2XBTA

Structure of a scaffoldin carbohydrate-binding module family 3b from the cellulosome of bacteroides cellulosolvens: structural diversity and implications for carbohydrate binding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
PVQVNSDLKLLFSNNGAAASSNQIYMNMKLQNTGSSTYDLSKITIRYFYTSDDDKALTYYSDYVSIGSASATFNNLSPVHAKANKYIEIKLASGTLGAAGAQWPSQSEVTIQGRVAKADWTNVDQSNDYSYPGSMSQFGENKLVAVYYNGALVYGTPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOMAL SCAFFOLDIN
publication title Scaffoldin-Borne Family 3B Carbohydrate-Binding Module from the Cellulosome of Bacteroides Cellulosolvens: Structural Diversity and Significance of Calcium for Carbohydrate Binding
pubmed doi rcsb
source organism Bacteroides cellulosolvens
molecule tags Sugar binding protein
total genus 35
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xbtA00
2WNXA 2YLKA 1NBCA 1G87A 3ZUCA 2WO4A 3ZQXA 4B96A 1GA2A 3ZQWA 4B97A 2XBTA 1JS4A 4TF4A 4JO5A 4B9PA 4B9CA 4C8XA 1KFGA 1K72A 1TF4A 3TF4A 1G43A 2WOBA 4B9FA 2L8AA 3ZU8A 2XFGB
chains in the Genus database with same CATH superfamily
2IV8A 2QTVA 4LDCA 5T1LA 4PLJD 3KPLB 5DJ2A 3U0WH 1KIRA 1SMDA 1KXHA 1HOCB 1V54B 2NY0C 4HG4J 2EE9A 1GJUA 1CB4A 1YMMB 2N7SA 4NZRL 3WY3A 1XGQB 4OUOA 4HJ0D 4HXAH 4U4BA 5FB8B 3BKYH 4UAHA 4IEFA 2X7LB 9PCYA 4Z8FH 2HG5B 5IMLA 2DZEA 2OJEA 5JQIB 4PWGA 5ERWB 3W0WE 2CM6A 4MSWA 2EXSA 3FS9A 2WNKA 5D7JA 1LL1A 2JELL 3QWQB 3KPRE 1IGFL 4PVBA 1LP9B 2VXUH 2Y1YA 2N59A 1Q9KA 3QQXA 2J4WH 4XNUH 4JGJA 3EYQC 2FX8H 1U58B 1AZUA 1GVIA 2G5RA 3BPOC 4NQQA 2GAZA 4L4TE 3OVUB 3QEQD 1NGZA 4ICWA 4MDJB 1HHKB 1KYFA 1NEUA 4HD9A 4U1KA 2PXYB 1MRCL 1R3KB 2J21A 4NCDA 2XWEA 5EIQA 5EBMA 2ZYHA 2XPGB 2OTPA 2OXHA 1ZDQA 4OLXH 4JFDE 4XMZA 3OC5A 1KYOJ 4YHNB 1KTKE 3SGDH 1TMQA 3QDGB 3ESMA 1H3VA 1G7QA 2YXWA 1I7RA 2Z1KA 2FH6A 5B21A 4K8RL 2WVSA 2XQYG 3H42H 4MMZA 5AG8A 4V1DD 3SBQA 5DMGD 3HS0C 4PRPE 1BFTA 2P8MB 2DY2A 1X5ZA 2D7TL 1TPXC 3IRZA 4G8IB 1FO0L 2XZQH 4U1JB 1XCQA 2YXFA 3T3PE 3UO1L 3A67L 4HWZB 3DOSA 3QHZL 1WPCA 1NCDH 3DURB 4QAWA 2H32A 3FF8A 4AZ8A 3J27A 1HEJC 4WSJA 7FABL 5C09B 3QK0A 5I17B 5C07D 3T4YA 1CK0L 2Y7LA 2ETWA 1PAMA 1OQOA 2VABB 3ZU8A 3QEHB 4WFED 2V2WB 2WTOA 1J9RA 2CD0A 3HG4A 3S4SG 3O8XC 5H8DA 4HFWB 4P5KB 3RIFF 5F7EH 3L4TA 4F8LA 2HLEB 4Y5VA 1EGJH 1TVHA 1ZS2A 3IU4H 2NY2C 2PCXA 3K80A 4B96A 4YDKH 1ASQA 1N8ZB 5L9DL 3QXAA 4F7CB 2BO0A 1MUJA 3EBIA 4O2FA 4YL9A 1AI1L 5AVVB 4FNPA 3OGCB 3CFTA 5DVNA 5T3XE 1OSPH 4U6XB 2IAMA 3ZDZE 4LESA 1XIWA 1JZGA 2AQ1A 2VDOL 5ALCL 1ICTA 3NSYA 1OP3K 3MXWH 2DD8L 4NKDB 4ZDHA 3ULUH 1H6FA 2YBRB 3Q8FA 4NRYA 2V7HB 3K6NA 5GZNC 3R18A 1GYVA 2RFXA 4FG6C 4HMCA 4J3OF 1IGIH 1P1ZB 2NNRA 3IRCA 1AGFB 2NZ9C 2X1XR 4O02B 3LQAC 4PBWD 2FCBA 5L4IA 3SD2A 5JA8B 5SX4H 4CL7A 3MLVL 3LZLA 3IDXL 4LCCC 3W39B 5EU5B 3ZTDC 4P4KA 3UEZA 5EEUA 2DQDL 4P2OC 3HZVA 4LIQH 5E8EB 1HIML 2X9YA 3MC0A 5AB2A 1V7ML 1ET7A 1X4ZA 3Q2CA 5JW5A 1HVXA 3PNWB 2UWEB 1F90H 5TH2B 3N40F 4PGBA 1GCYA 1N8OE 3C8KA 4QLRA 1GMEA 3LQZB 4LSPH 5EIIG 5F1OB 1NGQH 2BVPA 3NP3A 4JZJA 2YGVA 2ZP0T 3P9WB 1IX2A 4WUKH 3PHOA 3STLB 4AEEA 3OR6A 3W9DB 2DTSA 1HN1A 2Q3XA 1JNLH 5AW3B 3W11D 2B4CH 2Q86A 2VR6A 5KYNA 2NX5D 2VQUA 3B56A 5D1QE 1IBGL 3QZWG 3DHPA 3QI9A 3WO3B 5F7NC 5FHBH 4WEBH 2HT3C 4OI7A 1R0AL 2GFBB 3LQAL 1R3HB 2EDDA 1XSIA 5GS1A 2FJHB 4KJYB 3QJSB 1UACH 4L0ZA 1I1AA 1Q9LA 1NBYA 4M1GH 3TYGL 3TVMB 2HT4D 2J25A 1FN4B 1NCGA 4L37B 1UZ6F 2AJXH 3L4VA 4OKDA 2CDEA 1EZUA 3P3UA 3N04A 4TM9A 4ZO8A 4UINH 1IBDA 5KAQG 1F4WL 1A14H 5EC1B 1AAJA 2Q76B 3SDAB 2BIHA 4G1MB 4FMVA 2PMZA 4ZTOL 2IADA 1KNOB 1JOIA 2KL6A 3HN3A 4O4YL 3FQRB 1I9RL 3APNA 4HIXH 3CSYB 4ODHH 1I1FA 2WN3A 3UX9B 2B8OT 2VW6A 4IMKC 4HGKC 1FF5A 4UOZA 4QHLA 2F18A 1BMGA 1WWCA 3LDBC 4NT6B 4BXSV 3MX0B 2DLIA 1P5UC 1RI8A 1TFPA 5J5EA 2DDQH 2HN7B 4QYAA 4Z7OF 1R46A 2OMZA 2JB6B 3KPMB 2WLHA 2Y1AA 1RIUL 3APMA 3K5SA 5I5JA 1LD9B 4XBEL 3T0BA 2R56L 3SO3C 3ZK0A 4LNVA 2VJ8A 4FA7B 3FULA 1JCKA 1UCTA 2ZKMX 4KTDL 2DWEA 4CADB 2OSWA 2KQMA 4PJAA 4FFVD 4OD1L 1ZLUH 4D8OA 3P2BA 2O1AA 4YHYC 2AQQA 3D4GA 3APFA 1MI5D 2YA1A 1UWYA 3HG1B 2IV9A 4I3RL 4RAUB 5GS2H 4YNYB 4TLSA 4HLZG 3WJLA 1HWHB 2MCG1 5EEVA 3VXRB 3BWUC 3CFBA 5I1CL 1ANUA 1KWGA 5F9DC 1AO7A 2QL1A 2VW4A 2PWEA 1FNEA 4Z7QB 2NY1B 1LEGB 1Z3RA 2BJMH 4J3SA 2NTSP 1OANA 2FECI 2I5YH 2E27H 5GRUL 3MLUH 4BFIA 3LXCA 3UTTD 2CA4A 4I87A 1K72A 1M1XB 4MYWB 5I71B 4GXUM 4E2OA 1MCBA 3HR5A 1CLOH 1RZIA 3O11A 3MLYL 4AYEC 2EDQA 3ERXA 2G2PA 2WXNA 5IESL 1E40A 1J8KA 1X5AA 1S7TA 3PGCA 2EKSB 5D96C 5JXAH 1ZHBA 3NAAH 4NJ9L 5KYYA 1WA1X 1IAIH 4GH7B 4Y1AA 4MBOA 4PJEE 2VM4A 4UOW0 5IBUG 3PQYE 5EZLA 1JHKH 3EH1A 2NDFA 4TUOB 1TJIL 1A2YB 4JFOB 2CLZB 1QR4A 3MKKA 4CVXA 4NC1C 2Q8BL 4EN3B 3DTXA 3C75A 3PV7A 1UKSA 4OLUH 2FLMA 1LYQA 4G59C 2ZOKA 2ZUTA 2C9XA 2VDQB 3D25B 3CWGA 5EZIL 2X0VA 3K71B 2GTWA 4MFHA 5AZEH 5I18H 2IH9A 3ZTNH 4L9LC 1P4LB 3V7MA 2BSBA 2J2ZB 3O3DA 1SFDA 5GHWH 1SEBB 4OAWB 3L3DA 2DKMA 1UEYA 4G6AD 1J5OH 1BEYH 1WUZA 2H3NA 4U1GC 2CKBL 5IMOA 5IMMB 4QRPD 2LAAA 4AENA 4LCIL 4N2IA 4X6CB 2FO1A 2JI1A 4H7VA 3RWCA 3QR2A 1BBJB 1UASA 4ZUTA 1MCIA 1LJMA 3DX8A 2GJ6A 5C92A 2ROYA 4QHUB 3WEMA 3NGBC 4MRCA 2CDGA 1CFVL 1ZKAA 1AD9B 3HC0B 4GQQA 4N0CD 3SE6A 3CLFH 2P49B 3OQRA 4ELKB 2PO6B 2HTLD 3N55A 3L95B 1VACB 4JFXB 1RZ7H 5FA4B 1RV6X 3KJ6L 2VMDA 5FW8A 1G7JB 1BGXL 4FABH 5AENA 9CGTA 5I6XB 4DUVA 4DT2A 2WQVA 4U3SB 2IWKA 4K7PH 4R90L 3N85H 1QOKA 1U4FA 4V2BA 3MLWH 4GIPD 3ARBD 3HZ3A 3QIUA 3NRPA 3AWGA 1A7OH 5FUCE 3ATBA 4PHXA 2FLBT 3ORJA 4JM2D 4UU9B 1DJGA 3CUPA 5AVWB 5CUSL 3ETBJ 3LTVA 2CCWA 4PJ5A 5FYLL 2HTKD 4JL1A 3MJWA 3QQ9D 3QJFB 1TQBC 2VYRE 2DBJA 2FAUA 2VC2B 3RFZC 1R1CA 5IVZB 5ISZE 1WIOA 4X6EA 2WCSA 5I1DA 2DQJH 3RVVC 2EADA 3QUXB 1ZT1B 3CMGA 3WN6A 1CYGA 4JUSA 3TM6A 3M1BB 1T4KB 4FQJL 3CX5K 4BDVB 5BS0D 4GKOA 1J1OL 3DYMA 1UD6A 2BVOB 1OP5K 2X6VA 1UVQB 3NJVA 2QPSA 4NN5B 4WHYG 5CJOH 4ZSOB 3VG0H 3K3QA 2P1YA 5KAQF 3BWAB 2QMJA 3C5ZB 5CWSB 5BVPH 2VN5A 1X5FA 3DRQA 3QDME 4WENB 1Y6KR 3BQUD 3T1WA 1ZVNA 3P0VL 5DZPA 1I8LA 3BP5B 1USQA 3WNLA 3H2QA 2VH5H 4W6XB 1EVUA 4XCYA 1KJ3H 2XKUA 1J7VR 3EZJB 1IC5H 1MF2L 3D39D 4ZQTA 3WTUA 5B22A 1BD2E 2X0UA 5I9QB 5F72S 1S9YA 1XGYH 1OCWH 3VSVA 4NGHL 3LNHA 5AL8A 1T21B 1KDIA 2MEJB 3OKKB 4ZXBA 3FT2A 3R1GH 3LAFA 3RA7H 4Z6AT 2AXGB 2PXYC 4BBWA 3E3QC 2PPEA 1X7SA 4WWKA 5IMKB 1VKXB 3BGAA 2B2XH 8FABB 4PJIB 2ZP9A 3NCXA 1AHWB 1BP3B 4GG8B 1IO4C 2XY2A 5GGSY 4IOIB 3TFBA 4MA8L 3STZA 5MEQA 5T8IA 5HVHB 5ITBH 3D05A 4QXTB 3P4OA 1J1PL 2FYYB 4BK4A 1QUNA 1QRKA 4PIBA 1D5RA 4XNAA 3RWEB 5C70A 3MRCB 1OE2A 1KEGH 1FGNH 4QEGA 4R96B 2HFEA 1XL6A 2YGNA 1U91B 3LKOB 4MAUL 2ADYA 2XG5A 5BO1H 1I9JH 4GW4B 2HVJB 1XF4A 4IU3A 4LAJH 4GS7B 5JUEL 4F2FA 2QADB 5DUJA 5JOPE 1U8PB 4GFXA 4JCWA 1ORQB 4KUZL 5LNDA 2V9RA 4Q9BA 4XP5H 1NAMH 1PCXA 1XR8A 3RWDA 3VXMA 4F58L 5LGKA 2DIJA 1DJIA 1YEGL 3K74B 4QCIA 4UWQB 5IB3A 1NIFA 4MXWH 4M5TA 1O5PA 3GSUA 2ZG3A 1QAWA 5ETUA 4HWBH 2D31B 5I82A 4TNVK 3VD0A 5DRWA 2EICA 2WXPA 1M4KA 4M02A 2FSEB 4OVUA 1JD7A 1YEFL 2YXMA 1RVFL 5DLLA 5DRXB 1J8SA 4U7SA 1KYDA 2FHCA 2ICEB 4W4NA 4LQFH 3SPHA 1AMXA 4JKWA 4A6YL 4MCNA 1PD1A 3L5IA 3SJVD 1JV2A 2WB1A 1LM8V 1IM9D 1DQIA 1F8TL 4F2MA 4JUTA 1CTNA 4DIXA 4Z7VE 2ZP8A 2UYLB 2HWZH 5IBTH 3SYPA 1F56A 3C9NA 2XICA 2XWXA 3G5ZA 4DVRH 3I85A 1KOAA 1PYWA 2P5WB 2P48B 4WUUB 5I1KH 1QFPA 2LU7A 2P8PB 4NBYB 4PJ8A 4QRFA 4Y19E 2Q3AA 1KCVL 2O26U 4M5ZH 4YHML 1NCCH 2WTRB 1D6VH 3D5OF 5IF0A 4OI8A 1JHLL 1XZ0B 4Z0XA 1CU4L 3WO4B 4KKLD 4XPHL 1MJJA 1A7QL 3MGOA 2JJSC 1RK1B 3BE1L 2P43B 2AKRB 4BK5A 4M6OH 1X9UA 3WFCL 2ESVD 5FUOH 3S3SA 5BJTA 5ANMA 5LGJA 3VW3H 5HGBA 2H7WA 1MQKL 2F08A 4IU2A 1FFTB 3BUBA 5E5MB 5JPNA 2N7AA 2ZUWA 4D2NA 4YSCA 4P4RB 1ZK5A 5IIEA 1LK2A 5GZOC 5HHOA 4OZIB 1PDKB 3H8NA 1L7IL 3JWOH 4IMLA 4PG2C 3HRPA 4NQXB 35C8H 3F7RA 4D0DA 5EUKA 4M8VA 4AGLA 4PB0L 1JPGB 4S1DC 4RRPA 1NCAH 4FQIH 4FFYA 2IGFL 2Q87A 4AXWA 2HRHA 2J5LB 2A73A 3L4UA 1KTCA 4JHBA 5BUGA 3ECBB 1SJXA 1C16A 2YARA 5DD3H 1UTDA 5JW4M 3DK0A 4AYSA 4Y5YA 4Y9EA 1TVDA 4HV8A 4LVNB 4MA7H 5E6YA 4N6QA 3RL1A 3V6FB 3G08B 4O02L 1G5AA 1MW1A 2IBZX 5F88B 1RK0B 4X8JB 1T0NA 4JDZA 4POZD 4JHAL 4PTTA 5IEKB 3RAJL 3F58H 3RIKA 3PU7A 2IPTH 4GRWE 5ESAB 2B1AL 3TVMC 4F15B 1DCEA 4KO7A 1Z0NA 1JFHA 2FX9H 3JVFC 4QDGA 4TTDD 3SDAC 1AZBA 2NY6B 3ARDB 1I3UA 3MRIB 3RVXD 4LAQH 1NM9A 1R47A 3B3BA 3FO2B 1UKQA 5SX5K 4YXKL 3UYPA 4D3CH 1XGZA 3IN2A 1A9EA 4Z78B 1EUUA 4GXVH 4CC0A 1BHGA 2LAGB 3A6BL 2VLJD 5DUBA 4GI6A 4CNIA 1CD1B 3SGJC 1T1ZB 4Q74A 4TOYL 2QVMA 5FF6B 3S3BB 1GZPA 2QVFB 5KOMC 1ZA3B 4G70B 4NKOB 2Z8SA 1F58L 5GGQH 4PP2B 2DYPB 1AGEA 4LLAA 3TLRA 3NN8A 4IYKA 4NUGH 3WS6C 4EDXA 2X0WA 3TT1H 5I0WA 4EI0A 3HI5L 2YA0A 5LHDA 4NUJB 4DVBB 3BFOA 1LP9E 4JFEA 4UM8A 4N2FA 2YMTA 4WSGA 5KUKA 3BP7A 4PRAB 5DI8B 1XBDA 2AK4B 3IEAA 4GUQA 3NCWA 3CGTA 4L2LA 4TSBL 4FJYA 1KIPB 1UZ6E 3I74A 1QBMH 3MLSL 4UAOB 3N06B 3HUJF 3QR1A 1YEKH 2NQDA 3GKZA 1FFPB 4HH8A 1CL7H 5DXWA 3M46A 3UADA 1N6QH 2YAMA 3GT6A 4J3UA 5E23A 3SYCA 4HG4K 5AW1B 2R23A 3KPSD 3KAAA 4S1QH 6FABL 2NY1C 2HUHA 3GHEH 2HJFB 5TE7H 1DP0A 2HYMA 2J88L 3NUKA 4MDJA 3PABB 3VYOA 4JGNA 1FLRH 3LS4H 3GUTA 4ABWA 5I71C 1EGJA 4OIIL 1JYXA 5TDNB 4JN1H 2CU9A 1HKLH 5JDJA 5C0CD 4M62H 4W9EC 4NP4L 1WFTA 1YNTA 3SKNA 3ZE1F 4EZJA 1F6AA 2VAAB 1JFQL 3M8OL 4XTRD 1N0XH 4R4FH 3UERA 4XODA 5I5RA 3JWNG 3N1PC 5FA3A 3ES6B 3NP4A 2A6KA 4Z76A 1AG0A 4EN3C 3T77B 4GRLA 3HC2A 4GQ9H 1KYOK 3A6CH 3TYFA 2IQAB 1PLGH 5E8DL 3GO1L 5IG7B 5C8JA 4UQ9A 3ZKND 1NCIA 5ESVB 2D03L 4AW4A 4FAAB 4BZ2L 1NAKH 3BDBA 2JCCA 3FO9B 3MACH 4UQ2B 4X7FC 1QVOB 3V7AG 5KBLA 3CK0L 4G8GD 4ODVH 4XNQB 1EHAA 5BZDB 2C9SA 3DO7A 1NA8A 4HFWA 4A55A 5EFIB 4F3FA 2ZPKL 2WBJB 4Y7MA 1JGUH 4FC3E 3LCYA 2HFFA 4FXTA 4FHJA 4M4PA 2VXSH 4OT1H 1Z3GL 5E8NA 3VXQA 1L9TA 3WJMB 1FVCB 3HNVL 1N8ZA 3FO0H 1X6LA 3E38A 2CR3A 5KEZA 3F12A 4UT6H 5I1LB 3KZ8A 1E9PB 4HJ1A 4YHOH 4YHZH 2XZAH 2E3VA 2PO6C 3D51A 1XGPA 4XP1L 2DQTH 4D8PA 1PQZB 3K5RA 2AK1L 3CHQA 3QNXA 4U3CA 2E0PA 1AZVA 3NOIA 4YPGB 5JIKA 4FYRA 4RDBA 1AGFA 5FDWA 2DEYX 4G7VH 3ZRCC 3HI6H 3AXLB 4Z7WA 3REVA 2Q9OA 3I50H 2Q2LA 4H40A 1N12A 4HAKA 2K7PA 1NGPL 4LL9A 5EUOB 2CO7B 4H0LC 4P8QA 3SYQA 2A38A 1E6OL 1LNUB 1XD1A 3DOHA 1S9XB 5DC0A 3VD3A 2DWTA 4LCUB 3OJDB 3QUXC 3PV6A 3WNJA 4M00A 4KXAA 1JDCA 5I76B 4DKAA 2QEJA 2Q7NA 2VE6A 2GIXA 3AXIA 4NJAH 3RY5A 2ZXDA 4NWTH 1OE1A 5HBBA 5FKPB 3L7EB 5A16B 3PWUA 4NN5C 1R6VA 2UWEA 2WUCL 5TH2A 2NW3B 3CZEA 1UOWA 4CMHB 4FMFA 2ZUSA 1Z5LB 3C5ZC 2YPLB 5HI3C 4JG5A 4N2HA 2XPZA 5FWQA 2MTAA 1QI4A 4NZTL 4X9IA 2K0RA 5ENWB 4HIIA 1ZPUA 4YL4A 3VI3F 3CN4A 5GGRA 5SWSB 1WFJA 2XLLA 2IPUK 3I75A 3I02B 5I66A 1YCSA 1VPOL 3BUTA 1QNZH 2QT6A 5CJXC 3ULVC 4XNBA 1DQQB 3EOAA 2VLMD 5F7DB 2FBOJ 4GW1B 1MY7A 4YQXH 4LPUA 2PR4H 4V11A 1RSFA 3FCSA 4LRIC 3ETSA 2ENJA 4M56A 4NKQB 1I3GH 5DFVC 4IK7A 1L9PA 1IBYA 4X80H 5BRZB 1Y0LB 3AREB 4KJYA 4TSAL 2A7BA 2QGCA 3WFZA 5JHMA 2J5WA 4KZDH 1DQVA 2JFCA 4GAYA 1JE6A 2X3CA 1CGWA 1AHWC 1S5IL 3MROA 4Q9QH 4FG4A 2CO6A 2VC2L 4EVNB 2VLKB 4UIMB 3RGVD 4Y2OB 1QFUL 5E2TL 2R0WH 2Q76A 4FQ2L 4WJG3 1UYWH 3ARWA 2DIEA 2XA8L 4MAYD 5CJQH 1QLEH 1VENA 4WO4A 4HLJA 3VSUA 1UGNA 4C56E 4GS7C 4RESB 3HE6A 2APXA 2VDNH 2NUTA 1XB8A 1EO7A 5DFTA 3VCLB 2QADC 3VXNB 1P4UA 4NHCL 4TUKL 3L3IA 4P3CL 5CSZA 5EORL 1JNHA 1EHNA 2D8KA 1OCZB 2DLFL 4BD4A 2CA3A 5D1XE 3WS3B 3FUMA 3H3PH 3S8FB 4QKXB 6CGTA 3ULVL 1XZWA 3HB3D 1NBCA 1PIGA 4URTB 1AC6A 2PW1B 1RL1A 3N91A 4M03A 4Z7IA 1T89C 3GI9L 2YEVB 4QY8B 1VFMA 1E9QA 3ZW3A 3NT0A 2WSDA 3TCXA 4ZD3H 1DL7L 1I3RB 3BOVA 5JHDE 1E65A 2BSTA 2WLYA 3WEXB 3OXRB 3HAEB 2WB7A 4FULA 5AD0A 2WLKA 4AJ0A 1RUKL 1XCTB 3ARFD 3GJEB 1TCRA 3F7VB 2IDSA 1ZV9A 2H2SD 5C71A 2BC4B 1SXCA 2WO2B 2R9HC 2DRUA 3B8SA 3T3MF 1J8HB 5HVFB 4NS0A 5DJZA 4ZO6A 3SY0B 3HG1A 5TDOA 1BZ9B 4LHUA 5E1AB 3C5JB 3JT2A 4UDTA 4XMUA 5AUMA 3UBXA 4KK6D 1MCRA 1AKJD 2GC7C 3L7FA 4R3SB 1CD8A 3I9AA 3DUUA 4PREA 4L1LA 1MH5B 4KRPC 1S6NA 4UNTA 2I9LB 3AT9A 1JZ3A 4PN6A 3SQBB 3WO4C 4NQDB 3BKCL 3S0PA 4EIUA 4NPJA 1THCA 3MNWB 3DIDA 5FCUH 1WAPA 2WANA 2QSVA 1JWSB 2W0FA 3L1FA 4NQCA 3A4FA 4FZEH 2J6EH 3L4ZA 2F19L 4OF7A 2OA9A 1ZSHA 2ZKWA 4NI3A 3L3OA 2D7QA 1QRNB 1V55B 4N3TA 2BFGA 4ZUVA 5MENB 2X3AA 3FFDB 3J8F7 3MRNA 5TDPA 5HHPA 5MEOA 4NQTA 1OTTD 4QRRB 4UDUA 5EF3A 3Q13A 3G6AA 4G9FB 3HKFA 3KVPA 5K9OA 3DX9B 3T0XA 4XMPL 5IHBA 1A0QL 1BZOA 3IN0A 3VXOA 1KTBA 5CU9A 3IPEA 3KWWA 1FV1B 4LPCA 3QORA 1W15A 1PX4A 1AS6A 4F7KA 4JB9H 3D25A 4HIQA 3UZEC 3SGDI 4LASH 3WIIH 5ICUA 1P9MA 1SLXA 2QHRL 3MYZA 5EO1B 3OX8A 1YA5A 5EA0L 3H9HB 2J5LC 4HKZB 1ZGLA 1S78C 3WHE0 1GTNA 5LKNA 2AI0L 4ESKA 3V4PB 1QSZA 1BM7A 1CXEA 5M95B 3I9GL 1KLGA 4ZUUB 4X6CA 3U9PL 4JO4H 4LVNC 3HJEA 4LCWD 1MCLA 1BBJA 4MJID 2OMBA 3IJEA 1OM9A 2XWBB 5GJTL 1SQ2N 5HYSA 5I8CB 5FGSA 5E5UB 1DQJB 1TJHL 3HC3L 4R7XA 4F15C 4XOEA 5KUMA 3L9YA 2A0LD 4JKKA 1KXTA 3BSHA 5CBAA 2A77H 2FECL 4D9QE 5F7LB 1VACA 4DKEH 5AB1A 4PJAF 4U6VH 1G7JA 4XT1C 3KE0A 5FUZH 1KN4H 3II3A 3MUY1 4PJXB 1FORL 1YYMH 3VFSA 3BO8B 4U05A 4HIJA 3U2SA 5JIQA 4X4YB 2V7NB 2CH8A 4TVSa 1EXHA 2OMUA 3QEQB 4PRDA 1YQ2A 1ZT4B 3DXAA 2BRRL 3T08A 4YE0A 5CS7A 4RX4A 1H19A 2V2TB 3WAKA 1R5IB 1CFSB 1KPRA 1MW3A 1YLBB 3FU7A 1R24A 3QJFA 5CN2A 2QV4A 3E8UH 5T5NF 3LXUX 5IHLB 3FUEA 3NH7L 2E74C 5EO0A 3O45B 3MREA 3RDTB 5FYJH 2X6BA 2XA3A 1WFUA 4N8UA 4GAAA 3ULVE 3BRFA 1ZT1A 4ZT1A 3O4LB 3U0PA 2PYEA 3QZLA 2XZCL 3M1BA 4PRBB 4K3EL 3OF6A 3X11A 4PUBL 1ITCA 1Q72H 4MWFB 1S8DB 4V1DB 1ZA6B 1DLFL 4HT1L 3G6JA 4U7KA 4L8CB 3FU3A 1RZJC 3GSQA 4UAOC 5B8CB 1F86A 3CPLB 3MLRL 3DSFH 5B3JE 2WBKA 4PGDA 2OTUB 1MHCA 3HC4H 1C8QA 4UB0H 3KBPA 1EZVY 3P77B 1WUNT 4ZS7L 2C1PB 3BP5A 1DBAL 4JVWA 5DMKA 1GZQB 3AZUA 2JKSA 5C0RH 4NB7A 1CFTA 5C07B 1INDL 1NAMA 4PG9B 1CR9H 5FLVA 2CO2A 3FCTB 2QELA 1YYLH 5FOJA 1P7KB 3TFKC 2GG1A 4ZMVA 4HWBA 3BEWB 4Z7UB 3T0AA 1DSFH 1VKXA 5C0IB 3PP3H 4NENB 8FABA 3RI5K 2EDFA 5CINH 2D7PA 1XTLA 2H41A 4OLEA 1LO5A 4IOIA 4BQ9A 4GMTH 4L5FL 2J56A 2L7EA 4K7PX 2FYYA 2H8PB 3U4BH 1U21A 3CN2A 3U7WL 3ZKQD 1N26A 1FG2A 4PFEA 1I8KA 4HEPA 2XVLA 1EO8H 5DJ8A 1W0VB 3HUJE 5BXFA 4U1MB 4RVBA 1RZJL 2R0ZL 4A7VA 5EZOH 2AJ3B 2TAAA 1R17A 5SWZD 4F7TA 2NYZA 4Z7NF 3EO9L 3TNMA 3BAYA 1D9KD 4K23L 2Q8AH 2IALB 5I6LA 3BHBB 3GBNH 2Q6WB 2F74B 3IDMA 2EH8H 3NJGA 1YPZB 4GW5A 3K46A 2VITA 2Q10A 2BNQB 4KVCL 4RRPG 5IGXH 3BISA 4PGEA 4L8SB 1A6UH 4QT5B 3TN0D 5E94B 2DTML 3FNKA 3UGUA 3K6IA 4DGVH 2CLRA 1MCCA 4OIBA 1CFNA 1E27B 2R4RL 3FTYA 3MRBB 4R5TA 1E4WL 1UCBL 2K1MA 3SDXB 1MREL 1ZSDA 4OLVH 4XHJD 4PJGE 4AI7A 4HW6A 4L9DA 1IEBA 5B1AB 1SBSL 4LSSL 1ZIAA 2IPKA 3IDNB 2QJDA 5T1MB 1NANH 1JIBA 1DBML 4LLWB 1XV8A 3U79A 2AEOA 3I6LD 4GO8A 1FVEB 4LP8A 4DKTA 4DGYH 4KKZA 4WUUA 4AITA 4QNPF 4M1CC 2IAND 3QCUL 2FBJH 1HEZB 5HHXH 2R0KL 4OU3A 2GI7A 1TO4A 3WMSA 2YAOA 2EXWC 1G7MA 1XZ0A 2YC1B 1TIUA 4MD5B 3FQ1A 3V0WL 3FFCA 1S7RA 1A6VH 1QO3A 4QHPA 1COBA 2X4UA 2X4TB 2NNAB 1OP4A 2J8OA 2O6DA 5EBWB 3MLXH 2HH0H 3V52L 3BIKB 3QG7H 1F3DH 2OKMA 1S7WB 1JXKA 3MV9E 4ZW3A 2FWLB 2IAAC 3WUZA 3PP4H 3LNDA 4P4RA 1AR1B 2B3IA 5DT1H 4BV1A 3FQWA 3IFOB 4BFGA 5ICYB 4CMHC 1IEAB 4MS8D 3RL2B 2XWJA 4OD3H 4NQXA 1WS7A 15C8L 5EOCJ 4GI8A 5D71L 2OMXB 4JGMA 1E5YA 4G3YH 1X5GA 5FGCB 2R8SL 2ZTBA 1EDYA 2W9LA 1IAII 2BWQA 3K8MA 2F54D 3LNEA 4BFRA 3S2CA 4H8WC 4ODBD 5JW4Q 5JYMA 3TJHD 3ULAB 5KVFL 4IS6B 4G5AA 3QIWD 3V6FA 2BNRD 5AAPA 1XR9B 4AW7A 5G4MA 5F88A 4C4UA 3BSZL 4I89A 1ZHKA 3VFMB 3DPBB 5IEKA 4E36A 1G9MC 1M9WA 4RQQB 1Z2KA 1ETZA 2B20A 2WO4A 2XSKA 3EYOA 1X6NA 3UGEA 1MI5B 3SDCD 2Y5TA 1RHHA 4Q58C 2X05A 4L5FE 4PTUB 3ARDA 3WFDL 3MRIA 1A7NH 1MWOA 3MUZ1 5A2FA 3GBDA 4BA8A 3CMOH 1ZY9A 3P02A 4X7EC 4OCYL 2JKNA 1KELL 2NYYC 4X83A 1UM6L 4FTVB 1S3RA 1KT2A 1GGBL 4MMXB 5IVOA 2OYKA 4BFEA 1TITA 2IBZY 1UUNA 1Q0XL 2Y0SA 2X1WL 5TPWL 1KJ2B 3S8GB 3VTMA 1T1ZA 1U6AL 3UTTB 4NKIH 4DEUA 1BVLB 3N2JA 5F9WC 2J55A 3SKMB 4DP9X 4UYPA 4MZIA 3N50A 4LRNH 3E80A 4YFDB 3W57A 5K1NA 4CKVX 2K4WA 5GIRA 4QRTA 3BFWA 5AAMC 1E3ZA 3QG6A 2H0PA 3MRGB 1J88A 5ECGA 2ENPA 3B2UC 2F2HA 1WZ1L 4X4XB 4N2NA 1UWGL 3DJ9A 5I1JL 1GKOA 2Y36L 2M8XA 3AVEA 5IZ7A 3CDGB 2X4QA 3QEUB 4UUJB 5ALBL 1OGAD 2R4SH 3ZL4H 2XNAB 2YK1L 5CZXD 3T0EB 1QSEB 4FI7A 2W9DL 4Y9GA 3N5AA 5HDBF 3U48A 1G9ML 1UM4L 5H2BB 1OAQH 4Z3JA 1SVBA 3CHOA 4K0OA 1A3RL 1P84J 2BK8A 4YDNA 5CZVL 1XF3B 5BZWA 5LAXA 3D2TA 1TYEB 4ZW8A 4JRYA 3MBEB 1ORSA 3WGUB 5ILTH 1BFOB 4OW6A 3QFJB 5MEPB 4XBGA 2Z7WA 1JBJA 1IT9L 1B90A 3BJLA 1N5YH 2H1PH 3V95A 2V5YA 2XFGB 4JO2L 4JHUA 3TO4D 1EFXB 3E0GA 3PDDA 5JQ6H 5HVGB 1OXYA 4G42B 4N2CA 2NXYD 1CLZL 2YUVA 4LSTH 2YZ1A 5LAPA 4JCLA 1J87A 1YHPA 5TQ0L 1JZ7A 1IGYB 4GP8B 3CVHB 1A3LH 5IB1A 2FB4L 2OJZL 2WPGA 4FZ8L 1MJUL 3SGKC 3VFUA 3HNTH 5D70L 3ZKMC 3GKWL 3OKEB 5F44A 5HJGA 43CAB 4UT6A 3EH2A 3WXVH 1QEWA 3OB8A 5BRQA 1MVUB 3OLDA 5IVXA 1H6TA 4O2EB 5JDSA 2B1OA 3NEEA 5ICXA 4X9GA 5D6DC 3FB8B 3B9KB 5J9PA 1O5DT 3QXDA 2FJGB 2P5PA 1I8IA 3BPCA 5J57B 2EIZA 2BNUB 1KBWA 2VUKA 5F97E 3IMVA 3MUGB 1M7IB 3JWNE 3T3ME 4XCCL 1LEKA 1E4KA 3SDDB 1XSOA 1F2QA 4CGTA 2V6HA 4ANKA 2PP8A 3HMWH 3SBPA 1K4CB 2GSGB 2YD8A 1U9KA 2XPYA 4YXLH 4POUB 1JF1A 2V9UA 4CDGC 4MNQE 2ATPA 1SXZA 5F96H 3WYRA 5E2VH 2H47C 2JQAA 5IQ9A 4AQEB 2N3JA 4MA3B 2C3VB 2A6DB 3WY1A 1I8AA 2F53D 5ADPL 4I4WA 2Z91A 2F5BL 4QTFA 2HVKA 4W68A 1BZQK 1QZNA 7PCYA 3N0AA 4P2RD 3V7AE 5KVFE 4FE9A 5GRWA 5FDYA 4PLJC 1BXVA 2WBJA 3P4NA 4GAJH 4LKCA 2W81C 5HHNA 2CRIA 1T7WA 2I69A 3UO8B 1KXQE 3ARZA 2XHNA 4XXDA 1JXJA 4ONFH 3P0YL 3WUWB 5B39B 4PYHA 1NPNA 5ACMA 1PZDA 5I2IB 1S5HA 2BSCA 4Q0XL 1QBLH 4FF9A 1R34A 3KD4A 4GNKB 5IUCA 3BQUB 4M8QA 1F6LL 3BZFB 4GQRA 1JNNL 2J1WA 2R0LL 2VXVL 4OM0L 5ANHA 5C08B 1VZIA 3VFWB 3V0DA 4X99B 5ID1A 3L3GA 4FQHB 4JPVL 5LJYH 5IEHA 5E6IB 4HKJA 4K7FA 4YPGA 4WU5A 4ZTPL 1R33A 1DEDA 1NL0L 1EVTC 1BCIA 3A5VA 4WHDA 3PL6B 3QUZC 2JTYA 5E2WL 5INDA 4MTMA 4C83B 3DOIA 1RUQL 1OAUH 4NDMA 4YK4C 2ZT9C 4OJFL 3FYEB 5JW3L 2VERA 1LNUA 4Q9CA 2TRHA 4N8VB 2UXGA 2VZSA 3GSWB 3K6SA 1CGYA 1MNUH 2FATL 3RDTC 4YLCA 4IJTA 3HE7D 3BUPA 2D0FA 4JHVA 2AEQL 2DYRB 1DQDL 4I8DA 3DX3A 5DD6A 4IRJB 4XPGL 1PZ3A 1N7ML 4FQCH 1D5IL 1DBKL 2EC9U 4JLRB 3TBCA 1O6TA 3MLTA 3TL5A 5KW9L 3GHBL 4CSTA 1C5BH 4IBVA 3O9WA 4RGNB 5B8CC 1FC1A 3DX1A 1YNTF 2C3WA 3MJ9H 3GC3A 4MJHA 4E9WA 2R2BA 4KJQD 1WIPA 5E9DD 2WAHA 2JXMA 3LKNB 4NO2B 4PJAE 4YUEH 3QUGA 1KGCE 5SWSA 5JOFB 5FO7B 3MV7D 3UBGA 3SKJL 3ULUF 5DEZA 1PZ5B 1IGTA 3EOYG 3SD5A 4LHUG 4X4MA 1Q9OB 4HOZA 2Z7YA 2ZWKA 3C2AL 3LKRB 4HJUA 4NM4L 3UBXG 1IZKA 2AJZA 1G7IA 2NY4B 1KJVA 3FHQA 1LO3L 4LO9A 3UTZB 2OMYB 3V4UH 5D7EA 3ZIMA 1OK8A 3QGVA 1AO7E 2Y6TE 3AREA 3PWVB 1INEH 5IFJB 2JCCF 4YSDA 3LKQB 4GQZA 5E99H 2W65B 1AVAA 2FQFA 2A9MH 3SDYL 1IM9B 3QSKB 1CDBA 1A1NA 4I48A 3NACH 4P59L 4WDIB 3OKMA 2DQCL 2MPAH 3CDZB 1UXMA 4OY9A 4AQ8C 4P99A 2Y06H 4BUGA 1TQCB 4EAEA 3P3TA 4NUPA 2YQBA 4NQEB 3FT4B 2ENYA 4JY6A 3EHBB 2MRYA 1AYRA 3S37X 1KBGL 1H3XA 2G75A 4P9HH 4Y1AE 3NBNA 5EOQH 2YFOA 4YXHH 2KBGA 3OZ9H 2R2EB 2QPFA 4I85A 3KYOA 3MV8D 4O58H 3D3VB 4XWOC 5ITFA 4K3HA 2G3ZA 4IKIA 4H8VA 1A6TB 3TT3H 2ESVB 1D3CA 4AQ1B 5CEZD 3WLWC 3VYNA 2UUDH 3ECQA 2J6EA 1HQ4A 1FYTB 2WP3O 4OCXH 2V5MA 4Z7WF 5GRJH 4BE5A 2EP6A 3I9IA 3Q1SL 5F9JB 4JRLA 2MFNA 1ODAA 3BAJA 4NO0A 5F7MC 1KF9B 2WVTA 5H4YA 1VFAA 4KVNL 2IXQA 2ZQKA 2XWCA 3QJHB 1FDLH 2W95A 4QOKB 4ZG1A 1KGUA 4LEBA 3F00A 1GGCL 1VEMA 1XCTA 5AKTA 2FK9A 3O2WH 4E41A 1KIUB 2TRYA 2Q5BA 1BX2A 1AIFA 4JREB 4X7CC 5HYSG 1EEUA 1KC5L 1LO4L 3PGDB 3MSPA 5BV7H 2GJ6E 2H2PC 2XETA 5EBLB 3AMKA 3LIUA 2BHUA 3QO0A 1QRNE 4Y2DC 3W11C 3V0AC 1HYRC 2UWEF 3QUYB 4PJ9D 3EO1B 4KMTL 2KH2B 1QTPA 1LDPH 1BDYA 2BOCB 3OHMB 2OP4L 3NDYE 3FMGH 1WWBX 2P8LB 1JD9A 1NCNA 4OCWH 5DD5H 1NFDB 2GC4C 3INOA 2BHFA 2ZWNA 1KPVB 5C0AE 4LKXA 2HX8A 3GJFH 5F3HB 4QYOA 5F8QC 5B1BB 1CL7I 2AS5M 4AG4L 2KC0A 3ECWA 3TPUA 4HUUA 3WFHA 3PJSB 3BKJL 3GB7A 1DVQA 1YEIL 1BOGB 4JFDD 4P46C 4PJ5E 4PLKD 1RIVL 4OGZA 4YDJA 2X6AA 1AR1C 3UPAA 5GJSL 3B2MA 2ZCKL 3FOMA 3HFML 1ED3B 1J9TA 5EBGA 1T66D 4PRPD 3MMEB 1PCSA 1W0WB 4TYUA 3QA3A 4DZBA 1RY7B 4WQOA 1U8QB 3X2QB 3DX7B 1GSKA 4YO0B 3F62A 4OFYD 2AXFB 1PLAA 2ERJB 4Y4FA 3EJRA 4HCIA 2BVQB 3FT9A 1CE6A 4FFYL 3TA3D 4KKNA 3ZRFC 5CEXB 1OAYH 3U4EA 1GXEA 3Q6GL 1U41A 3RYMA 1FIEA 5GGRY 4PJXE 1QFWM 3BWZA 1T20B 4Y16D 3S35L 4PV9B 2MTPA 1FAKT 5I6KA 3HI1B 1HHJB 3PAUA 1XQ4A 4IOFC 1YEHH 3OC8A 4PWEA 4HDIA 1XFPA 4N87A 3O3EA 4TQEH 3EJQA 5H35B 1DQJA 1TQTA 5FM4A 3GS0A 3H9YA 4FOMA 5HDWA 1A1MA 1MFDH 1OCCB 3H0TA 4CN1A 2WUBH 2WXRA 4D0DB 2EDKA 5CP7A 5T3XD 2MSPA 3NIFF 4HXAL 3RTQA 2ZX8A 4CVZA 3BKYL 1JNJA 4MJ6A 1EJ8A 1MWAB 1WBXB 1Q0YL 3DV6A 4Z8FL 4G6MH 5K33A 2NT1A 4KBPA 4HEPG 4MMXC 3K72B 3KPSB 5J12B 1LILA 2Z3FA 3VUAA 3ZSSA 5IV2A 4EMZA 3OHXA 1EZLA 3ZE0F 1H3GA 2A74A 3DIFA 3JWDH 3CBJB 3QEQA 3C08L 3GMMA 1OV8A 3WE1A 2FX8L 1XF5A 1HWWA 2OZNA 3KMDA 2QPDB 1E7VA 2VZ3A 4DP2X 5KYXA 1UM5L 4LBEB 5T5FH 4BKTC 5KYWB 4EQ3A 2Z0UA 1HNFA 3LRGA 1BYPA 1LMIA 4GBXD 1OD7A 3UCRA 3VXME 4R9HA 4DO6A 1JTTA 1MLBA 2KDGA 2B14A 4OLXL 3WHXB 5I1HH 3OG4B 1S8DA 4V1DA 4JG1H 2W92A 5AW7B 1P4BL 4TSCH 2QLYA 3VB8A 3H9SD 3QZNA 3T0EC 4N86A 1QLRA 3FN0H 4YAQB 1HCYA 4XC1H 3OPUA 1A6PA 1GAFL 3L6FB 3VQMA 4H8HA 1FC2D 3P77A 3MBEC 2C1PA 3ZDYE 3GMRB 3WSQL 1HSBB 1EEYA 3FUKA 4F2ME 5C07A 4G6AC 4BA0A 3TBVA 1GCFA 1UT1A 2H1XA 4G8GB 1WVZA 3KLSA 5D1QD 2ZSVA 4NIYE 3QQ3A 1CICD 1N9PA 1BAGA 3H9ZA 2CUIA 3UCQA 2NLJB 1KJ2L 3KBFA 3VGHA 2IWFA 2V3FA 1VFBA 1E6JH 4M4RB 2E7LC 5EEXA 3EDJA 1BM3H 2CJUL 2KPNA 1DFBH 4LNRB 4K94H 3TWYA 4QRSA 1QEXA 1GIGH 3D85B 3IU4L 1N18A 1NDMA 3JV4B 4X6CF 2G5BB 4CSPA 3C60D 5JQHC 1NCBH 1TTGA 2ITEA 5HHMD 4AV5A 3KBEA 3B9KC 3SPJA 3TBTA 1OW0C 2XFXA 5ANME 1ILUA 1GPOL 2CHXA 5HDBE 1FL6B 1TJGL 3V0VB 1QI3A 1OSPL 2H3KA 1DJSA 3Q8AA 3GXTA 1W0VA 4WJ5A 3GXDA 1KTLB 1XB6A 4JEGB 1WBZB 3ULUL 3X1GA 3SDXE 3MXWL 4FMKA 1HE7A 4K8RD 3SDDC 2AJ3A 4ZX3A 2ZSWA 2EDWA 1LQBC 3BIAX 3KW8A 3LX9A 2Q6WA 2NY0D 2ZKYA 3QARA 5HHOE 4BIKA 3QYCA 3DVGB 4RFOH 5LXGL 3V6OA 2GBAA 3MCKB 2GTZA 4F57H 3QQ9C 4LSRL 4UMSA 1LO2L 1T83C 2F9BT 5I75C 5E00B 4K7PY 5F1NA 1X5LA 4HJSA 5E94A 3F7YA 1FNGB 1U93B 4C59B 4HH9A 1R5WB 3P54A 2E7HA 1S7SB 4EOWH 2Q7YB 1E8XA 1R3JA 4OKVA 2CR0A 2VR7A 3EYQD 4G1EB 2D73A 1UWEH 4HUVB 1OSZA 3CVHL 4LIQL 2ZJSH 3QNYA 5FGBA 4QF1B 3IDNA 4X7DC 1IB5A 4CC4A 1UFGA 4LLWA 1V7NH 4BH8B 3ROLA 1F90L 3BQUC 2Z1PA 3KS0J 1O6SA 3Q9QA 4LSPL 4OLWH 4DEPB 4PSPA 2IBBA 4JO8A 3B7RL 5CCJA 2NX5A 3JV0A 2VDLB 5KVEL 4WUKL 5E9AA 3T6ZA 1I31A 1QLFA 5E6IC 1L0YA 5DFWH 4OSUH 4AMKL 1OTUC 2YPKA 3PNRB 3WTXA 2OR7A 5IR1B 3S9DB 2AXJA 5KBDA 2B4CL 5LBSH 2YC1A 3PL6C 2W9EL 2CSPA 4PW3A 4XPTH 5GS0C 4G8AC 5DLML 4NYLA 1UB5B 5A2LH 5C0EA 1GC1C 5F9OH 4WEBL 3TA4D 3QPXH 5E0QA 1L0XA 4OBRA 3WFBH 4R6UA 5CBEB 3N44F 1V05A 2GIMA 3GIZL 3ZYZA 3RGVB 1P0SE 3DSNB 2EXYC 2FE0A 1KIQB 5I28A 5T1DL 4Q6YA 2FWOA 4IRJC 2XT1B 1HL9A 2AJXL 4LF3A 4P5TB 4UINL 4JFEE 3VD7A 4EIBA 1A14L 3LSOA 3QDJD 1VF5C 5DVMA 3O8XD 5JZ7C 5G2NA 5B38B 1IEAA 4RGNC 3RL2A 1HFUA 3N43B 3SO5A 4OJYA 2QBWA 1TETL 4DK6A 1U3YA 2NY2D 2X87A 3N1GC 4M7LH 1PL3A 1DYZA 3HLKA 1OE3A 4ALAC 3IBEA 4HCFA 5JA9A 4IDLA 4OD2B 4YR6A 1A5FH 5E0FA 3HB3B 2EZ0C 1R4XA 3EBAA 3BIBX 2NY4C 3GMPA 5CN1A 1RMFH 4RBPK 1BVZA 3Q8BA 4KY2A 3DDFA 1P4IH 4R7DB 5GZND 1D5ZA 5BQDA 5IOPA 4FG6D 3FRPB 5GS0L 3KCPA 1XT5A 5CJ5A 2NZ9D 1DZ0A 1GC1L 2IO5A 3DPBA 2X2YA 3B2PA 4PB9H 4ZOBA 2DMGA 3US0A 1CMOA 3RWGB 4F7EB 1NC2D 1MI5A 3KDMB 2ZOLA 4WRLA 3VD9A 3ET9F 2EYSA 3SYOA 4GSUA 3X12A 4YX2H 3GGWA 1L6PA 4MLIA 1YUKB 2X10A 3AY2A 4UQAA 4X0KA 1AGDA 4OJDH 1DCLA 4WW1B 2IGTA 3EHBC 3UTSA 1E2ZA 4P2OD 2AITA 2YD3A 4HX1B 2YD1A 3T4AB 1KN2H 4CN6A 3SBRA 4ZNCD 3ULUE 2N01B 1U8NA 3NCEB 2X4SB 3OAZH 1SJMA 3FHAA 2YRPA 4ZS6C 2ZE0A 2V3DA 4ALAL 5D9SB 4QD2E 4BFNA 3QQNA 2I5YL 1HI6A 5HGDB 5L88H 1PVHA 3MLUL 3ZTCC 4AQ1C 4NRXA 1HH9B 3EYVA 3WD5H 5LDUA 4KNUA 3DPDA 4PVMA 1CLOL 4X0NA 4X4XA 4EXPX 5ISZD 3QNZB 5IJDC 1M2VB 4JL2A 1UOKA 3KR3L 3U25A 2JCCE 1ILSA 4HUKB 3BP6A 3IFPB 3PFQA 3CDGA 1OF2B 1MCOH 1G0YR 1XSKA 4H26A 1YQVH 4BCXA 1IGJA 4WGWB 1IAIL 2HT3D 5CD3B 3QHFL 4QTIL 4JREC 5JORA 4JRXD 4LIQE 3V2AR 3T2QA 3SKOB 3O3AB 3WKMH 2F58H 4HETA 1QHQA 2JB5H 3BVNA 2ZXQA 3II1A 2Z0BA 3KYNB 2JQZA 3QUYC 3ZMRA 3CFDA 1ADWA 3MODH 5KSVA 2X4PA 3L2LA 5AZEL 3ZTNL 5K59E 5KVEE 4RMUA 4QRPA 5F1SA 3NRFA 5TJWK 4F8NA 3NFSH 4ZMTA 5DA4A 1BD2D 1P84K 3L3KB 1G9HA 1URZA 4K3DL 4QO1B 1FBIL 2Y2WA 3AMLA 4I2XB 5EZJB 4BSWB 5J4MA 3TIDB 1IGYA 2Y2YA 3VTTA 1DUYA 3TPKA 4NO5A 4Z7WE 4CVUA 1JWMB 2FO4A 1EJOL 3OKEA 4WI9A 3GM0A 4FKKA 2EO9A 1JZHA 5LVEA 4P57B 4MQ7A 4B9GA 4RMBA 1A22B 4MD4B 1IQWH 1U92B 2BP8A 2R83A 3VH8B 4QI3A 1EERB 5A7BA 2V3EA 4KKPA 1OOWA 2E59A 2JTDA 3EG9A 3O3BA 1PD6A 4N0UB 4OJEH 2J8UA 1M7IA 2GUYA 3BLPX 4XN2A 4GSRA 4XWGH 3ARBA 1WH0A 2P46B 1ZTXL 5JIPA 4B9JA 2XTSA 3RNQB 3Q9PA 5GQBA 2FX7L 4JM2A 2GEQA 1DBBL 1TZHA 3N41F 1KEML 1PY9A 3EDDA 1TZ8A 5FV2A 2A9BA 2YUWA 4NQSB 2ERJC 4IRSB 4LEOA 3D06A 4EI5B 4ELMB 2Z93B 1ZV5A 3AY4A 5JOPD 1M6OB 2CGZA 4LK4A 2WY3B 3EJZC 4MA3A 5EWIL 4JCMA 4TNWF 3ZR5A 2DQ6A 4F7MA 2EIJB 3HZMA 1NEZB 3DDGA 2YPVL 2XN0A 4PRHB 3AQDA 3GEWB 5AVRB 4AKPA 5BS0A 2DH2A 2JJWA 5FV1L 4F24A 1FIGL 4W9FC 5C2BH 3U30B 3L1OL 2VOTA 2VMFA 3IVKA 2EDMA 1QMUA 4XH2B 4LSUH 3TCLA 4N9GA 2Z8WC 1KENL 3BPLB 3UC0L 4F37K 1D6EB 2ZOOA 3GBMH 5C6TH 3BUYA 3S2AA 4PY7B 3VG0L 5CJOL 2WLIB 1HSAA 3MJ9A 4MDRA 4QIRA 2DJSA 1B4LA 1U3HB 4RNRB 4FJZA 5D4HA 1NJ9B 3GSNL 3ZE2E 1E90A 1PEWA 3D39A 1OP3H 2FGWH 5K9QI 1RURL 2XKSA 4MZ3A 1OM3H 3X3FL 1B2WL 1C7TA 1R3LA 3U6XS 3FU5A 2DQFA 5DQ9A 5IW1B 5A1AA 2NNCA 3OKDB 2OK0L 5AEAA 4KY1L 1RJLA 1IC5L 5GSVB 2VDKH 4JAMA 2NYKA 3HEIB 4KDTC 5D72H 1XGYL 4KGJA 2AW2A 4XGZB 5TE4L 4N24A 5EB9A 1OT1A 4P9MH 3RA7L 3DYOA 1U4EA 1IGMH 1UENA 2IF7A 3FZUC 4GEJA 4AYMC 5J6HB 1QWNA 4YHPB 5FYLD 1EMTH 1KXVC 4DP5X 4ANXA 3BAWA 2XN2A 2VR4A 2FHBA 4LVHB 1PX8A 1JI2A 4X5XB 1IC1A 3V9FA 4F2EA 2AMGA 1BSIA 3EFDH 2DQGH 1RZKC 4XI5C 2PP9A 4PRNA 1KEGL 1KCKA 2YLHA 4HBCH 2VIRA 4MS6A 2VGLM 5IVXF 3GMNB 3CE1A 3FQXB 3MO1A 4KDWA 3Q2LA 3NIFE 5KVDH 2VDPH 3DC0A 1MCHA 3LKNA 4IBYA 3I2CH 2I9TB 4XBMA 3G5XA 1Q1PA 1O7SA 1INQB 1EDQA 4WTWA 2XVGA 3VI4B 1WEJL 3HFFA 1MWAL 3PFUA 4LLDB 4YC2C 4J3OD 3ZE0E 3HPJB 4F5CA 4QRQA 2CRZA 3MBWA 1EXUA 1AANA 4JKNA 3ZR6A 1OSYA 3KLLA 1OZUA 4DF9A 3IDJB 1W9XA 3G5VA 3TP4A 1NBZA 2B59B 2X53A 4K2UH 4MXWL 3U4AA 4TQ8A 4L3FA 5FYKU 2BVYA 4ZODA 1QWHA 5IFJA 5C0GA 4PGCB 3GRWH 3C6SB 1GW0A 4Y1TA 4MCYA 3SJVA 2O72A 1DLHB 2ATKB 2ARWA 3DHMA 1IM9A 3WKNA 3LNGA 5I1AA 3B6SA 3WEAA 1F1AA 2VR5A 4HCGA 5J1TC 4XAWH 3RUGA 5TK4A 4NQCE 2X41A 2BRQA 1I7TA 4PQXA 1RPQA 1SHXA 2P5EB 2IANB 3D30A 4G7SB 3JV6B 5AZ2H 3RVVD 2CCLA 4F9LA 4X9BA 1CF8H 3LPWA 2BW5A 5GGUA 4DVRL 3O6FB 5CZRA 2PR9A 2UZXB 4P2AA 2YWZA 4JFPA 1XAUA 4LPXA 5AYQA 4TNFA 1QA9B 1MFBH 5CP3H 3Q48A 1JGLH 1YMMD 1NCCL 1UD5A 5IB4A 1N2RB 2ZONA 2O61B 4KJPD 3DGGA 4R8WH 3CIAA 1J1XL 3FB6A 2F7IA 5E1HB 1LEIB 1A21A 5FGRA 4ZUWA 4S10A 3TO4A 3PWPB 4ECNA 3GJFA 3ARYA 1WZLA 3MXVH 5DUML 1QKZH 4M3KB 5TFSH 1EZSA 5IJKC 1BVNP 1T22B 3OR7A 1U8IB 3AS0A 2WK2A 2WHVA 1DE4B 1WBYB 1OF0A 2MH4A 3O2DL 2YEQA 1UJ3B 2KERA 5EUOF 3VDAA 3U46B 2JQMA 4E9QA 3VW3L 1RJYB 3M6DA 3O6LL 4Y9BA 3SY6A 1QQDB 5B1JC 1AGBA 1FCCA 4LLYA 5F0PB 4AJWA 2EDHA 2Y07H 3FB7B 3FHEA 2A6IA 5CMAA 3V5HB 4RFEB 3CXHJ 4HPOL 4I18A 2ZX7A 5FO9A 5B7EA 5IT2L 2OX5B 4C4KT 4IGBB 2Y22A 3B37A 2HKAA 1OB0A 2K3TA 4Y8AA 5DMIL 2WOBA 3RIAK 3V6ZA 3D52A 3WDHA 4F1SA 5KTEH 2WYHA 4DEPC 4K5NA 35C8L 2F54B 4FA8A 3LZFL 3QDGD 1DBJL 2QKIA 2BOCA 4FQIL 1F00I 5F2FA 3RX8A 2CMRL 4P2QB 3APCA 3SPCA 5HPMB 3O0RH 5ACLA 5I73B 1W72L 3QIWB 3D4CA 5C0BB 4GMSL 1JZDC 1FE8L 1JS4A 4XVTH 2AV7B 2ITFA 2NT0A 5DD3L 3WY4A 1NFKA 1F1GA 1MVYA 4WW2B 3GSXB 3QUMB 4JGUA 2Q2EB 2DIBA 5DSCA 1H0DB 2P80D 2OL3H 3DXAE 5IJVB 5CZKA 1MFVA 1MHEA 3SDCB 3PJSA 3OMNB 5BVJA 4JFZL 1T03H 3L4YA 1G6RB 2E9GA 2XTJE 2X28A 2IPTL 3HA0A 5C09D 2SODB 3QWNA 1BVKA 1FPTL 4P5TC 3EO0B 1BWWA 5D2NB 1ED3A 2PYEE 3FH8A 1CUOA 3CLEH 4OFIA 3BXNB 4LAQL 5DEFB 3D34A 4LCVA 4ODSL 4H88H 2VLJA 3G6DL 4IHBA 4RMRA 4L1DA 2XG4A 4D3CL 2YWYA 4E5XA 3G6JE 4XXWC 3H54A 3GHPA 1QATA 4GXVL 2V9TA 4HZ1A 4KQ4H 3TV3H 2WIMA 5IWLA 3W38A 2VKXA 1I4FA 2EDRA 2BVQA 1NKGA 4PR5B 3UTQA 4RMWA 1SN0A 3QYNA 5B7FA 4NSKB 1PJ9A 3ZX1A 5GGQL 3V8OA 1SM3H 3PYCA 5ACZA 4ETQB 5I6MA 2EVJA 3EOTL 4NRZB 1T20A 1N70A 1F18A 3QUMH 1U95A 1NFIB 4BZYA 1ONQA 3EYFB 1K8DA 5C6PB 2FIKB 1A4KA 3EUDA 2QMKA 1HXKA 4LPTA 3KGTA 5I1EH 2H2SC 5J11C 3KEHA 2IIJA 1ZLWK 1OKEA 1G6RH 1YSOA 3TH4T 1YN6B 5K9QG 3EFOA 2MOVA 4LFHG 2WQRA 4CRPA 5C3TA 5LB1A 3D7PA 3CZSA 3HRZB 3QIBC 1DN0B 4JKMA 5H4ZA 1NCJA 1BBDH 3AAZB 4WY7H 1TZGL 4HK0B 3VDBA 4JFFB 4HIHA 3PAYA 5CSGA 3KPSA 1T6VN 2D9CA 4EI6A 4KZEH 2BFVL 5JR1L 3DJRA 4X6DE 1MJ7L 4Y4HC 4YX2L 3S34H 1MAML 4YPJA 5HYJB 2NXYB 4A2GA 5GXBB 4CW1A 5L6YH 5GZOD 4S1QL 3KPOB 5JO5B 3DGCR 4Z77A 4X4ZA 2HRGA 3W5MA 3COOA 4G83A 4GG6B 4XVUC 1NLDH 5C0CA 2DAVA 1A6AB 4S1DD 4FP8H 3KLHC 3LZQA 3QJXA 4GRMA 3CFCL 1SVCP 3VGFA 2OMTB 3CCHA 1Y18B 4RISL 2CK0H 4EIGB 2J20A 1S3KL 2C7UB 2ID5A 2VLRB 5DCCA 4NOFA 1TNMA 3UAAA 4F33B 1TUPA 1CFMA 2YUZA 3Q5TA 4N2KA 1LK3L 4R4FL 5EU6B 5CCHE 4YAQA 4KI5C 5LN4A 1OP5H 5FHAL 2Y5EA 1AXTH 2E4FA 2QQNL 1I7UA 3QQDA 5L7XH 3F64A 5I6OA 1M71B 4L8BB 4BHUI 2EDXA 1IGCH 2Y1VA 4YDIL 3VRJB 1YECL 3NIGF 5IFAH 1VGEL 4XBPB 3SBWC 3NCYS 4GQ9L 4FG2A 3TVMD 3A6CL 1WTGT 5JIMA 1ZXQA 1PLGL 4E9TA 4YDLB 4GT0A 4WNSA 2F53B 4KXBA 1JPSH 4W70A 4G82A 5L8LB 4G8GA 3BX7C 3MRKA 3SDAD 2DQEH 4XZUA 1WLHA 2A4ZA 3DX0A 4TULH 3MACL 3E6HB 2XQBH 2XRAL 1ML0A 4Z5RB 5LUMA 2E9JA 1WICA 1T2QL 2EACA 4ODVL 1JL8A 4WKZB 5AYUH 3VVVA 1JTPA 4KRNA 1PKQA 3H7BB 3ILPB 1QUPA 3K8LA 2X1OA 2CIIB 3BAKA 1C08B 1OHZA 1IFRA 3FFCE 4WNQA 1ZTMA 2IQ9L 4ZBJA 5I6NA 2VXSL 2WVVB 2EIKB 1UT2A 3JV4A 2KHAA 3HVDA 2WM0A 1L3WA 3ROOB 1F0LA 4A2DA 4JPKH 4APXA 4P5RA 4AQAB 2WWNA 1YEDB 3ZT6A 4NC0B 4YHOL 5HJ3A 4YHZL 4HMEA 1FNSH 2CLVA 2HLAB 4HVBA 2XBDA 2BW4A 3IRPX 2HXAA 1XB3A 2V0AA 5FCSH 3GSRA 3RJQB 3ZRSA 2WLLA 4C56D 4DCQB 1S7VA 1WD9A 5LBSA 4ZPTA 1HKFA 1FFQA 3BPNB 2IWGA 4UV7L 4Z0BH 5CGBA 4IRSC 4EI5C 1KPUB 3LPGA 2IG2L 1A4JA 3MCKA 3AM8C 3GSVA 3PPEA 1BQKA 3ZY7A 3HI6L 1U8MB 4X98A 2UZPA 2QZQA 3QHTC 5D1XD 4B7IA 3MJ8A 4M48H 4MXVE 3ZQWA 3L5HA 3HE7B 4NCC1 1XGUB 2A99A 2Y6SC 5I30H 3T1FA 3UTPE 2BCKB 25C8H 1OAJA 3VXRD 2J44A 4N0FB 2K4AA 3NJMA 3LN4B 4QR7A 3P4MA 3U30C 2CM5A 4HSAC 2NY1D 5K9KB 3CC1A 2AXWA 4WKXA 3RPKA 1JZ5A 4QXGL 1GY1A 1RD6A 3IM1A 4FHBD 4L4VB 3BPLC 4G6KL 4NWTL 2EEFA 3NA4A 1FH5H 1C1EL 5JIHA 1SY6H 3ALXA 3GRGA 3ZT5A 2Z34A 3MV7B 2GUOA 3RY6A 4E0RA 3X3GH 1W8OA 1LQSR 1U3HC 2UX7A 4G7YH 3H4HA 4JQIH 5H94A 5DUPH 4KOBA 3OBAA 4AGPA 3L5JA 2AJVH 1G7PA 4ZFFA 2X70B 3P11L 4N6RB 1TLKA 4IBSA 2J72A 4OZHA 1ZJBA 2R39A 5EULV 4D0BA 3PGFL 5CHNB 1A9VA 5GGTL 4PJDA 1MAJA 3QUKA 2PR4L 4EN3D 3REWB 3RWHA 3ILDA 4OGAC 1U8KB 2I07A 2ED9A 4NZUH 3PWNB 4WI5A 4BUHA 1RZPA 3A22A 1I3GL 1ZHNB 3CN3A 4XO4A 4Q9RL 1RPUA 1TVBA 3GXIA 3OWRA 1T80A 3DROB 3KXFB 3JVGC 2F7PA 3ARVA 3ME0A 1TLMA 3ZVVA 3HLAA 1D7DA 2VWEC 1MCDA 3JTBA 1Z5YD 1AD0A 4MAYA 4F7PB 4K55A 1DVXA 5AALA 1BLIA 2HP4A 3MJ6A 2QV2A 3TJEH 1P6AB 3R8BB 3ZN6A 3FJTA 1UYWL 5E56A 4P04A 4WVRA 2AC0A 2ZICA 3JBG7 4UMGA 3QUHA 1QLEL 5B7MA 1U2YA 5DZAA 2LVCA 1K8IA 3EXJA 2BWDA 3MV8B 1IVLA 1FZJA 5AKRA 4RWYH 3OKOA 5DD1H 3PCYA 3KPQB 2GY5A 5G55A 4AZUA 4DOHB 5DR5H 1T6WA 1UZGA 2C1OB 4DO4A 5D5MB 3ESUF 3BW9A 3GTTA 1MDAA 2R69H 2PO6D 4JRYE 1J0JA 2ZX5A 3H3PL 4F9PC 1O7DC 4J1UB 1NC4B 4R7DA 5E6RB 3DETC 4F8PA 5HJBA 1N19A 1XXDC 4IDJH 5AFAA 4YVNA 1P7BA 4HALA 5EEWA 1GYAA 1KLUA 2DQIH 1RQ5A 1L6XA 5HY9A 3IT8D 3OZLA 4ZD3L 3ARFA 3MHZA 3O41B 4OB5H 1JK8B 1HC1A 3S6CA 3MRHB 4BFKA 5F1IA 1CXLA 2BS9A 1NCUA 8PAZA 4MHHI 3VMNA 1HESA 4U1NB 2A9CA 1MQ8A 4N5ED 1A47A 4RIRB 3W0WB 2YMXH 4S1SH 4APQB 1CT8A 3AQZA 4D9QD 1AKJA 3QUXD 4QUOA 5AWNH 3KPRB 1WFMA 5CLWA 3O6FC 5FM5M 5F3BA 2APBA 1YZZA 3DJTA 1OB1A 1NUDA 1E50A 2A6JA 2HJLA 4XR8C 4NXKA 4XO8A 1ZLDA 3EYUL 4L4TB 3N40P 1NKRA 1SOQA 1EH9A 2P52A 5HI3D 3C5ZD 5CGMA 4Z18A 5CEZH 4KROC 4L0YA 4P23B 3G5YB 3FB5A 1A7RL 3VFNA 2BX5A 4QRAA 3M1OA 4FFZL 2OYMA 4NHUB 5ABDE 1H8LA 4JFDB 4X7SH 4XPAH 3SE9H 4FZEL 1Q4NX 3FT3A 2YAEA 3CC5A 1UJ3C 3ULVD 1DUZB 3IFPA 1OF2A 4Y5XB 3HMXH 3TNNB 3X1FA 1MG3C 5TQ2H 4LCYA 2FJFA 3VXUA 4H4NA 4MS8C 5HDQH 2ZNWA 2IBGA 4N25A 4IGBC 4PRPB 4L29B 3TBSA 1WV7T 2XWZA 5DFVD 1CGVA 1E4XI 4NNYB 5IROC 4ODUB 2IOIA 2G3XA 3P3RA 2VISB 3O3AA 1CQYA 2ZIDA 3LS5H 3FOLB 3ZZ1A 5JHLH 4GUPA 2P7TA 3N42F 3T3PB 4IBWA 2BP0B 1OPGH 1OAZL 1R3IL 1GZHA 3CSPA 3MNDA 4WWPA 2M83A 3VM5A 3TO2B 3X14B 4XP9H 4A7SA 3SCMB 1S7UA 3HZKA 1XXFC 2F61A 4Q52A 4G43A 4LPVA 4M29A 5J1SC 3H3KA 3MRLB 1WC7A 1SDDA 5I73C 1BF5A 3V0JA 4M6MH 4U31A 4BM7A 4LCWA 4ACTA 4GSDH 2H3XC 5EZJA 4MJIA 4WW2C 3CFKA 4M6AA 4L23A 3WOVA 3UJIL 3OAUL 1AFVH 4QHNB 3MA7B 4X5RA 4XNXH 5T1KD 2VCOA 2FL5A 4JO4L 2YQ2A 2QADD 4M61A 3AACA 4ELME 3F83A 4HOXA 4EBQL 2RBLA 5F71A 2ZCLH 2H45A 4N2OA 1LE9A 3IXTA 2CJSA 3VWKD 1KZQA 2G2RA 4ZYKB 5C0JA 3ZDZB 2DBLH 2BOLA 2YAPA 3MRQA 5FO8B 2XQ0A 5AVZB 3RX9A 3BKMH 1AOHA 2D3JA 4N0UA 1CJYA 2KPWA 1Z5HA 1JUFA 5D2NC 4FQXD 1N4XL 1W6LA 5LWYH 2X4RA 2NCMA 2P47B 4KVPA 3KLKA 3N9GL 2W07A 3RE0A 4XX1G 1YJDH 4Z3FA 3GFUA 2VDMB 3CFQA 3U6RA 3NCBB 2XN9A 2Z4QA 1KDJA 2O5ZH 1VADB 3W2DL 4LEXL 2R9HD 1WFIA 2XWTB 2DLEA 2WZ0A 2X9WA 3IS0X 4ODXA 3L3HB 4WEEA 5IHUH 5I74C 2PTTB 1QHOA 5E1GA 5KJ4A 4BFFA 1Q1JH 4YSOA 3DRTB 2PUQT 4U1HA 1SYVB 4X4ME 5ICZA 2VRAA 5TGBA 2GITA 4FGMA 5BNXD 4KRPD 5CZXC 5FFGA 4M1DH 5BW7C 5J6GA 4JG0H 3OJMB 3V4VB 3D69B 3QXWA 5E8PB 3LH2H 3IFNL 3VQ1C 4XCEB 4DERA 3ZT7A 1Q72L 4JPWL 2AABL 2VDRB 4YSRA 2EVHA 4PY7A 1SHSA 4J2XA 5T3XH 3HRZC 4OQTH 1ZANL 2ADGB 2X42A 4OF5A 1MFEL 2PPDA 3WTSA 3WXWH 1B9ZA 1F6FB 2EINB 4KHXH 1AHMA 3HC4L 3QXVA 1A9BA 5D1QB 5BUPA 1ZLSH 1S7XA 1L4IA 5M7QA 4DK5A 1G7LB 1Z9SB 1OAKH 2RCSH 3KL3A 3LKSA 4LOVA 5C0RL 1CZ8H 1CR9L 4ONHB 2JE8A 4KJWD 1YYLL 3MYJB 5D7KE 1N59B 4O2CA 2DM4A 4XGZA 4AM0B 2OCJA 1BVNT 4JR9H 4HSCX 1NTDA 4M93B 5A3IC 1FHGA 5I1IL 3GRWA 1QR1B 4YZWA 4Y8DC 1KYAA 2Q7AA 4DHLA 3V5KA 4YHPA 3CH1B 3EFFB 4KI1A 3SE3A 2DOCA 4U49A 2MCPL 1S78D 4TNEA 5HGHB 2GABA 2W0LA 4HPYH 3NABL 5FFLA 4TNGA 4WTZA 2PYFB 3V4VH 1H5BA 1KTRL 2O5XH 1TQUA 5I23A 4UTAL 2WKLA 3RZCB 2YHGA 5SWZA 1TYJA 2I7SA 4PV8B 3PWJB 1AQDA 1D9KA 1IAMA 4LLVB 4N0YH 4NZRH 2MOGA 5DRNA 3RWFA 2PCYA 2NR6C 4FQLL 2X12A 4QHMB 2OCCB 2VRQA 3LZRA 4W4OC 5EZOL 4KAQL 5CP3A 4E41E 1JN6B 4HUXA 2B1HL 4LOUC 5K1JA 3G7TA 3TN0A 2J8UF 1W2KT 2O93L 4YDLC 5J13C 3WTTA 3KYMA 2EVIA 1U3NA 4ICXA 1FZOB 4XB3A 3QZOA 1IGFH 3DJSA 4JM2F 4LLUA 4ZPVA 3VYPA 1SJEA 5IGXL 3VG9B 2CGYA 2X9ZA 1NIEA 5CGYC 5D7JD 1RZQA 4AJVA 1NGYA 3FONA 3VFPB 3QZMA 5AOKA 1I53A 3GIVA 3UZQA 1CG9A 2XYCA 4EUPB 1JWUA 1T3FA 4X8XA 1TKWA 2CXKA 2H6UA 1MRCH 1DLHA 1JRHH 2RIKA 5FEBA 1WHOA 1FZMB 2H6PA 1T7YA 4OLVL 5F7AA 5MP6H 5I8OH 2ENSA 1FL5A 2AZUA 2DYPD 4BZ1H 4A66A 3AU1A 4X9FA 3S97C 4PGJA 3B3IB 3MTRA 5CKAA 3VE0B 3M88A 2K6ZA 2IANA 4MMYA 4Q8BA 3IBOA 4K8RH 4G6FD 1M7UA 2JLPA 1CD0A 1FNHA 2AK4D 1P69B 1URIA 1ACCA 2UZXA 2D7TH 1OD9A 1FO0H 2VQ1B 4E9RA 3QJZA 3NIGE 3HS0B 5DWUH 4GOSA 4HJGA 1QA9A 3BPNC 3I6GB 3DNKA 2XCMC 5HHXL 3A67H 3QHZH 4HKXB 5LBVA 2OTWA 3NCYP 3ARGC 4X4KA 3QQ4A 3QR0A 3TBYA 4Z3TA 3R06B 5IHZB 2GVYA 4ZFZB 1LWHA 4R0LA 1P5VA 1A6VL 4OZFB 3RWJB 3K6OA 4GLRH 4ZMPA 5L2KA 1CK0H 2OL3A 1DE4A 2V17L 3OKNB 1XWVA 3EGDA 2MCMA 2X4OA 4LLQB 3QG7L 1JMXA 3FUHA 1AKPA 2O6PA 4HLEA 2KZKA 2WLMA 1QQDA 4GKZB 4HUWB 4U1IB 4JMXA 4PJEB 2C9VA 3OLIA 3PQYB 1UEMA 3MA9L 5FYJE 3TFKD 1FFNB 2VL5A 4AJYV 1ND0B 3PP4L 5FO2A 3SODB 3IU3B 5ECJE 1K2DA 5DT1L 5L9DH 3VFTB 1UQSA 2AV1A 1AI1H 1DR9A 3CFJB 4MKMA 5KBMA 3MRPB 4XMTA 5DVKA 2F54A 3MRDA 4PJ7A 3MUJA 2VDOH 5SV3A 2ZXGA 2L4OA 4BCZA 3DYPA 4EQ2A 3CQPA 3LHPH 1HJBC 2A9AA 2IAMD 2IDCA 3QIWA 4RGOH 2BNRA 5CGTA 5D2NE 1RLBA 1T4WA 2PPCA 3MQIA 4K3GA 4P5MA 3BRGC 4YZFF 3QUMA 5DK2B 4UT7H 2MKWA 1F2XK 1MCSA 1U8LA 1SEQL 1MCWM 4PJHE 2TSBA 3MLVH 1M7DA 2LLLA 3IDXH 1E3XA 5IJVA 3SDCA 2YOAA 2DQUL 2G4EA 1G6RA 1F4YH 4IBTA 4LCCB 5AVYB 3ZL1A 4C47A 1X7QB 5D7LA 2Y23A 1RPKA 2DQDH 2YSSA 4UDUB 4ODWA 3IDIA 3QPQC 1X4XA 4NPYB 3EO0A 1F3JA 3D18A 4YBQC 4JS7A 4UIKL 4WNJA 4ZI8A 2MOQA 4YDVA 4P2OB 4AEIL 1VZHA 1KJMB 4HAFA 4EEEA 5GRZA 1L0PA 3BXNA 4FTDA 4JW3A 1MAKA 5JHBA 4UZSA 1HHGB 2BSRB 3CMOL 3RUGF 2BVTA 2UVFA 2PABA 2IOMA 4L3CA 4KFZC 1OAXL 5DO2C 3VWJC 4ZQKB 1YG9A 4KO6A 1MHPL 1G5GA 2WNWA 3KLDA 1REIA 1P7QB 5KSUB 3RKPA 3DVFA 4IBUA 2R1WB 4MNQD 4ABVA 5DJ6A 2DWDA 5JOEA 3QJUB 4YSSA 2FZ3B 1F1DA 1LVEA 3P9LA 4JM4L 5K93A 2EE6A 4CN4A 1S9VA 3POCA 4HCRH 3NJLA 5EV7A 1C12A 1IBGH 1Q0EA 3QBTB 3Q44A 5ISZB 2GYSA 1ASPA 4LSVH 4A2FA 2GK0B 1UXSB 3PJLA 2M2DA 4M1CD 1KCUL 3BDYH 1QSFB 3W56A 1OGAA 3GLZA 1PZCA 4WFEE 1WP6A 2ZXCA 5HP5A 3BH8B 3LQAH 4CU6A 1EQWA 1IQDB 3GMQB 5DHDA 2EUXA 5DEGA 3R19A 2O5YL 5E5RB 3DUSA 1DN0A 1T0MA 1VGKB 3IGAB 3MNMA 1BW8A 3QDMB 1HZKA 3BZEB 4R7NB 4P3DB 4B6ZA 3D50A 4APQC 4UANA 1XVSA 4ZFOA 2AF2A 3FBQA 4OZGA 1Z0MA 1EJ6A 1H15B 2WTPA 4N9OB 4XAKE 4ORGA 3WL9A 4D0CB 5KSAB 2ZUUA 2VLRE 1Q9WA 2YKKA 3ENEA 4MQTB 1I9RH 5EIVA 1OK0A 4R2GB 5F89B 1BD2B 2QGBA 4X6BB 1KCSL 3OL2A 3KHOA 3B2VL 1D5XB 4ZOCA 2H1PL 3NCJH 4O5LL 1ZIBA 32C2B 2ADFH 3EJJX 2YPLD 5DK0A 3L48A 5JQ6L 5DHEA 1XD0A 2H26A 1D5MA 3GXUB 4GG6A 4P23C 3T2NL 4BSVB 4LSTL 2NPLX 3LDBB 4OM1L 4C4KO 2ZX9A 1H3WM 4HIEA 3V6OE 1FCGA 4KH2A 3DBXA 2PP7A 3HNTL 3PXHA 4JE4B 2OMTA 3ZBMA 3RILA 3QFDA 5KOVC 5ID0A 4DP1X 5DJCB 2E5EA 4HHAA 4HUMB 1XCXA 1T5XB 5E51A 3X13B 1S7QB 4CMMB 1RJZA 2ZXEB 3IMWA 1PPIA 5BRZD 4KK5D 1MRDL 3CVDA 3QXUA 1DSWA 3F3HA 3MRRB 3CDYA 4BINA 2YUXA 4KXZH 4FLOA 1KGCD 1VFUA 2VLKD 1U8HA 2NY3B 4PV1C 5JNYB 3SCMC 2F53A 3OKLB 1R5VB 4FQQB 3WIFB 4YXLL 5DHVB 4TLTA 1PG7X 3OXSA 5F96L 3JTSB 3UPRB 1CQKA 5I1CH 4P2RA 4RAVA 3TBBA 2UY6B 1JGEB 2NX5E 2SEBA 2Y7SA 3E6HA 1XH0A 5C3LD 2G9HA 5L8JB 2NYYD 2CKBB 1EANA 4K3JL 5GRUH 1G1CA 1PZAA 2W80C 1SVZA 3UJJH 2ADJB 4JG9A 4OCSL 1SPDA 3VJ6B 2MNWA 3MLYH 1K3ZA 2WVVA 3S5YA 2QGEA 3HBGA 5FLUA 5IESH 3GDCA 1SY6A 1DN2A 4Z7VB 4FN0A 4H1LG 2FWSA 1DQMH 4DP6X 4WHTA 1QBLL 1Q94A 1I9EA 2JCWA 3S96B 3B2UD 3L2NA 4Q6KA 1IIKA 4G7QB 4JQIA 3OLGA 5D7HA 3RVWC 3MUUA 2H9GB 3BZ5A 3ZDYF 4PWIA 4Y19B 4A67A 2Q8BH 3GPSA 3IXAA 5F6HI 3UZVB 4DCQA 3TEZA 4FNLH 3UBFA 3QDAA 3BESR 3ZTJH 4CGUB 5JMOC 5FECA 5EZIH 1L5GA 4N4YB 3NSFA 3G04B 3K4ZA 1J8HD 3E1F1 1N5AA 2FEJA 1OAUL 3HE7A 2D2CC 3NPSC 1IFHH 4LDLB 3CFMA 4L9LB 1JYNA 3QWOB 1OOAA 5CILL 2QVIA 1MNNA 3J07A 3MNVB 4H1LB 4XNZB 1ETA1 3DMMB 4I0PB 3KJ4B 4WZ9A 4LCIH 3L9RA 4H44C 5ADOH 3QS3A 5J89A 1BECA 2P24B 1EFQA 4A7UA 4MA1B 1N0LA 4NQDD 4FQCL 5E9DA 1E5CA 3L5XL 1CDCA 4BK8A 1CFVH 1C5BL 3Q8CA 1BFSA 1NH6A 3MV7A 1XX9C 4FYSA 4PJCA 3ZKMD 5CIPH 4ZAKB 2JF1A 2J3SA 3V8CA 1QRND 3GXNA 2Z31B 5D7IA 4EXKA 3KJ6H 3WJJA 4KK8C 7CGTA 1BGXH 5MEND 2WV3A 3ZIYA 1T1XA 4NQVB 1PY0A 2WLZA 3TBWB 3IDGA 4N6RA 4R90H 4G9FD 4PP1C 4TNWK 4KKBC 4JO1H 3HZYA 4OIFA 1HCVA 3UTSE 1MCJA 1V27A 4UZUA 2VDML 3NIDE 1P1VA 1SDAB 3OPZH 4H25A 1ZVHA 3PWNA 4XPFH 5CUSH 5C0AD 4K07A 4M93C 4S0SD 3B2XA 5FYLH 4GRWB 4HS8H 4JMNA 4J3XA 4AVJA 5E4IA 2H0EA 3PDOA 1XGRB 2CIKB 1I7ZB 2ICWB 1YMHB 3CZNA 3FTGA 4Q6IB 1UB6A 1RZFL 1Y6MR 5HGAB 5BCAA 4IM8A 2OCFD 2XWRA 3NG5A 4JDEB 3RZCC 3B1UA 4MB3A 1BG1A 1AJ7H 4NN6B 2VDRL 1SOKA 2LFGA 2OSLA 1E9OB 2WIIB 5CLXA 2E86A 3BVUA 3H4FA 1A6WH 2JSFA 2OMWA 1CXKA 3P0VH 5EOQL 3S7GA 3OZ9L 1ET8A 5BMFH 3RKDC 4O58L 4TPRH 1E2VA 1T5WB 4XHQA 3TT3L 4RZCB 2H1LM 1MF2H 4Y2NA 3VG9C 1HQRB 5DJDB 1HH6A 43C9B 1ZPLA 4PGZA 1QBBA 4MAZA 2C9PA 5JXEC 4NGHH 4MCZB 3V0FA 4OCXL 1TQVA 4QRPE 3WMQA 1IAOA 4MNGA 4FXGB 3HMXA 3QUZD 1NGWA 3NFNB 4NOBA 2BIPA 4PJFA 3T5WA 4PJBA 5ESQA 2XYBA 4GKNA 1K5NA 3FUNA 4ZXBD 3Q2NA 1HK6A 4A6YB 4JJ5B 1NINA 3BYYA 1JPTL 4MA8H 5JHLA 2YAFA 1BYNA 5KYUB 2GHZA 3DK2A 2QDVA 3CSBA 3KL5A 2HJKB 1QW8A 3RDTD 4PJ9A 4A2EA 2EUZA 3O4LD 4I5BB 1SUHA 4AYFA 3VI3A 4MAUH 4J23A 5F0LB 3NZ8B 5E08L 5I0DA 1ZE3C 2NZIA 4ABUA 5F7YC 4W6WB 3TX4A 5JUEH 3FMGL 2J8UE 5DRZB 2QQKH 1KLFA 3ZYIA 2VMEA 1HXMA 4KUZH 5CSBA 2QR0A 1UXWB 4Z7OB 5C7XL 3G5YA 4Y4KB 5D6CB 5DVOA 4F58H 1YEGH 3TEWA 5JPMB 4OZHF 2BWIA 4QKTA 1CVSC 2O5NA 4PJDF 3BJ91 2EEDA 3ZTEA 4Y5XA 2DJ4A 4R4BA 1ODUA 2Y7QA 1ADQL 4B60A 5E2UL 1YEFH 5BS0E 5D7SH 2HKHH 4L29A 3AU0A 4JO3H 4OLYL 4ODUA 3LEXA 4H2CA 4ONOA 3FO1A 5GSRB 3DHUA 2BMKA 1IC0A 4OFYA 2BP0A 5EU7C 1BZ7A 1NMBL 3RPBA 3HCVA 1A7PL 2CXGA 2UXVA 3TA3A 3MRJA 3N43F 5IM7B 1EBAA 3WNNA 1F11B 1NBVL 2FT7A 3N1QC 3GMLB 4ZMNA 2WINA 5CD5C 4S2SA 2WXHA 1JYWA 4Y16A 4YHMH 3D2UD 4DH2A 5I8EA 2R1YB 1FJ1B 4LBAA 1LE5A 1JHLH 2WC7A 3KPPA 1CLYH 4I13B 4IW4C 1MOEA 4YSEA 1KCRH 1CU4H 2EYTA 1KY7A 3S4SB 1NICA 4QXUL 4XPHH 3TESA 3DX4A 3RB5A 1A7QH 3AWFA 3BE1H 3MFFB 4JANB 4JPIA 2M26A 4XWOD 1QPPA 2C7FA 1V3KA 3K1DA 1DDHB 3WFCH 4ES8A 5BQ7A 2EVFA 2BNQD 4J6RL 4TQEL 4DAGH 3E6FB 2E9BA 1MQKH 4ZYKA 4XCFH 4OQTA 3WLWD 4L3EE 3LN5B 2BVUA 2CO3A 4R26H 1HILB 2WUBL 3BD3A 4FXKA 2WQ8A 2QKSA 3K6DA 3ASWA 2GSMB 4G6ML 3MGAA 3VB9A 1L7IH 5FUCC 5KN5B 5EU3B 1A25A 3QWRD 1G7HA 1KCBA 3VXPB 2HKFL 3C8HA 3LH8A 4XX1E 3EBHA 5DJAA 5CJBA 4HEME 3UAJC 3ZDXF 1IKNA 1GHFH 4CDHA 2IGFH 4KHTL 2H2PD 2YS4A 1JPEA 4GBXA 4JDVA 1H9DA 1AXSB 3WIAA 4YZFE 4Y2DD 1DVYA 1E4XL 4LSQH 4X8GA 1KB9K 4IHOA 4OCRL 5T5FL 3MU3A 4AGMA 5KS9A 1BZDA 2MPVA 3H9SA 4O02H 2PLTA 1NCHA 3V4VA 4IRZL 3MRFA 5I1HL 5A7EA 1J86A 1FL3B 3RAJH 4JG1L 4POYA 2EYRB 1MIEH 4PVNA 2B1AH 1OT4A 3IF1A 3IFLL 2CJ3A 2N0MA 3FN0L 1BQHG 3R7QA 4KRMB 2COQA 2R1XB 5EIIB 2YRZA 1KY6A 2FT6A 4CBPA 2CHNA 3PIQA 5AB0A 2BHZA 4P46D 4JKPH 3RUGE 5KSAC 1ZLEA 2RD0A 3CFNA 5EU4B 2UY7A 4R2GC 1G7LA 3R4RA 1AR1D 1SXAA 3CIQA 4JQXC 4AYBA 1CICA 1JDDA 5MHSD 4BRVA 4ONHA 3W37A 3VXTB 3QZWB 3WN5A 3A6BH 1FRGH 4HF5L 1GSMA 3BDXA 5INCB 2WZPD 3IJYA 3VFOA 3UACA 1VJSA 2IH3A 3C2SA 2ZUYA 2ADIB 5D1ZI 5FAAA 1F58H 3E9UA 3EGXA 1KG0B 1T1YA 5C9JA 2ZF8A 5HHVL 3C60A 2I32A 4QTHA 2HG0A 1U8JA 3CXDH 4QHKI 4RA3A