2XBTA

Structure of a scaffoldin carbohydrate-binding module family 3b from the cellulosome of bacteroides cellulosolvens: structural diversity and implications for carbohydrate binding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'PVQVNSDLKLLFSNNGAAASSNQIYMNMKLQNTGSSTYDLSKITIRYFYTSDDDKALTYYSDYVSIGSASATFNNLSPVHAKANKYIEIKLASGTLGAAGAQWPSQSEVTIQGRVAKADWTNVDQSNDYSYPGSMSQFGENKLVAVYYNGALVYGTPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOMAL SCAFFOLDIN
publication title Scaffoldin-Borne Family 3B Carbohydrate-Binding Module from the Cellulosome of Bacteroides Cellulosolvens: Structural Diversity and Significance of Calcium for Carbohydrate Binding
pubmed doi rcsb
source organism Bacteroides cellulosolvens
molecule tags Sugar binding protein
total genus 35
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xbtA00
4B9CA 1GA2A 1G43A 4TF4A 1TF4A 4B96A 2WOBA 3ZU8A 4B9FA 3ZUCA 4C8XA 3ZQWA 2WNXA 4B97A 1K72A 1G87A 2XBTA 3ZQXA 2L8AA 1KFGA 1JS4A 2XFGB 4B9PA 2YLKA 3TF4A 1NBCA 4JO5A 2WO4A
chains in the Genus database with same CATH superfamily
1HS6A 2QBWA 3VD1A 1D5XB 3TT3H 4DVBB 4GEIA 3IVKA 1HKLL 4WVRA 3R0NA 1ACXA 4EEEA 3RE0A 4WKZB 5CUSH 3CFJB 3R8QA 1JPGA 1YYLL 1DFBL 2BFVL 2DQJH 3DHUA 4PRBB 2JELL 2LVCA 4NZFA 1MAJA 4A6YL 2B39A 4BJLA 2XKSA 4PLJC 3L3KA 5DZJA 3EAKA 4I48A 1EDQA 3P9MB 3TO4D 2QT6A 3GHPA 2HFGH 3RDTB 5JHAA 4NZUH 3KVQA 3CU1A 4I4WA 5C92A 5ISZD 1LJMA 2D31B 4WLCA 4L37A 2NY3D 4JFZL 4YSPA 4KVCL 4KH9A 4HXBH 4DQOH 4C58B 1SXSA 2IANB 3HLAA 3BAEH 2BWIA 1J9SA 1P9MA 2J8UA 5D7HA 1P7QA 3N43B 4WK0B 2EEDA 4YBQC 5D55A 3MV9A 3PJNA 1IV8A 5CGMA 5IIEA 5A1AA 4WJ5B 3K5RA 4NRXB 5C0JB 1KGXA 4DEUA 3NJIA 4OI9A 1TTCA 1E3ZA 1QNZH 5K9OB 4HJEA 3LKQA 3OJ2C 2HMID 3ILPA 1SYVA 2CM6A 1Q9WA 2G2NA 4E5XA 1C16A 3ZRSA 5I75B 5LGHL 5DK2A 1RZKH 2XVBA 4L1BA 1A7RH 3MUGA 1JS4A 2X6UA 4XP4L 5DJAB 5IMOA 4GI9A 3D69B 4QLRA 1KIPA 5T1LA 5C0FA 4NFBA 3L5HA 1FH5H 4DGUA 3K0WA 4HCIA 1BQ5A 5F96H 4NYLA 3QO1B 5C0CB 4Y9BA 5G4OA 1JBJA 4O02A 2X4RB 2C3GA 3VWJD 4YOKA 1F3DJ 5IFHL 2ZWYA 2HWZL 2YPVA 5AB2A 2YS4A 1EZVX 1NFDA 2IGFL 3TFKD 1OAKH 4XPTH 1SOSA 3CX5J 3WKPA 3NIFF 2VR5A 3DTXA 1QSZA 3UTTB 5TD4A 1JD7A 3AMLA 1TQCC 2BOLA 4N2BA 2OMYA 1TTRA 4IRJC 4YXLH 3DV4B 4XBGB 3FTSA 3PWNA 4HIIA 5HHMB 5MP6L 1KN4L 3EGSB 1OO2A 1A3ZA 2EEFA 3H2WA 5FCSH 1JV5B 1RERA 5E6SB 4B3VA 5KZCB 2TSBA 3ZDYF 4HFUH 4M48L 5B38G 3IK2A 1UWEH 4NQXB 4KI5F 3GSNA 3H9SD 4X6FA 4EMZA 4MRBA 3UJJH 1IBDA 4GS7B 1LP9A 5E4EB 3IAGC 3ESUF 4PS3A 4PJCA 2XWTA 2O93L 2XXMB 4LT7A 1H6TA 2EC9U 1DBJL 4X0KB 4KQ0A 3L95B 3FCSA 4OZIB 2P45B 1IAII 3TNNA 4D2NA 2YD4A 3WIIL 1WP6A 1M56B 5FO8B 3QXVA 1N3NB 4JFPA 3VX1A 3IXTB 4MYPA 1EO8H 3NIGB 4PRPE 3WUZA 2WW8A 4DP9X 4EDXA 2OFQA 1E9PB 3HG5A 4UILL 3B9KC 1YPZF 3P54A 4OZ4A 4F2ME 4AYDC 5I73C 5PAZA 1DEDA 3UTOA 1TVBB 2JK5A 3ZT7A 2DQGH 1E4WL 2WCGA 5GGQH 1DVFB 3S34L 1J86A 4FABL 4G6JH 4QOKD 3Q2LA 1QUNA 5AZ2H 3FOLB 3FCTA 3ATEA 4WO4D 1XAKA 3HE6A 1NBZB 4PRIA 4W93A 5A16B 1NGXB 5IVXE 3HTLX 5KSUB 3APFA 1OM3L 5IBUB 3V6OA 2X9WA 4KRPB 4JDEA 5DURD 2Y06L 2E9IA 4UT9H 2AKRA 4ES9A 3F5WB 4J3OH 5EFIA 2Y7MA 3HZVB 1PU0A 4D0CA 2VSCA 2E3VA 4N2GA 2CRZA 4Z7VE 1MW1A 2AVGA 2FEEL 2K6ZA 4WFGE 4CNIB 1N12A 1XCWA 3S37H 2HFEB 1T2JA 3SGKC 3G5YB 4UB0H 4O9HL 4PJXA 3O0RL 5F9DC 4PJBF 2YRLA 3VI4B 4PJDB 4GG6E 2HFTA 3I6LD 2BRRH 5E2UL 3QUKA 4PW9A 2I9TA 1W0VA 4Y4HD 2Q3XA 1JXDA 2RTTA 4GMSH 1B4TA 4BA8A 3MJ7A 5CP7A 1PZSA 1XH0A 2D4FA 2CDEB 4LRNH 3C60B 2YMXH 3EJQA 3QULA 4FTDA 5ISZB 1L6ZA 2EEAA 1ZDQA 4KKNA 3QQ3A 4NGHL 4CC4C 3CGTA 4D9RE 1FZJA 3IN2A 1Q38A 2DL2A 2GJ6E 1OAQH 3ELQA 2ZSWA 1FVCA 4NNYB 3NA9H 1BBDH 3GSQA 3MA7B 2WJ7A 3D2UA 5E5UB 3U4EA 3NZ8B 3L5XH 3ULVE 1Q1PA 3BKJH 2E56A 3ZGHA 4DPRA 3FQRA 4N28A 4XPGL 3DETC 3DGDA 2JJTA 3CZGA 1TO4A 4MMXB 5LAPA 4UOQA 1EZSA 4V2BA 1MLCB 2X0UA 1P4IH 5GSVB 4L4VE 4LPTA 5IF0B 4NZ8A 3MREA 4QXUH 3LKOA 1T0NB 2CRIA 3WTSA 3HA0A 3QHZH 4I9WE 5B1AB 4X6DA 5FLUA 3IETB 5FYJH 1QSFD 3UAAA 2NX5A 3DYPA 1HOCA 1OGTA 4FTVB 1GZHA 3JVGC 2QPFA 5HYJD 4L9LC 4RFEB 4P23B 4QHMA 3FU6A 1C12B 3OKLA 4BZ1H 4NWTH 4U1KA 1UZGA 2E9BA 2QSVA 1AMXA 3VWJB 1KTLB 4TVPD 1OSPL 4KKLD 1PIFA 3QWRA 3RUGE 1FC1A 3FCBA 1RJYA 2A0LC 4RGNE 3RA7H 3FUEA 4P4KC 4JO5A 3PWPA 5GISH 5BS0D 1J1OL 2UY6B 1WE5A 4E9YA 2WHVA 4EI5C 2NCMA 1AIZA 1Q0YH 1M53A 4KJWD 5BQ7B 4PJIF 4XCFH 4ICWA 2ADFL 3LQAC 3Q01A 4AT6B 2Q2LA 4YDNA 5DFAA 5GSRB 1EO5A 5C08A 1MFCH 1OL0A 1XGYL 5INDB 5L2JA 4JQVC 3LZNA 4G9FA 1NGQH 2G3XA 4M6OL 2W9EH 5KVGE 3MAWA 3GD1C 5DJ2B 3RL1B 2R0ZL 3H9SB 4K8RC 5HDRA 1TTUA 1RZJL 4TTGA 3KPRE 4C54A 4G8FB 2YGQA 1D5MA 2JF1A 4F80A 2R0WH 1Q1JH 1CDJA 1HHKB 2JCCA 2XTSA 1RU9H 1AE6L 4RA3A 3PWUA 4J3VA 3UBFA 4PHXA 2CO7B 3ZGIA 2VLKD 5GZOD 1F3RB 1ES0A 2EKSB 2EVIA 3GRWL 1CDIA 4J8RB 5FYKH 2NY7L 1NGWA 2XN2A 1R24A 3BWAA 1KY7A 3HOGA 1P6AB 1QP1A 3OAUL 2P8PA 4LPXA 1MREL 2J21A 3SKNB 5EOTB 4XAKE 1QR4A 2A3TA 1UZ6F 2JTYA 2EE9A 1CQKA 4MKMA 4P4RB 5IY5B 3W37A 3BP4B 3L3IB 1AS7A 1OB1B 2QSCL 3V4PA 4W9ZA 3FH5A 2B7DT 1KGYE 5HPMB 3MUHL 4QRRE 3U1QA 5LWYH 1ZANH 3KJ4C 4FXGC 4MDRA 1NIDA 3Q1SL 5E5RB 2BVEA 4UZUA 2FYYA 1ASOA 4BELD 5HHXH 3U0PA 1P5VB 2L7UA 4HKJA 3X14B 5JHLL 4JVUA 2QGBA 1JZ5A 1I4FB 1AYRA 3U46A 5I1CL 1BYOA 1O9VA 3IWVA 2Q8BH 3KYOA 2K8QA 2VDOH 5TJWK 2EVGA 2V7NA 2GJJA 5C0RL 2OMTA 2APBA 4H25B 4QO1B 5KBPA 2V2WB 4P3CL 4A63A 1KLUB 5LQBH 3GLEA 5ID0B 4APXA 4Y5XA 5FIEA 5HHNA 1JZJA 1L9RA 2WGNB 1KCRL 1Z7JA 2HT3C 1FL5B 1YJDH 1QD0A 3ATFA 3PJSB 4KMLB 5JUEL 1IEBA 2ORBL 1AGFB 4K23L 3QA3B 1HKFA 1KLGA 1R1CA 1DBMH 3MRPA 2YSSA 4PGBB 3T8VA 2J25A 3QCVH 3DI2B 2ICES 2ODHA 2Z8SA 3GLDA 4G6AC 4U6YA 4GSUA 3QIWD 5K9KA 2A83A 4LRIC 4QTHA 2C4FU 3GZQA 2EKJA 2BVPA 3RWFA 1AH1A 3T6QC 3HNVH 5JW3H 2G2RB 3AABA 3CFDA 4P46D 2XY1A 4Z7UE 3PWLB 3M8OL 3VXOB 3MOAH 3TBTA 5BQDA 3W0WD 3K5SA 1SEQH 3CFBA 3GMRA 1NAMB 3OGCA 2AK4E 3DJRA 3OKNB 3BT2L 2Y25A 3REWA 1SM3H 1AZUA 1OTUC 4K07A 5I1AB 4HSQA 4ZQKA 2NNXA 3NEEA 4HD9A 1AANA 3TTYA 1XCTB 3VI3B 2PYFB 1BMGA 2LE9A 2N01B 1JGLH 1YSOA 4KMQA 3TFBA 4O2CA 2UZYB 2PO6A 3NCJL 3EZJB 4OIAA 5E94B 2OYKA 1A4BA 4F57L 2A6KA 1KBVA 3OKEA 4PTUA 2BIQA 2VISA 2Z1KA 3MRBA 5DK0B 1H8OA 3I75B 1VKXA 1J8KA 1IJNA 1R9FA 4M5YL 2AV7B 3DC0A 1S7UA 5F1NA 3WD5L 4F3FB 1FDLL 4XNBA 2IQAB 3CTTA 3ARED 4KK8C 5DD0H 5CEYA 5JYMA 3V6ZB 1ICTA 1T3FB 2JCWA 1JGEA 3O0LA 4ADIA 3NJXA 1LO4L 3UZEC 5HYJB 1J8HE 3NAAH 4XH2B 4S11A 3MV7A 1PYWB 2XRAL 2Q86A 3VRLF 1NKRA 2HH0L 1F1DA 2ZOLA 5F88B 1BZEA 3BN3B 3NN8B 1U95B 2CRYA 4Y19D 4R7VA 4JHAH 3AT8A 1MCBA 4K3JH 2Z35A 4RMUA 4EN3D 4K94H 1KFAH 1Q9LA 2V8MA 1QFPA 1G5AA 3PRZA 5LCVL 3QCTH 3QQ4A 3BRFA 4NJAL 5BS0B 5DJCB 5DJ8B 5FX3A 3ULUC 4MA8L 4ZFFA 1JP5A 3QAQA 1KWKA 4ZZKA 3M07A 5JPNB 5I9QC 1J9TA 3RGHA 4LMQE 1UOWA 5FUCC 2YFNA 1KGIA 2J1XA 4KVPA 3N04A 3RWJB 5JHMA 5HSFA 4LPWA 2YGVA 5L8KB 3F7YB 2DKUA 2WXQA 3K6NA 4F15B 4APQA 2BSEA 2R1XB 4ZAKA 5E4IA 2VSMB 1CJYA 3V9FA 3FKUS 1VIWA 4M6ML 3GBMH 5E70A 4HJ0C 5I82A 4JR9H 4FXKC 1NEZA 3N0PB 2VLKB 4NNPH 3HS0C 4MCZA 1CZ8H 4LGPB 2GB2A 3B2VH 5GGSY 2QADD 1S9XA 4LSPH 4MXQC 5I8KL 1JTTA 3EJZC 2VN6A 3QQXA 1C08B 1MPAH 2GVYA 1KTJA 5DD6A 2X6CA 1B4JH 3G08B 1PKOA 4XVJL 2FIKB 5KYUB 4X50A 4TNVK 3VW3L 3DKHA 3EFOB 4PV1C 4RWHA 3T0AA 2F58H 4ONGH 1DL7L 2WZPA 2A6DB 2R2BA 2CKBL 2V2XB 3ROLA 3O4LD 4MMYA 4CN4A 4ERSL 2WTOA 2M26A 5BNXD 4KTEH 4JDVA 5CGTA 1F2XK 3FN0H 4BGLA 1MFEL 1CK0L 3JWDC 3QHFH 1MFUA 2XV0A 1F41A 4JN2B 4KZEL 3OB0K 1INEH 1DUYB 3HUJB 2G5RA 4QHNB 1U9KA 4I1RA 3P0VH 3EYOB 3DUSB 4QHLB 2RCSH 2AITA 4JRYB 4GFXA 1PCXA 4HKBB 2BY1A 4QRPA 2NYYD 5C0CE 3V5HB 4GW4A 3S0PA 3FRPA 2Z3FA 1RLWA 2UXVA 3VB8A 4N86A 1J5OL 1BBJA 4IMLB 1OGAD 3GGWB 3LEXB 4L5FL 4GKSB 5DQJA 3VFWA 5HD8D 4MB5A 3NJHA 1A6PA 2VDNH 3NJKA 4HWEH 5DRXB 3FQXB 4CSZA 4IOSD 5L2KA 4WU7B 4MX7A 1KBGL 3E6FA 3EDDA 4MSWA 4P46B 5JW4Q 1XSJA 4XVSH 1JK9B 4N2NA 5D5MF 1NCHA 4JM2D 1QBBA 5HHME 1C9SA 3LNHA 4MLIA 4U6HA 5CSBA 2Z7YA 1KT2B 2CUIA 4YHKH 5EN2A 4TPRH 2IPUG 4AH2A 2N4IA 2VLMD 3AW5A 5EBMA 3MGAA 1IEAB 1Z5YD 3KLSA 3FB6A 4LLWB 4S1SH 5JOFA 3PAYA 2A9AA 2NQCA 2VO8A 3W9DB 4JKMA 4QJ4B 4JPQA 1HXYB 5E5MB 4HPHA 2D7NA 4NKMB 1OCWL 3V5DB 3S88L 1HILB 5GGRB 4GQQA 5I0WA 4OZIE 4G5ZL 4FMKA 2GBVA 5JQ6L 1TQVA 3DX8A 3WKNA 3O6FD 3ZK0A 3QFDB 2ZCHL 1UGNA 3LD8C 4UDUA 1YMHB 4P2OA 3NIGE 4YR6A 3VNZA 2Y6SD 5CNHA 4Z7OF 1JZ2A 5CMAB 2W65B 5J7CC 2VE6A 4LPCA 2PW2A 4PRHD 2IADA 3CPLB 4AQ1C 3IDGB 5CD5C 2P49B 1KB5H 2EUVA 3HHSB 2HKHH 3UMNA 3AXIA 3D25B 2A74A 2VXTH 1XGRA 2B2XL 4A66A 2IALB 3LN4A 5EO9B 4EN3B 2Y3AA 1ND0B 1AG0A 3L9BA 4HOZA 4YDLB 2TRYA 5H2BB 1KIRA 1T1YA 2R56L 3EO1A 4JO4L 4L8SC 5I5JA 4N0UE 2RD0A 2HVJA 3U1SL 2EQDA 1YLBB 5H35A 5B8CA 4GSDL 5GJTH 2BDNH 3TF7C 3CN2A 3QFJB 3AG3B 5AAMA 2EIEA 5KN5B 3CQPA 4H26A 1EEYB 4XP6H 3V0WH 5B7EA 2BOCB 8FABB 2J8HA 3ZKXB 2J2ZB 2V7HB 1JWMA 4PIBA 4ZX4A 4L8DB 4BD4A 3VFMA 2VSKB 4X6CB 3SDCB 4YLCA 4AVIA 4ATTA 2CM5A 5AOLA 2PCPB 2VZ3A 2Z9TA 3H54A 4NN6B 3O6LL 2DDQH 2R2HB 3HZKA 1EGJH 2O6CA 1P7QD 3MZGB 2OXGB 3MV9D 2MQ3A 1T2QL 1UM4L 2D03L 1MHCB 4X5WB 3GK8H 1FLRH 1H5BA 4CAGA 4PBVC 5ESVA 4JFOB 5IB4A 1NC4A 3WFZA 3GB7A 2JI1A 1ORQA 1RFDL 3TA3A 2G30A 3CQQA 4FQCH 4JRFA 2ZCLH 4UZSA 1GRWA 4JVPA 1V7MH 4BSWA 1WFIA 3QH3B 3ERXA 3SIKA 1UA7A 4DGVH 3GSRA 2Q0ZX 5J9PB 4JW3A 5EO1A 1LDSA 5T1LD 3SPCA 4OM0H 2AK1H 4CU8A 2Q76A 1XF1A 3CXDH 2R2EA 2BM3A 3WMQA 2BXYA 2QQLL 4JO1L 3Q43A 3O4LB 4U49A 4YHMH 3G6JF 3X12B 5B38A 5C8JA 4Q9RL 5D1QC 4Q9QL 2OXHB 3GI9L 2VTFA 1NCIA 2OTUB 1CO1A 1LEGB 2AW2A 4LSSH 1VFBA 3BEWA 5D6DA 5EZIL 5LCVA 2R69H 5ANME 1RUKL 3QISA 4A7VA 2XBDA 1SXBA 3AXLB 1YYCA 3QORC 4JM4H 5MEPB 4FTVE 1YA5A 4R4BA 4QT5A 3NPZB 1M71B 4ZYKA 5BUAA 2UYLA 3APMA 3Q8BA 1TPXB 5CJBA 2Y6TE 4LL9A 3ROOB 5IB2B 1QTPA 2BS9A 1JWSA 1MF2L 5HGDA 4PGCA 2BSSA 4GLRH 4E68A 2JB5H 2I7OA 1A6TA 4S0HA 3D85A 5DYFA 3MUZ1 3MRIA 2CK2A 4Z7QE 2LW3A 1I85A 1I9RH 4NZRH 4XN9A 3UACA 5J8OA 2UZIL 4R8WH 5B1BB 2PPEA 1YDPB 3L9EA 1MJ8L 3DIFA 1YC7A 2DBJA 4QR7A 3GMQB 4QWWD 3BO8B 1UJ3A 2HRLA 1WFTA 2X1QA 1BECA 5CIPB 3Q3GB 4AEHL 1CI3M 1S3KL 2EZ0C 1KTBA 4JN1L 3AS3A 2NNFA 4K9JA 4FFYA 3V2AR 2WZ0A 3BPLC 1SXCA 1W72B 1FNLA 2VMDA 2CKBA 1DJXA 3L13A 3FONA 4Z3FA 2MQ0A 5KBKA 2L7QA 5K39A 2HP4A 1DR9A 3ZHLA 1HU8A 1A6AB 3VD5A 2RIKA 3D05A 1E2VA 3L17A 3QBTB 1A3QA 3HE6D 3MRRB 2H3NA 3B2MA 4NT6B 1M05B 1XCQA 3N85L 1U92A 5E8DH 4DT2A 2HVBA 4NP4H 3WEMA 5I1HH 5IQ9B 4OR1A 1CGXA 4YPGB 3VFSA 4XNUL 2V4LA 5E1IA 5JW3L 1A2YA 3APNA 3K4ZA 4Q89A 4DTGH 2W0FA 1S7XB 1HEJC 4WI5A 1TLMA 2C1OB 3II1A 2J8OA 1KB9K 2MPAH 5H94B 1OM9A 1I8KB 5MHSE 5JORA 2P7TA 2A5UA 3HFML 1IFRA 2DM3A 2UZXB 3PP3H 4JJ5A 1CU4L 4M1CD 4B27A 5EIIG 2CE6A 4NN5C 1ZV5A 1YO4A 5KSBB 1F11B 4OLUH 3F12B 1A7NH 4M3JA 4JL1A 3K6OA 1Y0LA 1X3DA 3UIYA 1BM3H 2PW1A 4LLYB 2CGRH 3L3KB 1A66A 3OTTA 5I17B 4OCSH 4WUKL 2J3SA 3K6FA 2FLRT 2CLVA 4L37B 5I76A 4BZ2L 4ZSOB 1PBYA 3KPLA 2VAJA 3KYAA 2WCSA 5HYQB 3IS0X 2XFGB 4TNVF 2OJZL 1N8OE 1P7QB 2QR0A 2E9JA 3ES6B 3NVQA 1X9RA 4ZW8A 2QDVA 3TX4A 4PI0A 3QYCA 2K4AA 4OZFA 4F8OA 1IKOP 2LTQC 3LIZL 3D2UD 3MRLB 4ZMVA 4XZUB 4G11A 2YSTA 2NY5C 1RL1A 1AGBA 3SE8L 2UVFA 4MLSA 4OCWL 3ILPB 1SYVB 1BXAA 4MQSB 1Q9WB 5F89A 2RR3A 5KSAA 2CK0L 5DK2B 2CJ3A 4RAHA 2X70A 1BLIA 3DX2A 5FFGA 4HWNA 4X99B 3VI3E 2OAAA 3CLEL 2AMUA 1LLAA 5T1LB 3MOBL 1I9JH 1CE1L 4AKOA 2NX5D 4OF8A 4OLZL 1ZT4B 4MNGE 3UBGA 1NUGA 1HXKA 1OE3A 2XN0A 1XL4A 3D8MA 5HDOA 4J3BA 1BXXA 2AABH 2GQHA 2YZ8A 3ARGA 2AJ3A 1CF1A 5MENA 3QNZA 1NPJA 2BNUB 5E9DA 1KDIA 1M6OB 2DEYX 3WLWD 5GPRA 3QWRD 1TZIA 3U25A 3SOTA 3CZJA 1YEGH 2RAMA 2UX7A 4AL8C 2AFNA 4GAGH 3PWPD 4I18A 5F3FA 1DZBA 1C8PA 4P5TB 3N42F 3MO1A 5C6TH 4KJQC 1XF4B 2Y9RT 2DEWX 4F9PA 1HCYA 1E5ZA 5C08D 2CJSA 1E4XH 2PPFA 3NK4A 4JE4B 3FUFA 4G9FD 4WEBH 5FM8A 4RGMB 3OSVA 1TNNA 3B2XA 4X6FB 1AGEB 3EG9B 2B1HL 1OHZA 1W8EA 5CEZE 1I3UA 4RMSA 3SGDI 1MJUL 4NQDA 1DVUA 1TFHA 5BVJA 4ZW6A 1LM8V 3L3OA 1HZKA 1W6WA 3OB0H 4GIPD 4ELKA 1ADQH 1TETH 3EJRA 4X7FC 4ZX3A 3BISA 3QUZB 2FYVA 1KXVC 3RZCA 4XC3L 2AJZB 2IFGA 1JK8B 1KBWA 3BKCH 3NCYS 4NXSA 4QF1A 1LO0L 2PP9A 5HY9B 4FFTA 1E30A 4DKEH 2MNWA 5CU9A 1AZRA 5DC0A 3I2CL 5MEOA 3DX1A 1G0YR 2F15A 3CZLA 3NACL 2FUQA 3OMNB 2JK5B 2F7QA 1NCAL 3HCVB 5T1MB 2Y07H 4N0RA 5EC2A 2ITDA 3EFDL 2ZAGA 3FCTB 3V0GA 2BSDA 2HX9A 4JO3L 3GYRA 1DANU 3HMXL 4ZODA 4X6EB 5HI3D 2ZNXA 3FO9A 3VXUA 1KWGA 4A2MA 4NN7B 4PMEA 2JB6A 2VXQL 3BH8B 3GTVA 4WV1C 3TYFA 4DGYL 3KHOA 4F37K 4NKDA 4JDEB 4NQEB 3RU8L 1MFDL 4R7NA 5AALA 2GSMB 2FLBT 5TTRA 2FQGA 5E9AA 3L4XA 1CTMA 2YAHA 4ZS6C 1FVDB 4D0CB 3I50H 4HGKC 1FGNH 4YDMA 1F1GA 3WIHH 1WVZA 2DBLH 5JIQA 1YUHA 5DF0A 1JOIA 5EMYA 2DM7A 3OAZK 1N0LA 3KYNA 3OX8B 1JPST 3OKKA 5F70A 5JOPD 3HUJE 3A67H 2E5EA 1PLCA 4H0HB 3ZL4H 3P2DA 1QBML 3QUKB 5AQ0A 3S5LG 1GL4B 3L1EA 5EU3A 1JDDA 1I3GH 2G0KA 5C0BA 3FOMB 1WAAE 1EHLH 4JRYE 1NBVL 5CP7B 2WUCH 5KOVC 4N8CL 1ESOA 5AVTB 3WXWH 2ROXA 1G7IB 3BMWA 1E5CA 1GR7A 4ZUSA 1UCBL 4M1DH 3C5SB 3ZRCC 3QQ3B 3K1KC 4NC0B 4E9WA 1LO5B 2GTZA 4P57B 4XWGL 4OGZA 4LHQB 4G43A 5C9KA 4PLOB 4RA0C 2F74B 2OS7A 1FVCB 2Z34A 1KCKA 3WJMB 1TU2B 4OTXH 5E8PB 4RETB 1AD9B 1YEJL 3RY5A 1SXAA 5IJKA 2A9MH 4EZJA 3VCLA 3U4EB 5JDJA 2QDWA 2EDJA 3EHBD 3VXMA 1TZ8A 4P0DA 1E9OB 1KPRB 2PO6D 3SPHA 3WN5C 1VFMA 4HWZA 4FZ8H 4DVRH 2ZKHL 3BDYL 5D6CA 1D9KB 5TFSL 1OK0A 3FQTA 1OP3K 5ADOH 4P3DA 1CFVH 2CO2A 2Y2WA 4DKTA 4M8UA 1FZOA 2PCFA 4I77L 3GJEB 2VC2L 1EMTH 3TIEA 1VPOH 3GHBH 4YL9A 1NUFA 3K91A 4IBUA 1OGTB 4J6RH 2R4RL 5D70L 1IC7L 3UTSA 3ZKMC 4AIEA 2VW6A 5AUMA 3EYFA 2CAKA 2X0WA 3MV7D 2M83A 4N8VG 4K3DL 4U4BA 4YX2L 1EPFA 2GBTA 4XNXL 4ZTPL 2DB8A 4KFMA 3I6KB 2XWCA 1YN6A 1JRHL 1IZJA 4Y5YC 1MHEB 1FNEA 1NBYB 3KBFA 3NZUA 2FATH 3HBQA 3IJHA 3HZ3A 1OD9A 4K7PX 4DP6X 3L08A 2VDLL 1JXGA 2CXGA 4NM8L 5DU7A 3ZDYE 1UH3A 1VADB 4MMZC 2WYTA 4JS7A 3S36L 4JG5A 3HAEH 4QKXB 5D9SB 4FJYA 4LGSB 2DI9A 2QQNL 3LV3A 1S7QA 5IQMA 3C6SA 2AGJH 4KNSA 5C08B 3TO2A 3DSFH 4FCHA 3BWZA 4W4OC 1ASQA 5L2JB 5KTEH 4X7EC 2AJYH 4BQ8A 1CGWA 3K7UA 3V4VL 2Z6FA 3MRMB 4LBEA 1ODUA 3PQYA 4KXZI 3JV4B 2BSED 4UTCA 4APQD 4ZAKD 1YEDA 2BVYA 4DAGH 1YPZE 1A6WL 3QFJE 3T0EB 1IL1A 3DMMA 4OD3L 2X4QA 4X9YA 3KPPB 3H42H 2WZ6A 1B3JA 1D5RA 1NZRA 4HIJB 4BIKA 1TQWA 3JYCA 4W68A 4XVUD 3BFQG 4YSAA 1UFUA 3W39A 2WLZA 3KLHD 1OAZL 4XNDA 1R24B 2MKWA 3BWAB 4X6CE 4ACTA 1NCCL 2P8PB 3RNQA 3IDNB 3AGVA 2C9AA 3M86A 2FT7A 2W9LA 5DD3L 2DJMA 1SJHA 3WJJC 3S9DB 1M9WA 4R0LC 3MRDA 4ETQA 2C5DC 2F61A 1WZ1H 3P0YL 4I85A 4GUPA 4P04A 4QRQA 3V4PB 4HMDA 3VGFA 3QJHA 4XR8C 1BAFL 1QG3A 2GTWB 4KUZH 4OFDA 4OZHF 1NMAH 4AC2A 4DK6A 1EFXB 1ZHNB 3FXIC 3NRFA 5KVFL 3FW6A 4GMTH 3IDXL 5E1QA 2ALWA 2WZPD 1KJ2H 5CFHA 2FYYB 1TVHA 1DN0B 2FO1A 1HYSC 2O5YH 2YC1A 1JVLA 2XVGA 4KDTC 5DZPA 4GAJL 4ZFOL 4X9FA 1F90L 2UWEB 4TQEH 2WINA 2OSWA 2VZTA 2OMTB 4H8WC 2WXIA 3AT9A 4ZI8A 4HCFA 1AC6A 3CHQA 2GK0A 4N24A 1YECH 3ALXA 4LEEA 4Y5XB 5HHNB 3D48R 4BV1A 4CMHC 1CL7L 3F3HA 4QRPD 5C0AE 3GRGA 3PAVA 3QEUA 3A22A 1TSHA 3STZA 1BF2A 3MCG1 2YSSB 1IKNC 3F6LA 5LO7A 4PJ7A 2Z8VC 4B53A 2FBOJ 5EEVA 1G4RA 1T03H 4AYEC 2ODIA 1WG3A 3V6BR 5SV4A 4BKSC 4QTHB 3P3SA 4QYOB 4X5PA 1QKZH 3QDJA 5L2KD 3T3PF 3D34A 3LZOA 3OR7B 3TBTB 4P2RB 2IPTH 1NPUA 3CFBB 1PD0A 5FYKE 1F86A 1IC4H 1XGTA 3OGCB 3Q44A 4NRYB 3REWB 3WGVB 1RMFL 5DS8A 4XC1H 5BZXA 1KJVA 3O6KL 4WRLA 3RWHB 2H0FA 1J5HA 1D2OA 1B0GA 3EHBB 1MUJA 5HI5C 1G6RH 5L88L 4WI7A 3WKMH 2E9GA 5IW1A 4AUYA 4MVBD 1R3HB 2PO6B 3HMXA 1BGXH 4GQ9L 4IRZL 4XMZA 4FX5A 3FT3B 3OKEB 1I7TA 3U48A 4PRDB 1G9NL 3A4DA 3CDZA 5AFAA 3WTVA 4CJ0A 3MLRL 4MAYC 5FM5O 2VABA 1FJ1B 5F1NB 4HT1H 4I0PC 1UWXK 3B9KA 3D06A 5CEYB 4P2OD 5I6OA 3MQIA 1G1YA 1WC7B 1E5BA 4LLMA 4L0ZA 3BZ5A 5FFOA 4QCIA 3MV7B 4HUWA 2Q86B 5L6YL 1UM5H 1E28A 4PR5B 4X80L 1E7VA 1HI6A 5I0ZA 3AQYA 4PJIE 4PJEF 5DLML 1S7RA 1LVEA 4OUUA 5CHNA 4OU3A 1FF5A 3K8LA 1MZZA 4RZCB 7CGTA 3QRGH 5B1CA 3ARZA 2WXNA 1NMCB 4PV9A 4EKXA 1S5IL 4NQCA 1OD7A 2J5LB 4WNQA 5ABZA 3OHXA 3PV7A 1EAQA 3BKML 4ISVA 3L3GA 1ZE3H 2XTLA 1HN1A 3BPNB 1YCSA 4M1GH 1ZK9A 4XHQA 1WBXA 2CA3A 1T1WA 1AIFB 1RK7A 1OT4A 4NHCH 2VYRE 1D6EB 2P42B 3L45A 5FYLL 2XICA 2R39A 5KSBE 1D6VL 4G7VH 4LGRB 4FG4A 3I02B 5IM7A 4KY1L 1ZVNA 4FNUA 1UZ6E 1SLVA 3U36A 4TVPH 1QX1A 1BVLA 2PF6A 2DWEA 3GINA 2E7HA 5JHBA 4KWUA 3MFFB 3BJ91 2FD6H 1QQDA 4P2QE 1YEEH 2XBZA 2PR4H 2YPKA 5D96B 1G9MC 1NC4D 4UV7L 1YNTA 4ZSOE 2Y7NA 4MGXA 3TA3D 4HV8A 4KNUA 3SN6N 4ILDA 5E6RB 2X42A 5ID1A 4W9DC 3BVUA 1N8ZA 3A21A 1FSKB 2Y5QA 4NWUL 3PV6B 4FKEA 2DQJL 1WWBX 3BAKA 1PF3A 2NY2C 3ESNA 3QB7C 4X4XB 5EOCH 3DGCR 2ZKWA 3ROLB 4Z76B 3VGHA 4NQSB 2BERA 4N25A 2NZ1A 1MCPH 3SE6A 1X7SA 4XOCA 4IGBC 1NA8A 4C56A 4D3CH 4YHPA 4HUNB 1G1OA 2BSRB 2C9UA 5KJRH 4FERA 4MD4A 5JYLA 2EXSA 2DV6A 3BAYA 3IWUA 2NZ9D 5C0DA 2WLYA 4RDBA 3RX5A 2L3BA 2XLLA 5KW9H 5DEFA 1M9SA 4L1HA 4R96A 1HE8A 3IMVA 4GW4B 5CLXA 1MCOH 2ZWNA 1NTDA 1BBJB 4WI6A 5B1JA 1E6JH 2YZ1A 4UQ2A 4GAAA 1HEZB 2F54E 5DQJB 1Q94A 1SMAA 1C5BL 1IARB 4OIFA 1BVKB 4DEPC 4N0YL 3UCQA 3S7GA 1RZKL 3D85D 3C6LC 2YOAA 3RJDA 4B7LA 2Y4SA 2DEXX 5C09B 3ZUCA 4Y2NA 4M29A 4YFDB 5L2KB 1A4JB 2LLNA 3E6FB 3MLYL 5BVPL 4UIMB 3C12A 5LB1A 2I9LA 1AKPA 3CCHB 4JG0L 4WCYH 5KVMC 1ZGLA 4FG2A 3RNKB 3SGJC 4X42A 3ZTNH 3LRLA 1HSAA 2VDRH 4QRSB 5EBMB 4M6AA 3RDJA 1YEWA 3VE0A 3LS5H 2HAZA 2VR7A 2D3LA 5J57B 4G72B 2FIRT 3UTPE 1CD0A 2ZX8A 2MCG1 2J43A 1AY1L 3IMBA 3ARXA 5GHWH 4AC4A 2CBPA 2GUOA 4OF6A 5EIIA 4XXWC 2C7UA 3O3AA 2A73A 3TCTA 2GAZA 3ZR5A 2R27A 3BUTA 4R90H 4YXLL 4ZFOA 3TCXA 2DQ6A 1OAUL 3GFUA 5DJ0B 3ARFC 4UDUB 1JNHA 2Q3ZA 3S4SB 1X4XA 2R8SH 4YR6B 2RA1A 2XV3A 1Q9OA 2HTLC 2CMRH 1YEKH 1OAJA 4EUPG 2HLAA 2PW2B 3T77B 2QPEB 4ODSH 1UWEL 5F6IB 4YHLL 4Y7MA 4K9EC 4FXGA 2A74B 3UJJL 2BVQB 5B4MC 1XGRB 4KX8A 3OKMB 3KW8A 3LN4B 5KS9A 1GC1H 3HFFA 2VRKA 3OLDA 4G7YH 5EZPA 3ZYJA 2O6FA 1RJLA 2OR9H 2R0LH 1MG2C 4LSUH 4UM8B 1Y07A 1IBGH 4PGDB 4YBLB 4G6MH 4BFOA 4NQEE 4TULH 3A6CL 5HVGB 3T3MB 3FUIA 5H35B 5B8CB 1EO8L 4FI6A 2IGLA 3PHOB 2HLFD 2I60L 5DRZA 4F2EA 5AOJA 5F1IB 3T08A 3PXLA 1OP3H 3QUXB 1CDCA 1IGCH 2X2JA 3LIUA 4S1DC 2DQGL 4HC1A 5TPWH 4U0RB 1JWMB 1IM3A 4WEEA 3VFMB 5EF2A 5J13B 3VFGH 5HTSA 3KDMB 1ZTXL 4LRIA 2XWJA 2YOCA 1DO5A 5D2LF 4CW1A 1UZ8A 1INQA 5BV7B 2WVSA 3Q6GL 2P8LB 2X4PA 4FJ6A 1H5BB 3KWVA 4YE4L 4J1UA 1ZLVH 1RZPA 5IB4B 4U6VL 3O9WA 4FQ2H 3IFPB 2EXYC 4CGTA 4M61B 5KSAD 3L1GA 1VF5C 3NK3A 3CN3A 1ZS8B 1BJ8A 2DTSA 3A4FA 4PP1C 5I5MA 1AHWA 2BRRL 4Z9KB 2UV3A 1PZAA 2Y0SA 4FNLH 3DX7A 4Y9GA 2Q76B 4HCRH 2W60A 2BO0A 4PLKC 3S3SA 5EA0H 2VR3A 3CD4A 1QI4A 5E00B 2ZKMX 2H41A 1OAYH 2XV2A 3OG6B 4AK1A 3SGEH 3FUJA 1OF2A 3ARGD 3BEWB 4R7LA 5ALBH 5D7LA 5MEND 4JM2F 1PJWA 4KHXL 5I30L 2QSQA 5E9DD 3UZEA 2EH7L 1FZKA 4PY7A 4PJ8A 5ITFA 3CQFA 1W16A 2VM9A 1SHMA 3NA9L 4Y2OA 4TSBH 1RUPH 5GZNA 1KEML 3FU5A 1EJOH 2AQ3A 3G7TA 1WFOA 1DVQA 4LVEA 5D5ME 5FOBB 5F6HJ 1D7DA 4JMXA 4HJJL 1BJ1J 3IFOB 5JIHA 5M95B 1P4IL 1B0WA 1T1ZB 1HWHB 1A6TB 3BAJA 2XYBA 4QXUL 1L0QA 5TK2A 5DHYB 1X5MA 3NIDB 3OV6A 5FYJL 4QXTA 1QFOA 5CLZA 3VXNA 4BQ9A 5ICZA 1Z5LB 3PPSA 4L3EA 3MZTA 3HB3B 1RK1B 3B7TA 3R4RA 5K1JA 4NQDD 3GMPB 4AK2A 4BQBA 2G3MA 3F85A 3NA4A 3QUYB 5SWQA 4O00A 1H6UA 1F45A 2ADJA 2AJXL 2F53A 4BQCA 3WKYA 3N40F 2F68X 1H3PH 3CVHH 2EYRB 4NERA 5EH1A 5EUKB 3RZCD 1F00I 2FHBA 2X6AA 3HS0A 3T0EE 1IC0A 2D7MA 3VG0L 4TNEA 5AZEH 4M7KL 1B6DA 4OW6A 4TUJB 5K39B 1FVEA 2BZ7A 3S5LA 3FF7A 4H2CA 4HZ1A 3TEYA 3VXRA 4GW1A 2C3WA 2Q8AL 1L5GA 3WNIA 5EEZA 2CCVA 2W0PA 5SWZA 5GRUH 3SDXB 3U4BH 3VXUD 2CCWA 1XCQB 5JMOC 1U92B 1NGQL 1RUAL 1IRAY 2J56A 2OJ1A 2AEQL 1KNOB 3BAIA 1CT8B 3RVWC 1OGPA 2B4CH 2AQTA 4ALAH 5IHZB 1NQBA 2BCKA 1A2YB 4CMMA 1NCNA 2E86A 3G5XB 2R0WL 1Q1JL 2W0FB 2ZPKL 1RU9L 3KWUA 5C07B 5TDPA 2J8UF 4YC2C 1PAZA 1OPOA 1UD4A 5E8NB 2QVFB 4H5SA 1P84K 3VMNA 4FFZH 4AE0A 4JJ5B 8CGTA 2E6JA 1LNUA 1EVTC 5ALCL 1U8PB 2UWEE 2PP7A 3LEYH 4XBPA 3TH4T 1HZLA 1NCJA 1NM9A 2OSLA 4FQJL 4FD0A 1BFVH 2C8NA 1HTYA 1OQOA 5C0BD 2N59A 3AG2B 4AW7A 3GXUB 3KR3L 1PFOA 2PW1B 5AVWB 4X6BB 2Y2TA 3L54A 1EUTA 1MCFA 1ZANL 3O41A 5TQ0H 3T4AA 5D1XE 4H0GA 4PCTA 4KO6A 3EXLA 1OW0C 5I76B 3B1UA 3EUDA 1T7WA 3MROA 3RVTD 3MRKB 1A1MA 1II4E 3KPLB 4N8VA 2IH8A 1CN4A 2VDPH 1BA9A 4U3SA 4ZFZB 2Y1YA 3QJOA 1BF8A 5SX4H 2QR0B 3T6WA 5T5FA 2HPTA 2VDOL 4P5MA 3MDJA 3BE1H 4ZPTA 4NZTH 4G1EB 4PBWD 4L9DA 2B3IA 3S48A 4A67A 3VXMD 4C83B 4IU3B 3GM8A 5LQBL 1UEYA 1NFDF 4P2RE 3ASNB 4PUBH 1DLFH 1WIOA 3DYMA 1YJDL 2C9PA 5EV7A 5F89B 5CLYA 3CC5A 5K5YA 3BN9D 3BH9A 2DRUA 2X70B 4F2FA 3SHSA 3SKJH 3IBOA 1I1CA 4W9CC 1N7ML 3NOIA 3UG4A 3OKDA 2JKTM 5KAQF 1KSRA 3KBPA 3UTSD 4MNQA 3UC0L 3AITA 1JGIA 4OZGA 3HNVL 4F27A 3HIZA 4H1LH 4O2EA 3ARGB 4WZ9A 1OK8A 2CDGB 2AJ3B 1KTDA 1TOXA 1XFPA 3E2HC 4JQIL 5JMRA 4LSDA 2QEJA 2ZX7A 2ED9A 3MOAL 5J6SA 3QNZB 5L8LB 2WLIB 1LP9F 4MA7H 4EIUA 3U6RB 5F0MB 4FKKA 1E2WA 4PJCF 3ZKNC 5JHDA 4GFTB 5I8OH 1QPPA 1I3VA 3ABZA 3IGAA 2QQKH 4YEFA 2P28B 5FGCB 3FQWB 1H3TA 4TSAH 3JWNC 3MCKB 1RUML 4OFQA 5J4MA 4XE5B 3VVWA 4L8CA 4HUVA 1IIIA 1CLZH 4IKJA 1XCXA 3UGEA 3MO1B 3ALPA 3QP3A 3QIBB 3UTZB 3QCUH 4HD5A 5IHWA 2VDMH 5AWNL 1L9TA 2ZXBA 1OZTG 4L8SA 2P5PA 5KVDL 4GO8A 4QRUB 3FU8A 2HLEB 4RNRB 5H37G 1ECYA 1AQDA 3BKYH 5G55A 3W5NA 5EF1A 1CFNA 2VDQH 1W8OA 2VQTA 3IS1X 3B34A 3PQYD 4HPYL 1FFQA 1IM9B 4O02H 5DD0L 5EOQL 2Y5TA 3BYTA 4RQQA 3C6EA 3LMJH 4A2LA 1Q0EA 1DQML 2YPVH 4ODWA 4Y5VC 4GXUM 1I1YA 3DMMD 3KLLA 1VFAB 1FAIH 3HBZA 1FHNA 3L3OB 2XYCA 4K71B 5LG6A 3CFKA 4GAFB 4ELKB 1K5NB 4MA1B 3RVUD 5F7WC 3SO3C 1QFWH 1Z3GH 4K3JL 4OJCA 4K5NA 4U31A 1N64H 3OB8A 1F02I 2IDSA 3IGFA 5HJGA 3RZCB 4DH2A 1U4EA 3CFCL 4IOIA 4Z7WA 1KPVA 3B1TA 3VD7A 4P99A 4LLQA 4KU1A 5AG9A 2JIXD 3OZ9L 4PJXF 1KCVH 1KELH 1PGRB 5ACZB 4OB5L 1BQRA 4OLWH 1A5FH 3GSNH 3EOAB 3NFPA 1X4YA 1BQKA 4AYFA 1Z9PA 2E59A 4Z77A 3FSAA 1H0DA 1VEOA 3VXUB 4B9PA 4ORGA 2G5BA 2DF3A 3TYFB 3WO4B 4NKDB 2WXHA 4HHGA 2Q7AA 2DMHA 2B16A 3AS1A 4EQ3A 4OQTL 5D1ZC 5DJYA 5I6NA 4D8PB 4HETA 1E40A 3GBML 1BQUA 4UOZA 2NRDA 4DCQA 3MX0A 4FKHA 4NNPL 3ZE0B 3H2QA 5L4JA 3AGWA 4KQ3H 3VXQA 1XO8A 4WWPA 1MW3A 4LSPL 1N0LB 5CWSA 1AO7A 3OKKB 5LXGL 1MPAL 3SBWC 3G5ZB 2LOEA 3Q2WA 4UUJB 5HGBA 5C0BB 1DDHA 4PJ5A 1ODAA 1R34A 5EC1B 2WWKT 1QVOA 4X6DF 4LSVH 3QDJD 2J1KA 2V5YA 3GSWA 2F58L 3FH7A 3FN9A 3KPSA 4P49A 4ZUSB 3T2PA 1QLEL 4N20A 1QO3A 4DOHB 4TNWK 3LZFH 3BZFB 1LWHA 3MU3A 5BRQA 4K2UL 4G43B 4KTEL 4UQBA 5I8CB 3FN0L 1BAGA 3K2KA 3SE3C 3VQLA 5AVYB 2F8XC 2ALAA 2R23A 3NDYE 1ZGLP 3VG9B 3PP4L 5HDQH 3O11A 1INEL 5C09E 5CR1A 1RZIA 4HH8A 1PVHA 3A4EA 4P9MH 1FH2A 3S3CB 5E99H 3P0VL 4G7QB 1V55B 5I1GH 4GEJA 4NO5A 1PW3A 2V3DA 3EYSL 2EC9T 4P5SA 5D6CB 3FQTB 3FNKA 3LSOA 3PU7A 3UDWC 1RHFA 2YJQA 3T9WA 4XB3A 4ZTOH 1UXMA 4OCXH 3B9KD 1FCGA 3E8UL 1N4XH 3ZTJG 4QRFA 3I9PA 3TPUB 3TF4A 2XVKA 4W4NA 3U9UA 3QWOB 3EYFB 1DP0A 4KMTH 4ODHH 2H6OA 2BPBA 2F7RA 3TVMC 3BVNA 3IAPA 2VLRA 4Z0XA 5GRWA 4Z3JA 3MCLL 2EAEA 4XVSL 2EJ1A 4G42A 3FFDA 2JCCF 4IMKC 1DJYA 5D8JL 4N90E 3IJHB 4ORZC 2I07B 5DQDH 3X1FA 1KYOK 2AF2A 2EXWC 4YHKL 4IU2A 3BW9A 2FJSA 2OZNA 2V37A 2IWGA 3QI9A 3AT0A 5EU7C 1X5JA 4MCYB 3MCYA 4NQCD 4XCEA 3RX9A 2KDYA 2Z31A 2GY5A 3ENEA 1U58B 3WDHA 2WP3O 3BQUC 4AGLA 1S7QB 1DQJB 4JDTH 2FB4L 2WYZA 3C6SB 4Y1AA 3DOIA 2A9NH 3KYKH 2V17L 2X41A 5LN8A 2EDHA 4PSRA 2Y36L 5I18L 1CLOH 4N0CD 3RL2A 5FKPA 4LBEB 3T3ME 3ULVL 2BIMA 1PNDA 1XIWC 4UQ3A 5E2TL 1PKQB 1QSVA 1QLFA 1Z9SA 1HKLH 3AACA 4WSKA 1IL1B 2C3HA 2Y1ZA 2EIJB 2HKHL 2VIRA 2X4QB 3TH3T 1DFBH 2BFVH 3AUVA 4BKLA 2OMXA 4FQLL 1NIFA 2JELH 4UTAL 3U30C 2VXTL 2Y72A 1PZDA 3L3DA 4A6YH 3IU4L 2HJKA 5DCCA 3UGXA 2PYEB 4OKVB 3QEQA 4P2CG 1M1XA 5INCB 4KI5C 5T3ZL 1G1KA 1HXMA 1DSFL 4PWKA 2FL5A 4JFZH 5EN3A 2OLDA 3CH8A 2WBJC 1SJHB 4CGUB 1H3XA 2JIXB 2CCLA 4WNSA 3M88A 2BDNL 3DROB 3PDOA 4ANKA 3CZKA 3KGSA 3KM1A 4KNTA 4XHJC 4JQIA 1A7OL 5T3XE 3GHEH 1RCYA 3UZQA 4JANA 4JHUA 3QDME 1BSIA 1G84A 1M6UA 2YC1B 4OM1L 4J8QA 3SDDC 4X7TA 2BIIA 3DPDA 4XE0A 4LU5H 2GK2A 5BJTA 4MKTA 5T1JA 4C56D 2N3JA 3MUUA 4XNZC 5LGHH 2NNAB 3D3VB 1U3HC 2CO4A 2J88H 1MVUA 4XP4H 4Y16C 4IHOB 3V0VA 1U8HA 3SDCC 4E9XA 5K9JL 3V5KA 5I16A 4FNPA 2HUHA 2VITB 3ZMEA 1YY8A 4YWGL 4B0MB 4PWFA 5FCUL 3L5JA 3QEUB 1UD2A 4XZ4A 4R6UA 2G60L 2Q2EB 3EZ8A 1OIOA 1EDYA 3WMPA 4JG9A 2A0LD 1U8IB 3OL2A 3UYPA 3L2MA 1V7ML 5TF1L 1JWUA 1SY6L 3LKPA 3T0WA 2HWZH 1YEHH 1TQCB 1GGTA 4AITA 2JI2A 4DGVL 4IRJB 2IGFH 1SN0A 1I7RA 4G6FD 4PJAF 5IUCA 4XCYB 1XMWA 3W57A 4EUPA 3KZ8A 2HKFL 3H4HA 4N5EC 3Q9PA 1T0PB 4ZO9A 5G2NA 5I6XC 4GKZA 2COQA 1DO6A 2OMUB 3LZLA 4ANUA 1XGTB 4W9LC 3RX8A 4LSSL 5MP6H 3V0EA 1KN4H 4K8RD 5DS8B 3WSQH 2R69L 1PX4A 1I8AA 4JFHE 3NIDE 5C2BH 2D9CA 4QGYA 4LZKA 4M48H 5EBGA 5EEXA 3IKCB 3A23A 2NUTA 3MBWB 3NYKA 4ZTEA 5IJBC 3GXIA 3J27A 2NXYC 4ANVA 2Y23A 1U8NA 1I7TB 4Q6KA 1U93A 1DBJH 1DSWA 1YAIA 3CDZB 1KXVA 3GLAA 3US9A 2JKLA 4O58L 4JFXB 1OGSA 1WT5C 3WIIH 3IPEA 4Z1PA 2EABA 2WTRA 3JBG7 3K74B 4OQTA 4WFED 2OTWA 4PRNB 5I73B 3QARA 4BFNA 2DN7A 3WTXA 2G9HB 1T89C 2VQ1B 1ZEAL 1I9RL 1E28B 4I1PA 4R8WL 3AVEA 5JNYA 2B9AA 3ETBF 1FFTB 3GS0A 3ECBB 1MSPA 1ZHKB 4OCRL 3UTQA 4FABH 4OVVA 3S34H 3SDAC 1KIUA 3WGUB 4JZOA 15C8L 4XWOC 3SDXE 4DK5A 1AI1L 4KX9A 1Z9LA 4K73A 3P0GB 4RAVB 5IG7A 3BD3A 3NT0A 1LE9B 2EDYA 2FEDD 3WY3A 5T1DL 1J12A 1OM3H 4WNQB 2XDHA 5CZRA 3TLRA 1EA9C 1F6LL 2CGYA 2MNJB 2Y06H 3L3GB 2DL9A 1A64A 3WE6A 4L1SA 4PRPA 5C07E 3ZE1B 2BY0A 2HT3D 2APTA 2W0LA 4TVSa 4F2MA 5AB9A 1T1WB 3HC0A 2QJDA 4K7PH 4ACPA 1XEUA 3AWEA 1KACB 1F3JB 1OSZA 1IM3D 3K6DA 4PI2A 2P8MA 3E7JA 4LMQI 1PEZA 3GZOA 4G6AD 4O9HH 3O0RH 2PN5A 3D0VA 3U36B 1NM4A 5KVEL 5E8DL 1IAIH 3VWKA 3VJ6A 3ZE2F 1BDYA 1FV1A 4HU8A 5I1HL 1BVLB 1FWXA 3FB5B 5IVXA 1IGFL 4XB7A 3IT8D 1FYTB 1N67A 2C4FT 3EOYG 4AWJC 3FU7A 5DVOA 5LNDA 1NMBL 1GPOL 5F7YC 2G9KA 3KXFE 2PETA 2YPKB 3ZT6A 3O9WD 1GZQA 2Q7YA 2R7EA 4LOEA 1CDHA 1PDKA 2ILLA 3BYYA 4HV8B 3JTSA 4LEXH 4NGHH 4GSRA 1E27A 4Z7VA 4LSRH 1DE4A 4ZMWA 5DFTA 1U91B 2WOYA 4NIYE 4PBXA 4HH9B 3GO1L 4MZRA 4ZG1A 5ID1B 1OWRM 1IGIL 2V2TA 2LU7A 4GG6A 3GIVA 2X4NB 2WN3A 3DUHA 2WO2B 2FX7L 3HJ0A 4XPGH 4NM4H 3FQNA 4AYID 5K1NA 5DUBB 4KK8D 4NS0A 4YHPB 5IK3A 5D7LD 5BZWA 2VW7A 4ELMF 2ITCA 3BLPX 5JW4N 4Y89A 5LBVA 4L9LB 5EUOB 2MCMA 4PJ8D 1UFGA 4NPJA 2GJ6A 3WJLC 5GZND 1UD6A 4TNWF 1U8KA 4POYA 4Y5YA 4C59B 3UJIL 2GC4C 2QELA 1SOQA 2ZXQA 1CIUA 2OMVA 4WU5A 3FO2B 5TK4A 3FQ2A 2DQDH 3FFCD 3MLTA 1NBCA 4UQ2B 5B3NA 3K2IA 1URLA 5FGCE 4P4KB 3KJ6H 3ULUD 4EI5B 4L4VA 3QNFA 3FT4B 3V9EA 2NW3B 2LABA 4G6FB 4HALA 1GJIA 5GGSB 1ZHBA 5F9WC 4UTAA 1TJGL 1J1OH 4K94C 3I85A 4ZDHB 5LN4A 4L3ED 2G0LA 4MAZA 2JKJA 1FORH 2XQBH 2ROYA 5F0JB 1JHKL 3MYJB 3TBVB 2ADFH 1BOGB 2FZ3A 1HSAB 4TL4A 2F53D 4RCAA 4MWFA 3VE0B 2A7BA 3Q9QA 4L48A 1KGWA 3FRUB 1HNGA 4M6OH 4HJ0D 1KLFB 2R0ZH 1UENA 4AMXA 4DNLA 3UP1A 1RZJH 2GUOB 1M3JA 2IEPA 3RUGA 1GYAA 2C7UB 3VX0A 4BRVA 1OP5K 2GAZB 2VGLM 4RLDA 1JIBA 1BZ8A 4PEEA 3EJZD 2OW7A 5C6TL 1UXSB 2DQFB 4G8GB 4WFHE 3QVAA 1JNHB 3GRWH 3ZSTA 1INDH 3VXRD 2NY7H 4HG4K 4NO0A 3WJJA 4HHAB 5SWZD 1ZA3B 3PG2A 2IAMC 4ZJ9A 2HLAB 1GYCA 4MD0A 2OMZA 1MREH 2P1YA 1P1ZB 4E42B 2R15A 1XH1A 4NAMA 3KJ4B 3SE9H 4FXGB 3WNPA 4YE0A 4HYTB 5CEXB 4WENB 1I31A 4KDTA 3KPRA 1S7WA 5KS9B 4I88A 3GMMA 5IB1A 5GS0C 3Q1SH 5IREA 1Y6MR 3C5ZC 4LDEB 2Z0UA 2BOBA 1E9QB 4O51A 4PGZA 1BWWA 1UH4A 3DDGA 3O3BA 3QYNA 4N2OA 4MA3A 4MASA 2Y7QA 3AFLA 3AB0C 3BZEA 2Q5BA 5I1CH 1BD2E 5DRZB 4FQ1L 1UB5A 1L9MA 3QQDA 1DCEA 5C0RH 5C7XL 2ADGA 3UOAB 4LKXA 3ZE0E 5DSCB 4P3CH 2ZUWA 5HBBA 2HCZX 1KB9J 3LZRA 2Y07L 4YHYC 1G0DA 1RZGA 1IM3B 1KCRH 2VN3A 3I84A 4BRJA 4QRRA 5JUEH 2RBLA 3GUTB 4X98B 2D3JA 4K23H 3OJMB 5I19H 3QWNA 3O4OB 1YAZA 1XR8B 4LCVA 1V8HA 4Y4FA 4Q7DA 4OFYA 2ZOKB 1INQB 3TJHC 3VQMA 4NN7C 3FO0H 4J1UB 1R5WA 4Z8FL 3G5VB 4PREB 5EZLB 3WIHL 1WEJL 5I0DA 4DO5A 3M8OH 4G8AC 3WYRA 1IE4A 2XN9B 3WE1A 2WJ5A 4M4PA 4MJ5B 1IGYA 4WQOA 2NW2B 3BP6A 3FN3A 3NSXA 4U1SB 3GJFA 2WMPB 3BT2H 2IH3A 5EBLB 5F8QC 3MJ8A 3HG1B 1SUJA 4R84A 1PLGL 2HPOA 5DJXB 1I3GL 1EHLL 4D9QD 1XGZA 2L7EA 3ARRA 4HEME 4MNQD 1FL3B 4EI0A 3NCJH 2H32A 4QHPA 3B8YA 4ZOAA 2YUXA 4I0PA 2WVUA 4F57H 5BV7H 5CCKL 2P44B 3WNJA 3EH2A 3PLYA 3RTQA 1LO2L 1T7ZA 4Z7UA 1UM6L 2FWSA 5HGAB 5JHDD 5D4HA 4PY7B 3V6FB 2H2PC 1UA6L 4IIQC 5CD5D 5ITFB 3QXAA 1FDLH 5KSVA 3IE4A 3K72A 1S7VB 4P5RA 2AK4A 1QOKA 4ANXA 4Q6YA 1EUUA 1W15A 2XRAH 3KPOA 2NNRA 3EYVA 5CGYC 2HH0H 4WWKC 3DX6B 3FFCB 3EJTA 4JFYA 1S9KC 2EDRA 4FZ8L 4DVRL 4AVJA 4AIZA 3BZ4A 4JLRA 5EU4B 2BSCA 2OJEA 2FH6A 3FC8A 2F5AH 1BVNP 3P4OA 3RJOA 5LCVH 4QXTB 4E0RB 5ICZB 2HRGA 4MA8H 4RRPM 2XA8H 3NRPA 4UQCA 3V7AE 4ZMAT 3R0MA 1J48A 1J8HA 2ITFA 4F7TB 3MFGB 1B2WL 3BDBA 3LKSB 3PE9A 2V5RA 1ZVYA 2ADJB 1HDMB 1WPCA 2J4WL 2VKWA 2MTAA 4FLRA 1U8OA 3GSUB 4MD5A 2XG5B 2N7AA 1AZNA 1PKQE 1GMIA 1N6QH 4FXKB 4IRSC 4RIRB 3RVXD 3DVGB 4BE6A 5EU6B 4QJ5B 4AZ8B 4EVNB 3HS0B 4PVMA 2FSEA 5IQNA 4QHUA 4ZMLA 5ERWB 3II3A 2B5IC 4G8IA 3OWEA 1WRFA 2N0MA 2CJUL 4GRMA 5K59F 4NRZB 3BSZA 1FVEB 2JXMA 4FE9A 1DHKA 2BY2A 1FQ9C 4AXWA 2O26U 2PYEE 4FQXC 1EEZA 5CM1A 3VXRB 4GW1B 1XDTT 1Y6NR 3S35X 2AGJL 2XC8A 1G7PA 1MJJB 3K1DA 3CDYA 4GPVA 5AD0A 3K4AA 5A2FA 2VXSL 2A2QT 4YSQA 2BCKB 2CALA 2CXKA 4GOSA 5JXEC 1D5XA 4DAGL 4XVJH 4FOMA 4ODBD 3FSZA 4Y8AA 4WKZA 3VW3H 3CFJA 4J4PC 2ZX5A 4NZJA 2J12B 1W0YT 3CDCA 1DL7H 3VMOA 4IGBA 4HS8L 3R7RA 2CKBH 1JXJA 2K9UA 1DCLA 5DZ9A 1AO7D 5C0ND 5BMFH 4XBPB 3SOBH 3D3VE 3ZL2A 5CCHE 2D31A 4UAOC 2PKDA 1EEUA 5D2LE 4PJ5D 4PG9B 4KUZL 3NJFA 1NMAL 3EGXB 1DJIA 1JZGA 1LGVA 2KPWA 3KPSD 2N0KA 5HYSG 4YSCA 3GXMA 4NRXA 4B5EA 1Q4NX 5C0JA 1A1MB 3VUAA 4MJ6B 3LB6C 4N8VB 3C6LA 2C9XA 1J5OH 5C0EA 5K9OA 3E8VA 2K3HA 4U3SB 4A1RA 5IBTL 3LH8A 4L5FH 1HX0A 4OGAC 5JLZB 2F7IA 1F4WH 4P5MB 4TTDC 5C2UB 1H3UA 4ZPTB 4W9KC 3K6IA 3TIDB 1KJ3L 5HDLA 3V0JA 1SXNA 3NQIA 2XJKA 4A39A 1NCWH 2AAAA 4LNVA 2XV6B 3HHMA 2ZCKL 4UQDA 3RFRA 4B95C 1KOAA 5JA8B 4N2KA 3UROR 4LCIL 2EZ0D 3KWXA 5LXVA 3MJGX 1P69B 4GP8B 4M5TA 4G9DA 3BH9B 4H8UA 5C0CA 25C8L 3M45A 3QO1A 5CSZB 2X05A 3VU1A 2EIMB 3MRNA 4I3GA 2X4RA 4MNHB 1JYNA 3FTUA 2A4ZA 3PIQA 2SEBA 1KN2H 5D1XC 2PABA 3JV6B 5B7MA 1T03L 2EVJA 1R3KA 4MNQB 1CFMA 3FFOA 2X5PA 3M46A 3FB7B 3ARFA 3KL5A 3LD8B 4MXVF 1IILE 1NCUA 2VLRD 2AJVL 3H9ZA 4GP5B 4OZFH 3RI5K 5JQ6H 1Y6KR 5JHDB 4Z3TA 4AQ1B 3B3BA 4DP5X 1V05A 3IGAB 1E67A 3QI9D 4XC1L 1JV5A 1F58L 2KDGA 4F8TA 1U21A 5CZXC 1XZWA 2Z31D 2BS8A 3VSTA 4AVHA 1JV2B 1G6RL 4NQXA 1KXQE 4MAUH 1LD9A 2X4TB 3P11H 4KKPA 4E9LA 1BGXL 1A22B 3PAUA 4Y1AD 4L8SB 2B2XH 4Z78B 5IJVA 1JN6A 1AQDB 2YK1L 3D5OF 4H44C 4X0KA 2X2HA 4XGZB 1XH2A 1FPTH 4OZIA 4LP4A 2XX0A 2C7FA 2XNAB 3CVDA 1NCGA 2R56H 4JO4H 1YHPA 2NTSP 2Y5TB 2Y24A 3U1SH 5FO8A 5DFVC 4RQQB 1N3NA 1T83A 1PIGA 4GSDH 3ZE1E 1NAML 4ODWB 1E9PA 1UATA 5HJBA 4KRLB 4URTB 1WIPA 2VW4A 1EERB 2KMWA 5DHMC 3CFKB 5F7MC 3K81A 5JXAH 4PV8B 1TVBA 4Q4IA 1DVFA 3QEQD 3L6FB 1X9UA 4PMFA 3FOLA 1NICA 1JPSL 2JLPA 2WXRA 2GI7A 1QEWB 1NBZA 5DA0B 4Z7WB 1GW0A 5A16A 2ICEC 4OLYL 4LLQB 5DJZA 1AQMA 5KSUA 1FYTE 4BUGA 5FF6A 1N5AA 2X10A 4N0UA 2X53A 3R19A 1P5UC 2HT4C 2F2HA 5FA4B 1T2QH 1UM4H 2D03H 3ZVVA 4Z77B 1S78C 3HZVA 5C0IB 3O3UN 1H0DB 3GXNA 2XX1A 1C5DB 3UO1L 4ORGB 1FP5A 3PAZA 3D52A 4HIHA 5BW7C 4DW2L 1XV8A 2JQAA 4M9OA 1JCKA 4G7VL 1EFQA 4NAQA 3L48A 5FV1L 1JF6A 5C6PB 4B9IA 4PS4L 1AP2A 3F05A 3PL6C 4OLVL 5AOZA 5D1QB 2J6EA 3CBJB 4Z6AT 1EAJA 5H4YA 4K4KA 2HX7A 5BO1L 2AQSA 2WBXA 3D18A 2QQLH 4JO1H 2CJTA 1WGVA 3DBSA 5DZLA 1IGML 3VXQB 3QORB 2CDEA 2PR4L 3ZYOA 4UMSA 3C60A 4Q9QH 3GI9H 1MWAB 1B2YA 4ZS7L 2LAAA 5EUOE 1RUKH 4IKKA 1IBYA 3N44F 4YHOL 5HGBB 1ZRUA 4QI3A 1DDHB 5IW3A 1NOAA 3GTTA 4XAWH 3ZX1A 5JW4R 4NNYA 2AEWA 3MTXA 2A9BA 1DVXA 4TLUA 2B08A 3GSWB 3KPSB 5JPMC 4ZO8A 1HL5A 2OMWB 5EOCL 1XF3B 4GBXC 1GZPB 3NZ8A 4YZFF 4B97A 2H9GB 5AAWC 4MMXA 1MCPL 2FR4B 1MLCA 4R7DB 5F3HB 5GSVA 4Y4KC 2R23B 4D3CL 5IF0A 4IBLT 2R4SH 5K1VA 1RZIB 1TG8A 2IC2A 2QGCA 4V2CB 3FQUB 3DHJA 4U1NB 2QVTA 2UZIH 3CE1A 3IETA 1SOXA 4X83A 1TCMA 4JZNA 1HQ4A 5FUOL 5KW9L 3I6SA 4IM8A 4FTVA 2QKIC 4OH2A 4NO5B 5AENA 3QUMA 5HYFA 4RFEA 4P23A 3LSOB 2C9QA 5HI4C 1N9PA 5B3JE 1MCOL 4JO8A 2MNUA 4DUWA 3HI5H 3MLZL 4AEHH 1EJ6A 3TH2T 1QSEB 2XPZA 1S3KH 3BPLB 4WK2B 5J6HB 2VMJA 4JN1H 1T80A 2XWRA 1OWWA 1OCOB 5DHXB 5DZNA 1UB6B 4HS6A 3U9UB 1NDMA 1C5CH 3WHE0 3B9VA 3ARTA 3QXDA 1OY3B 3D09A 4G83A 5F1OB 4C4KO 2DQEL 3VTTA 3ARBC 3LJ3A 2UY6A 4Z0XB 5C70A 4HAFA 3EYUL 1XB6A 4G42B 4G8GE 4Y1SA 1S9YB 3U2IA 2DJ4A 3A0OA 5BQ7A 2CHXA 3ZTNL 4Z7NB 4IU2B 3BW9B 3SJVE 4AT6A 2WO3B 2KLSA 1B0RA 5J1AA 4J5VA 4WY7H 4BM7A 5INDA 3QXTA 3UEZA 1BXUA 4OQ1A 3BEVB 4PRIE 1I8LC 3DHMA 4XNUH 5DJ2A 3RL1A 3RY6A 3BVDB 4HSCX 2DYRB 5GHWL 1HH6B 5GS3A 1MELA 4PRPD 4G8FA 5DQ9B 4Y1AB 2WK2A 1HHKA 4AV5A 1DQVA 1FZMA 4N0FB 3MLXH 1PZ3A 4NN5B 5I71C 2CO7A 1BV8A 4YQXL 4A7GA 2JKNA 2FSDA 2EKSA 4IHBA 4J8RA 1QHPA 3QJUB 1CU4H 4FFVC 3RGVC 1NFAA 3JWOL 1PX3A 4K3EH 1YEKL 2BIPA 4YIQA 1CGTA 5EOTA 3VWKD 2PNDA 4ODSL 2VIRB 2O72A 4XTRD 3GDBA 3FF8A 4BKLB 4P4RA 5IMMA 3BP4A 1I1RA 3NCBB 4I1NB 1OB1A 2VZSA 3WLBB 1X9LA 1JMZA 5HPMA 5I5IA 4RFOL 1YQVL 1M1XB 1TDQA 4WUKH 1HXMB 4U1HA 4XPHL 2NSXA 3RFZC 2GCYB 4BZ2H 4M7JL 1FNSL 1HNYA 2OR9L 4LSUL 1G7HA 1KV3A 1IBGL 1PPIA 1P5VA 4G6ML 4TULL 1S7SB 1UVQA 2LTQB 4WFGD 3X14A 4DKFL 3RWDB 4HJIA 2OJZH 4N4YB 1I4FA 3PDOB 5DI8B 1BP3B 2H6PB 4PJ7F 3BUYB 4PJHB 3UZQB 3B37A 4YPJA 3GRBA 4JANB 3G04B 2V2WA 4QTFA 4ZUUB 1TZAA 1JJUA 2ZOTA 3LRHA 4X7TB 1WICA 2XN9E 1J05B 1FNFA 4QYAA 5IVNA 3SE8H 2IV9A 3VMPA 1FL5A 1WFJA 1J8SA 2QMJA 3PJSA 4OCWH 5D93C 4EDWL 4KDWA 3CZSA 4LLUB 2CK0H 3UBXG 1AGFA 3HR6A 3QA3A 3ZKMD 3HG1E 2FH8A 4OGQC 4PGBA 4D9RD 4DP8X 3OMAB 5D7IB 3CVIH 1U8HB 2GJ6D 1CE1H 3V5KB 1R19A 1KTCA 5K93A 1YY8B 4XN1A 4OGXL 1O9ZA 2Y1VA 2NY3C 3OPZL 1IQDB 2G2RA 1PCSA 3ULVD 1BZOA 3PWLA 3BSGA 5AVRB 4OV5B 4JFFE 4P3WA 4G71B 5LBSA 2N1KA 1NAMA 4L4VD 3OKNA 5I1AA 4DETA 1ML0A 4FNLL 1XCTA 2W59A 3KE0A 4I9WD 3VI3A 2PYFA 4ADJA 2HRPH 2CDFA 3D9AL 1A02N 3IKKA 4XO8A 2HMIC 4MNGA 4GAYB 3AY4A 3AM8C 3U4KA 1P4LA 1FYHB 4ODUB 5ALBL 1D7FA 4UDTA 5DMIH 5DK0A 3I75A 4XVTH 2M8XA 4F3FA 2ESVB 1B4RA 2PXYC 3HC3H 2IQAA 2NUTB 2CKNA 3V6ZA 4PBDA 1T3FA 1TJHH 3RBSA 1MQKH 5AKVA 4GUCA 2FHFA 5DWUH 3RI5F 7TAAA 5HYJA 2F5BH 1PYWA 3Q6FB 4RGND 1FG9C 1MJUH 1XGUB 2XIIA 2BK8A 5F88A 1FCCA 5IJCC 2DWSA 3INOA 1ROWA 1WZAA 4Q56A 3SCMC 2BP8A 2DWTA 4NO0D 3UXFA 2WTRB 5EU6E 3IJEB 2GABA 3TFKC 2DZEA 2AHIA 3FUNA 4XC3H 1VRSA 1CXHA 1AKJB 5GS1C 5IHUH 3ZDWA 3I2CH 5DJCA 2PWGA 2HVKA 3IFNL 2X7LB 1HYSD 3HLKA 3KPRD 4HP5A 1NCAH 1KIUB 3L81A 5JPNA 3JZ7A 3EFDH 2XPGB 4WV1B 1HEHC 4JO3H 4B0MM 3HMXH 1T4KA 3H56A 3PJLA 1M7UA 3RWJA 2CO3A 5DVLA 1EVUA 3Q2VA 1K8IB 2EIZB 4WWNA 3K0YA 1BMZA 1H3PL 2VXQH 1YNTF 4DGYH 4EOWL 3SY0A 1MFDH 5DC9B 3H4FA 3T65A 3QR0A 3FZUC 4PRPB 2OW6A 4RAUB 2B3RA 3C5JB 4XAKD 5AZEL 1PEWA 3N2JA 3SGDH 4QRRD 4B5ZA 4HKZB 1H15A 3NMEA 2BSTA 1GGBL 5GS2H 4KUCF 1C08A 4WW2F 1CUOA 1T5XB 2NY6C 2XWEA 4GXUN 1QBMH 2K6YA 5TDOB 4S0TD 1HINL 2NXZC 3OQ3B 3R06A 4Y4FD 3QJRB 4OFYD 1IKFL 5ESAB 2WVVB 1SN5A 3ILDA 5IB5A 4F33B 2APWA 4ZPVB 1NBVH 4MB3A 4N8CH 2FIKA 5KYUA 2C26A 3O2VL 4WO4C 4KXDA 4Y2DC 3SE3A 2R7EB 3EO9H 2Q7YB 3DSNA 1UCBH 3CXHJ 5ILTL 3WNKA 2A6DA 4BFIA 1MRDH 4GIOA 2V2XA 1IZKA 3LVTA 2YD6A 4XWGH 4Z7VB 3DUUA 4B50A 1BFOB 3HBPA 4KKCD 2EE2A 3LEYL 3CSTA 3RLSA 5HI5D 1BFSA 1YEJH 3WN5B 1DUYA 3CV5A 3HUJA 3PGFH 4P48A 3ABKB 1JD9A 1P2CA 4RX4A 2W92A 5FKAB 4QNPE 1C8QA 5ADPL 1M3IA 4QTIH 1G5GA 3GZPA 5I24A 3O2DL 2ZUQC 1WAAA 3EYOA 3DUSA 1BG9A 5TQ0L 4JRYA 4MAYD 2VT0A 1D7CA 4HKBA 1BWMA 1CTOA 4I0PD 3FPXA 5BZWB 7FABL 3D4YA 4MHHG 3QIUB 3RTQD 2VDPL 1ETB1 4KKAD 4IMLA 1UKQA 3J07A 1V27A 1BPLB 4FQIH 2GJ6B 4K55A 3ARPA 3TVMA 4IBVA 2EO7A 4TL5A 2OYPA 4DZ8B 2AK4D 2C34A 4PJAE 3QHTC 5CKGA 4ATWA 2AXWA 1IC7H 1RLBA 4B9ZA 4Y5YB 4KROC 4XPBH 4IMKA 2DMGA 1SVBA 2IG2L 4HEPA 1U8CA 1I9IH 2OMVB 2YD3A 4K3DH 4YX2H 4BGDA 4ZTPH 2D9QB 4P46A 1UASA 4RMBA 4MCMA 5HPOA 2FT6A 2H8PB 4PYGA 2YGPA 4MMZB 5MENB 1KT2A 3QJSB 4I8DA 2NR6C 5DFWH 1UXWA 3ORJA 4L4VB 4JPSA 2VDLH 1CB4A 4U33A 4ZUVA 4A7TA 3BCFA 1XT5A 4ABUA 1ZY9A 1IEAA 3F7KA 1P0SE 2JJUA 5FWQA 4W9EC 3S36H 1T4WA 1EH9A 4HA1A 2FRGP 3QXUA 4LLWA 4B9GA 4FXLA 3W9DA 1HXYA 3V9CA 2NY1C 3LNFA 1J8HD 4KY2A 4NKMA 3WNMA 1Y1UA 3OJDB 3V5DA 4JFEE 2FZ3B 1HILA 1XIWA 3LCYA 4FZEH 5GGRA 1HJCA 3VGBA 4OV6F 4MA7L 4MWFB 2H0JA 4L4TB 1SHWA 3TWYA 1ZE3C 3QFDA 5I8OL 4OY9A 3W3BA 4TSAL 3JYBA 3KCPB 2VUOA 3SD5A 5CMAA 2W65A 4FQPA 3RUGB 1A6WH 3UIZA 4YL4A 2OL3B 3CPLA 1MIML 2NSQA 3IDGA 3O45B 1I1AC 3VRIB 4FNTA 5E9NA 4OD3H 3VACA 5AW5B 1UJTA 3D25A 3CHPA 3X2QB 3L2LA 3QCUL 2X1XR 2VDML 3PHAA 4PJ6A 4PSPA 4UOW0 1T6BX 4JNXA 12E8H 1J0JA 4XO9A 4NO0B 2YRBA 3EF4A 1OAZH 2IALA 4R0LB 1L9QA 3BKYL 5EO9A 1NCCH 1ND0A 1WITA 5CD3A 4FI7A 1NEUA 4YDJB 1OANA 4HJGB 1MVYA 5DD3H 4K8RH 1F4YL 1XSIA 4B6ZA 4KJWC 1BAFH 2GFBA 2W38A 2YPVL 3KPRB 3N41F 3SDDA 1S7WB 1VHPA 1YPZA 5KVFH 3QFJA 3GMMB 5KN5A 1Z1WA 4IGBD 5IB1B 1VESA 3EGDA 4JPIB 1JNJA 1L9OA 4O51B 2BOCA 2GI0A 3O3BB 4TLSA 4YLQT 1NWPA 2J2ZA 2V7HA 4GAJH 1N64L 2XZQL 4Y16A 3BZEB 1BQHB 1F90H 1SXZA 1BHGA 4X6CA 3SDCA 3QQDB 5D1QE 2WN2A 4QIRA 5E0FA 3JV5A 1T04B 2PCPA 4J3TA 4PD4K 1CD9B 4RSYA 4WI4A 4M93C 3UYRL 3WUWG 4CMHB 4KXZH 1KELL 5GZOC 2R2HA 1P84J 5D7EA 2OXGA 3GSNL 4XP1L 1MNNA 3QZLA 1JI1A 1CL7H 3TURA 2WOBA 4FCAA 1SEBA 3BZDA 2P5WE 3C6LD 3OZKA 4ODTH 4KJPD 5A7EA 3VFTA 1FFOA 4GQZA 2NYZA 2I27N 3E80A 3QH3A 5GRYA 4NPKA 1JZ8A 2FLMA 4LOUD 2WPGA 3KS0H 5J9PA 2BMKB 3TPKA 5BOPA 4HUUA 1EZLA 2GITB 4FLQA 2FO4B 3CSPA 3DRQB 5BO0D 2EDWA 3KL0A 4KV5F 4X8CA 3T8MA 4AEFA 3GBEA 2EE0A 1TTBA 3ATBA 3EW3B 4ES8A 2VRAA 1R5IB 1IGYB 1CLVA 1X5IA 4HC1H 4JVWA 2OTUA 4ELME 5C0CD 2FUTA 2PPDA 1KBPA 1LEGA 1Z9MA 1IAOB 2XZAH 3GJFB 5C0AA 2IH3B 1RMFH 3ZDZF 1YNKL 3AXLA 3HKZA 3MJ8B 3RG1C 1AACA 2B1AL 3ULUF 4PPTA 3F83A 1WCBB 3ILQC 3DGGB 3CSYB 1M71A 4AQ8C 3G6AB 1ZXQA 5E0QA 4G7SB 5IFJA 4FYRA 4LSVL 4MAYB 2H32B 3QDGB 3ARFD 5CZVL 1WZLA 4GQ9H 4PLNC 1WT5A 2L4OA 1OF0A 3KPMB 3B6SA 2HTLD 9CGTA 4LFHG 5DGRA 1G9NH 1QSEE 4AM0B 2ZXWB 3ROOA 5IB2A 2DY2A 1Z0MA 1T89A 3MLRH 3FT1A 3FTVA 5HHMD 3TT1L 4ZW3A 2K78A 5SWSE 3QIWC 2WB7A 4CL7A 5C86A 1KCUL 1XBDA 4G82A 5B39G 2IBZY 3KPOB 5L6YH 3SDAA 3LHAA 4DPAX 2EO1A 4UTBL 1YDPA 5I1GL 2ZSVA 1JTOA 4BEIA 4JFYB 5DLMH 1L0PA 2YD0A 2VZ1A 3BZ4B 2X09A 1JZ3A 4OFVA 5DD1H 4EN2A 1SNRA 1WUZA 1TQTA 2LGNA 2IIJA 2W80C 4ZTOL 4RESB 2ISDA 1UWGL 5CIPA 3Q3GA 4LPUA 3PNWA 1A1NA 1E5AA 2XUWA 3NJVA 4ZMNA 3F7QA 1S5IH 2WQVA 1GC1C 1FC2D 3BXNB 4X2UA 3BKMH 3HE7C 2EDXA 2R51A 1W72A 1OPGL 3K46A 4RDQG 2XBTA 4XNMA 1TTGA 3OG4B 3SE4C 5HDBB 1DVFD 1U8OB 4MD5B 4PJIA 3AREC 1KYUA 2FJHA 5DQDL 5FYLH 4IDJL 4F1ZA 4EF3A 4L18A 1H3WM 5TDNA 4LAQL 1D6VH 2QPSA 3KVDD 2FSEB 4KY1H 1XF5B 1OAXH 4NT6A 4QHUB 2EDLA 2XKNA 4XPFL 3ULUH 4G8IB 3O2DA 1AC0A 1HL8A 1FG2B 2X9ZA 5HDWA 1WO2A 2YBGA 4KRPD 1X6NA 1T5KA 2VLLB 1V10A 4PJFF 4YSOA 3IXAB 3GBNL 1EEZB 4JDTL 1S4IA 4GRWB 1REIA 2A9NL 4IBSA 1S7XA 4W9GC 1XB8A 1G7PB 2FWOA 2C1OA 3TBWB 2FJGA 5H94A 1I8KA 1JFHA 1NOLA 3IB4A 4K7FB 4HJTA 4CVWA 5CBAB 2EILB 2VWEC 3LNGA 1A0QH 1CDGA 2NY2B 2GYSA 4YXHL 3ZT5A 1SBBA 1WBYB 1F11A 3KLAB 1O7VA 4MHHI 5KSBA 3F12A 4PJHE 4NWUH 4TF4A 1AD0B 2DQCL 2EDTA 4L3FA 4HK0B 4IGBB 1XXFC 1UD8A 4ODVL 3S4SG 2G75B 5T1KB 4TUUA 4E2OA 4LLYA 4QAWA 3C60D 1IUZA 4P2QA 5I17A 4KAQL 3V79C 1QRNE 5BPPA 1YZZA 4HBCH 3UPCA 3WJLA 2ZYHA 4ZSOA 3ZZQA 5D7IE 1BYNA 2P48B 4WF7A 5HYQA 3WIFB 1JZ7A 3ES6A 4JJOA 4DP0X 2QADC 2WKOF 2X1WL 4X4YB 3GHEL 4KQ4H 3B5HA 4ZMYA 3MRLA 3G9AB 1L0XA 3TN0C 4XZUA 4ZOCA 4DEPB 5KANG 3C6LB 5C0EB 4OZGF 4W1TA 2G3ZA 4LU5L 3WMSA 4JREC 4CBPA 1C5BH 4N0YH 1JVKA 3U83A 3E9UA 2B59B 4AIXA 1N6VA 2J88L 3ALWA 2UZPA 2P80A 4X99A 1NIBA 5KBLA 1U3ZA 5IR1B 3IGLA 3NCFB 4HPOL 1ZT4A 3MLYH 4FTVD 5I74C 2ATKA 3FU0A 3QG7L 5BVPH 5I5RA 1AHMA 4IDLA 4A7UA 1PY4A 4JG0H 4QHKJ 1ANUA 4P23D 3V4PL 1TJIH 4G9DB 2Z4TA 3ESPA 2AEPL 4BH7B 3T1FA 4RRPG 2NZIA 3MRNB 3UGUA 2ESVE 1BVNT 3D1MC 2BNUA 3PIQB 2SEBB 1M6OA 2F54A 3EJJX 1YEHL 1R3KB 4GB9A 1CGVA 1GYWA 1AY1H 3O6ML 4IOFD 4WHTB 5DDHB 5MEQB 2QTEA 3OMIB 3OQRA 3ARFB 1TR7A 4J27A 4K3GA 5T5FH 4J3OF 3RPKA 1FGVL 3HZMB 4P5TA 4XT1C 1LYQA 5DA4A 3G3LA 2WCPA 1OAUH 1T22A 2YA1A 1M7IA 1XF4A 2ED7A 3Q7JA 3WSQL 4BFFA 3WEBA 3NFNB 1CDBA 1V54B 2APVA 4PJGB 5IQLA 2BCMA 5C2BL 1OLLA 2EDMA 3EKCA 2COVD 4N2HA 4HIPA 3BSHA 5E08H 1CLCA 5AW0B 5FM5M 3WFEL 3ZKQD 4PB0L 3F2LA 4YHLH 4F9LC 3U9WA 1LD9B 1AGEA 4JM2C 4WI2A 3EG9A 4Z7WF 2KQMA 2ARWA 3UO8B 3VB9A 2E4TA 3NQKA 5IJVB 2IDTA 4ALAC 1JN6B 2B4CC 2JVUA 5FO7A 4HX1A 2WXOA 1M2OA 1KGCE 4XB8A 5ICYB 2O61B 2ZXEB 4HKXB 1ZHLA 3S8GB 2OSXA 1I7ZB 3A6CH 3L9RB 3CFIC 3QUZA 4HIEB 2JJSA 2AJZA 1JK8A 3GS4A 7PCYA 2I60H 5AKSA 3TEZA 5HY9A 2Q10A 5J6GB 3ZDXF 2ZUYA 4LPYA 3O6FC 1QW9A 2V3EA 1HSBB 4DQAA 3DX3A 1KEGL 3HCVA 5T1MA 3MTRA 3R4DA 2BZDA 4F7EB 4X6EA 4E9VA 2Z1PA 5MHSD 3T2OA 2ARJB 3AC0A 5DJZB 5LKNA 3NJNA 1M2VB 1ZTXH 5FF6B 1SZNA 1N5AB 3BH8A 4N0UB 1DVTA 1MHPL 2VC2B 1R6VA 4NQEA 4XMKH 3F7RA 5C71A 1HAUA 2BRQA 3QJTB 3Q6GH 4XN4A 1SQMA 1I53A 4AMWA 3EBIA 4YE4H 3PGDB 1FVDA 4U6VH 4LK4A 4K7PL 1U0QA 4JX0A 4HIHB 2DKMA 6FABL 1SDDA 2P24B 4I0KA 1ZWIB 3DV6B 2E4FA 3GMNB 3OX8A 5HHOB 1AP2B 4GRLC 1RIUL 3X1EA 1IAIL 3FQYA 3HC4L 3JUYA 2X3AA 3WXVL 4UTBA 5CCJA 3FTGB 3FOMA 2YUVA 3D18B 3KWWB 3PWVB 5LNEA 3ZKND 4I2XB 4LP5A 1G7IA 3C5SA 4LEXL 1T0MB 1NSNH 4KHXH 1LO5A 1ZIAA 4P57A 1O0VA 4P07A 5I30H 1FIGL 3MGTA 2EH7H 1P9MC 4LSRL 3M1CA 3V4VB 2F74A 1E4XI 3QUGA 2YN3A 4AJWA 3NFSL 4IIZA 3WJMA 1TU2A 5E8PA 2Q6WB 1AD9A 3C87A 1KEMH 4M7ZB 4FXTA 3OSKA 1PAMA 3CHSA 3HS9A 1E9OA 1KPRA 1JGDB 1S7TB 3P40A 4NM4L 3RIAF 4OJDH 4HJJH 1NGYB 3MLPA 4WEUD 3W9EA 2BS71 4HMEA 1D9KA 4JO2L 1RKRA 5IP4A 1EHAA 2OMNA 4DGIH 4G70B 5ANMB 1EXHA 1LTXA 4Z7NF 1IC5H 2NDGA 3GJEA 2WXFA 4NQTA 4JZNB 1HQ4B 3QUMB 5IVOA 1XSOA 4MXVE 5JO5B 4PVBA 2HRHA 3RVVC 2DQDL 4L4TE 2VZUA 3I6KA 2LT9A 5D5MA 2AJXH 5A6IA 1FO0B 1MHEA 1NBYA 1N68A 4U6TA 3KJ6L 1OB0A 2D7PA 5C6WH 5DMYA 4G80B 2ZCZA 4HS6B 4NI3A 1NDMB 1HE7A 1WZKA 2HKAA 3QXDB 2QZ5A 5EU5A 4G3YL 5IWLA 3RZWA 1OCZB 2IDCA