3TT3H

Crystal structure of leut in the inward-open conformation in complex with fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
218
Chain Sequence
QVQLQQSGTELMRPGASVKISCKAFGYTFTNHHINWMKQRPGQGLDWIGYIIPYNDYTTNNRKFKGKATLTVDRSSSTAYMELSSLTSEDSAVYYCARGNYGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Leucine transporter LeuT
publication title X-ray structures of LeuT in substrate-free outward-open and apo inward-open states.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 37
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2011-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt3H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt3H02
2X4QB 1YEGH 1NFDA 4ODWB 4JFYB 4RX4A 5GGSB 3UJIH 1MCHA 4RWYH 3WIFB 3UJJL 4MB5A 4ZSOA 4ZUWA 3IJYB 3OWEA 3HPLA 3BZFB 5DMJB 5BS0D 1UEYA 5K93A 1J1PH 1R24A 1YEHH 5TE6H 2J4WH 2AJYL 5DWUH 1JP5A 4TVPH 2PYEE 4JFEB 5TQ2H 3MACL 3I85A 5GGQH 5F7MC 3PQYE 5IV2A 4NC0B 2IANE 3DVIA 3X11B 3VU2A 4RBPK 1LNUA 1SJEA 1OW0A 5BV7C 4HDIA 5E7BA 1KTDB 4W81A 3MRKA 4XP6L 3BHBA 3OG6B 1OWRM 3MRCA 4RSVA 3RJDA 1A5FH 3TIEB 4NQDA 4RCAA 2W65B 1HHGB 1X6NA 2DMBA 3GMLB 3ZKMD 3ABZA 1U3HB 2VR5A 3CVIH 5CLTA 1RHFA 4QXUL 1CF8H 3SDAA 1K9TA 1CQYA 5EUKA 4PJGF 3OKOA 2EDQA 1WIUA 3AMKA 4YDIL 4KPHH 5MEND 2B4CC 2BVPB 3OB8A 5E1AA 2AK4D 4UTAH 3QUKA 1Y18A 3HI1A 4F7EA 1JNLH 2EDOA 2LAGB 2FEEL 2CLVA 5C0IB 1FFPA 4OKDA 1MHPH 4UB0L 4LKXA 1CU4H 1T4KA 5GS2H 1YMMD 5EORH 4NP4L 2VLJD 4E41A 4GBXB 3V6ZB 5FUOH 3QQ4B 1RZKH 2VMFA 3ULUF 5KSVA 3VG9C 4FQPA 1NANH 5KZCD 3HCVA 5HI4D 2VE6B 4Z77B 4M03A 3S35H 4M5ZH 4HPOH 5IJVA 4PB9L 4QHUB 4PGZA 1I7RB 4PGJA 1O7VA 4K3JL 1JGEB 4JQIL 1BF2A 5FA4A 3BWAA 4JHWH 4BA8A 3MUZ1 1IGJA 1YC8A 4MCZB 1S9XA 3L7FB 1Z9LA 4R4ND 5HI4C 3DWTA 4JY5H 1X5KA 4L1DA 1PVHA 3OAZK 4GKSA 1CDCA 3SGKC 3GMPA 2W1NA 5F89A 1EUTA 1RJZA 4I3SL 2CUIA 2B4CH 3DV6B 1EZVY 4JE4B 4JDVB 1JGLH 2FL5B 5GRWA 1G0YR 1AE6L 1NDGA 1IC4L 2YWYA 1OP3H 1HIML 3QHZL 4R4NC 5IB3B 4U1MB 2B39A 3GJEA 3GSWA 4PJXA 2PYFB 4X8JB 4LHUG 3JWDH 4KI1A 5DVMA 5FECB 2VO5A 5C8JA 1PX4A 3AB0C 3V52L 5CJOH 3IAPA 3FT4B 1HKLL 1YEDB 5L6YH 5IFAL 2XG4A 3OXRA 4LKCB 4ZO6A 1J8KA 4DFIA 5C2UB 5CGYD 1PW3A 4PR5B 3IT8D 4NRXB 2NY2B 4PJCF 1CIDA 5I71C 1MEXL 5BW7A 1QHPA 5ISZA 5JQ6L 3VJ6B 1LO0L 4Y4KB 3S5LA 3NCJH 3H8NA 1OSZA 2OTWB 3C87A 3NABL 1CTNA 5CGYC 3GSVA 4GQPH 1EHNA 3TBVB 1FFNB 2GEEA 4LCIH 4UQ3B 4ZTPL 2VXSH 3QO0B 2CH8A 4YXKH 2BNQA 3ZYZA 3BO8A 2AK1L 3S36H 1R3KA 3TH3T 3VFRA 1LO3L 3BKCH 4M43L 1LD9A 4QXTB 5DURD 4PJ5E 4AQOA 2FGWH 4AMKL 5KN5A 4MNGA 5D1QD 1MRDH 3OPZL 4NCDA 5CEZD 1QRNA 2K7QA 4Q74A 4Y4HD 4XNMB 2X05A 1T2JA 3INUH 2B0SH 3WO4B 2AJ3A 2GSIA 4N68A 4O4YL 3CSYB 5EZLB 2A6IA 1HYRC 4F7MA 5D1QC 2NYYD 1T0PB 3UP1A 8FABA 1BIIA 3MROB 3ZKQD 3B5GA 3H6JA 4P46D 4Y4HC 1NEUA 4JREB 2WQ8A 1RD6A 4LNRB 5D9SA 2F54E 2O93L 3QH3A 4P2OC 4U0RB 1FAIL 2JJSA 3BMWA 1F6AB 3T04D 4KI5E 5GGVY 1KN4L 2H6PA 4QLRA 4G6AD 4HUUA 1FO0H 2NYYC 3VFWB 4PJFA 2AJVL 4M48L 1BEYH 2C4FU 3HR5A 3V4PL 1CT8B 1OAKL 3WE6B 4H1LB 4P2QD 1NMBL 2A9MH 4H5SB 4DK6A 4G6AC 5IB2B 3ECBA 1YPZF 3MRRB 1CXKA 3CXHJ 1DLHB 2IGFL 2KKQA 2Z8SA 2KDGA 2NY7L 4LLUB 2D7TH 3QCTH 5JPMA 3VFOA 1C08A 4PJDE 4APQD 1EV2E 3BKML 2A6DB 3EGSB 4ODTL 5CBEA 4JKKA 4JLRB 1UM4L 3SN6N 2IBZY 4TQEH 2N1KA 2HKFL 2IAND 2VXVL 5EZIL 2EXYD 1RUMH 1XCQB 1AI1L 3JVGA 3OKLB 1AD0B 1R0AH 4UNUA 3WNLA 3BP6A 4APQC 1WEJL 5F7DB 3V0VA 3UPAA 3CVHB 1VGKA 3O3AA 3PUCA 4OFYA 1QUNA 3QIBB 4DAGL 1DP0A 4WI5A 3UYRL 4EI5C 2UUDH 1IQWH 1HXMB 2OSLB 3EO9H 4HPYL 3VE0A 1C5DB 3EYOB 4MJID 1YNLH 2ZSVA 2V9RA 1MLCA 4EBQL 5J06A 4LLAA 2YPVH 2EDDA 2EXYC 3DBXA 3JV4A 4M6OH 3B2UD 3BSZL 3UROR 1QOKA 1E28B 3QUMH 4FFVD 4KQ3H 5D2NE 3RWFB 3ARGD 4UDTB 5IFJB 4KKLD 3PWUB 2CGRH 1N2RA 2K9UA 3IFNH 1A3RH 5FYJL 1D5MB 3CMGA 3IFLH 4YQXL 3QEGH 3B2UC 4F57H 3QXAB 1EJOH 5FIEA 2EICA 1D6EA 4FFVC 1F8TH 3FN0H 3ARGC 2NW2A 2WIMA 4OLWH 5IQ9A 1VEMA 4KKLC 3DX7A 2FATH 4K07A 4G9FB 3B9KB 5CZVH 3QBTB 4EN3D 5IMMA 4BH7A 4HXBH 3V5HB 2EDHA 4OZIB 3RWHA 3NIGE 1X4ZA 3RL1B 4QHLB 1BM3H 2XKSA 1RAMA 3RWGA 5ITFB 4BYHA 2BRRL 3H3PL 2A1WL 4L3AA 3VWKB 5BV7L 4K94C 4PRAA 5E00A 2OM5A 2Z92B 4NO2A 3RU8L 2PUQT 2BSSA 2NZ9D 2R2CA 3ET9F 4Q6IC 4Q9RL 1T03H 4IRJD 1QBLH 1MJJB 1XR9B 2FJFA 3MRGB 4NT6B 5DF0A 3QG7H 1P6FA 2BMKB 1NGWA 4EN3C 2DQCH 3LKQA 2CKBH 2Y7QA 1XGUB 3MLYL 3ROOA 4LPUA 5KOVC 2AKRA 2RBLA 4HS3B 4KK9D 5FKAB 4FP8H 1A22B 1BLNA 4PP2B 3H7BA 2NZ9C 5DTFA 3W9DA 1P1ZA 4IRJC 3PG2A 4OGXL 5IR1B 1QSFB 4OCLC 3QDGB 2CO6B 3UYOD 1QFHA 5B8CB 3GK8L 2XXCB 4OLVL 4LAQL 5JZ7D 3MLWH 5F7EH 4KK9C 2QQLH 2VXTH 4YDKH 1NJ9B 3QWQB 3MRQA 1DLFL 1IL1B 5MP6H 2I26N 4PLKD 4OCWH 3PP4H 4MAYA 5LVEA 5D1XA 5DD1H 3IJHB 1AD9B 2WBWB 2NY4B 1TZGH 3VWJD 4LGSB 3WHXA 4QTIL 5JW4Q 5FB8A 3LSOA 5JZ7C 2OMNA 4AT6A 3IDGA 1FL5B 1IGCL 1S9KC 5HDOA 5F8QC 1F02I 3F58L 4PLKC 3U2SB 3RBGA 2X5PA 1X5GA 3AVEA 2ZG2A 4GSDH 3VWJC 2H2PD 1CDIA 1CVRA 1OAYH 2JTDA 2J1KA 4MJ6B 2C4XA 1FGNH 2HG5A 1K4CA 1OM3H 1DBJL 5CCKH 2NY0B 1K8DB 4CMMA 5LBSH 4LCWA 1IM9A 4WHTA 5C2BL 3UTTD 3QXUA 1BIHA 3JV6A 4PJ5D 3QO1B 2B20A 1BWMA 1CL7L 1J1OL 1GRWA 5FGBA 2WM0A 4EOWL 5J4MA 2GKIA 4I48B 4R2GB 2J5LB 2VQUA 2DKMA 1I85C 4FS0A 1U92A 2Q1EA 3MA9L 4WO4A 4QOKB 4A6YA 4NO5A 4XCYA 2Q7YB 1W0VB 5FUZH 4JRXA 4S2SB 5JR1L 2YMXL 4J12A 1ULVA 1UH3A 3EYVB 1LK2A 3K4DA 4YC2C 2YN5A 5FYKD 1NC4D 3P4OB 2BVTA 3FMGH 1NH6A 1U8KB 3QI9B 1I3UA 5E6IA 2F54D 5IP4A 3BXNA 4AEIL 1F3JA 2ZPKL 3Q5OA 5IMLA 1GIGL 4XMKH 4NWTL 3O45A 4J8RB 4P2RB 4R8WH 3V6OC 3ESVF 3U7WL 3D69B 2CDFA 5DJAA 1QNZH 3OJDB 5BOZG 1A1MA 3V4VL 4DUWA 1EK3A 1AKJB 4RAHA 1I9RH 3FL7A 4U2ZA 1WBYA 5DEGB 3G6JF 2I5YH 5E8DL 3U0TB 3WSQH 2W60B 3GRWH 4WWKA 2QQKH 1KCRH 1XF5B 4OIIL 2FR4B 5I17B 1F90L 1F3DH 3HMXA 2DQUL 5I73B 4NQXA 3OHXB 5M95B 4OT1H 1NBQA 3W2DL 2IQAB 3O11A 4HC1A 1CFQA 5B39A 4B53A 2A6JA 1QTYT 4O2FB 2L7JA 2ARJQ 1RZJL 2EH8L 2OL3B 3DIFA 2EYTA 4RGMC 1QSED 5KS9E 3HAEG 4XP4H 5TH2B 2VB5A 5DJCA 5F7KC 4U6VH 1L6ZA 2WP3T 1EVTC 4LCYB 4XNZC 4IRSD 3ULVE 3WN5A 3QXDB 5KVDL 5C0BD 1A7BA 4HV8A 1CGXA 1J7VR 3MV8B 5GGTH 3VXMB 5EIQA 4GMSH 5HGBB 3WNOA 4JVPA 3P2TA 2G2RB 4MXWL 3OX8A 4M7LT 1M1SA 4MD4B 5C6TH 1CGTA 4KRNA 5DMIH 3MV9D 5SWQB 5SWSE 5ESAA 1JYNA 2NY5H 2QHRL 4IRSC 2CUMA 1JZ5A 2XI9A 3ARFA 3OXSA 1PJ9A 3O3EB 4XCEB 5F1SA 1YUHB 3FO1B 4I0PB 3TPKA 1HILA 4DVRH 1WCBA 5DJXA 4O2CA 3AM8C 2RFXA 4S1QL 2EXWD 5IOPB 1EFXB 4Z7VF 5DZNA 1CR9L 2XZQL 3Q0HA 1X5XA 4UQ2A 3SE8H 1CFTA 1Q9LB 4R0LA 1OAQH 1NGZA 3HNTH 5D2NC 3OAYH 5JXAH 5IEHB 2BP3A 2EE6A 1KPVA 4PUBH 3CU1A 4M7ZB 4UIKH 2GT9A 3W9EB 2EXWC 3HZKA 5E24E 1ZEAL 5CEYB 3DV4B 3AFLA 2VZSA 2X4QA 4PV9A 3LKPB 4ODWA 4JFYA 2BJML 5FOJA 3GZKA 1JPGB 5TF1H 4L8DB 4HKBB 5IWLC 1DBML 1Z0MA 3RVUD 4NDMA 3WIFA 4R26L 1FIEA 2VLRD 1MAJA 2ESVE 3VCLB 3IJYA 3CK0L 1P5UA 4HXAL 3MOQA 5CJQL 1AGFB 4GG8B 4DN3L 3FN9A 3OKYA 2BZDA 3C2SA 4JFEA 1A6UL 3RVUC 4AIOA 1P84J 1KIRB 3MV7D 1QD0A 2D7NA 3DURB 3U0PB 1ZS8B 1DQTA 4ODSH 4P9MH 2DKSA 4OZHF 3H9SA 4YHOL 1U8HB 1JPTH 1OY3B 5D7JA 3X11A 4DQOH 4LSDA 5D6DC 5L2KD 1L9NA 1VFUA 4YWGL 4FXLA 3IDNB 4I13B 1FFOB 4L29B 1ZHBA 1EDQA 5FOBA 4OD3H 2ITDA 3HA0A 3ZSTA 3SE4A 1J0KA 1MI5B 1DE4A 2W65A 1HHGA 2XQBL 2Q8AL 3MUGB 1U3HA 4K7PX 5HI3D 3SDXF 1AO7B 4OCYH 5HVGB 1S7UB 2IPUG 3BAEH 1UEMA 3U9PH 2BVPA 2E6JA 4PJAB 5C9KA 5J0BA 1A1NB 2CIKA 1A6ZB 3CAFA 3QPQD 3ZTNL 2EDTA 5HI3C 4XNXL 4XNQB 1S7WB 2ERJC 5C0IA 1IVLA 1NCAL 1LEGB 3L3GB 1IAMA 3MA7B 3UAJD 5D7LA 4GBXA 3X3FL 3CZFB 1IZKA 5EBMA 2OJEA 2ZCKH 2FIRT 2E5EA 3QPQC 1ZT4B 4N9GB 1ZA6A 2VE6A 4TSCH 1I75A 2KZ1B 3QQ9D 1MAKA 2JB5H 3LQMA 2VN7A 3ZT6A 3BP7A 4QHUA 3L6FB 3EDFA 4AEEA 1M05B 1JGEA 3UAJC 1FLRL 5L8LB 4UAOB 5J9PA 1URLA 4MCZA 5MI0B 3QWOB 2VJXA 4LIQE 1ZANL 4NJ9H 5JHDE 5E9DE 5D72H 3QQ9C 4V1DE 3FO9B 4XXCA 4M7JH 1E4KA 3GSRB 5E2TH 4QF1B 1NCBH 3QEQD 4X6BB 3NMEA 3O9WA 2DLFL 3AMLA 3WUWB 5CSGA 1AH1A 3NZ8B 3LEXB 3TESA 2J3SA 2IBBA 4UTBH 2AEQH 4FFZL 5CWSB 4JDVA 3HG1B 1Q8MA 4HW6A 1AY1H 3TCLB 2Z31D 4U1MA 1GZQB 2R1YB 5B3NA 5I1LB 4PGDB 4PJHB 3V9FA 1CE1L 5L8KB 1WTLA 5F72S 4LLVB 1JRHI 2E6QA 3IU3A 2X4SB 4ZFOB 1N4XL 4G6JL 3FT4A 1A7NL 2MMXA 1YEDA 4G42B 4YIQA 3MLRH 4LKCA 4NRXA 1IKNA 1TJIL 4QNPE 4NCC2 1SM3H 2EIZA 3MYJA 2Z31C 5HHNA 3VJ6A 1JZ6A 1FCGA 1P7KB 3BPLB 4OD1L 3TVMD 4PRPD 2JLLA 4JZNB 4XAWH 2EYSB 1A3LH 4OLZL 1IEAA 4G8GB 1T2XA 1DANT 1O7SA 2EZ0D 1VKXA 4ZYKB 3ULSB 5GGUB 3CC5B 2VH5H 1U2HA 2R9HD 1FFNA 3DMMB 1LP9F 2YEZB 3VXOB 1FVCA 2W0PA 3AS0A 3TVMC 2I9LA 1KC5L 1KXVC 2NX5B 1Y0LB 1UT9A 2HRLA 2X9XA 2VLKD 3STLB 2EZ0C 3KJ4B 2F53E 3I50H 4HEPG 3FOLB 4I0KA 4ODVL 1GGIL 5FYKL 3QJHB 1I8MA 4L3ED 2R9HC 2VKXA 5HHMD 5SWSD 4XNMA 2CD0A 1U8OA 4G8IB 4D0DA 3BQUB 1IC5L 4JJHA 1K5NA 5FXCH 2R8SH 5DXWA 5F88B 3VFSB 1MFEL 3CU7A 2G5BB 3DX6A 3CSYA 5EZLA 1N64H 4YR6B 5GS1B 4LEOB 3MXVH 2YPLA 3EZJB 3MROA 4W4NA 4ONHB 3V7MA 1QFOA 3MNVA 3CUPB 5CJBA 2YHGA 4C56B 4Q0XL 4YDIH 1MJUL 3BX7C 3VD5A 1C1EL 4YX2L 5GGRA 3DX8B 2X4TB 3V79C 2C3VB 1F6AA 2AEPH 1E4JA 4FN0A 4IMLB 4Y1AD 2W9DH 4OM1H 4IJ3C 3M17A 4AM0A 3RTQD 2AI0L 2Z8WC 3ZHDA 4QRSA 4ORGB 4EZMA 2LVCA 2XQYK 4M6NH 2PTTB 3D39E 4H25B 5DJ0B 1CT8A 1J88A 3ARSA 2ADFL 1DN2A 5FUCC 1H5BC 2LAAA 1W8NA 3KPTA 2ICEB 3IKCB 3WFHB 1JZ3A 4NJAH 4JFDB 4JPKH 4ONOA 1AJ7H 1H8SA 1D5XB 2FEEI 5C0DB 3S3JA 3RTQC 1WT5C 3AAZB 2V2WA 3MRRA 5D5MF 5MHSE 1DLHA 4JQIH 5C0RH 3O3UN 4L1HA 4TRPH 4LLUA 1XGYH 4GRMA 3ULVH 5GSVA 1S3KH 2PKDA 3HMWH 3VXSE 3MUY1 3EGSA 3RVXD 2OR7A 2NY1B 3AY4A 3T2PA 1NFDE 1WICA 2VDQL 3V6BR 3BJ91 4JLRA 2DJSA 3MRIB 3GKZA 3P0YL 2OZ4L 1MRCL 3CLFH 4I3SH 4N0UB 1F4HA 2FBJL 4OCRL 5T5NG 3H0TB 3WO3B 3L5XH 3N1MC 4PJBF 5F7DA 1I3VA 3CVHA 5SX5H 3WNKA 1HIMH 3RVXC 4F58L 1JWUB 5I16A 3KXFB 4OSUL 2HT4C 1HXMA 2OSLA 1DVFB 3P4NB 2DYPB 5HHOB 1RJLB 1KEGL 5BZDB 3IGAB 3OAUL 5ESVB 4ZTOL 4XMLL 4GRWF 4NFBA 1H3XA 3RWFA 1OAZH 4PRDB 1DQLL 2JCCB 5B3JE 1JHKL 2YD9A 1NUDA 3D5OF 3RKDD 2WW8A 1V7NL 4NBYB 2FB4L 3VW3H 5B22A 1HH6B 1CDUA 1MCFA 4LL9A 3GJFB 5BRZB 2PETA 3IXTB 4NQDE 4LFHG 3D0LA 2C1OB 3QXAA 3QZWB 3I3BA 4XWGL 3PWNA 3H9HB 1MFCH 5T3XD 1OL0A 3IS1X 3B9KA 2ARWA 3IDXL 2DLHA 4PB0L 1LO3H 3V5HA 3O8XD 2JIXD 3RKDC 4OZIA 1CLCA 5DHYA 3VXTB 1TQBC 3RL1A 4HIXL 3K2MC 4PJIB 5ITFA 2DM3A 3D0VB 3ARRA 3VWKA 1QYGL 2Z92A 1CQKA 1CZ8H 1KYOK 3EO0A 1MJJA 4S1SL 1Q94B 1A6PA 1CK0L 3TT3L 1F6FB 2ZCHH 5C07B 4Z7WF 1UB5B 3O4LB 4E41E 1OGAB 3D85B 3IF1B 3T3PE 4ENED 3SDDD 1ZGLM 4HS3A 5FKAA 4UI2A 5JHDD 1V3LA 4V1DD 5JDJA 4BFIB 1L9MA 4WI2A 1AGBB 1JPFB 1EH9A 3GMQB 1ZHNB 2HFGL 4OB5L 1FAIH 5LAXA 1RJYA 5B8CA 2FHCA 3LPWA 3KJ6H 3MCLL 1G7QB 1LO5B 2X4OA 1KN2L 1PKQB 2XTJB 4ENEC 3SDDC 3HAEH 4GG6F 4U1KB 1NJ9A 3CFBB 3LKOB 1MJ8L 3UZVB 1OAKH 1AD9A 3IJHA 1M4KA 5F1KC 5HJ3A 1CXFA 4WNQB 5IFHL 2E7HA 4HJJL 3QUZD 3PGCB 2XN9B 1RZ7L 1L0YA 4GXUN 3QUXB 1FL5A 4RWHA 3FQWA 3KLDA 3PGDB 3V5DB 2A73A 5JOEA 3LQAL 4OCXH 1XZ0B 1UKQA 3O6KL 2NY7H 4KVCH 2OP4H 2IPKB 1ZLSH 1AIFB 3QUZC 1T83C 2XIDA 2YKLH 1B2WH 4KZEH 2XV6B 3DI2B 3U82B 4ERSH 5L8JB 4POZD 2DOCA 4M9PA 1K8DA 2VAJA 3PDOB 5KANI 1V8HA 1BVKA 5GSRB 5ISZE 1EEZB 1HHHB 4HS8H 1KCUH 2QJDA 4LSRL 4R90L 5KJRH 5CD3B 2GJ6B 5D1ZB 3BGMA 2CRYA 1NMCB 1DQJB 4MSWB 1RSFA 4HUNB 5E0QA 4DAGH 1FIGL 1NGQL 3UTPE 4LIQH 4POZC 2DQFA 1KOAA 4GW4A 1IC1A 4QOKA 2R0WL 4ODUB 4OZGB 1XT5A 5FEBA 1TLKA 4Y5YC 1NMAL 4X9HA 4KKAD 3NAAL 4MNGE 3EYVA 4I77L 3WXWL 4JO3H 1UYWH 3K8KA 2V9QA 5SWZA 3RP1A 2OK0H 3P4OA 5F97E 5F6IC 1QRNE 1U8KA 4PV8B 3QI9A 4NN5B 1ZLUK 3L3JB 4BK5A 4BQ6A 2ZJSL 3G5ZB 1WZMA 5C0FA 2H8PB 2Z8VC 2E7LA 2DJ4A 1OLZA 2MCPH 4U6XB 3ES6B 4P2RA 4KKAC 3E3QE 3BYTA 2XA3A 2P5WA 2GTZB 1WF5A 1QRKA 4YZFE 1HHIB 3HLAB 2LV4A 1FZMB 2ZCLL 3CDYA 5IB5B 1I8KA 1NFKA 1H3TA 5FM5O 2V2XA 3H3PH 2A1WH 2KQNA 2W60A 3JTSB 4GAYB 3UPCA 4YLQT 1TCMA 1RUKH 1T7YA 2FR4A 3LRGA 2NXYB 1DQDH 5CZKA 3OHXA 4JRWA 3E6HB 2X89D 2IQ9L 4PJFE 1LGVA 3A67H 1MCLA 1CGSL 2L4OA 1YC7A 3RPIB 4NFCA 4I9WD 4D3CH 1NANI 4ODBD 2FECI 4O2FA 4Q2ZA 5ABDE 2HH0L 3MBXL 3WJJA 2A83A 3TLRA 4OIBA 3TYFB 4XPFL 4Y8AA 3L9RB 3BH9B 3D25B 1U8QB 4OFKA 3ARUA 5HPMA 4LCYA 3QIWD 3QXDA 3L3DA 4DZBB 1S7TA 3UJTH 3VXMA 3MV8A 3ME0A 4GKZB 5HGBA 4XPHH 2G2RA 3D18B 5B38B 3TO2B 4NKDB 2JB6A 2KL6A 4MD4A 3V6FA 4MQ7A 4M93B 5SWQA 4XTRD 5F1IB 4XCFL 3QHTC 3ZHKA 3QIWC 4ZNCD 3UMTA 4JKMA 4FFYL 4LBEA 3BRFA 2BY2A 4JANB 2V6HA 4O58H 3P0GB 4XB7A 4MXVF 3MRNA 3MODL 1YUHA 4E42B 3FO1A 4I0PA 5FFLA 3IFPB 4AZ8A 1FBIL 2MOVA 4YHIB 4XTRC 4YDLC 5IOPA 3LMJL 1HHJA 5F96L 3CFJB 4KUCF 4KJYB 1BGXL 3MFFA 5HGDB 4RMRA 4YE4L 3O2DL 1QO3A 2MHAB 3UTSD 3WNMA 1OW0C 32C2B 4OUUB 5C2BH 1OAXL 4CMHB 4MNQD 3X13B 1S7QB 3MBEA 1DZBA 2QSTA 1BF8A 2R0KL 4WEBL 3SKMA 5DQJA 4AH2B 2D31B 3BIKA 5F3BB 2NNAA 4PJGB 3W9EA 5ALBL 1CL7H 4JY6B 1RIVH 4FQLL 4PRBB 1A6TB 1AGEB 5E56A 3DV4A 5E8PA 5HYEA 3MV01 1BQUA 4PJDF 3DGGB 4CN1A 2AS5M 4HZLA 1WITA 4HIJA 4UT7H 4HKBA 2FLBT 3MA9H 2H9GB 3EYUL 3U30B 1MHEB 3AREA 1G6RA 1GC1H 2I07B 3VCLA 2CLRA 4K7FB 1P4IL 3EOYG 4KHTL 1AGFA 4JM2D 1T21B 4GG8A 1FNGA 4Z7UF 2A0LD 3RGVB 5E2VH 4WFFE 3NVQA 2E9WA 4O2EA 4S11A 1RIUL 1BBDL 3BRDA 1JI1A 5DFWH 4BZ2L 4OBSA 5K9OB 3CLEL 4ZUSB 1KIRA 3TM6A 3DURA 3U0PA 1HDMA 1ZS8A 35C8H 1ZVSB 3KPLB 1TIUA 1I1FB 3DRQB 4JM2C 4OLUL 1OARL 2A0LC 3T0EB 3IDNA 1JNNH 3HUJF 3U7WH 3T08A 1J0JA 5DGRA 1LO2H 3VXRD 5A2FA 2DMCA 1IEHA 1VFAB 2GQHA 1EPFA 4G8FA 4CUCA 2QR0B 5DHVB 5GIRB 1MI5A 4OIIH 3AGVA 4RISH 5B39G 3DVGB 4P5TD 4AENA 1JGDB 4OGAC 2DQUH 5T3XL 3M1BA 3M8OH 5JNYB 4NWUL 4YAQB 3R06B 4LLMA 4MQTB 4YO0B 5EDXA 2VLME 1PG7H 1AO7A 4PGBB 1S7UA 2GK0B 2QADC 5GHWL 4JG0L 1KLGB 1RZJH 2FYYB 3GMOA 5JORA 1F97A 1W72B 2ZNXA 4F33B 1A1NA 2EKJA 1A6ZA 4Y88A 4C58B 5A2JH 1LK3H 6FABH 2JJWA 4P5TC 4CKVX 5DJYB 1WV7T 5I1KL 5ISZD 4XNQA 1S7WA 4PJCB 3R1GH 4OQTL 4R97B 3L3GA 1PAMA 3MA7A 3JV0A 5JTWA 3U9UB 2XZAL 3CZFA 3NCYP 4WW2A 4N0YL 1GZPB 1H3VA 1KB5B 2YUXA 3KPNA 4ZNEA 4PGCB 3D2UA 2M8XA 1PGRB 1ZT4A 4OM0H 5DLMH 3GUTB 1TTFA 3ZYOA 4AG4H 5BW7C 4OD2B 5HVFB 4LCWE 2BNQD 2VITA 2AJXH 2X70A 1F4XL 3RIFK 2VC2L 2DIJA 3HZYA 1KELL 2DQTH 3TV3L 2J8OA 4JPVL 4X6CF 3VRLF 1NGXB 4WI3A 1UM6L 1Z3GL 4KMTL 2YSSB 2HJKB 1MLBB 5E6ZA 4MX7B 4Y4FD 3FO9A 4S1QH 3GSRA 4NQED 4QF1A 5I74B 1KJ2L 3BDYH 3NACL 5FYLL 1CCZA 5CHNA 4FZ8L 3WUWA 3NZ8A 3LEXA 1CFVL 2F5BL 5CWSA 4JRXE 5K9QG 3HG1A 3QUYD 2XG5A 4HWBA 3TCLA 2APVA 1GZQA 2HT2D 2R1YA 1F13A 2ZP0T 5I1LA 5I9QC 4PGDA 4PJHA 2YRLA 1T89A 4Y4FC 1A02N 5IVXF 4Z76B 1QLEL 1QFWI 2PO6B 1F11B 2P8MB 1Y6KR 1NGPH 3E3QC 3QUYC 2NR6D 5LGHH 1DBMH 2ATPB 2J2ZA 3AU1B 4RA0C 4A2LA 1E4XH 4R26H 2HT2C 1P7KA 3LZFL 1IEBB 2EYSA 3OGOE 4G8GA 4OGYL 3RY6C 3FQTB 4DN3H 3QDJD 1J8HD 3ULSA 4FQIH 5GGUA 3IVKA 2CUHA 3CC5A 3VMOA 2ADIB 4HIHB 2NR6C 4KRPD 4U6TA 5C0AA 3QFJB 3EUUA 1T7WA 1YPZB 2ADGB 2BVOB 4YHOH 5MEOB 4JRYA 4E5XB 5J8OA 3VMPA 5EO1A 4X7EC 3ZZ1A 2H32H 3K0WA 4CRPA 4JFQA 4WTWA 5IVZB 4KRPC 2R1WA 1MUJB 3DTXB 2IALA 1NAMB 4K7PL 2HN7A 4Z18A 4GKOA 3THML 4NO0B 2OCFD 1DSFL 3SPVB 5EO0B 4NM4H 2DQEH 2IH1A 3V95A 3SQOH 4YR6A 1F5WA 3A6BL 4LEOA 3TIDB 5DK3A 3TP4A 4ONHA 3BPNC 1H8NA 4YNYB 3RA7L 3RDTD 3RX8A 4RFOL 3TC9A 3CFCL 2VKWA 3FQUB 3F12B 3DX8A 3J8F7 3HZMB 4JAMB 3JVGC 3D3VB 2XPGB 4QRPD 4IMLA 4K9EL 5C09B 3ZTNH 1E6JH 5EUOF 3HPJA 5HY9B 1Q9OB 1UWGL 4DKDC 3T77B 2FX8H 1NCAH 3LHPL 5IK3B 4YHKL 1X6LA 4Y5VB 1ZA3A 4OF6A 3RDTC 2CJUH 1MCSA 1SY6A 2PTTA 2MQ0A 4P57A 4F7PA 4L4TB 4KZDL 2BNUA 2ICEA 5ERWA 3O2VL 2HP4A 3C08L 1D5XA 5KG9A 3CFKA 3AAZA 2X4RA 5EB9A 4DVBB 3MRFB 5KS9F 1F00I 4EDWH 2ICWJ 1RMFH 1CGUA 3GSNL 2D4DA 5TQ0L 4LSQL 4WFFD 5DUBB 3ULVF 2O5YL 5IW3A 4J3OC 4XPGH 1X7QB 4ZG1A 2APXA 1YECL 3UTOA 4JFHD 3TA3A 2GUOA 1UB6B 3P3YA 5BXFB 5CSZB 1ED3A 4X6EB 3LCYA 4OTXH 3R0NA 3VXQA 3Q5TA 5GISL 1JWUA 4Z78B 2DD8H 3DI3B 3EOTL 2AV7B 3KXFA 1RUQL 2VZUA 5HYJB 1CE1H 4O02L 5JXEA 3P4NA 2HVKB 4JFEE 3MZGB 3PIQB 4TULH 4D0CB 1OQXA 3E0GA 4XNYL 1UKSA 5BZDA 1HHKB 1EHLL 1KCLA 1OHQA 4XT1C 1WIOA 5TFSH 5ESVA 4WUUA 1L7IL 3MJ8B 4DCQA 3O0RH 1LE9B 3QRGL 4PRDA 1CXEA 3SJVB 5GS0H 4KKCD 4OD1H 5BMFL 4NKMB 1NC2B 4OLZH 4MAYD 5L0QB 2R2HB 4JCMA 5D1XD 2IPTL 5ICYA 1CBVL 2WWKO 5J11B 1VCAA 4M1DH 4PJEA 4NM8H 1T04B 1QKZL 2C1OA 4FZEH 3I6LE 3QZWA 3KGRA 5GS3A 2W92A 4X6DF 2E27H 1MAML 5C1MB 3I75B 1CXIA 1ADQL 4MAYC 5D1XC 5JOPE 3DJ9A 1WGOA 1N5YH 4JKPH 1YEEL 3VXTA 5EBGA 5TE7H 1BBJB 1DCLA 4I18B 5I1EL 5JQHC 1P7QB 5AWNH 1TNMA 5GZOD 1IM9D 4EKXA 1ORSB 3DHMA 5C6PB 1KT2B 1IC5H 4X0KB 4MHHI 4EI6A 5IMOB 5C07A 4LRIC 1MWAL 5D7LE 3IF1A 3B43A 1OTUD 2GITB 5EOQH 3X3GH 2B2XL 3QRFM 1ZGLA 2HFEB 4L9LC 1V3JA 2QKIB 4YGVB 1P9MA 5GZOC 4BFIA 2COQA 1C1EH 4M4PA 1AGBA 4LK4A 4WO4D 1A9BB 3GMQA 1ZHNA 1HQRB 3T2NH 1G7QA 4N0FB 1LO5A 4JZJA 4YXLL 5IEKA 4IOIB 2VSCA 1OTUC 1OP5K 1TETH 3FAWA 5FGBC 4H1LG 2EIDA 3WFEH 2NTFB 3BDXA 3HNVL 4G9DB 1BHGA 4UILH 5DUPL 4HX1A 1MCPL 4WO4C 4WNQA 2ADFH 5D8JL 3PGCA 2XN9A 4S0SD 3V7AE 1I9EA 1J11A 1IGTB 2AABL 5L7XH 2LQRA 3ARPA 3QUXA 2SEBB 4JVWA 4TN9A 1IMHC 3PGDA 4FG6D 1T5WB 4R3SA 1T2QL 2ATKA 1XZ0A 1C8PA 2EC9T 1Q9WA 3GHBL 1FRGH 4Z5RB 1UVQB 5IHZB 1C5BL 1CLZH 5IESH 4J3UA 4RQQB 4GAGL 4NQVB 5CEXB 3G6JB 4YHYC 1EZVX 1KLUB 2CPCA 4ZO7A 3BW9B 1A9EA 1XGQB 5I1AA 4FG6C 3PDOA 2OZ4H 2G60L 3K46A 1HHHA 4FQ1L 5E4EC 5C0GA 2J88H 2GJ6A 5D1ZA 4Y16B 3I2CL 2ZWLT 4OCRH 1G84A 4JJ5B 1DQJA 4KK8D 4MSWA 3C09B 3QUMA 1IGML 4WWKC 1IBGL 2YPKA 3E2HB 4IDLA 4CVXB 5DD6B 3RWDA 3K7UA 5J57B 4X9BA 4PS4H 1DTUA 1GHFL 2P5EB 4ODUA 3N85H 3OAUH 1MY7A 2G5RA 2UZYB 5T1LB 4A6YH 2X2YA 1HNFA 3BIBX 4KK8C 4TUKH 3OL2A 3TZVB 2HFTA 2A38A 4F15B 4HS6A 3ELAT 4X99B 2W9EL 3L5WB 2GFBA 4S1RL 4PV8A 3TH2T 3SBWA 3DARA 3L3JA 2FB4H 3WFZA 5E99H 3UPRB 1I7UA 5D96B 4G7YL 4HIIB 4IIQB 5K59E 2H8PA 1N6QL 5DFVD 5I1CH 5GRJL 4WV1B 4XCCL 5TDPA 3VH8B 3VRIB 3ARFD 4U31A 3MRMA 4DGVH 1KYOJ 2GTZA 4OJFL 4PB0H 2YPLE 1HHIA 3HLAA 1FZMA 4KTEH 4OV5B 3MQIA 2CKBA 4N1HB 3JTSA 2G75B 4GAYA 5DFVC 4Z7VB 3SDYL 3F65A 1RUAL 3MO1B 1VFBB 5MEQB 3ARFC 4K7PY 4S1SH 3C9NB 4XZUB 4PY7A 4HWEH 2PTUA 1CK0H 3HMXH 4KV5F 4PFEA 5HVHC 5FGCB 1F2QA 1WZLA 4RFNC 4RFEB 3TBYA 2J8UF 5GRUL 4ZFGL 2KQMA 2A6KA 2A77H 4K3EH 5JPNB 3RBSA 5CKGA 3UTZB 1RIHH 2DQGH 1WFNA 2WV3A 4XI5D 5ESQB 1JTPA 2A9NH 3TYFA 5E1HB 1YMHB 4XPTL 4HJ0D 4BKLA 3BH9A 3D25A 1U8QA 1JGVH 3STZB 4NRYA 1QP1A 1A7QH 2X4PA 1XIWA 3W0WD 2O5ZL 3VDCA 4DZBA 3IU4L 4K71B 4KGJA 1JIBA 5DD3L 4GKZA 4FOMA 1YJDC 1CD0A 4OCSH 3D18A 5B38A 4XI5C 3TO2A 4NKDA 3N1PC 2E9IA 3FB5B 5L9DL 3N1FC 4HJJH 3GB7A 5F1IA 3MLXH 4HF5L 3DROB 1JHTB 3H9SD 5HDLA 4JPWH 5D7JD 3BEVB 4G80B 4LCCB 1TFHA 4JVUA 4OZHB 1TJGL 1FORL 2VDOL 3K2UL 4JANA 1FG2B 3LQAH 2R4RH 3IFPA 2IG2L 1MJ7H 2QTEA 3L3IA 3CFJA 2WIIA 1MIEL 3HE7B 4KJYA 3TJEL 4JDTL 4V2CB 5D7JC 3ARZA 2PCPB 3C2AH 1VDGA 4DGYL 3ILQD 4PBVC 4ETYA 1TPXB 3IB4A 5IUSA 1MCEA 4G5ZH 1QR4A 3X13A 1N0XL 1S7QA 3OF6A 3SDXB 3VFGH 4ZO8A 2D31A 2VXQL 5F3BA 3WIIL 1EMTL 4I3GA 1A4JB 1DBKH 4KDTC 1FZOB 3NOIA 4GS7C 1AGEA 4Z7OF 3E1F1 3S88L 4DW2L 4ZFOL 4HK0B 2Z9TA 4G6KL 4OLYL 3C5ZD 3EFDH 3C8KA 4YDJA 3DGGA 5C70A 3ILQC 5T5FH 4FNLL 2H9GA 3VD9A 4HWNA 4MWFB 5DMKA 5D7LD 3NTCL 4OZIE 4R7NA 4KHXL 5EO9B 4TSBH 1T21A 3NAAH 1NCCH 4I77H 3RGVA 4OAWB 3C5ZC 1RZFH 4CBPA 1S7RB 1AFVH 4C59B 1RPQA 4ZQKA 4ZUSA 1JWMB 5BS0B 1NKRA 4OIAA 3TBWB 2UZIH 4I5BA 3MRBB 5BV7B 2KPNA 2GI7A 3GRWA 4P0DA 3KPOB 1ZVSA 3KPLA 4Z95L 2VL5A 3DRQA 4Y5XA 5FHBL 5JW5B 1R3JB 1JGUL 1I7ZB 3Q6FB 4IMKA 5K9JL 3I9GL 1GPOL 1GGCL 4EIZC 4WUKL 1VFAA 2P47B 3O9WD 2FX9H 3GMNB 4GAJH 2L0DA 5H35B 4YHMH 5GIRA 1HEZB 4UT6H 3SKUD 4DJMA 3DVGA 4TTGA 3QEHA 2ZG1A 5JNYA 2H45A 1OT2A 4KGLA 3R06A 5CJ8A 5EU7C 4ALAH 5SX4H 4YAQA 5E2UL 1FYTA 4LCUA 1CGSH 3O6LL 5ITBL 1E4KC 4KY1L 2DL2A 1KLGA 3O6FA 3O9WC 1HXYB 4K3DH 4RDQG 3S34H 1W72A 4I2XB 3BEWB 4R7DB 2AJUL 4PRID 3UO1H 5JA8B 4NGHH 4QXGH 3RAJH 5DJYA 3TT1L 4PJCA 5MENB 3LH2H 1MCOH 4N90E 3Q1SL 4NNPL 3L3OB 2AK4B 3VG9B 1A6WL 3EDDA 1RK0B 1NUGA 4EVNB 4POUB 1GZPA 1RZ8A 3CFEB 3WKML 4JDZB 1AQDB 4K23L 5D71H 3T3PF 4UUJA 1IKNC 1YMMB 2VLJB 4JM2F 3GHEH 1TVBB 5I2IB 3RUGF 1LP9B 4LVOC 2QV2A 2OLDA 3VG0L 4XMPH 3P11L 4X5XB 3RKPA 5IM7B 4F7TB 3VXUD 2X9WA 5AD0B 4FFYH 4P4RB 2FJHB 3P4MA 5KZCB 3MJ6A 5HYQB 1I7TB 4J3VA 1ZLVH 2NPLX 3NH7L 1ROWA 3MODH 3PWJB 3NA4A 5C9JB 2HJKA 4DOHB 1MLBA 1NDMA 1FBIH 2EEDA 4YUEL 5ECJE 5FO9B 2K1MA 3HFML 4P4KD 3KHOA 3NCCB 2W0LA 4C55A 1EXUA 4QOKE 1BGXH 5T33H 5GQBA 4YE4H 3SE9H 4NC1E 3AB0B 2WUBH 1OAXH 1LEIA 1A7OL 3PP3K 2DLIA 2AEIT 2YPLD 4FQQB 5E7FA 1NCWL 3CMOH 5SWZE 5FV1L 4LARL 3O3DB 5ALBH 4NKOA 4P4KC 1A7PL 4FQLH 4Z76A 1RQ5A 1ZOXA 4PJXF 1VSCA 5CSBA 5I71B 1JMZA 5LXGL 4NUGH 5T5NF 4NZTL 3S37X 4KVNL 2P8MA 1WFUA 5D7SL 4JN1H 5FM4A 1PQZB 2Z91B 4P2RE 2ATPA 1SJHA 3AU1A 4J7RA 2P5WE 3HE6A 5TJWK 4S1DD 4HC1L 4W6YB 2VRAA 2JKXA 2AGJH 1FZKB 4ZO9A 4JHAH 3P9MB 2OJZL 3KR3L 1LMKA 3FQTA 5A2KH 1BBDH 4XCNB 1I3RB 4KJPD 3CLEH 4U1LB 1FNHA 4U1HA 3FHAA 3WIHL 2VDRL 5I76B 4S1DC 2YA1A 1YPZA 2ADGA 2BVOA 1QR1A 5MEOA 4E5XA 1T3FB 4OLUH 3O81A 1YA5A 4FQXD 4XVTH 4M5YL 3G5VB 4XRCB 2WUCL 5IVZA 1CD1B 4KJPC 4XGZB 3DTXA 1MUJA 15C8H 5DURB 5BO1L 1NAMA 1H3WM 1MCJA 4Q58C 4LPXA 4NO0A 5D1QB 1BVZA 2MFNA 2X7LB 4DGIH 1T1YB 1QSZA 3VXME 3MV8E 3A6CL 2IJ0C 5T1MB 4FQXC 3BWUC 4Y4HB 3TIDA 1CD8A 5J13C 2LU4A 3AY4C 4LLYB 4UNTA 4DKEL 3KYMA 1NAKH 4JO2L 3LPGA 4YNYA 1XF4B 5BVPL 3MNWB 4RA3A 3OKMA 3F12A 5D7KD 1FYHB 3HZMA 3LN5A 3OMZA 4JAMA 3D3VA 1OTTD 4Y0GA 3VFTB 5EOTB 5C09A 4XPBL 5D2LF 1HCFX 3UBXB 4ZFFB 2D03L 4P46B 3WBDA 2F74B 2Q76B 1YEJL 5HY9A 5HDQL 4JR9L 4GRWB 5IK3A 4Y5VA 2H41A 3SKJL 5ALCH 3HN3A 3L1OH 1VPOL 4MA8H 4W6XB 1UJTA 5I6XC 4L4TA 1L7TL 1OTTC 1D9KD 1YJDL 4ESKA 4H1LH 2JJUA 4HGWB 4EUPB 3IDIB 1X44A 4JCLA 5EN2B 1BJ8A 4GRLA 4DVBA 3CXHK 3MRFA 4P2QB 2VC2H 2ICWI 2PXYB 5MERA 1JHLL 1XGPB 1FLTX 4JPVH 1SEBB 4GOSA 4F9PA 2VISA 1UM6H 1D9KC 5DUBA 5I66B 3WUWG 1J05B 2BVUA 3R8BB 25C8L 4MB4A 4XVJL 1NLDL 2XACC 1S5IH 2W0FB 3KYKL 5E4IA 3NACH 1PLGL 1UB6A 2XWBB 4BFGA 3HKFA 4Q9QL 5CSZA 1HQ4B 4G8EA 2CK2A 5FCUH 5CIPB 5CLWA 4X6EA 4Z7WB 4HUWB 2V5YA 4WDIA 2RCSL 1A64A 4Y8DC 1UXSB 5FO8B 4JGMA 4GQ9L 3CVHH 2AV7A 5DS8B 2IANB 5HYJA 3FB6B 2ZOLA 3OB0K 4YEFA 4P9HH 2HVKA 4I8DA 4NRZB 4D0CA 1HHKA 2Y5TB 2XWJB 1FL6A 5DUMH 1JNHB 4W4OC 2XKUA 5I8OL 1LE9A 4ODHH 1T1XA 1OP9A 4H20H 1SVCP 1GAFL 1LHZA 2K7PA 4MJIB 2F15A 3SJVA 4GG6B 1H9VA 2C3GA 4ZUTB 4F8TA 1WBZB 2CR6A 1EAJA 4NKMA 3ZDZE 2R2HA 1R3HA 5C3TA 3WFBH 1G7JB 3ARDD 3ARGB 1T04A 1K4DB 1MI5E 1RHHB 2Z93B 4DKFH 5HGAB 2GY7B 5F9WC 5C0EB 4NBZB 1EO8H 1YEIL 2AXJA 2R0LL 5KVFH 2G9HB 4D8PB 2VQ1A 3I75A 5ANMB 1AO7E 2DN7A 3BT2L 4G6MH 3FO2B 1M7DB 4NN7C 3GBNL 4Q6IB 5ADPL 4AY0A 1RURH 3ARDC 5M94B 4I18A 4CAGA 5ICZB 1CWVA 5KSUB 1DANU 2OR9H 4EN3B 4N5ED 1HZHH 1G0DA 1P7QA 1NBZB 1P7HL 5I19H 1E6OL 4Y19D 3GBMH 1KT2A 3THMH 4X0KA 5C0CD 5IMOA 4XC3H 4LHQB 3OGCB 1OAUH 5J6HA 3K4ZA 2DAVA 2GITA 4IRJB 1U8PB 2YA2A 1OSPH 1KGCD 4ZNEE 2GJZB 3RY5A 4N5EC 3KPRB 2QKIA 5DEZA 5E94B 4M00A 3GKWH 4PD4K 5EOCH 4RGND 3TYGL 1A9BA 1WAAF 2FZ3A 1HQRA 3DNKA 4N0FA 4KRLB 3DSNA 3D9AH 4C57C 4HAFA 3FFCD 4CNIA 3T2OA 3QA3B 3CXDL 4LEXL 4XP9H 3P0VH 1A7RH 2NTFA 5SWZD 4BQBA 1CFBA 4G9DA 2VERN 1FNSH 1W8OA 4RGNC 1QBAA 1DFBL 3MLVH 3GMRA 4ONFL 2FDBP 1HKFA 5DRWB 1MOEA 4NPYB 5GRZA 2P46B 3I6KB 4M7LH 2CLZB 2SEBA 3HG1E 2FWOA 3JTTB 2P5WD 1YEFH 3VWJB 3EHBD 1U8NA 4PJHE 5A3ID 4Z5RA 5CINL 5IHZA 4UINH 5TQ0H 1I1AD 2E7LC 4NQVA 1UACH 5CEXA 3S36X 2YN3A 3G6JA 3GNML 4OLXH 1KLUA 2WLZA 1I4FB 3BW9A 1GH7A 4XXDB 1AC0A 3RIFF 1UA6H 2WK2A 1A3QA 3VA6A 4LLDB 5A3IC 1U8JA 2I9TB 1PY9A 5ID1B 1SBSH 4G8GE 3S96B 1I1AC 2AERT 4UV7L 3CZJA 5GISH 4CVXA 1RUQH 2VDPL 5DD6A 3UTTB 3FOMB 4MAUH 4OBRA 2VOTA 1P5VA 4PJ5B 3FQXB 1RU9H 4XNYH 4MJ2A 3N9GH 1B3JA 4MJ5A 1EHLH 1NCUA 2MPAL 2NX5E 3U4BL 1ZLWH 4YC2B 1H0DB 3K81A 1I3GH 2BOBB 1DQMH 3TZVA 1S5HA 5IVOA 1D5BB 5FA3B 1FV1A 4X99A 3SY0B 2DQJH 3WJJC 5BMFH 2FO4B 4XBGB 4YHNA 3QZWG 5FGRA 1Q1JH 4O5LH 1BFOB 1XCTB 5F3HB 4LNVA 3UPRA 43C9B 2Y1VA 2I60H 2D7OA 4HIIA 2PW1A 1S8DA 4X6FB 3MRPB 4WV1A 5LG1A 3CSPA 2QBWA 4CVZA 3VRIA 1JJUA 2J6EL 1NC4B 5HHPB 2ZUVA 2BNRD 4LSUL 1OCWH 4OCNC 2F54B 3RIAK 1T0NB 5DDHB 4C56E 5KBNC 4GW1B 4FMKA 1FNLA 1W0YT 5GJTL 3MGOB 3ARWA 3MO1A 1VFBA 4WFHE 3NFNA 3GO1L 1XMWA 3C9NA 3UEZA 1L0QA 4JFFD 5AEAA 3MBED 3ZDXE 4Q7DA 2OX5A 1Q9KA 1U9KA 3BN3B 4RGMB 2E8ZA 3QIUD 2B2XH 2V17L 3V8OA 5JPNA 1A6VL 2DQDL 2OL3H 2BERA 4H88L 4JFDE 5KSBF 3CX2A 3BZ4B 3HI5L 4RZCB 4XNZB 5ESQA 5I1JL 4HKJB 1YMHA 3TFKD 3ARED 2H1PH 5GRXG 4XP1H 3MBEC 5F7HA 1BOGA 3STZA 2C1PA 5AYUL 1U8LB 3ZL4H 3FTGB 3GI8L 4M7ZC 4L8CB 2F19H 1QSEB 5DR5L 5GRVL 1QFPA 4NZRL 4XHJD 4QHNB 2BDNL 2X1PA 4HT1L 1UH2A 1IAIH 5I1IH 4Z7UB 1KB5L 4IRSB 4EIGB 1BWWA 2A74B 1NCDL 3TFKC 4DEPC 4H0HB 5C0BB 3AREC 3LB6D 4FMFA 3ZT5A 2FX7L 2AABH 3PHOB 1OP3K 4OUOA 4JG1H 3BEVA 4BUHA 3MJ9H 2NY6D 5INDA 4XHJC 5C86A 4P3CH 1FG2A 2Y25A 3C8HA 3MV9B 3ZE0F 4NFDA 1DL7H 3ZLQC 3HUJB 2JF1A 2B8OT 3KXFE 3GHBH 1OGTB 1AXTL 2Q3ZA 5C7XH 4AYFA 4KQ4L 3LB6C 1TTUA 5H2BA 1H8OA 5HHOE 5D2NB 4GAGH 1WIPA 3PHSA 3C5SA 1AGCB 4Q9CA 1YYLL 1E4XI 2PCPA 2NY6C 1Q72H 4WUUE 3LDBC 2B1AL 3LKSB 5C08A 1PYWA 1JV5B 4RGOL 2G60H 1RULH 4N1CA 1GGBL 3P9WB 5GRYA 2JCCE 3Q6GL 1ORQB 2FLRT 3REWB 1R3IL 1L0XA 4M1GL 3PF2A 4DTGH 1VEPA 5J56B 1N3NA 3CSBA 5BVJB 7FABL 4PJEE 4HK0A 3B8SA 1R5WB 2EH7L 3V4UH 1KCSL 4N8VB 3L95B 3L5JA 4P23D 5LQBH 4M61B 1GHFH 1QPXA 1QLRA 1F2XK 2HWZL 4MWFA 1G0XA 4I3RL 4M02A 1PSKH 1A21A 1K8IB 4KTYA 2EDKA 1QACA 4ZPTA 1JYXA 5EO9A 4QRRA 3H2WA 3D2UD 4OAWA 5BCAA 2W91A 1KXTB 5CILL 3JV5A 2VLRB 4P23C 5KSAD 4L4VD 4TUJB 2DIBA 1NSNH 3LIZH 5D7IA 4KMQA 4RMWA 1N6QH 1G1YA 3TBWA 5I1GH 3QR2A 3MRBA 4HEME 5C07E 1Q0YL 4RIRA 3BI9X 4WW2C 3KPOA 3P40A 2FIKB 1OGAE 1AXSA 3NFSL 1R3JA 3ZKXC 4X6CB 4ZAKD 3Q6FA 4R4FL 3S4SA 1K85A 3MV7B 3MMEB 1YYMH 2RR3A 2PR4H 1V5JA 4Z7NE 5IGXL 5KSAC 1TJHL 4O51B 1FPTL 2Z35A 2Y06H 3MRLB 5L2KB 1BZ7B 3GMNA 3SDYH 4N8PA 1S9VB 2P1YA 2XTJE 1EEYB 5DO2D 2VDLH 4ZAKC 2P7TB 4PRHA 1N6UA 1V7ML 3EFFA 4HWZB 4IOSD 1Z2KA 3PWPD 2ZOKB 2WBJD 3B3IB 1KFAH 3IDJB 4KUZL 2GY5A 1ZSDA 1HXYA 1FG9C 4YHZL 2QLVB 3D1MC 2XN9E 5DVLA 5IVXB 3NZHL 1WC7A 2ERJB 3KPSD 5FCSH 3DYPA 3N06B 4P59L 3EYSL 5DO2C 4X98B 5L88L 2Q20A 5K33A 1YY8A 4TVPD 1PDKA 3OZ9H 1J9CT 1OD9A 1XR8A 5MENA 3E6FB 4HGKC 4HBCL 2WBJC 5TGBB 5B38G 1T89C 2O5ZH 1YQ2A 2RQ8A 4LSVL 3CSGA 1VHPA 4A2MA 4JDZA 4DN4H 1ND0B 1AQDA 1DBAH 3JWOH 1QEWB 4HG4K 1U3ZA 4WY7H 2JJVA 1YMMA 2CK0L 4LQFH 5C0AD 4KTDL 1TVBA 3CH1B 4JQVA 5IMKB 3D39A 5JOFB 1MFBL 1CLOL 1VA9A 5FAAA 4F7TA 1JZ2A 5AD0A 2GJ6E 4JRYD 4P4RA 1H3PL 1JRHL 2UUDK 3K2UH 5DJ2B 3LS5L 3WMSA 3N1QC 3PWJA 4K2UL 3QCVL 1YNKH 4ZS7L 3LEYH 5LGKA 3TJHD 1T66D 5FF6A 4JB9H 1JPSL 3GIZH 1E4WH 1E27B 3W11D 1VERA 2CQVA 2XZCH 3ZO0A 5EBWB 3VXSA 2HA1A 4MA7H 2W38A 12E8L 3AS1A 2DDQL 1ZHLA 3VI4F 4MD0A 1FE8H 5F9OL 1F4WH 3EYFB 3QEQB 4FQQA 4HWBH 1P4LB 1JK8B 5AAMA 1U93B 4AEHL 4RRPG 4XBPB 5GS2D 2VXQH 3TJHC 1T66C 1EMTH 3DXAD 1T0MB 4NYLA 3W11C 1OOAA 3S88H 2AVGA 4DW2H 3QDMD 2LE9A 2Z31B 2DB8A 2C3WA 4XVSH 4AL8H 4MZ2A 1XGTB 1PQZA 1G9NH 5EUOB 3SE3C 2XA8H 3NTCH 1FZKA 1D5IL 1XFPA 3U1SH 3MRJA 3PHQB 3WJLA 1RZKC 4BZ1L 9CGTA 4LMQE 1RJCA 2F9BT 2W59A 1CIUA 2ZUXA 3TVMB 2DTMH 1INDH 3QQ3B 4PRPB 1N8ZB 3CPLB 1OPGL 1I3RA 3NBNA 4U1LA 3T3MF 5E5MA 4K3HA 3GGWB 2R0ZL 4LSTL 4IDJH 3K8LA 1A1OB 3WV0A 4Z0BL 5KS9B 3U0WH 4PLOB 5FHBH 4G3YH 1T3FA 4P3DB 1JGUH 5EOCJ 5DK0B 5K9JH 4XBEH 2R69L 3G5VA 4AEFA 1XEDA 2LU7A 4CDGC 5F1NB 1CD1A 2EDLA 5DK2B 5ILTH 1RZGB 3TA3D 2VLKB 5DRNB 4Z9KB 4UDUA 5DRXA 3MOAL 3MNZA 5EC1B 3QAZC 1IGIL 2X7LA 4NZUH 1T1YA 4L3EB 3VFUB 3NA9H 1MFDH 3FO0L 1J1XH 4L5FL 5ACZB 3O3BB 4LU5L 5HHMB 5SWSB 5T1MA 4Y4HA 3MGTA 4ZOAA 5EC2B 1M7IB 4ZD3L 3JWDC 1LO4H 5JXED 4NQCA 3FFDA 4DWHA 3TA3C 3L3HB 3RNKB 3MZTA 1H15B 4HH9B 4BH8A 4U1JB 1CE6B 4J6RL 1BQSA 1CFNB 4WUUD 5J6GB 3UBXA 4PP1D 4TPRH 2YOCA 4P46A 3CFDB 4ZFFA 2F74A 2Q76A 5IBTH 3TT1H 1QG3A 2VLLB 4F3FB 4AIZA 4NNPH 1H5BB 2CDGB 5JXEC 2JELH 2IEPA 4Y1AB 1SY6H 1UM5L 5I30H 3RTQB 1UWXH 3MLTA 1CLYL 3DOSA 4K23H 1DUYB 4UV4H 3RX7A 4PP1C 3EAKA 1L6XA 4FTVD 5EN2A 3FT2B 5IQ7L 3F7VA 1HSBB 3ETBF 4X6DB 4YEEA 1BFVH 1KEMH 3D6GA 4P2QA 2BVQB 2PXYA 1XGPA 3LS4H 4JEGB 3C60A 1SEBA 4XC1H 3DYMA 5IHUL 4X80L 2IFFL 5I66A 1J05A 1G7MB 4X4MA 1FN4A 1B6DA 2UZXB 1XF2A 1KENH 5T3ZE 3HFMH 3EDEA 1HWGB 2W0FA 3QWRA 2XWBA 1PEWA 3G08B 2NW3B 1HQ4A 3NFPA 2BOCA 3DVNB 5CIPA 5GJSL 4Z7WA 1YN7B 1UXSA 5JUEL 2LVEA 4MA1C 3QNYB 4G7VL 3TN0D 2R29L 4H0IA 2NY3D 3ULUE 3S37L 3U36B 1KIPA 1UCBH 1IKFH 1U6AL 4NRZA 2VAAB 1BD2D 5LXGH 43CAB 4WHYG 2Y5TA 4KVNH 1Z9OA 1RUPL 1MHCB 5HPOA 4HJGB 4MJIA 3QHFH 3TN0C 3T0EE 4ZUTA 4GG6A 3KPMB 2VXUL 4NN6C 2NY3C 1WBZA 4KC3B 1P9MC 1BQLL 4FXKA 3HC3H 5DRZA 3N1GC 3KR3H 4GAFB 2NXZD 4YBHA 1IM3B 4JZJC 2H32A 3HC4L 3GJFH 4N8CL 1K4DA 2Z93A 4X7FC 5T1DL 4LRNL 1I1YB 1A6AA 2CIIB 2G9HA 1Q0XL 4M6MH 4WU7B 1T1ZA 2VDRH 5ANMA 4FABH 1TQBB 1FYTE 3UDWC 2B5IC 3F62A 5I75C 4OZ4B 3QDHA 1I9JL 4P2OD 2NXZC 1P4BH 4D9QD 2AJSL 3SOBH 5IJKC 4C54A 5ICZA 4LSSH 5KSUA 2YZ8A 3VD4A 2AXGA 3O8XB 2JIXB 5HHQB 1U41A 1VGEL 4FQCL 5FGSA 1HINL 4PJCE 2V7NB 4JO1H 5DQDL 4LLQB 1WCQA 3GMMA 4KAQH 3OGCA 5T1KA 4U7MA 2E7MA 4WW1A 3BUYB 2DLEA 1NBVH 2B1HH 1U8PA 4PGEA 4MYWB 1EHXA 3O6MH 2VWEE 4HQQH 3KPRA 1I8LC 1JUFA 3KS0H 4GW5B 1Y6MR 4KKNA 1QFUL 2ICWB 5F71A 3SDDB 3U7YH 1AC6A 3G6DH 3GSXB 5EU6D 1KPUB 1MPAL 2GTWB 4V1DB 3K74B 2YC1A 4PREA 4WHCA 3UJIL 3QA3A 4M8QB 4Y7MA 4RWYL 1VPOH 5JIIA 2HLAA 1KNOA 4HBQA 3IDMA 1J1PL 3OAYK 1YEHL 5DEFB 2EO9A 5E2WH 5DRWA 2UY7A 4NPYA 8CGTA 5TE6L 3HNSL 3I6KA 3BE1H 1F4YH 1S7XB 5DWUL 3RWEB 4EI5D 4TVPL 3G6AB 3JTTA 5TQ2L 1KJ2B 5GGQL 3T4AB 2P42B 2PYED 3EZ8A 3QUZB 1WBXB 3PQYD 1A8JH 1RVFH 3SBWC 1BPVA 3RRQA 4GKNB 4JO4L 5EPMB 1D5ZA 4NKIH 4GFTB 4HHAB 1I4FA 1YZZA 3SGJC 2VDNL 2YD1A 3LN4B 1SYVB 1BAFH 2C7UB 4M6AA 4R96B 1VACB 4LLDA 5TE4L 1IQDB 1FHGA 1G7LA 2J8UB 5ID1A 4TOYL 4NSKB 2Q87A 4X4XB 5EBLB 1CF8L 1NL0H 2XKNB 3FOMA 3MCKB 4M62L 3MV11 1NFIB 3BZDA 3FQXA 4KDVA 4KPHL 3WEXB 3O2WH 4TSAH 5F93C 1YPZE 4UTAL 1V05A 1XIWD 1H0DA 5MEPB 5KVGH 2BOBA 2MJWA 5F6IB 4KJWD 1D5BA 4OCMC 1JNLL 3SY0A 2FGZA 1NCTA 1MHPL 4WI6A 4MA3B 2BXZA 4ODXB 1RFDH 2HMID 1BFOA 1XCTA 1JTOA 1X4XA 5FUOL 4CW1B 43C9A 1U91B 1KCKA 1U8IB 1NEZB 2F5AL 5TF0A 1QA9B 4X6FA 5SX4I 1XIWC 2VIRB 2FECL 5HHPA 4L4JA 4KJWC 3S35L 1CGYA 4M5ZL 4HPOL 2XT1B 5DJ8B 1MREH 1T0NA 1OB1A 4NO3B 5DDHA 2HMIC 2DLGA 4Q6YA 3DUUA 4PJ8A 1HCVA 1KXQE 4GW1A 4JHWL 4Y2DA 1A2YB 1IGFH 3D3VE 5INCB 3MGOA 1BJ1H 5C6WH 5C09E 1XF1A 4J4PD 4KK6D 1QVOB 4JY5L 1MNUL 1TCRB 3NN8B 4O9HH 1KACB 4XWOD 3OF6D 1AHWA 4PD4J 3X12B 3T0WA 2GW5A 3U46B 5E08H 1IRAY 3C5JB 2B4CL 4ACPA 3R4DA 3L5IA 3OG4B 1MIML 4L4TE 5F1OB 1JGLL 1RZIB 3RWJB 1JYWA 5I15H 1NBYA 2ADJB 3BZ4A 4RZCA 2GSGA 4J4PC 4KK6C 4TUOB 3JWDL 5IG7B 4MNHA 4HKJA 3BD3A 3OR6B 5CJOL 4XWOC 1PEZA 3K1KC 3BVNB 1HOCA 1U8LA 2LTQC 4NNXB 2R56H 1QSEA 4QYOB 1YN6A 4E9LA 1TQCC 1W0WA 2HTLD 3L7EA 4ZSOB 4J1UB 3NCJL 4Z7UA 4ZUWB 3QIWB 3TWCH 4IRSA 3HPLB 1YNTB 5C0BA 3SKNA 3GSNB 1R24B 1OWWA 1AR2A 5I8KH 5DYOB 3CJJA 4QGYA 1ZHKB 3RHWK 4LCIL 1QQDB 1C7SA 2HTLC 2VXSL 3MV9A 4LASH 3RWIA 3VXNB 4YXKL 3WFCH 5HYSB 1MCRA 2OZ4A 3HUJA 3S36L 3N50A 5HYJE 3BKCL 3OBAA 1LNUB 4QO1A 2FGWL 1AGCA 1MRDL 5DI8B 4U6YB 4K8RD 4Y5XC 2ZUSA 3QCUL 3LKSA 3MRKB 3BHBB 4H8WC 2XYCA 3FQNB 2FD6H 1JV5A 3DRTA 4HUVB 1FYTD 4U49A 3SJVE 4CN6A 2FHBA 5LJYH 3INUL 1T7XA 2B0SL 2X6MA 1ORQA 3MJ7A 5JDSB 2YBRB 3REWA 3O6FD 5IT2L 3OSKA 3UTSB 4UV7H 2EC9U 5BVJA 5IWLA 1ODAA 4E0RB 2VDPH 4MNQB 1WWAX 4PJ7F 3BN9D 4K8RC 4N8VA 3L95A 3WXVH 1YEKL 4HCRL 2NMSA 2YD6A 3JXAA 5T3ZH 4OKVB 3OV6A 3QPXH 2MPAH 3ARVA 1Y18B 1K8IA 3O6FC 3SGDI 2DRUA 2VR4A 4QTHB 1I9IH 4KI5D 1FO0L 4QWWD 5CUSH 5I8CA 2CLVB 3ISWA 3LEVH 1FFPB 4LVNC 3BN9C 2FJGB 3TPUA 2YK1H 1BEYL 2VLRA 3EJZD 1G9MH 3MOBH 3VH8G 4KUCD 3ULUH 2HJFA 2XRAH 4TUJA 5KVMC 4R97C 5FKPA 1GCFA 1KCVL 4JM2B 5D6DA 1PKOA 3RUGB 2NY5C 2BFVH 2A9ML 4P2YA 2J6EH 2FIKA 2BSED 4HLJA 4KI5C 4QWWC 2R4SH 2HKHH 4X6CA 1J0ZA 4GLRH 4P5MA 3MV7A 4H8WH 1P69B 1FVDA 3EJZC 3EBAA 2D7TL 3QCTL 1MWAB 4ZXBA 3TNNA 1IGJB 1S9XB 3MRLA 3IDYC 2WINB 5L2KA 1BZ7A 1BOYA 2R2EB 3EKCA 5J12C 3IFOB 1S9VA 2I24N 5DHVH 5HXMA 3MX0A 1EEYA 2AJZA 3BGAA 3VXRB 5F7YC 1JTTA 4LHUD 4K8RH 2P7TA 5CEZL 2Y6SD 4U05A 3GMPB 2QQNH 4TQEL 3UTQA 3WD5H 1RJZB 2Y72A 3B3IA 3IDJA 1R0AL 1CDYA 5BOPA 4P5TB 1FH5L 3RNQA 1NDGB 5F44A 5IVXA 1IAIM 4PJXB 3TO4D 1W72H 3EOBA 3QISA 3QEUB 1IQWL 2ZUQC 3EO9L 5C8JB 5J7CC 2Y6SC 1YNLL 3HE6D 4MDIA 3E6FA 3NIFF 1GGYA 5TGBA 1KTRL 4M6OL 3X14B 4PRNB 4XVUD 3AXLA 1KJ3H 2V7HA 4NZRH 1CGWA 4FQJH 4HMEA 2WWMD 2BDNH 4U33A 4KQ3L 5ISZB 4HT1H 3S5LB 3TO4C 1KB5H 1ND0A 3G6JE 1QEWA 4WW2F 1JF1B 1GOGA 2CGRL 4XNUH 3IFNL 1A3RL 3GDBA 4D9RE 3HE6C 5D93B 3CH1A 2LFGA 4KK5D 2ZSWB 3IFLL 3NCEB 1RV6X 3QEGL 4XVUC 4DZ8A 5SX5K 4F57L 3GSVB 3HZVB 4OFDA 3FCTB 1EGJL 2WWMC 1F8TL 1QFWL 3FN0L 5DJ2A 2BNQB 4OLWL 1KBGH 3BO8B 2FATL 1INQA 1AXTH 2VDKH 5CZVL 1LD9B 2I25N 5F9JA 4KK5C 1R3LB 3WL9B 4L9DA 2P5EE 1BM3L 5KN5B 1OQOA 4MNGB 1YYLH 5I8EA 4NHCH 1PZUB 5AZEH 1ZTXH 1TDQA 2QSCH 5I9QB 4XAKE 1F45A 1QBLL 4KH2A 4Y4FB 1WWBX 4RGOH 3EYFA 3QG7L 4NQEB 3EDJA 3QNXB 5IBUB 3QEQA 1FGVH 1P4LA 1JK8A 2O5XH 1Y6NR 1M6OB 5GGSA 2W07A 2DQCL 4HMDA 5DVOA 5LCVH 2FNBA 2GSIB 4I0CC 1T0MA 3GM0A 3QUYB 1Z9MA 3HRPA 3ZSSA 3C6LD 4FP8L 3BZFA 8FABB 1BIIB 2HFFB 1I1RA 4NHUB 4HZAA 5D2LB 1R6VA 3JZ7A 4Z7QF 2VZOA 5EUOA 3QH3B 1MRFL 4I3RH 3B9EA 1J5OH 1AGDB 4WHYH 4NUJB 2E9BA 5A2IH 3MLWL 4GMTL 1ZXQA 2QQLL 2VXTL 4YDKL 3C6LC 3LQZB 2FBOJ 5DQ9B 5F7FA 4Z7VE 3MTRA 3HR5B 4PRPA 4OCWL 4ELMF 3CPLA 1KTDA 3ZTJG 4GRLD 1VFOA 3GGWA 3MLSL 1TZGL 3S4SG 5FGCE 1YQVH 4BFEA 3QDJB 1J8HB 4NZDA 3TIEA 5EZOL 1S9WB 4K94L 4LPWA 4ZOEA 4KRPB 4I1NB 3GMLA 3VI3F 5DK0A 5JO5B 1NQBA 5F1NA 1IARB 5JPMB 3VFOB 1L4IA 4GRLC 1RZGA 2ZKHL 2AQ2A 2VLKA 2P43B 5FM8A 5DRNA 4GSDL 2EE2A 5KW9H 1NAMH 5CBEB 1EFQA 3BPNB 1FGNL 3KPQB 4F9PC 3RIAF 5ACZA 3O3BA 5D70L 1N7MH 5LBSL 5LKNA 1K3ZA 2F58H 1M7IA 4P3WA 5GGVH 5IIEB 3BMVA 3L3HA 3V0VB 4QT5B 3RNKA 3FQRB 5B21A 3V6ZA 4U1JA 3QQ4A 1CE6A 2E7BA 4GO6B 1CFNA 2QSVA 3RDTB 3A6OA 4HG4J 4Z77A 4F3FA 1ONQB 3DBXB 4HFUH 1H5BA 2CDGA 5FUZL 1I7RA 4QRPB 4Y1AA 4F9LA 4HWUA 1F58H 1WT5A 5FHAL 3L7FA 2ZUUA 5I1HL 1EAPB 2AXHA 2BCKB 3K4AA 5EH1A 3FMGL 4KTDH 3FT2A 3TGXA 5C08E 4X6DA 1DBBH 5DZLA 4WENB 2BVQA 3W39B 4XMKL 1T5XB 3P9LB 1J12A 3O2DA 4R8WL 2NW2B 3DV6A 2DQIL 3DX7B 1G7MA 1CDGA 2FL5A 3KLSA 5FDYA 5IMMB 4KROD 4TNWK 5IB3A 5BJTB 3RWHB 1QNZL 2PYFA 4X8JA 2MKWA 5FYJE 5FECA 1I9RL 3G08A 3WSQL 2NW3A 1HI6B 2RAMA 3GRWL 4RAVB 4QXWA 2QQKL 4LSPH 5EWIH 2BSSB 2ARJB 3LKRB 3HI6H 3NIDF 1PZ5B 1YN7A 4CADB 2FJFB 3SCMD 3Q2CA 2UYLB 1C16B 4QRRE 4PR5A 4I18C 4OT1L 4EXKA 4HFWB 2DI9A 3K80A 4PYHA 1NGWB 4KROC 2WLYA 3UJJH 3KNBB 4Y4KA 4EQ3A 1YY9D 2VAAA 5D7IE 5BS0E 4UU9B 3ARBD 2Q86B 1BLNB 3H7BB 43CAA 3CDGB 2OTWA 1P1ZB 1MHCA 4XP4L 4NBXB 3SCMC 4HJGA 4U6VL 2AJYH 3TBVA 4CN4A 4UQ3A 3MACH 3QO0A 3ULVD 2Y5EA 1YY9C 4BZ1H 3ARBC 5GGTL 1IM3A 4QXTA 2IAMD 3MRQB 3KDMB 5FYJU 4MAYB 5C6TL 5D1XB 2CIIA 4PJEF 2R0ZH 2V5TA 5DMIL 4JGUA 4PRHE 4XP6H 5D6CB 3WHXB 1LDSA 2NY5L 1SMAA 4OZ4A 5FB8B 3LSOB 1NPUA 2HT3D 3ULVC 4AT6B 1WFTA 4GH7B 1FSKC 2O61B 4B7IA 1UZ8B 3QSKB 1X5ZA 1FVEB 2IAMC 2IPUK 3DVFA 4I2XE 2RIKA 4QXUH 4DVRL 3O8XA 1H3GA 2BSTB 2JIXA 6CGTA 5MENE 5J1TC 3MOAH 4LLQA 3SE8L 5J1AB 4LNRA 2HT3C 1IGIH 4L9LB 4LGRB 1CVSC 3VMNA 1IAII 2HG5B 3BKYL 2Y4SA 1OAQL 2D4FA 4M7KL 3HNTL 4L5FH 5JXAL 1IM9B 3CCHB 4D2NA 3P77B 4PUBL 4OQTA 4ZD3H 4HAGA 1CN4A 4N0RA 3VFWA 3UBXG 1YMME 4UB0H 2VLJE 2P44B 4NP4H 3SDDA 3ZHLA 2YR3A 3C8DA 4WI9A 1ES0B 3GSXA 3WE6A 3NGBC 4H1LA 1MCDA 1QHOA 2GTWA 4XAKD 2UWEB 1HWHB 4H5SA 2BXYA 4M8QA 2BY3A 1DUZB 4WO4B 4YH6A 5IB2A 2YUVA 3RZCD 2OI9C 4PB9H 4EUPG 3REVB 4DOHE 2ESVD 4K3JH 3G9AB 4LF3B 3BOVA 4NOFA 2WP3O 4IHOB 5I1DB 3EOAB 2A6DA 3X17A 1S7XA 3RWEA 3IXAB 3G6AA 2VSDA 2HT4D 1KJ2A 3T4AA 3RZCC 4YFEA 3QUZA 4L8BB 4ODSL 5IMLB 4YHYB 3O45B 4DQOL 3OKLA 1XCQA 1AD0A 4PJ9D 1K3IA 3QNZB 5EPMA 2IFFH 1OT1A 2AQ1A 4HHAA 1AE6H 1IC4H 1PG7W 5DJAB 5E4EB 1O0VA 3QHZH 4K55A 4LQ1A 4POYA 3QIBA 1T80A 1C12B 1SYVA 2V2TB 2C7UA 4R96A 3V52H 1C5DA 3EYOA 1VACA 3PL6D 1QLFB 5KTEL 3ORJA 1IQDA 1HKLH 1OLLA 1TTGA 2KUTA 1UADC 5JIKA 5IFAH 2YUZA 4JQXC 4PJ9C 5JUEH 4N9OB 4GT7A 4NSKA 1E28A 4X4XA 5EBLA 2P8PB 1MEXH 2XKNA 2AW2A 3BAEL 4OCYL 5JQ6H 1CFQB 3MCKA 1LO0H 4KXZH 4UDTA 4DK3A 5KSBB 5IFJA 1NFIA 1U6AH 1UKTA 3PWUA 3U9PL 1JCKA 3WEXA 2CSPA 3T0VA 5DMYA 3DIFB 1U2CA 3PL6C 1D5MA 2FCBA 2Z0BA 1J87A 5DA0B 3FT3B 3SDCD 4LVEA 1KV3A 1F3DJ 2VZ1A 3WCYA 4U1NB 3NABH 5CS7A 3IETB 5EU3B 5MEPA 3C6SB 1IGYB 2DI7A 4ZTPH 3T8XB 4MA3A 4ODXA 2AK1H 4G9FA 4M43H 1U91A 1U8IA 1NEZA 1JF5A 2ZCKL 4N8CH 3SDCC 3MGAA 4QHLA 2M2DA 3PWLB 4AMKH 4LRNH 3QXWA 4F2MB 1CTOA 3OPZH 2JB5L 5DJ8A 2DWEB 1XR9A 4U1GC 3WKNA 3BD5A 3MRGA 4NT6A 3MUHL 1UJ3C 2BMKA 4NQCE 5AG8A 1SYSB 5JLZB 4NNYB 3ARFB 3OXSB 1A2YA 2KBGA 1XGUA 1CICD 4O4YH 5INCA 5HVHB 1HILB 3FAXA 3DETC 4RFNB 4PP2A 5D72L 5DJXB 4O2CB 2RFXB 5C08D 5E9DD 2DM7A 3NN8A 5E2TL 1NCBL 4GRWE 5IR1A 3MSPA 1QSFA 4UQ2B 3X12A 3OKKB 1CFTB 1TVHB 3U46A 3QDGA 4UTBL 2AEQL 1CICC 1RZIA 4OF8A 1KN4H 1SVZA 1AY1L 2X89A 2EYRB 2ADJA 3KPPB 3P30L 4TUOA 5IG7A 2AJVH 4M48H 1IL1A 1UXWB 3HZKB 3OR6A 3LN9A 3V4PH 3LD8C 3BVNA 2QSQA 4P2QE 3MLRL 2DMKA 1MPAH 1NMBH 4QYOA 4QRRD 1SM3L 4NDMB 2D9CA 4J1UA 4X4ME 4AK1A 4HK3J 3QIWA 4X8XA 4U4BA 1YNTA 4XAWL 1A3LL 4ZOBA 2IGFH 3W0WB 3U2SA 4MZ3A 3GSNA 4MMZC 4QY8B 3BKMH 5DYOA 2VH5L 3HNSH 3HC0B 4ODTH 1ZHKA 4Z7WE 3PDGA 1QQDA 3VXNA 4MJ6A 4HULB 5HYSA 1UM4H 5E70A 3V0AC 3H9SB 2HKFH 1WWWX 2VXVH 5D7JB 3B6SB 5EZIH 1AI1H 2DM2A 3RVWD 4JO4H 1KJMB 3I50L 1WEJH 3GSUB 3QO1A 1ZHBB 2F53D 5DI8A 5DD5L 4U6YA 3UYRH 2VDNH 4I48A 4JZOB 5FOBB 3UZEA 3FQNA 4PRHD 4HPYH 4MJIE 4HUVA 2ITDB 4GG6E 4LHJB 3QQNA 1BREA 4GS7B 5DZOA 5TE4H 4EBQH 1DE4B 2R8SL 5JDSA 2YBRA 1FCCA 3RVWC 2P45B 2Q7YA 4TOYH 3BSZH 3UTSA 4UNVA 1W0VA 1N64L 4S2SA 3MXVL 2ICES 4E0RA 4MNQA 4LVHC 4M62H 2ILLA 2BVYA 5ANME 5FYJH 4OKVA 2CIKB 2AEPL 3C5ZB 4YQXH 3ZKMC 4C4KO 4QTHA 2W9DL 4MHHG 4OM1L 2CDEB 1ADQA 4J8RA 4YXHL 2FJGA 4Y89A 3U6RB 5E5UB 4M6NL 3D69A 5D7LB 3D39D 5F9AC 4ZFZB 4JM2A 4MLIA 3OJDA 2F5AH 4PLJD 2OJEB 5EBMB 3RUGA 5ICXB 4NJAL 1AKJA 4JPKL 1AJ7L 5DEGA 1ZA6B 4OI8A 2BRRH 3U0TA 5BV7H 1DEEB 3FRUB 3RU8H 3NCYS 1XF5A 4Q9RH 5I17A 3BP7B 3ZTJH 4KMLB 3P4LA 5C0RL 3L3KB 3KPRE 4TRPL 5MHSD 1XGYL 1MWAA 2IQAA 5J9PB 4JQVC 3ULVL 1A47A 1WZ1L 2WINA 1S3KL 2CXKA 2GHWB 4PLJC 3MLYH 2FEDD 3HMWL 2R2EA 1WZKA 2AV1B 3IFOA 3VXSD 5KAQG 2OL3A 3VXRA 4Q97A 1MNUH 5C0JB 4RX4D 3L5HA 2DQHL 3O9WB 3SGEH 4FQHB 5TH2A 4OGXH 3VFNB 3CLFL 3DGCR 1SEQL 3MR9B 4NQUA 3L5XL 1MIMH 3BFOA 3GK8H 4P5TA 4RMQA 4OLVH 4LAQH 4RMUA 2FEDC 4MMXC 3KHQA 1B0WA 4O00A 3W82A 3QEUA 1DLFH 2DTSA 3IU3B 1PFCA 4DUXA 3LRSB 4L8SB 4YBQD 4YIQB 3X14A 1GC1C 4PRNA 5EULV 4KU1A 2IADB 2BK8A 3NPSC 1T7ZA 4PRIB 4QTIH 3MJ9A 1UENA 2EDBA 2EIZB 3MYJB 1P2CB 1OAZL 5HHNB 1IGCH 4LVOB 3O3EA 2WANA 4XCEA 4YHLL 1JF1A 2GAZB 4QCIB 1IEAB 3F58H 4KI5F 3VW3L 3BP4B 4YBQC 2ZSWA 4U3CA 1VKXB 3OJ2C 3PV6B 1EFXA 3WJLC 3HZVA 2EE3A 3FCTA 4NQDD 3S97C 1ERNA 1X5AA 1MFCL 3TEUA 1Q9LA 1HN1A 1FVCB 3VGDA 1DBJH 2I9LB 5IEHA 3UTTE 1D3CA 2D0GA 4WEUD 3VXUB 1V3KA 4PPTA 3SDAD 1EIBA 3F5WB 4UOW0 3IAGC 1FAKT 1FZJB 2X9YA 1R3LA 3WL9A 1ACYL 5JW4R 1I8MB 1J1OH 1LQSR 4EOWH 5CEYA 3QCUH 1CZ8L 1KSRA 3LKPA 4Y4FA 3ZE2E 4NQEA 3BGFB 1U8OB 3QNXA 4P4KB 4D0DB 1JPGA 1M6OA 4YFLF 2ZCHL 3BPOC 4L8DA 4NQCD 1K5NB 3SDAC 4N8VG 5IT2H 2RGSA 3DX6B 1RZJC 3QUYA 3N0PB 4E41D 5IF0B 5JR1H 4HMCA 2YMXH 4YK4C 2YPLB 1MCWM 2HFFA 5DC4B 3V6OE 4NOBA 4ORZC 2XICA 4NHUA 3MNVB 5FYKE 1YEKH 3T0DA 4WCYL 5D2LA 4YHPB 1WLHA 4HCRH 2JE8A 5GGRB 3RY6A 5LWYL 1HNGA 1HK6A 3M07A 4MXVE 3KJ6L 2RJMA 1AGDA 1MSPA 3H9YA 4NUJA 4X9GA 4AEIH 4BZYA 4ZUVB 2ZPKH 3M17B 4AM0B 2YWZA 1GIGH 3HRZB 4NWTH 4QRSB 1U8HA 2XTLA 3LQZA 4WJ5B 2WZPD 5DQ9A 4AQ1B 4DKAA 4OGAD 1U36A 4PLNC 4P46C 2DJUA 1FFOA 4L29A 2ZG3A 4WTXA 1KCVH 1O5DT 1EHAA 2QADD 3RQ3A 3V4VH 1KG0B 4B0MM 2PXYD 3QDJA 1J8HA 2QEJA 3C60D 1TZIB 5E8DH 1CDHA 1S9WA 4ELKB 2V2WB 1F90H 3MUGA 5JO5A 2Z8RA 1C7TA 4MLSA 3H9ZA 4OCXL 1S9YB 3W2DH 4KVCL 2OP4L 4TNVK 4GRMB 5GSVB 5DSCB 3QWRD 1ZLSL 3AC0A 4CU8A 2YKLL 1B2WL 2PXYC 4FQXB 5FYKU 4KZEL 2EH8H 3C60C 5J13B 4ERSL 1QSEE 4PJAA 3KPQA 5CEZH 2IFGA 3NIGF 1UWEL 4HS8L 1KCUL 4Z7UE 5IIEA 5KJRL 4F37K 4BJLA 1JFQL 1M71B 1UGNA 4WU5B 1LEGA 5C0BE 1FH5H 4QT5A 5KVDH 3FQRA 3G5YB 3FRPG 5I16B 2YRZA 2ED9A 4LIQL 3RDTA 1GSMA 1ZV5A 5A43C 3UTPD 4MXWH 5I6XB 4N9GA 4F8QA 3MV9E 1ONQA 3ZYIA 3HUJE 4GRWH 3DUSB 3WUZA 4X83A 3L6FA 4QRPA 2QHRH 4LFHD 1GOHA 1M05A 3V0WL 2X42A 3OR7B 5F6HJ 4NKQB 2ENYA 4JO3L 1EAPA 1UYWL 2OK0L 1X3DA 2BCKA 3QWOA 4XH2B 4EUPH 2DLTA 2EDFA 3JUZA 2D3VA 1QRND 4JFXB 3D0LB 1D9KB 4X6BA 2MCPL 1CR9H 2XZQH 1EGJH 3PWNB 2VABB 3W39A 2BSRB 1T5XA 3P9LA 3H7LA 5CGMA 1QFWH 2W0KA 4HUXB 2Q8BL 5BJTA 3Q5YA 5DHYB 2ED7A 2AQ3A 4RMSA 4LLVA 1HI6A 2X4SA 4ZFOA 4RAVA 3RHWF 5ACLA 1ZEAH 5T1KD 2ARJA 3LKRA 1FNEB 1RUKL 4G42A 1PZ5A 4CADA 3EO0B 5CIPH 4RBPH 1DQDL 2UYLA 1C16A 2Y07L 4WTZA 2BJMH 4HFWA 5HDBE 3A67L 1HSAB 3KPRD 2VLRE 3KNBA 4D3CL 2WAHA 4JZNA 3CK0H 4UU9A 4HXAH 2Q86A 5CJQH 1FNAA 1WAAA 2W9LA 1CYGA 4W6WB 3CDGA 2JJSC 5H94B 3ZE1E 4ZYKA 3OJVC 4X6CE 3VRLE 3DMMA 1MRFH 5LAXB 2YEZA 1A6UH 1RJYB 3MV7E 3VXOA 2X4OB 4LMQI 5CJXA 1MVFA 2YA0A 3F7RA 2EDEA 3WNPA 3VD7A 4GMTH 4FQ2L 3PABB 2NX5A 4LGPB 1Y0LA 4WI4A 5F9WB 3UJTL 5L2KE 2BHZA 3CDFA 1LILA 3T65B 4XPHL 3STLA 4QHKJ 3KWWB 4YWGH 3KDMA 5EIIB 3FOLA 5JHLL 5HJ3B 2H3NB 4NN7B 3QJHA 3MLSH 4RAUB 5D6CA 3ARDB 1DN0B 4U1SB 4G8IA 5A40E 5EZOH 2XY2A 3BQUA 4QKXB 2O61A 4K94H 3FQWB 1UZ8A 1FVEA 1KUMA 2XQBH 2Q8AH 4O58L 2A73B 5F88A 3PE9A 3VFSA 5IVXE 1A0QL 2G5BA 3OKEB 1J10A 5GS1A 4BSVB 4OFYD 1G7PB 2FSEB 2BSTA 4LRIA 2ZKHH 3G9VA 4QHMB 2PW2B 3CUPA 4C56A 1SHMA 5IVNA 4P99A 5J1AA 4L9LA 4R4BB 2X4TA 4GUPB 2C3XA 5D70H 2C3VA 2R39A <