA 3QFGA 3SKMA 3HCVA 3QR0A 2NNAB 3SYPA 3K91A 5D4QA 1QNIA 3NFSL 1JNJA 5EFIA 1IAIM 3B7SA 5LBSL 2FUQA 3IRCA 4Y9BA 5H35B 1LEGB 1IC4L 4J3VA 3OC5A 1TG8A 2R23A 3IDYC 1FNHA 1H6EA 5IQNA 1IU1A 4FNLH 4LLAA 3C5SB 4BFNA 4TLKA 3U25A 5ID0B 2HRLA 3NABH 4KKLC 4U1GC 4MA1C 3DURA 3QQ3A 3BIKA 3WDHA 1CN4A 2YUWA 5EO9B 1B0GA 1JGUL 3QZBA 4S1QH 2P1YA 4K5PA 4JG0L 3KL3A 4I5BA 2F74B 4X8JA 2JCCF 4JO3L 5FM5O 3FB8B 4F93B 4MB3A 2PPDA 1JGDA 1H5BA 4PS8A 2C7UA 5L6YH 1GGBL 1MJUL 4L1HA 2NY0B 1QMUA 3ASOB 2CXKA 1KTJA 3FH8A 3U7YH 4W9IC 2VM3A 4JKNA 2EDEA 2Z92B 1HZHL 1IBFA 2C7FA 4LLYB 2AKRB 4JG1L 4NENB 4PRNA 4AMKH 3DK2A 3FHAA 3K46A 1QLEL 2P52A 4KK8D 1EJOH 5IBTL 1X5XA 3HB3D 3DWTA 1IT9H 4J2XA 1MHCA 1LTXA 4EZLA 4UB0L 1UOLA 3P3RA 4ENZA 2Y7NA 1C5CH 4I8DA 5DD0H 4LLMA 1VZGA 2W0PA 4J1UB 5KSBE 4YDJA 1NFDE 3N1FC 4QKXB 1KB5H 1K72A 4KBPA 4P5TC 5E6RB 1SXZA 2YGOA 4OFDA 3LSOA 4G7SB 1VEPA 3QPQD 5C0AA 2AFNA 2JCCB 4A2LA 4P06A 3P9MB 4XP4L 4OB5H 4OF5A 3TL5A 5KSUB 4GUPB 1TLMA 3HNVL 4NYLA 2F7IA 3QDJB 3IRZA 4QHNB 3QCVL 4UUJB 5HGDB 1CE6A 3L4TA 3ILPA 4UTAA 4FNRA 1A6TA 3MCYA 2YGPA 3E6HB 3MNMA 4XWGH 1DJYA 1XGZA 3FQYA 3L6FB 1Z32X 4RMSA 3QUGA 1IM9D 3RDTD 1IVLA 4CJ1A 3C8KB 1YVLA 4DGVH 1MAJA 3RWIA 1AOHA 1IGJB 2JXMA 3N1QC 3NACL 4WENB 3A4AA 4L37B 5BZWA 4ANWA 4FABL 2H45A 1AXTL 4RZCB 1WAAF 4YSOA 4AMXA 5E2VL 1VZHA 2DD8H 3T6WA 2RACA 3PGCB 1VFAB 2Z31B 4PYHA 1MHHB 1AQ8A 2EC9U 5HYSG 4JJ5B 1DQMH 3UYPB 2ZOTA 5E9DD 4B5EA 2GUOB 3QZNA 1PNDA 3WTYA 3KDMA 4P2YA 4PRBB 5IW6B 1KBGH 2FD6L 1MRCH 2KERA 4TVUA 1NOAA 1BJ1J 3VXMB 2K9FB 4FTDA 1ZLUH 4F8NA 3OVUB 3HTLX 3OJMB 2CDFA 4JCMA 3FF8A 1E6OL 2PYFA 4M1GL 4FJ6A 3F58L 1GY2A 3RE0A 2JQAA 1SJHB 1AR1B 1WFOA 3QJTB 4YJZL 1ADQL 3O6KH 3SGEH 2OW6A 4HQQL 4WSJA 1CPUA 1T20A 3A21A 4Z7UA 4R8WL 4XRCB 5HI5C 3HAEA 3SCMB 5I15L 5DWPA 4WO4D 3UYRL 3S3PA 3WIFB 4HX1B 5DHEA 2NR6C 1M53A 3EG9A 5I1CH 5IMLA 4OLUH 1E8YA 1XB8A 2YD5A 1OLZA 3DVNA 4JFEB 3GM8A 2IEPA 3O6FA 5I1KL 1XGTA 2WVVA 2AQ3A 2UY6B 4WTWA 5C0JA 1YEHL 4OZGF 4MMZB 3PIQA 2H32A 1RZFH 1T7ZA 1BREA 5F1SA 1PZCA 1QSFB 2FJGB 4MCYA 3LDBC 3QWQB 5FF6A 4ODUA 4XPBH 1FIGL 1WWCA 3L08A 4M03A 1A7PH 4XXCC 5I8KL 5J9PA 1UATA 1F45A 3H9YA 2DWDA 2K4AA 2WXIA 3OKMA 4U3HA 5KANG 2ISDA 4XMLL 4LSUL 4BSVB 4OZFH 3BVDB 4YDLB 2BS9A 1KIUA 1N0LB 1NMCB 1XIWD 5DD5L 3BLBA 4YSEA 2ICEC 4KRPB 2GSIB 3VWJA 3CFBA 2PWHA 2A4CA 3KVQA 1Y6MR 2YBRA 3QDAA 2X3BA 2ZUUA 2KUTA 4WGVB 1RUAL 4P48A 2XG5B 5HSFA 3FAWA 3MMEA 1YEKH 4ZS7H 1NH6A 3ETBJ 4KQ4H 4A2HA 4CSPA 4RGMC 4I77L 3TN0A 2MWCA 5T3ZD 4PJ7E 3FUMA 5HYIA 1ZXQA 3SPIA 4XCCL 4OM1L 2OYMA 1QWHA 4A7VA 2Q1EA 2IQAA 4L8SA 4NQDD 1Z5YD 4AYSA 2PLTA 4DPBX 3ZVVA 1RAMA 3RL2B 5AENA 5ACLA 5KVMC 1FVEA 3Q13A 3FO1A 4ADIA 3HBPA 1I3RB 4HH9B 4TMPA 1YUHB 4HLJA 4I2XE 4X99B 5BUGA 4N1HB 1E4KA 32C2B 1F3RB 2HT4C 3AQXA 1UJ3A 3DKHA 4LVOC 1J18A 5FUZL 5C09D 3UGXA 3CFKA 5DJ6B 1G9NC 3S5LB 4JRLA 4ESKA 3PV6B 2B16A 2XETA 4M5TA 4JANB 2OMVA 2O5XL 2X4TB 4BCXA 4F7TA 3U83A 3QJRB 5GS1B 3EGSA 4JREB 3MZTA 1AIFB 3HPJB 4P3WA 4PN6A 5HHNA 4J7RA 3IJHB 4N87A 2BDNL 1CLVA 4LSVL 1C16B 1O9VA 4JRXD 2VXQA 3EOTH 2ZOKA 4OAWA 3MTRA 1P7QD 2I60L 2QKIC 1SYVB 2JIXA 1QUNB 2XWEA 3N40F 5DUPH 3VQ1C 4WHYG 2I9TB 3RHWK 3GIVA 4OZ4A 1QFPA 3IGKA 4F2FA 4JO4L 4MTMA 2X12A 1SBSL 2K9UA 3UACA 1U8LB 5HHOE 4UM9B 3CXHJ 1QPKA 2HN7A 1S5IH 4QRPE 2ZUTA 2A5UA 2OL3L 1RK1B 5CU9A 1W16A 2F19H 3PGFL 4XVOA 5GRWA 2XICA 3QFJD 4KJPC 4HK0A 4WU7B 1INEH 1BD2B 1CGWA 3WENA 5KVGE 2DH2A 3EOBB 4PRPE 3M45A 2G9HA 3OKOB 1ZLEA 2I07A 1WFJA 4NQUA 2EUXA 2VDLL 3BT2H 3HUJA 2VDNB 4TNVF 1DN2A 2CIIA 3KCPA 4IGBD 4H25B 2F54A 5FHAL 2WZPA 1OPGL 4P5MA 5DJAB 2JJUA 3MODL 5I6KA 3TC9A 1WCBB 3QUKA 5I1JH 2PR9A 1HE7A 2OMYB 5I5JA 3ARFA 4X6FB 1RZIA 2WUBL 4XMXA 1X4YA 1YPZE 3LXUX 1FO0H 2V5RA 3HE7C 2VSKB 3SGDH 5FR3A 1M1SA 4QHLA 4RGOH 5I0WA 5DURB 3ZJAA 4HKZA 2MQGA 1AKJA 1E90A 1O6SA 4YC2C 5C0EB 5HI4C 3IMWA 4NN6C 2VLKB 1I7TB 1GHFH 3OHMB 5BO1H 2BCKB 3SDAD 1NMAH 2WOYA 3H6JA 5J7CC 3ELAT 4NIKB 1WBZB 5IIEA 5MEQB 1SFHA 3MBXH 1RUKH 4I87A 4ACTA 5G5DB 1DBBH 1TVBB 3BP7A 4L2LA 5GGQL 3CZJA 3UDWA 3CVHB 1OAKL 3G5WA 3Q2LA 5BOPA 5I82A 1AGCA 2ZUWA 4HDIB 5JHDA 3PQYB 3RI5K 3HS8A 4W9DC 3QNXA 1F2QA 4ZD3H 4JS7A 2OMUB 2PTTB 3ARDA 4LVNB 5D2NE 3RAJL 3ZYJA 2O61B 4FI6A 4UM8A 2OP4L 4U2YA 2G0KA 4LPVA 2F61A 3OR6B 2HVJB 3ASWA 4L8CA 1MELA 3UTSB 1CF8L 2P9RA 2Q7AA 3LKOA 3PWPA 1XD1A 2JWYA 4HJJH 4UOQA 4DOHE 4GSUA 1D5ZA 4FQCH 2BFVL 4HS8H 4IRJD 4XWOC 2W59A 2W0FB 3FFCD 4UIKH 2CLVB 2R0WL 5KYNA 4PVNA 5B8CA 1AJ7H 1P5UA 1S7QA 2IALB 4IBLT 3QIBA 5AVYB 2CKNA 2ZKYA 1DVFC 4Y4KB 1FPTH 5BV7L 1DEDA 2IANB 3FQ4A 1Z9NA 1UM6L 1ZLSL 1PKOA 1FDLL 4GOSA 2ADYA 4YHLL 4U6YA 3T2NL 1I4FA 1WTGT 2EZ0C 4BQ8A 1D7FA 4C8XA 3NMEA 3QAZB 2Q3ZA 3QHZL 4PJFF 1ED3B 1TPXB 1UWXK 1BBJA 4PD4J 2MJWA 1VGEH 4OQTL 4JFOB 5HDWA 3Q05A 1URLA 5IB4B 1T0PB 1YY9C 5KYUA 2M26A 3ZTNH 5CAYB 4JQIH 4L4VD 2H2PC 1FAIH 1YDPB 3OKKA 3PHOA 2N3JA 4R7XA 4EPSA 5D8JL 5DJ2A 4TULL 3S88H 4Y4FD 5L4FA 5D7LD 2EVIA 4F2ME 3LS4L 4BZ1A 1OARH 3B3IB 4OR1A 4L3EA 1RV6X 1C1EL 4G59C 4JO2L 3CDZA 3HR5B 1A0QH 5KUKA 2FQGA 3IMTA 3IN0A 5DJXB 1GRWA 3P0VH 4APQC 4B41A 5T1MA 4RBPH 4YSAA 4I7ZC 2BSBA 4HT1H 4J3WA 2VDQH 2YPKB 3NUKA 4U6HB 4BUHA 5CN1A 1ZGLB 1QFOA 1MUJB 4XNQB 3F05A 5BO0D 1KJ2B 3EGXB 5AVVB 1OP3K 3ESPA 2APXA 1Y0LB 2ZX6A 3MC0A 1HEZA 4XO4A 5FYLE 4RWHA 3HKZA 3SE6A 3UJJH 3X1NA 3PAVA 2EE2A 5E6ID 1O7VA 3HRZB 3MBWA 3P11L 3T0BA 5E08L 1OAYH 2YRZA 4ATTA 5FX3A 1NPNA 4XPHH 2AQ1A 5ISZE 2WHVA 3NP4A 3LNFA 5LNGA 4BKLB 2VH5L 1DQQB 2AV7B 2LFGA 1WP6A 3NDYE 4S1DD 1XV8A 5F7EL 4RA3A 4DKFL 1AVAA 1HVXA 2H6PB 3FB6A 2ED9A 4WI6A 4KK8C 1EEYB 4BBWA 4D9LH 1B0RB 2P7TA 3NH7H 3W0WA 5BMFL 3ZT7A 1GH7A 5DYFA 5JIIA 3GXPA 1O0VA 3O2VH 3SPCA 1TJHH 4I1RA 3GI8H 4A2DA 4Y5XA 1DBAL 3MI6A 1AHMA 4JPKL 3V6BR 2G3ZA 1A9EA 5DFVC 3QIWB 5C70A 3FULA 1FNSH 2Q76B 4OLWH 1TO4A 5EF2A 4OLZH 4M61B 4NNPL 2XC8A 3QPQC 4L23A 1GTFA 4FFYH 4GIPD 4YFEA 2ZOLA 4LSSH 3GUFA 5EEZA 3P4LA 1QO3A 5GGTL 1F02I 4PP2A 3A6CH 1L0QA 4KXDA 1PZ5B 3VB9A 4DQOH 1FZMB 2VAJA 2PR4L 3ZHFA 3F00A 1U3HC 5EC2A 3SGJC 3HG1D 3SDCD 5KZCB 4PWJA 2NY4D 1TF4A 4Z3FA 4OGAD 4K15A 3KHOA 1ZANL 1WZ1L 2GFBB 1MCKA 1T3FB 2AXWA 1ND0A 2O6DA 1XTMA 1K2DA 3RDTC 3ECQA 3MFFB 4WLCA 1KULA 3BE1L 1XD0A 2A1WL 5AVTB 5F7LB 1IE4A 1EFXD 1AOZA 2R59A 4JFUA 5DDHA 3LX9A 3NQIA 3G6DH 8PAZA 2FH8A 4JHAL 2ZKXA 5AYUH 3TA3D 4ANKA 3ECBA 2WMPA 1CXEA 3SKNB 5FECA 3EYQD 4WEMB 4ZTEA 3UMNA 5D55A 3VVWA 5BW7C 3LXCA 1A4AA 3T6ZA 3L2LA 2XIIA 3DETD 2IPKB 4L8BB 4MSWB 2D2CC 5CILH 3COOA 1DUYB 1FFPA 3FUKA 4N2AA 2QPFA 3WXWL 3WNOA 5B1JA 3RWGB 2XN9D 5F9DC 5E8NB 2X3AA 5IBLD 4ZTPL 1FFOA 4KKNA 4R4FH 2Y72A 3HFMH 5FAAA 1HL4A 1PLBA 5IV2B 3RGVD 4PREA 1RERA 5C86A 5C0BB 4G3YH 1WWBX 4M1CD 3TYGH 2ZD0A 3KBFA 1VDGA 3GRBA 1JK8A 5IWLC 2VQ4A 2ADFH 2R23B 5F0JB 3BEWA 3HI6H 1RD6A 1A6UH 2IAMD 2OZNA 1KENH 2QQKH 2PO6A 2E59A 3BIKB 3D07A 3DOHA 4P59L 4WO4C 1B0GB 1PLAA 1Q9KB 2IDTA 2QPEB 3RIKA 3ZE1B 3BO8A 1BVLB 4X8JB 5DEFB 4KDTA 1I31A 4TUJA 4YSDA 1H5BB 1S5HA 4WFGE 3TCLA 2C7UB 2G3XA 4L3FA 3FU0A 3D39B 1J5HA 3RIAK 1WBYB 1F58H 3VD5A 2VDKL 5F21B 4JHUA 2JFCA 5A2LH 5K1NA 5JUEL 5DWUH 3CVDA 4HPYL 4G9FE 1UQSB 2F15A 3K4DA 2P26A 3RBGA 2XN2A 4PJXE 4EOWH 4AIOA 4M93B 4N2MA 3HC4L 3UGEA 4TRPL 1G7HB 2BRRH 5JHLL 4MZ3A 2B0SH 3LQMA 1ETJA 2CU9A 4P8QA 3FT9A 3CN0A 1XIWC 4NRYB 3BQUA 5D71H 2MCAA 1RK0A 5AAMC 2E7BA 3MV8A 5BRQA 4BFIA 4DERA 3LSOB 5C0AB 4TUKL 4W9ZA 4IOSA 3LKQB 3OKLB 1UVQA 5HGHA 3EYSH 5I16B 5HHQB 4IBSA 2WW8A 4I1PA 1B4JH 3FTWA 3HC3L 4ZTOL 2UZYB 5KBNC 2WNKA 4DPRA 4LNVA 3D4YA 4GI9A 4FL4C 1CE6B 5EF0A 2MMXA 3ILPB 4U1KB 1UADC 1MIML 4IBYA 3R7QA 4M6NL 3QDJD 2V2TA 2VDML 1BF2A 3TBVA 1T22A 2Y36L 4ZUTA 4PV9A 2FT7A 2YD4A 4DPAX 4QEGA 4F80A 3IJSA 3HG0A 3RPIB 3ZDYE 4X7DC 1JN6A 2IH3B 2ORBL 5BZWB 4CNIB 3INUL 1SJXA 1KTDA 5EO1A 2C9RA 4PWHA 4N9GA 2LVCA 4U33A 4WW1A 1NCOA 3KD4A 3MXVH 1V7NH 5IB1A 4OIIH 5ABDE 5C3IA 1F3DJ 1E4WL 1YMME 2N0MA 1BSIA 1J5DA 3LZQA 3O2WL 3JSSA 3PHAA 1OGTA 4POZD 1FORL 5EUOE 5IBUB 3BZFA 5JW5B 3ULSA 3BRDA 3VO0A 4QXGH 1XZ0B 4MXWL 4PJHE 1PL3A 1DFBH 1VKXA 2GCYA 4DTGH 1BJ1H 3KYOB 3IDIA 4FQPA 2G60H 4KI5F 4DEPC 4QMEA 4U0RB 4JFWA 3M1CA 2YFOA 5INCA 5AEAA 3VXMD 1QBAA 1KIRA 4FXLA 3ARBA 1JHKL 3FPYA 2AJYL 3PL6C 4GKNA 2QR0A 4R4BA 3LZFL 3VGGA 5D96B 1KCUL 3EJCA 2Y06L 4PGCA 5CEZD 5F7UA 1ZLWH 4Z7UB 2Z7ZA 5D1XD 5DFWH 1QI3A 3SDDB 4YR6A 1AR1D 1H6UA 5KVEE 3HAEB 2YD1A 4ORZC 2CO2A 1ULVA 1ZLUK 3TOPA 2HTKC 5GS2H 4P2QE 3MRNB 4J3OG 4PLJD 4X4ME 2R27A 3ZE0E 1U92A 4AGMA 4H8VA 2JSFA 3OAWA 3SCMD 3O3BB 4IGBC 3FRPB 2ZKHL 2W1NA 3O6FB 4Y1AB 1XGTB 2DQGH 5JIQA 3WN6A 3S34H 5T1JA 2PW1A 4LPTA 2WLHA 3II2A 2IBZX 3PIQB 1FNGB 1SF5A 2H32B 4F7CA 2IMNA 3VGFA 1XCTA 2J5LC 1KPUB 2BZCA 1E7VA 1WAPA 2YIHA 4KO6A 4MCYB 3L1GA 2P48B 3BD5A 3GC3A 4ODUB 5FF6B 4ZAKD 4N26A 4AGQA 1I9RL 4WW2C 5J9PB 2V17H 1U8MA 1QSFD 2XZAH 1RIUL 3Q2NA 4U1HB 3WN5A 5C9JA 1S9YA 3OKMB 4PRHD 2FT6A 3S7GA 3UC2A 4YMPA 4N2OA 2FJHA 2EDBA 4ZFFA 3J7HA 1KIUB 4MRCA 8FABA 2IO5A 2PWFA 4KROB 3C5ZA 5BRZD 1DN0B 2YBRB 4IKNA 4NPYA 5EZPA 4P9MH 1XSKA 4Z0XB 3V9EA 5HVWA 1MCBA 1DCEA 3BKCL 2R1YA 3EFOA 1OALA 4GG6E 3Q2VA 1OCWL 2A77H 1AI1L 2V9TA 4IRJC 3S3SA 4QHUA 4OZHF 1A5FH 1T0OA 1T80A 2IQAB 1JWSA 3MLSH 1WT5A 4HJ0D 4X2UA 4NUGL 2P5PA 2JE8A 2VLJE 3CZLA 2CR6A 3SOBH 4EUPA 3WTTA 3GPEA 4AQAA 5JQIB 3VXUA 4GKOA 2AXGA 3S35H 1CBVH 5E1QA 1PZUB 1TOXA 4O02L 4FA7B 4YQXL 1A6VL 3UTZA 5ITBL 3B9DA 1ASOA 3ARXA 1UJ3B 2Y4SA 3WGVB 3AM8C 3CFKB 1B6UA 1S7SA 4CSZA 4ETQA 2GBUA 4RDQF 4AGOA 1JIBA 2WXHA 5T5FH 5J57B 3V2AR 3UIZA 1ERNA 1GGTA 5DSCA 4ZW3A 2VO5A 1UXSA 2XWXA 2ZSVA 1CGSL 2G4EA 5DLML 4TQIA 4BFOA 4Y4FC 1VFMA 1TZOA 4WV1B 2VZSA 3QXDB 5IVXF 4A68A 1IAIH 4OAWB 3CFNA 2JIXB 5FYKU 3BDYL 3GIVB 3VD9A 2Z3FA 3NAAL 4OVVA 3UG3A 1K6QL 1CFMA 4R3SB 5LJYH 3BSZA 1F4XH 2R29H 3CV5A 4W9KC 5GRVK 3EDEA 5IZ7A 4Q6IA 3TM6A 3WE6A 3EH5B 4A7TA 2IFFH 2C1PB 3ZL1A 4HK0B 4EI5A 5I0XA 4CDHA 4XMWA 3G6AA 1TZGH 3MGTA 3O4LE 3RHWF 2G9HB 4FNPA 1F6AB 3T77A 1CD9B 5E9NA 2I07B 4ZBJA 4NZFA 3HUJB 3L13A 1AD9A 5E6IC 5AB0A 2CIIB 3KCPB 1LK2A 4GP8B 1HEHC 1XAKA 3ARRA 4P5MB 3VRJB 4X7SL 3QUKB 3PE9A 4ELMF 2VW4A 3EJZD 4QY8B 1CD1B 3ARFB 2EYRB 3B5TA 2BVQB 3IU4L 2BM3A 5GGVY 2Y22A 3BAXA 4KRMB 1N8ZA 1YA5A 3PAZA 5EUKB 4QHLB 1IC5L 1LXMA 1N3NB 4NRZA 1OK8A 1AKJB 2J7LA 2IBZY 5JA9A 3NJXA 3TO4A 1FLTX 3KGTA 1YNTF 2X4PA 4IM8A 1TJGH 4PJIE 1CDYA 1F1GA 1D7BA 5CJ8A 4AG4H 4M5YL 4TSBL 2OXGB 4NOBA 4PJBE 4AL8H 2IOIA 3LRGA 4YDVA 3CQFA 5IIEB 4P4RB 4WHTA 2VLKD 3MRRB 3BP7B 4Y5VC 4R96A 2V4LA 4LHQB 4MFHA 1MFEH 1AGCB 1QBLH 3KPSE 3OG4B 3U4BH 5JHDB 4UYQA 5CJXA 4R7LA 4X8CA 3APMA 3CTTA 3LEYH 4PEEA 3QNXB 3T1FA 1Z7JA 4JFXA 5F96H 2AJ3A 4JFTA 1MWOA 3N55A 4WRLA 2H26A 2PYEB 4UM8B 4UINH 4UTBA 1OO2A 3MU3A 5H8DA 4N25A 4ELMB 2DWSA 3LKOB 4BHUI 1ZIBA 3K71A 1KCKA 2K7PA 2HVKA 5KSBA 1Q9OA 1PX8A 1NFDA 1D5ZB 4TKWA 5KVEH 3TWCH 2H1PH 5MI0C 3ZYIA 1DDTA 2BNQB 2X7LA 5CZVH 5F1KC 2NY4C 3UTSD 4YXHL 5B8CB 4OGAC 4PJCE 3ZOAA 4NO0D 2YUXA 4Z3JA 1RXLA 1P5UB 3VFWA 4Y7OC 4CKQA 1MREH 4P04A 4XVSL 3GLDA 3RKDD 4YLQT 4XBEH 2DS4A 3NIGB 4P2OA 3L3IA 4M29A 3GTTA 3MV11 1FV1A 4I3GA 2V7HA 3L95A 5D1QB 1OAQL 1V05A 1OOAA 4FEMA 4NX0A 4Y4KD 2YO3A 4U6YB 4NERA 1DQLL 1YCSA 2IAND 3TA3C 4P46D 3I9GL 4TL4A 1UWYA 3MREA 3KEHA 4F8OA 1RJLA 3EYQC 1B6DA 4NXKA 4TS6A 3EOAA 3DBXA 2GB2A 3WCYA 2WLKA 4M62L 5EU6D 5T1DH 3DETC 3GKWL 5AL0A 1RSYA 2A74C 1AZUA 4IOIA 1WBXB 4Z95L 3OKKB 3PHOB 1G7QB 4D94A 3BZ4A 2FO1A 4L4TB 2LU3A 1DDHA 1JPTH 1T6BX 3DBSA 3NYKA 2AXHA 5DJ2B 3BKML 1DSFH 2XZCL 5D7IA 1G7IB 1JCKA 4HFUH 5D72L 3RTQB 3UBXA 4ZPTA 1V3MA 1ZT7A 2I7SA 4IKJA 4PJEF 5CNHA 2WTRB 2F8VA 5CLYA 4HC1A 1OGAD 1VENA 3R19A 3VG0L 3WO4B 4CSTA 4DAGH 2V5MA 3BCFA 5I75B 4ZW5A 5KJ7E 5BPPA 1SM3L 1KBKA 1QW9A 2DBLL 4L8DB 3RGVC 1RZKC 1QKZH 3CHRA 2AVFA 4M1CC 1JGVL 3V8CA 4R0LA 4DKEH 5FIEA 2O5NA 4FI8A 1AZZC 1I1YA 3LNIA 3M7FB 1CC3A 1NEPA 2AK4E 4ZO7A 2HPTA 1MLCA 1U3ZA 2K70A 1PY0A 1IARB 2HT2D 5J12B 2YLKA 3J27A 2EDDA 1DJXA 1GYAA 4FGMA 3PWLA 1HEZB 4I4WA 4JFDA 4XN9A 1IGTA 4YBHA 2NW3A 5JW3H 1DVQA 2VE6B 4RBPK 3MBWB 4ENED 1I3VA 4WHDA 4UT7H 4CVWA 5IMKB 3H54A 5MENA 1J8SA 4PJEB 4JGNA 3ZDWA 3RX9A 2B3IA 5JHMA 3MCKA 2Y7MA 5IY5B 3S3DB 1KELH 4MAYD 1BWMA 3RQ3A 3I9PA 5E99L 3WG7B 4EZJA 3DJRA 3NEOA 2FT8A 1OK0A 4PHZA 3WJJA 3CVIH 2Y7QA 3LN5A 5TE7H 3IT8D 4U4IA 3W0WB 5LN8A 1HH9A 1FAKT 2DBJA 4QXWA 1A6PA 3WXVH 4LCWE 1U0QA 1M9SA 3QJHA 4PB0L 5CJBA 2CDEA 3LRHA 3M8OL 4OSUL 4D7PA 5JDSA 4G6FB 4NQXA 3MRDA 3O41B 4F24A 5FO9B 3HMXH 5HDBB 1S7RA 2ICCA 4P99A 1RP8A 3MRLB 1KCRH 1NPUA 3QIWD 1QO3B 1MJ7L 4L1TA 2PP8A 1J1OH 5AQ0A 1G9HA 1NGZA 3L9EA 3VTMA 1OWWA 3U1PA 5EC2B 4IU3A 2JK5A 5T3ZL 2MCPH 3GSUA 2GK0A 5J8OA 3ZSTA 2JH2A 2H2SD 1MLBB 4F20A 3J2PA 4CN1A 1DQJA 1IBGL 2C4FU 5ICXA 4IBVA 1MCOL 3MUY1 4G5AA 2R4RL 2VDOH 4GAJH 3SDYL 3H8NA 4NO5B 4PJ7A 2B4CL 2QHLA 1DBKL 1HQRA 3PDOA 2E4TA 3WEXB 4ERSL 5I1IH 4PBDA 4KXCA 1TETH 4IS6A 2FGWL 2J55A 5AG9A 5DO2D 5D7KE 2DQHH 3EDFA 3VFMA 4P5SA 1QABA 2ZCKH 2CO4A 1IKOP 3UTQB 4K9JA 3QDME 4R26L 4POZC 1HX0A 4I2XA 3B37A 2Z31C 3K2MC 3ISRA 3OL2A 4YPGA 2FR4A 2X0WA 2Q5BA 1DR9A 1FFPB 4W1TA 2EDMA 3Q8BA 1E4JA 1HWGB 4H26A 5KAQG 3FQNB 1KCSL 4PWKA 4KX7A 4TL5A 4BK5A 5KVDL 4OJFL 3MXWL 3VH8B 1NAML 5E6UB 2EEFA 2FEJA 1FFOB 1JK9A 1MVYA 1V8HA 3D2TA 4WI4A 4B95C 3PG2A 4P3CL 1JOIA 5DVMA 3B2PA 1G0DA 1BX2B 1HESA 1RZ7L 1Z9SA 4HIIB 5DHVA 1O9WA 4APXB 1Q0YL 1U58A 4LP4A 4BFRA 2QDVA 3LD8B 5JW4Q 1FLRH 1AQDB 2V8MA 1ZWIA 4Y19E 5EO0A 1ZPLA 5F6HJ 3FT4A 1CCZA 1MPAH 2AP2A 3D51A 3KLSA 1QASA 1AR1C 4KPHL 1HIMH 1JV2A 5EOCH 4PLJC 1BM3L 3C9NA 3V4VA 3BO8B 3SCMC 3N44F 4KHTH 3ARYA 2YSSA 1S5HB 2QZQA 5B3JF 4N2BA 4PJDA 5AVZB 3VFVA 4K7PH 1Q1PA 1JGEB 4EUPG 5AW1B 1G6RL 3OPZH 3U4AA 2H1XA 4PWIA 5C0RL 2JI2A 4DZ8A 5JIMA 1I53A 5GS0H 3SDXF 3WAKA 2N7SA 4MMZC 4OVUA 5T1KA 1WEJH 3CFQA 1LK3L 1PKQB 4NAJA 1MFNA 1NWPA 3H2WA 3M86A 2FBJH 4EF3A 2J44A 5FO7A 1YPZA 2HKHH 4EXPX 5JXAL 2FX9L 1U3YA 5IJBC 1EQWA 1TTRA 3BQUB 3K0WA 3QR1A 3ZR6A 3MV8B 3OAZH 3L16A 2WD0A 3B6SB 5IF0A 2DDQH 4Z8FL 4YDLC 4DT2A 1FRGL 1NMCC 2Y9RT 1CXLA 3L1OL 2WXPA 3U1SL 1YEIL 3BUIA 4CU6A 3VD0A 2CDGA 2UVFA 3ILEA 4MCZA 2HJLA 5AB2A 4OJEH 2VUYA 1GW6A 2OXHA 1E65A 1J05A 5FYJU 4BRJA 3MUUA 5C0AD 4LSPH 2ZAGA 3JV6A 1GL4B 4NBXB 1WUZA 3EO1A 3T0DA 3U1QA 2FLRT 2WN3A 3SDXB 4HJ0C 1P4BH 5D2NA 1RZ8B 3TBVB 4G6KL 4MA8H 3QQNA 3U6XA 1CR9L 2CA4A 4UQ2B 4ZFQA 3DJTA 3IJSB 5CLXA 1E2ZA 5LDSA 4HD5A 4HBCH 4AJYV 1T2QL 2FJSA 2G5UA 4GQPH 1KTDB 5EO1B 3WNJA