2XBTA

Structure of a scaffoldin carbohydrate-binding module family 3b from the cellulosome of bacteroides cellulosolvens: structural diversity and implications for carbohydrate binding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
PVQVNSDLKLLFSNNGAAASSNQIYMNMKLQNTGSSTYDLSKITIRYFYTSDDDKALTYYSDYVSIGSASATFNNLSPVHAKANKYIEIKLASGTLGAAGAQWPSQSEVTIQGRVAKADWTNVDQSNDYSYPGSMSQFGENKLVAVYYNGALVYGTPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords CELLULOSOMAL SCAFFOLDIN
publication title Scaffoldin-Borne Family 3B Carbohydrate-Binding Module from the Cellulosome of Bacteroides Cellulosolvens: Structural Diversity and Significance of Calcium for Carbohydrate Binding
pubmed doi rcsb
source organism Bacteroides cellulosolvens
total genus 35
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2010-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 2xbtA00
1G87A 4TF4A 4B9PA 3ZQWA 1G43A 3ZU8A 3TF4A 2YLKA 2XFGB 2L8AA 1GA2A 4B9FA 2WO4A 3ZUCA 1JS4A 2XBTA 4B96A 1K72A 4B97A 2WOBA 1TF4A 2WNXA 4C8XA 1NBCA 4B9CA 3ZQXA 1KFGA 4JO5A
chains in the Genus database with same CATH superfamily
3MRJA 4PRBB 5I23A 3UCQA 2QKIB 2GTZA 2HT4C 2YPLE 3PWJA 1XH2A 1AP2A 5EO9A 5HJDA 1MCHA 1NCCL 1NLBL 2CGRL 5D70H 5F0JB 5I1DA 4JHVA 2ZTBA 5AWNL 4KZCA 5DTFA 3S6CA 3LS5H 4NP9A 4OJYA 1LO3H 3FO9B 4RGOH 4P2QE 4APQB 4M5YH 4OSUH 3MU3A 3IN2A 4HLZH 3V0VB 2A6JB 4LHUD 1QZNA 3ZHFA 4WTWA 3UAAA 2NNFA 3VDBA 4ZXBB 1GL4B 1NGXB 1VADA 2AK1H 4UT9L 3DGGB 5DZNA 3TIEB 4K94C 3N1PC 1JPST 2V7HA 4J1UB 3GSVA 3CSYA 4UT6H 5T1KB 3ZY7A 3NZUA 3LD8C 1WITA 3CVIL 2FJUB 3T2NL 1EQWA 1UCTA 4ERSH 4JQXC 1L6XA 1IQDB 4TNWK 3DX3A 3L7FA 4ZW6A 1EH9A 1UATA 1SYSA 5E6IB 1R3HA 4A04A 1ID5I 2FBRA 4FULA 3VW3H 4Z5RA 3ULUC 4XTRD 1CG9B 4N2MA 5LG1A 4JRLA 3KYOB 1GVIA 3MLTA 5CEYA 5IJVA 1XXFC 4XPBL 5EB9A 3ZDXF 5EIIG 4PBXA 5CMAA 2FWUA 1Q4NX 1M56B 5F7DA 4CMHC 3Q8AA 3ZZQA 1CD0A 4JEGB 1JIBA 4PWKA 3G04A 1YRKA 3A22A 3BPOB 1AHWB 3ZZLA 1U9KA 3T65B 5MEPA 1O5PA 4BWWA 2XG5A 3CJJA 4Z18A 3O6LH 1BIIA 4R7NA 2X6BA 5PCYA 5CBEB 1NWOA 1OQOA 5DMYA 1YYMH 4IJTA 1WWWX 3RG1C 3P4LA 4E9LA 1KEGH 2D0GA 2NSMA 3FO1B 4J3OD 2F58H 3BAEL 4ZFOA 4HQQH 2HWZH 1KXQE 1MCJA 5LO7A 1RZIA 2EXWC 4CSPA 2AEQL 1H6FA 3NJHA 3NBNA 2B14A 3K6SB 4XZ4A 4JHBA 5FCSH 2CIIB 2GABA 3S4SA 4NOFA 2DS4A 5AB1A 5IEKB 3ARDA 4M6OL 4HU8A 2BOBB 4I3GA 2WUBH 3IRCA 3MKKA 5F3HA 1FYHB 4PJHB 2WLLB 3G5ZA 5DWUH 3BVWA 3BAKA 3MRHA 1S9WB 3T2OA 1I4FA 2NTSP 4J6RL 3VFTB 5KN5B 2JF1A 1B0GA 1P5UA 2X40A 3P4NB 3VACA 1XIWA 3R8BB 4I48B 3WIHH 2ENYA 4FFWD 4LKCB 3S36X 4ODSL 3RVTD 1H8LA 3H9ZA 1QFHA 2HFFA 1EEZB 2LVEA 4J8RA 5AZEL 5CN1A 1OF2B 4FTVE 5JHLL 4KXDA 1T22B 3OJVC 4IRZH 1XSKA 3IXAA 4I0PA 3TO2B 3NAAL 3SOBH 1FHNA 3LRMA 5ACZA 5I8KH 5EORL 1RHHB 4R8WL 5BO0D 1P7HL 1EJOH 1AY1L 1M3IA 1O9ZA 3DOSA 1ITBB 2JTYA 4PJ5E 1CFTB 3RI5F 4IRSB 4UQIM 4A7QA 1IBZA 1UM4H 3N44B 3CVHA 3CX2A 3FT9A 3S2AA 2ID5A 2IDTA 1DBBL 1UKSA 3OKOA 3ZZSA 3GEFA 3ZQXA 4OIAA 2XVBA 1HXKA 1SZNA 3CN4A 2HVJB 2IALA 5C1MB 3LZFL 3Q1EA 4NB7A 5E2TL 4I87A 4QRTA 4B9PA 5AFAA 2N1TE 3P3TA 1EHXA 2ICEB 2K1MA 4H8PA 4FLQA 1U33A 2KZKA 1OSZA 4L3CB 2G2PA 1THAA 1NAMA 1Z9OA 3O4LE 4QNPF 1XTMA 2DI8A 5FYKU 3AXLB 2VC2H 3GMPA 2WLIB 5DGRA 4KXAA 1ZGLB 1LM8V 4IS6A 3LS4H 4P5TC 1KOAA 1ZT7B 4HPOH 4MJIA 4X8JB 5KOMC 5B8CA 3BT2H 3HMXL 5KVDE 1CFVL 1TZHB 4PJGE 1GR7A 4G1EA 4LZKA 3L4TA 5DHYA 4KU1A 2FO4A 4PJ8D 4ZFFB 3FOLA 2NYYD 3U83A 3FUJA 4I3RH 2ZJSL 3GBDA 4KQ3L 4S1DD 2XRAH 2XTSA 3O2WL 2N4IA 2DQUH 4J39A 5SV4A 2Z9TA 2RIKA 5T3ZH 1ND0A 5H2BA 2VLME 3CZKA 1FPTL 4PJXB 1OP3K 4Q9CA 3NN8B 1N10A 4I5BA 4MCZB 4M48H 5IROA 1ZE3H 1QASA 4OGAD 2IH1B 1F4WH 3NIFB 3IJYA 5INDA 3KPQB 4YSRA 3BZ4A 3FT3B 2J6EH 3CHXA 5EU6A 3MBEC 1A65A 4OZHE 5CEZD 1NC4B 3DARA 5DC0A 1JZJA 3UTOA 1G4RA 2K7PA 2TRYA 5D1ZA 1CUOA 4D2NA 5EUKA 3OAYH 5BV7C 4D9QD 1PGRB 3IFLL 3IMTA 3VSUA 4ONGH 3V8CA 3D3VD 2I26N 3V10A 5CP3A 4DT2A 3BRFA 1FN4A 5T33H 2AF2A 4YHNA 3LHAA 3ILPA 3K4AA 4HT1H 2IOIA 4N2DA 5DJZA 4LF3B 1W0WB 4X50A 2IQ9L 3WFHB 3L4VA 4I0PC 4V11A 3AY4A 3BLKA 1NDMA 3ARBC 4PGJA 5H37H 3LQZB 1KPVA 4OLYL 3QEUB 4X6CF 1A7RL 5DC4B 2A77H 2EKJA 2JKTM 2JQZA 2K0RA 2XWEA 4KFZC 3T0VA 4NGHL 1YA5A 1QNIA 1UOKA 5EBMB 1N8ZB 1RZKL 4G7YL 3UC0L 4D94A 2E6JA 1CC3A 5DS8B 2C9RA 2YGQA 2P7TB 4CILA 3QE5A 4OIBA 1X7TA 4AENA 2O5ZH 3JYCA 4HJUA 5DMGD 3T4AB 3B2PA 4NLAA 2OX5A 2QV4A 4JRXA 3G5XA 5J3HD 1LNUB 2PCFB 4WTQA 3SY6A 3NGBC 3MUGB 3NFPA 3ABZA 4NSKB 5EC2B 3MYZA 3ECUA 5I8EB 2DM4A 2FEJA 3BW9A 4ZQKA 5B3SB 1KC5H 3ZTCC 2PW2B 4HEPA 4N1EA 3IJHA 1WVZA 2YMTA 3K7UA 3ZMNA 3ZPDA 4Z7WF 1OB1A 1XGPB 3S3SA 3SDAB 3HRZB 2YSTA 4FXGC 5JHAA 4AH2B 5I75C 4P2AA 2VLKA 3IKCB 4RFOH 4U31A 3H54A 5JHDE 3SYCA 1F90L 3L5HA 4UTAA 4PW9A 3B2VL 2CHWA 2PMZA 5D4HA 3PP4H 3I50H 4U3SB 2NY4B 2ENJA 3DX9A 4H0HB 3GM8A 2DWDA 3TNMB 2VDLH 2QSTA 5A7EA 3VNYA 3FT4B 5IROC 1GYAA 1UXWA 2WCSA 5H94A 4F2MA 5T1DH 5CD5D 2P47B 3E2HC 5IHZA 2C3XA 4GW1A 4ZDHA 1IGFH 2E7BA 1AFVH 5FW8A 2BNRA 4LARH 4OFIA 1P6FA 3A5VA 3D25B 4POYA 2IO5A 4UUJB 4G9FD 3U6RB 2V7NA 2WLZA 3HG1A 4NQUA 1A9EA 5IVXB 5DVKA 2EEXA 3F7VA 2B1OA 5I76A 1G7HB 4F7TA 2G5RA 2QADB 1YEFL 4LCYB 1LVEA 4H20L 3T2QA 4LVOB 2XIDA 4KC3B 1U8KB 1KYOK 2YN3A 4M7KH 3MLWH 4DETA 2AGJH 4EN3A 3R18A 5B1JA 4PS8A 1BYNA 1NGPH 1HHKB 4OF6A 5HI3C 3QDHA 5KVEH 3U0WH 1KCUH 2QQLL 2K4AA 4AL8L 1EV2E 1G5AA 3E6HA 4PS7A 4TUKL 2DBLL 4LL9A 4KV5F 2X4SB 5IBTL 1Z0MA 2OK0L 2NY0D 4M8UA 1RIUH 2GUOB 1S7SA 3V52L 4I18B 2JELL 4IIQA 1XL6A 4PJIA 5LGHL 2D31B 3AY4C 3ELAT 2VLJD 6PAZA 1KCSL 3ARFD 3GSWB 4TLUA 4CW1A 3BN9C 5GRWA 2F53D 3MJ8A 3BIKB 5HVHB 5GRVK 1JFHA 3SDXF 3DJSA 3D87B 5DURB 1R5VB 2P80D 2EH8H 3GXNA 4W9CC 2YJQA 5K39B 4NPKA 3OKKB 3GXDA 2YBGA 1P7QB 2AVGA 5DUBB 4IKJA 4AZ8B 2GJ6E 1E65A 2PWGA 4FABL 2NYKA 2YUXA 4N0FB 1AO7B 4P2CG 1UZ8A 2HPOA 4KPHL 4XNBA 2W5PA 3CCHB 3O6KH 3MYJA 4N86A 4XVOA 1VB9A 2B5IC 4X7DC 5D1QE 2QL1A 4MDRA 3MBXL 3GWJA 4HF5L 5E4OA 4YPGA 5GRXG 5IQOA 3T0XA 1LMIA 4AK2A 2G5BB 2R1XA 1INEH 4H8VA 1BVLA 5H4ZA 2Y7SA 1NEZB 4WWID 1O0VA 2QQKH 2ZOLB 1VCAA 3E3QC 2E4TA 3QORC 4JFVA 2J5WA 4MJ4A 4D3CH 3FFCD 4D0DA 1XCTA 1KIUA 1WAAA 1NQBA 2HJKA 3ZTJG 4RBPH 1H3GA 1LP9A 3H9SE 4FRWA 3ILDA 3KGSA 4XP9H 1RMFH 4P2RD 3G6JF 4MNGB 4LLVA 3OZKA 4LHJB 3VWKD 1AZZC 4AIZA 2Y72A 3NOIA 1KUMA 4MA3B 3IF1B 5DGQA 4YNYB 2EINB 5BS0E 2HZHA 2AXHA 1QNZH 5CZVL 4XNXH 4OI8A 4P0DA 1HDMA 3MLSL 3H9HB 4JJOA 5F70A 4C4BA 1F3JA 2WQUA 1XSOA 1CTMA 1RJLB 4ZUUB 4S1QL 2Q76A 1ZGLP 5AD0B 1X5XA 5EU4A 2IFFH 1IBGH 4KROD 1XGUA 4F9PC 5GGVL 3PP3H 1FYTB 4NJ9H 5B39G 3MBWB 1PLCA 4BCYA 3RGVB 1BBJB 1BSIA 5HHNA 4X5WA 4MVBD 5ICZA 4NQCB 4JFYA 5K59E 4B3EA 1MCCA 4EN3C 4E0RB 1BOGB 4ONHB 4XVUD 5ALCL 4GY4A 4B7IA 5I73B 1EEUA 1IGML 4PH8A 3RWCA 5ESQB 5JOPD 1QZ1A 2IVFC 3JWNH 3DRTB 4W9DC 4DGWC 3JQOB 3QQ9D 3AW5A 5IB3A 2O6FA 4ABVA 1JCKA 1MFEH 2ZE0A 3QH3B 3KYMA 1PLGL 1G7LA 4IIQC 5IESL 4WGKA 2B59B 1Q9KB 4FQLL 1CGSH 2WJ5A 2OPCA 3D39D 3QJVB 4HJTA 4ABQA 3CDGA 5I0XA 4AGLA 3FQWA 3N43F 3PV6B 1JWUB 1S7RB 1UM6H 5TQ2L 1DCLA 5D2NB 1QQDA 1XAKA 4G7SB 7CGTA 5IB2A 2BS8A 4PJDB 3NH7L 4HJGB 4JPWL 2WLJA 1WZKA 4XO3A 4YK4B 5F9JA 2ESVA 1ZS8A 1HHIB 2KZ1B 2QQNH 4B3VA 1KJ2A 3KDMA 2ADGB 2V3DA 4HPHA 3QP3A 2EXWD 2DRUA 3IETA 1D2OA 4MAYA 2RR3A 3TYGH 1ICTA 1GZHA 2AJVH 2BVTA 4MAUL 2FNWA 1W72L 1XZWA 3MLUH 4QHKI 3RL2B 5K9OB 5L4MA 3PY9A 4FI8A 4YHMH 3LMJH 5INCA 2YAPA 3TH3T 3L5XL 4HKBA 1MG2C 4PY7B 5C9KA 3FU9A 5K9JL 3FO2B 3II3A 3LNIA 1J0HA 1ET7A 3BKCL 5D7JC 1HHHB 1MCOL 4TL4A 1ZKAA 5I16A 2MEJB 4UB0H 4OZ4B 1NAKL 2WN3A 4NO2B 4BQCA 3EZJB 1EVTC 5E1QA 3I6KB 3MA7A 4ZUVA 4ODBD 2QGCA 4XNQB 1AKJA 2NSQA 2VJ8A 5JPNA 3FN0L 4KO6A 2JB5L 4OLVL 4OM1H 3FQ1A 3SD5A 4NFDA 4GAJL 4OFPA 1FDLL 3MCKA 5DEZA 1I9IL 4OV5A 3EG9A 4HCRL 2CO3A 4QEGA 4QGYA 4X6BB 4OBSA 1A7QH 3O2DH 1NM4A 3APFA 3N2JA 1ONQA 2ATKA 4GAYA 5H35A 1Z5LB 4ISVA 4OT1H 5C0FB 2VN5A 3RWFA 4M5TA 4LLWA 5SWQA 2PR4L 4E9VA 4JFEE 1ASOA 3HE6A 5M95B 4UTCA 2XKNB 3CN2A 4XPTL 3K6OA 1C5CL 3HW7A 3LKPB 3MV01 2AJXL 4OFKA 2Z93B 4O00A 3OKLA 1MNUL 3CFQA 1A1MB 2P24A 4XI5C 2OP4L 4K94H 2AAVA 2Z4QA 2PYFB 4HWUA 4YDVA 3OPUA 5IQLA 1KTDB 4MD4A 3GINA 2Y25A 1KYAA 4DPAX 4FHJA 4CRPA 2AKRB 4KTYA 3U0TB 4XVJL 1L9RA 5AVVB 1BF8A 4MCYB 4MNQA 4OZFA 2JB6B 1U3YA 4QPEA 4XMZA 3F12B 3ULUH 1SEBA 2IADA 4JHWL 1GS7A 1U8PB 1D7BA 1GAFH 4J3XA 4P5TD 4Z95H 4F33B 1U0QA 1E8YA 1X5ZA 4R2GC 4YDIL 3G6AA 2ZXEB 3B5GA 3NSFA 3RFRA 3VFGH 2QV2A 3QFDA 4MCMA 4QXGL 1BXVA 3GIVB 4DP9X 3RYMA 1W15A 1M2VA 3SPGA 4LVHB 3I6LD 2HP4A 1N5AA 1BQHA 5D8JL 1CZ8L 4U0RB 1FFRA 1K2DB 4ZAKA 3VH8G 1DVQA 4MTMA 4WDIA 1LGVA 2EKSB 5HI5C 3JV5A 1J5DA 2H0FA 4K5OA 2LR4A 3CWGA 3ISYA 5CO1A 4FN0A 1DL7H 2VAAB 4KDVA 2NUTB 5I1HL 3DVNB 2QTVA 1MWOA 2H32A 3ZIYA 4MJHA 1SN0A 4J3BA 1IC1A 2E9GA 5DHVB 4F24A 1T2JA 3NACH 1OIOA 4L3FA 4I88A 3ZTNL 1OP4A 3OAZH 2N59A 1SJEB 3GSRB 4CVZA 2E27H 5AOJA 3ZOAA 4UTBL 2ZKWA 5F21B 4PJGF 2AQPA 3CFEB 1J1OL 2I60H 4J3WA 5D7LD 5A6IA 3B9AA 5E1AA 2AQQA 2BMKA 3APCA 4PMEA 3WV0A 4EI6B 2Y07H 2ICWJ 5J89A 1IGCH 2JKRM 3MAWA 4R26L 2H4EA 3VQMA 1SMDA 3HE6C 3HLAA 5B1AB 3REWB 4OZHF 3A6OA 1B6UA 3D33A 4I1RA 4PRAA 2L0DA 2Y1YA 1HKFA 4OCYL 4HPYL 4JM2C 5I24A 4GI6A 1UWEL 8FABA 1WWCA 3NVQA 4X42A 2W81C 5IOPA 2CBMA 1FUNA 5C0BB 4Z3HA 1YY8B 3MJGX 5L4JA 1CGVA 3SE9H 1U8NA 3LN5B 4KJPD 4CL7A 1YNLH 4J27A 3A6BH 4IGBC 5K93A 4ZD3H 2WQXA 1HH6A 1KBBA 1A1OB 1E30A 3GSQB 3MJWA 3IGAB 4XC1H 5I6XB 4M5ZL 4L4TA 3OGOE 4MFHA 5I5IA 3SJVB 3C60A 2CBPA 2R0ZL 5C3LD 2HMIC 4FNLL 4WSJA 4YXKH 3L4CA 1NSNH 2VL4A 2DWTA 1RZ7L 4OIIH 2WKOA 5HYJE 3L5JA 2J57A 5HHMD 3JYBA 3WFEH 2X4RA 1KLGA 2X2YA 3CE1A 4JFWA 5HHQB 3F7PC 1T5XB 3FMGH 4ORGB 4JM0A 4PUBH 5C0EB 2YWZA 2LABA 4ES8A 1JGVL 2BDNH 3UZQA 3HZYB 3KWWB 3UYRH 2X3BA 3ULVC 5IGXH 4ZAKC 1OZTG 1LXMA 3PNWA 4P2YA 4CGUB 4ZSOE 1X4ZA 1T3FA 2XFXA 3STZB 3BVTA 1I7TB 3QDGB 3DUSB 4O5LH 3H0TA 5E8EB 3QZNA 5DMIL 1AMYA 2FIKA 4AM0B 4KZEH 5KBLA 4JJ5A 1ZY9A 2ISDA 4NT6B 4LRNH 4M1CD 3FJTA 2QSQA 3I3BA 3M17A 5JPMA 2EDKA 3K71A 5TF1L 4LMQI 1GHFH 1EZVX 2YZ1A 3ZK0A 3MRRA 3EOYG 4R96B 2BWDA 4X9IA 3LKOB 4GW5B 5BV7H 2D3NA 4ZX4A 3GSNA 2EABA 3N9GH 3AG2B 2DQCL 3C08L 4JJHA 3L45A 2G75A 2J2ZB 1HINL 1OAYL 3TVMD 2WLMA 3GBNL 3QWOB 2J12B 4V1DB 2YA0A 2HTLD 4Z0XB 1UT1A 3QG6B 1RZQA 2PP8A 3L1FA 1TG8A 4DWHA 3MRFB 3UOAB 5BO1H 3GQFA 4DGIH 4FXKB 3FB5A 3RAJH 4R5XA 5LKNA 2VLRB 3KGTA 1NBCA 3FO0H 1ES0B 3DUUB 1A9BA 1HU8A 3BD4A 1E5UI 4H26A 5BVJA 3MROA 4IOFC 1NCWH 2DQFA 1YEJL 3ZSTA 4NCDA 2F74B 5D1XB 1XR8B 1SEQL 1KB9J 2RD0A 4PJHE 3N06B 2VR8A 4D8OA 4Q97A 2X53A 2C1OB 5LAPA 1PD1A 2DLFH 4AKPA 3HI6L 4W9GC 1VGKA 4QCIB 4Y4FA 4AV4A 5I30H 5JLZB 4GG6B 1CFNA 1MHHB 1P0SE 1HEZA 3MV8A 4UDUA 5A2CA 5C97A 5FUCC 4QOKB 4A2HA 3WXVH 4XBEL 4X9BA 5CLXA 5A6MA 4L1DA 2DQIH 1QSFD 1VERA 1F3RB 3MUZ1 3DX6A 1MPAH 1NAMH 4JY5H 2K6WA 3C60C 1EO5A 2NXZB 2ZX5A 3D0VA 3JUYA 1BVNP 3UCRA 5LDSA 3VQLA 4ALAH 1JXJA 1FL5B 3HZKB 4C4KT 4Q9QL 4HBCH 5DS2A 1WLHA 2JJUA 1JV2B 4JFHE 2R83A 2EDYA 4H2AA 4KRLB 3WAKA 2ATPB 3T0AA 4JQIL 5DLLA 4JO2H 4JMXA 5K1JA 4WJ5B 3D4GA 1GCYA 1JRHL 1FL3B 2WWKT 4S2SB 1ORSA 5KTEH 3QEHB 3TNNB 4WWKB 2WGNB 4Q4IA 2ZKXA 3HZMB 4APXA 2L8AA 1DQDH 3EHBC 3MV7E 4J4PD 1CDUA 1YQ2A 1MI5B 4J28A 4K7PL 5I82A 2MPAL 4ZOAA 5JPMC 2CKBB 5DMKA 1TNNA 2WINA 3MRPA 3QRBA 4RLDA 1SHSA 2R69A 1OANA 2QPUA 1FC2D 1I8IA 3GMMA 3MRQA 2CRYA 1GJIA 5FO2A 3UAEA 2VJ0A 2A9ML 1P4LB 4TNVK 1CICA 3F2LA 1BVZA 2VR4A 5DJAA 1HQ4A 1O6SB 3ESMA 4IHOB 5D9SB 2ZX6A 2RFXB 2QKIA 2VIRB 3O2VL 4LSDA 1WFTA 5CP7B 1V05A 1B4JL 3I02B 4JO8A 1TTCA 4M62H 1D2PA 4OCRL 4QXVA 4PJXE 2FB4L 1ZT1A 4LLQB 3WO4C 4RISL 1RIVH 1AS8A 1M71B 1KPRA 5ITFB 3U9UB 1MCIA 4PWIA 3NIFE 5FEBA 1BZ9A 2C8NA 2YD2A 1YNTA 3FULA 1U8CB 4LNRB 4RMWA 4QWWD 1OSPL 4Y2OB 4U33A 3NIGE 3OSVA 3L3GA 2D73A 1WFUA 3KPRB 4D8PB 3HN3A 4FQJL 3WIIL 2VQ1A 1E9PA 4IW4C 5K59F 5EU7C 4WW2B 3PWNA 4OD1L 1P4UA 4HIIB 2X87A 2JQMA 3X11B 2GI7A 3MNWB 5IB1A 4YHPA 5MP6L 1ESOA 1U6AH 5C71A 4JKWA 4R5VA 2MTAA 4GUQA 4E36A 4POZC 1KBWA 5DZ9A 1NCBH 3Q5OA 1J7VR 3KYOA 4G82A 5CEZL 2FUQA 5JUEH 4PGEB 3S3JA 5D55A 1AQDA 1OGAA 4XZUB 1AGCA 4WIQA 3TJHC 5C0AD 5IEHB 2NR6D 3ILEA 3P77B 5E00B 4JANB 4NQDD 3E1F1 4KVCL 2MMXA 5BRZE 2QDWA 3QQDB 1KELL 3FNKA 2W38A 2W60B 4XCCH 1PNCA 2LLLA 3EH4B 1E6OL 3RPIA 2VDNH 1K4DA 4U2ZA 4JVPA 4YBLC 3KLKA 4F2FA 4JVUA 3PYCA 1UD3A 5ADOL 1JYVA 4O4YL 3QRGH 1I1AC 2RJMA 5EUOB 3EGSB 1T0NB 3BYYA 1T0MA 4PV9B 5LBSH 3S3PA 2UZXA 4H44C 2CJ3A 1R3KA 4IEFA 4PRNB 5IEKA 4KNSA 1LJMA 4IBZA 1JTTA 1IM9A 5EZOL 3WHXB 4RIRB 4YSAA 4YE0A 1T21A 3QEQA 4QHUA 3RP1A 4Q58C 2ZNWA 2WLLA 2YFNA 3BWAA 4FQQB 3CHPA 1S9WA 4H88H 4ZMWA 1OTTC 3H85A 1A2YB 4U6XA 1PY0A 3O6ML 3MRNA 3S37H 2J1YA 4KXZH 4PRIA 1SUJA 1EEZA 1LWHA 4WY7L 2Q8AH 3RTQC 5CEXB 4QRAA 1CE6B 1GIGH 2OMZB 2ZWNA 3P2DA 3L8QA 4P48A 4KUCD 2YC1B 4QXUH 5DYOB 3SQOH 4AE1A 4Y4KC 2XNAA 3P3UA 1MXGA 4FQHB 3D2UA 2Y36L 1SYVB 1RHHA 3MRMB 4HS8H 2NZIA 1XVSA 2AI0H 1XSJA 3Q8EA 3QK0A 4IRSA 4RFEA 3THML 2C1PB 5KS9B 5TE7H 1MFAL 5IVXE 1RUKL 2CDGB 4AVHA 2F15A 3TCLB 1D6EA 1IGIH 4O51B 2VN4A 2OJEB 3L13A 2YN5A 3HG3A 1QR1B 2W9DH 3B3BA 2IBBA 3SKNB 5TFSL 1SJXA 4LAQH 4Z7OB 2UWEB 3BPCB 4GW4A 5AYTA 4J2XA 1NC2D 1IFRA 5DHXB 3AACA 4G6AC 4LLAA 4ADGA 2LU5A 3E6FA 1PAMA 2Y3NA 2CO1A 4XXCA 1NINA 4OCSL 1S7TA 2MWCA 1QRND 5HI5D 2BZCA 4LIQL 4AQ8C 2KPNA 1AZBA 4AEHL 2I24N 3P73B 2P5EB 1JDCA 2OQJA 3DDGA 1NGQL 2JIXB 2WLIA 1MVYA 3NJKA 2X70B 2X42A 2YGOA 1FNSH 2W65A 1OHZA 1X6LA 1HHGB 1NFDB 2AFNA 5HGHA 1XGRA 1H3UA 3SY0A 1YSOA 3MJ7B 4ZMAT 2GIYA 1HJCA 4GXVL 1JFQH 4X6DB 5KANI 1F11B 4PY8J 5E9DD 4KGLA 4JMNA 3P0YL 4ANXA 3SDCA 3IFPA 4LNVA 5JHMA 4XCEB 1IQWL 4XCYA 4M8QA 1D5BB 1CI5A 4MCZA 5HYSB 4B9CA 3UTSA 4ZOBA 5AYQA 1WT5A 1DUYB 5L88H 3VD4A 1GS8A 3DUHA 5E94B 1ACYH 4EUPG 1DBJH 1IEBB 1OGTA 2MOVA 3KM2A 4NUQA 3VFWA 3RUGB 1PKQB 4N85A 2NW3A 2VERN 3TN0B 1OK8A 2RCSH 2RTTA 4AGQA 2VDPB 2YKKA 3QIBB 3RTLA 3UJJL 2IH8A 4JM2D 4MA1B 4S1SH 4DN3L 1Y0LA 2VDQB 2CKBL 1UD8A 4A63A 5C07D 1MRCL 4Y1AA 4GRWH 1I82A 5EOTA 1U8MA 3VQ2C 1NPJA 1MFMA 3VXRA 1R5IB 4MNGE 1KLUB 4L9DA 2DTML 1W0WA 1DJSA 1ODUA 3IDGB 2B4CL 2MCPL 2HKHL 1F1DA 3KYKL 1ZHBB 1TT6A 3GNML 4FFVD 4ZUTB 3UH8A 4AVKA 3PXJA 5FKAB 5E8OA 1QFWL 2HMID 2BNUB 1UEYA 1X5HA 2NZ9C 3B7SA 1L5GB 3CZFA 1ED3B 3VSQA 3C6LC 1FYTE 2A4ZA 5CCGE 1NTDA 4MCNA 4PV8B 2ETWA 5GRUH 1HJBC 5DS8A 4FA6A 5EZLA 4MLSA 5I1JH 1RQ5A 3BE1L 5I5JA 4TQHA 4NJAH 3ZKSD 2CXKA 3KPPA 3HBZA 3EBAA 3ATFA 3QUZA 1GSMA 4MA8L 3KE0A 5CSZA 5FFOA 2HH0H 3LIZH 3L16A 1K8DB 2QGBA 4QO1B 2P28B 1DLHB 2QKSA 4GBXC 4HP5A 3BESR 3HC2A 3RDTA 1KB5A 1WZ1L 5F7EH 1E4XL 2OMXA 2H6PA 5E5MB 4WQOA 4TLSA 1AR1B 3TURA 2C34A 4JO4H 2AABL 2YRZA 2GC7C 3RWIB 4XBGB 4GI9A 2DWEB 1ZEAL 4FQXA 1IAIL 5ETUB 2EVJA 2HLEB 3EW3B 4QTIH 4AH2A 3I9PA 5CGTA 4PLNC 4YSTA 2PUQT 5AENA 5D2NE 4JFQB 4BXSV 1WSST 3TTYA 2HJLB 1BQRA 3TGXA 5GS1A 4PJDE 5DVNA 3D18B 3NFNB 5D96B 1FFQA 1Y1DA 5EIVA 3OMIB 3ZHLA 1HN1A 4GLRH 1GJUA 3TNMA 1FL6B 4KK9C 5JIDA 1AKPA 3VD3A 4X80H 1OCCB 5DEGA 4BKTC 4OD3H 1GCFA 4FYRA 2HKAA 3FU6A 4X6CA 1AHMA 2IEPA 2ROYA 2CK2A 3E8UH 4O2FB 5EWIH 4N5UA 4PJ9D 1U91B 5F7MC 5I6PA 1Q38A 3C5JB 1CLZL 1UHVA 2AJYL 1PZ5B 1KN2H 4LCYA 3NRPA 2ZOOA 1YEKL 1U8KA 4NPYB 1TQBB 4C4UA 3BJ91 3BZFA 1TVDA 1QOKA 4ETQA 2KLRA 4YXLH 2MHAA 4AZUA 5JMOC 2F08A 2Z31C 2WXPA 3VXUB 4NZUL 4G8GB 1U8IB 3O6FD 5A3ID 4M1DL 3SIKA 1OAKH 4PLKD 1SDYA 3B4NA 1IFGA 1G6RB 3NDYE 4LQFL 1KY7A 2ZQKA 2MH4A 1U3HA 1XB3A 4I18A 5MEOA 1ZVSB 4KKZA 1RZGA 2WIMA 4JG5A 5E2WL 5C6TL 2D31A 4Y5XA 5C08A 1AE6H 2IWFA 4WUUA 3O81A 4IK6A 5F7UA 3GSWA 3WFCL 4FXLA 4R7XA 2FVNA 3PIQA 2V5RA 1LO4L 2CO7A 2EH7L 2VR5A 1KN4L 2W0PA 3QG7H 1R3IL 3GMOB 2FUTA 1IAOB 3MA9L 4LBEB 1ZHNA 1SJHA 2A1WH 3S3BB 2O5YL 1FJ1A 3SB3A 1P7QA 4B9GA 4DP4X 5DUBA 4MAZA 1LLAA 3BKYL 2EUZA 1AO7A 1S3KL 4AXWB 4ZFZB 1XF5B 5TTRA 1AI1L 5IQ7L 5KSAB 4PJHF 2P5WD 3QUZC 4QUOA 4X4YA 5K1VA 3RZCA 2R0KH 2W88A 2X0UA 4MMZB 1TCRB 1U95B 4I4WB 2OLDA 4JZJA 4LLYB 4M7JH 5DQJB 4EI5B 1JZ8A 5B38G 2RALA 3PFUA 1LEGA 2O26U 5LGYA 1NEZA 3AZUA 3GS4A 1KG0A 4M7ZC 3TIDB 4BHUI 2D7TL 3L1OH 1QEWB 1LO5A 5CSGA 4HIEB 3PP3K 4MNHB 3V7AG 4FQXC 4FZEL 4LU5L 4JRYD 4N4YB 2M8XA 4X98A 1VKXB 3RL1A 3WKML 1JBJA 2Y69B 2ORBL 2YQBA 1NGZA 3FUNA 3QUXD 3FTWA 4DP8X 5IR1B 4YHYC 1KXVA 1K4CB 2MNUA 1QWHA 3GC3A 4F80A 3CX5J 1AGEA 3QS2A 5GGVY 5ECJE 4WFED 3ASNB 4F7PA 4J8QA 1ZLSL 3TZVA 1M6OB 2CCWA 4K9JA 1E4XI 5ENWB 1RJLA 1U8OA 5EEVA 1SY6A 1AR2A 4F7CA 4JGMA 4PG9A 1CGUA 5BZWB 5SWSB 2XN9D 2EYTA 2WZPD 2H26A 3RGVA 1BBJA 1Q9WB 3N40P 1O6VA 2XZAL 3L5WA 1A5FL 2AV1A 4NQCA 2A6KA 4L4VB 5D7EA 3W2DL 5I5RA 4L3EB 5E4EC 4MMXA 4YO0A 5IQMA 5CINH 2HX7A 2HJFA 2XETA 5ESQA 3OB0H 3DRTA 1KCWA 3RA7L 3IM1A 3VGDA 4BGDA 2BHUA 5AVRB 5AOLA 2BNQD 4PG2C 1H5BB 4R83A 3QBTB 4EVNA 3C5ZB 3FB7B 1G4MA 4Y5XC 1HCYA 4TQ8A 1FO0B 3V0JA 1BAFH 2YAEA 3QHFL 3CFBB 4BFFA 3SPCA 5ANMB 1KY6A 5HPMA 1SMOA 1I8LA 3A4AA 4PJXF 3ZN6A 1Q0XL 1MG3C 3TJHD 5DJ2A 4JCWA 2VAJA 1CYXA 2X6CA 4E5XB 4S11A 1Z9SB 5I1LA 3F01A 3NIFF 3AS0A 1BGXH 3PHQB 4P5MA 2A74B 5BPPA 1QACA 4FQPA 4JFFB 1NCGA 5GZNA 3L6FB 1FZOB 3ORJA 3MC0A 3ROOB 1CTNA 2PPEA 3BC9A 3NIGF 4ACPA 1P7KB 4LSQH 4AYFA 4ZYKA 2Y6SC 1L7IL 1HE7A 3OLDA 2JKWA 3OVUB 2XTJE 4P4KB 4YLCA 4QTFA 5DVPA 3VCLB 3GPEA 3ARGA 3GFUA 3GM0A 1N2RA 1I1AD 2DB8A 3DMMC 4N8PA 4KZDH 2PR9A 2WLHA 1DSFH 4Y16C 4CDGC 4K3DL 1I9JH 3T0EB 2EYRA 3NIDE 1S5IL 4QHLA 1MSPA 1NL0H 4K73A 4KKCD 1ZRUA 1EMTH 1XD0A 5CEZE 3ZHDA 2IOOA 2JKNA 3EF4A 4Y5VA 3EJYC 2C4XA 3RL2A 3T4YA 4HIQA 2BVYA 4UMGA 3S35L 4K7FA 3UC2A 1AZVA 3E9UA 3X3FH 1AZNA 3FO2A 3SJVE 4D9QE 4LOFA 1BFVH 1OTTD 1G7MB 4K5LA 5HGAB 1TQSA 5E99L 2LOEA 3VXQA 2VMEA 2CMRL 3LKNB 2E0PA 4OZ4A 2GK2A 1FVDB 3II2A 3I85A 5EA0H 4TPRH 3REVA 1XCXA 3KPOA 3P9LB 1S78D 4OQ1A 4W9JC 2VZUA 4OTXH 1F13A 4K2UH 2XWBB 4WTZA 4UAOC 4PJCE 4M8VA 3TZVC 4Y4KD 3VXMB 4G6ML 3WFZA 2VZOA 4KJWD 4R4FH 4RCAA 5AQ0A 3S7GA 1GXEA 3B7RL 3HRPA 3VYPA 4JG1H 3QFJD 4P57B 4Z7VB 1XF2B 4FQ2L 3NJIA 4CU6A 1WCBB 1Z5LA 4X9YA 4JKNA 1JGLL 2IC2A 5JW4R 3BXNB 1JPFB 1MJUL 3NQKA 2XKNA 3DX8B 1KBGL 3AS2A 3MFGB 1OO2A 3GHBL 5DA4A 2OTWA 1RY7B 3HVDA 4OVUA 3LAFA 3QUYB 4CN1A 4KITB 3M8OH 2E3VA 2VGLM 3LTVA 4CUCA 1A1MA 4BFKA 4G6AD 5DMJB 4A2GA 4HVBA 1Q9OB 4B60A 2SODB 5FUOL 5FF6A 2H41A 2RQ8A 2PYFA 3LQAC 1M7DA 1KTDA 4IBSA 1HCVA 3SD2A 2DQTH 3T6ZA 2AKRA 1C1EL 5F3FA 3JV0A 4DGVH 1OTUD 2DMHA 4IRJB 1QTYT 1PZDA 2OJ1A 1I8LC 1BEYL 5F88B 2PN5A 1SPDA 3ATBA 1U8PA 1TQUA 1U58B 4OGXL 5FGSA 4PLOB 3GIZL 4N6RB 1QLEL 2R59A 2XU9A 4F33A 4LB8A 3MTRA 1J8HD 5AOMA 4DQAA 2RH0A 2ZP9A 1WGVA 5J1TC 4U3HA 1ML0A 1N3NB 2YD6A 3QC5X 3GDBA 1AQKH 5EU3B 4W81A 4CNIB 4D0CB 3V5HA 4AX3A 4MQTB 2CJUL 2V5SA 4KUZH 2ZWLT 1NJ9A 1V3KA 3H42L 5EPMA 5IMKB 25C8H 2WXJA 3HNSH 4LIQE 4R7DB 2BIIA 4YIQB 2JLPA 4GG6E 5E0FA 1CF8H 2H0JA 4QRRB 1RJCA 3BP6B 1AOZA 1AIFB 5IBUB 2VT0A 1X9LA 3S2CA 3TBYA 3GI9H 4GMTH 1D5RA 1X7SA 3LN9A 1LO0L 4WUKH 2ENQA 2X3AA 2WBJD 3IK2A 5L2KA 3CPLA 3MODL 1CI3M 2DYPB 2XVKA 1KACB 4UZGA 5LCVA 3GSRA 1ZLVK 3WDHA 3MRIB 2X44D 2EDDA 3QO0B 5I1IL 1KLFB 4UILH 3WEXB 1UACH 2KMWA 3APMA 3LRSB 5HVGB 4DOHE 4YZWA 1KJVB 1DVFD 2F8VA 2PO6C 1TVHB 4YDLC 2BIQA 2WQWA 2VLJE 2AEPL 1U42A 2FLMA 4I8DA 4XNYH 1UJ3B 2AK4A 1A7NH 4EI6A 4A67A 3WEOA 3R06B 5G5DB 4XWGL 1YPZB 1FAKT 4NHUA 4PGDB 3REWA 2XPGA 1YQVH 3T0BA 1DJGA 4KMTL 3C6LD 1FAIH 5J13B 3GGWB 4L37B 3QYCA 1TQWA 3FTSA 3U79A 1Q9LB 1YMMA 4KTEL 4R84A 5GS2H 1DVYA 1ETZB 3VU2A 3VFRB 4DEPB 2YPVA 3IXTA 3ELQA 3T6XA 2Q86A 4KRPC 4DNLA 1L6ZA 2NQDA 3OPZH 1DFBL 4Z7QB 1Q94A 1UCBH 2F61A 1P4BL 1L9QA 2HVKA 2AQ2A 2CDEA 2VE6A 4GKNA 1IGYB 2UZIL 3LN5A 4L29B 2V2XA 4Y4HA 5GS0L 4NCC1 3WLWD 4GBXD 3EFFB 3FFDA 3GMQA 3FQRA 3HC3H 1A1OA 4JGNA 3GSQA 2QPDB 3IGAA 1FNAA 5JIIA 1BWWA 2NY7H 1EBPA 5HDBB 1T5WA 1UTDA 5KYYB 4OCWL 3WN5B 3O3EA 3P3SA 2B39A 3EOTH 5AAMC 2DD8H 3B1TA 1JNLL 4NHCL 2BHZA 4LPWA 3BGMB 4N9GB 1X5AA 1ZT4B 1JXFA 1BX2B 1T5XA 4X0KA 4KY1H 5C0EA 2VR6A 3OB8A 5EFIB 2ODIA 3QR2A 3ZL2A 3GJFA 5GSRA 2CZNA 3ZXAC 2WZAA 1K5NA 5EO1A 1OAQH 2BY2A 2D8KA 2NNXA 3O3AB 2NY1C 1N0LA 3KLQA 4P23A 1TTGA 2J21A 2BX5A 1R9FA 2IDUA 3FT2A 1OPGL 3KVPA 1UKQA 2Q5BA 3ZZ1A 3IJSA 1QKZL 4HD9A 4YHLL 1LDSA 3PQYB 3MLXL 3M46A 1EJFA 2EIZB 2NQCA 3CU1A 5KBMA 4A6YL 5AOZA 3VFPA 5BUAA 4X7TA 4NKMB 3HNTL 5EH1A 1S9KC 4BZ2H 4UIMA 1NBVH 3IPFA 2ADFH 2PXYB 2IPUG 4FQ1H 4M56A 1D5MB 5HHOB 3NCEB 3CFNA 4JB9L 1XDTT 1MFDL 5DD0L 3Q1SL 3V9FA 1IM3D 3CZJA 1LK2A 4W68A 4S0HA 3DOHA 3C6SB 3SO3B 2IXQA 4FOMA 2J8UB 3P40A 3RWGB 3W39B 2OMVB 4OQTL 4PJDF 4YEEA 3F58L 2J2ZA 3LZNA 3AU1A 4PJFE 3QWOA 4V1DA 3D39E 3Q8CA 5GGUA 3CDYA 5IF0B 3KWUA 1RJZA 3VXSB 3NJNA 4NM8H 4U6HB 1N6QL 2EYSB 2IAMD 5EUOE 3EGDA 1ZANL 4BKLA 3HAEB 2HUHA 3D85B 4X83A 3QYNA 5LGKA 1TJGL 3QEGH 2KYIA 1ES0A 4R7LA 1PZUB 4LOUD 2F54B 5C3IA 4LSRL 4H25B 5E08L 4MXWH 3KL0A 5BNXD 3C2SA 3D9AL 2H1PL 2VRAA 4OLEA 1JOIA 4GSDH 5MEQB 3TO4B 3BEVB 1JF5A 1Z9MA 3FQUB 3G9VA 7FABH 2IPUK 4M6NH 2WUCH 1BFSA 4BZ1H 4LPTA 3ABLB 1FG2A 5HY9B 2UY7A 3WDJA 4Q9RH 4JVWA 4XRCA 1JZIA 1HXYA 2KL6A 3FT0A 1DLFH 2Q3XA 3PJNA 3OLGA 4N2KA 3X3GH 3K3QA 4KHTL 4Z7UA 3NCJL 1EZLA 4CBPA 1XCQA 4JDVB 1EZUA 3KR3H 4O02B 4MBRA 3V6ZA 1LE5A 3O0LA 1CDBA 4DVRL 5HGGS 1FL5A 3HZKA 1A7OL 2QBWA 1MAMH 2EE9A 2ZG1A 5C0IB 4G3YH 3ETTA 4KBPA 4AC4A 1NDGA 4EDWH 1QPXA 5GGTL 2WMPB 4GKSB 1E42A 5D7HA 1NMBL 5F7WC 3GBML 1DBMH 1FFPB 3R0NA 5TGBA 3DIFB 4W93A 4NQSA 1BD2B 1TYJA 4XB8A 1OLZA 4L0YA 2PPCA 3GI8L 4OFYD 1OCWH 1GZPB 4G6KH 3DURA 2VZ1A 4K7PY 3A67H 3DTXA 3FUHA 4J3OF 4WJ5A 4Z7OE 1EHNA 2UWEE 3OX8A 2L7JA 3BQUC 3P11H 1VRSA 2BH0A 5GGRB 5CNHA 5FFLA 2CG9X 3F8UB 5FUZH 3QEHA 3TNNA 2XWJB 4K8RC 5CR1A 3VVVA 5D6DA 4NPJA 3VFVA 5ERWA 3ZKXC 4TSBH 1J9SA 4B96A 1CWVA 3MUJA 2CUHA 4QRSB 3FONB 1ZLUH 3EGXA 4IQHA 4JFDB 3NPZB 4PRPE 2CO4A 1U8HB 4BK5A 2FK9A 3ERXA 3SODB 1P4LA 3CVBA 1B3IA 4F1SA 4KI5D 1IE5A 1QTPA 1A1NA 2A9CA 4PWHA 5IMLB 1O6SA 3DXAB 3CSFA 4IHOA 3MLYL 4KKPA 2W8CA 1RU9H 3UYPB 1IIIA 4OZGB 2XN0A 2VC2B 4FI7A 1AYRA 4H0GA 4P05A 1SUHA 4Q6IB 2EIMB 5A2FA 2PLTA 1RK0B 1EFXB 2DJSA 5H8DA 3MUUA 4DP1X 1ZWIA 5ITFA 5DZJA 1AGDA 4L5FH 5T5NG 4B41A 4GKZB 1U8CA 3M7FB 1H15B 5E70A 5F0MB 4HA1A 4YAQB 1IEAB 4RGNB 5ICXA 2J88L 4FMKA 4O2EB 4F9LA 2N0KA 1AAJA 4NYLB 5FKPB 4EOWL 1E6JL 1PKQE 1BP3B 2DQDH 5SX5H 3RUGE 1BFOB 3GF8A 3I6LE 4WW2A 3SDDA 3P3RA 4H5SB 4YDJB 1SDDB 4PJEB 2IAND 1M05A 3MNWA 3DMMD 2P8PB 2VXVH 4KAQH 3RBSA 2GJJA 4Y16D 2CGZA 5D71L 1S9XA 4UANA 3QNYA 3VXOA 3V4VB 1NIDA 4MS8D 5KZCD 4OM0H 2X41A 2Z4TA 3BX7C 2J55A 1XHHA 2PTTB 4OUUB 4DJMA 4RWYL 4PP2B 5FV2A 2YUVA 1ZA6A 3C2AH 3HBQA 4E9YA 2Y1ZA 2ADIA 2MNJB 3EJRA 1N6UA 4I77L 4Q2ZA 3NTCL 3OXRA 3F5WA 5MI0C 4GS7C 3QDMD 3IGKA 1IEHA 5HDQH 1WS8A 1XB8A 3HUJE 3R4RA 4ZX5A 3KS0J 4EIZC 2W94A 1KV3A 3ESUF 4ZMNA 1B0RA 3BDYL 1QTSA 3H1ZA 4KK5D 2OI9B 1HESA 2XA8H 5JOEA 2QSCL 1G7PA 2B1HH 4EZKA 4JAMB 3BO8A 4MDIA 4RMQA 3S98A 2BP3A 3FUKA 2R9HD 3NIDF 2ZCLH 3QULB 3MZGB 4GAFB 4JBSA 4CU7A 4ZX3A 4UM9D 1M1XB 3QIWC 4HYTB 2AERT 3AB0B 4FQQA 1U2YA 1ZDQA 2NX5B 3UO1H 5CJ8A 3BD3A 4Z7NE 2FWSA 3FL7A 1A2YA 3MMEB 4AKOA 5FHBH 1AQMA 2ADJA 3UTQA 3ILQD 1XIWD 2OW7A 1S9VA 3Q2CA 1DDTA 2R4SL 1MCWM 5DJDB 1K6QH 1UB5B 3LHPH 2WKGA 5ISZD 3O8XB 1XH0A 2Y7OA 3FSZA 1CE6A 4LP8A 5F2FA 3FU3A 3ZE0B 4F57L 5AB2A 5DYOA 1G84A 4PBVC 1KDIA 1KYUA 5I0ZA 2YXMA 4M3JA 3EDJA 3B34A 3DX2A 4P3DB 4PVLA 2MKLC 4PJCF 3W56A 1M7XA 2M83A 4CMMA 2C4FT 3IDYB 1HL5A 1NFIB 1MDAA 1U8LB 3CDZB 1SBSH 2C1PA 3IJ7A 5EU5B 2YMOA 4UT9A 4FNSA 1J0ZA 4F9LC 5I19L 1PZBA 1J5CA 3TCLA 2OJEA 2VDLB 2VITB 4NQEB 4XMKL 3SDDC 3KPNB 5JTWA 4LEOB 1Z9PA 5FA3B 5B3JE 4OLUL 3RE0A 2BFGA 1KGCD 1AZRA 2F9BT 1WUNT 2MIZA 4I85A 5IQ9A 1K85A 3OKNA 4ZS7L 2P44B 2NY2C 4PBWD 3T0WA 1R3JB 5DI8A 4P4RB 5D1QC 4Y19D 2X7LB 5JORA 5HDRA 1E3FA 4OI9A 1OW0A 3GHPA 4I9WD 4WI3A 5FFGA 5DF0A 2VCOA 5L9DL 4PQXA 2AXFB 3KCWA 3KPSB 3RB5A 3WUWB 1X3DA 2HT3D 3ESNA 1KTCA 4XPGL 2MSPA 1AXTH 3NZHH 1GSKA 4HC1H 1FFTB 1SM3H 4FCAA 4N8CL 2VW4A 1KFAL 3OJ2C 1HHGA 1B2WH 1NFDA 4HJJL 2EAEA 4PREA 5KBDA 2X4OA 5TDNB 3ZU8A 4O02L 4HWZA 4MJID 1Q72H 3KEDA 1CXHA 1A6WL 4X6DA 4WSGA 4ZODA 4MYPA 5IBLC 2VDRB 1S8DB 2WXQA 4XAWH 3UERA 4X9HA 3W1ZA 1FVCB 4GMSL 3HE7A 4XCNA 3SGEH 5BOZG 2YPLD 3AS1A 2PO6D 4XWOD 4XCEA 1EHLH 3EBIA 3S36L 2VL5A 2L7EA 4JZOB 5HYSA 5I71B 4HXBL 5AVWB 1XAUA 4P2QD 2OAAA 3AVEA 12E8L 2WW8A 3ZMRA 1JUFA 4GFXA 1WBXB 2Q0ZX 4HJSA 1JPSH 4NZRH 5ID0B 1SXCA 1IEBA 3HHMA 4XPAH 2DQJL 2OXHB 2A9NH 4JFEA 3BWUF 4RRPM 2WVSA 4C83A 3OF6D 5C0CD 3N1QC 4AK1A 5AKVA 3D07A 3BH4A 4NLHA 5ILTL 3D12B 2KUTA 3P30L 1KZYA 1QSEB 1XSIA 3UAJC 4NWTH 4F58H 3TM6A 5C0NC 4KWUA 3VYOA 4WGWB 3QHZH 3LXCA 3FT1A 1ZHKB 2BSSB 3PGDA 4W9EC 1KLUA 4HK0B 3T8MA 2YPKB 1C5DB 5LWYL 1CT8B 4UT7L 2YXWA 1QSFE 3LEXB 4ICXA 2HLAA 3LQAH 4PRHB 3RX5A 3PWPD 2R0LL 4JRFA 3K2UL 4HFUH 4FL4B 5AL8A 3ZL4H 2CPCA 4DK6A 2CLVA 1RJYB 2P52A 5FKAA 4NC0B 2VC2L 3MNZB 4FJYA 4A2FA 2FTAA 3AM8A 3LS4L 4DZ8A 3W0WB 3BHBA 3F6IA 5KYWB 1ED3A 4CSZA 3OM3B 4HKZA 3DRQB 3U25A 1MHCA 1W0VB 5MENB 1KT2B 3E7JA 3VFSA 3U2IA 3X1BA 5BOPA 1ZK9A 3WU1A 4HS6B 2XHNA 3EXJA 4L4VE 4MHHI 4L3EE 3HCVA 2FD6L 2P8LA 1IFHL 3W5MA 2NY1D 2XFGB 3HJEA 1I7RB 3TX4A 4AGPA 1OW0C 5HBBA 3PWUB 4NS0A 1MRFL 2ZOKA 1LEKA 4P5SA 4XN1A 4PWGA 3VFNB 3GO1L 2FQGA 3NSYA 3OGCA 4NUPA 1E7VA 2BY0A 2IG2H 4Y7MA 2JCCF 4OZFG 1XGTB 4HMCA 1DE4B 2F1BA 4C56A 4ZUSA 5BZDA 1FV1A 1P9MC 4U1IA 2B7DT 1X5JA 4YLQT 1PEZA 3V4VL 4BRJA 5CJ5A 1HFUA 1HWHB 2IGFH 1PW3A 2DMBA 4UNTA 5ANME 4U4IA 4XBGA 5DZVA 3C9NA 1EO8H 3RWIA 4HG4J 3X1EA 1TZOA 4ZFQA 2DM7A 4L1BA 4ZUWB 4MA7L 1DQMH 3D18A 1UH2A 2GSGA 3DSFL 4O58L 4WRLA 1LD9A 1MIEL 2B3RA 4GRLC 1W0YT 4N5EC 4XH2B 1MF2H 4FTVD 2QPFA 1BPVA 1LWRA 1MJ7L 4IU2A 1KGJA 3F7LA 1DBKL 2HT2D 4TNEA 3VG0H 3QIUB 5T5FL 2N3JA 2ZWYA 4E9SA 3GK8H 3D4CA 4J3VA 4NO0A 4TVUA 4O2FA 1QLFA 4XMLH 4WAFA 5EBLB 1MHPH 3DPBA 3T0EE 4PJ5D 4Z78A 1QI4A 2DAVA 1PZ5A 5MERB 3ZDZF 2X4TB 5FR3A 4Y9BA 2XQBH 5LJYH 1E9QA 1OAXL 2Q10A 5GZOA 3DVGB 1J9RA 1TPXB 3PRZA 5DJCA 1FVEA 1INQB 1P4IL 2FR4B 2WV3A 3VXNB 2PYEA 3VXUA 5JYMA 4G8GA 1U8IA 2OMWA 3BUBA 3IFOB 3D7PA 4MX7B 1G6RA 4LEXL 1GRWA 4X7SL 4FAAB 1V7MH 2YGPA 4XE5B 3IU3A 4DESA 5HYEA 3O0RH 4HGKC 3O4LD 1UGKA 2ARJQ 3AT9A 4NP4H 1NEPA 4PJFF 1S7UB 1H19A 3B9KA 2FH6A 1VZIA 4CU8A 1HQRA 5JQ6L 3AM8C 5EUOF 2NTFA 3MV9A 4Z7VE 2GITB 4KK8C 3GB7B 4UQ2B 2YEVB 1T4KA 4IMKA 5HYJA 3SGJA 2BS9A 1AXSB 2W9EL 3LN4A 1I8MA 4LSSL 3RB7A 5J5EA 2VSMB 4GIOA 5T1LD 3VWKB 1GY2A 2IIJA 5C9JA 4ZFZA 4X6FB 3LZRA 5C8JA 4DGYH 1YECH 4XC3L 1FNHA 2VLMD 3PL6D 1UYWL 4BXVA 3ZYOA 3WTSA 5TF0A 3BQUD 2F6AA 4TRPL 4GQ9H 1R0AH 4YR6A 4I4WA 4U1KB 4LKXB 4PWEA 1AFVL 5DXWA 4H0LC 5DQJA 2O5XH 4GSUA 2W91A 1AJ7H 4Y2DA 1HILB 1R19A 1R3LB 1T5KA 2JK5B 1IBBA 2Z3FA 2G9HB 5DDHA 4DKEL 4F8QA 5CLTA 3L95A 2VR3A 3P02A 1BF5A 3BVVA 4MNHA 1N12A 1RSYA 4XMPL 1MVFA 1FLRL 1J9TA 1XV8A 1FZMA 1JN6A 2FLBT 4LASH 4CN6A 4L8SC 5ACMA 1YDPA 4P2OB 3VMPA 3TEWA 5LCVH 3T3PB 3LD8B 3VI4B 1DQJA 2E76C 2NY3C 3GXUB 1D5ZB 3GMNA 1K4CA 3KM1A 3OB0K 4XVSL 1UM5H 5KJRL 3O11B 4L9LA 4L18A 5SWZB 4M3KB 2YEZA 3VFUB 3JTBA 3FFOA 2VDRL 5IIEB 1E28A 4UF7C 3OKYA 1M6OA 5KSBB 5EF1A 3N0PB 4HGMA 3ASOB 1YYLH 1IGJB 2CGYA 3LZLA 1OSEA 2UWEF 3QDJD 4G5ZH 3WLBA 5IHUL 4CMHB 1TTRA 4G83A 5BZWA 1A0QH 3FRPB 5BW7C 4M1GH 5F6HJ 2FQDA 3ISRA 2Y2TA 5HGDB 5DRNB 4IHBA 5HD8C 2BOLA 5E6YA 2CD0A 2GT9B 4M7LL 1JHLL 4JM4H 3EIFA 3MOAH 5E4IA 5CJQL 5GZOC 4HWBL 1VPOH 1XCWA 3GS0A 5EBGA 3O6KL 1CGYA 3A6CL 3HI1A 5LB1A 2YPVH 4HIPA 3PAVA 1QRNE 5DVOA 1PG7X 5HDWA 5EOCH 3WHE1 3C5ZA 2DMKA 4GP4B 3FB7A 3VJ6A 4AMXA 5A40E 4UQEA 1FO0A 4TLTA 5J6SA 5CGYC 1KV7A 1QHQA 3VTTA 2ICES 4Y8AA 3HMWH 3CFBA 1IC7H 1L0YA 3TF4A 3B9KC 1Z5YD 1FFNA 1LQBC 4UYQA 2Q9OA 3QJOA 1IILE 3CG8A 2WTRA 4FE9A 3SE8L 5E1HB 3ARWA 4APQC 1L4IA 3UXFA 3SGJC 4E5XA 5LUMA 2AJSH 1RZKC 1ADQH 5JHDD 2K70A 4GOSA 1OQXA 2OV0A 3QQ4A 5C09D 1T1WB 1GH7A 3BSZH 3N50A 4RAVA 2I07A 3L6FA 4N2LA 1RMFL 4ZXBC 3IYLW 3K6DA 3MRJB 5KVDH 3DDFA 1QUNA 4RGMC 4ZMZA 3PGFH 4TYUA 3QI9A 4P4KA 1P84K 4AIOA 3ZSSA 1AP2B 5EO9B 4IBTA 3RUGF 3VCLA 2MQGA 3TWCH 3GJFH 3WAJA 4URKA 5DTFB 3VNZA 4OFQA 4XNXL 3Q6GH 3R4DA 1S7WA 4K23H 4MAYD 4Z3FA 1FZKB 5E6IC 1T20A 2JJWA 5IWLC 3CFCH 4LEEA 1VADB 3VWJC 4AQ1C 1J0YA 3FH5A 4OF7A 4PJ6A 4F2EA 4GT0A 5IFAL 4K8RH 4N8VA 4DAGH 1FNLA 4OJFH 1IAKA 2OZ4H 3EAKA 2V7HB 1T2QH 1F2QA 3GSVB 4OKDA 1G0XA 4QHPA 4FTDA 2FSEA 1FVDA 4TXVB 2GC4C 5FDYA 4L9LC 5J57B 2GCYA 1YZZA 2H3NA 3QUGA 1V5JA 3L7FB 1LO2H 3HUJF 1SYSB 2GSIA 2CK0H 2QTEA 2WWMC 3H3KA 4U1SA 1N4XL 3HC0A 1AKJD 4GQPH 4XP6H 5D7KD 4Z5RB 5F0LB 4FP8H 3VXMA 2LU3A 5J12C 3MLTB 4DCQA 3QPXH 5CEYB 5IJVB 1DVTA 2EIDA 1G0YR 2BCKA 5CMAB 4PJBF 4TULH 4P57A 1IL1A 1MCFA 3NPSC 3CN0A 1XF2A 4X6EB 5CCKL 4P5TB 4K9EH 1WCBA 4PPTA 4OY9A 5MEPB 4S10A 4CADA 4E41B 2XG5B 3RPBA 2V8LA 3VTAA 4WKZB 5I28A 4R7NB 1BIIB 5GGSY 1TZIB 1WCQA 1BFTA 2GKIA 2FEEL 4JFPB 4OCXH 4UU9A 2ODHA 4AL8C 5HHOE 1QBLL 1W91A 2NUPA 1HAWA 3ZL1A 1UWGH 3SYAA 4Z7NF 5KVGL 1RZIB 4XX5A 1F4YL 1KJ3L 4Z76A 3QUKA 5D1QD 2EDTA 4G6JH 4D0BB 1UXSA 3S4SB 3V4PL 2J8UE 3WJLA 2ZOUA 3ARDB 3JVGC 1BYPA 1NICA 3QJFA 4UIKL 1LE9A 3MBEB 2YFOA 2Q8BH 4B50A 1CE1L 2XUWA 1UOLA 5D7IA 2AQNA 5F3HB 3VFMA 4MZRA 3VXSE 3G5ZB 4QRPD 1BIHA 1I4FB 3HFMH 5BV7B 4MNQD 1B0GB 1P5UB 5FPIA 1NMCC 4N6RA 3RX7A 4OFVA 3DBSA 1MFCL 2VO5A 3H9SD 4IKNA 1NMAH 3C09C 1CFSA 2COVD 3B37A 4U1HA 2D4FA 4XPFL 2X4QA 3GZKA 4Y9GA 5CKGA 5HDLA 2HFFB 4N1HB 4J8RB 3M1OA 1F02I 1W80A 4G1MB 4AE0A 5B4MC 4LSPL 5BS0D 4NKQB 1RVFL 3IXAB 3PDGA 4I0PB 4WO4C 5B3JF 3RFZA 1XEDA 2R56L 5TPWH 5ACZB 2HRHA 3CAFA 1I8AA 3BKMH 4R7DA 4RRPA 3U7WL 2GBTA 1WHOA 3ARBB 4NNYB 3TH4T 3DOSB 1W72A 2R29L 3GYRA 3S34H 5I0WA 4AI7A 3BP6A 1BQLH 1UFUA 3CVHB 1QP1A 1JNNH 3MJ9L 2MNWA 2GTWA 2F18A 5E8DH 3OKOB 4XGZB 1XFPA 3PREA 2IALB 2DYPA 3IRZA 4LPVA 1DVUA 4QRTB 4DW2H 3UAJD 2E9WA 3G6DH 4KX8A 4ZTPL 3SKJL 2NT1A 1XF3B 2WO3B 5IREA 4LVNC 4BE6A 3S5LA 3U1SH 1GZQA 3WEXA 3LRSA 4R90H 3NGBB 4ZMVA 1NAMB 1KJVA 5GHWL 3UDWA 1JCVA 3KBFA 4YQXH 1UB6A 3WD5L 3U0PA 2AJUH 3M88A 1UJ3A 4ENED 1FORH 3GMPB 1DSYA 5IMOA 3D52A 1VIWA 3CHQA 2KC0A 5AUMB 1A6UH 1YPZA 2YMXH 4MWFA 5B8CB 4KVNH 3SPHA 2EE6A 4G1EB 5DHYB 2FO4B 1J9QA 4Y5YA 3AQXA 3VE0A 3FOLB 5DD5L 4N2OA 3U4BH 1WEJH 5EIQA 4AIEA 2BLFA 5E8NB 3O41A 5D6CB 3VFRA 1ND0B 1RURL 3I9GH 4Y2NA 5H2BB 3B5TA 3WSQH 3ZUCA 4N2NA 4JFDE 1ZPLA 4I5BB 5EEUA 3F7RA 3IJYB 4I13B 4L29A 2BSEA 3OR6A 5INDB 1G9ML 5K33A 1R24A 3BZ4B 3WJLC 3CMGA 1OXYA 2EC9T 2I5YH 3DXAE 5EU6B 4NC1E 1EHKB 5FWRA 4KRMB 4FEIA 4A68A 4DKAA 4OZGE 3PDDA 3CFTA 3I6SA 1VFBA 1J1PL 5D1ZB 3TP4A 1WH0A 2HLFC 1HX0A 1PVHA 3MZTA 3BP5A 2ZSVA 4L0ZA 1FN4B 3CUPA 3BGMA 2TSAA 4YHNB 4P06A 2BVOB 3ILPB 1KTLA 3ASWA 2VN7A 2F7RA 5DJZB 4JRWA 4GRLD 4N5ED 3B2UC 5GJTL 4WFEE 3RFZC 3L2MA 3ZLQC 1ET8A 4W4OC 4EAEA 4PJEE 1NDMB 2PCPA 4KO7A 5KYXA 1NCIA 1KPVB 3PQYA 2C9SA 1J1XH 4XO8A 5JA8B 1OAUH 1D6VL 2BP5M 1CD1B 2OL3H 3B56A 5F9OH 2XN9E 1R4XA 3WHE0 1TVBA 2KZBA 4HOMA 5F9WB 4K5MA 4UT6A 4W70A 3SDAC 4WHYG 4AENB 1UA6L 3IMBA 3E0GA 3HRZC 4HUWB 3EJUA 2J4WL 4JRXB 4PSPA 5ICYB 2NY6B 2XICA 2B5IB 3W39A 1I1YA 2OMVA 3FOMA 3MQIA 3BJLA 5EEZA 3ARED 2G0KA 4XCFL 2QVFB 4ZQKB 3N1GC 2BZ7A 4XBPA 4AGMA 4F8OA 1NCCH 1NLBH 2C3GA 2XBZA 4JFZL 3IJHB 5AOKA 1BZEA 5I66A 3QORB 5AWNH 1UOVA 1OB1B 3G5VB 1A4AA 1ZSHA 1UWXK 5F97E 2JJSC 2P49B 2EZ0D 2NMSA 2VLKB 4H25A 4Y5YC 5J9PB 3FB6A 4KNQA 1AANA 2VDNB 3UTTB 4P5KA 2EEDA 2CWRA 4UT9H 2WXIA 3FDWA 4XOAA 1ILUA 5CIPH 4YDMA 3V79C 2QADC 1SLVA 3DX9B 1YEEL 4B7LA 4LVOC 4PUBL 5GGQL 2DWDB 2NX5E 4X99A 1S7XB 1D9KA 4E9WA 1LTXA 1PY4A 4F2MB 4DTGL 4P3WA 4GW1B 4ZDHB 2OXGA 1OE1A 4LGRB 4HLEA 3CVIH 3T2NH 4NDMB 2DDQL 5B1BB 2BNRB 4ZFOL 3BI9X 5TE4L 3HG1B 4KDTC 5KSVA 1D5XA 1JDDA 3F7VB 3ZE0E 5C3TA 1TOXA 1DN0A 4HJ1A 1BQSA 3Q48A 1IBHA 4BCZA 1HIMH 3SOTA 4XMWA 4KO9A 3UYOD 1E40A 4XPBH 4L1TA 5FYLL 3RI5K 3WIHA 3O9WA 4EN3B 4HUCA 2FWLB 1USQA 2XBDA 4ZNCD 3EFDL 4GKSA 1QFWM 1ZLUK 4Z7VF 3E6HB 5FYKL 5GPRA 2IMNA 4WV1A 2WWOA 4IRZA 1BD2A 1QYGL 1S7SB 5IHWA 4IIQB 4NQEE 4OR1A 4Z8FL 3BAEH 3OXSA 2C9QA 5E6UB 1CL7L 1G1KA 3M6DA 1NLDL 3QXDB 4FJZA 5FCUL 2AEQH 3ETBF 3FRUB 5JIHA 2NOYA 1IBYA 5GGRA 4CW1B 4LCUB 3MJ8B 1PIFA 2XWJA 4A39A 5KW9L 4LHUA 5TDOA 2A83A 4M6OH 4Q9BA 3BLBA 4FC3E 3MPCA 1WGOA 2BPBA 2XX1A 1RP8A 3FONA 4HWNA 1UZ8B 3CVHL 2LTQC 3TF7C 4J6RH 2BVEA 2OR9L 3MYJB 3NZ8A 1U30A 3LB6D 3RIAK 4NRXA 1H9DA 3EO0A 3GHEL 3KH3A 35C8L 4L8BB 4GQZA 4R4NC 4W9KC 1IAIM 4O2CA 4ODSH 5KSUA 1CICD 4RVBA 5AVYB 5AZEH 5A16A 3OWRA 4BQ9A 5G4MA 1BVLB 1T0OA 4OLWL 5CGYD 4KUCF 4NCC2 2DQIL 5FDWB 2MQCA 3MI6A 3NAAH 4PS4L 4ZRGA 5DD6A 5FOBA 3PDOB 1R46A 3EDEA 4LCVA 1HI6B 4R8WH 5EORH 4D0DB 1AY1H 4F8NA 1KIUB 3S8GB 4GT7A 4APQD 1LP9B 1WFMA 1OCZB 4KHXL 5D7JB 2XQYA 4N2BA 5F7FA 3MNDA 4O2EA 4LLVB 3QYMA 4AIZB 1DBBH 2WNWA 4NYLA 2BVUA 4ZXBD 2Y1AA 4AMWA 4Y9CA 1EGJA 4YSDA 4LCIL 3MNMA 2ICWA 1BFOA 2P43B 3SYPA 3FZUC 3LZFH 5DJ6A 3D34A 3MX0A 5F9AC 5E2TH 4AWJC 3WG7B 4AYGA 2I9TA 1B4RA 4MJ6A 5DA0B 2YD3A 1QSEE 1EDQA 4BSWA 1HDMB 3L3KA 2IF7A 1KGUA 2J6EA 1YO4A 2DIEA 1F3JB 3AXHA 4JKMA 4NWUL 5T1KD 3F7KA 1VESA 2Q76B 1F18A 5EU4B 4TV3A 4PJ7F 1XGUB 5CJXA 4YUEH 2NZ1A 4QRUA 5E6ID 5EOCJ 5HHNB 4OUUA 4R5TA 1T89A 4G9DA 4UINL 5ICZB 3JUZA 4PRHE 3L9EA 4JFYB 3EKCA 4NKOA 2YUZA 4LPXA 1PZAA 3C8KB 4PR5B 3UG5A 4GP8B 4A7GA 3HMXH 5D2NC 1CFVH 3B5HA 4KNTA 1PEWA 4BFOA 5KWYC 3T6WA 5IB3B 7PCYA 4WV1C 3W0WE 3FYEB 1RUAL 1E4KA 1GGIH 3OHXA 4HEMA 1RPUA 3TPKA 1G7LB 5CR8A 5MENE 2ZJSH 4KQ3H 2QT6A 2OS7A 3O2WH 1DHKA 3FPYA 1QMUA 2DZEA 1FPTH 1UWFA 3CDGB 3QUMA 2CUIA 2ATAA 4CA4A 2XG4A 4F7EA 3NSCA 1LILA 4JAMA 1BW8A 1NEZG 3SN6N 1QQDB 1K5WA 1JD9A 4M9PA 4YC2B 5IB2B 4WZ9A 2A2QT 2MFNA 1NCOA 4R2GB 1GTFA 1RP9A 3GXIA 4JPVL 1ZD6A 2C7UA 4Z0BH 4F7KA 1P6AB 5F9JB 2ESVB 2JWYA 2CHXA 1ZS8B 4I2XA 2O5NA 4JFXA 3IFLH 3QPQC 2ARWA 3KXFE 3QZMA 5GQBA 4C8XA 3AQZA 1G7IB 2KLSA 3GXPA 2J3SA 4N3UA 1ZLDA 3IETB 3HTLX 3VM5A 1ZSDB 3ZMEA 5JW3L 3CZLA 4FFZA 4XB3A 4JR9L 4XTRC 1C7TA 2IQ9H 1ECZA 4CKVX 2Y7QA 2XWTB 5INCB 2IWEA 2B15A 3PABA 4HKBB 2FBJL 3Q6FA 2B9AA 2AJ3B 1M2OA 3VB9A 3P4OA 2ZZUT 5CFAA 4WKXA 3WCYA 1YJDL 3CMOL 3WMQA 5JHBA 1NFIA 2VSKB 4OLYH 5ADPL 1UGNA 3TT1L 4UV7L 1A7RH 1ZPUA 4NN7B 2BVQA 3JV6A 4IRSD 3V7AE 3OG4B 4PJ8A 2VJXA 4L1LA 4NGHH 3V0WL 3L3DB 2B1AL 3MA7B 4ZUVB 4TVPD 5E9DB 5KVGE 1RZKH 3UC0H 4G7YH 5JPNB 4M6ML 5B4MD 2EDBA 3K8MA 4J3OC 4M9OA 3ZGIA 4TNVF 2X9WA 3DK0A 4UTAL 4D9RD 1NCAH 4K3JH 3MCKB 3H56A 5E51A 2XLLA 2A73A 4OV5B 3EG9B 3K74B 4RMRA 3WXWL 2BIMA 1OP5K 1G7QA 2IPTH 2CQVA 1W2KT 5GJSL 2N7BA 5LNDA 1KCVH 3DLQR 3N04A 3QW9A 3CLFL 4GAYB 4M7LT 1P1VA 3HN5A 3U30C 3FHAA 2UZPA 4XXWA 5H35B 4JLRA 4ISVB 3WUWA 1OAZL 2ITCB 2JI1A 1E4WL 5SWQB 2J8UF 2WXMA 3GEWB 3HE6B 4YHIA 2OYMA 2ZCHL 3ML8A 4TUOA 3ABMB 3EJZC 3WFBL 3D3VA 2BVPA 3EBGA 5TDNA 4ELME 1T7XA 2P24B 4H13C 4JQVC 1F90H 3BT0A 1IKNC 5C2BL 1CIDA 4QRBA 2Z4QB 4YDVB 1B9KA 1TZ8A 3B2VH 3NABL 3MJ6A 4MD4B 5LG6A 2Q8AL 2JNZA 4IGBB 4XNZB 2Z7WA 1CDCA 1BPLB 3VXTA 3DHMA 2EADA 3WNLA 3QZLA 3S8FB 1T83C 1ZTXL 1T6VN 4Q89A 1C8PA 1AACA 1SEBB 2IADB 3O3BA 2Q2LA 5EN2A 3HG2A 4I0CC 1AG0A 4JKLA 4JE4B 5IT2L 3IBEA 5AW6B 2VXTH 3G6AB 5J1SC 1NC4D 1GGCL 1KTBA 2DWSA 3D08A 3ARPA 3QFDB 4FERA 4J3UA 5D1ZI 5D5MA 4BUQA 1YEFH 4H20H 1M2VB 4XP5L 1BQHB 4M8RA 2MKWA 1TSRA 1TKWB 4H8QA 4FA7B 1TQVA 5L8LB 4YSCA 3AMKA 2G4GA 4ZAKB 2QQLH 4ENZA 4AMKL 4YSSA 2Q6WA 4AL8H 2WP3T 4DSYA 4TUKH 4WDIB 2GQHA 5HYFA 2DBLH 5IBTH 4PCSA 3T3PE 2OK0H 3VI4E 1C5DA 3C6EA 5TK4A 3B8YA 1PIGA 1FHGA 2JELH 2OSYA 4GAAA 2AZAA 4M4RA 3BVXA 1S6NA 3FPXA 5LGHH 3TCXA 5FYJL 3X14A 3OJMB 2H32B 1MFBL 1KCSH 3Q8FA 5CILL 1NCDL 1W6LA 1JWMA 5KSBE 1NBQA 2HLFD 2VUKA 3F83A 4U49A 1XZ0A 2D0HA 4CVZB 2PTVA 3VD2A 3FN9A 3LKRA 5BRZD 2KHAA 2NYYC 1KT2A 2DBJA 3QWQB 3RIFK 1I9RL 1R17A 3OQRA 4WNQA 3FQXA 4HAGA 5E6SB 4DVBA 4WI0A 5C7XL 5D7SH 1MCPL 5K1NA 2XTJC 3M07A 4KPHH 3IS1X 4QGTA 3ZO9A 1MKFA 5E1AB 4LCCA 2XY1A 3BDXA 2AXJA 2BMKB 1J87A 3PWLA 1FRGL 2XZQL 1MCBA 2XBTA 3KJ6L 3DYPA 3EYQC 4YOKA 3MBXH 5L88L 4HF5H 2KBGA 3EH1A 4G9FA 1IKFL 4QAMB 2Q87A 1QI5A 3RY6C 4B9KC 3VD0A 1CGXA 3HLAB 2VISA 2WO2B 4GIAA 3RWEB 4PRAB 3LNGA 5JW4N 1QO3A 4JNXA 4FLHA 8FABB 3SDAD 1W8OA 2B77A 5IOPB 4KI5E 4F15C 5A2BA 4HHGA 4TQEL 3VI3B 3ZE2B 3NFSL 1BA9A 1U8NB 2EDEA 4G8FA 1BYOA 1KCRL 4Q0XL 4NM4L 5EDSA 4HGWA 1VCBC 4YBQC 1HH6B 1NGWA 2NY4D 3MOQA 2ZPKL 2FX8L 4L4TB 4ODXB 5CZVH 1OPOA 5IG7B 3C60B 4NO3A 3MLSH 3ARFA 2ZUWA 4JG0L 4OD2A 3S97C 4ZTOL 4PJEF 2F53A 2J1XA 3NRFA 4S1QH 3MDJA 1UH3A 4TTDD 2VDKB 2P80A 1MIML 3BSGA 1VEMA 1AHKA 2X4RB 5GGVH 1KLGB 5EIIA 1PZCA 1FIEA 4AT6A 1H3TA 3QNXB 4NEHB 4FF9A 2QADD 1KBKA 4R3SA 4CN4A 2Z7UA 1IGMH 4NO5A 3KBHE 3GJEA 1NUGA 1UURA 5J06A 4KKBC 3X1GA 3US0A 2B2XL 5TE6L 1KJ2L 2PWEA 2JKJA 2XPYA 1PLGH 4G71B 4IBYA 2JCCA 3V6OA 4OZIB 3AU0A 5AAWC 5IESH 1ERNA 2FIKB 2FZ3A 2BY1A 4JJ5B 4JS7A 1A47A 4C4KO 3EHBB 3DBXA 1T2XA 3P2BA 3GS7A 5FX3A 3OKMA 5JPMB 1R1CA 5FW6A 3FFCA 3EYVB 3ULSB 1ODAA 2GG1A 5CCHE 5KANG 5TQ2H 3AABA 5TD4A 2GITA 4UQ2A 1KDJA 2P8MA 3MRRB 4JN1H 4WJG3 3SQBA 4W9IC 3B7UX 3NH7H 4P2RA 5DURD 3VRIA 4WSKA 4JPWH 2WLNA 5FS5A 1T7ZA 2YR3A 3VWKA 2HA1A 4WI6A 1YHPA 3T3MB 4BFEA 1P7QD 2G75B 1L9PA 1XB6A 1AO7D 2WWKO 1QPKA 3TBSA 2VR7A 5CD5C 2ZF8A 2FWOB 4QR7A 2ICCA 4F3FA 4U1KA 3OBAA 4W4NA 2Y1VA 2FATL 1PJWA 3QNZA 5E2UL 1A9VA 3M86A 4AVJA 3D06A 4H26B 5BVJB 1R3LA 3OAUL 1J8RA 1W72H 3CVDA 3MROB 5FYLE 2G9HA 4WHCA 2DQFB 5J11B 3OZ9L 3QWRD 4HIJA 1ZVHA 5K9JH 3ZT6A 5HYIA 3BKCH 1F41A 5FYKE 5EO0B 5DLML 1KTRL 4HDIA 2RHEA 1MCOH 2UZYA 3ARXA 1CFNB 2IGTA 2O1AA 2NY0C 1NAKH 3MV8B 1HEZB 4KJYA 4R4ND 4UDUB 1ZAGA 1KGYE 4JQXA 2BNQB 3O11A 2F1EA 3D4YA 2FLRT 3T2PA 3CFJA 4LLMA 3FN0H 3H7LA 3LH9A 4OLVH 4BV1A 6FABL 4PJFA 3U2SB 4DQOL 3FF8A 3D39A 2ZSWA 4GAJH 1M6UA 1FDLH 3UMNA 3MLZH 1I9IH 32C2B 4HCRH 1RAMA 2EO9A 4FQCL 3LY6A 4P8QA 3IWVA 4TUJA 3DGDA 2B8OT 4UV4L 2L7UA 1QAWA 2OMUA 4FCHA 2UXVA 2PR4H 2VQ4A 3VRLE 1FYTD 4ZFGL 2YA1A 4XPTH 5DHMC 1C5CH 1GC1L 3P0VL 2AJXH 4NQCD 3SBWC 4YBLB 1KGCE 3FZUD 4LSUL 5EC1A 3WYRA 1MNUH 2FE0A 2Z7YA 3LZPA 1PFCA 5DJ8A 1URZA 2OP4H 1K8IB 1ZV5A 2B4CC 2PW1B 4I9WE 1ORSB 2V5YA 5E24E 3GJFK 3U82B 1YLBB 3MCLL 3ULVL 4K55A 5JXED 1R47A 4APXB 2IFGA 3C87A 3U2JA 5C0JA 4HMEA 3GSOA 4RFNC 4XVJH 2AV7A 3KCPA 1C7SA 5DMKB 1SLWA 2WINB 3MRPB 1CDJA 4RMVA 1O9VA 2DIBA 2ZXGA 3KLLA 4JHWH 1USZA 3DO4A 3BP7A 1I8IB 3GMMB 3QCVL 3QZPA 4MJIE 1G7JA 2DH2A 1H3VA 4YDIH 1B6DA 1U8JA 3PF2A 3QHTC 3ZRCC 2HKFL 2NNCA 4JGJA 1HQ4B 3RBGA 4QXGH 5FO9A 3MLVL 3RTQB 4PMFA 2Z35A 4TF4A 3ZRFC 2FO8A 4JKPL 5IB5A 4WW1B 2D3VA 4XPHL 2F7QA 5D8JH 1CZ8H 1INDL 1ZT1B 1FWXA 1KPRB 3JZ7A 1ZIBA 4K0OA 4JPKH 1BZ9B 3PGCA 1RULL 1YNTB 1FZKA 4KROC 3LV3B 4NFBA 2DPKA 4UWQB 5EU6E 1L9NA 2O6CA 3L3GB 4MVBC 5I1HH 2WYIA 1Z1WA 2D4DA 2CHDA 2FX7L 3FKUS 5C0CE 4H8WL 2VQ1B 1E9PB 1D7FA 4XVUC 4B9JA 2LW3A 1S7QA 2APSA 2QVTA 3FQTA 4FFYL 4PSRA 3PWNB 3V0DA 3QPQD 3ZTNH 3QQ9C 2QR0A 1I3VA 2DF3A 4G43A 5IB1B 2YSSB 4ODVL 1TFPA 4RQQA 4YHPB 4WU5B 1TTUA 4UTBH 2ZUQB 3NCBB 2E7HA 5J6HA 2ZAHA 1J1OH 4ODWA 3I75B 4YGVB 3PWPE 4HK3J 1QUPA 3MRBA 5AW8B 1XGQA 3WJJC 3LNHA 1AQDB 2J73A 1OGAB 3QRLA 1AGCB 4X6EA 2VR9A 4P5TA 3SHSA 5FOJA 2ZKMX 1KF9B 4TUUA 4R26H 1ZLWH 4E41A 2CDFA 2OMBA 4WKZA 4ANKA 1TZIA 3ECQA 2E56A 4JFPA 1XX9C 1A8ZA 3RPIB 3OZLA 1K4DB 2VDKL 3IDMA 3LDBC 2H2SD 3QXAA 4HPYH 4NUJA 4OCYH 5DJYA 3WOVA 4XO4A 1UC6A 1UWEH 3L48A 1N59B 4YL9A 3UBXB 1F4XL 3I6GA 4YFLI 2XX0A 3W82A 1TSHA 1T0MB 2R0WH 3DO3A 3IU4L 2UZXB 1F56A 1OGPA 3QXVA 4PD4K 4PJAE 2O6PA 4WEEA 4D0BA 5LQBL 1R3KB 4IEFB 4RMSA 2QLYA 4ETYA 3MRDB 5LXGL 1JHKL 3MBEA 1IM9B 1ZV2A 2JH2A 2AXGB 2ZUSA 2UUDH 3S96A 1T21B 3QEQB 4QHUB 4M5ZH 3BWAB 3GRBA 4OF0A 5CU5A 4DO4A 4XVTL 4PB9L 2DL9A 2EECA 2R0ZH 3V5KA 4FNLH 4MB5A 4U6XB 3EJZD 3KLAB 1IC4L 1RZ7H 3RY4A 1BZ7A 5BQDA 5D2LA 5AW2B 2RQEA 3MRNB 2PPDA 4PRIB 1NIFA 2PKDA 4G1MA 4YMPA 2JKLA 2YXVA 3GSNL 5D7LA 3EJSA 5T8IA 4K07A 2XNAB 1MUJA 3BMWA 3ZDXB 2EDNA 3EADA 3CSGA 3D2UB 3LH2L 4MQXD 4PJBA 2W95A 3JSSA 4I7ZC 3ARBA 4NNYA 2WO4A 4BYHA 2WIIB 4G6FB 4RFEB 2BNRE 1HKLL 5IVNA 1UJTA 4JFSA 4RSVA 1U4FA 4U1MA 3HG1E 3ECBA 5FHAL 2VTFA 1D6EB 3KD4A 4PGBA 4XGZA 1DDHA 2X4NB 4DP7X 4TSAL 2YKLL 1OAJA 4PB0L 2W0FA 5TF1H 4GW4B 5DD3L 5HYQA 2EIEA 4XNMB 1XF3A 3E6FB 5B1CA 3G9AB 1IAMA 1UXMA 2OSWA 4ELMF 1GPOL 3WNIA 4AVIA 1S7TB 2GBUA 3U4EA 4QY8B 2DQCH 3C08H 4GBXB 5IV2A 1BEXA 3N91A 1ZTXE 2DQTL 1HINH 1OAYH 4PJIE 2OQJB 3UJIL 5AB0A 4A2DA 1FGVL 1WWAX 5AUMA 1C8QA 2XVGA 4XAKD 3U7YL 3HPLB 2W65B 5T3XL 2FBOJ 1SOSA 5HGHB 2VOTA 1XGRB 4FXGA 1IRAY 5DUML 3SY0B 1F58L 5EHFA 5CU9A 1MWAL 2G2RA 1FCCA 1YEJH 2VDOB 1GKOA 3D0AA 2XV3A 5E8NA 3SDCB 2CHNA 5HSFA 5D6CA 3TN0C 2WLKA 3IFPB 1MRDL 2V8MA 1ZHLB 2BWIA 2XTJD 3QIBC 4XCYB 1EGJH 2VKXA 4M8QB 4MA1C 2OMTA 3HI6H 4F37F 1XXDC 2YAQA 4J3OH 4KUZL 3UTSB 4F8TA 4X4KA 2WQAA 2LE9A 2BC4B 4U1JA 5E7BA 5C0BD 3UTZB 5KUMA 3VQ1C 3HG4A 2ZCZA 5FYJE 3EYQD 4JO5A 1WTLA 2YAMA 3UP6A 2JI3A 4XBEH 3T3PF 1OGTB 3VI4F 3VFWB 4PLJD 2NW3B 3TBVA 4EMZA 4IBLT 2AC0A 3CZNA 3SJVD 1SQMA 2D7PA 2WAHA 3BPNC 4Q9QH 1NBZA 5DT1L 5B39A 1Y0LB 5KSBF 4DN4L 3BAJA 3DIDA 3TOPA 4WEMB 1FLTX 1WAAE 2Z31B 3W81A 4Y1AB 2BVOA 1LP9E 2R69L 4QHKJ 1KIQB 1U8MB 1WUZA 5EOTB 3TFBA 2AQRA 3VXRB 5B7EA 4OLXL 5DUPL 1UACL 1FA4A 3AWFA 4JQIH 3TVMA 1X4XA 4YBQD 1PSKL 3KYAA 4HETA 4DPRA 3LXUX 5CS7A 4OGZA 4OJDH 1JRHH 3QDJE 2DM2A 5E8OB 3VU1A 3TPUA 3QUMH 5FO7A 3CBRA 1KIPA 4H1LH 4WI9A 2OYLA 1MHEB 3QZWA 1CD1A 3DJRA 3UP1A 3CZFB 1JTOA 3QDGD 2WZ0A 4K7PH 4HX1A 4QXWA 5AZUA 1BVOA 3RJOA 4IKIA 2JKIS 5KG9A 1JMZA 3H2QA 3MNVA 5EZLB 1PD0A 5DCCA 3W9EA 2DY2A 3KPPB 4HUWA 5BMFL 3OTTA 3CFKA 2A9MH 3QUZB 2X0WA 5CSZB 4M5SA 3EDFA 5ICYA 4KJPC 1A3ZA 4KI5F 4KKBD 5JW4M 3RWHA 4BFNA 4K71C 5HYSG 1KCLA 2H5UA 3E8VA 4ALAC 3RDTB 3QA3A 1KB5B 3ZDYB 1VACA 2FNBA 3O2VH 1QSFA 2OMXB 4FFZH 2H6PB 3ZE1E 2KERA 1T6BX 1B4JH 4V1DD 4OCRH 1Z3RA 3QORA 4M7ZB 3B3IA 1I75A 2FB4H 3G5VA 4RISH 3Q13A 4N6QA 4JL2A 4FQXB 3G7TA 2EEFA 5TK2A 5HDOA 1FZJA 4XODA 2VLRD 5J9PA 5C09E 1QRKA 5GS1B 1OOWA 1OSPH 3UTTA 1MH5A 1HSBA 2BSRA