2XBTA

Structure of a scaffoldin carbohydrate-binding module family 3b from the cellulosome of bacteroides cellulosolvens: structural diversity and implications for carbohydrate binding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
PVQVNSDLKLLFSNNGAAASSNQIYMNMKLQNTGSSTYDLSKITIRYFYTSDDDKALTYYSDYVSIGSASATFNNLSPVHAKANKYIEIKLASGTLGAAGAQWPSQSEVTIQGRVAKADWTNVDQSNDYSYPGSMSQFGENKLVAVYYNGALVYGTPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Scaffoldin-Borne Family 3B Carbohydrate-Binding Module from the Cellulosome of Bacteroides Cellulosolvens: Structural Diversity and Significance of Calcium for Carbohydrate Binding
pubmed doi rcsb
source organism Bacteroides cellulosolvens
molecule tags Sugar binding protein
molecule keywords CELLULOSOMAL SCAFFOLDIN
total genus 35
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xbtA00
3ZQXA 4B9PA 3TF4A 4JO5A 2WO4A 4C8XA 4TF4A 1KFGA 2WNXA 2XBTA 2L8AA 3ZQWA 4B97A 2XFGB 1K72A 1GA2A 4B9CA 2YLKA 3ZU8A 4B96A 4B9FA 1NBCA 2WOBA 1G87A 1TF4A 3ZUCA 1JS4A 1G43A
chains in the Genus database with same CATH superfamily
3T5WA 5IMMA 3L3DB 4OZIE 2VTFA 2NUPA 5FPIA 4PW9A 2VABB 4J3UA 5DURB 3RWFB 5MI0B 1S7TA 3ERXA 5FC9A 4DGUA 5F3BA 2O4EA 2YR3A 4HPYL 5KJ7E 1VACA 2CGZA 3WJMA 1FFNA 4I5BB 4Y8DC 2XFXA 4WNJA 5LWYL 1BFVH 3X14A 4WCYH 4G1EA 2IH9A 4PJGB 1EHNA 3TWCH 3LKNB 3ZTJH 1ZK9A 4FQPA 2BSCA 4GP8B 2Z1PA 4LHUB 4F9LC 5AB9A 3BWUC 3GF8A 1Q0YH 2DTML 2JLLA 4FLRA 1KJ2H 1IAIM 3B7TA 5ESVA 3ZUNC 1MVYA 4IOFC 1M42A 2WTPA 3VRLE 2UZIH 4QHUA 1H8SA 3TOPA 1CYXA 3ATAA 4P5TD 4OTXH 1B88A 2Z35A 3WHE0 2MJWA 4H2AA 4YE4L 3RU8L 3V7MA 4DP8X 3SCMB 4YLBA 3E1F1 2ZE0A 3ALXA 3BQUA 1KIRB 5C3IA 1EGJH 3P4LA 2X53A 5JIMA 2VL4A 4O2EB 2FE0A 4GKNA 5GZOA 1JYNA 4NNPL 1X9UA 5FYLL 5A2JH 3PWLA 2OSLB 3DUSB 1UB6A 3BP5B 1U33A 4JHVA 4C8XA 1F4AA 2BRRH 3GHEH 3HS9A 3LQAC 2CH8A 4XXDA 4Y2LA 1JFQH 2R29H 4XPGH 3GMPA 3FT4B 4OFYA 1DE4A 4RMRA 5BOPA 1QRND 4L2LA 2X4OB 4MD4B 1ZGLM 2PW2A 4QJ3B 2WLHA 5FYJE 3AROA 1YCSA 4LOFA 2XPZA 5KJRL 4FFWD 5FUZH 2N59A 1NZRA 1TUPA 2VDOH 3AADB 4P5TC 4PMFA 4UUJA 2WCPA 5DU7A 1TG8A 1FAIL 1FJ1B 1HN1A 4DTGL 4EPSA 3BPCA 2WLIB 1EFXD 3NCCB 5EWIL 4R2GB 4JG5A 1JD9A 1JRHI 3WDJA 3QJHB 4ES9A 4UMGA 1RZGA 4JO3H 3NFPB 5JR1H 1Z66A 2F5BH 1MRCH 3DX8B 5EU5A 1N59B 1RZJH 3GSXB 5HYJB 1RPKA 4F15B 4OAWB 1JAEA 3B1UA 3G9AB 4Y4HA 4NGHH 5HDRA 3UCRA 4GO8A 1YQVH 4KROD 2B3IA 1OW0C 5J3HD 4Q89A 5BZDB 4G82A 3D8MA 4JFWA 4HKZA 4N90D 3WLBB 5DJ6B 2VERN 2YOAA 5AW9B 2Z8RA 3DXAB 5I16B 3QQ9C 4FLHA 3GUTA 4Z7AA 2E4TA 4GJTB 4AM0Q 2ED8A 5CN1A 4FDWA 1I8KA 3TJEL 4D0CA 5FHAH 4KAQL 2KPWA 3O2DL 1SXBA 2J2ZB 3DSFL 4I0CC 5D6DA 1CBVH 3VXSD 1FUNA 1J0KA 2JJTC 1KUMA 4NJ9L 4O00A 4OZIB 3LKRA 2KKQA 4ZUWA 3FB6A 3DYPA 3EHBC 4NBZB 3KJ4C 1S7UA 2A9NL 1BZ8A 2UZYA 4JN2A 4NKDB 4P4RA 2W9DL 1HXYB 1UADC 5ETUA 4G8FB 4Q14A 4HJGB 1TETL 4Y9GA 1HJBC 4JM4L 2UY6A 2FK9A 5A3ID 4QRUA 1IGIH 4Q4EA 1NCAL 1ZV9A 4X6FA 5KYXA 4ERSL 5CCKH 1Y6NR 1CFSA 2VDML 4NCC1 3DI3B 3MRNB 4KKCC 4P2RE 4F2EA 2G3XA 5BJTA 4OZIA 2A83B 5IBUB 4GMSL 4J3OF 4IS6A 4ZFOB 4M7ZB 3VDCA 4X7SH 3DMMD 1KPVB 1FZOA 2EDJA 2WB7A 3L3GB 4LASH 3ARGA 3PCYA 3RDTB 2RCSL 4MAUL 3TZVC 4NNPH 3S36L 2I7OA 3BSGA 1RUMH 2C1PB 5IFAH 4DKDC 2FZ3B 5F1SA 5IESH 5JW4Q 2XN1A 4TQEL 4P2RA 1XH2A 4TUJB 4LLAA 3MZGB 4NQXB 4DKAA 2CHNA 4LVNC 2OW7A 4ZUTB 1QSEA 3VI3F 5KBDA 4S2SB 4XZUA 3HE7C 1A6PA 2D3JA 4CADA 1KCBA 4Z7WE 2EYRA 2D7QA 5EOCJ 4H25A 1VA9A 3FFCA 3L81A 4CC4A 1MCOL 1HQ4B 1Q1JL 1R46A 3CSBA 1ETJA 2G2NA 1K6QH 1BF2A 5KSAA 5ABZA 4FNLL 5D4IA 1U91B 5AYTA 4F1SA 3WNJA 4X4XA 4PRBA 1AS7A 4AENA 5I2IB 2FR4A 1ZTXE 2XZQL 3JZ7A 5BUGA 4H88L 2VN6A 3E0GA 1PG7X 4FFZH 3QIBC 4O9HH 1T5XA 1TTUA 3PP3K 4NQEA 3CLEH 4MMYA 2DBLH 2X1XR 3C8KA 4XGZA 3C6LD 2FSEB 3OKKB 5DVNA 4IDJH 2PPEA 3ARDC 3P54A 2X4NB 1G87A 1KC5L 4JQXA 4OGQC 2R39A 4Z0BL 4NQVA 4EQ3A 3CCHA 1W91A 3EOTH 5AD0B 3TZVB 1E6OL 1XQ4A 2HXAA 4QGYA 1FFPB 4G9FE 3EO0B 3GMRA 4KY2A 4R5TA 4WUKH 4E42A 4H1LH 1R3HA 1TQCC 1NQBA 3TH3T 1D6EB 1YEIH 4DO4A 1PZUB 5JOEA 3CFKB 4ODTL 2LT9A 5CEZL 1BZ7A 2QVKA 5D93C 5T5FA 4AUJA 4Y9CA 4UDUA 5EZIH 5AW3B 3KL3A 5IJKA 1JZJA 3K4ZA 3PXHA 4F5CE 2CLRA 2VDQL 3K6SB 1ADQH 5I17B 5E9DD 3TN0C 1BREA 1DHKA 1F90H 3BZ4B 5E4EC 4ACTA 4DGVL 4AVJA 3RHWK 4PCKA 1T0PB 2EICA 3JTSA 4K94C 1BAWA 4H0HB 3BOVA 4Z7UB 4CMHB 2XY2A 4Y4FD 3DRTB 1VPOL 3TESA 2EXSA 5AQ0A 3WUWA 2WGNB 4H8VA 2Z65C 3RRQA 2HZHA 2VITA 3HFML 4MS8D 3EOBA 5I71B 1S3RA 2VXQH 4F27A 1BZQK 3OX8A 3CXHK 3OKDA 3OR6A 3SYQA 2GJ6A 4FI6A 1YYLL 4XBGB 5JLZA 4JO4H 5TK4A 2JWYA 3WXWH 2DQGL 1GCYA 1A9BA 3MLYH 4E2OA 4JKMA 4X4YA 2AJUL 3JXAA 4X6CB 3ZQXA 4KAQH 1WF5A 1FLRL 1QLRB 4WSKA 4MMXA 4R7VA 2XN0A 4MJIB 1S78D 1L9RA 3IWVA 3RUGA 5IMMB 1XVSA 4P57A 3HE6B 2WXKA 4QTFA 2R69H 3DHJA 5FK9B 4XODA 1I8LC 4JHBA 2Y07H 1TJXA 2A73B 1H8NA 1P5VB 4X5WA 1H5BA 3CN4A 3GMMB 1LP9A 3CVHH 3IFNL 4LXFA 4K5NA 3KR3L 5GGRA 4NAJA 4KKPA 1N5AA 3N91A 4QKXB 2C4FU 2EABA 4R5VA 4X6CA 3TTSA 4V1DE 3W11C 2HP4A 4L4VD 1R17A 2R83A 1L6XA 2NQ3A 4JZOB 1TVBB 4XVTL 1U2HA 5EA0H 3VXMA 3OX8B 4YL4A 4R8WH 4FQCH 5FX3A 5B1JC 4JQIH 3S37X 3NCWA 7PCYA 5F7YC 4AMWA 5C70A 4JG1L 1CQKA 2Y22A 2BVEA 4GEIA 1SUHA 4WEBH 4JHZA 1AGBB 4ZPVA 4U1IB 1XSIA 4TTDC 1LYQA 2BM3A 3T3MF 4OGAD 1MWAA 5C0DA 5D7IB 3RVTC 4MA3A 2WOBA 1D5ZB 5FIEA 4UIMB 1F6AB 1H3UA 1PFOA 4HQQH 5I30H 1D5XA 5T3ZH 2ZD0A 4LRIA 2JB6A 3OHMB 4WI0A 2HT3D 2A9MH 1FNHA 4B9ZA 4GMSH 4A39A 4ESKA 1GGTA 1KXQA 3T8XB 4K5OA 2JJWA 3BKYH 1D6EA 5DWUH 1JERA 1MDAA 4UV7H 4TNEA 4YZWA 5BRPA 4K8RH 2V5MA 4DK3A 5AG9A 4PRPA 4NXSA 4Q9CA 1OGAE 4L1BA 3D08A 1IVLA 2QQKL 3L3OC 3QDMD 1ECZA 4IRZL 4OZ4B 4Y1SA 2DBLL 5D1QE 3WEMA 4YLQT 1U58A 2VLKD 5TQ0H 4QTIH 4ADJA 4G6ML 1LO4L 1TTRA 2F53D 2VL5A 4Q4IA 1GIGL 1CVRA 4KY1L 4YSQA 3BZFB 4K94L 5IQMA 2XN9D 4N28A 1OB1B 4HKXB 1J0JA 3UYPB 2ZCZA 5DYOA 1A7NL 4WK2B 3TBVB 4HBCH 2PCYA 3RILA 2B5IC 2HRGA 1XO8A 3VWKD 4NQDB 4A7GF 1U58B 4HCIA 5B1CA 3APFA 4Y8AA 3RWHA 2QLVB 1EIBA 3V4UL 2WQUA 1OSEA 1RZ8A 5LB1A 1HKLL 3ABKB 2WBKA 3L16A 4N9OB 4JFZL 3HNTL 2XTJB 2UX6A 1RZIA 2UY7B 3HR5B 3LHPH 3PHOA 1LO3L 2XKUA 5IROC 5C0GA 2GI7A 3KWTA 1CFTA 1JHLH 3FTGB 1EUTA 4X4ZA 3TBVA 2VAJA 1TJHL 3RKPA 2VT0A 1Z7JA 2CPUA 3GI8L 3M1BA 1TJIH 1CJYA 4QUOA 3RIAF 3KPNA 1W16A 4IMLA 2A9BA 3KCWA 1J5OL 3DURA 3EYSH 1T5KA 5BO1H 4K15A 5EPMB 5HY9A 3NRFA 1F1AA 4IBVA 1GGIL 4KO5A 1DSYA 3ABLB 1LK2B 4GRWE 3EO1A 1OY3B 4JE0A 1JK9A 4XVJL 1CL7L 4TVPH 2OMVA 3EBGA 1CXKA 4X6FB 4MDJB 2J5LB 2OMWB 3WOVA 4EI5A 4RLDA 3MYJB 5IW1A 4MA3B 3ETTA 5DFWH 3D9AH 4G8FA 4GG6F 5DZLA 2GSGA 2J8UF 3BP4B 1OKEA 1OTTD 3MBEC 3QEUB 1MFCH 1NOLA 3IDIA 2AMGA 4H0IA 3RDTD 1NAMB 2A77L 1ZPLA 4NYLB 1EXGA 3D69B 3T4AC 4UYQA 3T8XA 4G9DB 1UH3A 3W11D 1YDPA 2B9AA 1WC7A 1EERB 3ML9A 2IC2A 3BVVA 4M00A 2NCEA 2UXGA 4D0CB 2HT2D 5A2LH 1TZOA 4OUUA 5D71L 3EJPA 3LPWA 1KLFB 2ZSWA 4W9JC 3E1ZA 4Z6AT 3BRDA 1T1WB 2QPSA 1X5FA 4PAZA 5HI4D 1MCSA 2G3MA 3ZE1E 4EUPH 3II1A 4NO5B 1A7NH 2VDNH 3MOBL 2J8HA 3AM8C 2VLLA 1TPXB 1AGBA 1X5ZA 3DROB 3QZWB 2BP8A 2HN7A 3FCTB 2O5NA 4APQA 5DA4A 1GRWA 3L4YA 3V6FB 1HWGB 1KPUB 2AQNA 2F53A 2V3FA 1KEML 5EIIA 3D30A 4MBOA 1REIA 1AP2A 4DGYH 3MCYA 4JRFA 4PB9L 1AGCB 2BC4A 2K70A 4QMEA 3GSOA 3NZHL 5EBWA 3FFOA 1T20B 3Q1SH 1RZGB 4M4PA 2WQXA 2CMRL 2CQVA 5EBLA 1QFPA 4DK6A 4P2OB 4G7RB 3R7RA 4D0BB 4EUPG 3T3PF 3MKGA 4N2KA 3TF4A 1SVCP 3RX9A 2WSKA 3C60A 1MCHA 1MFAL 2GAZA 3VXSE 5HHXH 4QHLB 4J7RA 3BEVB 3G6JA 4XWGH 3QJVB 4YHPB 5I76A 1Q0XL 1E4WL 4MJ6B 2WPGA 1T7XA 3BZ4A 1QBBA 5SX5H 2PTTA 3H8NA 1MG3C 5KJRH 3GIZL 2VZOA 3UAAA 3ZE0E 5EHFA 1KBKA 3KVPA 4QLRA 1YN7A 4XBGA 5JLZB 5CZVH 1DYZA 4ZQTA 1CD9B 3SPVB 2LFGA 3FT2A 3BKMH 3O4OC 4ORGA 4KMQA 3VFTB 2ENPA 1NCBH 1RURH 1ETZA 4GBXB 1GL4B 4IDLA 2QKIB 1NEZB 1WH0A 3BW9A 3QEGL 3SDYL 4FAAB 1F8TH 1IAIH 5ADPH 2E75C 5A16A 5GPRA 1C5BH 3CMGA 8PAZA 3BZEA 1OM9A 1TO5A 1KDIA 1YY8A 3EYVB 4UINL 1MEXL 3QRGL 4GUOA 2X4NA 2CO3A 3ATBA 4GKOA 2XTLA 4IOSD 1KLUA 2G2PA 4KK6C 2FB4L 3U0PA 3KL0A 4EI6A 2NY0C 1QBMH 4R0LC 1YMHA 3VFTA 1QPKA 3SGKC 2WKGA 7FABH 4J27A 3FQWA 1CGWA 4UT6H 4OIIL 3WY1A 3QXDB 5I1JH 3P9MA 3CHXA 1GZPB 1QSFB 4N2FA 1X9LA 5ELIA 3T3ME 4DEWA 4G1EB 2M1KA 4E9VA 5DJCB 1BZ7B 5F7KC 4WJKB 5J12C 3OL2A 4XNUH 4AUYA 4L9DA 2PO6A 4K5MA 4Y5YB 1T1XB 4MAYD 5DZJA 1X5KA 4JFHD 5JW3L 3HE7D 5EG6C 2EJ1A 3TIEB 1V7NL 2XZZA 3A6CL 4O02H 5HGDA 1RFDL 3W9DA 1KN2L 1ET5A 4M4RB 5FW6A 4X8GA 2WXGA 4B41A 4YXKH 4PP2A 4F7TB 4K3HA 3MRCB 1HCFX 1ADWA 3G5VB 1TPXC 1MY5A 3ZTEA 2XA8L 4LARL 2Q0ZX 4S2SA 3A6BL 5E6UB 1WK0A 5GGTL 2B1AH 2NX5D 1YPZA 3GRBA 4QHNA 4Y4KB 3FRPB 5FA3A 4DN3H 5JUEL 5I5RA 3AB0C 4NQEB 1MIMH 5AOJA 3NGBC 5D5MA 1IAOA 3BIKB 1R3IL 1P4LB 3BT2H 4LVEA 4LLYA 4P23C 1T20A 5C7ZA 3L3GA 2BC4B 2PO6C 1LO5B 5E2UL 5KN5A 4FFYL 1TF4A 5F88B 1NL0H 3MRHB 3OAYH 1XDTT 1RHHA 4OQTH 4EN3D 2VDQH 5CJ5A 4MHHI 3UTSA 3EO9L 2WMPB 3MRRB 2ETWA 2G4GA 1I75A 3KDMB 3OXSA 1O5DT 5DA0B 4HPHA 4MA8H 1WV7T 1XXFC 4M8VA 1QOKA 3T1WA 1G0DA 2X10A 2BX5A 4NO2A 4Q9QL 2R0ZL 4Q9QH 5AUMB 3QEGH 2AXHA 1YA5A 2GHWB 1R24B 3L1GA 5JHDB 1LE9B 5ABDE 3UO8B 4IJ3B 2GEQA 4Q56A 3TT3L 4UQ2B 2ZSWB 4ONFL 3ZZ1A 3VFNA 3QFDA 4LEEA 4DP5X 2A6JA 3DJTA 3IJ8A 2VDPL 5D70H 5GJSL 1ZLUH 1HHKB 2DLEA 4N8PA 1F90L 5B39G 3LMJL 4L0ZA 4DGVH 4IRZA 3V52H 3D3VB 4LSVL 4RX4A 2ZYIA 3FQ4A 1CURA 4QYOB 3QULB 2BSTA 4OCXH 3PPSA 2QHRL 5KOVC 2JKTM 3L5XH 4YL9A 1NBVL 4HS8H 4B27A 5T1KB 2YD2A 4WWNA 1KIQB 1T6VN 2ICWJ 3EH2A 3ZIYA 3QFJB 1KENL 4J3OD 4KKLC 1BMGA 4EXPX 3MC0A 5J13C 3ZE0B 5CJQH 2AMUA 3R19A 2R9HC 4YDLC 5B38A 4IOIA 1TTAA 2I7SA 5DHVB 4AQOA 5G4OA 2CE6A 5GS1C 1IGMH 3Q8FA 2F9BT 2XN9B 1BVNP 1SYSB 4RDQG 1LK2A 1TFHA 3BPOC 1C5DB 1CU4H 1BYPA 3B7YA 2N7SA 5DHEA 1TT6A 1PLAA 4WI7A 2PXYC 3K5RA 3HAEA 4JZNA 5FYKE 1T21B 4FG4A 1OAUH 5HHOE 5K39A 3ARGD 1P4UA 1E2WA 1MZZA 3ZDYE 2QFPA 3M1BB 1CR9L 2AQQA 5F96H 2P5EA 4X8JA 4FFWC 3DDFA 4P2RD 1ZHKA 4M43H 2APWA 4R90L 4Y2DC 6FABH 3GSNB 3ZMRA 5KW9L 1NIFA 4GBXD 1FJ1A 2X2YA 2MIZA 2ADGB 1KWGA 1YNKH 1XF3A 5L2KD 1M57B 1BF8A 1E3XA 2DQHL 5HPOA 1SY6H 4X5PA 5DD0H 1UYWL 5A7EA 3IPEA 4U1HB 4RFNB 3ZT6A 3IDGB 1BM3L 1NICA 2IH1A 4HF5L 4F8LA 4JHAH 3VTMA 1ZVYA 3SCMD 1KCUL 4X9FA 3ZHNA 2E7BA 5L4IA 2V9TA 4RAVA 5AOKA 3G08A 4PVMA 4S1SL 1A8JH 3BGFB 3BZFA 2XJKA 2G2RA 4MQXD 1TEGA 3T6WA 1UENA 5DWUL 4QF1A 2NY6C 3C8HA 3UZEC 2WXRA 1I7ZB 3D2UA 3LEVL 1GYCA 4LCWE 4E0RA 1V27A 1ZMYA 3O8XB 3UJJH 3OKLA 3JWDC 3LJ3A 4M3JA 3AWEA 5D7JD 4F2MA 1A7RH 5HD8C 1JXJA 1YYCA 1S4IA 4FTVB 4YHNA 5CEZE 3X11A 4E9TA 3OMZA 1P7BA 5SWZB 5JIHA 5SX4H 3CAFA 3FH5A 4Z0XA 2VZTA 4GXUM 1DDHB 1DTUA 2HUHA 2OMUA 2R56L 3Q48A 4K2UH 4P3DB 4JM2C 4G83A 3QYMA 1G7LA 4GW1B 3BX7C 2VLRA 2IANE 3E2HC 3UG5A 4JFUA 3LRSA 1G7QB 4JMXA 2W07B 4LP4A 1ZE3H 1E50A 5DUPH 4I9XA 2VC2L 3GSWB 4UF7C 1TZGH 4HUCA 5IJVB 1MH5A 3IFOA 3N85L 4J1UA 1I1AA 3FQUA 3IBOA 4P2QB 4UM8B 3V4VH 4G5AA 4HH9A 4M1CC 3QAZC 1DQDL 1CU4L 3RKDD 4E5XA 5BZZA 1DQDH 3C12A 3RNKB 5DK2A 1XH3B 3CFEB 3F5WA 1E30A 5D7IE 1UKQA 4YHPA 1Q9KB 4ZUUA 3BUQA 2D3LA 4M03A 1UWXH 3MV8A 4XAWL 1IZKA 4NDMA 2DV6A 2NYYC 4AYBA 1Z9SB 3T2LA 2YGNA 3QQ3B 1LDPH 2IMNA 1F6FB 1U8LA 3KL5A 2AXFB 4PR5A 2C9PA 1A65A 3BQUC 5GRUH 1IC1A 4I4WB 1MPAH 2EKSB 4EBQL 1MAML 3FTYA 3D0AA 3S36X 2NTFB 3L7FB 4LSVH 3LN4B 4K3GA 4JZJA 2PP9A 4PUBL 4LDLB 4XP6H 3H3KA 1TMCB 3IDJA 1KZYA 2AK4E 4FS0A 2YAPA 4AIXA 5IUCA 2ZPKH 1L0XA 2WSPA 4LPYA 3GMMA 4QOKB 5B8CA 3X3FH 3QQ3A 5KVGL 1LNUB 1AACA 2UWEF 2H3XC 5ADOL 5AVQB 4OLWH 1GY2A 3DROA 4F2ME 5ANHA 3WL9A 1J86A 1OWWA 4WKZB 5F7LB 1TTFA 4L8CA 4JVPA 2HKHH 4LP5A 5JA9A 4QOKA 2Z64C 3MNVB 4Y16D 1PZ3A 2BVOA 2N7BA 4M29A 1LK3H 3JSSA 4UV7L 3ZKMD 3QYNA 1A9BB 3V6OA 1EEYB 4O2FA 3U2SA 4BQ8A 4YMPA 1YHPA 4AEIL 1TZ8A 1FL5A 4Z95L 2AVFA 3P2DA 1BDYA 1Q9WA 2Y06L 3GIVA 5F1OB 4M5YL 5I8KH 2VLMD 4OKVA 2DTMH 1Z9SA 3KPSE 1T0MB 5I18L 1X6NA 2NY2C 4BJLA 3ATEA 2VM3A 1HSBA 4PJDB 3UYOD 1R3JA 3UG4A 4TMPA 3DX7B 1JBJA 3P3TA 3SHSA 1MH5B 2EC9U 1KTLB 4P2QA 4UM8A 3SDAB 4EZLA 3SGJC 1KN2H 3O3EA 5FYKD 1UXWA 2FEDD 3OAZH 1A4CA 1EZUA 2BOCB 4P9HC 3TBCA 3TT1L 3MR9B 1PZ2A 5EPMA 3HZ3A 1PQZA 4LGSB 2VLRB 4XWOC 1QZNA 3W38A 2OMZA 3VD4A 3C09C 1GTNA 3AREB 5MEPB 1NFAA 4XCNB 1VFMA 2OMUB 3STBA 2H26B 5B21A 4P9HH 2K3TA 3AQZA 3TZVA 4PI0A 5K1NA 1M05A 2OK0L 4HK0A 2YBRA 2VSDA 2Q76A 3IGUA 3KPSA 2FUQA 2W81C 1NWPA 1RZIB 2UY7A 4C83A 3VWKC 1X6LA 4G71B 1LLAA 3HPLB 4KJYB 1QEWA 3ZT5A 4MBRA 3AY4A 5H35B 1UD4A 3CFUA 2A4ZA 1XF1A 5E5UB 2XIIA 4LVNB 2ADGA 5T1MA 3NPSC 4IJTA 1UZ6E 3O2DA 1T5XB 2A4CA 1FZKB 4FQJL 4GIOA 1I3RB 4HKBB 3C5ZC 4RSYA 4JREC 1YEFL 4N9GA 4HFUL 4HUXB 2XQYG 2AI0H 4PJIE 4MZIA 4ZX5A 5EF2A 4X0NA 2Y36H 5DI8A 1LMKA 4O51B 5F1NA 2AXGB 4DP2X 3KHOA 1DVZA 1B0GB 2YOCA 1MRFH 4TULH 3U9PL 2EDQA 5AKRA 3U7WH 3IDGA 5I6KA 3FPXA 1C7TA 2E7CA 4IBSA 1I7UA 1XF2B 3DIDA 3FAXA 3FRUB 1NGWB 5E23A 2WVVA 4YZFE 3FJTA 1FZKA 3SODB 5MHSE 4CADB 2XWBA 4EZMA 1PJ9A 4CMMB 3DGDA 4W9LC 4R97B 1SJVA 4WAFA 5B38B 3CN3A 1NAKH 4EKXA 5JMRA 2X41A 5C09D 5IB5A 4JY6B 3WTVA 1ORQB 4BGDA 2OQJB 3QZLA 1M05B 1UXSA 3L5WA 4OZGB 1N6QH 3HBGA 3EYOA 1KWKA 1OO2A 2Y0SA 3I9PA 4B9CA 4B5EA 4RRPA 4Q9RH 1RZJC 2FTAA 2L04A 3KH4A 3ZDZF 5CEZH 4PLJC 1O5PA 2PWHA 4GXFA 1J1OH 5GIRA 4J3TA 1WEJL 1ZLSL 3VDBA 1HAUA 1FFRA 4HEME 5DQ9B 3MRNA 5L4MA 3NIGE 5ALCH 2DTSA 4NLHA 2I07A 5A2AA 1ASPA 1G7MA 2MFNA 1JGEA 5IFJB 4HJ0D 4BFNA 4HHAB 5EO1B 5DJXA 1OP3K 5ALBL 4FYTA 1ZVHA 1KB9K 1BQLL 4L0YA 5D7LE 1U8JA 3CK0H 1U4EA 5GRUL 1UCBH 3RPKA 5DZNA 3AITA 4G7QB 3GJFK 3HG3A 4LLWB 5MHSD 2HJLA 1FL3B 4I3RH 3HG1E 1QW9A 2V8LA 3MO1B 3DHUA 3NTCL 5GGVH 5TDNB 1AZZC 4BKSC 1T03L 3NRQA 1GMEA 3QG6A 5DS2A 2JLPA 1UVQB 2I9LB 4PW4A 3KPQB 2C1OB 4JO4L 3WXWL 4LLYB 4UINH 4Z78B 2WXIA 2ZYSA 1N5AB 1BXVA 2XG5B 4J6RH 3DMMB 3L4WA 2XV2A 1RIHH 2O6PA 2FEEI 3OKOA 1S7SB 1THCA 3FRPA 2HPOA 1BYNA 1TZIA 4CDHA 1RURL 3FL7A 1IZJA 1EQWA 2BWIA 1PAMA 4QJ4B 5IJBC 2Z7ZA 4P9ML 5MP6H 4Y4HB 4PP2B 3QJFA 1CFMA 1HAWA 4G8AC 3ZHFA 2A9CA 4NZUH 4HCRL 1AR1C 4N2DA 3DLQR 2Y7MA 5KN5B 5DEGA 1LO5A 3A4AA 4NN5B 5JTWA 3ES6A 4M5YH 4ANKA 4HZAA 5JMOC 3O81A 2NTFA 3NFPA 3OLEA 4KXDA 1FNEA 1II4E 2WWMD 4E41B 3RWCA 1WISA 3HZMA 2F1EA 2YD4A 4Z95H 4NRZA 4ILDA 1XF4A 2WLIA 4HC1L 4JQVA 2XJLA 4JFTA 2WIMA 4DF9A 4IGBD 2E7MA 5HHXL 4QHNB 1UXMA 3ECBA 3MLRH 2PW1B 3SKJL 2V3DA 1INDL 3QG7H 2NSMA 3D4ZA 4ZUUB 3ZZQA 1A9EB 1YY8B 1CFVH 3EYVA 4FF9A 4I87A 3L3IB 3SDXE 5AAPA 1ADQA 3SPHA 4IDJL 2GC7C 4CJ0A 2EO7A 2JIXA 3IU3B 4HJTA 3R4RA 2XWJA 4JCLA 2O93L 4ZXBC 2DH3A 2ESVA 4DP7X 3MBWB 2WZPA 2Y5EA 5K9KB 1BLIA 3GXIA 4QT5B 1IO4C 4UIKL 1EHXA 3NFSH 4XXCA 5EOTA 1KIRA 5HYJD 4PGBB 3P4OA 4ZO8A 3D50A 1AHMA 3MUJA 4PJCF 2XWJB 1DVFB 4MD0A 4IU3A 3VXOB 2YXWA 4LKCB 3QRLA 4W68A 3ZUCA 5HGHA 3GBNL 2AHIA 3B5GA 4GQRA 2CRZA 1X4XA 1R5VB 5EC1B 4Z7IA 4D8PA 4WTXA 2ZOKB 2VDPB 5L9DH 5D71H 5E0FA 3MSPA 3VMPA 5CZRA 4NB7A 1XF4B 1CLVA 4GAJL 4GW5A 2D03H 2GTZA 2QPFA 2EDBA 5AG8A 2X42A 3SPVA 5IESL 3WLWC 4AOFA 1DQML 1FC1A 3MJ9A 4QOKD 3UIYA 2W95A 2XFXB 3MVSA 2DJSA 3H2WA 4D3CL 1ZLWK 1I1FA 1KENH 4KTGA 2R1YB 4Q52A 3C5JB 4UBDD 3CZJA 2WUCL 2NXZB 2W1NA 4E9SA 3IGKA 1IBHA 4IBLT 2GK2A 4APQB 3IGAB 4MJ6A 3UAJC 2DEXX 1YEJL 2FGWL 4TVPL 4G72B 1QPPA 2AV7A 2HLAA 4YHML 4X7TB 5ICZB 2BPBA 2XPYA 4AGNA 1HH9A 2Q7YA 4GUCA 1E4JA 6CGTA 3WFEH 4QHPA 4LLMA 2BY3A 3W5NA 2F8OA 3ZDWA 1EO8H 4IKKA 3VM5A 1IQDB 1EO8L 1TJHH 2B20A 4XNAA 1SFHA 4ZMPA 1YUHA 3BPLB 5BS0E 4OQTA 1MI5A 5H37G 5DZPA 1IBDA 3BLKA 3U83A 3KLHD 2BP8B 2HN7B 3PAZA 5BO0D 4L4VA 2F8VA 1YEHH 2R0WH 1SHWA 3I74A 4U6YB 4KV5F 1G9EA 3D0LB 3K8MA 1SYSA 1DLFL 1FNFA 4OGXL 2GSGB 3BP4A 4ZMOA 5C3LD 4Q6IC 3RL1A 1X5JA 3WSQH 2C5DC 2CO6B 1LWJA 3MX0B 5D2NE 1XAUA 3BUPA 4XI5D 1CCZA 4FQHA 4OUOA 4U2YA 1R19A 3QUKB 4A1RA 2C9VA 5HTSA 1JK9B 5JO5B 1OXYA 5CGMA 5EOCL 3MLSL 4YSPA 1EEQA 3QDMA 5T3XE 3MRKA 6FABL 5TFSL 4BXSV 1AO7A 4HFWA 1E4XH 2J44A 4HMEA 4NRYB 1JWSA 1L7TL 1SOSA 3FTVA 3U6XA 1N2RA 3MUY1 3P30L 3CFJB 4ZMYA 3WUZA 4HXBH 3AC0A 5IHZB 3BH9B 3QDMB 4R4FL 3MUUA 1Q9LB 1U42A 1Z9OA 4AK2A 4KKQA 1OGAD 1IC4L 1XWVA 3OG4B 3N44F 4JFYA 4LIQL 4R83A 5KUMA 5IV2B 3D2TA 4B95C 3ZL4H 2FO8A 5EWIH 5KG9A 1WBXA 5IG7B 3O6LL 5DD5H 1ZTMA 2X4TB 1FGNH 1IGML 4FTVE 2ZCHL 1NGZA 1RCYA 3RP1A 3VMNA 4JY5H 2XETA 4XTRC 4BWTA 1J05B 3CH1A 3IDMA 2Z3FA 3DJRA 4G6MH 2F1BA 5IGXL 3LQZB 3P4NA 4LNRB 4PG2C 1IEAB 3LVTA 2VDQB 3RPBA 4D9RE 3UJJL 1CIUA 4NN6C 5CCGE 3S7GA 4X2UA 2GUYA 1U93B 2OYKA 5LG6A 4K8RC 4JZJC 4XN5A 2X88A 1HI6B 3ECVA 2WCGA 1N19A 1WA1X 2X0WA 1NMAL 5C09B 4NPKA 4WUKL 5CEXA 3QUYA 1UA6L 3GRWH 2H2PC 1QABA 5IVNA 3TH4T 2Y72A 1TVHA 4R7DA 3HPLA 2PYED 2FJFA 1SMDA 1G7HB 3JWOL 3K0YA 4LLVA 1IC0A 3QO1B 2PCPB 3MLZH 5AWNH 2K0RA 2VMEA 1FH2A 3UYPA 4Z7UF 5K9QI 1LE5B 2GITA 1OAQL 4LLUB 3TO2B 3OAUH 4ZNEA 2MKWA 5C0AA 3OJVC 4UOZA 1MLBB 3TV3L 3EFOA 1OTUD 3SE9H 1YG9A 1FCCA 1ZWIB 4R90H 4EIUA 4PJ8A 4NM8L 3SEPA 3QCVL 1K4CA 1QA9B 2QGCA 3EG9A 3QUYC 5E8EA 2D3VA 3O6KL 5JIPA 5TDPB 3ELQA 3HZYA 5I82A 5LHDA 3MCKA 3RY5A 2OXGA 4HGKC 2ICWI 4F1ZA 3KJ6H 2XBZA 3QVAA 4GSDH 3VU2A 3E6HB 4U6TA 4L3CA 5FYLE 3VD0A 2YGQA 1QSED 5CGBA 1VESA 3PJSB 3RTQD 1NEZA 2IXQA 3BW9B 4TQEH 2EUZA 2NUTB 1MN4A 2WYIA 1BJ1J 4P5MB 2WNXA 5ACLA 4RIRB 2AKRA 4N87A 3GIVB 3ULSB 2NY4C 3MAWA 1WGVA 5I18H 5GRXG 2HSIA 3NN8B 2KZWA 2P8LA 1VCAA 1B0RB 1D9KB 3SE4A 3S37H 1RUQH 5FDYA 4NKOB 1U2YA 1FLRH 1M1SA 5BMFL 4EO5A 1A9EA 4XBPA 3X12B 4ELKA 2KH2B 2MNUA 3ECBB 4M7LT 1MCNA 2ZT9C 3PDOA 3B9DA 5K5YA 2VE6A 3QEQE 3THMH 2XUWA 5TH2A 5I19H 5F9JA 3T9WA 3I6GA 1VGEH 3VA2C 3UC0H 2IGFH 2NDFA 3LN4A 1BIIA 4TRPH 2NX5A 4PJEE 3D18B 1CLOH 1F11B 4P06A 1UA3A 4KXZH 3OZKA 5CM1A 1NAKL 4PTUA 2H2SD 1WBZA 3GBEA 1CYGA 4A63A 4LSSL 2R23A 1S5HB 4D2NA 2D0HA 4AE0A 2AXWA 4NDMB 5DMJB 3NIFF 4MYPA 3VSVA 2R1WA 3ARVA 4PFEA 5AYUH 1JZ5A 1L7IH 2XG4B 4NKOA 1KBVA 2QV4A 1FGNL 1NDGA 2WQAA 3UJIH 1NC4B 4PJIB 3ROOA 1NCCH 1UWEL 2DQTL 2ATKA 2H9GA 4JDVA 5H37A 4W6YB 2BNRE 1U30A 3BGMB 4HV8A 4KROB 1QSVA 2B9BA 4XE5B 1TEFA 2AANA 3GEFA 3ILDA 3TEWA 3OAZK 3ZKSD 2FT8A 3F01A 5C6TL 3P30H 5EZJA 2PYEE 4UU9B 1DANT 2E56A 4KK9D 5JHDD 1M7DA 1J5IA 1OAYL 3M45A 4QRQB 3KVQA 1K3ZA 1I1RA 5E8NB 2FO1A 1AYRA 3UTOA 1EMTL 1I31A 4MDJA 4W1TA 3JV6A 2DL2A 5H4ZA 4PV1C 5E8PA 3IJHB 4AEEA 3BVTA 2EC9T 2G9KA 3EFDL 2QV2A 5GIRB 1I85C 3W82A 5LQBL 3FN0L 4A7GA 5C86A 2OCCB 3GXPA 3COOA 3RWIB 2WBJC 4YIQB 2XHNA 1CDJA 3MRLB 2ZONA 3FUEA 2OKMA 5AZEL 4TKWA 2WV3A 2Y25A 4G8GA 4JO1H 3D5OF 4W70A 4AXWB 4IIQC 5IB5B 4AL8L 3B7UX 3MBXH 3QJSB 4LOVA 5C8JA 4HP5A 1CG9B 1TQBB 4OLUL 4UM9A 2WZ5A 1QFHA 3LNDA 3WD5L 4XVUD 3RWHB 2Z91A 4AQEA 4PI2A 2ZPKL 2JKJA 1D6VL 5C09A 4A2HA 3FO1A 4O02A 4V1DA 1EZSA 2DH2A 2VN5A 3POCA 3RFZC 3DWTA 4X4XB 2DQJH 1AGFA 1L4IA 2BSDA 2A6DB 2AQ2A 2BCKB 2H0EA 4HW6A 3GSUA 4OFKA 3REVB 5F1NB 5JIQA 3CTTA 2AGJL 4GRMB 2Q8BH 1NBQA 1ROCA 3P0VH 4ZTOH 3CNKA 2JMRA 1WZKA 1AD9B 4NENA 3GM0A 5SX4I 5JQHC 3RTQA 4CVXB 1DQJB 3M46A 4F57L 2QEJA 3DX2A 2IAMA 3H0TA 4M6NL 3SDCD 4L23A 3GJFB 1PD1A 2NY3D 2GB2A 2YC1A 2OR7A 4H2CA 2OMTA 4PJ7E 1KYOJ 2Z8VC 1WITA 3PP4L 2GJ6E 1BXUA 5F93C 4HK0B 3BVDB 2R7EA 4FXGB 5FHBL 5TE6H 2MTPA 4YUEH 5EULV 1XF5B 2Y5QA 3G6AB 4XO5A 1LEGA 2ITDA 3UDWC 1S7WB 4F24A 4WFHE 5G4MA 4XPBH 3AG2B 3UTPD 1G5AA 4NRXB 1S9YA 3NJIA 1QAWA 2HMIC 3VA6A 4PJGF 5DO2D 5DR5H 2NR6C 5I16A 2BHFA 1BEYH 3RGVD 1ZT4A 1ZLVK 5KTEL 1MJUH 2YGVA 4Y9FA 5C0CD 3ML8A 5JDJA 1R3JB 4GQPH 4KK8C 4GMTH 4HJGA 2BNRB 4BK4A 2IMMA 1HK6A 2GIXA 4U1IA 3WKPA 5HPMB 5I19L 3FONB 4WHTB 8FABA 2BXYA 1G7PA 2WMPA 4Z7WB 4B5ZA 3IDYB 4BFIB 1E5ZA 3AGWA 3O2VL 1MFMA 1CFVL 5EIVA 2IQAA 2FX9L 3VXTB 3FBKA 1TJGH 3K6OA 3VFGL 2J2ZA 3NP3A 1AGEB 1INQB 4YDZA 5E6IC 5F7EH 5FUZL 4UQIM 3HRPA 3PAVA 4G42B 3T6QC 1XR9A 3RBSA 3HW7A 3PDDA 1FRGH 1PD6A 5DGQA 2O61B 1CF8H 2E6QA 1HINH 2DWTA 3LXAA 3OLIA 4XAKE 5C0BB 3SDDB 4MVBD 3O6FA 2C8NA 4U1KA 4MJ5B 4MX7B 1KJMA 2TAAA 1T2JA 5K69A 1HH9B 3SJVA 1MJ7L 2PWEA 5JPNA 5I6OA 3MRCA 4O58H 4IKLA 4K07A 1DQQA 1Q38A 3TPKA 3MLPA 1SOKA 3K81A 3MA9H 1OAYH 2A1WL 4GYBA 4JG0H 5BW7C 1DUYB 1FZMA 4C4KO 1QLRA 4KK5C 2IWEA 5E1HB 2XICA 4YXKL 2CGRL 3WO4C 4QO1A 4MAYB 2GBVA 2PYFB 3OXRB 1MHCB 4PY8J 1QHOA 5CN2A 1N67A 1R3KA 1RHFA 4IRJB 3HLAA 3PABB 4X6BB 2EVHA 4L3EB 5AW1B 3UJTH 5AENA 4RRPG 4K7PX 4IKIA 3QIWB 2W5PA 1CDIA 4UILH 1FQ9C 4Y5XA 2C7UB 4WO0A 1AD0B 3PL6A 3VTAA 1FSKC 5I1GH 2CCWA 4JO8A 3UH8A 1Q9KA 2E3VA 2WNKA 5JW4M 1NANI 1WT5A 3CUPB 2Z31D 2VR5A 2X2UA 3RNKA 3E7JA 3QQNA 5DYFA 1Q1JH 2Q8AH 1ZGLB 1P4BH 2V5SA 1OCOB 4ONOA 4G1MB 1I1AB 3FQUB 4RMQA 4FKHA 4M7JL 4W4OA 3J2PA 1UB6B 2YAQA 1SXNA 1XHHA 1A7QH 2K9FB 3GM8A 3IJSB 2NY1C 2XA3A 4B9YA 3V6OC 1A66A 1MIEL 3TVMD 2G0KA 5EU7E 3T0AA 2FHFA 4HJIA 3VFMA 5BS0B 3ZDXF 2ZX6A 3KNBB 1RERA 2EAEA 1MCRA 2KMWA 3DVNB 5E4OA 3EJYC 1S9VB 2P42B 3U1QA 4A04A 3UX9B 1VACB 4A6YH 2NR6A 1JGUH 2GTWB 3VFOA 4AEFA 3ARDA 4JFQA 4QRPE 2J1KA 4NT6B 1V54B 4RETB 3X11B 1LO2L 1DBKH 1T22B 4U1JA 2IDCA 3WNIA 4HVBA 2P24B 5D2NB 1HINL 3OGOE 1FNGA 3A0OA 1N0XH 1ROWA 1XTLA 3N40P 2YMXH 4JM2A 1O6SA 4XNMA 3IJEB 3VGHA 3CD4A 4AH2A 2F74A 2FATL 2Y7QB 3MJ9H 3ETSA 3P11H 2WP3O 3RWGB 3D85B 3T1FB 4AZ8B 4GB9A 2AJXL 1XSOA 3RWCB 4X0KA 3JV4A 1P4IL 2YD5A 4I2XB 5AL8A 5DUBB 2E47A 1V3MA 3GYRA 2FJGA 4NQSA 4XMTA 4S11A 1QRKA 2O5XH 3QUZC 3L4TA 3FFCB 3FHQA 2CM5A 3BISA 4OCYH 1E8YA 1MJUL 3FO9A 4R7DB 3GZPA 5HI5C 2WKOF 1RK7A 1SZNA 3FW6A 3BSZA 4OBSA 3RGVB 5BMFH 2V6HA 1XMEB 4R26L 2EXWC 4FERA 2N1KA 4LVHC 3CFTA 3GZOA 5DT1H 4K7PY 2OMXA 3F6JA 4U1NB 3UIZA 4IU2B 2Y1ZA 1ANUA 4K23H 3LEYH 5I8CB 5DTFA 3ARGB 3LEYL 3UBXG 4OUUB 2B4CL 1RVFL 5D5ME 4NZFA 2XZQH 3WMPA 3QG6B 2G3ZA 3E3QC 3PV6A 4FC3E 4M5ZH 3MLUH 2IG2H 4KVCL 4GSRA 3FTUA 3VXTA 5IFHL 4N2MA 2IQAB 5T8IA 2HJLB 1IGFL 4HUMB 4JX0A 3NCYP 5C0CE 1RKRA 4KJQD 5C09E 3KLDA 4XX1G 2XWXA 2VIRB 3JWOH 1MCWM 1RI8A 3SE3C 1ZDQA 1WFJA 4MMZA 1JP5A 2QADD 1VGKB 3BJLA 1A3LH 1T1YB 1V7NH 2X1PA 4B50A 1KB5L 1I3VA 2A9DA 3OZ9L 2JCCB 4MYWB 1BD2D 3QFJA 4GKLA 4BUGA 2ADIB 1AXTL 1I9EA 1SXCA 4G8GE 1NCBL 1F2QA 2IBZY 3DRQB 1S9YB 4KZCA 5E7BA 4AEHH 1HFUA 4ZZFA 1G1CA 1L9MA 2A38A 3AUVA 2HTKC 3FKUS 4MB4A 3SQOL 2MEJB 5I75B 3B2DC 2K1MA 1DUZB 4EKJA 1KNOA 2V0AA 3S0PA 1XZ0B 4OV6F 3WGUB 4PJ7F 1G1YA 4XN8A 3WEBA 2VR6A 1X5IA 4X83A 4IRJD 1YNLL 5D1ZD 4MJID 4BHUI 1I8KB 4DHLA 5HJ3A 3PYCA 1QFWI 1ZVSB 1LWHA 3UOAB 2ZCKL 3FSOA 25C8H 1JGUL 4JKKA 1KF9B 4F7EA 3N42B 3AM8A 3IS0X 1IJNA 1SNRA 4XP4L 5JPMC 3N0PB 1A3ZA 2BHUA 5TPWL 3B43A 2PYEA 2K8QA 3FRUA 1UQSB 4WU7A 3RU8H 5CLXA 4YGAB 2CDEB 5D4QA 1DN2A 3DHMA 3QUXB 4M9PA 3SD2A 1U3ZA 2A6KA 5IKCA 2OSXA 4J2XA 1WFOA 2X44D 4FQIH 5HHQB 2X4QA 2HTLC 4QTHB 3ME0B 4IBUA 4H8HA 2A6DA 1OGSA 2GHZA 3FSWA 2GUOB 3NDZE 4N2NA 3ZHLA 3M7FB 4U31A 2IDQA 4Z7QE 1Q0YL 3DGGB 1EPFA 1DVUA 3CC5A 1EMTH 1N8ZA 4AWJC 4XP9L 4AV5A 5C3TA 5HDBB 3B8SA 3AFLA 3IPBA 5H35A 3LRGA 5TQ0L 5C8JB 1XEDA 4BSVB 2EE6A 1NCNA 1U6AH 1J48A 2X5PA 5CSBA 4F7TA 3BRFA 3C5ZA 5KVMC 5J11C 1FYTA 3DV6B 3EGSB 1PKQB 3UPRA 1OK0A 1HL9A 3ECUA 5KBKA 4ZI8A 2DLHA 1P9MA 4PJEB 2WCSA 1R0AL 2QZQA 3LRMA 3HTLX 3MLRL 1L3WA 1WD9A 4YSAA 5J8OA 1IL1B 3HUJA 2DZEA 3T1FA 3QORD 1E9PB 3LNGA 4HWNA 5KYWA 2BVQA 2C9RA 3C6SB 4OD2B 1NFDE 5CP7B 4NIKB 4YK4B 2R2BA 1RL1A 2DD8H 4X7SL 3MLWL 5DDHA 4N6RB 4JQIA 4C4KT 4OF3A 3APDA 1UD8A 5IVZA 4RSVA 2Y4SA 2P28B 1P84J 4X7CC 4Z1PA 2OX5B 4O2CB 1S7VA 2VR7A 1H8OA 2ED6A 1CL7H 4J12A 4Y1AE 4Q97A 3QDAA 5JW4N 3HC4H 2Y2YA 3OB0H 3BP7A 2WM0A 1LJMA 3INOA 4A2FA 3P4OB 4PJBF 1N18A 4PRDB 1IC7L 2BJML 5JNYA 4RGNC 1FL5B 1G9NC 4DIXA 5B3JF 2X9XA 4YHLL 4GINA 1NMCC 4OLUH 1YNTF 4KTEL 3VX1A 1E65A 3MGOA 4M6ML 2HFGH 4JHWH 4NUMA 5CLZA 1SUJA 2ZUXA 1EEZB 3EYQD 3ULUH 4UOQA 1J7VR 4AV0A 3JVGC 1FH5H 2J3SA 2MPAH 4LCCB 3MNMA 1H5BB 1P0SE 3EO9H 3L9EA 2XVBA 5DR5L 3B2XA 1SDAB 2FQEA 4QNPF 3TWYA 2APSA 3DK0A 2CBPA 4QIRA 5I76B 4L8CB 5T5FL 1UM4L 4JHAL 4N0UB 3CVIL 4ZPTB 3TO4A 1ITBB 3ZGHA 1Z9LA 3EFDH 1AD0A 1LNUA 1ODUA 1SLXA 2AEOA 2XXCB 3KPOB 1RVFH 3GMOA 3JVFC 4FXKB 4Z76A 2VLRD 1UB5A 3DIFB 3EBIA 1G7IB 4HIQA 4YUEL 4L3EA 1M9WA 2VXTL 3D18A 4F93B 1JGVL 1S9WA 2C4XA 3SY0A 5KSVB 2A2QT 1XGUA 3BLBA 3ARRA 4XNZC 1GS7A 1PY0A 4MQSB 5CHNB 1G7IA 3HZKA 1UB5B 4FE9A 3EOBB 4TYUA 3B9AA 3FRPG 3T6ZA 3TVMA 5I73B 1MVUB 5CSZA 5D72L 5E4IA 4XPHH 2KQNA 1KJ3H 5B39A 2CD0A 3LKPB 1IGTA 3DRTA 3ZHKA 2I5YL 5DUPL 4L1LA 4P2OD 2VLLB 5FOJA 3N1QC 1URIA 2CBQA 3KYKH 3PG2A 4NC2B 4N2CA 5B22A 4EI5C 4YJZL 1JF1B 2N3JA 3DMMA 3ULAB 1VEMA 2A1WH 2BIHA 4MLSA 3TFKD 5ECJE 1W6WA 3GKZA 3EDJA 3FQXB 3UPCA 2BWDA 1DBJL 4I0PC 4L8SB 4V2CB 5JHLL 4Z3FA 1VFBA 2YLKA 3ROLB 1RP9A 2JQAA 3BZ5A 4B3EA 4WTQA 3T3MB 2QBWA 4WRLA 2A9ML 3EYQC 3OG6B 5LCVA 3WIIH 3ZPDA 5IVOA 1YEDA 3EJTA 4RWYH 5DJ0B 3BAWA 5EZLA 4Q6KA 4TSCH 4DZ8B 4Z7VB 1QR1B 5SWQA 3IMBA 3DA0A 1FFPA 4ABQA 4FMKA 1YO4A 4P0DA 1OB0A 1IVTA 3NQIA 4DPBX 1QSEE 1X5HA 3SB3A 2F54A 4K8RL 5FKAA 1IV8A 3QHTC 3UAJA 2HRPL 1INDH 2FL5A 3E6HA 3RE0A 2VERA 4P9MH 3VJ6B 1TJGL 5MP6L 3MDJA 1X5YA 2FBOJ 3MRMB 4NJAL 3DVFA 4X8CA 4DK5A 5IHUH 4HUWB 4YPJA 4Y19E 1E8WA 1MCLA 4KITB 2H8PA 3B83A 3CVCA 3TNNB 5E7FA 3VXNA 5HY9B 4N1EA 4WFEE 4ELME 3B2UD 4AVKA 2CRYA 1CD0A 1E9OB 2V17H 3CXFA 5IROD 1A0QL 3HIZA 3DTXB 1KB5B 2YRLA 4PV9B 2DJ4A 5CEZD 2K6YA 3VNYA 2F53E 4ZSOB 3VI4F 1HE8A 1MFUA 2R8SL 3HR5A 2DQIL 3UP6A 3WKMH 3BUIA 3FXIC 2NDGA 5D55A 4OSUL 4FJ6A 1L3NA 3VDAA 4UQAA 5KYUA 5FDWA 1QUNA 3TNMB 1C12A 2YARA 3FT9A 3OMNB 2NPLX 4CMMA 4D7BA 5LXGL 4F92B 4XC1H 3V5HB 4MNGA 4ZMQA 1SPDA 3FS9A 3RTQB 3AXIA 4CVXA 1KULA 3FB7A 1I1CA 5C0JA 2K4WA 1O9ZA 4KTDH 5TQ2H 1DEDA 1KCLA 3QRBA 3H9SA 3H7BB 1AHWB 2TSAA 2FUTA 4ZFOA 5C0JB 3GMQA 5EOCH 3HFMH 2GABA 3HJ0A 5FB8A 3NG5A 1OPGL 4HKJA 3V5HA 3MFFA 4TVUA 2GFBA 1L9QA 3TYGH 1U8QA 4XT1C 3SYPA 2YD8A 3ORJA 4XNQB 1I7TB 4HAFA 4IOIB 1NBCA 5M94B 2ZJSH 4LHUG 5IQNA 1AY1L 2VXQA 1NH6A 2UY6B 3BZDA 4KOCA 2F19L 2HUEA 4ALAC 4BK8A 2N01B 4JN2B 4ZSOA 1QWUA 5AW0B 2XWTA 2Z93A 4I77H 4Y1AA 3GZQA 1KYDA 3GB7A 1OCZB 4HCGA 4B9IA 4WWKB 4FKEA 3U9PH 4OH2A 4D3CH 3L1OH 2VDMB 5FYLH 5MEOA 5DD1H 3KCPB 5K9JL 3IXTA 1S6NA 2WXNA 4BYHA 1JYXA 4DVRH 1TQWA 3DBSA 3OV6A 1QRNB 3CFNA 4OGAC 5C0EB 3WN6A 4LRNH 4FABL 4WW2B 1HL4A 3JV6B 1NCJA 4YHKH 5F3FA 4FQJH 3MRPB 4OTXL 3MGTA 1QX1A 3KE0A 4JFOB 2JKSA 2MHAB 5BRZD 3QDGE 2BFGA 4F58H 4H20H 3QA3B 3HG2A 4TVSa 5F71A 3BT2L 4D9RD 1KBGL 1P7QD 1M7XA 3TCXA 2X38A 5FKPB 4DP6X 1SEBB 5GGVY 4G9FA 3GTVA 1AZCA 1J1PH 2IADB 4FD0A 4G8GD 1HL8A 4G8EA 1KCKA 3VWJC 3PV6B 2B1AL 2G60L 2DICA 2FJSA 4JRYD 4KJQC 1XBDA 3BAXA 5EV7A 4Z0BH 3MRGB 3MJ8A 1ET8A 3ARFC 2R2HA 5C0RH 3WTUA 3QIUD 2X4SA 5ICYB 1MWOA 1LEKB 3D39B 3EAKA 4NFDA 4CA4A 4GT0A 1QPXA 3C60C 4Z7OB 2R1WB 1QNZL 1GA2A 3ZO9A 4W9FC 3C2SA 4HBCL 3RGVA 1AH1A 4XNUL 2A0LD 4GG8B 2DQIH 4NM8H 2P48B 2ZAGA 3D07A 3QG7L 4JFPA 5GGRY 2CIKA 2F8IA 4P2CG 2OK0H 1HYRC 2ED9A 4MJIA 4XPFL 2Y9RT 4WEMB 1L7IL 2EDDA 2KL6A 2BY1A 5HI5D 3GT6A 2BVTA 2FJGB 3LDBC 4XO4A 5K9OA 3P2TA 5DRZA 5FLUA 2B1OA 1KT2A 3GS4A 4GP5B 2B8OT 2QHRH 3OKDB 3OR6B 3U0TB 1A6ZB 1KGIA 2NNAB 5AKTA 4Z76B 4X5QA 4BGLA 3WV0A 1XGRB 4UV4L 1IU1A 1FI8C 4KNSA 4QHKJ 4PS3A 5CAYB 1KLUB 2V7NA 1X5XA 3TURA 1NSNH 2KT6A 3Q7JA 1UC6A 4TSAH 1Z32X 4BZYA 1SFDA 2OTPA 3A24A 1NC2D 1SJMA 1U8KA 2A77H 4KKBC 3QPQD 4FFTA 3U0WH 2L0DA 3BCFA 4KX7A 2H45A 4WEEA 4TNGA 1MFDH 4P46A 1JGLL 2WYTA 3NDYE 3ZSTA 4ZUSA 4A2EA 5L8JB 3D9AL 4CSTA 3B4NA 5CMAA 4M93C 4QRRE 3B9KB 1X3DA 3VI3A 1FE8H 4KRNA 4TQHA 3MA7B 3RZCB 4Z3HA 4YFEA 5HYQA 4OLEA 4P46B 4NSKB 1LEIB 4I85A 5DJYA 1IBFA 4QOKE 5D7LA 2VLKA 2IDTA 2Q86A 5D96C 1BW8A 1OAUL 3QAQA 4F2MB 3KLSA 4KJPD 3CIQA 2J72A 4FQCL 3AS3A 4DQAA 1E28B 4P4KC 3WJJA 1PAZA 3PP4H 1R0AH 2OR9H 1UZ8A 2ZXCA 2OR9L 3HJEA 3UTQA 4P2OA 2PPFA 3NVQA 3HRZA 5ESAA 2GBTA 5MERA 5F7AA 2BNUA 3QPXL 5T1DL 4RISL 3BD5A 2DYPA 4DPRA 4F8TA 5IP4A 1FFOB 1PCSA 5ITFA 4XNYL 4WJ5A 2LU4A 1G7HA 3O6FD 2OLDA 3PUUA 3OPZH 3REWA 5I8OL 1AOZA 4GRLC 4PVNA 2BSSB 1YEHL 2R0WL 3DX9A 4P5KA 1AJ7L 2J88L 5IBLC 3FUKA 4MB1A 3EOAA 4JCMA 1M6OB 5GRJL 1KELL 1KB9J 3OJMB 1SN5A 3OKOB 3P3UA 3TJPA 1EHLL 1QFWM 3VRJB 3CN0A 1TCRB 2A9AA 3L1OL 4XB8A 1CTMA 1DL7L 1N12A 4DEPC 4ETQB 5ISZE 1FZOB 3ARSA 5KZCB 2LLNA 1JZGA 3KBFA 2ARJB 4Z7QB 1JTPA 2IOOA 2W65A 1UJ3C 3HC4L 1BEXA 2YQ3A 4YHMH 1N0LA 5EC2B 3CFBB 2OMNA 1KPRB 5EN3A 2QGEA 4AT6A 1EO5A 1PG7L 3EF4A 3SBQA 3WFCH 2ICEC 4WUUA 3SDDD 3GBLA 2F7PA 1MCIA 1BVKA 1SF5A 4OD3L 4EE2A 1C1EL 4ZOBA 4J4PA 1B9KA 1TJMA 3BWUF 3ETBJ 3CPUA 4PPTA 5AVRB 1MRFL 4TULL 1HVXA 4OIFA 3CX5J 2QSTA 2X0UA 1S7WA 5BUAA 3L2NA 3QHFH 1T7VA 1U41A 2C26A 1J8KA 1G9ML 3I75A 4IHBA 5GGSB 1P84K 2ZZUT 5L88L 2BSEA 5DVLA 4C59B 4M1GH 1F6LL 3TT1H 2EE0A 3RQ3A 2Z93B 2QLYA 1WHOA 3NJFA 4UQ2A 3STZB 1AQKH 1TCRA 3SOBL 1B9ZA 5JO5A 1NUNB 1IIIA 2XWCA 4Y5VA 3QR2A 5D7JB 3ZOAA 3W37A 5J6GA 4PJCB 5AUMA 5KAQF 1HYSC 3GJEB 4EXKA 1EJ6A 3QCVH 3SPCA 3ZKNC 3VXPB 2XXMB 4HSQA 4HKZB 1BZOA 1MW3A 3U9UA 4P4KA 4CU6A 4XN2A 3MN8A 1QSZA 5C07A 1U8QB 3VAEA 3VD7A 3MFFB 1QHQA 1B6DA 3HB3B 1O0VA 3IMVA 4L4VB 1DQJA 3GSXA 4WNQA 2X70B 2IPKB 5TE7L 1WFTA 4JVWA 1KBBA 3GSRB 2XWDA 3RJOA 5C0BD 1EJ8A 4M5SA 3ECWA 4PBDA 3ZE2E 3AT8A 4BZ1L 3EOYG 1OSPL 2QQLH 2P43B 1DSFH 5EO9A 1PY4A 1XGQA 3FDWA 1SDDA 5GS2D 1IAOB 3BIKA 2OMXB 4U1NA 1CE1L 5HVWA 3BFWA 3TCLB 3BKML 1EDQA 3OWEA 5LDSA 4NNYB 3DGCR 2HFGL 1MCEA 4JHWL 3SDAD 4PRAB 2JH2A 3U6RB 4HGWA 4TNWK 4PRPB 2YKKA 3REWB 2Q86B 4HS8L 3SDCB 5D7LB 4U1LB 5AAMA 1OF2B 2FLMA 2PF6A 2VWEC 5T3ZL 3TF7C 3PNRB 4AQAB 1MJJA 1DEEA 4M6OH 5BQ7A 4XC3L 1E5BA 1S7XA 2AK4A 3BKJL 3Q0HA 32C2A 1N6UA 4NO3A 1A64A 1XGYL 1OE1A 4N1HB 1LILA 4JDZA 2YN3A 3NYKA 4FFYH 5E6IA 3HRZB 4U0RB 3F83A 1BFTA 5DD5L 3V0WH 3QIBA 4AH2B 2IPTL 5IJKC 3O3EB 3N5AA 2EUXA 4LDCA 3MLWH 2RJMA 2Z35B 2H32A 3IFPB 1YY9C 1KCRL 4I18B 4PJ5B 1B2WH 3DX7A 4I8DA 2Z92A 5ICXB 4R8WL 1P7QB 2D8KA 4U1SA 2CLVA 4U3SA 3VQ2C 5EC1A 5D7IA 3P3YA 4P8QA 2VLKB 5CN3A 1S7QB 3EJZD 5A16B 3K4AA 3Q6FA 1A21A 4OCWL 1YEFH 2ICWA 3ARBA 2HX9A 1BJ8A 4IRSC 5B7FA 1CMOA 4Y1TA 2WY3B 3DVNA 1MQKL 3FU7A 1BV8A 1L0YA 4WWPA 5IJDC 4GFTB 1A2YA 4PJGA 5K9KA 4HV8B 1VADB 3EW3B 3ZMEA 3O6KH 4KZDL 1XGTA 3H3PH 3LXUX 4KC3B 4EN3A 1UT2A 1HCVA 2V37A 5IR1B 1TXKA 2V7HA 4TUUA 5CILH 3MFGB 3QORA 2G5BA 1CVSC 2X7LA 5BQDA 5B4MD 1TDQA 3RX8A 3ZTNH 2FWLB 2OXHB 2A73A 2JVUA 2X4UA 3HNSH 3RA7H 2H0PA 5DHYB 4PLKD 2D2CC 5ID1B 1X5GA 4KXAA 3HC0B 1YN6A 1G1OA 4UILL 1FO0H 4U6XA 1T89A 2VKWA 3P0YL 1JGDA 3MJ7A 1U3HC 1E6JL 3HG4A 1U92A 3G5WA 5F21B 5ADPL 1MFCL 2ZAHA 2CGRH 4AQ1C 2XACC 4UMSA 1G0YR 1ZANH 4YVNA 4E41A 3SE8L 4CJ1A 5ANME 4APQD 4ENED 5KSVA 1WFMA 3LS4H 4HWZB 4JG0L 4W9IC 1UFGA 1XD1A 1TZHA 2ZP9A 3H1ZA 5KBNC 4B9FA 2GJ6B 5A2BA 2QVTA 4V11A 1FHGA 5F7FA 1N26A 2P26A 4HJEA 3PDOB 2GJJA 1FVCA 1V8HA 1XCTB 2ZCKH 4JFPB 1BD2E 2DKMA 1BQUA 4U3CA 1IKFL 3QR0A 1VSCA 1A4AA 4J3WA 4N0UA 1E8XA 5DK3A 5E2WH 3IAGC 4QWWD 2RTTA 3LEVH 2D0GA 2OXHA 1JYVA 2AJ3A 4NO5A 1PEZA 3B9KD 1U3HD 2WZAA 3MBXL 2QHLA 1Y18A 1R6VA 2ZUQB 3FK3A 4FQLH 1NCAH 5F0PB 5I6XC 5BRZE 1LVEA 1T7YA 3L1EA 3X1GA 3NJJA 4UDUB 4YC2C 1QLEB 1P5UC 2GIMA 2A99A 4PIRF 5FWRA 2E8YA 3L4ZA 5HYSA 5B1JA 3EGDA 3FUIA 4O4YL 1T0NB 3QEQD 4XPHL 3AT0A 3TIDB 1EAOA 3Q43A 4FP8H 1G7PB 3QI9C 4LPUA 4FG6D 5INCA 4ONGH 4NUGL 4XMLH 4NQQA 2LR4A 2MHAA 4ZFQA 4U3SB 2FO4A 4BA8A 5I24A 3MYJA 4K73A 5C92A 4IRSD 2OMWA 3OKLB 1QWHA 1PS3A 2MOGA 4LO9A 3CFDB 4XNYH 1X7QA 5T3ZE 1MCKA 1J0ZA 4NRXA 2VR8A 3DVGB 2R0LH 5C0BE 4EI0A 4FXTA 5TF0A 4A6YA 1A14L 4FQIL 1P1ZA 5FWQA 4AENB 3KCPA 1F41A 1ZWIA 4CUCA 4IEFB 1MVFA 4YHIA 1UM4H 3G3LA 5D1QD 2YPKA 5F9WB 3U1PA 3I2CL 1MZYA 3CU7A 1RZKH 2RAMA 4KNTA 3QORC 1DEEB 5DJZA 1ZEAH 4N2HA 3SO3C 1NM4A 5BQ7B 1FWXA 3DV6A 3EDKA 3Q2CA 4OGZA 3SDCA 3V4VL 1ORQA 4HWBH 3TT3H 4AVIA 4M6MH 4MNGB 2UVEA 4GSQA 4F57H 3SZKC 3TA3C 2OMTB 4IMKA 3QDGB 1QUNB 2KS0A 1F2XK 5D1XB 2CO4A 5AB0A 4KUCD 1N8ZB 1UZ6F 3V0HA 3VFPA 3VH8G 1A7BA 1FRGL 1XGQB 4OCXL 2XX1A 2PLTA 2PP8A 1WFIA 1I7UB 2C1PA 2J57A 1GZHA 2K6WA 2VDRH 3HG1B 1BQHB 1XGYH 2VMJA 3K1KC 1G6RA 1VZGA 1DN0A 1AHWA 4KHXH 1WFUA 3DTXA 4PV9A 5A2FA 3DPDA 1IGIL 4XC3H 4XOCA 5JQIB 4BH8B 1QLFA 4ZW8A 3ASWA 2W80C 1ILSA 2QT6A 3WAJA 2BVYA 2DD8L 2BRRL 3GHEL 2QADB 4LCUB 2QJDA 3D4GA 5TJWK 2ZUTA 4DSYA 3DARA 2AC0A 3OSKA 4OJEH 4Z7OE 4EVNB 4DKFL 3LZFL 1C12B 1NGZB 4RZCA 5BV7L 1PLGH 3N9GL 5IIEA 4ZZKA 1PJWA 4IGBA 2ZWLT 2DMBA 3PAYA 2YBRB 4L5FE 2TRHA 5GGSY 5TE4H 1ZVSA 3LHAA 5FGCE 3DSNA 3O41B 3S88L 4OJCA 2O6CA 3NA4A 4EBQH 3KEDA 4XCNA 1LDSA 1M9SA 3CFJA 3GKWL 5DJ0A 5J1SC 1WRFA 1UURA 2B4CH 1KJ2L 1ZLUK 4EZKA 3VXUA 1IILE 3GHBH 3CHPA 2AQRA 2BP5M 2BSRA 2CDGA 3QH3A 2FEEL 4P99A 3V9EA 1KTBA 1JWMA 2PNDA 3VFNB 1FNLA 4J28A 1KLGA 1JPEA 2MQ3A 4MZRA 4DN3L 2EXTA 4WCYL 1JGIA 2DY2A 3UMTA 3C5SA 3R7QA 1SLWA 4NO2B 5E8NA 3OTTA 4M7KH 5GZNC 2HTKD 4W9DC 3T09A 4WUUB 3FUHA 2OJEA 2AEWA 5FS5A 3M6DA 4O02L 4AKQA 1SVZA 1T0MA 5AZUA 4OKVB 1TYRA 4NJAH 3TVMB 1FZJB 2IGLA 4OQ1A 1JIBA 1OGTB 2EYSB 2HH0H 4HPOL 1JHTA 2EO9A 2X6CA 4QRRB 2CRIA 2HRPH 5GGQL 1P5UB 3ZRSA 5CJBA 4B3VA 5FYKL 3L6FB 1KYOK 4XCEA 5T3XD 1UACH 1GIGH 5DTFB 3T0VA 4HALA 2XX0A 5C08E 3U4EA 3GLDA 1D6VH 4NCDA 2ZUQC 4XPAH 1MCPH 3L54A 1YNTB 4H26A 1AG0A 2ERJB 1ACCA 2Y2TA 3KPOA 1JXDA 1M6OA 1YEKL 3OAWA 2AZUA 2V5YA 3NT0A 3HPJB 4DOHB 2FJHA 1CXFA 1LTXA 4Z18A 1LO0L 1YN6B 3G5VA 3UFIA 5E08L 4DO5A 4L9LC 2VDMH 5I6NA 3B37A 1BHGA 1MVUA 3GMPB 4TRPL 5CNHA 4P2YA 4KVNH 2VNCA 1CK0L 2VLJE 2ATAA 1UHVA 2R1YA 3IMSA 4XP1H 3D3VD 3UTZA 43C9B 4XHJD 2A6IB 1YZZA 5JYMA 5B1AB 3Q1SL 5JZ7D 1ZXKA 4LLQB 1I8MB 4HBQA 1FO0B 5ESAB 4F9PA 2EKSA 1EJFA 2VLJA 5JNYB 4GAFB 4NJ9H 1BWMA 2Y7QA 5D1XE 3IF1B 1HKFA 4LVOC 1CQYA 1JRHL 4MXVE 3HHSB 4M7LL 5GRJH 1ZV5A 2HT4C 2LU5A 1T6WA 4LSUL 3OHXB 5EBMA 1F13A 5K1VA 4X6EB 1ASQA 1EZLA 4M5ZL 4WO4C 3GMNB 5DK2B 1HOCB 3T2PA 2NXYB 3W0WD 2EIMB 3B34A 1C08A 2QQQA 3UEZA 4RISH 1GYVA 5EFIB 2R2BB 1IC4H 2VJ0A 5JOPE 3BGAA 1HDMA 1OALA 3CFIC 4I88A 4LNVA 5DRWB 3BN3B 3CVIH 4ZS6D 5ILTL 5D7IF 5ISZB 3WXVH 2H1XA 2XIBA 1QO3B 2OYPA 4NZJA 5DRWA 4JKPH 2A6IA 1QYGL 3NACL 4YSUA 4AC4A 5HHPA 5I1AA 3JBG7 4Y4FB 1RUML 3HC2A 1D5IL 3UL4A 2D3NA 1C08B 2CALA 3SPIA 2DPKA 4HAKA 1I4FB 1OEZW 4UTCA 2YZ1A 1L9PA 1SM3H 3CZGA 4IIZA 43CAA 4G6KL 3X13B 3L3JA 3DO7A 4AV4A 1GGUA 3MKKA 4ICWA 3UADA 3B6SB 2B1HH 4H26B 1JZIA 3IF1A 4QYAA 4GKZB 4ZW7A 2EACA 4NRZB 2DL9A 2J6EL 3CQPA 2PTUA 3EZJB 4M6OL 1JVKA 1ITCA 4Z7WF 3CSYB 4AJ0A 5LGYA 1MLBA 5EBWB 1C5CL 3N1FC 1EHAA 2QDVA 4N2LA 5D1ZB 4ZQKB 5IM7A 1TETH 5CEYB 1FIGL 3V0AC 3N44B 2W8CA 5M7QA 4XH2B 4BZ2L 4J23A 1CFBA 5E1AA 3BIBX 2YD0A 1OGTA 3NEEA 2DDQL 4GO6B 1SJHB 3O9WC 4F7CB 2EYRB 4OV5B 1CGSH 1QASA 1BEYL 2LU7A 5JPNB 4PSPA 1B3IA 4QRTB 4Q6IA 4YE4H 4ZFOL 4F7EB 5GRVK 3IDXH 4Z7NF 4U1KB 4UNUA 1ZAGA 4FQXC 4U3HA 1T3FB 1MAMH 2XV6B 3H2PA 4LT7A 2X87A 3QT2A 1SQ2N 4ALAL 1CUOA 1EFQA 1SY6L 4ZDHB 3NK4A 5DJ2A 5T5NF 1XB8A 3BDYH 1T83C 1JZHA 2P46B 3MRQB 2DEYX 5DJAA 4QKTA 5ACZA 1NLBH 5TD4A 2CDEA 2DQUL 3MODH 1DUZA 5DZOA 2CWRA 2SODB 4CVWA 5HYFA 3VG9B 1A47A 1E6OH 2ALAA 3HB3C 3IDIB 4FEMA 2DKUA 3QEUA 3ZKXB 5D1QA 2OR8A 4RESB 2J73A 1WHPA 3GI9H 1ZT4B 1KTDB 5T3XH 3F7LA 1MXDA 5DHVH 3ZQWA 3C08L 4K9EL 4BFEA 3QDJA 3CLEL 4UT6A 2I07B 3D48R 3UTTA 5A2CA 4N1CA 5D1QB 4X6DA 1UWEH 2DQTH 1SBSH 3BWAB 3NCFB 3X3GH 2BW5A 5BOJA 1XIWC 3SKJH 4DKEH 4PWIA 4N2AA 3F7YA 4OCSL 3OMAB 1NA8A 2ATPA 4XP9H 2HG0A 1EVTC 1G84A 1QBML 3VXUB 4ODBD 2KLRA 5LN8A 3NBNA 1NTDA 5DD6B 5DJ2B 1G6RB 4N2BA 3O41A 5D7KD 1SBBA 2IBBA 1SN0A 1A7PL 2L7QA 2YPLB 3F12B 4DP0X 4F8QA 4WTZG 3S5LB 4LPCA 3AQYA 3LRKA 1E4HA 4F7PB 5D1XA 5IIEB 2QVFB 4D8OA 3BN9C 1KEGH 3NCBB 5A6IA 2VIRA 3LXBA 3AWFA 1M3IA 1CB4A 2CNZA 4RMWA 5DZVA 4L05A 1W0YT 1FC2D 1NGWA 4YHYC 2NYKA 1VGEL 1UJ3B 3PGDA 3BQVA 3MRHA 1X44A 2OL3H 4BSJA 3G6JF 1H6UA 4DH2A 3QUML 4TL4A 1N68A 4KH9A 1D9KD 3QE5A 4LCYA 5D1ZA 4ZQKA 2MCMA 1CLCA 3SYAA 1EVUA 3JV4B 1GMIA 2W38A 4MA1B 5CIPB 4NX0A 1AOHA 4Y5VC 2WZ0A 1J5CA 4JPKH 4OLXH 1QACA 2OTUA 3RB5A 3UZEA 5I6PA 1N6VA 4UAOB 1PW3A 4ERSH 3TP4A 5BO1L 3MRJB 1O7SA 2COVD 1OM3L 4F2FA 3LX9A 4G70B 1ZANL 5BZXA 5T1DH 5I1HH 5HJBA 1M2OA 2P5WE 4U1JB 5E56A 2Q76B 1SM3L 2UZPA 4TVPD 4S1RL 4XVUC 4FYSA 4XXWA 5EH1A 3NIGF 5ILTH 1LEIA 5B3NA 5AAWC 5HYQB 3IK2A 4ZAKB 3WTSA 3H9YA 2UXVA 2XFGB 4PGDA 3AREA 5MEPA 4C56D 3UTSD 5DVMA 1ACXA 5CBEA 4MQ7A 2BZCA 5IHBA 4BIKA 5T3ZD 3MXVL 3HNSL 1EZVX 3NUKA 2G5RA 3JWDH 1K85A 1ET7A 3QZMA 1MRCL 2DYRB 4A6YB 4XO9A 5SWSA 4PV8B 1H9DA 4KX9A 4BK5C 1A02N 5CLYA 4D9QE 2GBAA 5CD5D 3IMUA 4NCC2 4BH7B 4YSCA 5JW3H 4OLVL 5L7XH 4KXCA 2A74B 2B59B 2VQ4A 4F58L 2FGZA 4AJWA 3CUPA 1J0IA 4H13C 1JN6A 3ZR6A 1JHKH 5INCB 3V52L 1HNGA 1A6TB 1MAJA 3ARBD 3T71A 4E9QA 5HGHB 4X5XB 2MTAA 1OPOA 4E9WA 5EZLB 3WHE1 2OI9B 2YEVB 3VW3H 5JHMA 3HMWH 3BAEH 3RZCC 2IEPA 4AYFB 5CFHA 5HYSB 2WKOA 3RVWC 1ZLSH 4KK9C 3E3QE 1YEGH 4GAGL 4XP5L 3R18A 4OD1L 5FUCE 1JZ7A 4X7FC 4X5LA 2COQA 3T77A 2VISA 3NJGA 1SJEB 3LQAL 4GQQA 4U7KA 1MUJA 4ZD3L 2VZSA 2DKSA 3UGUA 4N26A 3FU0A 3BKYL 1IBZA 25C8L 2FATH 3D85D 3MJ9L 3NJVA 4U6XB 1MIEH 3FZUC 4HIIA 3SPJA 4E36A 4TLKA 5I1IL 3L9RA 5AVZB 4EI5D 4XMKH 4FKKA 3S96B 1JXKA 5LUMA 2YMTA 4PTUB 3M1CA 1QP1A 1FIEA 1OPGH 2X0VA 3OR7B 3SBPA 2ZX5A 1H3TA 5EBLB 3LNFA 1TJIL 5DFVC 1TZHB 4OFYD 4JY5L 1X5MA 1QW8A 3LDBB 4Y2DA 5E2VL 1JVLA 5D6DC 5F44A 1SEBA 3EOTL 2VE6B 4OVVA 5EU3B 4JLRA 2XT1B 2WLZA 4JRYA 1CS6A 3GI9L 2O6DA 1XIWB 4I9WE 2AJYH 4OKDA 3RPIB 4YX2L 2D7TH 2WP3T 1U3HA 4NO0A 1P4BL 4GRWF 3S3BB 1TR7A 2V2XA 1ECYA 3MRPA 4FFZL 3JV0A 3WKML 4F20A 3L08A 1BJMA 1JOIA 3NAAL 4RQQB 1DJWA 1BVLA 2AP2A 5AVWB 1YC8A 5CLTA 1XGTB 1DVXA 2BIMA 5HYEA 3KH3A 2BSRB 2CDGB 1BQRA 4QTIL 2Y07L 4NLAA 4AYMC 1T6BX 2CPCA 4L3FA 1XL6A 2CBTA 2ZTBA 5ESQA 4OD3H 1CF8L 4F9LA 1WQVT 4HC1A 4RFEB 1GW6A 2O6FA 3QNXA 2NY3B 3EO0A 2P5WD 5A6MA 1OSZB 2WLJA 4ODXA 4URKA 5LNGA 3A4EA 5I0VA 4LL1A 3U6RA 4TNVK 3LQAH 2GK0A 3D51A 3MA9L 4N6RA 3LZFH 4U6VH 2Z8WC 3TEXA 5TDPA 3ZL2A 5E8EB 3SGKA 3B2PA 4JFEA 4XOBA 4BWUA 5D7LD 3L17A 5JXAL 4NO3B 2QPUA 4TS6A 1NFIA 3Q3GB 4C56B 1H15A 4ZUVB 2NY6D 4UQDA 3M8OL 4U1LA 1ORSB 2AF2A 3DO3A 1LK3L 4O02B 2DOCA 2XY1A 5C0CB 2BNRD 2BIPA 5CZXD 2C7FA 2IGTA 3GSVB 4WFGE 3FSVA 4WUUE 2VO5A 1FN4B 1XH0A 1T66D 3HUJF 3FFCD 3GJFA 1O7DE 1CLYH 3FFDA 3UPAA 2YPVH 3WTXA 1PDKB 4QXTB 4EF3A 3O3BB 4HXBL 3VRLF 2APFA 3QEHB 4G8GB 5DEFA 1OSYA 1QD0A 4KV5E 2B08A 5BS0D 3FULA 3FU8A 3L8QA 3HZVB 1J12A 4FA7B 1TZGL 4NQTA 2BDNL 1S7RA 1Y1DA 4PRHA 3D3VE 4IK6A 5C08B 4HJUA 3QIUB 4L8BA 3C8DA 4FL4B 4YVUA 2HTLD 5IQOA 2Q6WB 5LNDA 2EIKB 4JW3A 4NC1C 4HJSA 3VXPA 2CIIB 4BZ2A 3FT1A 7FABL 5LN4A 1BLNA 2P7TB 5DQJA 5T5FH 5F89A 2FL5B 3VJ6A 1T2QH 3M7OA 4G7YL 5EU6A 4Z3EA 4M7LH 5T1KA 3DX0A 2OW6A 1T7ZA 4W9ZA 1OSZA 4ODXB 1K8IB 1B0WA 2EC8A 3FB6B 2F7RA 5K59E 5EZJB 3QULA 2VXQL 2V5RA 3NJLA 5JW5B 5ACZB 1CYWA 2ARJA 4OFDA 1TEYA 2FX7L 1DVYA 5IEKB 4FZEL 3U0WL 3N50A 4IK7A 5KVFE 1U8OA 4X99B 1KXTB 4PJ9B 4NQCD 1TKWB 2WIIB 4O5LH 4ZOCA 4FQLL 5GRWA 4WSJA 4G80B 4HS6A 4JG9A 5HVHB 1NKOA 4HJJH 1XEUA 4V1DD 5DJ6A 4HJJL 1T7WA 4RWYL 3O11B 1CFNA 5E2WL 3WY3A 5KSUB 1UKTA 3U4KA 2BSSA 4U6YA 1N0LB 5EC2A 1L9TA 1S5HA 3PQYE 1RHHB 3VACA 5FECA 1TU2B 1YNKL 2NSQA 1FFOA 3PAUA 4JJHA 5JXEC 3FTSA 3RVWD 1P6WA 1NCGA 3CVDA 4I48A 2AW2A 1QQDA 2HFFA 4PY7A 5IM7B 4TSAL 4DETA 3QNZB 4PGCB 4FHBD 3VU1A 4HFUH 3IRCA 4MJ2A 2YAEA 3I6GB 2HWZH 2MOVA 3SIKA 4IU2A 5L9DL 2BS71 5T3XL 2DWSA 3INUL 3MNVA 1E6JH 1NFDB 1YJDH 1SDYA 3RL2B 2XQ0A 3FSZA 1NBYB 4WI4A 4MNHB 2AV7B 2HLAB 4WWID 1ZHNA 4HHWA 1WT5C 5I73C 4MMZC 3TJEH 5I9QC 1MUJB 5C1MB 3IJYB 3D87B 4FADA 4GRWB 4N0CC 3MLUL 7PAZA 2QQNH 4DP9X 4FOMA 4XNZB 4AZUA 1NBVH 2Y7NA 2F7IA 2OCFD 4D9QD 5EEUA 4UBDC 4ISVB 1DLHB 4P5MA 1U8MB 2DJUA 1HH6B 3ARBB 3ILPA 1KN4L 1SYVB 4S10A 5E00A 3WLWD 4D8PB 1I8LA 2FDBP 1HJCA 3GMNA 4G9FD 2E9BA 3DK2A 5DD1L 5K9JH 2X4RA 5I1CH 4C4UA 1PZAA 2L3BA 2B59A 5CGYC 2EE3A 3ILPB 4NSKA 1IFRA 3I9GH 4HH9B 2GIYA 5F0MB 1N4XH 2OXGB 5D1XD 2H32B 1J10A 3IFPA 4I18A 1DBAL 5KYWB 4WLCA 1FAIH 2O72A 5E5MB 1N6QL 1FO0A 3BVNA 3S9DB 4MQTB 3EGXB 4YN3A 2DYPD 1KT2B 2EKJA 2DQJL 4TSBL 4MQ7B 4BELD 1BAGA 1U8CA 2GITB 1MCQA 3FO0L 5DK0A 5CCKL 4BUQA 2GSIA 2AK4B 4G1MA 4HX1B 4N0FB 4Z9KB 3TBYA 4CN1A 1BBDH 1S7TB 5F3BB 1JCVA 4PJBA 2H6PB 2GI0A 3BHBA 2VABA 4YHZH 4MMXC 4ZS6C 4HLJA 3ZDYF 4NZDA 4TM9A 3EDEA 4HT1H 4L3CB 3ZE2B 3WS6A 1ZA6B 2Q1EA 4PJEF 4MDRA 5D1XC 4J6RL 3L3HA 3WKYA 3JT2A 2FSEA 1F3JB 3OKKA 2VXVL 3N55A 2CKBB 4GI8A 4U3XA 2XYBA 4MA8L 1U8PB 3LHPL 3I84A 4GAJH 3CGTA 2FIRT 2Z31C 3B3BA 3D39A 4CVUA 4QF1B 4X5RA 1UJTA 2FYVA 2JKIS 4KUZL 3VXSB 3U4EB 1HI6A 2XVGA 2GUOA 2FT6A 4YEFA 1RUQL 3I6LE 4RFOH 1MJ8L 3W39B 1UGNA 2IADA 5IB1A 5TGBA 4AGPA 1IRAY 4KDVA 2IH1B 2YXVA 3WEXA 3WMSA 2J8UA 1GHFH 4Z7VE 2WYHA 3L3KA 4ODHL 5EIQA 3U4BH 1JDAA 2ZOLA 4OF5A 4L37B 1QSEB 1LO4H 3SE3A 2OZNA 2FLRT 1S7SA 4UAOC 4JNXA 4KI5C 3U82B 4D0DB 2IBGA 2UZXB 4RA3A 1C16A 4Y5VB 3OBAA 5J6GB 3ARXA 1P7HL 2UUDH 4F33B 4MA1C 2VC2H 3MBEA 4XMZA 1VRSA 1M7UA 1WTGT 5I74B 1RK1B 3RWJB 4MCZA 4YDIL 3WNNA 3SDYH 3QH3B 2YK1H 3V0DA 1X4YA 1VKXA 1JZ6A 1UXLA 3OQ3B 3KPSD 3D34A 3EJCA 4A7VA 4N8CH 1TO4A 3P4NB 4CAGA 1Z5LB 3NIDE 5IBTL 1F86A 2P8MA 4WDIB 4XB7A 4XMWA 5F9OH 4TPRL 3OAUL 5IOPA 3TEYA 1CGTA 4LASL 2X12A 2VYRE 1CD1A 5I6XB 2VB5A 3P69A 5JXED 2AV1B 5FV2A 2X4TA 3O9WD 5AWNL 3U9WA 1AI1H 2CLZA 3HOGA 4LOUD 3ETBF 3HI5L 3V6ZA 2AV1A 3W9EA 1CD1B 1R33A 3BPNC 4QCIB 1DL7H 1S3KL 2P52A 2KDGA 4KK8D 1PKQE 4L4TE 4A6YL 5EN2A 5IW3A 3RY6A 3BLPX 2EILB 4GP4B 3GMQB 5C0ND 2IGFL 1KXQE 3SGEI 5DQDH 2NQCA 1TQUA 1MFBH 3GXNA 2VGLM 5CZVL 1RIHL 1XTMA 3P4MB 2BS9A 1A7QL 3GPSA 1HHIB 2WNGA 5BRQA 3HNVL 2VRAA 3GUTB 4XCCL 4BFBD 5AW7B 3WAKA 3MREB 4RGMC 5CR1A 4P59L 5F6IC 1HL5A 2CHZA 1G43A 4E9XA 3TH2T 3JYBA 4MHHG 1YEEH 2OMYA 3EOAB 3SE6A 5AFAA 2BNQB 2LU3A 3QPXH 4QRRD 2J7LA 3KR3H 3MV11 3MRRA 5DRXA 5I1GL 2WHVA 5D9SA 1E27A 1TLKA 2J1WA 4OZHB 4Q2ZA 5HYJA 2HVBA 4QAMB 1B0GA 3VGAC 3SGEH 1MCOH 3CPLB 3AABA 5DJZB 3WY4A 1YUHB 2W9EL 5AVTB 4ACPA 3HVDA 2CR6A 1WZMA 2C9AA 2PUQT 2VSMB 3HHRB 4R7NA 1WWAX 1GKEA 1VFOA 3N43F 4U49A 3VGAB 4DO6A 1KXHA 3V7AE 5D72H 2L7UA 3VXSA 5JHDE 1HHGA 4NKQB 4LQFH 4QRFA 4Z7QF 3CSGA 4AZ8A 4TOYL 1H6TA 4OI9A 4F3FB 3LH8A 1OVZA