3TT3H

Crystal structure of leut in the inward-open conformation in complex with fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
218
Chain Sequence
QVQLQQSGTELMRPGASVKISCKAFGYTFTNHHINWMKQRPGQGLDWIGYIIPYNDYTTNNRKFKGKATLTVDRSSSTAYMELSSLTSEDSAVYYCARGNYGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of LeuT in substrate-free outward-open and apo inward-open states.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transport protein
molecule keywords Leucine transporter LeuT
total genus 37
structure length 218
sequence length 219
ec nomenclature
pdb deposition date 2011-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt3H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tt3H02
2BC4B 4XTRC 4I3SH 4ZODA 5IQ7L 3QUKB 3BQUD 1OAUL 5D7LA 3ALWA 4N9OB 4M9PA 4XCNB 4NKDB 1DQDH 3GM8A 5I1KH 4J8RA 3EYFA 2NY1D 3H7BB 3MLWL 4JDZB 5E5MA 4K71B 2Y06L 1UYWH 2FL5A 4AG4H 2JJUA 3C6SB 5T1LD 5DRXB 1KCVL 3ILQC 5CGYD 5SWZE 1QR1A 1QSFD 2Z92A 4MXWL 2J6EH 2W0FB 2EDWA 3MRMA 1U8QB 1J0HA 4R4FH 3SDAB 2F5BL 1I8LC 1JNHB 2JK5A 5D5MB 5EWIH 1CQYA 1Q0YL 4RDQF 3SN6N 5F88B 4IMKC 1HI6A 5DJCB 1IAIH 3RGVD 2VXTL 5D7IA 5I1KL 4XNYH 3SJVB 2DLFL 3MBEA 4P9MH 1W8NA 3ECBA 1AY1H 1XZ0A 1JVKA 1KIRA 4FQJH 2YMXH 1HI6B 1R3IL 5DJCA 4K3JL 3KPNA 1LDSA 3CDGA 5DLMH 4Y4KC 2XFXB 2F53A 5C0FB 4CNIB 4OZ4A 3ZO0A 1QFUH 2B7DT 5EG6C 3M8OL 4MNQE 4O5LH 1MUJB 4MSWA 1FZJB 1P7QA 1YJDL 3MRFB 5CKGA 3WD5L 3KR3H 3ARFB 2FRGP 1A6WH 3NMEA 4S0SD 4DKAA 2PCPB 4FP8L 1OTSD 4M8QB 4LBEA 3OR7B 3KNBB 4MDJB 5KSAD 1FVCA 5D93B 2DM3A 1H3WM 4LIQL 3UTSB 3OBAA 2GSIB 4JRYB 2JKXA 3ARVA 1JRHL 1YEFH 1LK3H 4OZGF 1IGFH 3CFKA 1RZKC 2DI9A 2X1PA 3TIDB 1IGIL 5C3TA 3OXRB 3KG5A 3P4OB 2WNGA 1O7SA 3JTTB 1OM3L 2XNAB 3WYRA 5F9WC 4NN6C 3O3DA 3EDDA 4F37F 3TIDA 5L9DL 3M8OH 1RIUL 2QKIA 1QRND 4JY4A 5SX4I 1ACYH 1UVQA 4NWTH 5CKAA 2O26U 3U82B 3TT3H 3MCKB 2AXGB 1ZTXH 3LKSA 2YUZA 5IW1B 3DTXB 1U8PA 4MLIA 2X4OA 1NGQH 3LS4L 3VFMB 1C08B 1KCSH 2J8UB 3RL1B 3M1BA 2HVJA 2E9IA 1UB5A 1V3KA 3U83A 1LP9E 4JFFB 3DURA 1WSST 4JPIA 1XF3A 4JDTL 2ZOKB 5I0DA 1XZ0B 2WBJB 3MBXH 3L3HA 1IC4H 2NY4C 4LK4A 5HHPB 1S7UA 4WWKC 3GHEL 3B9VA 1HDMB 1G7JB 1JPTH 1HINL 3SBWC 4PY8I 2FHCA 1G7MA 1Q9WB 1N8ZA 1NGQL 3LH2L 1RZJL 4LVOB 3PWUB 3CCHA 4QRTB 2MCG1 1KEML 2FZ3A 2EDYA 3RWGB 1FLRL 2DM4A 3ZKXC 1DQLH 2GK0B 1YEGL 3LKQA 1Q9WA 2IANA 1KJMA 4NQVB 4WHCA 4M43L 2AABH 1N2RB 4IMLA 5IB1A 1E4WL 3O4OB 4BQBA 3SE4C 4LCWB 2PO6B 2I07A 1MIML 3OJ2C 1F97A 4JREB 1XR9A 4QF1A 2VDPL 4Z18A 3DHMA 1LK3L 3TA3C 1QLFA 4NHCL 5D1XD 1PJ9A 2OP4H 5KVMC 2BVEA 4QHKI 5EZOH 5HHQA 3K81A 4IRZL 4U1SA 1T21A 4AY0A 3QUYA 1QSZA 3RKDD 2RQ8A 5CUSL 1U58B 4UQ3B 1AHWA 2CIIA 3G6AA 1OD7A 1G7HA 2UWEF 4I18C 4FFYL 4E41A 1XF4B 2OR8A 1QUNA 5D70L 3U7AA 5FUCC 1CGYA 4U3XA 5A16B 1IRAY 4G6FB 3ARGC 1MFAL 5B3NA 3DXAE 4JREC 4OZIB 2Y25A 5A43C 5JMOC 1KLGB 2F58L 3MNVB 4OZGE 5L7XL 2AEQH 1B2WH 4Y4HA 2R4RH 5EU4B 4OTXL 4PB9L 1I8LA 2F19H 1A3QA 4KKLD 2X40A 3CDYA 4ZPTA 4D9RD 2AABL 3MV7A 5F3BA 2R1XB 2BVQB 2VXVH 3JV6B 4NKOB 4HXBH 4ZFOB 4S2SA 2ZP0T 3HI1A 4HKXA 3E3QE 5C09D 4ZOEA 1BECA 5KSBF 4LSRL 3UTOA 1NCWH 1QLEL 2AJUH 5C6TL 5D2LA 1T80A 5E6ID 1A21A 4WHDA 3LKRB 3GGWA 4ODUB 5EIVA 1ZLSH 1U8KB 1RI8A 1A3RH 3LQZA 3QO1B 3PGDA 4NBYB 1PW3A 1LMKA 5CFHA 3ARTA 3GSOB 2WBWB 4NQDE 5TDPA 2A6KA 1W72H 2ADGB 5HYJD 5IMKB 3REWA 2Z31D 4AZ8A 4I3SL 3PE9A 2G9HB 3U36B 1AGBB 4HWEH 5F6HI 3VGEA 1EBAA 4OV6F 1XGQA 4XCEA 3WJLC 4LQ1A 4XWOD 4EIGB 4UAOC 5CWSA 4QHLB 4OBRA 3HE7C 4U1JA 5T3XL 2HTKD 4YHOL 1MOEA 3HR5B 3MMEA 4YE4H 4ZFZA 3OKMB 4NZDA 1YDPB 4XGZB 1M05B 2MPAL 3P9MA 3VXOA 1NAML 3K1DA 4LAQH 4YFLI 4A6YL 2YZ1A 1QSFB 2E7CA 4ODUA 4WU7A 1WBZB 2M1KA 4MCYB 1YNTA 5DO2D 1S3KH 5E6YA 3ZL4L 4ZO8A 1RHHA 4G80B 2BHUA 3SCMA 1NCWL 4G9FD 4BUGA 3VWJC 1NMBH 4A2LA 5ESVB 3QDJD 4F58H 4NO0B 4DUXA 3STZA 3ZT5A 1WEJL 1JPGB 1RD6A 3H9SE 3KYNA 3ARYA 2V2WA 3C2SA 3S36L 4L4TA 1IQWL 4DQOL 4JZJB 2YPVL 4XX1E 5JA8B 2OK0H 1BVLB 3N1MC 5F1KC 4FG6C 3UYOD 1J7VR 3V0VA 2D31A 3BMVA 4EN3D 5EUOB 1BBJB 1XF3B 5I6XC 4D0DB 3PIQA 2D7OA 4P3CH 2AV1A 1UJTA 2NYYC 3QCTL 1ES0B 1KB5A 2BSSB 4MQSB 4S1DC 2Z91B 5HGGS 4M03A 4PGCA 1CLCA 2WWMD 2Q3AA 3U0PA 1PLGH 4ZUSB 1NCCL 4U1NB 1CGSH 2O5YL 4YHOH 1CTOA 4KVCH 4Z95L 2XZZA 3T09A 3W39A 3B3IA 3RWJA 5B38G 3PDOA 4HEPG 4O2EA 3VGAB 5KSUB 3ARDD 1HHIA 3SGEI 1L6XA 1LO2L 2WWKO 4KZEL 1IKNA 5AZ2L 1FGNH 3HFMH 3FB5B 5CGTA 1CU4H 3QQ3A 2Q7NA 3FO2B 4Z8FL 1U91A 2GFBA 4O00A 5E03A 1C5BH 2P46B 4MWFB 4FFWC 3PJSB 4JFFE 4WUUB 3B9KD 5A2IH 4R97C 4UZGA 1K8DB 2FD6H 4WW1B 5HI4D 1NFIA 4QF1B 3VFTA 3QZWB 4UOJA 1T2JA 5J13B 1ZK9A 1N0XL 5ICZA 1T03L 3CVHB 2HT3D 5HBBA 2F5AL 2HA1A 4G6KL 4OD3L 2EDLA 4F3FA 1VERA 5C0DA 1UWGH 2OLDA 4U6VL 1H3VA 1QSVA 4H1LG 4MAYC 4YO0B 5HDLA 4BSVB 1I9IL 4NKMA 3QEUA 2IH3B 4NZTL 2D9CA 4MJID 2XI9A 3ET9F 1G6VK 5FK9B 1S5IL 3O9WD 4HGKC 2R0ZL 4MNGE 4LCIH 5DJYB 1ZA6A 1DUZB 5MEQB 5I30L 4PLOB 3U7WL 4MNQA 1A6VH 3MJ8B 5FOBA 1AGDA 1MCRA 5CJXC 4LDLB 1FJ1A 3MACL 5CWSB 4ODVH 4CVXA 4Z5RA 3PL6A 4Q9QL 1KJMB 1HKFA 4NQVA 3UJTL 5BS0D 4HPYL 3QG6B 5FA4B 1KEGH 2YXMA 5C0EA 3AM8A 2PYEE 1U8IA 1QEWA 1SM3L 1A4KB 1JZ8A 2VISA 2DTML 3H9SB 5ISZE 3S5LA 4F3FB 3V5HB 43C9A 4R0LC 2BJMH 1JGDA 1X5AA 1KTLA 1SMAA 4MNQD 3RNQA 3VA2C 4YNYA 4F7TB 1BFTA 1C16A 1UQSA 3B9KC 4RFEA 1HZHH 4XP5L 2AGJL 4Z7QE 4G6AC 4JDVA 5DK2A 2YD4A 4EBQH 1MLCA 3V5DB 3LS4H 2FGWL 3UCRA 4GG6A 2Y36H 5BW7C 1RFDL 3GSWB 4YH6A 3QUKA 3I6LE 4F9PC 1T6VN 2UYLB 3FB8B 3L3IB 4XX1G 5I1IL 1I7RA 2H26B 3QSKB 3ORJA 1E28B 3G6DH 4FFVC 4RFNC 1Q1JH 5IBTL 1KIQA 1MQKL 3F7VB 3FRUB 1J8HB 1P4LB 5C0RH 3LY6A 2ARJQ 1AIFA 4NC0B 3TO4B 3E6FB 4NQDA 4YAQA 2RCSH 2W1NA 4P46C 1CFQB 4QOKB 4OV5B 3LIZL 2I9TB 1DEEB 3INUH 4JZOA 1ED3A 4AK1A 5HGBA 5L8JB 4U6XA 4JFZH 4NBXB 5BXFA 3A6BH 3GMOA 1HYRC 3O0RL 3L3GA 3WDHA 5I66B 2VDOH 3D2UB 4HPYH 1WICA 2OMBA 2V5TA 4JLRA 3QUZB 1IT9H 2GCYB 4GW1B 1QLFB 5F7LB 1BVKB 4MVBD 4FXGA 3I75B 1EEYB 3ESUF 4POYA 4WW2B 2UWEB 3TIEB 1KCSL 3N85L 4B5EA 5I16A 1PG7L 4QRQB 1MNUL 2DQIH 1UXSB 4U1IA 3WFEL 4WFFE 5DF0A 5KSBE 3HG1E 3QDGA 3TBYB 2VLKA 3WFHB 4HDIB 4DGYL 4TUOA 3EHBC 3ARBD 5DJZA 2P47B 1EHLH 1LD9A 1C5CL 1FG9C 1CXIA 5B3JE 2BXYA 3QJHA 5D72H 2CDGB 3KLHD 1KC5H 5EULV 5GGTH 4M6ML 4HIJB 1JZ4A 2B1AH 4UOW1 1U3HB 2DQDH 2A0LD 5A2LH 3V7MA 2E9JA 5LBSH 3P0GB 3HMWH 3E2HB 1P6FA 5C0BA 1II4E 3UO1L 1P7KA 1MCIA 5CD3A 1F4XL 2VOTA 4OF6A 4LSRH 1YPZF 3PHQA 4WI6A 3VGDA 2V5MA 5F6HJ 1ORSA 1KCRH 3EO9H 1GHFL 3NIGE 3H9YA 5JHDA 3MRIA 5T33L 1I1FA 2ESVD 4QXUL 3VMOA 4MHHI 4YBQC 1QTYT 3EYUH 3WS6C 4JJ5A 4FQHA 2CR6A 2FL5B 2GTZA 3FRPG 2LFGA 2FATH 3WS3A 1NFIB 5JO5B 1MJJB 4AL8H 3MUY1 3PGCA 3LEVL 4C55A 1YEIH 4JPIB 5HHOD 2F8XC 1ZLUH 1NFKA 2KPNA 4D94A 4UIKL 1XGQB 1QVOA 1MI5E 2V7HA 3REVA 2J8UA 1LNUA 4JRXB 5E1HB 4MA1B 3GJEB 2QQNH 3O3BB 4R4FL 5GS2D 4ZNEE 3B2UC 3Q6GH 1I7RB 1P4BH 1JCKA 1WGOA 2XNAA 4XBGB 4XAKE 3AREB 3E0GA 3BJ91 3F7VA 1H15A 3O9WB 4QXGH 4URTB 1V5JA 2IPTL 4CKVX 3ZKND 2F54E 4Z7WA 3SKOB 4LHUG 5EBWB 4XPGH 3KPPA 1I7UA 1XF2B 4PJ8B 4F33B 4LEOA 4LPUA 4QCIA 3P30L 2F9BT 4J3UA 4Y19E 4JZOB 4U4BA 3CFEB 5B39B 1FV1B 1OTTD 5FYJH 1R5WA 2QSCH 3MRQA 4ZUWA 5I1EH 4ZUTB 1PFCA 3MQIA 1QEWB 3GM0A 4WI2A 3DARA 4DTGL 4JY5H 1UM6L 4PRDA 3WHE1 4PJEA 5D1XC 2BSRA 3I84A 2EDXA 1HQRB 4QXWA 5D5MA 3AC0A 3S35X 5L6YL 3MRLB 1S7SA 2ITDA 4H0IA 1ZHBB 4JFOA 4FQXB 3WLBA 3P77B 3MO1B 1PQZB 3V6FA 3EAKA 4PRIE 1NUNB 3OKEA 3GMRB 1DBJH 1MH5B 3DXAB 3VCLB 1JNLL 4FN0A 5HTSA 1PQZA 3V6FB 5GJSL 5J9PB 4W4OC 3RNKA 4S1SH 4KGLA 4LARH 5D7KD 2XTJD 2V9RA 5HGDB 1QHOA 3OJDA 1SJEB 4NQSB 3WXWL 1H3UA 3MGOB 1DBKH 4ZUVA 3ES6A 1WVZA 1NCAH 4WWKD 4HS6A 5J06A 3IS1X 4RNRB 1FO0B 1I9RH 4BZYA 1P5UA 5ERWA 3P4NA 4D0BA 3QXTA 4OLYH 3X12B 1G7PB 3L5WB 4NCC1 4LAJH 1KACB 5K59F 3FQRA 3SKNB 1HHHB 2A38A 4RX4D 4X8JA 3LKRA 4HK0B 1UFUA 4G5ZH 3RPIB 3QWRA 4LLWB 2GK0A 5AG8A 3BESR 1B0RA 1RY7B 4UDTB 5DMYA 4UBDC 2NY7L 4M6OH 4ERSH 2KL6A 5F7WC 4NT6B 1I9EA 4HUMB 1CLZH 1HINH 5CEXA 3G5ZA 4Y88A 2J8UF 3PP3H 4OM1L 5D5ME 5E5RB 5F1IA 4K8RL 4LVNC 3UDWC 4I5BB 4H1LA 4QT5A 3AAZA 2ID5A 4G3YH 1JUFA 3STZB 3V0WL 4NQTA 2X4QA 3FFDA 5I1AB 4FABL 1F4WH 3S9DB 1ZLWH 1YY8A 2CRIA 1OWWA 1C5BL 1KCUH 1SJHB 4JKMA 1FNLA 5FUOL 4EJ1C 2X4QB 3P11H 1IC5H 3C08L 5D96C 1F2QA 5F7YC 1I3RA 3S88L 5SWSB 3T2QA 5I75B 1G1YA 4J4PA 1DLFH 1L7TH 3G5XA 1Z3GL 1GPOL 4JN1H 5C0CA 2R9HD 1A1MB 2VISB 5BRZE 2VDLL 4JPKH 2M2DA 2DYPD 4M4RA 1FYHB 2R4SH 1D9KB 2Q20A 1GAFL 1S7RA 3CCHB 4PJCE 1EMTH 2D7TL 2KQNA 3RZCC 3THML 1V3MA 3D2UD 1L6ZA 3TH2T 1A6PA 4N8CH 4Q58C 2AJYL 2IALA 1CVRA 4NO0A 3JTSB 5IUSA 5KN5B 1P4IL 3U9UB 1AFVL 5CJBA 4NP4L 1JV5A 3LEYL 1LHZA 2XYCA 3Q0HA 4JO3L 1CFNB 4KDTC 3PWJA 2P8LA 4RA0C 1TJHL 2FJGA 5AZEL 4LRIA 5CHNB 2IFFL 3RJQB 2BVUA 3KYNB 4OQTA 3U7YL 1I3GL 1YMMB 3QO0A 1LE9B 5DK0B 1ZLUK 4TTDD 2HFEA 1A5FH 5BO1L 4F7PA 5E8DL 1EMTL 2D7TH 3FN0H 4RIRB 5LGHH 3QXDB 3BW9A 1KCUL 3UP1A 2FO4A 5GSRB 4WY7L 3F7QA 2JJVA 3MLSL 4YK4B 2APFA 4LHQB 1FAIL 4Y1AD 3BISA 1FG2A 5DEFB 4G43B 1P9MA 1S7VB 4AIZA 3RWFB 3O8XC 3SKOA 4Z7WB 2WINA 2FIRT 3FO1B 2BNQD 1I3UA 5F96H 5DC9B 3VXQA 1YEKL 1INDH 3SJVE 4LGPB 2BX5A 3HLAA 4YIQA 5EZIH 2R0WL 1L4IA 2NNAB 2F5BH 3ILPB 1NFDF 1IEBA 4CRPA 1D5ZB 2R69H 4HHAB 4TUJB 2HT2C 1YPZE 3GDBA 3GRWH 3SGEH 4FTVA 1XCQB 5C0IB 3BKMH 3RKDC 4D3CH 5IJVB 4PJAF 1F02I 3L3KB 3V5KA 5DYOA 4UB0H 5C0CB 2CJUL 3QA3A 4TVSa 1RZJC 3SDCB 4Z7UE 4W4NA 1UT9A 4ZNCD 1NBYA 3WV0A 4POZD 3VWJA 2OMNA 3L7FB 4MA8H 4Q0XL 3BQUA 3ULUF 4OTXH 4PB9H 4JQXC 4XH2B 1TTUA 1EEQA 4DKEL 4QXTB 4ODHH 1LEGA 4JDVB 4EZMA 4OD1L 2V9QA 4O9HH 3EFDH 4HJGA 3RZWA 5T3ZD 5GJTL 1DDHA 3G6JF 2H9GB 2VXQL 1BFOB 4UNUA 1A9BA 3BYYA 2VR5A 4FQIL 4YR6B 1IEBB 4N5EC 4CN4A 1MCLA 3K8MA 4XMLH 1ZLVK 1R3KB 1RJZA 3UJIL 3L5IA 1ZVHA 1U8IB 1S9VA 1A2YA 3CSPA 4P5MB 4PJFA 5DDHB 43CAB 1SBBA 2FEDC 4I0CC 4FA8A 3IDJB 1FJ1B 3NCMA 5A3IC 2ICES 3B6SB 5TFSL 5FDWB 3TLRA 4IOSD 4YDJA 1PEWA 4ZQKB 1ACZA 5IOPB 2Q76B 1D5BB 4N8VA 3RL2B 4K8RC 4ESKA 4Y2DB 4NKQB 2V17L 5C70A 3AXLA 2VYRE 3ZDXF 1ETZB 5L9DH 1QQDA 2YD5A 3ALPA 3D1MC 3GB7B 5T1KD 3WKML 3L5HA 2OTPA 3WUWB 3ZTNL 1KJ3L 1S5IH 5FFLA 4WHTA 3UTTB 5KG9B 1A6UL 4PBWD 4JFQA 1DN2A 4P0DA 3PWJB 3F12B 5J9PA 2DQJL 3OAUL 5F9JB 3FQTA 5LQBL 4X6BA 2PXYB 4LF3A 3R4DA 3GSNB 4HWZA 1I7UB 5FO7A 3GZKA 5D7JA 2HJLA 3H9ZA 5SX5H 3SPVA 4BQ8A 2X9XA 1FZOB 4PLKC 4FTVD 3VH8B 4Z7WF 3LEXA 4PV9B 4C54A 1P1ZA 5I1JL 5K9JH 5HGBB 1JPTL 1OAZL 3WNOA 1EEYA 3NN8A 4V1DE 4XMPH 4Z7VB 4ODSH 2Z4QB 3RUGF 4GG8A 5DEZA 1TVBA 3IETA 1EAPB 5BRZA 5SV4A 3JTTA 4KVNH 3WO3B 4M1GH 3DX8A 4KROC 2YA2A 4PR5B 2R0ZH 3ARDC 5F1SA 3MXVL 3ZT6A 1E28A 2Y7QA 5F9OL 1Z9OA 1XIWB 2HWZL 5E7FA 2HLFC 5JXAH 2WP3T 3MRCB 1I1AC 3QIWD 4OV5A 1N6VA 12E8H 1FL6A 1ZEAL 3QIWB 3BUTA 4MA3A 1BREA 1G9NH 1ZGLM 4R26H 1WLHA 5FYLD 4ZG1A 5DUMH 5FCUH 3DHJA 1V05A 3P73B 3RY6C 1NBZB 2DDQL 2VLRE 3SDAA 1OM3H 1NUGA 2OBGA 3ZYOA 3K2UH 4Q9RL 5GGQL 2DIJA 3CNKA 2OJEB 3NH7H 2KBGA 4F7MA 1XR9B 2R9HC 4XCYB 2Q86B 1AY1L 4AEHL 4OIIH 4Y4HC 4Y5VB 1R3IH 2NY3B 4PGBB 3IU4L 4NUGH 3BN9D 3CJJA 4QHUA 5JW4Q 4GMTL 3SGDH 2IALB 3WKNA 1LO2H 3GIVB 1N59B 5DEGB 2X7LA 4DWHA 2BY3A 1E4KA 1NDMA 4L8DA 5KANG 3OXSB 1U8HB 4O5LL 1Q8MA 1KCLA 4R3SA 4HXAL 5ITBH 1QBAA 2X7LB 1U8JB 2O5YH 4N8PA 4WVRA 4OF3A 1DBKL 5DJ0A 4LSPH 4P2OC 4XXDA 1F6LL 5ANMB 2JK5B 4PJ9D 3BUYB 1IGCH 1DQML 3K2UL 5EU7E 1N4XH 5I71B 2YMXL 4L8CB 1QLRA 3SQOL 3T0WA 5K9OA 3T8XB 4A2MA 4EN3B 5EOTB 2FEEI 3U7YH 1J18A 1IZKA 4L8CA 3IJHB 1YQVH 4MA7L 3VXSD 4Y4HB 5I1HH 2FCBA 3IYLW 4JN2B 2BY2A 4R4NC 5CINH 3WS6A 3QQNA 1SYSA 4WDIA 4NRYB 2DL2A 1LO5B 4HG4K 3IDXL 2YEZA 2HFGL 3F7RA 4G6JH 4X7SH 3QR2A 1PBYA 5IHUL 3IF1A 4P23B 2HG5B 1LE5A 1DBAH 3ZLQC 1N59A 3KLSA 5CZKA 5E6IA 1N5YL 4HKXB 5LGJA 3ZKMD 4FNLL 3L3JA 4P23A 4QRUB 1RULH 1X4YA 3BPOC 1GCFA 3SQBA 4R26L 4XBEL 4MNHA 3TBSB 5C0AA 3CXDH 1RIVH 1BZQK 3BT2H 2DS4A 3OTTA 4BH8A 4YE4L 5I1IH 3BRFA 5F8QC 5FGSA 4X6EA 4FQQB 5GXBB 3S37L 4IRJA 3V79C 3D5OF 3PP3K 1A6AA 4R7NB 1IC7L 2I5YL 4Z7VA 2AKRB 2CKBA 5BO1H 5TFSH 1RUAH 4OFYD 3L9RB 3NIFF 2NXZB 1E4JA 3O4OC 4FQHB 3Q6GL 4PRPE 5EN2A 3IXAB 1C5DB 1P6AB 3BW9B 1TJHH 1YEHL 5JW5A 3MGTB 5FYLL 4M93B 5AAWA 1OD9A 2Z91A 3UAJD 1WFUA 4ZNEA 3CPLA 2UV3A 1UJ3C 3BGFC 3IVKB 4LHUB 2ERJC 2R0LL 3C9NB 1F58H 3EFDL 2H2PC 5HGHB 4JFYB 4P46D 2UZIL 1I7TA 2CDFA 4PJFE 4LPCA 3X12A 3FL7A 4KTEH 5EDXA 3D3VB 1MLBB 1R3JB 4NWTL 5BS0B 4IRJD 9CGTA 5MP6H 3U9UA 1LP9B 3N50A 3NCCB 4A6YB 2H2PD 1XAUA 3RAJL 3GSVA 1Q1JL 2CXKA 2D9QB 3BDYL 5E94B 5I8CA 3KPSA 4N8VB 4W6YB 3I3DA 4HC1H 4ZS7L 3PP4H 5D7JC 3RVTC 3BKML 1CICD 3AREC 3SGJA 3VFPA 1BLNB 1GL4B 3PWNB 5T5NG 1T20B 1X7QB 2X4UA 1CU4L 3CMOH 3IVKA 5INCB 3TBTB 5M95B 4XI5C 1QFWM 5KVFH 3MJ9A 4OF5A 4NQCD 2IH1B 4OCRH 5I1DA 3OKYA 1HK6A 5FK9A 3MRLA 1FNSL 2BC4A 1DTUA 4HWBA 4JRYE 4NZTH 1VGEH 4NC2B 3HB3C 3OZ9L 4LKCB 4NN7B 2R69L 2VE6B 5IM7A 4HH9A 3EOTL 5HYIA 5SWZA 2L7JA 4QRPA 1W0WA 5M7QA 2I9TA 1IAKA 4KTDH 5D1QD 2FO1A 4WFHD 3ZKMC 1D6EB 2BVQA 2P7TB 2P43B 4YBQD 3E6HA 1F4YH 4YDIL 2Y6SD 5ISZB 4YGVA 5C92A 3BP7B 4WW1A 2E7HA 4G7YH 1AE6H 3RAJH 1MHEA 5H94A 3CX5J 2R8SH 5ISZA 2CRYA 2A83B 2BVPA 4L5FH 2JB6B 3PL6D 2CK0L 4F15B 3VFUA 3QUXB 1LEIA 4LCUB 1WEJH 3MV11 4OGYH 1F4HA 3CVHL 3C60D 1B0GB 3L5XH 4L3AA 2EXWD 5DHVH 2LVEA 4MAYA 5ABDE 3QULB 5DJDA 1QBBA 2Q6WB 2BVOA 4LSTH 5DZOA 3C87A 5TDNB 2HFEB 2J5LC 3ARBC 3LN5A 4F7PB 1PKOA 2P24B 1QACA 1ADQA 2ADJA 3QIBD 4OSUH 1H0DA 4IDJH 3N1PC 5CZXD 3U1SL 3VD5A 1BLNA 4PGJA 4QRRB 3GJFK 2VDKH 4KAQL 4QOKE 1QFOA 2VR9A 1LWRA 3GMRA 2EC9U 4JB9L 4U6HB 1YY9C 4RDQG 3VW3H 4M3KB 4ORZC 5DDHA 4APQB 3BVNA 4RBPK 4JPKL 4LLDA 1EUUA 3ISWA 3D18B 2IBZY 2XXCB 3OKDB 1QA9A 4MJ6A 5AWNH 1UENA 1YEDB 4K2UL 4KXZI 1AGCB 4OGXL 3FB5A 2AJ3B 4OI8A 2EDQA 3MV9D 4XCEB 3QNXA 1NPUA 3SHSA 1KPRB 4YWGH 1MAJA 2R29L 2K9UA 3ARDA 4P2RE 5DEGA 1N6QH 4KZDH 2LQRA 2XWJA 4WRLA 4Z7VE 3CVHH 3WN5A 2JELH 1EFQA 2H45A 1XIWA 1IGFL 3I6KB 2WM0A 5CMAA 5I8CB 3BP6B 3MUHL 3E3QC 5GSVA 4PJXB 5D7JD 1M7DB 2WIIA 3RRQA 1TFHA 5CBEB 3MLUL 5MEND 1RQ5A 5DUBA 3HPLA 2B2XL 4HKJB 3TA3A 2P48B 4DAGH 2VR4A 3VD9A 3WSQH 4J6RH 4R2GC 2A73A 2O5XH 4HFWB 2V2WB 4UV4L 1S7UB 1VFAA 2JIXD 1KPUA 1AD9A 2A6KB 3SEPA 4KK6C 4CMHC 1E4KC 5TQ2L 4LSTL 2J4WL 4L8BA 3STBA 3BP4B 5JUEH 3QI9C 4PJGF 3RDTB 5KAQF 3KXFB 5BMFL 1UXWB 1MRFL 2FD6L 4YXLH 3R8BB 1NKOA 2VNCA 4U0RB 4X6CF 5CSBA 1VSCA 4WO4D 4YBHA 4M48L 3BD5A 4X5XA 43C9B 1WBYB 5FUZL 3G5XB 2AXGA 2IQAB 4XPAL 5FM5M 5MERA 3X11A 1T1YB 3O6KL 1CZ8H 3L7EA 3D0VB 4J1UA 4PJ7F 1MFEH 4R7NA 4ZOCA 4GFTB 5HHNB 5IB3A 4NUJA 3RWCA 4YIQB 5HHQB 4LSDA 5D7IF 4X7EC 1BD2A 2DWEB 4KHTL 2ICWA 5IEKB 1T89A 1MFBL 1IGJA 2LABA 5IF0A 1JNNL 3O6LH 2OSLA 3IB4A 5I8EA 1FE8L 5GHWH 3PDGA 2HT3C 1ZV5A 2XTJB 4N0UB 3AFLA 3A0OA 3T2NL 5E8PA 3C6LC 2ADJB 2VQUA 2KZ1B 3QDGB 3TBYA 5DJAB 4LEXH 3HZKB 5DWUL 2I27N 3MR9A 4XVJH 2Q87A 3RWDB 3DROB 4UIKH 4HULB 4PRBB 4F58L 1VGKA 5C2UB 5CEZL 3CX5K 1JFQL 5T3XE 5H2BB 4LLDB 1FDLL 4KQ3H 4NYLB 4LSVL 3UYRL 4OZFG 2B0SL 4PJBF 1OQOA 4XNZB 3BI9X 1HE7A 4OLXH 2PTTB 1FVEB 4JDTH 1R3KA 3WKMH 3TNMA 1BQUA 5ITBL 3NIFE 4JCLA 3SO3C 3FFCA 4LVHC 2P5ED 5KSVB 1R3HA 3S96B 3EDEA 3QUYC 5DJDB 4IJ3B 4DJMA 2AEWA 3GSOA 2I60H 2VQ1A 3IJSA 4K94C 1CFTA 1JHTA 2YPLB 5D9SA 4OI9A 3IFNL 2X9WA 3F62A 4IIQB 1H0DB 1KIPB 2NW3A 2P5WD 4TNVF 5H35B 3ZE2F 3CXDL 3ZE0F 4L9DA 3BHBA 1ZS8B 3QWOA 2QADB 3IDMB 2R0KH 3F58H 3NTCH 3EFFB 3V5DA 4Y5XC 3HZMB 1IL1B 5MEPA 3L3GB 4S1QH 2VJXA 1U2CA 3KAAA 4KJWC 1JGVL 1RU9H 3PXHA 1SM3H 1VFMA 4I77H 3V8CA 5DJ2B 5D1QB 3MPCA 5AG9A 4RBPH 4LRIC 4OM0H 5J4MA 1CCZA 4UV7L 4QHMB 1JRHH 4JFXA 3FT3B 4DN3L 4ELMA 3NACL 4FFZL 1UZ6F 3DECA 3VXNA 1U6AH 5CZVL 4TNVK 5C1MB 5GIRA 2QSVA 3E2HC 5KS9B 2GT9A 5IWLA 3NFNA 1Q38A 1T89C 1G6RL 1MRCL 2OL3A 1PDKA 3GBNL 5FUCE 1NEZB 2B4CL 1HHGB 4EDXB 5GS1B 4U6YA 3DI2B 4J4PD 2AV7A 3C60B 2DN7A 4UB0L 4AMKL 4OD1H 1MFAH 4MQ7B 2JELL 4XP6L 3RJDA 2J6EA 2F74B 2IBBA 4RAHA 4LKXA 5CJQL 4FZ8H 3HC0B 1KULA 3BXNB 2IBZX 4ZTOH 2R0WH 3KWWB 1TCMA 3GSQB 4KHXH 4HIIA 2VLMD 25C8L 4AYFA 4PJ5D 1RJYB 2VC2H 5JNYB 1DANT 3CZFB 8FABB 4APQD 2R2EA 4YQXL 4M6MH 1G7MB 3FB6A 5EN2B 4ZSOA 4UIMA 3SE8H 1JZ2A 4KKBD 4NM8L 1FZMB 2ED7A 4KKBC 1PY4A 3EZ8A 5T1DH 3K1KC 1OTSC 3QI9D 2DQJH 1FRGL 3RVXC 3IFPB 5FGCB 1T1XB 2GJ6A 4RX4A 4WFFD 2A2QT 2IANE 4GKNA 3MUZ1 1RZ8B 4DOHB 1Q0YH 4PJEB 1RZGA 4XP9H 2OZ4L 3RL1A 1NAMH 4KJQD 1N7MH 3WIHL 1RZ7L 4LLMB 3TN0B 1ZT4B 2VLJB 1EGJL 3FOLB 1JWMA 5K9JL 2CLZB 3D25A 5D1ZB 5D2LF 2G2RB 4POUB 3TWCL 3VRIB 4X6EB 3FTGA 2WIIB 4ETQA 5LVEA 4AH2B 4HKBB 1CE6A 1A14L 4S10A 4P5KA 3SKJL 1EERB 5EC1B 1EFXB 4E42A 2ATKB 1GSMA 3MYJB 4KDTA 3S36H 2QR0B 1ADQL 2FWOB 5J89A 3K3QA 1AD9B 3IGAB 5I1JH 5IFAH 1XF4A 1WZLA 1XCTB 1A22B 3ZL4H 3ZE1F 5BOZG 3PWPE 4WWID 5DVMA 5IBUB 1CL7H 4PD4J 4MX7A 5LXGL 3QG7L 3DMMB 5MEPB 1AE6L 3MSPA 5J56B 2ZUQC 3OAZK 4HQQH 2DMKA 3HRPA 5IB5B 3TBVA 5ACZB 1DQJA 4IRSD 4E0RA 4U05A 2AK4E 3UMTA 1WZ1H 3MV7E 5I76A 5ESQB 3PNWA 3LPGA 4EI5D 3DV6A 4ALAH 3IS0X 1ORQB 2DJSA 2EE9A 3CH1A 4XP1H 4OB5H 1ND0B 1NL0L 3ZTJG 4HFUL 4LLVB 4LRNL 4YEEA 1G84A 5C7XL 1OAXL 5I9QC 2A74A 4BFBD 1F58L 1Y0LA 4Z95H 5F9WB 4NN6B 2WIMA 2UYLA 1R5IA 3F6IA 4NN5C 1S7XB 1FFOA 5DFWH 2A6JB 4M7JH 4DKEH 2YPLD 1INEL 4PP1D 2APWA 4K7PY 2R1YB 5FHAL 4QTHB 2YKLH 2VZTA 2MJWA 3FMGL 1MHPL 4DZ8B 3B2VH 2PXYD 2NPLX 3HNVL 2UUDH 4Z6AT 4C56B 5J6GA 4EUPG 2FEDD 4XBGA 4R7DA 2NQCA 2APVA 2IQAA 4ONGH 1T03H 4Z7UF 4M43H 4H25A 5FHBH 1N5AB 2GJZA 1QP1A 3LRSA 1J88A 5GRVL 4DGVH 4FXLA 3BPCA 2FLBT 5FUZH 2C9AA 4FNLH 3DSFH 3TBVB 2EECA 3TFKD 1KNOA 4G8GE 4KZEH 4GG6B 2ZOLA 3Q2CA 4LCCC 5JUEL 4P4RB 5KN5A 1EVTC 3X13A 1NANI 3R0NA 5BV7B 4BELD 3UPAA 4L4TE 1CFTB 3CD4A 3X3GL 1WAAE 1M6OA 3IFOB 4NFCA 3VRIA 1D5XA 1FL6B 4IEFB 3BJLA 4OKVB 2BNRD 3RWIA 5CIPH 2NY0D 3GMPB 4P59H 2R1WB 3U0PB 1NL0H 1M7DA 1RJYA 4PUBL 3I2CH 1HEZB 3EYSH 5IFJA 5TE7H 4ISVA 4QRRD 1U9KA 1NGYA 4NO5A 4DW2L 1CLOH 5IBUG 3MRJA 4E5XA 3KYMA 3EJZD 3V6BR 4NC1C 1QRNE 5DMGC 1EXUB 1A9EB 5C0JB 3DUHA 4M02A 4XPFL 4NQCE 3PV6B 1SEQL 4XMKH 4JJ5B 5KANI 1WIOA 5BVPH 1R3HB 4TPRH 4V1DB 1LVEA 2IQ9L 4FQ1H 1UKTA 5GS0C 2Q7YA 5IHUH 1DSFL 4RFOH 1A1MA 1AKJA 4F8TA 4YHLL 5JW3H 1GVIA 5FA4A 4M61B 4G9FB 3TZVC 1M7XA 5C09E 3UZQA 2VKWA 3CXHK 3KYKL 4LKXB 5EPMA 4WEBH 1ZT1A 3QJHB 5HD8C 1NC4A 1F4YL 4L8SB 1D5BA 5EUOE 4M7KL 5D2NA 1AO7A 1XF1A 4KRPC 3IDYB 2EEAA 4L4TB 1XGRB 3W0WB 2ITCA 3ZSSA 4MYWB 5BXFB 2X89D 5MHSE 3ARRA 3KPRA 2X70A 1AGBA 3VRJB 2BFVL 3C5SB 1CLZL 1BVKA 4X6DF 1AC6A 4PP2B 4OM1H 4JM2A 4I18A 2J5LB 2BMKA 4TYUA 4OM0L 4OIIL 5IVXE 1DN0B 3QZWA 1W0VB 4M1CC 1F4XH 3NACH 2PW1B 1R5VB 1RZIA 2V2XA 2VITA 4N90E 4RAUA 2Y7QB 3BP7A 3J7HA 5F9AC 3T1FA 3HMXA 3TCXA 5ADOH 2BVYA 2B20A 2B1AL 4Z9KB 3BWUC 1WZMA 1U92B 2JJTA 2N56A 3T8XA 2VC2L 3KHQA 4O51B 5IT2H 5GGSB 3LDBB 4G6AD 1E4WH 1NGWA 1AD0B 2UUDK 3ZZ1A 2V7HB 4GRLA 5LAXB 3GSRB 1MHHB 2HTKC 1FFRA 3TT1H 2HLAA 2GHWB 4DN3H 5ALCH 5DYOB 1M1SA 3FFCB 1HSBB 1MLCB 5A2JH 2QJDA 2Y6SC 5DD3L 1DLHA 4QEGA 4FQCL 2Z31C 3GEWB 3CDGB 1EO7A 3AY4A 4G42B 1AO7B 4FFYH 4X80H 2LV4A 4YDKH 2ZWLT 3HZYB 5L2KA 2NY6C 3VXRE 4U1LB 3QQ4A 4IRSB 4UT6H 1VEMA 4D9QD 4C4KO 1Q9KA 3W2DL 2DL9A 1FSKC 3OR7A 4MDJA 4GLRH 2DICA 2FECL 1KYOJ 1AGCA 4NO3A 4OAWA 4LNRA 3NZHH 4JO2L 4YHNA 2IPUK 4LNVA 4TULH 2BNUA 3MJ6A 1JHLL 4Y16A 3DVNB 4CVZB 5DHVB 1CFSA 3VMNA 5F7EL 5J3HC 4WFED 3U9PL 4O58L 2HFTA 3LPWA 3WN5B 2Z35B 2WW8A 5F9JA 3U30C 4PJGB 1LD9B 3HRZA 2ILLA 2K1MA 5EZJB 4YHYC 4H5SA 4MJ5B 3P0VH 1F3DJ 3T0EC 2X89A 1QD0A 3B8SA 1T0MB 1VFBA 1Z5LB 4UQ2B 4JAMA 5IMOA 1EHXA 5FYLH 1UM4L 1ZHKA 5KJRL 2CMRH 2BSED 4KUCD 1K6QL 1F3JA 1KB9K 3OWEA 4BK5A 1MCQA 1OAQL 4JM4H 3S35L 4YO0A 2QL1A 3ULUD 3VH8A 4IOIA 1WAAA 4L4VA 1R5WB 3DVIA 1PYWB 4OZFB 2GCYA 5IB2B 2ZZUT 4HK3J 2W60B 4M7LT 3KYMB 1P69B 5J11C 1UM5L 2NY5C 5DFTA 1YN6A 2A0LC 2X4RA 1E6JH 3SCMD 2I26N 4LLYA 1P4BL 3Q48A 1A7PL 3H3PL 3KXFA 1HHHA 5JR1L 4KHTH 2YD9A 4PR5A 5JZ7C 5J13C 4KRLB 1HIMH 4HXAH 3FTGB 3E1F1 4JM2B 1E4XL 2OQJA 4GRMB 4CL7A 1AXIB 1OQXA 3U7WH 4WHYG 4LLAA 3BPLB 1IAOA 1VDGA 3BO8B 1T22A 3MLYH 4MAYB 1EO8H 3IXTB 3B2UD 5HHXL 5GJTH 5TE6L 1NBVL 4WUKL 2AJXL 3CFJA 3UPRB 3SDDB 5KW9H 1FVEA 1SVZA 3FMGH 2EYRB 4HGWA 1BF2A 1T2QL 4YX2L 4Q9RH 5DJ8A 1S78D 3R1GL 5EOCH 1JGVH 1PZ5B 1LO4H 1UB5B 2YN3A 1UWEH 3RY6A 1FO0A 2NY4D 4ZD3H 5JORB 5EH1A 4JFPA 2HRPL 3I9GL 4BZ2H 5E6IB 5HVHB 5E1AB 2D2OA 1GOGA 1J1PH 1YDPA 2E7LA 3MROB 5BCAA 2CKNA 2IGFH 3SO3B 4DW2H 3W5NA 2QKIB 4JY4B 1LO5A 2XG5A 4X8JB 5C08D 15C8H 1CR9L 4Z78A 4RAVA 5BMFH 2QQLH 3HLAB 4LFHG 1NEZG 3MXVH 4JQXA 5C0AD 4HCRA 1CGSL 3B4NA 2AGJH 4OI7A 4KJQC 5F1NB 4AEEA 4XC1H 1MCWM 5E99L 2QADC 4Q6YA 4JLRB 4Q2ZA 4QOKD 4YHNB 1V3JA 2HTLD 4IMLB 4F7EA 4EQ3A 3A6BL 1OP5K 3H6JA 1WBXB 2B0SH 3DSFL 3WBDA 4MS8D 2OTUA 4K71C 3CZFA 3EYSL 8FABA 4AEIL 5JW5B 5IMLB 4X7TA 5HVFB 4MXQC 4OGYL 3RPKA 2IAMA 1OP3H 1GGIL 3RTQD 2ICWI 2CGRL 1A7BA 5E1AA 4K94H 4R9HA 3SE9H 3LIZH 3TCLA 4JFFD 1HWHB 3UC0H 5SWSA 3JV5A 5ANME 1G9MC 5EBMA 1JNJA 3KPPB 5CP7B 5GRUL 4K8RH 1J0ZA 5DJYA 3HNVH 2AJXH 2FWOA 3BP4A 2APTA 2ZUSA 4PJEE 1HH9B 4JHWL 1CFBA 5ALBH 4Y4KD 2C3GA 4LSUL 5I74B 3VFWB 3D39A 1CXLA 2L0DA 1NCUA 4D9RE 3PQYA 4J12A 1MCBA 3BE1H 2NZ9C 1JK8A 5CLTA 3SOBL 3NPSB 1DFBL 3SKMB 5BZDA 1QG3A 2XKUA 1WUNT 5FYKL 1B2WL 1OGTA 4X9BA 3MOBL 4PJ8A 4F33A 3FN0L 1U58A 3CSBA 4EI5B 3Q1SL 2A6IA 5JDJA 5BS0E 4LGRB 5KS9F 3UJIH 3Q3GB 4Y19B 2IH1A 5DZLA 3X14B 1REIA 4JY6A 4F2MA 3G9VA 4PIRF 5F1NA 4GBXC 3O6ML 2EIZA 4HXBL 3VXRD 1RIHL 5LKNA 4JQIH 4FS0A 2K3TA 3PWNA 2NXZD 5IM7B 3LEYH 3D85A 3LN9A 4MXVE 2AK1L 2EYSA 3BGMA 4HS6B 3VXPA 1G0XA 3FQTB 1U8NB 5DRNB 4JFED 4U1SB 1KGCE 2UWEE 2XKNB 1ZLSL 4H20H 3HZKA 5EZOL 3EW3B 4X4XA 5FXCH 5ETUB 2LTQB 5FKAA 3T0AA 2CIIB 3G6AB 3O2VL 4AIOA 2RB8A 2XXMB 3CGTA 4PV8B 1QBLH 3OSKA 5BRZD 1EAJA 1FYTA 3LD8B 2QSTA 4OIBA 4Z7QF 1KTDA 5DRZB 3IDJA 3NVQA 2OK0L 4Y16D 4JQIL 5ECJE 3R0MA 3LB6D 5J6HB 3O3UN 4FMFA 4DVBB 1CD8A 1QSED 4S1RH 4Y16B 3X14A 3RWGA 3BKJL 1U6AL 4QHNA 1TIUA 1DQLL 2DKUA 5C9JB 2IANB 2MCPH 3TF7C 3JSSA 3B83A 1QQDB 2W07A 3PV7A 4YHZH 1DUYB 1MCPL 1ONQB 1J05A 3MV8D 3MLPA 3PF2A 1FNAA 3F5WA 1LEGB 2A1WH 1DBJL 2Z8SA 4PJGE 3ZKNC 1J8HA 2NY0B 1IEAB 4HQQL 1S9XA 2HAZA 3HG1A 5KJRH 4PJ9C 3OKMA 1YMHB 2PKDA 3VG0H 4Y16C 1WISA 4E5XB 2V6HA 3QEQA 2G5BA 4AQOA 4P5TA 4K7FB 4ALAL 3U1SH 2EDDA 3HE7D 4HUUA 3BAEL 4QRSA 3SE4A 3KPRE 4I0KA 5KSUA 3ULVD 2FIKB 5B4MC 2VZ1A 3GHBH 5ITFA 4M1CD 3MA7A 1FP5A 5D1XB 3ZDYF 2HVKB 3ES6B 2EDNA 2HJFA 2IADA 2DKSA 1RUML 3K80A 4XC3H 1PX4A 3S97C 4PRPA 1HSAA 3G08B 1AO7E 3AY4C 1S7QA 2W59A 4OT1L 5F3HA 3TM6A 2FYYA 1WIPA 3GUTA 2CKBL 1F90L 2VWEC 3GIZL 3IKKA 4G8EB 1TZGH 1CG9A 3MTRA 2R23A 5HI5D 4K3EH 2EH7H 1JZ3A 4NSKA 3O2DL 1JNLH 5GRWA 2DQEL 4X80L 1QPXA 1HHKA 1VADB 2GYSA 2HKFL 3QIUC 1RUKL 4MSWB 2ZPKL 3O3EA 4J4PC 1HN1A 3IDNA 3LKPB 3DVGB 1MVUA 3HZMA 2NLJB 4QNPF 5I17B 1FFQA 1YMMD 4KKLC 1OLZA 1K4DB 4P3DA 1J8HE 2C4FU 2ZSVB 1X6NA 2X4TA 3VWJD 4BZ2L 3DIFB 1IEAA 1DVFA 1SEBA 3CU1A 1WT5A 1ZWIB 4QTHA 4GBXA 2V5SA 2MNUA 2DLTA 4X6FA 3KJ6H 1JI1A 5FECB 3VRJA 1RK0A 5ESAB 1NDMB 2LE9A 1JWUA 2F54A 4DEPB 2XN9A 3MRBB 1NBVH 4WUKH 1ZGLA 3P9WB 1QBMH 3ARWA 4GAYB 3MV9A 1QKZL 2CO6B 1A4JA 1OPGH 3TVMA 4XXCA 4RQQA 1UYWL 5D2NB 1BOYA 4AG4L 3NCBB 5HDOA 1QR4A 1Y6NR 1SMOA 1K5NA 1YUHA 1EO8L 3JWOC 3EOAB 1ZANH 3HCVB 3MOAL 4I0PD 3ZKQD 4X4YA 1G6RH 1TCRA 1CXFA 2V5RA 3RWCB 3RZCD 5EC1A 3P73A 4I4WA 1JWSB 3NCYS 4L1DA 1J1XH 3DX8B 4IM8A 3WXWH 5TDNA 3WSQL 1IKFH 5HVGB 5D70H 1PSKH 3CUPA 5JMRA 1U8NA 1D5MB 4JKKA 1P2CA 4NIKB 4KKNA 1NBQA 2HKFH 4GG6F 4OQ1A 3C8KB 1A7RL 1UACH 1D5MA 2HN7B 1KB5B 2BSSA 1ZEAH 4KK5D 4LVEA 2ZCHL 1K4CB 4HC1A 4NNXA 1BFVH 3C6LB 5HJ3B 3SPVB 2VSCA 4HZLB 4XBPB 4WI7A 2WBJD 3GK8L 4U1MB 1SYVA 5FHBL 3HCVA 5I6XB 3MLYL 2PXYC 2W60A 4PJHE 2FX7H 3IJYA 1MRDH 4N1EA 1KYOK 4AT6A 2BERA 1P1ZB 3CFDA 4CU6A 4KUZH 4D8PA 2ATPA 2ARJA 3UTSD 4OLEA 5BZWB 2IAMB 3F12A 1WWWX 1I1FB 3KPQB 5JOPD 1T7WA 3HUJF 4V1DA 4GAYA 3DGGA 2WBKA 2YSSB 2X05A 3K0WA 4X7CC 2Z35A 1BFVL 4ZAKD 2HWZH 4OZHF 3S4SA 3RA7L 3BPNB 1NSNH 1M71B 2FGZA 3MODH 4KQ3L 4LOUC 4KKAC 4NQCA 2A77L 4ONOA 1UWGL 5DMIH 4CVUA 2FJFA 3QHFH 4TOYL 5GGVH 3TA3D 3TH4T 2NLJA 5GRVK 1GGBL 4LSSH 5HPMB 5EU6D 3KWWA 2CUHA 1MFCL 2C7UA 3LH2H 4HV8B 2X4TB 1MCDA 4TULL 1A7OL 1G7IA 4JPVH 3O6KH 5JNYA 1RUAL 3EOBA 3KPSD 1DZBA 2YRZA 4GMSL 2MKLC 5DQDL 1A3LH 1BZ9A 2ZSWB 4L3ED 4WW2A 4O58H 3TIEA 5CEZE 3FONA 4NQED 1SVCP 5J12C 2G75B 4NZRH 5ALCL 4ZSOE 1G9EA 4U6YB 4QLRA 4YZFE 2Q86A 4U1LA 1B0GA 1UA6L 4RMRA 4Y4FA 3ULUL 1R3LA 1D9KD 3F7PC 4H1LH 3O3DB 2EDBA 1G7QB 5HJ3A 1RULL 2JF1A 4K7PH 4N0CC 4NSKB 3AVEA 5T33H 2VTFA 3QEHB 4U2YA 4XWGL 2DWDA 5FAAA 3TPUB 3FO0H 2G9HA 1PKQA 4LSQH 4HUKB 4TSAH 3EYVB 4NQEE 1BX2B 5IT2L 4HUVB 5I1GL 4BSWA 5DD6B 1I3RB 1QVOB 3REVB 2D4DA 5E4EB 4YHPA 3QAZC 4ZS6D 4O2FB 4Z0BL 5C6WH 1UCBL 5DD6A 2ZUXA 2AK4B 2DQCL 4KJYA 4HIHB 5JPMB 2HJFB 1IC1A 5C0AB 1CN4A 1T83C 4FQJL 3DUSA 1JHKL 1Y6KR 4AIXA 2BRRL 3GI8H 4XHJC 1TQBC 4WENB 3UBXI 4U1GC 1S7WA 1WCBB 2EO9A 2OJZH 5GZND 4LGSB 1DL7L 1S9YB 1P84J 2GITA 3WHXA 2EH7L 1ORSB 1NGXA 2A6DA 3HN3A 3O2VH 3MRKB 3OX8B 2DAVA 1MY5A 1UH3A 4Q2ZB 4BFEA 3C5ZD 3I02A 2HRPH 4OZGB 1VKXA 5CP3A 5L8LB 1Z0NA 3BIKA 4RSVA 3DV4A 4G7YL 4QYOA 1OP9A 3SDXE 4P3DB 3QDMD 1YEHH 1U3JA 3Q5YA 1OT1A 4PTUB 1T0NA 4UBDD 3SDDA 5I2IA 1JMZA 3LKQB 2WQRA 3ULSB 4PJ9A 1NCDH 4TSCH 3CK0H 3PWPA 4PGEA 4KAQH 5JOEA 5IIEA 4HT1L 5JIKA 1KT2B 2JB5L 4GRLC 1HOCA 3UZVB 1ODAA 2NTFA 4JB9H 4MJIE 5K59E 2YBRB 4PJXF 5F8RC 4PRAB 2YC1B 5HYQB 4PRIA 3ILQD 3OKLB 1HDMA 5CGYC 4RMTA 4G3YL 4WI8A 2CLVB 4PJ8D 2DI7A 2AKRA 3SE3C 4O2FA 4PV8A 4EI5A 5IQ7H 2QQKL 4WO4B 3RU8H 4FQXA 3HR5A 3MMEB 4YDIH 5FV2A 1A3RL 4TPRL 2GI7A 3VJ6A 1CK0L 2VDKL 3GSVB 1BJ8A 4GQPH 4RWYL 2MSPA 2GTWA 5HHVH 2AJZA 4TSCL 2NTSP 4HGMA 3O4LD 1S8DB 3PP4L 5D6DC 1MAKA 4QT5B 2BXZA 3V8OA 5LWYL 2R1WA 4IS6A 4HWEL 2BCKA 2JE8A 2C1OA 4PJHA 2K7QA 4CJ1A 3RVTD 3C5ZA 4JFYA 4JY6B 3LV3A 4F2MB 2Y5EA 2GJ6E 5LCVL 3ARXA 2AJVL 2VDRH 3VGGA 3D0LB 5CBAA 4KI5C 4PYGA 3OKOA 4MCZA 4M5YL 3VMPA 3HPJB 4DCQA 3AGVA 1W2KT 1X5KA 2XWBB 4PRIB 2VSDA 5E9DA 4PRPB 2QEJA 1DQQA 1AH1A 2WANA 4ZOBA 4G7VH 3VXOB 4J3XA 4YBLB 1V7NH 4WTWA 5I1LA 3HC4H 4L3CA 5E94A 4HMDA 4ZFOL 5HYSB 2BDNH 3GJFH 4QHLA 2PETA 3FO9B 3VWKA 5E8OB 4OAWB 1A6TB 4PREA 5C9JA 3S5LB 3W82A 3P11L 2PTTA 1TXKA 2X10A 1I9IH 4Y2DA 4NOBA 3O6MH 4NQEB 1QOKA 5DQDH 3RUGB 3L6FA 2DF3A 3KXFE 3HTLX 4LPXA 3D69B 1AGDB 4H26A 3WE6A 4ZPVA 1T3FB 4N68A 1E27A 2A9NH 4P2RD 3U6RB 1WWCA 2EH8L 2XKSA 1CTNA 4DTGH 3ZDXE 2P8MA 3O4LE 1BM3L 2QQKH 1ONQA 4GOSA 4XVSL 3RI5K 4WI5A 4HIEB 1ZXQA 3GSNL 3WFDL 3PABB 4LCCB 2CQVA 1JYWA 3CVHA 5E00B 2BOBB 5HYFA 1PZUB 1KB9J 2VDNH 5J6HA 1JTTA 4P2QD 2F5AH 4PJDA 1S7XA 4FHBD 3VFUB 4Z76B 2G5BB 4P2QB 5E2JA 2EH8H 1BF8A 3T1FB 2BDNL 2FECI 2H6PA 4PYHA 4UILH 1RK1A 1INQA 4XNQA 2GT9B 1SHMA 3VI4E 3OF6A 3UTZB 4JO2H 3VXMD 4YXHL 4L3CB 3QDGE 4QOKA 1WCBA 1H3GA 4RGNC 5I1CL 1Q94B 2WBJC 5ICZB 3ZHKA 2LTQC 4LAQL 4YPGA 4JKWA 5E99H 4LLUB 4WWKB 4HHAA 1DFBH 3WJJA 4B53A 3MV8E 4O2CB 5DMJB 1CG9B 1RZFH 1WWAX 1NAMA 1CDIA 1GZPB 1HCVA 5D7SL 3LQAC 1FIGL 5IG7A 3VG9B 3LQAL 1ZT7B 4HUNB 4Y19A 2COQA 5DS8A 1TETH 5HHNA 5INCA 3TBTA 5C71A 1IC5L 2FEEL 1DANU 4G43A 2FX9L 1Z9MA 1KFAL 2VERN 2Y07L 3VWJB 5DJXA 4C4KT 4BSWB 4H1LB 3UTSA 1X5YA 1I8IB 3RWJB 1JGEA 2YPVH 5B8CA 3V0WH 2LAAA 1N0LA 3K7UA 5IHLB 2VE6A 3TESA 1GOHA 1YQVL 4OZ4B 1FYTE 4XPGL 4JPWL 1NANH 3WLWD 1S9WB 5HY9B 4PJCB 1JPFA 2GUOB 2GTZB 5EO1B 3QDME 5AYQA 5HGAB 2QQQA 4M1DL 5IV2B 3QB7C 3A6OA 4PJGA 3UDWA 3QXAA 2J88L 1ZT1B 1BQLH 5EO1A 5HGAA 5L2KE 4WV1B 3QNXB 5I66A 5DTFB 1MVUB 2MQ0A 1MCNA 3H7LA 1OOAA 2H32B 25C8H 3QEUB 3L7EB 5F71A 4JFDE 5D1ZD 3EOTH 5FCSH 5KTEH 1T2QH 2DQFB 4PJXE 4CNIA 4D8PB 3T77A 3VFRB 3RX5A 1UCBH 4R97B 4XNUH 4AQ1B 1UVQB 5DJ2A 3W9DA 4Q7DA 3EO0A 1OCWL 4PJEF 1G9NC 2JCCB 1I8MA 4GAJL 1IMHC 1N3NB 4KROB 2WWKT 1L7IH 3ULVL 4PLKD 4J3OC 4XWOC 2F15A 1B90A 5D6DA 3Q6FB 3DMMA 3SDDD 3FCTB 1JMXA 4YDLC 3CFKB 1CXEA 2FSEB 3NN8B 1LNUB 4NO0D 3SJVD 4ZYKA 1QA9B 2RBLA 3I50L 1AI1L 3OKDA 3WXVH 1KTLB 1TQCC 1FVCB 4XT1C 4GAGL 4I77L 5D6CA 3AS3A 2VLRA 5J1SC 3WDJA 4EI6A 5F96L 4X99B 1CDHA 4LLWA 1NKRA 3B5TA 5DR5L 3MYZA 3CLFL 2J2ZA 1FNHA 4P5MA 4PJFB 4ZFGL 4YFDB 3RHWK 4JO1L 4WUUA 1YMME 2J3SA 3T04D 1UM4H 3OHXA 1TVBB 3IETB 2CDEA 4WI4A 3O4LB 1KIPA 2X1OA 3MBEB 3T1WA 1NUDA 3OZ9H 5E70A 2IWGA 3TFKC 3TVMB 3GHEH 3O6FC 4S0TD 3ULSA 4K3DL 1BZ7A 1TZIB 2WV3A 4YDVA 1IFHL 4TVPD 4LRNH 2W0FA 3KPMA 1FL3A 4C56D 2CMRL 3P3YA 5F93C 4FFWD 5TE4H 3QUYB 2BJML 5JR1H 2ITCB 1P7HL 4N0UA 3B9KB 4TQEL 3H42H 5HSFA 4PP1C 3VCLA 5ESQA 3ME0A 1U8OA 3UJJH 3AS1A 2DQUH 3HI5H 5SWSE 5T5NF 3RBGA 1MJUL 3KPSB 1R24A 3SJVA 3X3FH 5T3ZL 3PDDA 4ODXA 2I07B 3C5JB 2FR4A 3KLAA 2V17H 3ZDYE 4CMHB 2FSEA 3QG6A 3LS5H 5TQ0H 2XN9B 4S1DD 1T7ZA 3MRDA 3QRGL 1GIGL 4YHML 1T3FA 3X11B 2DLHA 2XN9D 3CK0L 4ZUWB 4HS8H 1MFNA 2Q76A 3T0EE 3F7YA 2HMIC 3GSUB 4Y4FC 5CIPA 5LGKA 4G8GB 4MD5B 4ZDHB 3SCMC 1DCLA 3D9AL 5GISH 2VZOA 2FHBA 5L2JA 3PXJA 1ZLVH 2CK2A 4ZSOB 4PJ7A 3MRKA 3OX8A 2DWEA 5DR5H 5IKCA 2AV1B 3QIBB 4ISVB 3F8UB 4ETQB 3HE6D 3ULUC 5TF1L 4X83A 2P7TA 2NR6C 1N4XL 3ARGA 1OW0A 1JJUA 4OFYA 3SKMA 5E5UB 1EHLL 4FZEL 2GY5A 1QNZH 4LLQA 2NY7H 4M6OL 3O8XD 2DJUA 1JPSH 2HFFB 4C56E 2X44D 3T0ED 1CT8A 4JVPA 4HW6A 4Q9CA 1MIEH 1IL1A 3TT1L 5HGHA 1HH9A 1MFDH 4G80A 3SCMB 1K4CA 4JFHD 4LEOB 4KKCD 5JA9A 4ZXBB 4G8EA 4PBXA 5E9DD 3BZFA 4Q6IB 2BCKB 4P4RA 3QFDB 2E8YA 4JO3H 4ZXBD 1IKFL 3QQ9C 4JFEA 1KCRL 1QKZH 1OTTC 5GHWL 5D8JH 4M7ZB 1ZHNB 4JFEE 3VXMA 4DKFH 1FGVH 4G7VL 5C0GA 2NXYD 4W81A 2P4AB 4GRMA 5FM4A 5T1LB 4WFEE 2H3NB 4UT9L 2GSGA 3VJ6B 4R90L 3L95A 4X98B 5BV7H 3HS0B 1G9NL 2CKBB 5LCVH 4PPTA 1CS6A 4HKJA 4X9HA 3KPSE 4XVTL 1A7QH 4P9HC 5FCUL 4FP8H 4P4KA 3AU1A 2KH2B 5EORL 1GYAA 3W81A 1MPAH 1EIBA 3D18A 5C7XH 1FFNA 1HYSC 4PJDB 3MNVA 1DEDA 1R6VA 3DSNA 3B9EA 1DQMH 4HMEA 3TV3H 3JWOL 2OYPA 4DGIH 3AAZB 3BAEH 3KHOA 1ZWIA 3MJGX 4JZJA 4L4VE 4XNYL 2PYFB 3IAQA 4WTXA 4M8QA 5EZIL 1OGAA 4I8DA 5IVOA 4EBQL 1Z2KA 1CICA 3RDTD 3NAAH 3GMNA 1A2YB 3IU3B 3NA9H 3PWPB 3QPQC 4RIRA 4EDWL 2H1PH 2EDOA 5C08B 5C0EB 1TNNA 1I3GH 4Z7NE 3OB0H 3BSZH 4Z77A 1O7VA 4R6UA 2QADD 4A6YA 4L1HA 5K93A 1PAMA 4G9DB 3VD3A 5LGHL 1NAKL 4OCSH 2CO7B 2XWTB 4XMKL 2B5IC 3WFCH 4JRYD 3RGVC 1FV1A 2EDTA 1ZVYA 2MWCA 1W0YT 4C59B 3WFBL 5KSAB 4Y0GA 1Q9LB 4BQ6A 1RURH 3FFDB 5I1AA 5D7SH 3VFSB 3QQ3B 1KG0A 3UZEA 1OF2B 2APXA 5CINL 3HAEG 3T4YA 4N0YL 1C08A 1T1ZB 2XQBH 3NIDF 3O2DH 3MRRA 4U33A 5EO9B 3G5VA 2BVOB 1EDQA 2XY2A 3U79A 1LEKB 5TDPB 5KOMC 3C5SA 1JK8B 4JRXA 4RCAA 2LU4A 2NX5A 2VDLH 4JDZA 3MYJA 4KMTH 1MCKA 3CSYB 1CGTA 3FKUS 4FXKA 3HPJA 4DCQB 3I6GB 3RGVA 3IRZA 5IQ9A 4WW2C 1I9JL 3VRLF 5AYUH 1NCTA 5D71L 1NUFA 2ZNXA 2DOCA 5HYSG 5FDYA 4KTDL 4RQQB 1FG2B 5DEFA 3VE0B 4IS6B 1O5DT 5I1CH 4MDIA 5EPMB 3QIUA 5T3XD 1N5AA 2GJZB 4IRZH 3I85A 2G5RA 1BGXL 3HMXL 1U8LB 3QUXA 4S1RL 1LEIB 5JZ7D 5KSVA 4PD4K 5C08A 4MNGB 3IFOA 1NJ9B 3UTZA 1DVFC 5T1MB 5DWUH 1TZHB 5DK0A 3HG1B 5D7LD 5FO9A 4I9WD 5CJOL 1AXSB 1QBLL 2YUVA 1AP2A 5DRWA 3NFPB 1SEBB 2Q1EA 4ACPA 12E8L 4NQCB 5FYKU 3MO1A 1GZQB 5TGBA 3SGDI 1U3HA 4CDGC 4K8RD 4F7TA 1IM9D 5EBGA 2XG4A 2AJ3A 4ONHB 3DVGA 2AJSH 4JCMA 2NY0C 1FO0H 3ZYJA 4LPYA 3EOBB 2R0LH 3OJDB 5EBLB 3FQNB 3DX9A 3U36A 1AXTL 1TMCB 4FQPA 1K3IA 2XKNA 4GKZB 5IW6B 4HWUA 1H3PH 4NWUH 4OCMC 5CUSH 4OFPA 4R2GB 4B7LA 3HI5L 3CFDB 1DQQB 4OIAA 1T04A 1E27B 5J1TC 4BZ1H 2X1QA 1J86A 1S7TA 3VD4A 1CL7L 5IHZA 1I8KB 1CWVA 6FABH 1KF9B 3G6JE 4LFHD 2PW2A 1JN6A 3G6JB 1T5WA 1Z9LA 4P9HL 3CFJB 3NTCL 4YBLC 4MS8C 1PLGL 2GW5A 5MHSD 2FB4H 1CXHA 3STLA 4OUUA 3RA7H 4XAWL 3OAUH 3UBXA 1UEYA 4NNYA 3HZYA 2NMSA 3CLEL 5DGQA 2VDPH 1IGTA 4PG9A 1B4RA 5JORA 5T1DL 1ERNA 1F8TH 1L9MA 5ENWA 1CI5A 5IBLD 3O2DA 3KVQA 4NRZB 3TZVB 3SDAC 4KGJA 4P99A 4PJ5A 2ICCA 4X7SL 5F7EH 4IHOB 4Y5VC 3OB8A 1CD1A 1BBJA 1XIWD 4X4XB 4ZO9A 3GMPA 1UEMA 5FM5O 1BQSA 1PX3A 3D85D 4I48B 4PLNC 3MNWA 4YR6A 4K7PX 1QSFE 2VO5A 5DSCB 5E08H 4YC2C 4FQ2H 4EUPH 2AQ2A 2J1KA 4D9QE 5HYJB 1I1AA 3A6CL 4LBEB 3LMJH 1U92A 4HJJH 1U8JA 3O45A 2H8PB 1C8PA 4MZ3A 1ZT7A 3DPBA 4ZOAA 2FATL 4NN5B 4KQ4H 3W9EB 3AUVA 1NMAL 2R15A 1RJLA 1OHQA 3V95A 4AH2A 4Y5VA 3NFSH 5EUKA 1WJ3A 5JOPE 3OKEB 4HUVA 3NZ8B 3DIFA 1U36A 3LKNB 3MCLL 1IGIH 3V7AE 1EGJH 1EJ6A 5M94B 4RGOL 4XCNA 3E6FA 4NQDB 4YAQB 4WU5B 4CUCA 4GQ9H 1U8HA 4YC2B 1OL0A 3GBML 5C0CE 3D39D 2V7NB 4AENA 3VDCA 5FM8A 3S34L 4Q74A 2FX8L 1RIUH 1YC8A 2H26A 5F9DC 3PL6B 4L4TD 2R2HB 4MAUH 1X5ZA 4NJ9H 4XAKD 3DNKA 4OGAC 5TF1H 2B1HL 4AENB 1P7KB 3ZMRA 4HPOL 1GHFH 3RP1A 2Z92B 3TNNB 3BN3B 5D2LE 2FH8A 4OBSA 1R3LB 4QXTA 1ZSDB 4XHQA 4JG1L 3LHPH 5L88L 2YD8A 5JQ6H 5E8NB 3DGCR 3OJMB 4M48H 1YY9D 2FJHA 3C8HA 1EUTA 3KPRD 5CZXC 2EYRA 3Q5TA 1GIGH 1RJZB 4YHMH 3RIFK 4QO1A 3FO2A 1AJ7H 1JHKH 2C3WA 2AK4D 5E24E 2VDQL 1FORL 3BP5B 1G6RB 3DRTB 3QUZC 2VLJE 3V6OC 4PJIE 1NCNA 3BD3A 5TJWK 3T3PE 3KYOA 4ODTL 2N7BA 4Y19D 5FGRA 3ZE0E 1NMCC 1QFWH 1KCVH 3WEXB 1FH5L 3OHXB 5HHXH 1FNSH 2DQHL 3PGCB 4YUEL 3VGFA 1ZA3B 3GJFA 1ZKAA 5D9SB 4YPJA 3WIFA 5C0ND 1YNLL 3C09B 3AREA 4MLSA 1BQLL 1QRNB 4OZIF 3BKCL 4NHCH 5HHOB 5HHMB 1T6WA 4XP1L 2OI9B 3IJYB 4JG1H 4W6XB 3U4BL 4AT6B 3X17A 3MV7B 5F3BB 3FQNA 4AJ0A 3LB6C 3T4AB 2IQ9H 1T66D 4LSVH 3G5YB 4IHOA 5FYLE 3WFCL 2EIDA 2HH0L 1MFCH 2XV6B 1KJ3H 1UXWA 5I8KL 4HZAA 4PS4L 5D7JB 4U6VH 3DBXA 4TNWF 3Q6FA 4K7PL 4MMZC 1Q9OB 4CDHA 1M7IA 4LHUD 2VDMH 1TVDA 2EDJA 1G9ML 4XVJL 5EOQL 1HIML 5EZJA 4WFHE 1KLGA 5F21B 1IGML 3QEQD 2PR4H 4MQ7A 3R8QA 2L4OA 1L7TL 2PW1A 4IBLT 1VKXB 2QBWA 5IV2A 2CIKB 4V2CB 4WTZA 2E27H 1AGEA 4F57H 3HG1D 1R5IB 2Y36L 1N2RA 5IB1B 3BO8A 2ZUWA 6FABL 2E6QA 2FNBA 5B8CC 2PCPA 3QDAA 3ARED 3U4BH 3QJFA 3QCUL 1LK2A 1QFHA 5HI4C 1A7OH 4UINH 1UACL 4OSUL 2OX5A 4X9GA 4GBXD 1TVHB 4HV8A 4NRYA 5EO0B 5KS9E 3F6LA 3T0XA 4YUEH 3LQMA 3MODL 3BXNA 2ZCKH 5DVKA 3X3GH 4TRPL 1J1OL 4Y2DD 4IRJC 1RUQL 5F70A 5KVDH 1M71A 1OVZA 3TJHC 1N64H 3V52H 3FHAA 3ULVF 3DROA 2HN7A 2VL4A 2KQMA 1BOGA 1SJEA 4NQSA 4LOUD 3LDBC 2P1YA 2XACC 1FNGB 5FKPB 3AMLA 5I15H 4ENED 3CVIH 5I19L 4NBZB 1JBJA 1KBGH 3M17B 4PJBB 3VXMB 2W9EH 4P48A 4L29B 1S7WB 3UEZA 3I02B 1LP9F 5DVLA 1P9MC 5JOFB 1VACB 3MLTB 1KJ2B 4MD4A 5DJ6A 4IRSC 4QGYA 3P9MB 1BJ1H 1X4XA 1C1EL 3D0LA 2W65A 4IRJB 2LU7A 2AQ3A 2DM2A 2JB6A 2W0KA 3VXSE 2G2RA 4UAOB 3QRFM 2W65B 1KLFA 2EXYC 2NY6B 5DO2C 3V6ZA 2E7LC 2HFFA 2ZCKL 4O9HL 3VFMA 3DOSA 4H8WL 4P4KC 3D39B 5F6IC 4XP6H 4U1KA 5MEOA 2VLLB 4Z0XB 1ZS8A 3VXQB 1OARH 2OP4L 5GRXG 4PLJD 4P2OB 3RWEB 3N1FC 5D7IE 3QIBA 2R29H 3O6FD 2ZG3A 3OKOB 4KV5F 3RU8L 2QSQA 1BQHA 3PIQB 5L8KB 1TENA 1E4XH 5C09A 4JANA 1FZMA 5FEBA 3RZCA 4KVCL 5D1ZA 5GS0H 2QSCL 3F5WB 3LMJL 1I7ZA 3LSOA 2NZIA 3NCJL 3MRIB 4HH8A 5HYEA 4NRXB 3SGKC 1T1WA 3RNQB 4JRXE 4OT1H 1IVLA 1D3CA 2H32A 3P4LA 2IF7A 2D0GA 4P4KB 4OGAD 2DLGA 4N8VG 1KG0B 2IPTH 4HIEA 1RZ8A 1U3HD 5CJOH 3FT4A 1MJ7L 1NCDL 1U95A 2H2SD 3MLZH 5JXED 1IQWH 4WO4C 4DQOH 3CX2A 3OAYK 1OAYL 3JXAA 4OGXH 5IMKA 4KTYA 3BZEB 4K07A 1X7QA 2X4UB 1I7TB 5FYKD 5LWYH 4ZPVB 4PJBE 3PHOA 3EO1A 4WCYL 3V7AG 1U3ZA 3D3VA 3GBMH 1CFNA 1TTGA 4K3DH 5MEQA 1GC1L 1H3XA 2CKBH 4LCYB 4HX1A 2IBGA 5E9DE 2ZOKA 4LVNB 5D8JL 3RVWC 3HI1B 2P8PA 3SY0A 1Y18A 2DBLL 4HBCL 4KDWA 4PTUA 1INEH 1MCEA 2LVCA 2XY1A 4WJ5A 3ROLB 2Y1VA 4LLQB 1YYMH 2JJSC 3QXAB 4LQFH 3HA0A 4HUUB 1L0YA 2ZKHH 4XVTH 4OLUL 2ED9A 1JV5B 1CGXA 1MI5A 5TE7L 1JZ5A 5AUMA 4ODVL 4CGTA 4PJIA 4EOWL 1OARL 4ELMF 3OG4B 1QO3A 4KKCC 4JRXD 2O93L 4HFUH 4N0YH 3VD7A 2CLVA 1NLDL 1ZVSA 4G9FE 1T7YA 1S7QB 1S9VB 1DBBH 5FIEA 3VXTB 3MRPA 4LCIL 1YY8B 2NY5L 1LEKA 4X5XB 5HVHC 3T0DA 1R0AH 4OLYL 4D0CB 2B1HH 1WITA 5MP6L 5E6ZA 1TITA 2PUQT 1B0RB 5C8JB 2VAAA 4HKZA 1FGVL 1TTFA 1EEUA 3GO1H 5SX4H 5IWLC 1OCWH 5CEXB 3QNZA 3ZYZA 1EH9A 1EV2E 3QG7H 4G5ZL 3AXLB 2QR0A 4P2QA 5DQ9A 5EUOA 5C0BB 4NQXB 1MHEB 5H94B 3T65B 3RNKB 1RVFH 3ULVC 2APBA 1JUFB 1YN6B 2OR9H 1CLYL 3SDXA 3RTQB 3T4AA 5ENWB 2BNRA 5LBSL 1XH3A 4K9EC 3CMOL 1BZ9B 2ZSWA 4FTVE 4NUGL 1BGXH 3HMXH 5A40E 2XTLA 3B9DA 4WIQA 1JF6A 1CDGA 2VABA 1HOCB 1IAKB 4XPAH 3V4PH 4UDUB 1OAZH 5D7KE 1A4KA 1OGAD 5DJAA 2CUIA 4ZMAT 4C56A 3VFVA 1UM5H 2P8MB 3O0RH 3B8YA 1QSEB 4NN7C 3IT8D 4U1HA 1VGEL 4XP4H 3BRDA 2OS7A 1E6JL 5DFVC 3QUXD 5EORH 4Z5RB 3S7GA 1G7LB 4M9OA 4WU5A 4G8FB 3CVIL 3SOBH 3HUJB 1MHCB 1RIHH 4HG4J 1ORQA 1WBZA 3CH1B 5FF6A 4XRCB 3DMMC 1GC1C 3QUXC 4WTZG 1I9RL 4P46B 4XH2A 5J7CC 3QCUH 3ZE2E 4MJIA 2HJKA 4OKDA 3T2NH 4JFDD 5I74C 4NJAL 1QRKA 3UBXG 1Y6MR 1VEPA 1MAMH 1A5FL 3KDMB 1PEZA 5F7KC 3QFJE 1JGLL 1BFSA 1W72B 5D1QC 2N4IA 3UXFA 3WJJC 1J1OH 2VABB 3QUMH 2W91A 3NGBB 4FQXC 2EE3A 4CVXB 3BIBX 5IVXF 2EC8A 1RMFH 2XWBA 2E5EA 4F7CB 4XMPL 1DLHB 2NR6D 4KTEL 2F8OA 4JE4B 5DVNA 3Q1SH 4P5TB 2EKSB 1AHWC 1MJUH 4NQXA 1CGVA 2Z0BA 5DD5H 4UNVA 3QWOB 2VL5B 1FH5H 3HKFA 4X9IA 3L1OL 4APQC 1G7QA 4BH8B 2YPKB 4JR9H 4NUJB 4ONFH 1K9TA 3O8XA 2YSSA 4OFIA 3BSZL 4N0UE 3H42L 2MFNA 3NCYP 4J3SA 2W92A 2GSIA 4JRYA 1D9KA 5E2UH 1QSEE 2ED8A 2VDQH 5GS0L 4NZUH 2UY7A 4JFXB 4YXKL 4I0PC 5DQJB 5IFHH 3CZJA 4O4YH 2BY1A 3T08A 1EEZB 5DVOA 4FG6D 1DUYA 4FTVB 4KMTL 2VIRA 4Y5YB 4CADA 1KIQB 3RDTA 3EO9L 2HT2D 1T5WB 3QFJA 4HWZB 1J1XL 2QTEA 2PYED 3SBWA 4K9EL 1G9MH 1OY3B 4H8WH 4WUUE 3U2SB 1MJJA 5SWQB 1KV3A 5FB8A 5CAYB 1IGMH 1X5GA 3NIDE 4L8SA 3EO0B 4PGEB 1Z9SA 1FC1A 3SE9L 4ZYKB 1NGPH 5IROC 2BOBA 4X6BB 4RNRA 3WFBH 1P2CB 2W38A 2YBRA 3IU4H 1F3JB 3PHQB 1NDGB 4LU5H 4U2ZA 3MR9B 4NM4L 4QHKJ 3K74B 1YECH 4RISL 1AR2A 3U4AA 3RHWF 5DI8B 5J1AB 4QXGL 4PB0H 3KPRB 4LPVA 1KB5L 3NIGF 2C7UB 1SYSB 4LPTA 2ATPB 3GIVA 3RWHA 5DMKB 4YDKL 4XTRD 3EKCA 3RDTC 5BJTB 1QYGL 4YXLL 3NFSL 4XNMA 2D03L 2QQNL 1JL8A 2EIEA 3P77A 2YXFA 5KVGH 4GQ9L 4TUOB 1FC2D 5I73B 4FFZH 4FZ8L 2VXUH 4OUOA 4AM0B 2ZCLL 3MV9B 2OL3B 3V52L 1X5HA 1PG7H 3WFEH 2AAVA 4JR9L 2E6PA 2AEPH 1J5OH 4RISH 1ZHLA 4JO1H 3UX9B 4JM2C 3EJJX 3C8KA 1IAIL 3S4SG 1XCTA 1CBVL 3MFFA 2X4OB 1MPAL 1U41A 4WEBL 1QFWI 1P84K 4TRPH 4LCYA 5ELIA 4YEFA 1QYGH 3C6SA 4F15C 4YXKH 2PYFA 3R06A 1RUKH 1B6DA 1YN7B 3DUUA 2X1WL 5GGVL 5I8EB 1IAIM 4TOYH 2CJUH 3QH3B 3SDDC 4XBPA 2XZCL 4P5KB 4PRPD 2J88H 1OP3K 1QLEH 2AJUL 1FL3B 3KPMB 4RMQA 4X99A 2VDOL 2ZJSL 3MGTA 4L8BB 3P40A 1JI2A 1EAPA 5EOCJ 4BM7A 4PLJC 3SE3A 1Q0XL 3FQUB 4EXPX 5TQ0L 4YHPB 3MV7D 1DBMH 2J12B 2OR7A 2ZKHL 5DD1L 3QIUB 1S78C 4DZBB 2X4PA 5K9KB 4NZRL 5DSCA 1KC5L 5DHXB 5E2VH 4EVNB 4XXDB 5CJXA 3ZSTA 2WUCL 3BDXA 3WUWG 1SBSL 1DR9A 5JW4M 1ZGLB 5ESVA 3S34H 4XNUL 3CFEA 4KJWD 4JAMB 1F8TL 5CD5C 1KPVB 2Y4SA 4RGNE 4UTBH 5LJYH 1FZJA 1P7QB 2NY3C 4F80A 4XP4L 5FO9B 1ZA3A 3GJFB 1J0IA 4Q6IA 4PJ7B 3WS3B 5TE4L 1MEXL 5C3LD 5CEZH 2DD8H 1UH2A 5J12B 4RFEB 5F7MC 4MZ2A 5DFVD 2MMXA 4WEUD 4G8GD 2FB4L 5CIPB 2CLZA 1WF5A 2ZG1A 4UIMB 1DVFD 1A6ZA 2NTFB 2XRAH 5ACLA 2OJEA 2HMID 2HG5A 5DXWA 3MJ7A 5IEHA 1LE5B 4U1JB 1WIUA 3D9AH 4I3RH 4N0FB 3S3JA 4HIIB 1ZHLB 5HHME 1TJIL 1ZHKB 1X5JA 3VWKB 3T0VA 4IIQC 3QPXL 4BSJA 4L8DB 4DGVL 3J8F7 2DMCA 2XIDA 4OD3H 3TNNA 3IFPA 4RFNB 4KK6D 3C60A 4MA1C 1ZGLP 4K23H 1RMFL 3L3OB 4N5UA 4WHYH 5H2BA 1YEJL 4QCIB 1OT2A 1AKJD 4WFGD 4GW5A 4KUZL 1A1OA 3GSUA 4B7IA 5BV7C 5LQBH 1K8DA 5T1MA 1AKJB 5IB5A 1FNGA 5FKPA 4OFDA 4X7TB 5B38B 3NZHL 1MHPH 1T1ZA 3VXNB 1AR1C 1EK3A 4UQ3A 1YMMA 1JZ6A 2X1XR 1FN4B 4L9LB 4S2SB 4BFIA 4F7EB 4JFPB 2VAAB 3O3EB 4UT7L 5IGXL 2O61A 2BNQA 4FZEH 1AO7D 1T1WB 3VFGH 4U7MA 2ADGA 2MOVA 3BZ4B 3MA9H 4RMUA 3O4LA 2OR9L 4K7FA 1K85A 3TBWB 4OZGA 4HIHA 4MJ4A 1CZ8L 1YA5A 4KI5D 1FFPB 2X5PA 2NW3B 4PREB 3Q5OA 2VKXA 1HNFA 3QCTH 1FIEA 3QXUA 3W5MA 1NC2A 1MELA 5CSGA 1NH6A 4YDVB 1ZAGA 4PP2A 1KLUA 3MNWB 4PFEA 4OKVA 4L4VB 1NDGA 5E4IA 3QHZH 4RGMC 1ZT4A 4NKOA 3RIAK 4ZFOA 4QRPB 1BPVA 5EB9A 3RY5A 1G7JA 3T0EB 3CU7A 1F3DH 1YEJH 3PWPD 3RPIA 2CUMA 5J57B 1FO0L 3VFTB 5TH2B 5DHYB 5CD5D 3TO4D 1CE6B 1FL5A 3QEGL 4JZJC 4PJXA 3K2MC 1Q9OA 2J8OA 3EJYC 3GSXA 2HH0H 3BDBA 5IG7B 3BIKB 3MREA 3AU1B 4XCFL 1S5HB 2VMFA 4MNHB 4F9LC 5ID1A 5EBMB 1HHIB 1U3HC 4Y5YA 2EIBA 3INUL 3IXTA 5AUMB 5J11B 4HIXL 3QBTB 2NY1B 3BKCH 2E3VA 3DTXA 2DYPB 1FYTD 3MGOA 4ZUVB 5FOJA 3UC0L 1QFUL 2WQ8A 3NA9L 3VXTA 1P4LA 3NABL 3QXWA 2OTUB 3OAZH 5D1ZC 4LDEB 1FN4A 4UMGA 1Q72H 4KH2A 3SKUD 3BGMB 4WY7H 3QDJB 2I5YH 4X6DE 2YRLA 2H32H 2BHZA 2R2BA 2R1YA 3V0VB 3CFCL 3QT2A 4HX1B 2RFXA 1ZSDA 2AEIT 4OCWH 3RGHA 5KZCB 4DN4H 5KBNC 1FIGH 1UG9A 4XC1L 4DFHA 2AK4A 4W70A 4EUPB 1DLFL 4PJ9B 3MZTA 4ODWA 5L0QC 3UTSE 3FZUC 4PG2A 5BVPL 1EJOL 4MB3A 1HWGB 2IPKB 4LLVA 1D6VL 3FO9A 4FQ1L 3O2WL 3BMWA 3L1OH 2QQLL 2N1KA 3H8NA 3BH8A 4IOFD 5D5MF 5FUOH 3WNMA 4P23D 5F6IB 4H88L 3NZ8A 2EYSB 1UWXK 1X6LA 2R1XA 4MVBC 1NFDB 1KBGL 1A7RH 3WNNA 1JYNA 2YUWA 3GMQA 1GPOH 2VUOA 4JN1L 4RZCA 3GSXB 5D7LB 2A9ML 5DUPL 5D2LB 2NY2D 2I9LA 1G1CA 1OGAE 2YZ8A 3Q3GA 3V4UL 3PGFL 1AXSA 1TZIA 1GZPA 3GGWB 5IESH 1KN2H 3GFUA 4N8CL 3S36X 2ESVB 4LSPL 1C16B 1UQSB 3U0WH 3WFDH 1TQBB 5E8EB 1NGWB 3TA3B 4XXCC 5SX5K 3T3MF 5HHOA 2DLFH 4P9ML 2BNRE 3SDYH 3VFNB 3C60C 3G5VB 3CSGA 2OJZL 4O4YL 4UUJA 1GGTA 1I8IA 4W6WB 5GZOC 2Y9RT 5HDQL 1F6FB 1SYVB 1H5BB 4Y2DC 5BV7L 3QIUD 4KU1A 2VUYA 2D7NA 2AEQL 2YS4A 5C6TH 3SDAD 5IR1B 3GSNA 2JIXB 3S3SA 3V4VL 1BQHG 5B22A 5CSZA 4PGDA 4UU9B 3OR6B 3RVVD 4CN1A 1CQKA 3KYOB 1S9XB 4I1NB 5TDOA 4TSAL 3WUWA 3EJYD 3U46B 1UA6H 2GK2A 2D0FA 4HUWA 1JNHA 2AXHA 3RUGE 2ORBH 3IAGC 5H37H 3RVUD 3CFBA 3TO4C 2AP2A 2GQHA 3QI9A 3EDKA 5IKCB 4DGYH 4M5YH 1X4ZA 4K9EH 4F9LA 2W9LA 4NRZA 4XZUA 3GNML 5HPMA 3IKCB 2BNRB 2PXYA 4LF3B 5CD3B 5HPOA 7CGTA 1EXUA 4JRWA 4I3RL 3SDCC 4UTAH 3RX8A 3H7BA 3VFRA 3BGAA 4LDOB 1KCKA 5SWZD 2X4NA 3ARPA 4KK9C 3VG9C 5FKAB 3WFZA 2FZ3B 1U0QA 35C8L 4XNMB 1A14H 2R4RL 2CLRA 4PY7A 1X5IA 3JV4A 5BVJA 3VFOA 4RWYH 5D7LE 3N9GL 4GKNB 2JJWA 5FA3B 1JN6B 4TQEH 4Z7WE 4BYHA 3T0EA 2ERJB 4HS8L 5AEAA 1I3VA 5FECA 1RZ7H 5IW1A 1JZ7A 1OTUD 3BYTA 1OAKL 5DK3A 2RHEA 1T4KB 2J7LA 4HAFA 5A2KH 4U0RC 5GISL 4WFGE 4JHBA 1F6AA