3TT3H

Crystal structure of leut in the inward-open conformation in complex with fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
218
Chain Sequence
b'QVQLQQSGTELMRPGASVKISCKAFGYTFTNHHINWMKQRPGQGLDWIGYIIPYNDYTTNNRKFKGKATLTVDRSSSTAYMELSSLTSEDSAVYYCARGNYGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leucine transporter LeuT
publication title X-ray structures of LeuT in substrate-free outward-open and apo inward-open states.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transport protein
total genus 37
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2011-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt3H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt3H02
3L9RB 4KY1L 2ZCKH 4YK4B 5IBUB 1BVLA 2AV7A 4NIKB 1OCWH 3GBNL 1C1EL 4MJID 1NLDH 3MYJA 5D2NB 1YEDA 3VFOA 1CE1L 5KSVB 1V3JA 2N1KA 1N0XH 5D7SL 3ZYIA 3WMSA 3HA0A 3M8OH 4FOMA 5CEXB 5K9QI 3AGVA 5A40E 5C8JB 1J88A 4OUUA 5CUSL 4Y4KD 2Q3ZA 4NZJA 4CVXB 2Q8BL 1DQDH 1JPSL 4M61B 4XNXL 3K2UL 1HE7A 1VFUA 4HEPG 4XVTL 2FSEB 1S5HB 1Z0MA 4CADB 2VXUL 4HG4K 2DS4A 5CILH 2R0KH 2Y6SD 2ITCB 5DRWB 5IVZB 3GRWA 1KCSL 2BOBB 5KANG 5JZ7C 3DXAA 3U48A 2V5SA 4ELKB 5IG7A 4KKBC 2VDPL 5F1IB 4Z76A 5TDOA 3FN3A 4F8TA 4K3EL 3EYOA 2A83B 1II4E 2QQKL 4PJ8C 4JRYB 4Z7NF 2A6KB 1HSBA 2Y07H 1ZS8B 4JQVC 4EDXB 4FRWA 2EDXA 4FXGA 3RVXC 1PG7X 4F3FB 1G6RL 3NMEA 3FFCA 3DI2B 1T04A 2XWTA 1KG0B 3T1FA 1I8IB 4MSWB 3ULUD 5F97E 1FZMA 3UYRH 4MD5B 4F58L 1CD1B 1FG9C 2X4OA 1QRKA 3LN5A 4GS7B 4HIIA 2HRLA 4QHNB 3DETD 4L3ED 5IVXE 2LV4A 1NEZG 2MJWA 4CW1A 3V5HB 4PJ5B 4QYOB 5CHNB 2PW1A 4HMDA 3NZHH 4L9LC 5M7QA 3FQXA 3PQYD 5FM8A 4H1LH 2V6HA 5JUEL 1OAKL 3ARFC 3BD4A 1TJIL 1T0MB 4XPBL 3ECBB 1BFVL 3UPRA 2BSSB 3BH8B 3D0VA 1QBBA 2BVYA 3CDGA 1I7UA 4NUJB 3WD5H 1YMMA 1N2RA 4IOFD 4BQBA 2DLTA 3IF1B 5I8OL 4YXLL 1N5YH 1WIUA 2NY5C 4M03A 1G7IB 2XA8L 3MRNA 3NFNB 2QR0A 1OAQL 1CXKA 3ZYZA 1HYRC 3IKKA 4PRNA 3EIFA 1JHTB 3IDIA 4LLYA 1JNHA 4XB7A 4XP1H 1CK0H 3VXUA 4ENED 3W39B 4OT1H 5JIKA 3MV11 4IRSD 1M05B 1BX2A 1FZOA 1IGMH 4QRUB 3OV6A 3I75B 5L7XH 1HINL 3OKKA 5L9DH 5FUOL 2HRPL 5IQ7H 4CVZA 4PB9H 3VXSB 2GJZA 3B5TA 2HWZH 2DLFL 1G7JB 2YD5A 1KTDB 3G08A 3VFWB 1GGBL 2IAMA 1TITA 1GVIA 3R06A 3E2HB 1EIBA 5EU4B 2I60H 4GH7B 3V4VL 2UVFA 4WI6A 1T2JA 3K2MC 3TO4B 3HMXA 4WO4A 5EU5B 4G8FA 4UU9A 1F13A 2EDDA 3QCUH 5HD8D 1XZ0A 5JO5B 6FABH 3TYFB 3GI8L 3QPQC 4UILL 3TN0C 2BNRA 3FO2B 3HAEB 4ODUA 2YD7A 1KPUB 1XF3B 3OHXA 2O5XL 4G6FB 5FO8B 1KSRA 3GHBH 5A2JH 1MFAH 4XAKE 1NL0H 1VHPA 3X3FH 1A3LL 3RY4A 2BFVH 2C7UA 5SV3A 5D6DA 3CSBA 3WNNA 2HKHL 4GKZB 4OCYH 3TFKC 5E2UH 4K23H 4KK9C 3S35X 5DSCB 1XGYL 4RMUA 1LEGB 4I48B 4C83B 4HH8A 3NA9H 4QHKI 3KYAA 5IHZA 1CVSC 2GFBA 5IESH 2VDLL 4OF5A 1Z5LB 1PYWB 3MMEB 3MRLB 3V6ZA 3L6FB 1AQDA 3F58L 1MCOL 3EGSB 1VADA 4WWKD 4NQCE 1PBYA 4GQPH 3B9KA 3UJJH 3HUJE 5BVPH 1ACYH 5IK3B 4G80B 2DWDA 5IW1A 2AV1B 3KYOA 2V5TA 2LAAA 4ZOAA 5B22A 5DO2D 5GRVL 1MF2H 4CKVX 3MFFA 3VXMA 4NNXB 1R0AH 1TQCB 2BSTA 2FX9H 4KJWC 4HZAA 1VFBB 4DVBA 1FFOB 1DBJH 1UQSB 1DZBA 2EECA 3AREB 2EDBA 3OX8A 5HYQA 3BP4B 4P4KC 3VFMA 1DBBL 2VLJB 4R97B 3GM0A 4OZ4B 4YC2C 3MNVA 1N8ZB 5IV2A 5C2BH 2J5LB 2X4UA 2HMIC 1X5FA 3BN9D 4U1HB 1FL6B 1XR9A 2JJTC 4N90E 4KJPC 3DX6B 4R8WL 4QCIA 4ZXBD 4G8GE 1Z6JT 1H8OA 4ELMA 3O4OB 2XICA 4X6DA 3WIHA 2FBJL 1HILB 4UIKL 4E41B 4S1DD 5FA3B 4JFDA 4NRYA 4J2XA 4PJBF 1JHLH 1IKNC 3PGCA 5I0ZA 4PBXA 3Q0HA 5JORB 4MA1C 1FIGL 1U6AH 2NXZB 1MJ8H 5IOPA 4P2CG 1JPGB 1NCBH 2LU7A 3C2AL 5T33H 3JWDH 2W92A 1I85C 3QUYA 5J6GB 3HB3C 4HV8B 2F53D 3DX8B 2EC9U 4BK4A 2VE6B 4NQVA 2C3VA 3I6KB 3U9PL 3HPJB 3W9EB 3SDXF 3VRIB 5SWSA 2FB4L 4LEOB 1KFAL 4J6RL 4C56E 2XIDA 2VLKB 4I77L 3EOBB 4PJDA 3P73A 1VENA 2IGFL 4ZUVA 1CXLA 1KIRB 1S5IL 3G5ZB 1UG9A 2R2BA 4N8PA 4XCEB 3OG6B 5DS8A 4F9LC 3QIWC 4HGMA 5GJTH 3IDYC 1SBBA 2E7LC 2B7DT 4DGVL 3AUVA 3HFMH 4HJ0C 4MQXD 4XHQA 3WFBH 3WBDA 1FHGA 4GO6B 2GYSA 3TP4A 4Z0XA 4PYHA 4PRHD 4FNLH 5IB5A 5GISH 3PWNA 4FHBD 1MIMH 2NY0B 4KROD 2AK1H 4QTHA 4XC1H 5ESAA 3MO1A 2I9TA 3NIFF 1F6FB 3B2VH 1HHGB 2Z91B 4U3CA 1JPFB 2VN7A 3C60A 1D6VL 1R5VB 1REIA 5CSGA 3WXVL 3EYUH 2Z35B 2NXYB 1C12A 2CDGA 5MI0C 3IJYB 3DVIA 3BZFB 3P9WB 3KHOA 5JOFB 3NAAL 2ZCLL 4ZFOB 1IM9B 3KHQA 4Y19A 1M7IA 1F8TH 2V2XB 1XCTB 3QWRA 3U2SB 3QNYB 4ODVL 2A6DA 4N0RA 3D3VA 4E41E 4Z7WA 2R1XB 1NAMA 4OCWH 1HKLH 1MFBL 4CDGC 3KPMB 3O3DA 2YUWA 3MJ9A 4ODXB 5KAQG 2OZ4H 1X6LA 1MI5A 3SKUD 1EMTH 4LVOC 4PJGE 4UV7L 2PUQT 3MYZA 1ZHLB 2X70A 3LEYL 5CD3B 1J1PL 2W60B 4M6ML 1MVUB 1T20B 4R0LC 4UTAL 4FQ2H 5C0IA 3FMGL 4LARH 3VDBA 1IILE 2VITB 3ALXA 2B5IB 5I9QB 5JW4N 3SQOL 3UTSD 5FKAA 2NW3B 4LRNH 2BDNL 3SBWC 5EWIH 1MRFL 5D72H 5D9SA 3S36L 4U3HA 2GK0A 5FHBL 5D1XA 1UFUA 2AXJA 4FQXC 1IGCL 5C0AE 1PKQB 3ZE0E 3QUXC 1QRNA 3QA3B 5F7EH 3T1WA 1UWEL 2DBLL 5E9DB 2Z92A 4DJMA 3QUMH 4LQFH 2EEDA 4QOKB 1ZK9A 2HLFC 3PWVB 4LVNB 5GIRA 2Q7YA 4ZYKA 4PRDB 3A67H 5LGKA 1Y0LB 5F44A 2R8SH 1T1WB 3NCJH 2PTUA 5D7LA 1R5IB 2XRAL 4BK5A 2F15A 4XNUL 3ARSA 3RWCA 2P8LA 2EC8A 3O2DA 3I3BA 4G6JL 4PY7B 1KIPA 1U3HB 2GT9B 2HVKB 5BW7A 1UACL 1DVFA 2HJFA 3HI1B 4LLWA 2Z4QB 3MV8A 4J4PA 4ZAKA 3RHWK 4CAGA 2YD9A 2AEIT 1QG3A 1OARL 1X9QA 1EFXD 2QSCH 4F15C 1RUPH 3KJ6L 4L4TA 3ZKQD 3T0EB 2AJVH 1FAKT 4FMFA 4XP5H 4C58B 5EBLB 4FQQB 5DVMA 3JUZA 4KZEL 3MZGB 5DZOA 1YEFL 2C1OB 1P5VA 4GBXC 2DDQL 5F6IB 1AGCB 1FGVH 1RZKC 4ODSL 4Z78B 3AS2A 3DRQA 1NUDA 4Z7QF 5GSRB 1MWAL 5GJSL 3HHRB 4OF6A 1S7XA 3TYGL 5KS9F 3UTTE 2BVOB 4XVUD 2NLJA 3TM6A 5JXED 3ULVE 1TQBB 2C3WA 3LY6A 3ULUL 4OM1H 1EUUA 4NM4L 5E4IA 3SE4A 7CGTA 3DROA 3GI9L 4MAUH 3FT3B 3M1BB 4UOW0 3WNOA 1NCCH 1YNKL 15C8L 1EXUA 4BJLA 4PGCB 5DEGA 3O4LE 4FFVC 8FABB 3WLWD 4DGYL 2DLIA 2O93L 3BW9A 4BH7B 1OSZB 1PZUB 3EJYD 5CEYA 5DD1L 2AJZA 3NN8B 3GRWH 2FEDD 3P3YA 3QCVH 4F7EB 3Q1SH 5HYFA 5HGBB 5F3HB 1IQWH 3QR2A 4JQVA 4Y1AB 4EI5B 5EU6D 1LQSR 3VW3H 2OP4L 2WMPA 2VZ1A 4LU5H 4JO2L 1JV5A 4P2OA 1MCRA 1RVFL 5DFWH 5JW4M 1KJ2L 2H2SC 3PG2A 3IXTA 2FECL 2PYED 3JV4A 2J1KA 3V5DA 2WWMC 1WCBA 3C5SB 2XXCB 2LQRA 2IFGA 4FMKA 2RGSA 4K3HA 1NPUA 4OZHE 2YPVL 3V0WL 3DSNA 1J12A 5EUKB 4BQ8A 1LVEA 3G6JB 4ZSOE 1GPOH 4NPYA 5IVOA 2DQUL 3RA7H 3NGBC 5BOZG 1EO5A 3TCLA 2HA1A 4KI5E 3ARGD 4WY7H 4L9LA 3B5GA 5DI8A 5TDPA 3ARFA 1KBGL 3U7AA 1T6WA 5F8QC 4Y5VC 2C1PA 3RZCD 5I1JH 5D1QD 5ALBL 4CU8A 1F4XL 2VZ3A 1IEBB 2EXYC 4NWTL 2NY1C 5F7FA 1INDH 2IH1B 3BP5B 4GG8A 4X7SL 5MP6H 1F58H 1IGTA 1SVZA 1IC5L 4KMTL 3SO5A 1MQ8A 4QTIL 2VH5L 4B0MM 2X4RB 4PD4J 1LK2B 2KBGA 2ICWA 4Y2DD 4XPFH 2AGJL 1NCDL 3SPVB 1DLFH 3LHPL 4Z77B 3HZKA 1JGUH 2J3SA 2CDFA 3UBXG 2VL4A 4LOUC 4OB5L 1BF8A 3N1GC 3TEUA 4HT1H 1AR2A 1MRDH 3VGGA 4QY8A 1WTGT 1R5WB 5INCB 1YJDH 5TQ2H 1HYSC 1EO8H 3BWAA 4RBPK 4XMLL 2JIXB 3GKZA 4HUXA 5T1LB 3TPKA 3TWCL 2HG5B 4IRJB 4ZODA 4ORZC 4BFEA 3QFDA 3ARQA 2GSGB 3U0PB 1GZPB 3QB7C 1QA9A 1J8HB 3REVA 1DQJB 1NGWA 1OVZA 1ORQA 1JE6A 1RZIA 2HFEA 4EEEA 1MCEA 3KPRB 4GAFB 5DT1H 1DFBL 1BP3B 2YMXL 3OJDB 1F5WA 4IJ3C 2X1OA 1OF2B 1U8OB 3TN0A 4XC3H 2ADGB 5FUZH 4R7DB 4YDLB 2EO1A 5TE7L 3BDYL 1HXYB 2MHAA 2WWKO 2CRZA 1OT1A 4LCWB 3MROA 3U46A 4EZMA 1HHIB 3LDBC 4NJAL 1N4XL 1ZA6B 1QYGL 5F7NC 1RZGA 2JCCF 3LRSA 5EIIA 5GS0C 1NGQH 1WGOA 3NACH 5LVEA 5DJCB 3BJLA 1JWUB 5SX4I 5C0FA 5HPMB 4WENB 3V5KB 4D8PA 4LSPL 4EI6B 2V2WB 1I1AC 2UZIH 1A64A 3BVNA 5LAXB 3WJLC 3LKRA 2R9HC 5DZNA 1QSEA 1KNOB 1LO3L 4PJCA 5GGRA 2EYRA 4BSJA 3U7YL 3QWQB 1U8HB 2Y5TB 4I3SH 4LSRH 1UZ8A 3B2UD 3QDAA 2NY3B 1S7TA 4ZUWA 4HX1A 3PNWA 1EVUA 1YNLL 3H6JA 3TBSB 1NGXB 4RGMB 3CXHK 3FKUS 5C3TA 5L2KA 5D1ZD 4AMKL 4BSWB 2VL5A 4QWWC 1RZ7L 2NY7L 4L4VA 4OZIF 1FNFA 4X6FB 5AD0B 1WC7B 4EUPH 4JG0H 1PSKH 4DFIA 5E8OA 4HS8H 5CZXD 4MWFA 3BEWB 4HULB 5I1GH 4EKXA 4PGBB 1FVEB 3IDNB 1OHQA 4HFUH 4FP8H 2J8UF 3N06B 4HC1H 5CJ8A 3REWA 1FJ1B 3UTPD 3DARA 1CT8B 5DK2A 4EDWH 4U6XA 2PO6C 4U2ZA 1JPTL 4XAKD 3ZKMC 1HQ4A 4JM2A 3E1F1 3QDMD 3M17B 3BRFA 2HH0L 4F33B 4GRMA 3TO2A 1W2KT 3FQNA 4KXZI 5J1AA 3AS0A 1QD0A 3IB4A 4BQCA 4W4NA 3ZKND 1AXIB 2DQJL 3IXAB 4N1HB 5H35A 4LCCB 2X1QA 2LTQC 1YC8A 5F8RC 3KPRE 1D5ZA 1HXMB 1W0WA 4XMPH 1H3UA 1UWGL 4WI9A 2AJSL 1T6VN 4HHAA 1I85A 2BVEA 2QQNH 3NPZB 2M8XA 4NQCD 2W91A 2H26B 4PLKC 1AXSB 2F74A 1MIEL 3RY5A 3SKJL 3IFLL 3S3SA 1WLHA 5C07E 3MRDB 3GJEA 4PJFE 4GAJH 4LK4A 1JWMB 4KK8C 4KRNA 3SDCC 5F1NB 3QZWG 1LO0H 1NGYB 3BT2H 3EO0A 4X6DF 2BVUA 4A2MA 3WNPA 4NQEA 4UTBL 1F3DJ 2DQGL 4F9LA 3QIWA 4JCMA 3H9YA 5I1IL 1FAIH 2E7LA 2IBGA 1INQA 3DSFL 1CBVL 3EKCA 3TA3C 1RJLB 1BEYL 3BDXA 3QDJA 4YO0A 4G8GD 4TOYH 4NHCH 4TNVK 1M6OB 3FHQA 3OWEA 3SDDA 4NC2B 4YHOH 2FJHA 4RDQG 4GW5A 4AG4H 2JB6A 2E7MA 5FO7B 4D0DB 2WK2A 3U1SL 3DGGB 1A6UH 4PJDF 4Z95H 1CFQB 3ZT5A 1TPXC 3DVNA 1OAXH 1EGJA 1FN4B 4P2QB 1DLHB 3B3IB 1KLGB 2V7NA 4P59L 5DJ0A 1C5DA 1S8DA 4MXWL 4K3JL 1NAKL 4Z8FH 2EH8L 1LWRA 1QNZH 1TVBA 3CZJA 2OBGA 1DQLH 5I74C 4C56D 2Z93B 1U9KA 3KR3H 3LKSA 3UYPA 4L1DA 4APQD 3ZHLA 1P4IH 4KVNH 3ZDXE 3QAZC 4JKPL 1NAMH 4GAYB 3G9AB 1S7UB 2BXZA 4JVWA 4P57A 3MJ9H 3UZQA 2O26U 5C0CE 2Y6SC 5D6CA 1YECL 1UH2A 5LCVH 4ZUTB 2A6IB 4OZFH 4R0LA 4TUJA 4WFEE 3MA9L 3WFEL 4JFOA 3G5VA 2BOCB 5C08A 1NGPL 1IC7H 3MV9E 3WLBA 4HBCL 3L7FA 3SBWA 3V8CA 5TH2B 4RX4A 3H7LA 2OR9H 3MOBH 2QHLA 1CL7H 4FQXA 5E8PB 1N5AA 4Z7WF 3ULUC 5JXAL 2AERT 3C6SB 3QUXA 4RZCB 1WK0A 3TVMB 1NC4B 3MLWL 4OCXL 3DETC 3QEUB 4LHUB 5AAWA 3VFTB 5AEAA 3OG4B 4BSVA 5D7IA 3SDAB 4DW2L 3UCRA 4KH2A 3QXDB 3T0BA 1ZANL 1SEQL 1NBQA 2E7BA 2KQNA 2FRGP 1LP9F 3CLEH 3T3ME 4OJFL 3DXAE 4JY6A 4S1QL 4TVPH 4X4YB 5KBNC 3ARVA 2DI8A 5C09A 1YPZA 1IVLA 4OFKA 4JVUA 2H6PA 3P77B 3WE6A 3GGWB 3CCHB 3FTGA 5M94B 3O41A 4P2YA 3HC4H 4MDIB 5HJ3B 3W0WA 3D5OF 3GSNL 2D7PA 3QXUA 1MH5B 3HE7B 3T2PA 4HKXA 5DYOB 4R7NB 1EHLL 2CH8A 1EZVY 3PV7A 1R3JA 5DD3H 4LVHC 4FTVA 4OLEA 4P2RD 1FCGA 4GMSL 3NFSL 3MV01 1J0KA 5JOPD 4XNZB 1T2XA 3VGFA 4ENEC 5BZDA 5EBMB 4IRSC 5JHDB 1SBSH 2J6EH 3T0DA 2H8PA 4GBXA 5HDQH 1BGXL 3NH7L 4N0UA 2QQLH 3I9GL 1EJOL 4M5YL 4OLWH 5C0AD 4XPGH 4YXKL 4DTGL 5A2IH 3U30C 2P5WA 3WNKA 1J1XL 5DJZA 1X3DA 4M9OA 4TNVF 5HD8C 1OWRM 3HMWL 3AB0C 2OYPA 2P48B 3MZTA 5B3JF 4HUWA 2JJSC 3P0YH 3PWPA 5JIHA 1CWVA 5FCSH 4ZS7L 2YUXA 3LH2H 4PV9A 3VRJB 5GZND 3WKNA 3VXUE 4ODWB 4JRWA 4UV4L 5IBTL 1EEUA 3ALWA 1MY5A 3GO1L 3J8F7 1GOGA 1GGIL 3MRJA 5L0QC 3HCVB 1OGAA 1I7ZB 3P4NB 4YUEL 2VQTA 3TIDA 2OCFD 1P9MC 1UXSB 5FYKU 5T5FH 3ESUF 4KUZL 4NNYA 1JHKL 2ZUVA 3QXWA 4DOHB 2NTFA 3MBXH 2B2XL 4O58H 3KXFA 4WWKC 3FAXA 2MQ0A 1NJ9B 4UI2A 3VFUB 4RMVA 5CBAB 1F02I 3CVIH 2WLZA 3KPPA 4Y16D 2CXKA 2A9MH 3BQUD 4GW4B 4X5XB 3EDFA 4HCRH 4AQOA 5IB2B 3FQUB 3CFBB 1KB5L 1W72L 2MKWA 2NCMA 1SEBA 5I2IB 4PREA 2XXMB 4LLUA 3UTTD 1M7DB 3GBML 4PTUA 1FNSL 3JV5A 1UC6A 5E6ID 4WW2A 2R1WA 1Q8MA 4Q9QH 1JMZA 3SKNB 4HW6A 3CMOL 3DYPA 4WUUE 4HWZA 1D5MB 4Y5VA 3O4LD 1HHHA 3Q6GL 4P5KA 5ITBL 3BN9C 4PJ7B 1H5BC 3CVHH 3MACH 4X9HA 4Z7UB 4F80A 2CDEA 2VSCA 3GSRA 5DZLA 5F72S 1DCLA 3MRFB 3GKWL 3QH3A 3DMMA 1KJMB 2V9QA 5E94B 1EEZB 1GHFL 2NY5H 5FO9A 4RIRB 3L5IA 4PR5B 1MCWW 5T1MB 3MLXL 1LO5A 2QSTA 3DVGA 4NBXB 3VH8B 1UWXH 1CICB 4U31A 1A6AB 4EN3C 1TTFA 4I18C 3Q5TA 4U1KB 3TNNA 3WFHB 1Q9KB 1V7ML 5EUOF 2FL5B 4NQDE 1GZQB 2QBWA 1ZSDA 4RCAA 3RDTB 4LLDA 2WLYA 1EPFA 2N7BA 4OFDA 1OM3H 4JPVL 4LDLB 1N59A 4FQHA 5FYLH 2DIBA 1CFBA 2BRQA 5GHWH 5SWZA 2XKNB 2BNQB 1BFOA 1DUYB 3K1DA 5LXGH 4YDJB 2KZWA 3SE3C 1F00I 3C6LD 5GS2H 4KI5D 1NEZA 2WUBH 3TV3H 4M6NH 4ELME 3H42H 4N8CH 3EW3B 1IZJA 1U8LB 4JFDE 3OZ9L 3S96A 4D9LL 1BLNB 4ESKA 3I02B 4MQXC 5HHPA 5IW3A 3I3EA 1IL1B 3RWGB 1IKFH 3C2SA 4Y8DC 2VLLB 3VD4A 1N26A 3LS4H 1CFNB 4GRWB 5EULV 5DMGD 5ADPL 3WO4C 3F8UB 5EZLB 3O6LL 4TQEL 5MEND 1IFHH 32C2B 1ZGLM 2Y4SA 4GG6A 43CAB 5MERB 3MCKA 1RULH 1I1AA 2RCSH 2Y25A 3O8XA 5SWSE 3WJLA 1BVZA 4ZQKB 4EQ2A 5DJ2B 4TYUA 2VDMH 1KIQA 3GSQA 1H8NA 1HH9A 2J8HA 4QRTA 1NUNB 2NY6D 1ND0B 1KIUA 1RZ8B 3KDMA 3JTTB 3AY4C 4M5ZH 3WUWA 1U8KA 3L3IA 4WTZG 4ZUUB 2O5YL 4Z7UE 2PTVA 4V1DB 4XXCA 4OSUL 1AGDB 1KELL 3IKCA 3GHEL 1ETZB 1NUGA 5I8EB 4FQ1L 3T2NH 2ZOKA 4L3CB 2GTWA 4NBZB 5GGUB 2AAVA 3W9DB 3EDDA 2GCYA 5B38A 2VNCA 1QSFB 4NCDA 3C08L 3OKDA 2FX7L 2VISA 3C09B 3B83A 5DGQA 1Q1JL 2IH3A 4PJHF 4PJXF 3MUZ1 4HS6A 1JFQH 2UYLA 3QIUD 1AQKL 1GAFL 1YEEL 5EU7C 3MRPA 2F58H 5L88H 4Y4FA 4LHJB 5KSBA 4KDVA 5DR5H 5D96B 2E8YA 4P23D 3EYSL 3PDDA 1BJ1H 4S1SL 3VWKD 3PWLA 4R96A 1IGYB 3BFOA 4FS0A 4FA8A 4GMTH 2BNQE 4W4OC 4XBPA 3OJMB 2R4RL 3P0GB 1C7SA 1XCQA 2X4SA 4Y89A 2APFA 5E08H 4Z5RA 1UVQB 1UCBL 3D3VE 3HNSL 3ZHDA 4MJ5A 5KSAB 4X98A 1G6VK 2ORBL 3SCMA 3LMJL 3JXAA 3OKLB 3BX7C 3DV6B 5DUPH 4XH2B 1MI5E 2JELH 1YN7B 3LPWA 4XT1C 2YPKB 3OBAA 5IKCB 1A9BA 2W65B 3A6OA 3QDGD 5DTFA 2CLVB 3VJ6B 1MEXH 3TBTB 4RAVA 3WNMA 4KC3B 1AFVL 5E99L 1SQ2N 5J57B 3K8LA 1CLYH 3B9VA 5IB3B 1SJHB 2VDKL 3O6FD 2BVQA 2EYSB 2VB5A 4QNPF 1B9ZA 1MOEA 3UPCA 5ID1B 3T3PF 4KVCL 1J1OL 2L4OA 5BRZA 5L8KB 3MGTB 2YD8A 4MB5A 1OSPL 3BGAA 3T4YA 4YR6B 1OT2A 4PJIA 3T0VA 3T65B 2H9GB 1A4KA 5EPMA 2D7MA 1OLZA 4MX7A 4XAWH 3WIIH 2Q1EA 5BV7B 1QBMH 3FONA 4N1EA 4V1DE 4UUJB 4X80H 1FO0B 2UWEA 1Q94B 3F65A 3QIBB 1IBGL 1YNTA 2CIIA 3DBXA 5DMYA 5F9JB 5IFAL 4I0PC 1BOGA 5EO1B 4U05A 1TFHA 2XTJE 4OKVB 4TVPE 1PKOA 4YIQB 1RJYA 5BV7L 4HKJA 4OLXL 4MCZB 2OXGA 1GRWA 5D7LE 3PL6B 2NW2A 4WWID 4JO1L 2Z8VC 3CFKA 4G8IB 3QSKB 4MMZC 1HZHH 5JQ6L 4X99B 3R1GL 4MDJB 2EE9A 4XVUC 1Z9LA 1LHZA 1G1YA 4PLJC 1SM3H 3H9SA 5C07D 3OF6D 2F8XC 3U79A 3V4PH 3IDGA 4ZMAT 1NC2B 1ZLSH 1IGFH 1NBZB 5I15H 4QF1B 3WDHA 2Q76A 2EE3A 2H41A 2BNUA 2IF7A 4U1MB 1MFDH 1RY7B 3WLWC 2R2HB 4L4TE 1N64L 4J1UA 2VXQH 4HJJH 1MNUL 2CRIA 4D3CH 2MPAL 5DVLA 2HLAB 3BE1H 1JYWA 3MGOB 2FEDC 4G9FB 4QRPE 1MHPL 1JGDB 1NCUA 5F7WC 5AZEH 2ZNWA 5FIEA 1A7NL 3I85A 4GRLD 4IHOA 4X6BB 2ZCKL 3GBNH 3NZ8A 6CGTA 1U95B 4I2XB 5K59F 2FWOB 1AKJB 1OCWL 4MS8D 4NSKB 1NLDL 5D7SH 5DQ9A 2Q86A 3I6GB 5F89A 3RWDA 4Z7VA 1N0XL 3M8OL 4OFVA 2O61B 1AC0A 3VMOA 4XNQA 4MAYB 3VFSA 4DKFH 1IZKA 3RGVB 4UIMB 3K2UH 3FQWA 4RGNE 4UBDD 3RWJA 5DVOA 4GKSB 1XH3B 2R0LH 5IMOA 3PHSA 1RMFH 3ARGC 1E6OH 1ZT7A 1C8PA 2R1YB 4U1LA 1U2CA 2CXGA 4NFBA 4Y5XB 4G5ZL 4XPHH 3F5WB 1KPVA 3EDKA 3MJ8B 3HE6D 2NR6D 5AG9A 1CCZA 3HZVB 5CILL 1CD8A 5E8DL 2R0KL 2VDPH 1E4KC 3I6LE 1WV7T 1K3IA 3GIVB 5D1QC 1R24B 2YR3A 4P9HL 5C0CD 4LL9A 3BKJH 2XZAL 5C0DA 1PQZB 3ILQD 3TCXA 2Y07L 3L5WA 5CZVH 2I25N 5SWQB 3QPXH 3OB0K 4YZFE 4F37K 3QEQA 1T66D 4L8BA 1IGJB 3C5JA 4RMQA 4Y2DC 2IWGA 1CZ8L 3MV9D 5D7IF 1KXTB 4MLSA 3IFPB 4MQ7A 3SGDH 3UYRL 4AIZB 2VLRB 1GGCL 4LMQI 2HT4D 3VG0H 2W59A 1YPZF 4H1LB 3OR6A 1X5XA 3WS3B 2V2TB 1RZKH 4H25A 5DRNB 2KKQA 3AFLA 1BF2A 4IBLT 3KYMB 3GFUA 2YD4A 4HXAL 2YBRA 1RI8A 3MLRL 1OAKH 3NZHL 1SYVA 3DWTA 3BXNB 4WV1B 3BUYA 4XPBH 4LLMA 4P46B 4S2SA 1BFVH 2FATH 3L3KB 3P9LB 3DXAD 3P11H 1FFPB 1FBIH 1F6AB 1KCKA 3WD5L 3VXTA 1QVOA 2EDEA 4XGZA 3LB6D 1N5YL 1SJVA 5DRZA 4YK4C 3BRGC 4FQPA 1JUFB 5ACZB 5K9QG 3I3DA 3DRTB 4E42B 1X5GA 3PABB 3FFCD 4W6YB 2CK0L 3QJHA 4JY4B 3SO3B 1NCAL 3MUHL 5FYLE 1CK0L 2I9LA 1P84J 2IALB 2XN9B 2GUOB 3VRLF 3UC0H 1IGML 5GGTA 3ROOB 5ITFA 2DLFH 3CPLB 5L9DL 1QFWI 3B8SA 3Q2CA 4LKXA 5IQ7L 1IGIH 4PB9L 2OI9C 4IMKC 3C9NA 1DDHB 2HWZL 3QWOB 5HYJA 1MHEB 4YGVA 4YPGB 1IAIL 1VGEH 2I60L 4LCYA 2CLZB 4CMMB 1V7NH 1MCPL 1KENH 5D1ZC 4MZ3A 3IVKA 3DUSB 3QCUL 1S9KC 3TBYA 3GI8H 1UJ3B 3KPOA 1MLBA 6FABL 1N7ML 1T2QL 4BZ2L 4UILH 4K71B 2ARJB 2EXWD 1B0WA 4J3SA 5CZXC 1KLFA 5KG9B 3LQMA 2VLMD 2HT2D 4PP1C 1NL0L 2HKHH 1RV6X 3QHZH 1K6QH 4Q9CA 2BFVL 3OKOB 3WJJA 1L7IL 4WJ5A 1BFTA 2HFTA 4OCYL 5E2UL 4K23L 4LIQE 5HGAB 1ED3A 1E4XI 3VXUD 4PJCE 1A2YB 2VDLH 3KPLA 4OTXL 5IESL 1JZ3A 5I76B 1VA9A 3NFPB 1E27B 2XZCH 2ESVB 3ZKNC 3MLUH 3S5LB 2HVJA 2LFGA 3NCEB 4PJBB 3DUUB 2IAMD 3V2AR 4EN3A 1X4ZA 4I18A 4URTB 3B9AA 5FYJE 4L4VE 1FVCA 5BVPL 1ACYL 1MCWM 3UPAA 3L1OH 4PV8B 3Q5YA 4TULH 4WO4D 1KEMH 3ZTNH 5BQ7A 5DJAA 1MF2L 4M7KL 4Y4HB 1R0AL 1CDIA 4U1NA 4X4MA 5JQHC 2F53A 2FX9L 1OW0C 2HJLB 5HHOB 2WINA 5C0ND 4XZUA 1DBBH 5C6PB 2CUMA 2BNRD 3RL1A 1P1ZB 2OJEA 4XX1E 1U36A 3SDXB 1WISA 2AKRA 3A6CH 4X6EA 5MEPB 2ZUQC 3GMNA 1TJHH 3F62A 1T1ZB 4O2FB 3QJFA 1DE4A 3MRCB 1P69B 2ATKA 1AD0A 1WAAA 4IM8A 4WUUD 1IAOA 1C16A 4JFFE 3MJ7A 4AH2B 3SJVA 4UIKH 3C5ZD 4Q0XH 4C54A 4AEFA 1U8IB 1QKZH 9CGTA 1RQ5A 2VABA 5F88B 1AO7A 2DL2A 2YA2A 1FYTA 4PRHA 4KJYB 4GQ9L 1JHLL 1FIGH 2BCKB 1OP3K 4NP4H 2WBJA 4HIHA 1ZE3C 2DQTH 3B9KD 1U6AL 3MV7A 3OGCB 4HS3B 3MLTB 4KQ3H 3BP7A 4LFHD 5GS0H 1D5IH 2JTDA 3C2AH 3CZFA 3RJQB 5ID0A 5T33L 4LPVA 4NO0D 1A7QH 2WIMA 3UBXA 3D2UB 3VFPB 2XWBB 3WUZA 2VQ1B 4NQDD 4J6RH 5A3ID 3AC0A 4I77H 3MRIB 1ZVHA 4F7PA 3QNZB 2XNAB 3U82B 3QFJB 2GHWB 3AAZB 3B6SB 2BHUA 1K2DA 3K7UA 2EDNA 3O9WA 1PX4A 3RPIB 1XGPA 2EO9A 2MQ3A 2F54B 1ZHNB 2XV6B 3X14B 1F3JA 2DM7A 3BPNB 5GJTL 5DHYB 2YS4A 3G9VA 1NDGB 1OTUD 2ESVE 4JANA 5KVFH 1T0NA 4OLVH 3HFML 4W68A 4AEHH 4JFDD 4GG6F 3FQTA 5HHMD 1FNEA 5IMKA 1XEDA 1ZA3B 4KTDH 3QHFL 2QL1A 4FNLL 4P5MA 5DJYA 5GISL 2FIKB 3LKOA 2MOVA 2FO1A 2QSVA 1VGKA 2EIZB 1XGUB 1MIML 4Q2ZA 2AK1L 4NQSA 5IQ9A 4XC1L 3MRHA 3B2VL 4OZGA 3GSOA 5HGGS 3QUYD 1OB1A 3UTSA 1FL3B 3EOYG 4LGPB 3EYUL 1I1YB 1BZ7A 1K8IA 5EN2A 3AREC 3MLYH 1MHHA 5GRJH 4D9QE 5KVMC 2P8PA 2ZCLH 5H8DA 3GJFA 5SWSD 3FB7B 4M00A 1D6EA 1S7RA 25C8H 3QHTC 2IBZY 1CFTA 3F12A 1TTGA 2ED9A 3TBWB 3L3JA 5IHBA 1I1FB 1F8TL 5DD0L 2VUOA 4U1JB 2Z9TA 3HLAB 4P9MH 5L6YH 3MRQA 5FCUL 1OGTA 5GSVB 1I7RB 1KT2A 3LKNB 1LILA 3BKYL 4PGEB 3RX7A 4QHUB 3X17A 4PTTA 1KGCE 3QEHA 1HKLL 1YEKH 2PXYB 2ZG3A 4UV7H 2A77L 3OKNA 2OZ4L 4Q6IB 3LEYH 1EMTL 1A7BA 5C08E 1TCRA 1TVDA 2A6JA 4LRIC 5BS0A 1X5IA 1TZHA 5GPRA 1T3FA 5A43C 4FQ2L 4LARL 1JF1A 3OR7B 2IANB 3FB5A 5T5NG 3SQOH 5BJTA 1MUJA 2NX5A 1X7QB 2BDNH 2L7JA 3S36H 5FHBH 1DANT 1UXWA 1IC1A 3RTQA 5D72L 5HYSB 1IGCH 5HVFB 3QUMB 2FX8L 1A7PH 2BNQD 1FORH 4I0PA 2Z31B 5LKNA 2MSPA 1WF5A 4G43B 5TFSH 3VXRA 5F7EL 5KZCB 3IU4H 4YHPA 1N3NB 3IGAA 2Z8WC 4LQFL 3D3VD 5C09E 4QHKJ 1JRHI 2Q6WA 4P4RB 4QRRB 3DHJA 4PY8J 5FHAH 2X42A 2QSQA 3W0WE 1D5BB 2R8SL 5HPOA 1H9VA 4M3KB 5CWSB 3NCJL 1MI5D 4ODTH 5K9KB 4JZNB 3ROLB 5JLZA 1WZLA 5ERWB 2EYTA 4MA8H 3RBGA 4PJIF 4PB0H 1UACH 4DZBB 1VFAA 4FTVE 4P9HC 1G7HB 2NZ9C 3QZWA 2NY0C 3RNKB 4B50A 1FZKB 5B39A 1FYHB 5CINL 2DIAA 4HDIA 4ISVB 2GITB 2UWEF 3RIAK 1RU9H 5GZNC 1BD2A 3GM8A 1PFCA 1BIIB 4KKLD 5IHUH 5HYIA 2ZNXA 2QSCL 5K9OB 4UQ3A 5D5ME 1RUPL 5D1XD 2EEAA 1YEDB 1J0HA 1YEFH 2Y1VA 5I6XB 5C70A 1QRND 4U6HA 1NGZB 2P8MA 3MRRA 1P4LB 1K8DA 4JJHA 1FGVL 5JPNB 5IBLD 3RWEA 1A22B 2XTJD 3TYGH 3VXNA 4TVPD 3G6AB 1E4JA 1EDQA 3BN3B 3S7GA 4Y16C 2DMKA 3BQUC 3ULUH 3ARDA 3IAPA 3MA7A 5D7LD 3NABL 4NM4H 3HPLA 1BPVA 2DQIL 4B7IA 3TT1H 1XAUA 3HZMA 5C71A 4OM1L 3BEVB 3LN4A 3RI5K 5CCKH 3BHBA 4JJ5B 1EAPA 15C8H 1KN4H 4PD4K 1OAUH 2OMNA 1XF5A 4WHDA 4X7TA 3VFNA 2FZ3A 3ULVC 4OCRH 1NCCL 5E6IC 2QKIA 5AAMA 4MCYB 4J4PD 4ZAKD 5B8CC 1FFNB 1OGAE 5C0BB 5I9QC 4X7EC 1KJ3L 4MNQB 4L4TD 3GRWL 5KVDL 2H3NB 5C9JA 1EEYA 2OMBA 1Q9WB 3QCVL 1D5XB 3Q1SL 1A1NB 4G7VH 2PW2A 4LPXA 5ISZE 1DBAL 5ILTH 4LFHG 2OTUA 3ULUF 1BQHB 4QRPD 2OP4H 3G6DH 1HH6A 4JO2H 2OR8A 1RVFH 5CGMA 3VW3L 1KJ2H 2X4OB 2DKUA 3DV4B 1T83C 4KAQH 2GJ6B 3HG1B 3ILPB 4NN6B 3MNZA 4F7TB 1NFDE 2RFXA 4AT6A 4HUUB 4QRQB 1Y6KR 4ZDHA 1T21B 5EOTA 5DD5H 3RVTD 1CG9A 2Z8RA 5DDHA 1QFOA 3LKPA 2Y23A 4M1GL 1U3HC 2B8OT 3RA7L 2P7TA 3E8UH 1MAMH 4WY7L 3SQBA 4HIEB 1I7UB 1KBGH 1YDPB 3VWJB 5I73B 1YMMB 5IVXA 1CLZL 2H32H 2Y9RT 4PRAA 4RGND 5TQ0H 2IC2A 3IU3A 4KI5C 5ALBH 3DURA 2OSLA 2CIKA 1F4XH 4I5BB 5I1JL 3PP3K 3JTSB 5TGBA 4PRIE 4OGAC 2QR0B 1UM5H 3RPKA 3ZKXB 1J05B 3L9RA 1G1CA 2E3VA 1GOFA 3BKML 1INDL 2QADD 3I6LD 1IC5H 4Y5YC 4ONFH 3QRGH 1F58L 5E03A 2DKMA 5MP6L 4P2OD 2AGJH 5KSVA 5DRXB 2GY7B 4XPFL 5CEXA 3V6OE 1DLFL 3IDJB 1JGUL 5C8JA 1UENA 2JCCB 4TTGA 4L8SB 1QEWA 3KJ4B 3SGEI 4HT1L 2P42B 1TQBC 3JBG7 3R06B 2B4CL 2ARWA 5SWZE 2X9XA 4M48H 3KAAA 2NY6C 5TQ2L 1WICA 4G8FB 4KRPB 4OV5B 3RIAF 4D9RE 2FJGB 3FOMB 2VXTL 1YEGH 1S5HA 1Y18B 2LU4A 4YE4L 5ACMA 1NANI 2AEWA 3EOTH 5D1ZA 2YMXH 1T1XB 3E0GA 2ITCA 3HMXL 2BOBA 3GMMB 3RWIA 5I1HH 3W11C 4OZIB 1I9IL 1Z9SA 5F1IA 3UJIH 1NBVH 3VH8G 3V79C 4AIXA 1L7TL 5EDXA 2C7UB 1EK3A 3BDYH 2A83A 2DB8A 4RMSA 4JRYA 4J23A 5FUZL 2A6KA 4EDXA 1ZS8A 4EI5C 3RUGE 2DAVA 3BO8B 2APVA 1N4XH 2YUVA 5DLMH 1QYGH 2J8UB 5IHZB 2GFBB 3OXRB 3QIUC 4F3FA 2DM4A 3OKYA 1KG0A 1R3HB 4FQIL 4U6VL 1AQDB 1NGQL 1UM6H 3OPZH 4MSWA 3NACL 4MD5A 1NDMB 1CD1A 4HGWB 1ZVSB 1BMGA 4P23C 2UZIL 2ZUUA 4QHNA 3U7YH 1IAKB 5FYLD 5KVEL 3E6HB 2DWDB 2MMXA 4IIQC 5DUBA 4BFBD 3V5HA 3VXMB 4I3SL 4LSRL 3EJZD 4QYOA 5CHNA 5DMIH 4EUPB 1EX0A 4RMTA 2NY4D 2DTML 4NQTA 3OX8B 4JY5H 2APTA 5E00B 5IMMA 3V0VB 4AK1A 1RAMA 4N5ED 1CVRA 2NY7H 1T0MA 1NCTA 4O2EB 3ECBA 1A7OH 2BSSA 3BH8A 4NUJA 3KPSE 2X4UB 3IF1A 3ZT7A 4HK0A 5FV1L 4X6CE 3S37H 3RU8H 5I1GL 1G7IA 2X1PA 5HI3D 3HRPA 1QQDA 1ACZA 4QXGH 3PP3H 4HFUL 3OTTA 4X6DB 5KSBE 3SE8H 1RUAH 2OLDA 1RIVH 4XPTH 1HSAB 1JHTA 4LSUL 3ZDYE 2HH0H 2CLRB 4M7ZB 4LMQE 3W39A 3IDXL 4AENB 1AHWB 1M05A 2FJFB 3WIHL 1UYWH 4QRUA 3WS6C 3I75A 2DQJH 2RHEA 1QSED 4ALAH 4G8GA 2HKFH 3ZYOA 2P24B 2G5BB 3CUPA 1G7JA 2R4SH 1KTDA 3VFWA 3CDYA 1UZ6F 3CSGA 1PVHA 4QGTA 3VMNA 3TO4A 5DURB 5EU5A 3UEZA 5FYJD 3SKJH 1F4AA 4L4VD 1X5HA 5JO5A 3IFLH 3SN6N 3TYFA 4ZUVB 3DPBA 1YEJL 1CD9B 5TF1H 4U1SA 4RA0C 2HFGH 1KPUA 4GAJL 1XF3A 1EHXA 1Z0NA 4DFHA 4XHJD 4ETYA 5FO8A 4YDLC 5IJKC 4GT7A 3S36X 4UTBH 2DQGH 1UGNA 5BRZE 4JGUA 4C56A 4GKZA 5I1IH 2VKXA 4KV5E 4PGJA 3O0RH 2AXFA 1CBVH 4JM2D 5HI5C 1FAIL 1LEGA 1W8OA 4I48A 4C83A 2BC4B 5HY9B 3BMWA 3S9DB 5ICXB 1S9YB 1Z5LA 1PYWA 3MMEA 3MRLA 1C5CH 1Q9OB 4JFFD 3FO1B 3AMLA 4K8RC 1WT5C 3MJ6A 3EGSA 3KLSA 4TOYL 3L3OB 1TMCB 1XIWB 5EOCJ 3C60B 1G9EA 1QO3B 5D7JD 5SX5K 5D7KD 2NY3C 3N9GL 3U1SH 4YHOL 4G80A 4GRLC 5IK3A 5FGRA 2CDGB 4AG4L 1F3DH 4NNXA 1ZLUK 2WUCL 1OTSD 1A6UL 1TETH 1VFBA 4Z95L 1UQSA 3AREA 2RBLA 1OAXL 3BP4A 3FB6B 2X4QB 4Y19B 4RMWA 1H3GA 2ICEA 3T2OA 2C3XA 4MXWH 3ABZA 2VLJA 3GJFH 2ARJQ 2D7OA 5IB4A 2EDFA 1C7TA 5F6HI 4Z7WB 5I71C 1N8ZA 2WIIB 1NAMB 4F7CB 4LCIH 1QNZL 1A1MB 4NQED 3CU7A 4IOSD 3F7QA 3FO9B 3O3DB 4UBDC 3T09A 5EO0A 3DX6A 3KR3L 5GRZA 3OKMB 4JKPH 2NTSP 5D2LB 4KVNL 5K33A 2X70B 1LP9B 4OZFB 1NAML 5FAAA 1HILA 4E41A 2CQVA 4ZPTB 5FA3A 5EC1B 5IR1B 4YDKH 2NR6C 5C0IB 5LGHH 1G7MB 3NIGE 1CIDA 3MJ9L 1YECH 2DYPB 4OZGF 4LRIA 5JORA 4RSVA 2YD2A 5LCVL 3SDDD 5JW3H 1LDSA 4PJGA 1BQSA 1WCQA 2K1MA 3QQ3B 1A3QA 1JPGA 5FGSA 3N1QC 4Z7VE 2ZG1A 3ILQC 1QSZA 4P5TB 3JV6B 4HV8A 4KKCD 2Q3AA 1AXTH 2VE6A 3HI6L 1T66C 3MRKB 3I6KA 3HPJA 3W9EA 2OR9L 2XZQL 1CL7L 5JXAH 3BGMA 2J8OA 4LEOA 3ZDZF 4EBQH 2VLKA 1H8SA 5T1KD 2ZG2A 3EOBA 3D25B 3KYNA 1T1YB 3UP1A 3HRZB 4OCXH 1S7VB 1KIRA 5I17B 4DW2H 4WDIB 3O2VL 1O5DT 5I8KH 4DZ8A 4XCEA 4KTYA 4G9DA 4R4BB 4S1QH 1MY7A 2MNUA 2ZOLB 3MR9B 1LE5B 1K4CB 2ZWLT 4J3TA 3CLEL 2ZP0T 4TVPL 1KIPB 2M2DA 3BZDA 4JZJB 4U33A 4NN7C 5GGQH 1DVFB 4ZFZA 4MNGB 3LEVL 4Z0BH 3MV8B 1SHMA 1XR8B 1GGTA 3GSNH 4WHYG 3VGAB 4R26L 1NLBH 3BPCB 1KGCD 3HC4L 3O2DL 4PRPB 4HUNB 2NY2D 3LB6C 1GSMA 1G9MC 2LU3A 4QHMA 1LK3L 5C08D 1A6WH 1HHGA 2Z91A 1YUHB 4GMSH 5DD3L 3NFSH 5CGYD 3L3DB 2Z35A 4RX4D 3IJYA 3BZFA 4HXBH 2AJUL 1NKOA 5JOFA 4WW1B 1ZLUH 4NO5B 4ZFOA 1CGTA 1IM9A 5HGHB 3VI3F 2EIBA 5CBEB 5HDQL 4M5YH 2QQLL 1AGBB 3GEWB 5D2LE 3MQIA 4M02A 1XCTA 3U2SA 3QNYA 4YXKH 2NLJB 5ENWA 4JRXB 4OLWL 4XPGL 1J9CT 1U93B 4J8RB 1KPRB 1MHCA 2R1XA 3P9MB 2ENYA 4NRXB 3E6FB 1J1XH 4B5EA 3BQUA 3D87B 1ADQA 5EO9B 3MUGB 3KPMA 2J7LA 4CN6A 5C09D 4ODXA 3HMWH 1X4XA 1L6ZA 4UT9H 5HGDB 2DTSA 4X0KB 3CFJB 1I3RB 1ZHLA 1S3KL 5HHVL 3W0WD 3WCYA 5CD3A 4WI8A 2W60A 1FFRA 1MVUA 3S97C 1T20A 2EXWC 4DK3A 5CEYB 4I3RL 3P0YL 4R6UA 2VITA 2YK1H 4YPJA 1MJJB 4DGIL 2NYYD 3EYFA 4HFWA 2HT2C 2Y36H 4UV4H 4FTVD 1E6JL 4YBLC 4PJ8B 1YZZA 5JA8B 5CGTA 2EICA 4YUEH 4XI5C 4RDQF 2PF6A 3ES6B 2XKSA 1PKQA 1A1OB 3AXLB 2B4CC 4NGHL 1CDJA 2ZCHH 3QA3A 4GBXD 4OKDA 3IXTB 4NOFA 3TVMC 3MLZH 2EKJA 5E9DA 1FVDB 3PJSB 3V5DB 1ONQB 3MBXL 1BECA 2IAMC 4MNGE 3PWVA 1T83A 3MTRA 4JFYB 4PRDA 2HJKB 2AJYL 4NPYB 3CVIL 1U42A 1T1WA 1UKQA 1R5IA 2B39A 3UMTA 3GSWB 4HCRL 5EUOB 3C8KB 5DI8B 5DHVA 1FNSH 5EBWA 3LAFA 2E7HA 3ARFB 4PY7A 5C0NC 1U3HA 2GT9A 5J8OA 2HVKA 1TVHA 4OZHA 5AUMB 4XX1G 2CO7B 3HI1A 3CMGA 3CVHB 2RB8A 2Z4QA 3FZUD 5E1AB 2J12B 1MREL 3D0LA 3Q6GH 1CQYA 5IEHB 3PHQB 5AWNH 2IQAB 1B4RA 4WTXA 4GG8B 3T0EA 4XNZC 4A6YB 3GKWH 1OGAD 1HWGB 5EBLA 4Y0GA 1GHFH 1CXFA 4FQQA 3VDAA 1K9TA 1TENA 3C5ZC 5F93C 4JQXC 2XQYG 2C1OA 4JRXE 2ICWB 4Y7MA 2NY5L 5ALCH 3TZVB 2CDFB 4M7JL 1NSNH 1QLRB 4Z78A 5ISZD 3KWWB 3CDCA 3KXFD 4RWYH 4XBGB 3IETB 5GSRA 2ZSWB 3B9KC 2L0DA 4KGJA 1YY9D 4OQTA 5JDJA 1TZGL 2BVOA 2XQBH 3BWAB 4U6YA 3EUUA 4ZS6D 4HUXB 5IVXF 4EXKA 3LPFA 1NFIA 4OGYH 4JPVH 5HTSA 2DBJA 3T77B 4JKMA 1IARB 1QA9B 2DM3A 5EB9A 3FT3A 3P40A 1OM3L 5CLWA 3W5NA 5FYLL 3ARRA 5A3IC 1CFSB 1P7HL 1CFVL 4PGCA 3SY0B 3D48R 3VA2C 4PJAE 5T3XE 1YYML 8FABA 2KH2B 5GHWL 1UM4H 4NFDA 3D1MC 1WAAE 1IM3B 3TN0B 5IROA 1OSZA 5F9WC 5CJBA 2WUBL 3TV3L 3BIKB 4M6NL 3H42L 3NN8A 3ARBB 4N8CL 4MQTB 3EBAA 1FYTE 1RJZB 2GAZB 4F7EA 5HGBA 3DMMD 1OTUC 4TVSa 3TESA 5F3HA 5J4MA 3ZE2E 4K7FA 1S9XB 5DA4A 2AP2A 3MV7E 4EI5A 4CUCA 1QR1A 3LRSB 5LWYH 4NZTH 1IKFL 1JF5A 4PRID 3LS4L 3GMRB 4AJ0A 1ZHBB 4TQEH 4PJHB 3PV6B 4PJXB 4PJEE 5CSZB 4D8PB 5DHXB 3LKRB 1IFHL 2P45B 3BIAX 1DQQA 3UDWA 1T22B 5IB1B 2YD6A 5BMFH 5GGVH 3C5SA 1RULL 1WZMA 4P23A 3QUYC 2RCSL 1S7TB 2IG2L 5EUKA 1KTKE 1ERNA 2D4DA 2VDML 5L2KB 5BO1H 1WBYB 4J7RA 3TPUB 4RFEB 3NCBB 5SWZD 4P48A 4AQ1B 1INEH 3BDBA 4OI9A 4JO3H 4P4KB 3OB8A 1KELH 4D9RD 4FQ1H 1JK8B 4YC2B 4XP6H 1JIBA 5FYJL 4PP2A 3T2NL 2FDBP 4UQ2A 3OMZA 1IEBA 5CD5C 1OQXA 3ZYJA 2AK4E 5DC9B 4MJ4A 3H7BB 2IH1A 3BP5A 1WSST 3DHMA 1J0YA 3MLPA 3DGCR 5JNYB 1JFQL 3SHSA 1LK2A 2I26N 3L3HB 2HAZA 3F7YB 5CJOL 3SPVA 2MQCA 4X9IA 3STZB 5F7MC 4MA1B 3FRPA 3O8XD 4Q9RL 1D5ZB 3K81A 3WS6A 1H3WM 1R5WA 4HAGA 1IEHA 3RDTC 5INCA 4GMTL 3HUJF 4LLAA 2HG5A 1UCBH 4N0YH 5E08L 2GSGA 3U0PA 5JMOC 1J8HA 1DQJA 3LMJH 3KPRA 3N1PC 1BAFH 2ED7A 3OJDA 2OK0H 1L9NA 1G9NC 1OF2A 3ZSSA 2YOCA 5DUPL 3HC3H 1HI6B 5L2JB 2JELL 4DWHA 2ADGA 3QIWB 5BS0E 3MODL 1AFVH 3P4OA 3KPSD 4R4FL 2FH6A 2XPGB 5C07A 1DN0B 4TUKL 3OF6A 1INQB 3QQ4B 2VDNL 1FPTL 4JDVA 4LCWA 3C8DA 1ZA6A 2NX5E 1CLYL 1DQTA 2VZSA 3QDJB 4MD4B 1S78D 3RBSA 4CVWA 4KVCH 1J1OH 4YO0B 4Y4FD 5FYKE 5DJCA 4C57C 1JWUA 4GW1B 5HPMA 3WNLA 1QOKA 3V5KA 4EI6A 2V2WA 5LAXA 5IF0B 4ONGH 5E0QA 3BKCH 4KKLC 2FJHB 2JJWA 1KNOA 3ZE1E 1WT5A 4XAWL 3VXRE 3WIIL 1U8HA 5D1XC 4PRBB 4X80L 1B2WH 1FZJB 4GRLA 4UB0H 3P4LA 4H5SB 5MI0B 3TBSA 3S88L 3NCYS 4YDVA 5IT2H 1ZGLB 4NZUH 4ONOA 4BSWA 3SCMD 3V0AC 2Q87A 4X6FA 5AD0A 1WC7A 2XTJC 5JQ6H 3R1GH 5L8LB 2ERJB 3BEWA 1HZHL 2VR5A 2YSSA 1CGSL 2IADB 4GLRH 4PGBA 1FVEA 3IDNA 5J6HB 1FJ1A 3ALPA 2VC2H 1SM3L 1CT8A 2FLRT 3UJTH 3V4PL 1BJMA 1EZVX 5BW7C 4LVOB 2PNDA 4NKIL 2FHFA 3H0TB 3QUKA 1A0QH 5BRZD 2X41A 1MFDL 5AG8A 4TUJB 4ZAKC 2VXQL 1MNUH 1ZV5A 2MPAH 4HKZB 4HJJL 3IXAA 4LCCA 2X2YA 3BE1L 3L7FB 1HXMA 1A7NH 4N0CC 1CXHA 1IAIM 1PGRB 5AZEL 2FECI 2FH8A 2AXHA 1URLA 2A73B 3IFNH 4FQXB 5E5MB 2H26A 4X4ZA 5JW4Q 1CI5A 1AXSA 3RNQB 3WL9A 4NZRH 3QUXB 3LSOB 3MV9A 4QXUH 3KPNB 3MRDA 3VFGL 1MCBA 1JWMA 4K3DH 3D39E 3SOBH 1VFMA 4DKFL 3RVTC 3H9SD 4D2NA 3SE4C 5CFHA 4K94C 3O6ML 4LLVA 5I1LB 1YPZB 2H6PB 4KDTC 2EKSA 2R0LL 3T0AA 3WE6B 3FTGB 1RMFL 1E6OL 4G5ZH 4DAGL 3MBEB 2DMCA 3AROA 4PJGF 4RGNC 1RJLA 1P84K 4E5XB 4XPHL 2R29H 5E8DH 5DK0B 3UTZA 1U58A 4LNRB 3HC0B 1AIFB 4HIJB 1M6OA 1ULVA 4P9HH 1G6RB 4UOJA 4WHCA 4YHLH 4DN3H 4F15B 2XZAH 5FO7A 4D0DA 4HIXH 3BI9X 3BKJL 2QADC 4R2GD 3QXVA 4HWNA 3BZ4B 2HFFB 3DGGA 1CFQA 5CZVL 1MJ7H 3BRDA 4ETQB 4P2OC 3QPXL 2DJSA 5TE4H 3TH3T 5ICYB 1CZ8H 4JQIH 1FN4A 1DLHA 1OD7A 3B3IA 1KLGA 1NMCC 3ZE0F 1KLUB 4NNPH 1FE8H 1GGCH 4WFHD 4OLUL 2NQCA 4JGJA 2G75A 3TT3L 2P5WB 5I1CL 4DKAA 3VG0L 4PS4H 1RZKL 2Z93A 4HLJA 3S3PA 2WQRA 4HXAH 3MLRH 5F7DB 3IDMB 4UNTA 2IEPA 2ZPKH 1ADQH 1FRGH 2Z8SA 1U3JA 3PWPB 2FATL 5F1OB 5IGXH 4ACPA 3QG6A 3P11L 2WM0A 3CFCH 1FBIL 4ZUTA 4F7MA 5D2NE 2QJDA 3ULVH 5ABDE 1X44A 1G7PB 4MA7H 3MRJB 2BOCA 2SEBB 4YNYB 2XYCA 4HJGB 4AY0A 1PX3A 5C9KA 2MCPL 3QEQD 2CK0H 3OXSA 4GUPB 1NCAH 5FUCE 2QV2A 4JFHE 3HNTH 3RGHA 4PLNC 1SVCP 2PKDA 1ZKAA 3OAZK 1GIGL 3C6SA 4RZCA 4OD1H 1EBAA 3WUWG 3TVMA 2VQUA 1NC4A 4NYLB 4CMHC 3UC0L 3AVEA 3QEUA 3VFTA 3SDAA 3KLAB 1MFCH 3QXDA 2W0LA 1IGIL 2OQJA 3EJZC 1IAIH 2CRYA 3ULVF 4X4YA 4PREB 2NY4C 3NGBB 5B38G 1MCPH 1VGEL 3D85D 4Y5XC 5JPMB 1PZ5A 4N5EC 4JAMB 2P5EB 4WUKL 1V7NL 4OD2B 2COQA 1KENL 5IMLB 3CCHA 1N7MH 1T2QH 4JRYE 4BZ2H 2FYYB 4JCLA 5DHVH 2BSED 4O00A 4HWZB 1MH5A 1MLCB 4LASH 3BZEB 2ZJSH 2EIDA 4Y5VB 5DYOA 3R8QA 1TNNA 5HDOA 4R7NA 4W6XB 5JW5B 2CDEB 5HI3C 4U7KA 1L7IH 2NY1B 2BXYA 3DYOA 3QHZL 4JFEB 1K6QL 1CDUA 5INDB 2DQFB 4WUUA 4XCCH 1RUML 1OD9A 4AYFA 4H0IA 3NBNA 3C5ZA 4OTXH 4JQXA 5EBMA 4F9PA 2VUYA 1VEOA 4JPIB 2C4FU 2C9AA 4PJ5E 5D93B 4PG9B 4PY8I 2NNAB 1K4DB 4XXDB 2BP3A 1OPGH 2XZCL 3MLUL 4FFZL 5HYJD 3UTOA 3MNWB 1EJ6A 4OZHF 5EFIB 4JFZH 2Q8AL 3OAUH 5F1KC 3MRGB 4WV1C 3TBVA 3L1OL 4M7KH 4TULL 1KEML 3ZTNL 2V5YA 4NO0A 3UZVB 5FF6A 3DNKA 4KI5F 4OLYH 1FNGB 3P30H 4NQDA 4WI3A 4IJ3B 4DKEH 1F4YH 5FXCH 4XHJC 5E8EA 4GKOA 4ODWA 2P4AB 3A6CL 1HIML 3R4DA 1TJHL 2R23B 5KOVC 4KHXL 4NO2A 5CAYB 3TGXA 3HCVA 4MXVE 5FB8B 4JM2C 1I7ZA 5J0BA 3QUZD 1I3UA 4K2UH 3VXSE 3LDBB 1UXSA 4YHKH 4Q0XL 5EBGA 4KFZC 1QKZL 4GQ9H 2CO6B 3V8OA 1M7XA 1QLFB 3MCKB 3LQAC 4P3DB 1I1AB 4NP4L 4EN3D 1NJ9A 1UH4A 5D7JC 2DQTL 3JV0A 3VFUA 4UMGA 4KQ3L 5C2UB 5GS0L 2JE8A 1D5IL 4GW4A 4X5XA 1HHKA 1QHPA 1HQRB 2VZTA 1B0GB 3FQUA 3CFBA 1OTSC 4NKMB 5I2IA 1A7QL 1RZFL 1M7DA 4JHBA 4OBRA 4X8JB 2P46B 2V9RA 4S11A 4XNYH 4IS6B 3IKCB 3U6RA 5J12C 1R6VA 3SKNA 2GTWB 1P7QB 1NMAH 1D5MA 2X10A 4CVUA 4X7CC 1BVKB 2VISB 4PJ7A 1DUZA 4Z7UA 1ZLWK 3MRFA 3SJVD 1KJMA 2H2PC 3FN0H 5KVFL 4X5WB 2VDRH 2PO6B 4RIRA 4OLVL 4G8EB 5ESVA 4AEHL 4PR5A 3MRPB 1AO7D 3QHFH 5T1MA 1FYTD 5FGCB 3VH8A 4G6ML 1CICA 4KTDL 2WBJD 4E9LA 4I8DA 3MV7D 5EC2B 3KS0H 4MJ6B 4L1HA 3SDDC 1Q38A 3PWLB 4R96B 4U1KA 3WFHA 1Q9KA 4JO4H 2X4SB 4M6OL 2YPLB 3LPGA 1GZQA 1RSFA 2VLJE 3RDTA 3VD9A 1A9EB 4KKCC 1D9KB 2F5BH 3L3GA 3MLYL 5D71H 5GRJL 2XKNA 2VXSL 2BNQA 1DUYA 2VJXA 4YDJA 5IP4A 25C8L 4HD9A 3LIZL 1PLGH 5DD0H 5FFLA 3O9WD 1A9BB 3SDCB 3VCLB 1OWWA 5DTFB 5FCUH 5I1DB 1U8LA 1GH7A 5E8NB 4LKCB 4P9ML 5L6YL 3BKYH 4JG1L 1MSPA 2E7CA 4YBHA 3VFVB 3I02A 2A77H 3GNMH 1SJEB 1IL1A 2XZZA 5BVJB 1YEKL 1VEPA 2PYFB 3ORJA 4QHLB 4EVNB 1J0IA 1CFNA 2W0FB 3O45A 3TA3B 2AK4D 4XBEH 5EZLA 3RKPA 2D7QA 1VPOH 2NY2C 4YWGH 32C2A 1EO7A 5FECB 3KYKH 3VA6A 43CAA 4GSDL 4P49A 4QKXB 5MERA 5E2TH 2C4FT 1GL4B 3FCTB 2UWEB 4ZQKA 3TC9A 5DJ2A 5CGYC 2VLKE 4K8RH 1K3ZA 1ND0A 2FX8H 5A2FA 1RZ8A 4Z18A 3JTTA 4MJIB 5I19H 4YDIH 3AU1B 2CSPA 1TPXB 1A7PL 4NHUB 1FORL 4ZUUA 1UCTA 3BIBX 5TFSL 4V1DA 3T0WA 3T08A 5E2WH 1U8JB 1AGDA 1KCLA 3IU4L 5I8EA 1ETZA 2N4IA 4PJFF 4Y4KB 5HVHC 4L3CA 1I4FA 1QSFA 5FGCE 2BVTA 5I74B 3CFIC 1MCFA 3IDGB 5FHAL 4ONHB 5DEFB 3PP4L 3IAGC 3ZMRA 1JGVL 1FSKB 1HCFX 2YZ1A 4U0RC 4ODTL 2ADFH 3QXTA 4NDMA 4DK6A 4MA8L 4PUBH 1QUNA 4PB0L 5CIPB 5BS0D 5CINH 3PGFH 1KTLB 1F4HA 3VXPA 3L7EB 4GOSA 2NYYC 3WEXB 1XGRB 4LLQB 4WEBH 2NX5D 1E4XL 1RU9L 3Q48A 4OD3H 4KDWA 1M4KA 1HOCA 1IGYA 1E0OB 3IJHA 5IHUL 4RAHA 3RTQD 4I9WE 3INUH 2YC1B 4H26B 1S7SB 3L95A 1MWAB 1UVQA 4I0PD 4PJ9D 3VXRD 4WEMB 3RWDB 5KSAA 4QRPA 2GY5A 4HK3N 5CSBA 4XNQB 3VFSB 3X3GH 2AI0L 1XF4B 1I3GH 5IVNA 1OP5K 4Q97A 4XMKL 1YN7A 3LZFH 4L3EB 1H3TA 3TJHD 5IKCA 1DBKH 3NABH 3RWJB 2W65A 3RIFK 2DQIH 1S7WB 2CLVA 3VJ6A 2PXYC 4PLJD 3UXFA 2CD0A 4JDZA 3TT1L 1MPAH 3PQYB 5F96H 5CCKL 3CJJA 2D03H 3CXHJ 3ZDXF 1KPVB 2W1NA 4KDTA 1KN4L 3TNMA 2EYSA 1OAUL 1UKTA 4WI7A 4OCRL 5ID1A 2ZUYA 3FZUC 5DA0B 1I8KA 1BD2D 5E6YA 3MGTA 2Y06H 3UTQB 4MJIE 1KJ3H 2R69H 4YR6A 4YAQB 2VZUA 3T65A 2H9GA 3ZT6A 1PKQE 4ZFGH 2E27H 3T04D 3AS3A 2JK5B 3GB7B 4K55A 5KVDH 4LVHB 4HZLB 4JZOB 1AH1A 1LD9B 4MD0A 3WV0A 1FO0A 5E9DE 5AYUH 1KJ2B 3IJSA 1DBAH 1Q94A 3QIBA 4CL7A 4QOKE 5F9JA 3EFFB 1G9MH 4G7VL 5EO1A 1FNLA 4LAJH 1G0YR 4HUMB 4OKVA 5ILTL 3WFCL 4YIQA 3WKMH 5I18L 3RFZC 3G6DL 4MQ7B 1LDPH 4IRSB 4MCZA 3BH9B 2X4PB 2B20A 3PL6A 2YZ8A 1O0VA 5J9PB 4G8IA 1YY9C 3FFDB 4KAQL 2MKLC 4X99A 4MDJA 3ARDD 4ZS6C 4LPWA 3ZTJG 5DD5L 3V52H 1VKXB 2H32B 4M1GH 3BUYB 3D39D 3T3MF 3PXHA 3ZLQC 3G5YB 3QI9D 1WIOA 3E8UL 5GQBA 1MAML 4WW2C 1NFKA 3AB0B 4U1MA 1CLZH 2R2HA 3BPOB 5EH1A 1VDGA 1Q9LB 3T0EE 1QVOB 3B5HA 3NPSC 5TQ0L 4O02H 2PR4L 3RVVD 5GRWA 3MGOA 1FLRH 1JGDA 1U91A 5C0JB 3DMMC 5F7UA 3BKMH 1F42A 5T5NF 5DJ8A 5L0QB 1UM5L 4X6BA 1XF2B 3VXQB 3H3PL 2FWOA 1AKJA 3G5XB 4FZ8H 3ULSB 1A47A 4NSKA 1LEIA 4ONFL 3QRGL 4U4BA 3HR5B 3P4MA 1QFHA 3BPLC 1CF8H 1GC1C 3QISA 2O61A 5E2JA 3PQYE 4MAYA 5F7KC 3WDJA 1VSCA 1RZJL 2EH7H 4WWKB 1JYNA 3SDYH 1ZT4B 5EU3A 2B4CH 4XNMB 1OP5H 4K07A 3KG5A 4R9HA 2ITDB 3ETBF 2FR4B 1A7RH 2D7TH 4UIMA 3V6OC 4X8XA 4M48L 4GKSA 2BJMH 5GGTL 1XH3A 2VXTH 3IVKB 4JM4L 4YE4H 3RHWF 5I30H 1P4BH 1YEGL 1OQOA 3KPOB 43C9B 4Y5XA 1XGQB 2VN4A 3HMXH 3MJ8A 5BOPA 3EOTL 3HZVA 5E2VH 3CK0L 5KN5B 2HN7A 1UB5A 1I9IH 2BMKB 4Y1AE 1X5YA 1L7TH 5C0RH 2I24N 2YXMA 5I1HL 3GIVA 4NUGH 3UJIL 1NBVL 1R24A 1JZ5A 2CUIA 2M26A 5GS1B 3S3JA 1H5BB 4ODHH 4ZXBB 2DRUA 1PQZA 4S0SD 3X11B 3UROR 3UX9B 1FFQA 2B0SL 5SWQA 3VDCA 5DLML 4TPRH 2XI9A 1IGJA 4FQIH 4U6VH 3F7PC 3G04B 3G6JE 5ETUB 3TH4T 3IFPA 5KJRH 1UM6L 4IDJH 1E4WH 3OPZL 4EIGB 1P6FA 4QT5B 4AIZA 3O8XC 2VLRA 3K8MA 4JFHD 5KVEH 1BQLH 4KWUA 3O6KH 4H1LA 3CSYA 4XCNA 2V2TA 3NCYP 5DRNA 2YEZB 3OGOE 3T2QA 5HHNB 2IMNA 5BQ7B 3THMH 5DJAB 1DJSA 3KYMA 4Y8AA 2DTMH 2F53B 1FDLH 5DMIL 3MBED 3F7VB 4WV1A 4JY5L 1VACB 4P46A 3DX7B 1J8KA 3L3KA 4XXCC 3P9LA 2OJEB 4LPUA 1FFPA 1A7OL 3O2WL 1F6AA 4X6EB 4PGDB 2BZDA 3CSPA 3QJFB 2ADJB 4JRYD 2YN5A 4PP1D 4NQUA 3S37L 3RU8L 1JUFA 5ACZA 3DRTA 4QXGL 4E42A 3OKEB 2HT3D 4JEGB 4YBQD 2DMBA 1KYOJ 3K4ZA 4LSUH 2OTPA 3ZHKA 4MHHI 3SE8L 1RUAL 1RIVL 3ARYA 4I13B 4JY4A 4XPTL 5FM4A 2K9UA 1LE9B 1BZ9B 1S78C 3IDXH 4PRHB 1RIUH 4OF0A 4Y4FC 2P43B 1R3LA 3WIHH 4L8SC 2XN9A 3KJ4C 3PE9A 1J5OH 4KROB 2GUOA 3HI5L 3BP7B 1SYSB 4JFFA 1BQUA 1UYWL 4XB8A 2BVPA 2R2EA 3CZFB 3ROOA 2YA0A 4ALAL 2HKFL 1J8HE 1A21A 4JGMA 1DDHA 2IBZX 4PJ5D 5D7JA 2R4SL 1MHEA 4YGAB 4YPGA 4RBPH 4BZ1L 3DUSA 3SCMC 2D3VA 1A6TA 1UJ3A 3GSVA 1YEJH 2ARJA 4AEIL 5CEZE 5TPWH 1FH5H 1UB6B 3Q6FB 2RIKA 4X4XA 4LCWE 5KG9A 1L9MA 5TF1L 3VFRB 2HFGL 4ELMF 2CGRH 5B39G 4BQ6A 1KV3A 3DIFB 4M1CD 2LABA 5E7BA 4YHIA 5AYQA 3MXWH 3OSKA 3OKOA 3FN9A 2G2RB 5I1KL 1FNEB 5F1SA 3O0RL 2HP4A 4LSTH 2X44D 1F4WH 1A2YA 4N90D 2GKIA 4ZUSB 4JDTL 3BISA 3RVUC 4QEGA 3WSQH 3X13A 5I76A 3Q3GA 1J11A 1C5CL 3NFPA 1E27A 1Z2KA 1D3CA 2ESVA 4IDLA 3VXSD 1T03H 2A1WL 3S5LA 2W07A 2P44B 3DUUA 4KU1A 3UTSB 3N9GH 1FGNH 1ZOXA 4WGWB 4NN5C 1K8IB 1HHJA 5EN2B 2AQ1A 5J3HC 1BZQK 4FFYH 4PV8A 3TLRA 3TO4D 5JIPA 2WUCH 2KL6A 3GJFB 4L3AA 4TTDD 4F8QA 4Y4HA 4KMLB 1S7RB 1TETL 2HJLA 4HBQA 1KC5H 3F12B 3OQ3B 4FN0A 1U8MA 4ORGB 1P1ZA 4Z7UF 3W2DL 1XF1A 4G6FD 5T1KA 3SDXA 4E0RA 3QO1B 1AD9B 3MRQB 1OGTB 2CKNA 5EOCH 1ES0A 5MEPA 1WVZA 4PBVC 4LCIL 3BP6B 1T1ZA 4O2FA 4WU7A 3O3UN 1QHOA 3MRCA 4WFFE 1G9NH 4NC1C 4BH8B 3SEPA 2DICA 4RAUA 3RL2B 5IHLB 4LP5A 1A14H 1DN2A 1U8IA 1IT9H 1T3FB 4RISL 5F88A 1TNMA 4YDKL 1MCCA 5CP3A 5LGHL 4KJYA 1WUNT 4Z9KB 3UZEA 3FB5B 2BCKA 1EVTC 4N8VG 4ZO9A 1U8QB 3PF2A 3OGCA 3S34H 4HS3A 1EFXB 3MLTA 5JW3L 4CBPA 4C4KO 4R2GC 3PUCA 5JTWA 5T3ZE 4U1GB 2RR3A 3WIFB 3HI6H 1P6AB 3ARED 5D8JL 4LGSB 1AXTL 3D2UA 3VFPA 2XWBA 2XZQH 5K93A 5EG6C 2VQ1A 1HDMB 4K7PL 2RAMA 3OJ2C 2VLJD 3MRIA 3PDGA 4KPHL 3QNZA 5GRUH 5D70H 1N6VA 4EBQL 4I0CC 5HDBE 1JGLH 3O2VH 3AAZA 3B6SA 3FJTA 5J11B 2WBKA 12E8L 4LVEA 1PEWA 3RPIA 3KLDA 4N1CA 4NT6B 5I8KL 5LGJB 2F54A 1ZHNA 3X14A 4R4ND 5JLZB 1ZMYA 1IJ9A 1NUFA 3GSNB 1NDGA 1ZLVK 4JFXB 1VB9A 4X5LA 4Z7OE 4E41D 1VFAB 3LEVH 3GSXB 3QZWB 5GGQL 1G0XA 4M7LH 1RUKH 4O2CA 5IBUG 4YX2L 1Y6NR 4R26H 4U2YA 4Z0BL 2PCPB 3O2DH 3IYLW 1NLBL 3I2CH 1MAKA 4N9GB 2EIZA 2NXZD 1XGUA 3GMPA 3ZKSD 1LK3H 4MB3A 4P2QE 4U0QB 4M8QB 2ZSVA 1A6WL 3LN9A 3H2WA 5DJDB 5SX4H 3U4EB 2ZKHH 1FL3A 1DSFH 1I1YA 2IBBA 3GDBA 4U7SA 4IMLB 1ORSB 3MRRB 4XWGH 2AJUH 2OS7A 2EDKA 5EU6B 2ED8A 3FB7A 3FRUB 4HXBL 1G0DA 5EZIL 4X9GA 4UT7H 2VLKD 3RWEB 3PHOA 5E5RB 5TDNB 5D5MA 3VXNB 5I75B 3TBWA 2PYEB 4M7LT 1G7LA 2W0KA 4U1JA 2OZ4A 1T5XB 3DTXB 3HLAA 3CC5B 5GSVA 3CXDL 1I7RA 2VIRB 4UINL 2IQ9L 3LKNA 3BHBB 1DEDA 1KULA 4PGEA 1IQDA 4QHUA 5DVKA 2R56L 2PXYA 3BAEH 3ARGB 3BYYA 3KNBB 1BM3H 1GCFA 5T1DL 4Q6IA 1S3KH 3FB8B 5HHVH 4UT9L 3D69A 3CH1B 4POUB 4K94H 1ZXQA 2NZ9D 4G3YL 2NY0D 4I3RH 2Y72A 1IRAY 4DGIH 3RZCB 4HWEH 2KPNA 2IANA 5JA9A 5L8JB 2YK1L 1E6JH 5D1QB 3K4DA 2Y36L 1TCMA 4L29B 5H94B 4P5TC 4TUOA 1QBLH 4NO3B 2NXYD 4KXZH 3MLVL 4FABH 2XACC 3JWOC 3QUMA 4UOW1 1RZJC 4NGHH 1IM9D 4LPCA 4Y2DB 4G43A 1CDCA 2ZCHL 4I9WD 5FYJU 3EDJA 4H8WC 1FG2B 3MLZL 1N3NA 1KB5B 1W72B 5ISZA 2L7UA 4MVBD 2ZUWA 5EOTB 1ZWIB 5EA0L 4K3GA 2AJYH 3V7MA 4ZNEA 1MELA 2R0WH 3VG9C 2F8VA 1D5BA 2G9HB 4JZNA 1PY9A 3ROLA 5H2BB 5ERWA 3DLQR 4RFOL 1NFDA 2CR3A 3IU3B 3ULVD 3QXAB 3CLFL 2Z0BA 3U9UB 3RNKA 1FZKA 2DQCH 1Q0YL 1ZHKA 1MREH 4ISVA 2GITA 3S98A 1BIIA 3PIQB 2D7NA 5CMAB 5JHDE 3GUTB 4PBWD 3WJJC 5K9OA 5AWNL 2HTKC 2UZYB 2VAJA 3GMLA 2PYEE 5F6HJ 1W0VB 4MQSB 3QUZC 3BWUC 4J3UA 4UAOB 1NGZA 1ZEAH 1TZIA 4M7JH 4YZFF 1P4LA 3DECA 4LQ1A 5ALCL 2E9IA 3BOVA 4PRIA 5E9DD 4WHYH 5DFTA 5B4MC 2YD1A 1NSNL 5JPNA 5C0GB 4QOKD 1QEWB 4JFPA 2BY1A 4RWYL 3G6AA 1TZGH 2A9NH 2OI9B 4MB4A 3HAEG 2XQBL 4N68A 5LG1A 2XQYK 3V6OA 3BEVA 4WU5A 4OGYL 4JJ5A 3TJEH 1U3HD 5D1ZB 4MJ2A 1CFVH 3QYCA 4KUCD 4NCC2 4OFPA 3W82A 1YYMH 3LD8C 4AL8H 5BCAA 3RWIB 1UM4L 1YN6B 3HKFA 4MCYA 1FFNA 3H3KA 5C0BA 3WFDL 1V8HA 1YEHL 2PTTB 1IEAB 3CFEB 4MNQA 4UDTA 3T0ED 2H3NA 4OGAD 1Q9WA 4DOHE 3HS0B 1D5XA 4L8CA 1A1NA 4XP4H 5FV2A 5E4EC 1BQHA 4HPOH 5JDSA 5GGVY 3QBTB 5DGRA 3QDMB 4WI5A 5E6ZA 5LWYL 4NZTL 1QFPA 2WBJC 3MCLL 3RUGA 3RJDA 3DV4A 1SY6A 2GJ6A 3HG1A 3ILPA 5DD6B 1V3LA 4F7TA 3QG7L 5DUBB 4HUUA 4QRQA 5BMFL 2IG2H 5GGVL 1T21A 4LIQH 5IMMB 1AJ7L 2V7HB 4NQCB 5BO1L 3HUJB 5KW9L 2J2ZA 5FDWB 4PJ7E 3VWJA 4HIEA 1YDPA 4MGXA 1INEL 1QBAA 4JO3L 2VDOH 2W9DH 4HK0B 2A74B 3O9WC 4HWBA 5FYJH 2D0FA 3W11D 4P3CH 4WNQB 4XP6L 4HWUA 4I5BA 1QQDB 5DQDH 2ZUQB 3JTSA 3V4UH 1S9WB 4PPTA 3N1FC 1J05A 5ANMB 4Y1AD 4EI5D 3KPSA 2YUZA 4GAGH 5IM7B 5A16B 3TZVC 1S9VB 2IPKB 4YHYB 4M4RA 1NMBL 4JREB 4X6CA 4PJCF 1Z9MA 5CJOH 1R3IH 2AJ3B 5DRXA 1BREA 4G8GB 4M93C 3IDJA 4Z6AT 2JCCA 4XCYA 4Q9RH 3MC0A 3CUPB 4L8SA 4DCQB 4POZD 3IRZA 4LHQB 3LQAH 4OV5A 2FJGA 3FOMA 2ADIB 3QCTH 4O5LH 5IFJB 4CU6A 1Y18A 4N0YL 4RMRA 2W9EH 4KK6D 2FEEL 4HUVB 1YY8B 2Y7QB 3UTPE 1RFDH 4U1SB 3EOAB 1T1XA 1BAFL 2OJZH 3I50H 2ZUXA 2OK0L 4TSAL 3GMMA 1MCIA 3ARBC 4OZIA 3LEXB 1LGVA 4POYA 2VZVA 3QDME 4GRWE 3VXOB 3HC3L 1ZT1A 3LS5H 5FK9B 4C56B 3MODH 4JM2F 4R4FH 4U1IB 3WN5B 3VGEA 1F11B 4TUKH 3NIDE 2AXFB 2VDNH 4APQB 3T8XB 3BO8A 1FPTH 2XA3A 2J8UA 1MCSA 3OXRA 3UYOD 3L5HA 2IMMA 4WHTB 4CDHA 1YC7A 4JN2B 1R3HA 5DJXB 4W6WB 2QTEA 4V2CB 4D0CB 3U4AA 1NDMA 5A2LH 4HGWA 1ZVSA 5DWUL 1WBZA 4DQOH 2G60L 3T4AB 2VOTA 1U8NB 4ONGL 1XGTB 1IAKA 3BKCL 3E6HA 1W8NA 4ZNCD 2HTLD 2N56A 4DUXA 3S6CA 2JIXD 3RTQC 1G84A 5T1LD 4IRJD 4EUPA 3S88H 1B2WL 1CXIA 1J8HD 5E00A 4UB0L 3V0VA 4PJ9C 1U8PB 3O3EA 2ICEB 1A5FH 3KPRD 5IT2L 1EERB 1QSFE 4NZUL 4NQXA 3WXWH 4O2EA 1WBXB 4HLZG 4O51A 4O4YH 5IB4B 5ANME 4HC1A 1EGJH 5JR1H 3VD7A 3O3BB 3RAJH 2BSRB 3TJHC 1CGSH 5EO0B 3HZYB 3CIQA 1Q0XH 1A6PA 5CEZD 4LCWD 2VC2L 1KCRL 4NKIH 2JJVA 35C8L 3UJTL 1HSAA 4FQLH 5HI5D 3RKDD 1HNGA 4WI2A 2CLRA 5IFHH 3NCCB 4KQ4L 1A0QL 2EEBA 4CRPA 2AW2A 2MTPA 2EE2A 2R15A 4AENA 1AHWA 2FJFA 3P0VH 5MEOB 1GYAA 3MRBA 4K8RD 4PJGB 1BBJB 1T7XA 4DVRH 1JN6B 1NBYA 4HH9A 5CP3H 4IOIB 5F3BB 4CNIB 3GSUA 1A6ZB 2P24A 2G5BA 4AM0B 4P2RB 5HHXL 2NY3D 2YKLH 5B3NA 2GTZA 2FGWL 3BGMB 3IFNL 1CXEA 4NRZB 4JR9L 3FT2B 4NZRL 3KYNB 4GKNB 1JVKA 4LSDA 3VFGH 3VGDA 4A2LA 4QXUL 3QEGL 2JB5H 5C0AB 4DZ8B 4ZOEA 2XFXB 1PDKA 3RX8A 3ARDC 4K3DL 5ELIA 4G9DB 3CFDB 5HXMA 3SOBL 5FKPB 4ZPVB 4XWOD 5C86A 3O6MH 2O5ZH 2X9WA 5FM5O 3PWJB 1F45A 3O3AB 5JHLH 5K9JH 4ZFZB 5ACLA 3QI9C 3LOWA 5JW4R 1C5BL 4DAGH 5HSFA 3ZSTA 5I66A 2BC4A 5HY9A 1WFUA 4WFFD 5ICXA 1S9YA 1Q9OA 3OJVC 1AGFA 2R29L 3RVVC 3FO1A 5H37G 4HKBB 4HF5H 4QHMB 3RX5A 3L3OA 1XIWA 3VI4E 4TSBL 2FO4B 1QO3A 1OLLA 2X6MA 1A02N 1JWSA 4DN3L 4YHLL 2XT1B 3TIEB 1RIHH 3GIZL 4XRCA 5E70A 4HIXL 1H15B 4WFED 2C3HA 1K85A 1MJ7L 2DF3A 1CU4H 3PWUB 5TE4L 5ICZA 3FB6A 2RQ8A 2X4QA 4JQIL 4M62H 2HYMA 2X4NA 2DKSA 5T3ZD 1E28B 4H88H 4MA3A 4XP9L 1PW3A 2AEPH 1X4YA 2ERJC 2UZXB 1K5NB 4OLUH 5ENWB 1AI1H 2BHYA 1NKRA 1YQVL 3JZ7A 1MHCB 4NNPL 3TT3H 4ZFOL 1FE8L 4R3SB 2WIIA 4LSSL 4Y16B 3WHXB 4F7CA 5I1CH 1A1MA 4OIIL 3QO0B 3BQUB 4GXVL 2QLVB 5FA4A 4F2MB 3FO9A 2E9WA 1CTNA 2OL3A 4Q74A 4PS4L 5E95B 3OKMA 5GGSA 3E3QE 1RHHB 5D2LA 3UTTB 1I8MB 1LP9A 4OZFA 4G9FE 3D85A 4OLZH 1DEEB 4X7DC 4ZPTA 2E6QA 4P2RE 2ZPKL 5EC1A 1ADQL 1FRGL 5IR1A 5E6IB 4PGZA 4OI8A 1G7MA 1TIUA 3LQZA 2DYPA 3U36A 5IGXL 1G7QB 3EYFB 4HFWB 5JOPE 5B8CB 4I2XE 5CKGA 3D18B 3CFCL 3EO1B 4CN4A 4Z7NE 3GMQA 3O4LB 3ULVL 5C0EB 4MA7L 3QQ3A 4W70A 4LBEB 2MCPH 4P5TA 5D2NC 4WTWA 5D5MF 3IFOB 5CZKA 3JV6A 2JJUA 4UT6L 2CUHA 4P2QD 3MRKA 3RY6C 2GSIB 1GIGH 3HNTL 5IIEB 1P2CB 1X5JA 3D25A 3L5XH 1T1YA 4OD1L 3HRZA 5FUCC 5BZWB 1S7VA 4Q7DA 3HR6A 1NEUA 3A6BL 5I17A 4WDIA 1F6LL 1C08B 3V9FA 5F9OH 1MFCL 4R4BA 3MX0A 2ZOLA 2I07A 3MR9A 1LE5A 1K4CA 3BUTA 5DHVB 5EBWB 5GZOD 3FT4B 3KLHC 4X7FC 3MBEC 4WUKH 4C55A 4JZJA 1TVHB 4OZHB 4MNGA 4JHZA 3QNXB 4HQQH 4ZSOB 1EHAA 1U3YA 1DP0A 1XR8A 3MRMB 4JFQB 4YHNB 3C6LB 3D0LB 3BPCA 2FD6H 4PRPA 4LASL 3KPQA 2ZJSL 4OCLC 3LRHA 8CGTA 2OTWA 1S7QB 1YUHA 4ZD3H 3FRPG 4YQXH 2B1HH 3L3DA 2J6EA 2HT3C 2H45A 4YBQC 1T4KA