2XBTA

Structure of a scaffoldin carbohydrate-binding module family 3b from the cellulosome of bacteroides cellulosolvens: structural diversity and implications for carbohydrate binding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
PVQVNSDLKLLFSNNGAAASSNQIYMNMKLQNTGSSTYDLSKITIRYFYTSDDDKALTYYSDYVSIGSASATFNNLSPVHAKANKYIEIKLASGTLGAAGAQWPSQSEVTIQGRVAKADWTNVDQSNDYSYPGSMSQFGENKLVAVYYNGALVYGTPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULOSOMAL SCAFFOLDIN
publication title Scaffoldin-Borne Family 3B Carbohydrate-Binding Module from the Cellulosome of Bacteroides Cellulosolvens: Structural Diversity and Significance of Calcium for Carbohydrate Binding
pubmed doi rcsb
source organism Bacteroides cellulosolvens
molecule tags Sugar binding protein
total genus 35
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xbtA00
4C8XA 4JO5A 3ZU8A 1TF4A 1K72A 4TF4A 3ZQXA 2YLKA 4B9FA 4B96A 1JS4A 2XFGB 2XBTA 1GA2A 2L8AA 2WNXA 3ZUCA 4B9PA 3TF4A 4B9CA 2WOBA 2WO4A 3ZQWA 1G43A 1NBCA 4B97A 1G87A 1KFGA
chains in the Genus database with same CATH superfamily
1CI5A 1ZHNB 3SCMA 3ARBB 1OTTC 1WZMA 3CH1B 1IGIL 3U0WH 3AB0C 4QOKB 5I19L 5EBLB 1OP4A 2JVUA 4J8QA 2J8HA 2YXMA 3V8OA 5CZVL 2OYKA 3SPHA 1WRFA 4MCZB 4G82A 2E7LC 5CM1A 3KPPB 4JPKL 4KK5D 4ZO9A 4DO6A 5EOTA 1FFOA 3H6JA 3FU6A 1XL4A 1EXGA 3HNSL 4H44C 4U6YB 3RG1C 4HWUA 4R2GC 4YBQD 3BP6B 3EKCA 2WLIB 4NAQA 2BK8A 2OTWB 2WKOA 3BSZL 2UY6B 1JK8B 4NNXA 3DURB 4MD4B 5IESL 1RULH 1KEMH 3UTPE 5IMLB 3SN6N 2LE9A 3RKPA 5DJZA 5DK3A 5AB2A 4N9GB 2VWEE 2BSTA 5TPWH 5E2VL 5GS0L 4JO3H 4LNRB 5D1XC 3F58L 3VFUA 4TOYH 2X0UA 3QEQD 4P57A 2G9KA 1BYPA 5EEWA 1R5WB 4PG2A 2N56A 1D5ZB 4J23A 3FPYA 4M56A 4WHTB 3EYQC 3FL7A 3ULUL 3TWCL 1CE1H 3LMJL 3OZKA 1JTTA 3O9WB 3PP4H 4N2LA 2VW6A 1XCQA 2OMXB 3NTCH 5AAWA 3HB3B 5SWSD 5KAQG 4TMPA 4Z1PA 5IFAL 3L7FB 3BAIA 4Z7NE 5ACMA 4JFPA 2IH9A 4P48A 1ZVYA 3I6KB 2FH8A 5FFGA 5G5DA 1OSEA 5JORA 2CK0H 3GSNB 4MYWB 3A0OA 4XP1H 3CHRA 4FXGB 2P52A 2B1AH 3QUZD 4DGIL 4FC3E 1M7XA 2V9RA 5BZZA 1KIRB 3RZCB 3VTAA 1KYUA 2P44B 4JY6B 4R7DB 3P2DA 4S0SD 4HUKB 1KUMA 5C0JA 4GIPD 4PFEA 3N06B 3HS0A 1GIGL 1YYLL 2F8IA 3S4SG 2C9VA 4ZW7A 4D9QE 4NN6B 1RZJL 2XN9A 3G08B 4WTZG 1GL4B 1XXDC 3MLYL 4JFEA 1OE3A 1I8UA 4NZDA 5C86A 1E9PB 4LBEB 4PCYA 5F9DC 4ZNCD 1UWGH 3K71B 4JFFB 1NCTA 1SFHA 2WXPA 3PDOA 3M17B 3HJ0A 5TD4A 1CXFA 4FQLH 1YEGH 1AP2A 1VFBB 3UC2A 2BIOA 1PJWA 3CVHB 3B5TA 3HBGA 4P2OA 2V2TA 1CXLA 4FLHA 3AC0A 3GMOB 3KEHA 4Z78B 3PFUA 4GRLA 3RPIA 3V79C 3MBWA 3ZYJA 4G42B 5IVXE 1JF5A 5J13C 5LNEA 4X8JA 4HGKC 4GP4B 4L8CA 3AU1B 3NZSA 4ZUVA 4LAQL 4TNFA 1S9XB 4M43H 2OTPA 2NNXA 3L3IA 3G5YA 3MRFA 5FKPA 3REWB 3CFNA 4WNQB 2A3TA 2IF7A 3MRRB 4HHWA 2EICA 2FO4B 3ARBD 5DJXB 5DRNA 3OX8B 5EBGA 3WGVB 3D85A 1NUFA 4P2QB 4DP2X 4FG0A 3NQKA 1ICTA 4AXWA 3TPUB 3QJUB 1E4XH 4YSAA 3LKNA 4PJBE 3RJDA 4M3KB 2JJVA 5I1IH 3WJMA 3QFGA 5DMYA 2DWTA 2AQNA 4F24A 3QI9D 2YD9A 1WZAA 5ETUB 2BINA 2VDKB 2IG2H 5DYFA 1KLGB 3DV6B 3GB7A 2J7LA 2FECI 2YN3A 5ES4B 3M1CA 5JTWA 4JG1H 1SEBB 2ZG2A 4MS8C 3BEVB 2ZKWA 2WAHA 3ARDD 2BVQB 4FYTA 4QRSA 2AABL 2ICEA 2IMNA 1MFCL 1HH6A 2I5YL 4D0BA 2FT6A 4U6HA 5IIEA 2OX5B 2VDNL 3WS3A 4PYHA 4FEIA 4KKNA 1IV8A 1PX4A 4HAGA 4TLSA 1TT6A 5IROC 3ZGHA 3RFZA 3V4PA 5BOJA 4JY5L 3WDJA 1NANH 5HVGB 2ENJA 3GNMH 2MTAA 2ICWJ 3O9WD 5HYQB 2EE3A 3TFBA 1AACA 2WZPA 2X4RA 4OD1H 1C5DA 2OCCB 5IFHH 3L3DA 2Q6WB 3MR9A 1X5ZA 5F44A 1DJHA 2C1OB 1A7QL 5GISL 3QYMA 2C9QA 3US1A 2D2OA 2F53E 4NUQA 3T8XA 1XSIA 4HKJA 3IWUA 3L95A 1WWBX 4RLDA 3DUUB 1T0PB 5JOEA 2CSPA 4ODTL 3QJFA 3ZTNH 1MREL 3AGVA 3MJWA 3K72B 4EF3A 1NC4B 4TV3A 2PWHA 1JWMB 2DWEA 2X3CA 2NR6A 4YWGL 4LQFH 4WWOA 4HSQA 4BK4A 4HISA 2D3VA 3FB8B 4NQED 4TVSa 2C26A 2O5XH 5DHXB 1BW8A 4PRIE 1HH9A 4FNQA 3KZ8A 3TWYA 4LSPL 3A6BL 2DD8H 4MA8H 4XCNA 3APMA 1A6AA 3DRQA 3QUKB 1IO4C 3V4VL 5F9AC 4PUBL 3VD5A 2AAAA 4LLYA 3THMH 4OZ4B 2A6IB 1UJ3A 5EBWB 4JFFD 4AMXA 2QV2A 1MDAA 4MA3A 4WW2B 5IVZA 5FF6A 5D1QA 2B1OA 3CN2A 4QD2E 5HYJA 4P59H 3SGEH 4DT2A 1C5CH 5L8JB 4K07A 4EI0A 4PJAA 4OD2A 3MVSA 1KXTB 3HMXL 1NSNH 2A0LD 2F58H 5DI8A 2CKBH 4M4RA 2JCCF 5L6YL 3I9IA 1BQLL 2Q9OA 2UVFA 4YDVB 2P45B 1WSST 3IKCB 3KPSE 3HE7B 4YHKH 1T1ZB 2ID5A 4JKKA 1OD9A 4NO0A 3MRBB 3BD5A 3E3QE 3ARGC 1KDIA 4ZX5A 4E9QA 4K3JH 1QFWM 1SOXA 3U4BH 2OMVB 4GAJL 4W9JC 3N9GL 5HI4D 5I8EA 1NCCH 4LSUH 3TVMB 4V1DB 3UBXI 4L4VD 4XBPA 5IMKB 4YR6A 4XC1L 4XN5A 1HYSD 2XN9E 3IF1B 4LLVA 1VESA 4JFEE 4DPCX 4XVJL 5DTFB 3OAYH 3Q5YA 1PS3A 1F42A 2B0SH 5DRZA 4ZMTA 3QS2A 3B2VH 3P3YA 4EUPA 3VGEA 3WJLA 2NW3A 2P5WD 3GSXA 4WQOA 3G9AB 4Y9FA 1FRGL 2ADGB 5L2KB 4O2FB 1X6LA 1I9JH 1WUNT 1XO8A 4XRCA 2BHZA 2JLPA 4EO5A 4O5LL 2WQSA 3NIDF 1UXSB 1KJMB 2Z93B 3NACH 2ZP8A 2FJGB 4ZAKA 4NZUL 4D0DB 5C6WH 7FABL 3AQYA 2B77A 4P2RD 2BFVL 3BZDA 1PMYA 3C5XA 3QG6B 3T6ZA 3V7MA 3BSZA 2WLYA 4KUZH 5L9DL 1WEJH 4B53A 1CXEA 3CDFA 3F01A 2R1WB 1CFMA 4FTVE 2A83A 1XB8A 5LUMA 4N6RB 4TUKL 1GGTA 4WTXA 1RH8A 3P9MA 2VT0A 4ZX6A 2ICWA 4IMKC 3KGUA 3TH4T 3D69B 5DWPA 4G8FB 4LEXL 5E56A 4QHKJ 4OI7A 4JY4B 5FEBA 1WBXA 2A73A 5FA3B 5GRUL 3QT2A 3RGVB 4F8NA 1F4XL 1GGCL 3GIZH 3QIBC 1NC4D 4X7FC 1AGBA 2BP0A 4PGBB 2PYEB 3F3HA 4UT6H 3RWFA 4ZD3L 1WS8A 4Y7OC 1TTCA 3FSAA 1ET5A 5F9JA 3QJXA 3BQUC 2BOCA 3T0BA 3FTWA 1YEEL 4MMXC 3DNKA 4ZUUA 2VM3A 1VKXB 1TNMA 4AIZA 1IRAY 4OLWH 2FBJH 2PTUA 5FECB 4BH7B 3K4ZA 4I13B 4Y1SA 1BLNA 5C07A 4KRMB 1DEEB 2NY6C 2NDFA 1XR8B 1CD1B 3E38A 2AFNA 1ZSDB 4L8SC 1ONQA 3RWCB 1W0VB 2QQLL 4GAYA 5KVDL 4IYKA 3MNZB 4X6CF 4GYBA 2LW3A 3WO4B 3COOA 1PD1A 5HHNA 4HIXH 2RIKA 3U7WH 3CZNA 4S1SL 2HPOA 2PPFA 5IQLA 4XXCC 2CUMA 4EDXB 5DRWB 3VW3H 1IC4H 4GG8A 1NCJA 2NZ9D 4UINH 4UILL 4APQB 1BV8A 4DOHB 2QHLA 3S3JA 3HE7D 3TF7C 1JD9A 4WI0B 4DVBA 3JT0A 5HTSA 3IT8D 3MRLA 4LSVH 5IJVA 1QNZH 1XT5A 4HC1H 3RKDD 2X1PA 5T3XE 2DQDL 2JKNA 2YSSB 4ZFGH 3GKWL 1NGWA 1KPUB 2RALA 5C0CB 3QIWB 5ESQA 1Q0YH 5DHMC 5TDPA 3U46A 3AABA 2A4ZA 4WFFE 3WTVA 4LF3A 4NQCA 3ZE0E 4EUPG 2YXVA 1XZWA 4AT6A 5HGHA 4HETA 2G4GA 3DYPA 1PBYA 1SDAB 2G9HA 5BQ7A 1JBJA 1AGDB 1XF5A 1BAGA 3MXVL 5FUZL 4PRDB 5AVZB 3S37X 1MQ8A 3O6FB 4FNPA 1MCOH 3WKNA 5FYKL 1XGPA 1AGFB 1E90A 4ZOEA 2HUHA 3ZDYF 1UZ8B 1OARL 2HJLA 4ABVA 3FBKA 1C5BL 1EO5A 5D1QE 3A4FA 4WEEA 5L2KD 3UYOD 3QHTC 4NJ9L 2RHEA 3D18A 4JHAL 4JM0A 1DQJB 4S1QH 3K2MC 3SOBH 4PJAE 3P9LA 2KLRA 3UCQA 4EXKA 4NZRL 4G9DA 1BZEA 3AXLA 5I66B 2P5PA 1KIUB 2OS7A 1MEXH 1AO7E 4F15B 2HP4A 4DK6A 1AHKA 2VDRH 5LNGA 3QAZC 3S88H 4OF8A 5E7BA 4HPHA 4NSKA 1UOWA 3TO2B 4Y5XB 3V5KB 1JNNH 4YFEA 1JRHH 4ZFOL 4LKXB 4OZGA 5CEZD 1JYXA 2RR3A 2EE2A 3PDGA 5J06A 2PO6B 4FKEA 2EXWD 4OJAA 3UAEA 2P8LA 2PPAA 3MRKB 1U2YA 2A9NL 4U6VL 4OSUL 2HX9A 3R1GH 3DOSB 2B59A 4KKAD 4L29A 1R3HA 1JTPA 1ZTXH 2DQHL 3Q9QA 4Q74A 2XVKA 5EEZA 1DN2A 4Z0XB 1U3YA 5JUEL 2CR6A 1ILSA 3DX1A 4RGOH 2PYED 1NLBH 3H42L 3DC0A 1V3LA 3JUZA 5CAYB 2HRLA 2UZXA 4CMHC 4MZRA 2MQGA 2Y5TA 4W6YB 3V9CA 1BVKA 4ICWA 1ZXKA 1T03L 2J73A 2X4PA 2X4NB 4UNTA 4XO4A 4KKZA 1HAUA 2FJSA 1VEPA 3MFGB 3DJ9A 1WAEA 1D6VH 4JREC 1H3PL 1N7MH 5T1JA 1DQQA 5DZAA 4N8PA 3W11C 1F2XK 1MHHB 4N0CC 5AENA 2DWDB 2Y2WA 1RFDL 3MJ9H 5C08A 4CN1A 1NAMB 3ESPA 1EEUA 1J10A 1VGEH 3VXUB 1IBYA 5DFVD 1I1YB 4E42A 3V4VA 1QSEA 5DUBB 1GC1H 4HXBL 3VFGL 3VFSB 2HG0A 3I6GA 5EU5B 1LJMA 15C8L 1NEZA 4Z6AT 3ULUE 1VDGA 5KANG 4XNDA 4R4NC 2F5BL 1UT1A 5DJAA 3VXTA 2G3MA 2Z7ZA 5AG9A 4OM0H 3DRTA 3HMXA 2Q86A 3QIWD 1FL6B 2DM4A 1Z3GH 1JZ7A 2MCAA 1E5YA 1S7VB 4KRPB 4M9PA 2JCWA 4QYOA 4WY7H 5IKCB 3PJSB 2CHDA 2VLKA 2QVKA 3C2AH 3I02B 2X28A 4NN7B 3UMTA 3RPKA 4I48B 3PAUA 5IW6B 2WMPA 4PJCB 2F7QA 3UP6A 2VC2H 4HKZB 2C9RA 3O8XC 2ZONA 3O6FD 5C07E 1QW8A 2GJ6D 4IJ3B 3H55A 4R6UA 2XPGA 3Q6GH 1N5AB 4X9IA 5J1TC 2GITB 4OCSL 4G72B 3H7BB 4G9FA 4ZMVA 4M5YL 1HAWA 1W0YT 3QNFA 4DHLA 4NDMA 1JFQL 3TNMA 1PDKA 2XBZA 1YEIH 2PPCA 4W9KC 4BFNA 4PTUA 4AVIA 4WUKL 3FYIB 1M56B 5DURD 4PRPA 4BELD 3B34A 3VXRE 1CLZL 1JCVA 3SBWC 4F7CB 4H8PA 3DHPA 3LD8C 4IBQA 4MDIA 4L1BA 4ZFZB 2NUTA 2GVYA 1QFUL 3OHXC 2WBJB 3P30L 4RAUA 2ZOUA 5C0AB 4H0IA 5JHDB 3N1MC 1ZGLA 4UOJA 1OP5H 4LCCB 1BEXA 1ZGLP 4ES8A 3T4YA 2A74B 2W0FB 3LRSA 3EOAA 4BGLA 2XIDA 3CFEB 1B4JL 2PO6D 5JPNC 2HA1A 2WIIA 4NQCE 1Z9LA 3S2AA 2A77L 5HHMB 1RUPH 1QW9A 4IOIB 4AENB 4Y4HA 5I1AA 3LZPA 3UC0H 3D05A 1MJUL 2XA3A 3LKOA 3FO9B 4Y16B 1B88A 3KR3L 3U2SB 4XMPL 5E70A 1LGVA 2BOBA 3II1A 5FYJU 1PCSA 3UPCA 3N85L 4KPHL 5TE7H 1F58H 1HHKB 1MAKA 4GB9A 3RVVC 2YARA 4LGSB 1XGYH 4DZ8A 4G83A 5B1BB 3T71A 3BVWA 2EEDA 4ELKA 4GS7C 3L16A 3UOAB 3HBQA 3WN5A 3IJSB 4JQVA 1R3JB 3DSFH 4KO9A 3BW9A 3GXUB 3T2NH 3GS0A 4X6BB 3CV5A 4ABUA 4ENED 3DHUA 1CR9L 1I85C 5GGVY 3T0XA 3EOTH 1RZ7L 4ODUA 1YMMA 2BHUA 2O5YH 1LWHA 2P8PA 5C2BL 4AV5A 4PJXF 2DDQH 2C7UB 3WD5H 3OJMB 1G87A 2UX6A 1A7RH 3B9KA 3WUWA 1A4JA 4JG9A 4DF9A 5JHAA 2LU7A 2OQJA 1SEQH 1TKWB 2R4RH 2YPLB 4PJDF 4QXUL 3X14A 1A9BB 1COBA 3FF8A 4YHLH 1IEBA 3VXUD 1GOGA 1KZQA 3WO3B 4OZGE 2QQNH 1J0YA 1DANU 1V55B 4PREB 2ZUQB 4PP2B 3PWPB 3FO1B 2ZX9A 3SDDB 5D2LF 1SXZA 1I8MA 1OHZA 4OQTH 3V6FA 4KTDL 3RURA 1ZVNA 2EC9T 1MSPA 1DVUA 3GSVA 2XZCL 3GS4A 1IM3B 3NRPA 5FGBA 4BKSC 1VACA 2VW4A 4FG4A 2W88A 4X6DF 5FHAH 4Y2LA 4GSDL 3QUXB 5DD5L 3CBKB 3BAEL 1SXCA 1U33A 2ZCKL 3ML9A 3QO0B 3SPCA 2BOLA 5T3ZL 4M61A 1ZLUK 2Q2LA 3UO8B 1A2YB 3IXAB 4C4KT 1ADWA 1AJ7L 3MRNA 2XQBH 2CO6B 2HLEB 3MO1B 5DJ2B 2AGJH 5C9JA 1JCKA 4IRJC 5J9PB 2FK9A 3VD9A 1D5MA 1F3JA 5I1DB 4MD0A 1BVLB 1NGPH 1NUDA 2DQUH 4LGRB 1RUQH 1BGXL 2HVKA 3H54A 4LRNL 2BVYA 2BHYA 2OL3H 4X6EB 2HT3C 4K8RC 2NW2A 4ONGL 3V5DA 4XVTH 4OZIE 5C08E 2R2EB 4IRZL 5TE4L 4AMKL 4A2GA 3VYPA 2CRMA 2QHRH 2X0WA 4OH2A 4X99A 5L7XH 4PJ5A 5ALBL 4DP4X 3KM2A 1QSEE 4ETQB 2P49B 3GO1L 4MMYA 4EVNA 5IR1A 4TN9A 4NM4L 4A7SA 4Y2OA 3FT9A 2WBJD 3VXQA 5E5UB 5C0AD 2C3HA 2V33A 4PBWD 5GRJH 3BC9A 4M1DH 2QKIA 2YO3A 3G5WA 3TZVC 1KXQE 5C2UB 1AZUA 1A22B 4WV1A 3VGBA 3NZHL 2EIBA 3H9SA 1A3LH 1G4MA 4P23B 3PQYA 2EDDA 2IXQA 3BRDA 4H7VA 5AVUB 2E0PA 4MRBA 5F7BA 1C16B 2XZQH 1P5UA 2VLKE 2VTFA 4BFGA 1E9OB 2ARJQ 1VA9A 3DVGB 3RIAK 4H25A 1WWAX 1DCEA 4Y16D 5HJGA 3IDIA 1P5VA 4UTBH 4NC0B 4CVWA 1Q9KB 1RUKL 4NKDA 1H5BB 4GI8A 4ZFOA 1IMHC 2HKAA 4I77H 4Y9BA 2PNDA 2WWOA 4EI5C 4YDJB 4G9FE 1CK0L 3GMNB 2QR0B 1I7ZB 3HBZA 2ITCB 1T6BX 3FO2B 3MNVB 2HKFH 3O3AA 5AYUL 1FPTL 4IK6A 1V27A 4XPGL 1D5IL 4LPCA 5EDXA 2DQCH 3CAFA 3PP3K 2HKHH 4S1RH 5HVFB 4UYQA 5ADOL 3WUWG 2YOAA 1FO0H 2O72A 4KK5C 3O3DB 5BOZG 2HMID 4ISVB 3GSQA 3PNWA 2XXGA 2ICWI 3RDJA 4GAGH 4X5XB 3H7LA 3CHQA 2BXYA 3LHPH 4YBQC 1HL8A 2XCMC 2A9ML 5CU5A 3ZZLA 4XVUC 2NNCA 3AM8A 2YPLD 5LWYL 2ADFH 3FCSB 4DSYA 4Z7OB 4LPWA 1T0NA 1AANA 2CDFB 4F37K 2V9TA 2WINB 3FT3B 5BUGA 3GM8A 3QDMB 3VG9B 2JJUA 1RLBA 5K33A 5A2KH 4NQDB 3SDDD 2VMEA 1AZBA 4TQEL 5D9SA 3IJHA 4U6XB 3DLQR 1HL9A 3RVTC 2P24A 3CFTA 5DMGC 5BV7C 4OJDH 4O2CA 3UYPA 1WC7B 4K73A 1IM3D 3ULSA 3J27A 4UM9D 3BVTA 4H20L 4X5WB 5T5FA 1FI8C 1SY6A 3SJVB 3GK8H 5I0XA 1GSKA 2HXAA 5DEFA 4APXB 2KYIA 2CD0A 1HVXA 4JHUA 3QS3A 1FFPA 2WVVA 3ET9F 4EN3B 3UJTL 2BERA 4OLXH 5DD1H 2N1KA 1WAAE 4JDEB 2X9YA 4PS4H 5C6TL 3I50L 2PCXA 3IJYA 4QXGL 4FQXD 4K23L 3H2QA 4M8VA 3IVKB 3WGUB 1ZE3H 3CFDB 5TGBB 1YMME 2YAFA 5BMFL 3D3VD 3DX9A 4I3RH 3D4CA 2AEPH 1C1EH 5EZJB 4XPAL 1YC8A 1G7IA 1PL3A 3VQ2C 2XETA 3O2WH 3N1GC 3U6XA 5DHVA 2Y7QA 2VDMB 4B9ZA 2HH0H 2YIHA 3D8MA 1Q38A 4KJPD 2XKUA 3GMRA 3INUH 4XNQB 1QTYT 4PLKD 1N6QL 4ZMWA 3OF6D 4PJFF 4DGVL 5KANI 1OSZB 5C8JB 2DQIH 3J07A 2EVFA 1DQML 4HDIB 1XZ0B 3GRGA 3HG1E 4WCYL 4F2FA 1KBGL 1U3HD 4KMTL 1OF0A 5KVDE 5CWSB 1Z5HA 3IU4L 3CQFA 1IGFH 1T7XA 1BIIA 5DU7A 4C8XA 4FABL 1MY7A 4ABQA 1T20B 3ZDXE 4UCFA 2EDOA 1FVCA 5AOKA 2EO7A 2IALA 1ND0B 4PD4K 3HI5H 5E9DA 3E9TA 4U1NA 2AJXL 2YC1B 1K5NB 3QPKA 1E8XA 1T66D 1KJVA 4JQIH 4I7ZC 5MEPB 3C5ZD 4D2NA 4P46B 4EZLA 1OQOA 3DX8A 3WEXA 4JRXB 1NDTA 1S7WA 2CNYA 4LP8A 4ELDA 4QRQB 3ESVF 1A4CA 1PKQA 4KBPA 3ZTDC 4LU5H 3P73B 5J6HB 1ADQH 2DTSA 1WFOA 1U92B 5KZCD 4PJFA 4K3EH 5CBAB 3QORC 5TQ0H 1BXVA 2EE0A 4MD5A 4M62L 3UTTA 3SDAA 1MPAL 2E8ZA 4HWNA 3CC5A 4LBAA 5DZ9A 2W80C 4CADA 3T08A 4BQ6A 3CPLB 5EPMA 4B9PA 5H4YA 4PJ5E 1L9OA 4OLZL 5D7LB 2X10A 3KS0H 1KCRH 5FYKE 4PJ7F 1DJYA 1J0HA 2ZOLB 1JHTA 1IEAA 2ZWSA 1A0QL 1Q9LA 5EZIH 2B8OT 4AUYA 1OSYA 2NX5D 2GPZA 5BW7C 1MCPH 2EVIA 1ZA3A 4CAGA 2BS71 4ZMPA 2W0KA 2VL5A 3ESMA 3EIFA 3PF2A 1X5IA 1I8AA 4FFVC 1JGIA 4B41A 3QDMD 2FWOB 3NAAL 1NFKA 1MWAB 3MZTA 2H6PB 4NQDD 1AD0A 2RMNA 4QHKI 1OLZA 5IBTL 1IGJA 4HUVA 3IETB 5IHUH 2J1KA 4UT7L 1YNTB 4WTWA 1NC2D 3OJVC 4HS8H 4XWGH 2IPTL 1KY6A 3MRJA 4J1UB 1ASQA 5E6RB 2PTTA 1J9SA 1HHIA 2DZEA 2O6PA 4ZK8A 3EGDB 3O9WC 3OKOA 5AAPA 3BWAB 3WKPA 3OJDB 3SJVD 4BSJA 3HB3C 2H3KA 3Q1SH 1XIWB 1AR2A 2R56L 2BVEA 1LEGA 4EN3D 1QA9B 1QR1B 3TBWA 2GSGA 3ESNA 4ONFH 1X5YA 2KERA 5DQ9B 3SPVA 1MVYA 1TZHB 4LT7A 4Q14A 1ZT1B 5M94B 3FN9A 1FA4A 3RZCC 4YHNA 4HAFA 3QEHA 1T1YB 1A5FL 5I1GL 4UNIA 5GGVH 4NUJB 4YHZL 1DTUA 1X7TA 3CZSA 3OAZH 4G3YH 3PPSA 4A6YB 3FTYA 4XNUH 2KPNA 4HX1A 4HUXA 3TXAA 3S3SA 3F85A 3NH7H 4ZW8A 4NN6C 1URLA 3NJJA 3T3ME 4AV4A 4DP0X 3UDWA 5ENWB 1QHPA 3NN8B 5HDQH 4UWQB 4IBLT 5I2IB 3OM3B 4G6AD 2VXSH 1WO2A 3ARPA 1MFEL 3RTQB 3HZKB 5E5RB 5DEGA 4P2YA 1F6AA 4AH2B 3KL5A 2XY1A 4QAWA 3D08A 4GI9A 5IOPA 1ZLUH 4IRZA 4PJ8C 5FA4A 2GIMA 1X9QA 1EJ6A 4WDIA 4QRBA 2Z34A 4KZEH 2BY0A 4YQXL 1LE9B 1BQHA 4Q8BA 1OZUA 2EDTA 2WGXA 1PFCA 3VD7A 1NCUA 2APSA 2J6EL 3D50A 2XG4A 5I6OA 2OYPA 2BZDA 2ZYHA 3VO0A 1TJMA 5I5IA 1UM5L 2FL5B 3GS7A 1BAFL 1T6VN 4X8CA 1MRCH 3P77B 3TIDB 3QR1A 2ZKXA 1JVKA 1INEH 3JWOC 1OIOA 3L1FA 2NNRA 2X6CA 3GGWB 2G5BA 1L5GA 1AQKL 4S2SA 2BP8A 5HI4C 2AV1B 4NZTL 1UCTA 2XFXA 2NMSA 2G0KA 2G75B 2NQCA 1CVRA 2X09A 3FT1A 3S3CB 3D7PA 3ZYZA 3PL6A 4EQ2A 1A6WH 2FNWA 2FIKA 5FCUL 1I82A 5ESVB 1LILA 5B1JA 1FJ1A 1G7LB 4B9KC 2HYMA 3CLEH 4GRMB 3KPOA 4FP8H 4OV5B 3D4GA 1IGYA 1MVFA 2EKSB 2AAVA 3PGFL 4KO7A 4NJAH 3FB7A 4UQ2B 3KPRE 4P9HH 5F1IA 4BFBD 4I3SH 2JF1A 5TF1H 1KC5L 1BBJB 2VQ1A 2PCFB 5CEXA 4K7FB 2EIJB 4PGCB 2NQ3A 2R0KH 5LJYH 3FU5A 1SQMA 2VXVL 3EBAA 6FABL 3MOQA 1GRWA 3CSYA 8PAZA 2X4QB 2X9XA 3S36X 2CJSA 5G4OA 1FG2A 3SQBB 4YAQB 1JVOA 2HJKB 3IXTA 3O45A 4ZQTA 4PMFA 3BVXA 5JLZB 3NCMA 4J3VA 2IBGA 5CZRA 1RZKH 4AK1A 3O41A 1KMGA 3L2LA 5K5YA 2HVJA 1PKQE 3LPWA 2YJQA 2HFEB 4BSVA 1H6EA 1VFMA 5FWQA 2F7OA 4B9IA 1XIWD 3AG4B 3IFLL 3DI3B 1YECH 1F6LL 3O3BA 2ADIB 5JHLL 4ICXA 3GSUB 1QSZA 1FYTD 1ZANH 3ULVD 3V4PH 3UTTE 1F00I 5DQDL 4XT1C 5E99L 1X7QA 1EMTH 5DO8A 1ZHBB 3ALWA 3DETC 3E6HB 1MLBA 5BQDA 1KGWA 4HJIA 1NCHA 2FE0A 4BRVA 4XZ4A 3FN3A 2K4AA 1NCNA 2VR5A 1WA1X 3BUBA 1S46A 4G7QB 1N3NA 1WK0A 1JK9B 3M1OA 2NUPA 1KPRA 1M9SA 1TJIH 2Q0ZX 4XN1A 2C8NA 3I85A 2W1NA 1O6SA 1BQRA 4ZX3A 3FB6A 4IGBB 3OMAB 5T3XH 1YY8A 1Y6MR 4F8OA 3RTQD 4MMZB 4WUUA 3QQ3A 1R3LB 1J1OL 2KBGA 4DK5A 2ZCLH 2XN1A 4CU7A 3LEYL 1U8JA 2Y7OA 4XOBA 5D1XA 4AYGA 3D48R 4AW4A 1HTYA 2P46B 3CMOH 2Z4QB 4PJIF 2EYTB 3WE6B 4DGYL 3FXIC 3W9DB 4XNAA 4XMXA 2JXMB 2ZKMX 5CHNB 1OAQL 1JV5A 2Y36H 2B08A 3PGDB 2CHNA 1HIML 3I6LD 5E5MB 1N6VA 3PJNA 5AW6B 2IBBA 4WFHD 3GMQA 4J3OD 3TYGL 1FLTX 4D9LL 5HHXH 1EV2E 3MRHA 2XA8H 3RKDC 2BY3A 4JMXA 4ZTOH 1DE4B 4AJWA 5T3ZE 2D03H 3TVMC 5CD3A 3U2IA 1YO4A 3V0HA 3NIFF 2UXVA 1CBVH 2NXZB 2XRAL 3I9GH 1F3DJ 2V2WB 3PWNB 1NCAH 4NGHH 4IU3A 4UAOB 1RHHA 4KHTL 4PJIA 3CZFB 3IDGA 1IT9H 2WVUA 3L9RA 4P4KC 1OE1A 4N0RA 2P5EA 3T1FA 1BF5A 3VB8A 3X17A 1PEWA 2CO7A 1MCEA 2CUAA 5GQBA 4M7KH 1RIHH 2VN5A 3G04B 4YHYB 2CJUH 2A38A 2HTLD 2I9LA 4GMTH 4QRRB 1ZK9A 4PJHF 5LXGH 3WTTA 2QGBA 2V17H 1V3JA 1DDHA 4EUPH 3WKQA 2NY2B 5KJ7E 3VD2A 3LZFL 3IJ7A 4OTXL 2G5RA 2GY5A 1AZNA 5I19H 3TC9A 4JRFA 1A64A 1EEYB 2HRPL 1CDGA 3IRCA 2P80D 5C0FA 1QVOA 4KI5D 4I3GA 2K6WA 3T3PB 1QYGL 5SWQB 1J5HA 1XR9A 1E5ZA 1I1AB 3P4MA 4JPKH 1ZD6A 1ZVSB 4V2CB 4Z7WA 1NL0H 3PABA 1Q1PA 5KYYA 3HNSH 1KJ2B 3IRZA 3RUGA 1FZKB 3JTSA 3CVBA 1NFDF 3N0PB 2CHXA 5AVXB 3X1FA 5BRZB 3BSZH 1PY0A 4F3FB 3CLWA 2FNBA 1GVIA 2ZCZA 5B1AB 1TTFA 1HSAA 5IESH 3ZHDA 2VB5A 8FABB 5I1HL 3BGMA 3ABKB 5B21A 2OW6A 2YRBA 4K5PA 3CN3A 5E2VH 3RGVC 5GS0H 3MJ6A 3F58H 3KLLA 4P5MB 3VFPB 2V8LA 1CD0A 4LLMA 3ZDZB 1YN6A 2OMWB 3CXDL 3EH2A 3GMMB 4UM8A 1OAXH 3TWCH 3ULUH 1P7HL 3RWGA 3LMJH 4AZ8A 5AL8A 4DEPB 5DWUL 5EO9A 3WXWL 3B83A 4IGBD 4Y5VB 1KIQA 3LX9A 1CLYL 1J9CT 4POZD 2FSEA 4MA1B 3T6VA 4QHMB 1KY7A 1DLFH 1W8NA 2Q7AA 5IFAH 4PBDA 2VRAA 4IIQA 3QULA 1JXKA 1QLFB 4XNMA 5CJQL 5JXEC 4ZUTB 3O6KL 3VD1A 4U3SB 3M86A 1V5JA 1EK3A 1NDMA 4DGIH 4KY2A 5DD3H 2X9WA 2IBZY 3JWDL 4MFHA 2IAAC 3FULA 5HDBB 3QCTL 2XT1B 2BW4A 3IDNB 4OGXL 5IROA 1AXSB 3VXSB 5CKAA 1JF1A 4IKIA 4LOEA 3DX6B 4HHGA 1GIGH 1YYLH 3BUDA 1DN0A 1WZKA 1P84K 4APQC 3LPFA 3ECQA 2E46A 4MCYA 1RZJH 2W60A 3FQXB 3QRBA 2QTEA 3MLYH 1QMUA 1M6OA 2EEAA 1MCWM 2NRDA 4H88L 2X2UA 1SJEB 2XNAB 3MV7A 4RGND 4U4IA 5CO1A 3WTSA 1IEHA 1PJ9A 3IJEB 3NG5A 5D1ZI 2I69A 2J6EA 4A7QA 3D39D 5E8PA 3O0LA 4AYSA 2GAZA 2XY2A 4CDGC 3ZT5A 3GUTB 3TU6A 4XBGA 3OAUL 3MLTB 1DSYA 1TVBA 1VADA 3BDXA 2PWDA 3HAEB 4DP6X 1FNGA 2VMDA 5LBSL 2NZIA 5DZPA 4QLRA 1QWNA 2D4FA 1OGAD 4DERA 3M07A 4WUUE 1FLRL 3SKMA 3VI4F 3U6RA 4G8GD 4NZFA 3C8HA 2WB1A 2APTA 2OTUA 2VM9A 5GIRA 3G9VA 1SDDB 1INQA 1QNIA 3FQ1A 4KQ4L 4LAQH 3BEWB 2DWXA 3FQTA 5BPPA 1LNUA 4XR8C 5D1XE 3EYOB 4QRRD 3AVEA 2IQAB 5EN3A 3UTZB 4F5CA 3BYTA 5FB8B 1GS7A 3LDBB 4YEFA 2NY2D 3DUSA 5ABAA 3S96B 1D7FA 5A16B 2P42B 4FG6C 3NSYA 4GPVA 4F15C 3VXMA 4JL2A 1H3GA 1RJLB 3BKML 4L3FA 3DPDA 4PJEF 3VMOA 1QP1A 2VIRB 4MNGA 3MRGA 1I1AD 2IOIA 1BZQK 3BOVA 3HZMA 2WJ7A 4A7GF 2I9TA 4Y5XC 1N67A 3NMEA 3F8UB 2WLNA 4GG6F 2ZKHL 1A6TA 1HINL 1KTLA 1RP9A 3MJ8B 5BRZD 1ZSHA 2F8VA 1Q72L 3W81A 4AYFA 2XZAL 3B4NA 3MNWA 3MA7A 4BJLA 2H3NB 4JE0A 1EHKB 1GGUA 1WBYA 3ZE2B 5JIPA 3OVUB 4R4FL 4MB1A 4M00A 5I1LA 1MFCH 2I5YH 2RGSA 5T1KD 4K9EL 3KW8A 4AG4L 2XPZA 2VDNH 2C4FT 4DPBX 1OB0A 2P5EE 5JHLA 2W0PA 4R90H 4JY5H 2AC0A 1HEZB 1AS6A 4U2ZA 3FQUB 4HPYL 3UP1A 4NRZA 4GXFA 2PWEA 4PJEA 5ITFB 5C0IA 1GCYA 1E3FA 4A7GA 1CFQB 5JNYB 2F61A 3FT2B 1DSWA 4Y1AA 4DQOL 2BJML 4X8GA 1A7QH 5GISH 1HE8A 1DL7L 1S5IL 2XTJD 2D3NA 3B43A 1NOFA 4P5TB 3OXSA 4ODTH 3WI9A 4Z7WE 1MREH 3VXSD 3RUGE 3O3EA 4XNZC 3FT0A 5EB9A 3V0WH 1TVHA 5LGYA 1MHCB 4HIIB 5J5EA 2UXFA 2AEQL 3JUYA 3WFHB 3SYAA 1LE5B 4CKVX 2ED6A 3M88A 4F2MB 5BO1L 4LSPH 3A6BH 2A99A 3A24A 4UBDD 4XTRC 5A2IH 1PLCA 2BVPB 5ERWB 1D5XA 3V4VH 2YWYA 4X0KB 4L3CB 4PUBH 2N0MA 2ERJB 4QMEA 4YGVA 3RVUD 2Q7YB 2KPWA 2WBXA 1MW2A 2AZUA 4KRPC 4L1HA 3QFJB 1U2CA 1HHHA 1CXIA 3FFCD 4NN7C 1G4RA 3ZHNA 1DBBL 1I3RA 3QIBA 4PG9A 2WXRA 3HMXH 2JWYA 4LO9A 4IJ3C 4EKJA 3KJ6L 1KCUL 5L6YH 3BQUA 3L8QA 3OR6B 4WGKA 1BQLH 3EJUA 4PLJC 3R4RA 2Y9RT 4MMXA 1QRNB 3MUHL 1U58B 2XBTA 1BPVA 5L2JB 1D9KD 3P69A 2PWGA 4QTIH 3VM5A 3ARFD 3I3DA 3D12B 2GY7B 1C08B 4DAGL 4UV4L 3EG9A 3QUML 4L8SA 4KWUA 5EC2B 5HI3D 3N9GH 3GUFA 5DJDB 1BJ8A 3UG4A 4IBVA 4B3VA 4ZSOA 1XF3A 1WFUA 4XC1H 2G60L 2CCLA 3I75A 3QDHA 3QWRA 1QWUA 4XXCA 3R18A 4FQIL 4LCCC 5ILTL 2A74C 3TBTB 3ALXA 3MV7E 4JFTA 1AD9B 3B6SA 1Z66A 5EU7C 5CMAA 4ZQKA 3GHBL 3CDZB 4K71B 4PU2A 4KKCC 5F96L 3NCJL 4KVPA 1FRGH 3EYUL 1M9WA 5DHYB 3ECVA 4H0GA 1JUFA 1RZGA 1R34A 4ORZC 4I8DA 1SJHA 3CHOA 4BFJA 3BCFA 2EVGA 5EFIA 4O5LH 4QRUA 4O4YL 3X12B 3BHBB 1RK0B 3OPZL 3L2NA 1KCKA 1NBYA 3N3EA 4Q2ZB 1KOAA 5I24A 5E8EB 2Z6FA 4NZUH 7FABH 3L3HB 4K8RL 3UAFA 2BFVH 3SKNB 2UXTA 2UZYA 5IB2A 5L9DH 3G5ZA 2R4SL 5E23A 2Q87A 4E41B 1P6FA 2GYSA 4JCLA 1SXSA 5AKTA 4Z3IA 3EO0A 1BVZA 1IIKA 4HLZG 4Z7UF 1SYSB 4P3DB 5DS8A 2K7QA 2G2PA 3BIBX 3FC8A 1FVEA 4ZYKB 2BNRB 4OFQA 5LGJB 3QO1B 5HI5C 4TUKH 1EFXB 4AUJA 2WTRB 4MSWA 4AUUA 2B5IC 3VXME 2ZYRA 1R6VA 1M7IA 4O02A 5CJBA 2YSTA 4IMLA 2IANB 4LEXH 4P5TD 5FYLD 5BXFB 3S5YA 3QNXA 4MXVE 1BF8A 5GRUH 2G30A 4G59C 1F4XH 1HZLA 1GGCH 2EH8H 2LV4A 3BDYL 1I7UB 4B96A 3OKNB 3S0PA 3GXTA 3L4TA 3NA4A 4GUCA 5GRYA 3AG3B 3V8CA 4ZD3H 4HBQA 3LIUA 5EUOB 1F18A 2FJHA 3MGTB 2P28B 4R0LB 1YLBB 2BCMA 2X89D 1EJOL 1YEEH 3FU7B 3LVEA 1U0QA 1CYWA 3EDJA 3ZY7A 2BIIA 1F1AA 3TH2T 2JIXA 3VX0A 1KYOJ 4FQCL 4YL9A 5IF0A 2V2XA 3NJLA 2ZSVB 4FXLA 4WIQA 3L6FA 3QUXC 5F7UA 4PCSA 4JFDA 3QQDA 3CFQA 4HHAA 1W6WA 2ARJB 2ZAHA 2QQLH 3IGAB 5KVDH 4HIQA 2FBRA 3C8KB 5I8KL 2YUVA 4YJZL 4I89A 4N3TA 5DDHB 4HZLA 4ILDA 2CUIA 5HPOA 3L3OC 4AI7A 4S1SH 1XTLA 5KG9A 1KBBA 4PYGA 5KOVC 4B50A 3RWHB 4HD9A 3UTSA 4MJ6B 2VDPL 3SD2A 5BNXD 2G0LA 1QRND 4YHML 1FVDB 1J11A 1F4WL 5EO1B 4E0RA 5LBSA 5CZKA 2E7BA 3CCHB 4KJPC 4TUUA 2JNZA 3TCLB 4B27A 2DQDH 1JNLL 5IM7A 25C8L 1MQKL 3GKWH 3PV6A 3K5RA 2YA1A 3S35L 1C12B 1LP9F 2DJMA 3LXUX 4IM8A 4QTHB 5BV7L 3MLPA 2Q76A 5M95B 2J5LC 1T3FB 3FQWB 1K6QL 3B2PA 3FFOA 4NCDA 4KMLB 4P5KA 4G8EB 5TJWK 3PV7A 2FUQA 4GO6B 2A9CA 4CUCA 4JFZL 2YUZA 1S7SA 4WEMB 3S5ZA 2VITA 3X11B 1MRFL 3MXVH 5FUZH 3RBGA 2CCWA 3TTSA 3RL1A 1G5AA 1P6WA 4LAJH 3QWOA 4P23C 1UM4L 1WZ1L 3ARWA 4IEFB 4R26L 5E6YA 1OARH 5FYKH 1T66C 1C5BH 2VISB 1FIEA 3GJEB 3HZYA 1U8QA 3OLIA 1XV8A 4JHAH 4NJ9H 2KDYA 5HGAA 3VWKD 1TTGA 3OKMB 4RMTA 2E56A 1DQLL 1QUPA 4I18B 3KGTA 1H5BC 5KYXA 2FYYB 2JQAA 2VDLB 4LPTA 3T2LA 4KJYB 1LP9A 1JTOA 4P8QA 5JQIB 4E41D 4PJGB 3HG2A 2OI9B 1IL1A 1L0YA 2L4OA 4MNQE 3O8XA 5HGDB 3N41B 2ENYA 2R7EA 1X5JA 4IS6B 4EI6B 2J4WH 1YUHB 3EDKA 2VAAA 3ULVF 3GBLA 4OGYH 5IUSA 2GQHA 3MV9B 5C0EA 3MRMB 4NQXA 2A9NH 5JW3L 4U6VH 2IAND 4OSUH 3QQ4B 1A9EB 5AW9B 1NA8A 4G1EB 3CGTA 5TE6L 1BZOA 2FJFB 2DQHH 3SBWA 4KQ3L 4CSSA 2Y7MA 5FWRA 2EIKB 2ENQA 4F9PC 4MQXC 5D4JA 1LWRA 5JUEH 1Q90A 1GOHA 3OHXA 3VG9C 5I74C 5GS1A 4H8VA 4ZS6C 2WXHA 3H42H 4OZHF 1IAMA 1HOCA 3FO0L 3H3BC 4J3XA 4Z7VB 1PD0A 1OTSD 1WDAA 1T03H 4PRBB 5HD8D 1CICD 3K2KA 3B7RL 3PIQB 4JFVA 1U8NB 1CQKA 5J89A 4XAKD 4YFDB 1H3PH 3L4WA 2VZ3A 1SBBA 1CD9B 1OKEA 2YD8A 4Z77B 4QHUB 5T1LA 3BLKA 1RFDH 3VFNB 4FQQB 5CBEB 3VRIA 4KK9D 3VI3A 1KGCD 2EIMB 4PB0L 1DJSA 4MB5A 2WP3T 3N44F 3CLFL 3DMMC 4HFUH 4N25A 2XBDA 2DQGL 2BP3A 2BW5A 4HAKA 4HXBH 3VFGH 1FBIL 3QNYB 3QJRB 5KS9B 1G7JB 5I76A 2LVCA 1DLHB 3VH8A 4IHOB 4J3OF 2BCKB 2W65A 3Q2LA 3KH3A 2IFFL 5DLLA 2ZOWA 4QO1B 1I85A 5DRXA 2GKIA 2AXGB 4X80L 5AKRA 3ZKMD 1JHKL 1N70A 5J0BA 1TZIA 4RESB 5GRXG 3DGDA 3O0RL 3Q43A 1HZKA 3CBJB 3F7YB 4BZ2L 4WO4B 5E6ID 2UVEA 4MJ5B 3VAEA 4M5TA 1EIBA 1S5HA 3DK2A 5CD5D 1XGTA 4G8IA 1XMWA 2CLRA 5F9WB 1CT8A 3D4ZA 1WTLA 5KN5B 1NFIA 1Q94A 5C6PB 3NOIA 4PIBA 1B0GA 1P6AB 2OR7A 3QUMA 4GRWB 1KB5B 4JFDE 4OCSH 4Y4FC 2YKLL 1TCRA 4M5YH 3GSNL 3R19A 4P9ML 2L0DA 1JFQH 4M7JL 4P46C 1B4LA 3ZT6A 1LDPL 4FQJL 4DW2L 4JS7A 3LS5L 3OZLA 3U0TB 4WUKH 4G71B 3UJJL 4J8RB 3VJ6B 2Z92A 2NYZA 3HPLA 5IHZB 1KIPA 4XMLL 1CLZH 3EGSB 4KNQA 3UTSE 2AZAA 2Q10A 3DXAA 1QFUH 2D7QA 2ZXWB 3P30H 4AGOA 4KI5F 2MNUA 3LV3B 1SYVB 2DJSA 4ODXA 5L8KB 2IWKA 3CTTA 2NY0B 3CFKB 1IM9B 3NEXA 2CLZA 2APFA 4IRJA 4OUUA 2Y1AA 1FGNL 1YMHA 4EBQL 1UENA 4LSSL 4HZ1A 3DVNA 1B4JH 3KCPA 4MS6A 1YEKH 4Q89A 2CCVA 4RAHA 5DYOB 4P2CG 4NZJA 4N2IA 3D0LB 3OKKA 4MJIE 4IRSB 1MI5A 3B3IB 2F68X 1JGDB 3CVHL 4OLUL 1MJUH 3EHBB 1LM8V 1YEDB 3RL2B 2VLJB 3FTVA 5AZEL 1M7DB 4XMPH 2X4SA 1YUKB 2Y7NA 2F74A 1Z0MA 4GIAA 1I9RL 3N85H 4KPHH 2MPAL 2PKDA 1JZ6A 2WXLA 2D9QB 4GBXB 3TZVA 4TL4A 3SZ6A 3K46A 3IBEA 5HGBB 4RAVA 4XP6L 2MFNA 4PTTB 5C09A 3VE0A 3ABZA 3FU8A 4P0DA 3JWOL 3X1EA 1R3KA 4PMEA 3WDIA 1CR9H 3IYLW 3SBRA 1ED3B 1N19A 5EU6B 3WXVL 1RZ7H 2KHAA 1OY3B 3T6WA 2QLYA 3ZJAA 5C2BH 2VRKA 3SKOB 2L8AA 1S9WA 2EYSA 4KKLD 1X9UA 1NTDA 1QLRA 3UTQB 2XWEA 2QGCA 1YN7B 3QISA 1GGBL 4A67A 2F1AA 4QXUH 5HJ3B 1R17A 1WHOA 3VH8G 2HFGL 4EI5A 2VDKL 2FX8L 3T0DA 2Y2YA 3ROOB 3KEDA 2MQ3A 3ZTCC 3K1DA 5D7SL 2OKMA 4QRPB 1BZ9B 3K81A 4UT9H 3TJHD 1FC1A 5TDOA 1TQSA 4NQSB 2LU3A 1GJWA 3LPOA 5T8IA 2XG5A 3POCA 1HWHB 4KTDH 4H13C 5IMOA 1GZPB 4OKVB 3BP4A 3QPQC 1XH3B 2FZ3A 3KBPA 2QDVA 3K4DA 3LHAA 5ECJE 4CSTA 4ZPVA 2XZCH 1K5WA 4B9JA 4AE0A 1Y7VA 3C6LD 4GSDH 5DD5H 5E1HB 4UI2A 3T0EB 1TLMA 1W0WA 5EORL 1HKFA 3BAEH 2ZCKH 3RTQC 4Q6YA 4TNVF 2EUVA 5T3ZH 1Z7JA 4LEOA 1AJ7H 2Y7LA 2X70A 1FNAA 4XNXL 2ZIDA 2CIIA 3HUJA 4P99A 1ILUA 2GCYA 2N0KA 4KK8D 5E2WL 1LEIB 1AHWB 1PZ5A 3D30A 2HAZA 3SDXF 3KDMB 2VWEC 3QEQA 1FNEB 1NMBL 2K1MA 3R8BB 5KSUB 1BGXH 1PAMA 4I4WA 35C8L 4LHUG 4LRNH 3ZKQD 5EIVA 5HHOB 3EAKA 1DQDL 4ONGH 1G7PA 1OEZW 2B7DT 2YK1L 3G6JF 3AREB 1M05B 4HJEA 4IRZH 3VI3E 4AMKH 2F2HA 5E1IA 3RWJB 5ALBH 3TNNB 1ZVHA 4QXTA 4A66A 2PW2B 3GO1H 5IBLC 3ATBA 3TX4A 4NM4H 5LHDA 2IMMA 2WOYA 3RLSA 1TJHL 2J1WA 4NKOA 2EDWA 4ZG1A 1E2WA 2LR4A 2NY0D 4W6WB 1IM9D 1N4XL 2CBQA 5F71A 5I8OH 4X4MA 3FQRA 1PEZA 1U8KA 3NZHH 5F6HJ 1BWMA 3SDXA 2WWMD 3F7PC 3CN4A 4JKWA 1MCBA 1R75A 5GZND 1G6VK 3RNQB 4OGAD 5EOCJ 3QA3A 4OCLC 3DJRA 3VFWA 5JOFB 1W2KT 1S78C 4GAAA 2ZCHL 3EHBD 3G6JA 4YMPA 2OPCA 1HI6B 2VLJD 4YHOL 1RUKH 1H3WM 1X5GA 1ETZA 4RVBA 1T89C 1I8KA 1ZAGA 2XWBA 2Z35A 5LCVL 1AC6A 1U21A 3FS9A 1ZT4B 3QXUA 4K4KA 1CK0H 1Y07A 2IH3A 5LAXB 4DKFL 1CIDA 5DJCA 5ISZA 1DBJL 4L1LA 4UF7C 4FN0A 5AYUH 4XPGH 1CG9B 1BYOA 3E80A 3GBEA 1D5IH 4EE2A 3FRUB 5EU3A 5F1NB 3OG4B 1LQSR 3WY4A 4C83A 1HXYB 5ADOH 4C56A 1E8ZA 5EU6D 4QWWD 3ES6A 5ACZA 3MGOB 1SVZA 2CE6A 1GTNA 32C2A 4HWZA 4BV1A 4PB9L 3PWUB 3WY1A 3QDGD 3CFBA 4IHBA 2YFNA 4LLUA 4OT1L 1B0RA 4CGTA 2A9MH 4PRAA 1G7MB 4EIUA 3SGJC 3L1OL 5JHBA 3KL0A 5LWYH 5MEOB 3PWJB 3RX5A 1GTFA 2OM5A 3F6IA 4Z3TA 1A1OA 1ZHNA 3QORA 3RU8L 2AQ3A 3VU2A 4ORGB 3BUQA 3CH1A 4QOKA 5K59E 1ZLSL 4YIQB 4TQEH 5EBLA 4XO5A 3QDAA 4DTGL 1MI5E 2DMBA 4MCZA 5MI0B 3EJRA 5D7KE 2JKXA 5I0YA 4NKIL 4AIEA 4JRYB 3L81A 2AVGA 5KYWB 2ZF9A 4U6YA 4YE4H 5GS3A 4XP9L 4F7PB 4H20H 4IGBC 2ZJSL 3GRBA 3LCYA 3BP6A 2WLIA 3T0ED 2OTWA 5FLUA 1JK8A 2OBGA 4MMZC 4LLWB 3DURA 2F7IA 2JKIS 4MD4A 1WCBB 4NO3A 5BW7A 5IMLA 4B9FA 1ZJBA 4XP1L 1F1GA 4F8TA 2B1AL 5C09E 3I50H 2HT4D 4QXGH 3JYCA 1IAKA 2R1XB 2VRQA 4FFWD 5CEZL 1DYZA 2CJ3A 1FNLA 1GJIA 4U4BA 1R5WA 5BMFH 3QZNA 3NK3A 1D5ZA 1OCZB 1DJIA 2BS9A 1CGWA 4WHTA 4BZ2A 4WF7A 5HHOD 2KZWA 3ASOB 3ARED 3O9WA 2SODB 3CXHJ 4MX7B 2DMKA 3O11B 1KDJA 2NLJA 3QCUL 1QACA 4ZXBC 1CGXA 1RK7A 3R4DA 5DVNA 4Z8FL 1N6QH 4OAWA 4DGVH 1HDMA 4Z23A 2J8UF 4FHJA 1DQMH 4WCYH 1KBGH 1QG3A 4KMTH 1QO3B 4BFEA 2Q3ZA 4YDKL 4F7EA 3NP4A 4FABH 1MCSA 2FEDD 1QFOA 2NXZC 3RZCA 4A38A 4JY6A 4R7DA 2IH8A 1EO8L 4M7LL 4UAOC 5F6IC 2XKNA 2AJXH 1JGVL 1EJFA 5AQ0A 1PCXA 2VKWA 3GSWB 5IB1A 2IAMD 1WGOA 3IDJB 5J1AB 3W3BA 3IGLA 3B9DA 2GUYA 2DIEA 3HUJE 5EO0A 2IVFC 4DIXA 5CZXD 3LH2L 2BC4B 3Q06A 1D2PA 4LBEA 4DFIA 3VACA 1KGUA 3FCTB 3O2VL 3MOAL 3QEQE 4LCWA 2NY2C 1JERA 3M17A 1X5MA 1CB4A 4PJ8A 1Q9OB 3IN2A 4M62H 1VFBA 1MPAH 4ZMZA 4G6KL 3UBHA 1NJ9B 2F0CA 1DQIA 5H2BB 2CNZA 5TTRA 1F3RB 1ZV2A 3PXJA 1T5WA 4M7ZC 3LVTA 4P3CL 3QR2A 4G7YL 2D2CC 1E28B 2IG2L 4G42A 2H41A 3WFCL 5H37A 3O4OB 3NDYE 2X42A 4D9RE 1A0QH 1YPZB 1QFWL 1S9XA 3WHXB 2EIDA 3REWA 4FNUA 3D2UA 4XC3L 2WSKA 4XO8A 3GZQA 4K3HA 4RZCB 4X4ME 4J39A 2ZX7A 4PCKA 5GHWL 4KOCA 2FO4A 4NO5B 5DJXA 5A2CA 3NAAH 3OX8A 4G7SB 4OFYA 4P2QA 2VXTL 5FR3A 3L3JB 4X2UA 2JB6B 1TU2B 3E3QC 3TPUA 3A6OA 5CJOL 1NPJA 4ZUWB 2HTKC 2MJWA 1UT2A 1XGQB 4GXUN 5IBTH 2E6JA 2YD4A 5C0BA 3NFNA 2ATAA 4UT7H 4JM2B 1CDYA 4LSTL 4JRYD 1O9ZA 3OB8A 2PCPB 4DEPC 1MXDA 1PLGL 4NPYB 1DANT 4Y5VC 2JKTM 3DV6A 5I0WA 4MA1C 2OSLB 2R56H 2DYPD 1SEBA 4H26B 3BEVA 4QCIB 3M1BB 4MXQC 5ISZE 2BVQA 4JZNB 4I2XB 2XPYA 3QQ9D 3I84A 2WK2A 1CTOA 2DKSA 4OF7A 5D5MF 4YHIB 3HFFA 4E9SA 1NMAH 3RB5A 3D6GA 1A5FH 5I1GH 3LH8A 5F1SA 3P0YH 5KSBB 4YHZH 1UKSA 3GLDA 3BH8B 2QKSA 1A14L 4L4TA 2B4CC 1CL7L 2Q6WA 1AQDB 1XH1A 4N2DA 2E9IA 5HYIA 1IQWL 2C1OA 1UA7A 4MJ2A 3GLEA 1T2JA 4QOKE 4X4YB 3THML 1MFEH 3MLVH 1D5BB 1QI5A 43C9A 1EDYA 1JMZA 4YPGB 4F9LC 1ZLEA 3MZGB 43C9B 3ATDA 4MAYB 5DUJA 4BFIB 4TXVB 5A3ID 4RA0C 2NSMA 2CMRL 3PWVA 1TO4A 4YQXH 5D5MA 1AC0A 1NC4A 4Y2DA 1GYUA 1AG6A 4PVMA 7PAZA 1NSNL 2YD7A 1JWMA 1UB5A 4R7NB 3MV8D 4BE6A 3NSFA 4AJVA 2JSFA 3HNTL 4CJ0A 1GCFA 4R3SB 2AXHA 3IDMB 1UM5H 3SY6A 1X5LA 1NAML 1BAFH 5FUOL 4QI3A 3PYCA 5IZ7A 2X2IA 3LDBC 4JANA 3TP4A 2A6IA 1UD2A 5EBWA 2GTWB 1JS4A 1AQKH 3ML8A 1E67A 4RZKA 3K5SA 1TQBB 4NZTH 5JIKA 5H37G 1F3DH 1RIUH 4FZ8L 2AEIT 2C9SA 2TSBA 4AVJA 3C5JA 2H2SD 2ZUYA 2R83A 3UBXB 3LSOB 5ALCL 5FV2A 1A4KB 2KQMA 1KXTA 1WA2X 5FCUH 3BUPA 2F54A 5GGSA 1J7VR 5LCVA 1TEYA 3N42F 2OXHB 1AZRA 3X3GL 4XBEL 1B6UA 4HXAL 1B0WA 5JR1L 2HLFC 5ID0B 3IKCA 3W0WB 3GDBA 3PGFH 2Z1PA 4KC3B 1T04B 1T1ZA 2Z8WC 3MRBA 3SYCA 3CX5J 3OGOE 2BXZA 3IGFA 5IJKC 2N3JA 5B4MC 3NFSL 5MHSE 2VXVH 3IDUA 3TVMA 6FABH 4V1DA 3ISRA 3LQMA 2DRUA 3B2UC 3K6NA 3Q48A 1UWFA 4JM2D 3WDHA 3GSOB 5DTFA 1W16A 3PDDA 2MOVA 5D7IF 5DMIL 1U42A 4K7PX 1AR1D 3GQFA 1CZ8L 4H8UA 5E4AA 3DBXB 2G3ZA 3Q5OA 1HCYA 4U31A 3EJPA 1WAPA 3KVQA 4BUGA 4C55A 4P4KA 2B3RA 4LCWE 4R4BA 5HGGS 1XMEB 1OQXA 4JFFE 1VFOA 1AXTL 3CHXA 1AZCA 5JHLH 1EAPA 4O2FA 1KTJA 5KBLA 1WTGT 4HH8A 3H3PL 4LPXA 4KZ0A 1JN6B 1UYWL 5DQDH 4H8HA 5E99H 5L4MA 5LGKA 2CBMA 3LB6D 1IUZA 4P5TC 4LSRL 2IO5A 2Z93A 4FXTA 5CJ8A 2FJGA 4NI3A 3MROB 2I24N 5D7HA 4D0DA 4M03A 3KYMB 3F7VB 1TTRA 5KBKA 1JSYA 2VN7A 1UOVA 1R3IL 3F5WA 4XHJC 2F1BA 2DLEA 2EDFA 4HLZH 2R1WA 5C7XH 2V4LA 1SXNA 3SSGA 4N6RA 2COQA 4P2QE 2W9DL 4X9YA 1J9RA 2QPEB 4EQ3A 4I88A 4ES9A 1DSFH 2Z0BA 3D69A 3LIZL 4NQUA 4Q97A 1J1OH 3ZKND 2NXYB 4BH8B 2GI0A 2QGDA 2YXWA 2VGLM 1OHQA 3RGVA 3MDJA 3M6DA 4PS7A 5F3HA 1AIFB 5LAPA 1OP3H 5BZDB 1FZMB 4DPAX 4HKBA 2VKXA 4PGBA 2PYEA 1K2DB 1QTSA 1J8HB 2PF6A 4TKWA 4R7XA 2WLHA 1PZCA 1XD1A 4GI6A 1OAQH 3RY6C 1JZDC 3U48A 3R0MA 3VWJC 1HIMH 5AAMC 1G7QB 2WBKA 1VKXA 5G4MA 2ZWZA 4W9GC 5A2LH 3VSQA 2VDQB 2P7TB 1E2VA 3VD3A 4BH7A 4HC1L 3TYGH 4D9LH 5FECA 4FEMA 1OPGL 1ZRUA 4ZFGL 1DEEA 3E1ZA 3OL2A 3K6OA 3EO1B 4X0NA 1Q0YL 3VFTA 1BD2B 3FU9A 5F0MB 2AQQA 4AEHL 1IAIM 1W0VA 3V5HB 5JXEA 3CN0A 3MNZA 2D73A 2IPUG 1JPTL 1AKJB 2XTSA 2XRAH 4AZUA 3GJFK 3TV3L 4XXDB 1LHZA 2KH2B 3UTPD 2APXA 4KHTH 3OKLB 5GS0C 5HYSA 4APQA 4IBYA 4K71C 3W0WD 43CAB 3P2TA 2XIIA 4BBWA 1P7KA 4WI0A 2QL1A 3F7QA 2B20A 4ZS7L 3V55A 4P4RB 2XJKA 3IMRA 4PRHB 3ULUC 5DD6B 3HR5B 4HUWB 4WSGA 5C0CA 1KPUA 1IKFL 4NBZB 4Z7QF 2WM0A 1NLDL 3LZFH 3LJ3A 2EIZA 2V5TA 4OTXH 3L1EA 4LB8A 3UG3A 3SCMB 2YUWA 3TA3D 4XAWL 1A6UL 2HRPH 4ODVL 3S88L 5GRWA 2UZPA 2JELL 1QYGH 3HI6L 1CU4L 3EFOB 5HBBA 5KOMC 3KWWB 1SZNA 1UZ8A 1WVZA 1I4FB 4DZBB 4RETB 3IGUA 5EOTB 3J2PA 1G6RH 1KLFA 1OAJA 1TDQA 3N91A 3N5AA 1CTMA 5IGXL 1Z6JT 1RZJC 5I1HH 3UAJD 1YRKA 5I66A 2H26B 2JE8A 3IPBA 3EFDL 3TBVB 4F57L 4DKTA 4FL4B 3ZRFC 2R23A 3RDTD 2J6WA 3HE6B 1I53A 4XN4A 3CXDH 4P57B 3RE0A 2PP8A 4R0LC 3SGKA 3TO2A 4D8PB 4Y5XA 3V5KA 3BXNB 5DWUH 2YRZA 5I71B 4RISL 1CLYH 5CF3A 5IB4B 2EXYC 3MRKA 2FQEA 2J57A 1F13A 4V1DE 4CC4C 1ETJA 4PPTA 5CGBA 1TXKA 4XWOD 3E1F1 1WIUA 1G1YA 2ZAIA 3MYJB 3DOSA 4G43B 5CJQH 1BMZA 5AVWB 3O6KH 4JFPB 4M7LT 3SB3A 5JIDA 3K3QA 5G5DB 1ITCA 1J0KA 3QK0A 4HWBL 4IBTA 4WSJA 1RZFL 5MERB 4WWKD 4KK9C 5EBMA 4DP1X 1UADC 3JWDH 2DQ6A 5HYEA 1IBDA 4G6ML 5AZ2L 3QCTH 4OGXH 3L45A 1E4KC 1OB1B 2H47C 5L2KE 5HPMB 3I3BA 3ZKXB 4KRLB 1X9LA 3L4YA 4JB9L 3UL4A 3LNIA 3MLWL 3HS0B 2AK4A 2X4NA 2EINB 4G5ZL 3WNJA 2NY3B 5F97E 2YJLA 4H88H 5FYKU 2PXYD 3EH5B 3BT0A 2RACA 3BUTA 1RXLA 1JZHA 2YAEA 2EKJA 1BD2D 1I7TA 3I2CL 2CKBA 4WENB 4AL8C 1MHHA 3KXFA 2BZCA 1BEYL 3MUGB 3DHJA 3I9PA 4MQ7A 4PRNB 1AKJD 2JKRM 1A1MB 2JI3A 4NRYA 3OAUH 4Y9GA 3WMPA 3PDOB 3VXUA 4I9XA 3PHAA 2EH7L 2ED8A 2ALAA 4MYPA 5CEZE 2JJSC 1WZLA 5DUBA 1AP2B 3FQ4A 1USZA 3WJJC 3VFSA 2GTZB 1FLRH 1LEKB 3PHOB 1IC1A 3ILPA 5DLML 5F6HI 2A6JB 4KQ4H 3MX0B 3K0WA 4PRHD 4RRPM 1PGRB 4X8XA 5BS0A 2HB0A 4X8JB 2QPDB 1ULVA 4RX4A 5IG7B 1UQSA 3ILDA 3L3IB 4I18C 3REVA 2PYEE 3Q5TA 3IJ9A 3U0PA 1S7VA 4HCGA 5F2FA 1RQ5A 3PJSA 4LOVA 3B1UA 3VXNB 5I5RA 3SCMD 5DRNB 3GBDA 3BKMH 2VDML 2RQEA 4I48A 3NPZB 5IW6A 1W15A 2WXKA 3SE9L 2FX7L 4PJCA 4HKZA 1PF3A 1I3VA 2DYSB 1N5AA 2GITA 2ZKHH 1HINH 1KGXA 4R7LA 1Y1DA 1Q72H 2RAMA 2APWA 2XZAH 1TZGL 5I6NA 1F1DA 4C57C 1GS8A 4PJ9B 1MW0A 2JMRA 4R4FH 2YD5A 5C0ND 2DLHA 4OR1A 2H45A 3LOWA 5ICZB 1OL0A 2BSEA 4YZFF 4K9EH 1R5VB 4F7CA 5DT1L 2BNQB 3UROR 4AG4H 1DVFB 1OOAA 4OZFH 4ZFZA 1SUHA 3ZU8A 5HHQB 4A7VA 2Y3NA 3ZN6A 5IIEB 3P2BA 1XGYL 3EF4A 4DOHE 4JRWA 5JHDA 3NJVA 2OYMA 1A4BA 1PAZA 4LCCA 1QPXA 1ASOA 4HPYH 2OULB 2A74A 4BA8A 3DSFL 4JQXC 4XHQA 4WWNA 1HEHC 2W0FA 4L8DA 1UKTA 8CGTA 3HTLX 2EZ0C 5C0CE 1S9YA 3CFEA 4X42A 4AM0Q 1KYDA 1FORL 2FYVA 4DQOH 1EFQA 2BJMH 4HCIA 2X4RB 5SWZB 2O5YL 4UT6A 4AENA 4YLQT 1DL7H 2VUKA 3MR9B 3QRGH 3BISA 1S5IH 3TFKC 3WD5L 1KN2L 2V3EA 4Q52A 3FO9A 4U1SB 4PN6A 4KQ0A 1ZHKB 2EILB 3NJHA 3T8XB 4AV0A 1BSIA 2OJ1A 4YHLL 1Z9NA 3VFOA 3QDJA 5IW3A 1XQ4A 3L95B 4JPSA 3SY0A 3JSSA 2GW5A 3LIZA 3UYRL 5GGQL 1I7RA 1JHLL 2AEQH 4PWEA 4WRLA 3IJSA 2DWEB 3E7JA 4X6BA 2NY3D 5BO1H 1AE6L 4PGDB 2XN9D 3I9AA 3L9YA 4PS3A 1MWAL 1NBZB 5MENA 1JNHA 4JFED 4CW1B 4XXWC 2C7UA 4K5MA 4UQEA 4WO4C 1MFDL 2ZG1A 1ID5I 4JO8A 3GXPA 2XQBL 1TKWA 1A9BA 4MA3B 5IVZB 1DBBH 4HC1A 1DUYA 2PW1B 1L9QA 4TQ8A 5HYJB 4OI8A 3PWPA 4L4JA 4YSCA 3FO1A 2I32A 5F7MC 4UDUB 1E5AA 3NPSB 4P2OD 5I5JA 3VNZA 4AQAB 1JZ4A 5K9QG 4CILA 3B37A 1KCUH 3KJ6H 4N2EA 4OCYL 4OD2B 2XX1A 5HDRA 4GRLD 4HF5L 4RDQG 3NZ8A 4YEEA 1ESOA 3S3PA 3BO8B 4RMWA 4KJQC 5DI8B 4M4RB 2ZZUT 2MMXA 3NIGF 4U1HB 3FTGB 2XICA 4HIHA 3RNKA 2BSDA 3PAYA 5L7XL 1O7VA 2J21A 1MRDL 3QUXA 4DAGH 4UV4H 3ZE1F 3QUMH 4A6YL 1AZVA 3ARRA 1ZS2A 3IXAA 4FA8A 3WNIA 4AKPA 1G6RB 3D85D 3K80A 3L5JA 2G60H 3UMNA 3L3OA 1JMXA 1HILB 1IC7H 3AUWB 3L08A 1ES0B 5DJ2A 3EXLA 4XBPB 4YNYB 1AAJA 4FQ2H 4FQIH 5J9PA 2P4AB 4RA3A 1A3QA 5ILTH 1BVLA 2VLLB 1GZQB 2XI9A 3GJFH 5ID1B 3GHBH 4OVVA 1F90L 2ENPA 1OF2B 5F96H 3NCJH 1R33A 3F6JA 3EYUH 1JOIA 2NW3B 3QBTB 4ZO6A 2R2EA 2VDOB 5J12B 4ZTPL 2RJMA 3VFMB 3V9EA 2HN7A 3MC0A 4IRSC 1OWRM 2JCCB 1D7BA 2BP5M 3MRIB 3ZPDA 5FS5A 3RX9A 3VXUE 4ELMF 1OPOA 2AJVL 1AMYA 1KTRL 4G80A 4ETQA 1DVFD 1CURA 4XRCB 1KTBA 4I77L 4O4YH 5SX4H 1B90A 3OPZH 4DPRA 3LKPA 1FCGA 4M8QB 3IMWA 3M8OL 3APDA 4K8RH 1EAQA 2DM3A 2QSQA 2R4SH 4GBXC 3UX9B 1H8LA 5DEJA 2DWYA 3U9WA 1WPCA 5EF2A 4KH9A 4RMSA 2WYHA 3VGAB 4WI9A 3F64A 1RMFL 4P23A 2MHAA 2XQ0A 3HKZA 5DZVA 1I9EA 4YE0A 2WZPD 3E8UL 4QWWC 4XP4L 3HS9A 1C16A 2M26A 4NT6B 3DVGA 2CBPA 3ROLA 2DBJA 3P9MB 5TF0A 1RAMA 5C3TA 1P4BH 1Z32X 5DK2B 4PJCE 4YVUA 1H5BA 2ADFL 1Z9OA 4JM4L 2FHCA 3LRKA 3LNEA 4I1RA 5F1OB 3BDYH 5I17B 3GMNA 1I7ZA 4JL1A 2GC4C 4IKJA 2J3SA 2ATPB 1N8ZA 3FO2A 3NIDB 4KKBD 5T3XD 4U7MA 3BUYA 1URIA 3CZKA 4OFKA 5DA4A 1AGBB 4WFFD 1S3KL 2NR6D 3RWFB 1NZRA 3MKKA 3N40P 1EJOH 4HWBA 5ANHA 2BOCB 1FN4B 1UA6L 1THCA 1T21B 4ISVA 4OY9A 5CGYC 1PZBA 4L3AA 2OXGB 3QWQB 4L3EB 2UWEF 4ZUUB 4ETYA 2N7BA 4HK3N 5C0AE 3WNOA 3FSZA 5JHDE 5B3JF 5LN4A 1BLNB 2QSCL 2WLZA 4GXVL 4PS4L 5J3HD 2AI0L 5I9QB 4F9PA 2CDFA 2WINA 3FT3A 5EU7E 1S9KC 2C3XA 3GTTA 4GSXA 1AHWC 4FFWC 5HYJD 5KVFL 3D07A 3BP7B 1TCMA 3B56A 3WTUA 1MCFA 4OM1L 5E8DL 5HHME 2VDPH 1JXFA 4U6XA 4HOMA 4QHNA 4WWPA 4XH2A 1N64L 4YHMH 1WC7A 4B0MB 1TMCB 2Y06L 1F4WH 5D7JB 4X5WA 3HRZB 1J1XL 2ITEA 4NO0D 4BA0A 4DVBB 1JNLH 2A9BA 25C8H 2EYRB 1XAKA 3MRLB 3S35H 5H4ZA 3EYFB 2K9FB 2ADJB 4GKNA 5IJVB 3D25A 2ZXEB 5BV7H 1F4HA 2I7SA 3C9NB 5ESQB 4JDEA 5TDPB 1FZOB 5I1EL 1DDTA 4JHZA 3IVKA 3FB5B 4I5BB 2R59A 1CXKA 5GRVK 3DMMA 2X3AA 4JFZH 5E9NA 5GGSY 1J0ZA 5TGBA 4X6CB 3UTOA 3PREA 1VAHA 1MRFH 1YPZF 4KMQA 5HHVL 4OZFB 2GBTA 5EZJA 2G9HB 4R26H 1UM4H 1WZ1H 5T1DH 4A2DA 5GGRB 5BQ7B 2OR8A 3NCYP 1FH2A 5K9KB 3ASNB 1XGPB 2YPLE 4AYEC 4KXZI 3OMNB 1DQLH 1XF4B 3D18B 1VZGA 2P26A 1OSZA 5C8JA 3PWPE 2P9RA 1TTBA 3A5VA 4HDIA 4KXDA 1XZ0A 4E9YA 3IEAA 4GKLA 3AWFA 5CWSA 1QFWI 5JW5A 5IVNA 3BPLB 3DJSA 1FCCA 3V6OC 1A65A 1TOXA 2XV3A 4HZAA 2AXFB 4AYID 1FQ9C 5HYFA 2YC1A 4JO4L 5HDLA 2MCG1 4NSKB 2FEEL 4LK4A 4Y4FA 2ZG3A 3MREA 3QP3A 5MEPA 1GKOA 4P46A 2XDHA 2ATKB 3ARSA 4JRXA 2X3BA 3AQDA 3QH3B 3SIKA 5JW3H 3VM7A 3ZDYB 2UUDK 1Z5LA 2I25N 2KS0A 2C34A 3P73A 5TE6H 5J6HA 1U93A 4KQ3H 3G6AB 3SDCB 5CBAA 2B59B 3STLB 5HXMA 4S1DC 3TASA 1BF2A 1JJUA 4AJ0A 1QQDB 3FU0A 3T1WA 3L48A 5IHUL 3FO0H 3WFEL 4U1GC 3BH9B 3EZ8A 1D2OA 1SQ2N 1J5CA 2VUYA 1TIUA 5CLTA 5D7LA 2YA0A 1A66A 4RNRB 1U6AL 2ZOLA 4HQQL 5FDWB 2X1WL 3US0A 2UY7B 2X4PB 3GXFA 5EEVA 3B3BA 1TYRA 3ZZ1A 1BXAA 1UWEL 3BPOC 1UD4A 4OQTA 1YG9A 5D7EA 2WXFA 4XO9A 1GSMA 3BLBA 1EHLH 4FCAA 4RMVA 1P7QB 1CL7I 1DQQB 3DVFA 4OIAA 1NGXB 3QQ9C 2FWOA 4K3GA 2BPBA 1KJ2L 4FMFA 4FGMA 3HHRB 1KCLA 3ZUNC 2DQGH 4N9OB 2OJZL 1RP8A 1C9SA 3BZEA 4TSCL 1FBIH 5DA0B 3IETA 4E42B 2DS4A 4FKHA 4XNUL 1YNTA 3RVXD 4J1UA 4M4PA 1ZK5A 4IDLA 2OFQA 1NEZB 2Z7WA 2IFFH 3EGDA 5K1JA 1B0IA 2DKMA 3BWAA 4X80H 3OJDA 1JHKH 3BFWA 2V5SA 4HJGA 4IU2A 5I6KA 4HMDA 4L2YA 4A2HA 1QR1A 3ZSTA 2DTML 2Q86B 4BZ2H 4JFOA 5DQ9A 2NYYC 1GY1A 4H0LC 4NQCD 1TZHA 2ESVA 5ECGA 2Y4SA 3HG3A 2BRRL 2KI6A 4NOFA 4KZEL 1K3IA 1P9MC 1T1YA 3BKCL 4N2OA 3E8VA 1AGCB 4YK4B 4NNPL 3TBCA 1SN2A 2NT1A 4JGJA 4A6YA 1QSVA 3TN0B 4PGJA 5EOQL 2YKLH 2EDKA 4MZ2A 1VLXA 4NAMA 4AC2A 3GSNH 4AGMA 4P9MH 4PV9B 5LVEA 2A7BA 4M7JH 5I26A 4LVNC 1LDPH 4DW2H 1K8DA 4Z7OE 3OHMB 4NDMB 4XN2A 5B7MA 5I2IA 5K9QI 3QDME 2JJTC 5LXVA 1TR7A 5HDWA 4NQDE 4PTUB 4R7VA 4XMLH 3RTQA 4HU2A 1GGIL 4PRPB 4POYA 4Z7NF 4ACTA 4AH2A 2VR7A 1RZ8B 1IBHA 2BWIA 5DVKA 1OCCB 3RFRA 4ZFFA 2PWFA 3CG8A 4ENZA 2B4CL 2VLRB 1NH6A 4RAUB 4X98A 3RJQB 5INCA 3DI2B 2D0HA 1A6WL 5SX5K 1FGNH 3SJVE 4AGQA 3SE4C 4EBQH 5ANMB 1MOEA 3HCVB 4LSSH 4MVBD 3T4YB 1A7PH 4GFTB 4HJSA 3GMLA 3VRLE 1ORQA 1JVLA 3EOAB 4GUPB 3O4OC 4UQ9A 5IJBC 2WIIB 3T2PA 1SGKA 4RBPK 5TF1L 3UFIA 3WV0A 2D4DA 3CVHH 4KGJA 4LARL 4OLUH 3IRPX 4FI7A 4WEBL 2ZUTA 5AZEH 2CZNA 2ZUXA 4C4UA 3PAZA 3BH4A 3GHEL 2X7LB 1I9RH 5H37H 1NCIA 1H19A 2AV1A 2MPAH 2XKSA 5BZWB 3WLBB 2G75A 4CMMB 2LQRA 3H0TB 1KLUB 4JPVH 3Q9PA 4JM2C 3ZR5A 4XP6H 2DJ4A 4NKQB 3JWOH 2KLTA 5ESVA 3TOPA 2F5AL 4LLDB 3DIVA 2NNAB 4X7DC 1XL6A 3WN5B 1VF5C 3BW9B 4GRMA 2R0LL 2C4FU 2ZPKL 3RAJH 3UPAA 3WXVH 1YECL 5IVXF 3AFLA 3HN3A 5DZLA 4UQ2A 1ZANL 4TTDC 2FRGP 1HNGA 4WO0A 4YDNA 3W82A 5DMKB 1BBJA 3L7EB 2IADA 2PCFA 4XPBL 1MCWW 1NM4A 5KAQF 3DX2A 1GGBH 4PGCA 5AEAA 4IDJL 1A4JB 1T89A 3B7TA 2VDKH 2FX8H 5C08D 2OQJB 4WKZA 5DC0A 1AS8A 1DVTA 3X14B 1U4FA 2X4QA 5D7SH 3UZVB 1H6TA 2CHWA 4JRXE 5EULV 1QSED 1PX3A 3WKMH 4LASL 3VDCA 1XEUA 5J11C 4PJBF 2HT2D 2R29L 2EECA 2WQVA 4JZOA 5T1MA 1U91B 1WFTA 1KGJA 2AVFA 1E6OL 1ET7A 5AD0B 5SWSB 4A1RA 4Q4IA 4FJ6A 5FXCH 4H8QA 4RFOL 1MCCA 1VACB 1ACXA 4UIMB 5EORH 3P4NB 3SGJA 2ZCLL 1U95B 2C9XA 2H2PC 1C7SA 1GS6X 1ZHBA 5F89B 3KYNA 3VMNA 3DARA 4XNXH 4EEEA 4MAYC 1WT5A 5D7LE 2VLKD 4OCRL 3WFDL 5E2WH 1BM7A 1YEWA 3EYVB 2YEVB 2A6DA 3EBGA 3DHMA 3KE0A 1NMBH 4GEIA 4XGZA 1BOGA 1JK9A 3LNHA 2WC7A 35C8H 1D5MB 4JJ5B 5H35B 3VGFA 4RWYH 5FYLL 1DQDH 4G9FD 2WN3A 4PJBA 2O4EA 2BVUA 2YK1H 3FNKA 3NYKA 3KWUA 4IGBA 2NW2B 2VQ4A 3V5DB 1EZVY 4BK5A 2RB8A 4AX3A 1JYNA 4MMZA 1S7QB 5I8CB 4PRPD 4ZTOL 1T5XA 3K6SB 4WTZA 2YGQA 4E9VA 4X6DB 1TQBC 5IR1B 1J0IA 1JZIA 3KPMB 1UXWB 1N4XH 4JGMA 3CC1A 4YO0B 2YS4A 2Z4QA 3WE6A 5T5NG 3OKEA 1ADQA 5DO2C 1ODAA 2JXMA 1IT9L 2YOCA 4RGMB 4XI5D 3H9SB 2FAUA 2AQ1A 2WKOF 3WEOA 2BMKB 2IDCA 3PGDA 1S7RB 3UZQA 5E5MA 3PQYB 3RTLA 5AB9A 2IXQB 3JBG7 4Z0BL 4N8VB 3U36B 2ZCHH 3DA0A 1ORSB 2NSXA 1ZT7B 4ZXBA 1P5UB 3BFOA 1CGUA 4H25B 4YHOH 4IKNA 1L3NA 3IDIB 4JJOA 2EDLA 5FX3A 1DE4A 4XODA 1KBWA 5E08L 4MLIA 3F7KA 5LCVH 3GTNA 2ARWA 4ZMLA 1MUJB 4DKFH 5F3BA 5DC9B 2F53A 2EDNA 1DBJH 1L0PA 3PWNA 2EXSA 4HP5A 3QI9B 2F1EA 1NL0L 3GPSA 5F8RC 5KTEL 4CU8A 1AYOA 5JO5A 1F8TL 4N0UB 2CUHA 4PB9H 4OT1H 1YMMD 4WGVB 3GSQB 3G04A 3OMIB 1U30A 2DMCA 3UABA 3L1OH 3ARDB 4Q7DA 4PGZA 4PRIA 4WWID 5GSVB 3DO7A 3B9KD 3AADB 4N2AA 3GSRB 4MJJA 2KMWA 3RU8H 1KSRA 4DJMA 4Z7IA 3O3UN 5IMMB 1R0AL 3ARXA 1MCRA 4EOWL 1ZLSH 1EEYA 3T04D 1Z0NA 5DJ0B 2L7UA 4DTGH 2D0GA 3BVUA 1OAXL 5GGUB 5SWQA 3W38A 4NKIH 1N8OE 2GUOA 3NJKA 1ZVSA 5HVHC 1MLCA 4HCFA 1Q9WB 1KJ2A 1CDJA 2OMYB 3C6SB 4XP9H 1FZKA 4G7VL 4O2CB 2ZJSH 3HPJB 3UXFA 4GQQA 4PVBA 4U1LB 1DLFL 2IFGA 4BWUA 5I73C 3ULSB 4OB5H 3NJMA 1BDYA 3RVWC 4F3FA 2JFCA 2J56A 2NXYC 3BSGA 5DEFB 2PYFB 3KPSA 2WVVB 3RYMA 1PX8A 5DD3L 2BM3A 2XWJA 4NI6A 4K5LA 5CR8A 3WELA 4AIOA 4P5MA 2Y6SD 3IJYB 1NICA 3VFPA 5CEZH 3VXPA 3DPBA 1XGUA 3L1GA 3BKYL 5FIEA 4M5SA 2OMWA 1YNKL 3GMMA 4AYDC 4NQEB 5JW4R 3KAAA 5A1AA 4HJ1A 1E5UI 2LAGB 3QCUH 1TPXC 1S2EA 3D87B 3CSTA 4KROC 5DHVB 1LXMA 1RV6X 5KEZA 2ZF8A 4Z8FH 4QY8B 2OMNA 5M7QA 1RPUA 4PJ5D 1WLHA 3C12A 1QLFA 4ZUTA 5CFHA 5FYKD 4U3SA 4YDKH 3OQRA 3BN9C 1Z9PA 3HIZA 2W0LA 4W9CC 2EO1A 2DQFA 3IDNA 5KVFE 1EO8H 1AXSA 2IJ0C 4M7LH 2MRYA 1FVCB 3DX6A 4HMCA 3H9SD 1JGVH 5E9DB 1EGJL 1L7TL 4XMKL 2E6PA 5INDA 4IBSA 4PD4J 4NKMB 3PQYD 3JV4A 3P0VL 4YSTA 4Z5RB 1T1XB 3ZZQA 1CFTA 3DX8B 1IKNC 1SJEA 2M2DA 3LH2H 3WEXB 1SVCP 1PTZA 1S7WB 3IJEA 1F45A 4FTVA 5HSFA 3O2VH 4WFGD 3MOAH 2TRYA 4NLAA 3PWLA 3H9HB 4F9LA 1KPVB 2RCSL 4JFQB 4L4VB 2AQ2A 4PJFB 4UDTA 4BQ9A 3SCMC 4ZI8A 4G6KH 4NFDA 2XIBA 4KXZH 1CCZA 1GYAA 1V05A 4EIGB 3SDAB 3G6DL 4F80A 1JE6A 4DN3H 4P3CH 3LKQB 2XVGA 4G7YH 4Q58C 4AL8L 4CADB 5EPMB 3VXOA 2P5WB 3QEGL 4GNKB 3WFCH 2VJ8A 4IBWA 4KX8A 3ORJA 2ICES 4HFUL 4D0CA 1J8KA 1QFWH 3BEWA 3UPRA 4Z18A 3QJVB 4F58L 3EYOA 1X3DA 5E4OA 4X6FA 3UTZA 5L0QB 4XC3H 1Q9LB 3CIQA 4XVSL 4F7MB 5FB8A 3QJQB 1F5WA 1B4TA 5GHWH 3S96A 4K5OA 5A16A 2Z8VC 2YQ2A 1DQVA 2VXTH 3L3GA 3O6ML 3ABLB 2VL5B 1EAOA 1L4IA 5CJOH 3ZE0F 1RJLA 1CLCA 4FL4C 4P2RB 3NSJA 4R90L 2YAHA 2OCJA 1AD0B 3HE6C 3QZBA 4HSAC 2X4OB 2GJRA 3CQPA 5F1KC 3VYOA 4LSTH 1SRDA 4PG2C 4N6QA 1IGJB 2WN2A 4HUVB 2C9PA 1PLGH 1TSHA 1E5CA 1L9PA 5I71C 2BVOB 3NUKA 1XAUA 2VDLL 3MJ8A 2PTTB 3LZQA 4ZUSA 3B2XA 1W9XA 2NTFB 1OW0C 4ZO7A 2VCOA 4JDZA 1L9NA 4PJ7B 3RWDB 2FB4L 4U0RB 4DVRL 5IJKA 4UANA 2OA9A 1KBPA 4FCHA 4GW4B 5GRZA 4PJAF 3IM1A 3KLQA 1RLWA 4H1LB 3V0WL 3INOA 4KFMA 4YHNB 1HEZA 1D7DA 1REIA 4PJ6A 3ZKXC 5CGMA 5CP7B 3WIFB 1CLOL 3OSKA 5MEQB 1A14H 5ITFA 3HS0C 4QRRE 2ZUUA 4W9DC 2X4TB 4HUXB 1CL7H 1CFQA 1JYVA 5I0VA 5JNYA 1IQWH 3KWXA 2NY1D 2BHFA 1VEMA 5HJBA 2B14A 1BJ1J 2D3LA 3DYOA 3JV0A 4NHUA 5DQJA 4P5TA 1V7NH 5BZXA 3T3PE 1TQUA 2QPUA 3BZ4A 1JZ5A 4XPTL 3TO4B 4ZMOA 3BVDB 2CMRH 3WIIL