3MACH

Crystal structure of gp41-derived protein complexed with fab 8062
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
218
Chain Sequence
QLVQSGAEVKKPGSSVKVSCKASGGTFNSYAFSWVRQAPGQGLEWMGSIIPLFGFVVYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYFDTYNNYGFANWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 44
structure length 218
sequence length 223
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3macH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3macH01
3HI6L 1BBDL 3UTSE 4BKLA 3WFBH 5J11B 2OZ4L 4WWKC 1XR8B 4NGHL 4GW1B 3BVNA 4J1UA 1EAPB 5AYUL 3C8HA 3NABH 3QFJB 1S7TB 1IAKA 3MV9B 2I5YL 3FT3B 3EYUH 1U95A 3U7WH 3BW9A 3JWDL 3O9WC 3OMZA 1MHCB 3TF7C 1U91A 5FAAA 4JY5L 3REWA 2AK4A 2P42B 5IT2L 1CR9H 2OM5A 3W39A 1LP9A 3NACL 1EEQA 2X4OA 1N3NB 2EDNA 4EXKA 4FFYH 3LRSA 4R7NB 4HCRA 1MSPA 5J8OA 4PV8B 2R0KH 1A4JB 1T1XB 3EGSA 1Q9LB 2X1OA 2EH7L 4OZHA 2B2XL 4I3SL 3A6BH 1QBML 2W0FA 5I30L 1E4XI 2J8UE 2NXYB 4U1MB 2R4RL 2FATL 3KPQB 3S36L 1DQML 2YBRB 2EDJA 2BY1A 1SVZA 2PNDA 4JO4L 4LIQH 2YPLB 2HRPH 4PREA 3NCJL 1K4CB 4JRXE 4PJDA 1YY8B 3ARFB 3VRJB 3MUGB 1RJCA 4LKXA 3CX5K 4JDVA 3ARGB 5J6HB 4TSAL 3TNMB 5GGTH 2F8VA 3QI9C 4AYFA 3O2DH 2WQRA 3TA3C 3RHWK 1GGCL 3OKLB 4NO3A 3BOVA 4K3JL 2CDEB 4R2GC 4LPWA 2Z31B 1N2RA 2YRPA 3FOLB 4PJ8B 1JI1A 4X80L 5DK0B 5DO2C 1S5IH 1IT9H 4ZFGH 1XR9B 2XACC 4DEPC 4JRYE 2HTLD 4Y2DD 1YECL 2MHAA 4HFUH 4PJCF 5ESAA 3HE7B 3B9KD 1EO7A 4S1RH 2Z8VC 4H0IA 4N90E 2OP4L 2EDRA 4JAMA 1H3WM 3N1MC 3WO3B 4X4YB 5HI5D 3VRIB 2A74A 1FNGB 2AJ3A 5ANME 2ENSA 3QUKB 4XHJD 4HIJA 4DK3A 5C0CA 2UUDK 3MX0A 5MP6L 1JGDA 2V7NB 2ADFL 3SJVA 3NCBB 1E4XL 4TNVF 1F6AA 1EIBA 5J6GA 1X4ZA 3DBXA 3AGVA 3SDYL 4FQXB 4E5XA 4YGVB 1TVHA 3V4VL 1IBGL 4NQCE 2ATKB 1D9KB 1NCCH 4I48B 4F8QA 4P2QB 2DM3A 2F9BT 4R4NC 1JPTL 2HJFB 4J3SA 3T2NL 3RRQA 4WI4A 3QHZL 5I1GH 2NNAB 2XTJB 4YJZL 3SKJL 2R23A 5D1XD 1E28B 5J0BA 1WFTA 2V5YA 2OX5A 3IYLW 5SWQB 1RIVH 3WKML 4P4KB 2X7LA 5C0DA 2XZCH 3K2MC 4PTTA 4MA7L 5KN5A 3LDBC 3VFRB 2R2EA 4OF7A 3DVGB 4WWKD 3OB0H 5CJQL 1ZHBA 1FBIH 4TRPL 4X7TA 3EDEA 1Z9SA 1J1XH 2YSSB 4WW2A 4DW2H 3S3SA 4EBQL 5LVEA 1F4WL 4NM8H 3NN8B 1U3YA 3QWOA 3QEQD 4XNQB 5CCKL 3VXMB 3MR9A 1T0MB 8FABB 5C0BD 4WCYL 3OAYK 2DWDA 2I9LA 2BHZA 3MODL 4ELME 4XNXH 1JCKA 2BHYA 4ODWB 1CT8B 2GQHA 3ARTA 4EN3B 4UIMB 2XZZA 1NCDL 5F7YC 1QFOA 1GGBH 3NZHL 4O2EB 5EORH 2GAZB 2GY5A 3BSZH 4DKDC 2APFA 2J7LA 1DN2A 4PG2C 3CIQA 2X1XR 1WVZA 3EJZC 3T4AA 4S1DD 5GS3A 3MUHL 4CVZA 4HUKB 5IKCA 3HAEH 1GGYA 5HDQL 3NVQA 2H2SC 3FJTA 2OYPA 4KV5F 3OZ9H 2ILLA 1U8KB 4QRUA 3VH8B 3PWLA 4A6YL 3TFKD 4MCZB 1U3ZA 4EI5C 3HR6A 4PRBB 1L6ZA 2PR4H 1VKXB 4F57H 2YD3A 4PGEB 1UENA 1UH2A 3TO4D 3CSBA 3U83A 5K33A 4BH7B 3TA3D 5E95B 1ZK9A 1NBYA 2PTVA 1EERB 4QRRA 4WUKL 2VLJA 5DMIL 4HFWB 3HE6D 5DD0L 4JG1L 3D6GA 1N6VA 5CD3B 3V4UL 2OJEB 4MA3B 2NMSA 3NIFE 1NEUA 4CNIA 5DQJA 2FBJH 3GMMA 1R3HB 5IHLB 2DTMH 4U7KA 2XQYK 4GBXA 1KJ2B 3LH2L 1G9MH 4POZC 2R2BB 4X83A 4PJ5B 1ACYH 5SWZA 3LQAL 3P4NB 3D2UB 5FA3B 4J23A 4XC3H 2HVJB 3O41B 3B43A 2Z92A 4Z77A 2B1AH 2FSEA 3BRDA 3OSKA 3OKOA 2HTKC 5F89B 4HD9A 4G7VH 3X14A 3KYNA 1J8KA 2R9HC 1KTKE 3ROLA 1K8DB 2G9HB 3LKRA 2ITDB 5I8OH 5T3ZE 4Y19A 3BT2H 1OY3B 4U6XB 3ARQA 4ZFFB 2VXVH 1PX3A 2O5XL 4KRNA 1NBZA 3OAZK 4YR6A 5E2VH 3RPIA 3TBYA 5I16B 1UKQA 2F5BH 4M6NL 3DTXB 2JE8A 3BEWB 4HWEL 3RDTC 3EO1B 4G8EB 5IW1B 3DX7B 4NJ9L 2XN9D 4J7RA 3WFBL 2EDXA 3U6RA 1AGCA 3BKCL 2EDDA 4PYGA 4KI5D 5KOVC 1KLFA 3MZTA 2IQAA 4BSWA 1IKFH 4X6DB 4WDIA 3ZDXF 3LB6C 4ZUWA 1HIMH 4F7PB 4XPGH 2FL5B 3EYUL 3E2HC 4CDGC 3U7WL 5L8KB 5DHYB 2R56H 3UC0H 1C12A 1XF3A 1BM3H 2BNUA 2YZ1A 5DS8B 3G5XB 1CR9L 1TTGA 4GMSH 1SMOA 2CIIB 5J56B 1KTRL 3Q6FB 1J0IA 4R97B 4NO5A 2FWOA 1I8LA 2DMKA 3GMOB 4U7SA 3ZLQC 1S9KC 5C07B 2R0KL 1EFXB 4WW2C 1NMBH 1FIGL 1XGUB 5CJXC 5EO9A 4Y7MA 4BKLB 2R1WA 3ALXA 3A6BL 2JJUA 1L9NA 4ZD3H 2OR7A 2H6PB 5CAYB 3T0DA 1L0YA 1I1FB 1T3FA 4HMDA 2IBZX 4Q6IA 1IAKB 4HUWA 2BNRD 4MNQA 3BW9B 5D71H 4ENEC 1HCVA 4R90H 3REWB 2CLVA 5GGTL 3O2DL 3ZKQD 3GI9L 4ZXBC 2HFEB 3FB5A 1LP9B 4CN4A 2X4OB 4N1EA 3LRSB 2IANA 5GJTH 1ZLVH 4OD2A 5T1MA 5EU3A 4S0TD 5SX4H 1S5IL 3JWNC 1IT9L 1VACA 4EOWH 3EGSB 5IFJA 4NIKB 4GRLD 1A7QH 4HFUL 1F13A 1RY7B 2NX5E 4S1RL 2Q8BH 2HLFD 4NC1E 3W11C 4XP5H 4X9HA 1KEMH 4PREB 4M48H 4QNPE 3VG9B 4PJDB 1JGUH 3HPJB 4P9HH 5EIIA 1MOEA 4BQ6A 2OZ4A 4L9DA 4POZD 2N4IA 3QUMB 1KTLA 4PLKD 5F9WC 2GCYA 3BD5A 5CKGA 5D5MF 4G9DA 1IE5A 3FN0H 2SEBB 5IV2A 2JJTA 4ORZC 4OCYH 4LVOC 4OFPA 1NJ9A 2MHAB 2WNGA 2F58H 3H3KA 4L8BA 4TYUA 5DFVC 5ESAB 4RFEA 2ADIA 4JAMB 5EU7E 3EOAA 1B2WH 2R8SH 2AJ3B 4F9PC 4HIJB 1VGKA 5C0CB 1FN4A 1DLFH 3UPCA 3D39D 4I0PB 1A6TB 5J6GB 3VXOA 5FOBA 3DBXB 5E0QA 1AGDA 4KK5C 4WUUE 4PB9H 3NIGE 4E5XB 5E8DH 1A3RL 1TVHB 4R96A 4DW2L 4P9MH 4CUCA 3DSNA 1CXHA 5JZ7C 4NN7B 1HHJA 1AKJD 4DCQA 2DWEA 2XIDA 4K55A 5GISH 1EZVY 1CD8A 1H3XA 2OL3L 4I0KA 4L4VE 7CGTA 2IFGA 3GHEH 2R23B 1NH6A 5HHQB 4JFEB 4PJCA 2WK2A 2EC8A 1JGEA 5H37G 5KW9H 4KTEH 1GGBL 1Q1JH 5EORL 3BSZL 5C0DB 1EAJA 4F8TA 5JHDD 5KN5B 2IC2A 1I7RA 4ZSOA 1HXMB 4FNLL 2R2EB 2YKLH 5KVEH 3MRRA 5D96C 3PL6A 2AI0H 1KYOJ 5B4MC 1ZHBB 3OZ9L 4X7TB 3WDJA 1B3JA 3QDJE 4JKPH 4ZUVA 3CCHB 1O5DT 2X89D 2CGRL 1MFAH 3QWOB 1JZ7A 4F57L 1NL0L 1NC4A 3CDFA 3HUJF 3MR9B 5HHMD 1BWMA 4JLRA 1M7IA 5BS0E 2DWDB 2I9LB 3HNTL 3JVGC 4ZXBD 4CADB 3NCEB 3KR3H 1FFRA 4RDQF 4KDTA 4BQ9A 4M7ZC 2CJUH 2CKNA 1IAII 4NQDB 3BE1H 3FQTA 1YEIH 1CTOA 4MAUH 5GSVA 2VZOA 4ETYA 1DEDA 5HHVH 4UMGA 3T4AB 2FBJL 4CVZB 4XP1L 5TDNA 5IKCB 4LCYB 1G9ML 3ES6B 4QRSA 3QIUB 1ACYL 5LCVH 3LD8C 1WISA 4HULB 4QRUB 2O61B 2IGFH 3PWLB 2LU4A 1WBXA 2H9GB 2B1AL 1WSST 4NWUH 2BDNH 4LAQH 4G7VL 1BJ1J 1LILA 1FJ1A 2EZ0C 1NBYB 5D7IB 3C5ZB 5L2JA 5I8OL 4QRRB 3BT2L 3WFEH 2VLJB 2VXVL 3IJHA 3QIBB 1ZLSH 3BGAA 4PGBA 1CIDA 2PO6A 5E2VL 1CDBA 2ZKHH 5HPMB 3KPSA 4DQOH 4Q6YA 2F5BL 3GEWB 3UJIH 3BPCA 3GMMB 4KPHH 4IDJH 4GBXB 4G6FD 4PGZA 3IGAA 5SWZB 5LG1A 1W8NA 4JDTH 1HIML 4J3XA 4RMWA 2VERN 3NCYP 1Z0NA 2Z92B 4Z77B 2FSEB 3T4YA 5GGSB 3OKOB 3WE6A 1JNLH 1BM3L 4L3ED 3RVTC 5ALCH 4NN6B 3X14B 2HAZA 3KYNB 3BYTA 5LGKA 5E5UB 3MV11 3ROLB 4GMSL 3LKRB 3AB0C 4A6YA 2J5LC 5JZ7D 4OIAA 4Y19B 1KJMA 5J3HC 3STZA 5HBBA 1NBZB 4YR6B 2DQCH 5EU6D 3TBYB 3F7YA 3UDWC 4KGJA 4UQ2B 1FE8H 1NMBL 2VDLL 3BO8A 5DYOB 2V5MA 4KMLB 3VXRD 3QWRA 4K71B 1DBAH 3HC4H 3TBVB 3MRQA 3F7QA 3U6RB 4ZD3L 3K1DA 2WWKT 5K9OA 4D2NA 1YQVL 3DI2B 2IQAB 3TZVA 4BSWB 1JYWA 5BVPH 4KI5F 4WDIB 4ONHB 1NKRA 1NAMH 4AG4H 1CLZH 5D71L 4I18B 1XF3B 2BNUB 3O45B 5JLZB 4R90L 1F4AA 5B4MD 2LAGB 1YEGL 3GMQB 4F7EA 4S0SD 4UTBH 3MV7A 1GC1C 3MRJA 1WWCA 3JUYA 5GJTL 3SOBH 2YEZA 2HG5A 2UUDH 4U0RC 1ZT1A 1IKNA 1TENA 4EOWL 3M45A 1MHHA 5KZCD 4OCMC 1DBBL 4HEPG 3VWKA 1NFDF 2NZ9C 2VR9A 3HZVA 2E8ZA 5HHPB 4YDLC 2H26A 1CICA 3NGBB 2Q8BL 2HWZH 2OQJA 4XP5L 2OI9C 1QLEH 5D7JD 3E3QC 1Z6JT 1T3FB 2KDGA 1NMAH 3KPOA 4Q6IB 4HUWB 1QLFA 4M48L 1KTDA 5T5FL 2DLFH 4WTZA 3CFEA 4P9HL 1R24A 2XY1A 1HCFX 1BD2A 1KLUA 4RGNC 3SGDH 5F44A 3CD4A 2N1KA 4GLRI 4UB0L 4D9QD 2A2QT 2G2RA 1S8DA 5E8PB 1MCNA 1IZKA 4OFYA 4WO4D 2KH2B 4LP5A 5EUOE 1NGWB 1REIA 4NRXB 1UG9A 3L3KB 2GJ6A 5F1IA 2IANB 1ZOXA 1G6RH 5EU3B 2FD6H 2M2DA 5KSAA 5JDSA 2O5ZH 1VACB 2X40A 4QKXB 1PEZA 3WMSA 1RFDL 5IB3B 5IFJB 1KELH 4P5TC 4OCYL 3KYMA 4R4FL 4ODUA 3EFFB 3BQUD 2F58L 3UJJH 3G6DL 4AJ0A 1UT9A 4A2LA 4PY8I 1Q8MA 1E4WL 3KJ6L 4KK6C 4PBWD 1IGFH 3CXHJ 1HXYA 3BPLB 3SE9H 4X9IA 1LDPL 4GW5A 3GMRA 1DLFL 3OAYH 4P23B 5EIIB 15C8H 3JV0A 3SCMA 1S9VA 4HSQA 1EDQA 5E8DL 1FCCA 4KMTL 5A2KH 1BFOA 2R1XB 4P9ML 4DUXA 5FGBC 2UWEE 2XFXA 4JM2C 2GCYB 3RZWA 5ICYA 3ZKXB 4JQVC 3QQ9C 4YQXL 3LV3A 4PG9A 5GISL 5GGTA 3O2DA 2V2WB 1KCKA 3VFGL 3G5YA 5IV2B 1NJ9B 1Q38A 3GHEL 1P6FA 3FQWA 3JWOL 2A6KA 3WLWC 5J3HD 2VR4A 1JHLH 2ADIB 4LGSB 4OI9A 5KW9L 4MAYC 1P84K 1QA9A 1HEZB 1Q1JL 3EOAB 5JPMB 3KLAA 4CJ0A 4WTZG 3HB3D 3EYQD 4X6EA 5LAXA 2LTQC 5CEZD 3VXOB 5FOBB 1AGDB 2DIJA 1QRNA 3S88H 5E9DE 5L0QB 1RZFH 4R96B 3MRHA 4ODVL 5I74C 3HPLA 5J89A 2A6IA 4L4TD 4MLIA 4RAUA 4V1DE 3UTPD 4RFNB 1INEL 4RQQA 1MFAL 1NCAH 5IW6A 4LDOB 3LEYH 1XH3B 5JORA 3S35X 4JCLA 2XA8H 3KR3L 1EH9A 4NHUA 5FA4B 1GIGH 3LSOA 1I7ZB 2CJUL 1QBAA 2GTZA 4PJCB 2I9TB 1JGEB 1BQLL 4Y2DA 2EIZB 1FL6B 1TQCB 2QQQA 4O2CA 3RWDA 2F54D 3CVHH 5ISZE 1CF8H 4JZJA 5CEZH 3HNSH 2VLKE 3CSYA 1Y18A 3ZDZF 3DETD 2NZ9D 1I7RB 5IB5A 1IVLA 4X5LA 4XXDA 3MRRB 3PL6B 3FRUA 5LCVL 1Z3GH 4I2XA 4Y16C 2CIKA 2IFFL 4LRIC 1JYVA 1UCBH 3OAZH 1MFDH 3G08A 1MIML 3P11H 2K7QA 1AQDA 5T3XD 1J18A 3QDHA 3K74B 4HJGA 3VFNB 4NWUL 5FHAH 3IDMA 2BDNL 1NC4B 4MXVF 4AEFA 4JLRB 1M7IB 2VO5A 5D9SB 4NHCL 5F6IC 3O2WH 5IG7B 1E6OH 1RUML 5TPWH 3VI4E 1JL8A 4X7SH 5HHNA 3WFEL 4GRWH 5J1SC 2VXUL 3S34H 3FQTB 1ZLSL 4JN2A 4HZLA 1QD0A 4PIRF 1G7MA 3RIFK 3WBDA 4CMMA 2Z0BA 4DQOL 2OL3A 1AIFA 1YEKL 5DQ9B 4PJHF 1TZHA 4IDJL 5E8NA 4QRSB 5FM8A 4DZBB 1G7QB 1DE4A 2ICWB 1OTTD 3WNLA 1FVCB 4P2OD 2GIYA 5K59E 2EC9T 2DTSA 2HMIC 5EZOH 4FQJH 3QEQA 4OFDA 1FJ1B 1UC6A 2BY2A 3ZTJG 1MCJA 2MPAH 5L2JB 3U36A 3MRDB 3QQ9D 3SCMC 3IJHB 5HVHC 4LVNC 4PGBB 2FO4A 2H8PA 2PO6B 2DIAA 3P0VH 5HYJE 2WAHA 3WIIH 2APWA 3PJSB 3BPCB 5B8CA 2I27N 2XPGA 2GTWA 1W0VA 2P7TA 3HC4L 5E4EC 5EH1A 4G6AC 5JW3L 3K8MA 1D5IH 4IMKA 1OHQA 3ZE1F 3NIDF 1JUFA 5BVPL 3PQYD 1UYWH 1NAML 4PFEA 3RHWF 4YBQD 3VDBA 2AS5M 1CLZL 1NQBA 4W4OC 3T4YB 4CVWA 1A1OB 3IS1X 3WE6B 1J0HA 4XCFH 3HRZA 3PABA 4P2CG 4OLUH 3QBTB 3AFLA 3MCKA 3NPZB 3V5DB 1XIWC 4ZNEA 4Q58C 3TO4A 4UTBL 4A6YB 3AY4A 1QBBA 4OF3A 4KRPC 1KJMB 4XAKD 1U42A 1Z9OA 4JGUA 4RGOL 1L9MA 3ZKMC 1YMME 2I07A 1TZIA 5C6PB 3F7YB 3U4EA 3HE6A 5IROC 1DL7H 5IB1A 4PD4J 1CG9B 1BJ8A 2ZOLA 3FO2A 4S1QH 3MRQB 2HWZL 4KRLB 2HT4C 4KKBC 5K9OB 2C4FT 1CVSC 1LGVA 1QLEL 2FBOJ 3K46A 4NDMB 3TZVB 1OL0A 5D7KE 3CH1B 2DLFL 1TJHL 4EJ1C 4YZFE 5C09E 3WNNA 5MEPA 1AHWC 3ME0A 4HF5L 1HHIA 3WL9B 3CFBA 4N5EC 2VNCA 4XHQA 4RDQG 1BVKB 4F7EB 1EHLH 3W5NA 4HKBA 4QRPE 3MRJB 3ZO0A 2VWEC 3MUJA 3LKPA 2MFNA 2YEZB 1G6RL 5E4IA 2FD6L 2IAMD 4W4NA 2D0HA 4P2RE 1MHHB 4HHAA 4ODBD 3VWKB 1KELL 4JB9H 1U92A 5IBLC 2BRQA 2ED8A 2H26B 2LVCA 1CICB 3C2AH 4CVXA 3GM0A 2CDFB 1W2KT 4UV4H 4P4RB 1IGFL 2XN9A 3FHQA 1NGXB 3KPOB 3SE9L 3MYJA 4LF3A 3MRCA 1ZGLA 1U8MA 5A16A 1QLFB 1KTDB 1MEXH 3QJHB 4DN3H 3K4AA 5DVLA 1BD2B 2NY1C 3W0WD 1B4JH 5HD8D 3SHSA 1TVBA 2G2RB 1YEDA 1S8DB 2VZ1A 1XF1A 3OXSB 4WTWA 3R8QA 5HYSA 4PRPD 4PRAA 5ABDE 2Y9RT 5EZIL 5JXED 3ULVC 1QSFD 2NCMA 5E1AA 1J8HD 2GJ6B 5F1IB 5KSAB 4RMTA 5JDSB 1Y6KR 4R3SA 2QSQA 5JIPA 2BRRH 3RWIA 3T0WA 5DVNA 3KYMB 1NFDA 4TUOB 4PRIE 4KUCF 1YDPA 4WV1A 3GSNH 2YPLE 1OVZA 1JHLL 3RY4A 1HHHA 3QQNA 5AD0A 5DMJB 4HUUB 1QQDA 1B0WA 3KPNA 3T04D 3V7MA 2X09A 1X5GA 1ZVHA 3RWCA 2E7MA 3GMRB 3SGEH 3QCTH 1UZ8A 3JTSB 1ONQB 1FYTE 2BNRA 1S9VB 1MI5D 5DJ8B 3HMWL 1U8QA 3FTGA 1RZFL 4I4WA 1QSZA 2XFXB 4D0DA 1C5DA 4OBSA 2FEEI 5F9AC 1ZHLA 3G5VB 1NMCC 3DGCR 1NCAL 3LV3B 3LEYL 5ITFA 1Q0YH 3MRKB 3BZEA 2VAJA 1XGYH 4MDIA 1XIWD 1U8NB 2DJUA 1RZIA 1GIGL 1YPZE 3W2DH 3EJYC 4L29A 3FQWB 2A6KB 2J12B 4GRLA 2V2XA 4NM4H 1RUPH 3P9LA 1QA9B 1KG0A 1CF8L 2NY4D 5CEZL 3KLAB 3HNSL 1G1CA 3CAFA 4NYLA 5JOPD 3ZKSD 5MEOA 2X4NA 3U2SB 5L7XH 4KVNL 1T03H 5LAXB 2YMXH 3MOBH 3LKOA 5HYSG 1T1WA 2XKSA 4H88H 3TJHC 3D25A 3V9FA 1HN1A 1UCBL 3HPLB 1MFDL 2A6IB 3CZJA 2XI9A 5KVFL 1NBQA 2RHEA 3EOBA 3P11L 3SDDD 1LNUA 2JB6A 4RQQB 3OJ2C 4P59H 5D5MB 1DQQA 2Q86A 1GHFH 2N56A 5JORB 4F15B 3O2WL 5IB2A 3TN0D 1E6OL 4EUPH 4NHUB 5TPWL 3TV3H 3LSOB 4X7SL 1MPAH 4GJTB 3C8DA 4Y4HA 4OZIF 4K23H 1ZSDA 3KPRE 2AJZA 4Y2DB 3OR6B 2DMBA 1WJ3A 3HG1E 4O2CB 3RWDB 5JIKA 3B9KB 4JZJB 2BVEA 5J57B 3JXAA 1AI1H 3H9YA 5I73B 3TJEH 1KB5H 4GRWF 1T6WA 3T65A 3MBEC 5IBLD 5IHZA 2C9AA 1MHPH 2D7TH 4XXDB 5JIIA 3GMNA 3NFNA 4M6MH 2J1KA 5T3XL 1MCIA 2CIKB 2D0FA 1NUGA 4X9FA 4ZAKC 4PJ7E 4YHYB 3RY6A 5IVNA 1V8HA 1A8JH 1IRAY 1AQDB 3DMMD 1CFVL 2NY1D 4HJGB 4OGAC 4JO1H 5EZOL 3UPRA 4FQJL 3QDMD 1AKJA 2YD1A 4HPYH 5JW4M 1Q0XH 2WINA 4FQ2H 3KNBA 2MPAL 4GKNB 5HHNB 4HZLB 2AEQH 1G7MB 5D1XB 3N0PB 3P0VL 3NH7L 3OKEA 3G6JE 3VE0A 2OL3B 1NUFA 5F72S 1AIFB 4L8DA 4KJYB 3O6LH 4HIHA 1TZHB 5C3TA 4XRCA 3MJ9A 4G43A 5E8NB 3DXAD 4IIQA 3ZDYF 3IB4A 2WP3O 2Z91A 4WWKB 2R0WH 1YC7A 1UYWL 3CFDA 1DVFC 4LPUA 4MXQC 3T2PA 2GYSA 4OM1H 3HAEB 4OZ4A 3O3BA 3CFJB 5D6CA 4XCFL 4OLUL 4HXBH 2F5AH 3HUJB 2NW3A 3S97C 4Z7WF 2IG2L 4MX7A 4LSQH 5GGVH 5C0BB 1CL7H 5HGHB 5E2UH 1QVOA 2VH5H 3KXFD 5B39A 2H8PB 4KJQD 1J0ZA 1RV6X 2BOCA 5GJSH 1DL7L 5HY9A 4TTGA 1RK0A 1L4IA 3BUTA 2HT2D 5B8CB 3C60C 5F70A 2CQVA 2P4AB 2GTWB 3IJSA 5CINH 4PYHA 3EJJX 3MGTA 1A21A 2EE6A 3MQIA 4QF1A 2E7BA 2CKBH 4LVEA 4PJIF 3OPZH 3WJLC 3NCCB 3R1GH 4H1LH 3DV4B 4YHPB 3I9GH 2YD4A 1JNHA 3ZSTA 1KPVA 4X6BA 5AZ2L 4LSTH 4GRMA 1V3JA 3O8XA 5ICXA 1I9EA 3HRZB 3PABB 4KFZC 3V6OA 4GUPA 3MCKB 1RULH 1A47A 4X6CF 3DRTB 1C7SA 3TO4B 4LVHC 4ZOEA 1EHLL 3TA3B 2D9CA 1SBBA 1FORH 4MNGA 2GI7A 4PJEE 4HS8H 5M7QA 1D6EA 1K2DA 4R2GB 1N0XH 2I07B 1PEWA 2AEPH 3U4EB 2W60A 3HE6B 3CLFH 5E94A 1VGEH 4XBPA 1OARH 5CEXA 1PKQE 2ZOLB 4BH8A 3FO2B 3B2UD 1VADA 3C2AL 4UI2A 1UVQB 4UV4L 5CHNA 5DD1L 5C0IA 3MGOA 1AD0A 1NEZA 2F8XC 3V8CA 1ZLUK 2LU7A 3MLYH 3O3AA 4AY0A 1ED3B 4FRWA 1UXWB 1MEXL 4DN3L 2X6MA 2BX5A 1QLRA 1B4JL 4U1JA 2JCCE 1I7UA 1ZA3B 1HHIB 32C2A 3CFBB 4RCAA 1KJ3H 1VHPA 3U1SH 1YY9C 4L3EA 4M9PA 3GSWA 1HDMB 4PJGE 1NAMA 2VXQL 3S37H 1T89C 4HKBB 4WHCA 5B39G 3UZQA 4WFHE 4ZS6D 4OGAD 2H41A 4U6HA 4Y5VC 3IU4H 3DVFA 4OUOA 4DOHE 1PG7H 4Q9QH 2BRRL 1P6AB 1MCWW 5EU6A 3GRWH 1T5WA 3WIHA 2Z8RA 4XNUH 1EBAA 3QISA 3GSNL 4CVXB 4XCCH 3MBXH 3VXRA 4U1KB 1MAKA 2XY2A 2XN9B 3HI5H 3DARA 3RVXC 1AR1C 1ZGLB 2LQRA 1M05B 2AK4E 1U8MB 3MRCB 4LF3B 1NGQH 2YUVA 1CQKA 1QHOA 1QFUH 1RIUH 3QCTL 2HKHH 2WWMC 3PGCA 1QR1B 4DWHA 3D85D 1TVBB 1FNEA 4RISH 1YEDB 2DJSA 3IDUA 3SDCD 5HYSB 4QHUA 4KAQL 4PRAB 1I1RA 3BRGC 1KIRB 5I6XC 5CLTA 1CDGA 1AO7D 2BHUA 3WFDH 3AVEA 1Q0YL 1PZ5A 4OZHE 2ZCHH 4TSBH 1U3HD 4LPVA 1F4XH 1XGYL 3RWIB 5I8CA 3ILQC 1G7LB 3W2DL 3WD5L 1NFDB 4NSKA 4BA8A 1H3GA 1YDPB 2QBWA 3FCTA 1NEZG 3CU7A 2IBGA 1R5VA 1HHHB 5DURD 1G6RA 3E8UL 4NM4L 4NJAH 1Q9OA 1QQDB 3KPNB 3RVVC 3WN5A 1KYOK 4XVUC 1JTOA 4WI9A 3RWCB 1GSMA 5D7JA 1T03L 1IGJB 4TTDD 2MSPA 1UZ8B 1BVZA 2BNRB 2YMXL 5DGQA 3MOBL 3BGFC 1XGRA 1U8QB 3FTGB 4I4WB 2ZUTA 1GOHA 2EO9A 4UTAL 2EKSA 5F7KC 4D0DB 1C5DB 4FABH 1P5UA 4I3RH 5HVWA 1JZ3A 3FFCE 3QXAA 3QZWA 1IGCH 4BK5A 1T66C 3WUWB 4PJBE 2Y5EA 5JW4N 2HA1A 3BZEB 2ZUSA 1U6AH 5HDBF 1RZIB 4AENB 1MPAL 2J4WH 4K23L 2HH0L 1RUAH 3DHJA 3O8XC 3VFSA 2VDNH 4GRLB 5C08D 4Y88A 2V2XB 2ESVE 1U0QA 2GUOB 3BQUA 3P9LB 3SJVE 1KG0B 1AP2A 4XX1G 3QNXA 1AI1L 1MQ8A 4NYLB 4X5WA 2B0SH 5MEOB 3OQ3B 3MNVA 3TJEL 4HUNB 1KB5L 3VW3H 2VDQL 1MHPL 4LCIH 2D7TL 2O26U 5MHSE 1ZGLP 1RZ7H 4M6ML 1T1WB 3OKMA 1MVUA 3PDOB 5E2TH 1XF2A 1TQBC 4PJXF 4O4YH 1OOAA 4HKXA 1JPFA 3RTQD 3HLAA 3EOBB 4OZGE 2JB6B 1XGPA 1IL1A 2FR4B 4XBGA 4JO1L 1V5JA 5IB2B 4HPYL 4J4PD 1Q0XL 1YY9D 2CR3A 3RY5A 4FQ2L 35C8L 3N85H 5FO7A 1ZSDB 3HKFA 1UADC 3MRMB 2AJZB 2AEQL 2KZWA 2ZCLL 5HGBA 1UM6H 1SY6L 1T0NB 2MKLC 4FXGB 4MWFA 4ZOCA 4JREB 1G9NC 3T65B 3L1OH 1PW3A 3LIZH 2AXJA 1A14H 4KXZH 2DKSA 5E6ID 3GMNB 4R8WH 3D39B 2D7MA 1TCMA 4LSSH 4WFFE 5DR5H 3RVXD 3VD4A 3F6IA 2R0WL 3QZWG 4L1HA 5IOPB 3C09B 4JPWH 4OM1L 5IVXF 2V2TA 5FYKD 3UTTD 4DFHA 2OSLA 3PP4H 5FM4A 4DKEH 3UPRB 2F5AL 1KXQE 1AKJB 3BEVB 1IGTB 4Z7OE 4KZEH 3I02A 2WINB 2X4QB 2Q6WA 4L4JA 3KNBB 5GGVL 1CL7L 2FX7H 1IQDA 4OZIA 2VH5L 1K3ZA 3PWNA 1I85C 2YA0A 2B4CC 1ORSA 2CLZB 4P3DA 2IBBA 1TIUA 3CVIL 3OKEB 4LLWB 3VE0B 3WS3A 5DQDH 3UP1A 2F54A 5BRZA 1WUNT 4L8DB 5I75C 4YHKH 1L6XA 2E6PA 5JHDB 4CGTA 4XRCB 4UILH 1H8NA 5CIPH 3D87B 3DECA 2CKBL 4IIQB 4RMRA 5GGSY 3OPZL 1NAKH 2Z91B 3EDDA 1DUZB 3R1GL 5FYKH 2YZ8A 4XVUD 3TCXA 3SDAD 3I9GL 3E0GA 3CFDB 3RKDC 5DMKB 2W9LA 4OZ4B 3O3BB 4LSTL 2P5ED 3S35H 5D6CB 2NW3B 3BZ4A 1RULL 4MX7B 4OLYH 1NFKA 5HHMB 5CS7A 4QGYA 1HYSC 3KPTA 5KAQF 4ZXBB 1FG2A 1QVOB 4PLOB 3CK0L 4HS8L 3O4OC 5A2IH 5KS9F 1N0XL 3D69A 1OGTA 4EI6A 2VLRD 3WXVL 3CLFL 5HY9B 3FB8A 4M61B 4LASH 5I1CL 1CGWA 5IVZA 3H9SD 3BH8B 4WI3A 4Y4FC 4PJHB 1XF5A 3TP4A 3MGTB 4UQ3A 4JE4B 4I77H 4QF1B 2NYYC 3ZT5A 1ZA6A 43CAA 3TBSA 4XXCA 3MLYL 3HR5A 4TUJB 2P46B 5JQ6L 2AW2A 3AXLA 1KPVB 1I8IB 3RWHB 3SQOH 1A7NL 2DICA 4HUXB 5MEND 5CEYA 5ICXB 4P2OA 5DA0B 2VTFA 4ISVA 2A1WH 4GUPB 1KJ3L 3U1SL 4Z7WA 3S37L 3ARDD 1BFVH 3PWUA 1UKTA 5DD3H 4MNGB 4PP1C 4XCNA 1D6EB 2HLAA 3IU4L 4HG4J 2CDGA 4Q9QL 2W60B 4YPJA 3CXHK 5E94B 3GRWL 1QPXA 1JGLL 4XBPB 4LK4A 3UTSD 4BH8B 3IVKA 1VADB 5CJOH 4XCCL 3MBXL 4LVOB 5DJXA 2FJGA 3MGOB 1AD0B 4IOSD 1NEZB 3HI5L 4G6FB 3FQRA 3EZJB 4HZAA 1NGQL 4Q0XH 1QFUL 1QLRB 2HKHL 4U1JB 2F53E 4N1HB 3PWJA 1H8OA 1WCBA 3SE4A 4RISL 1CGSH 1LMKA 1PBYA 4Z0XA 4L3EB 4X6CA 4O02L 2MTPA 4BQCA 1NAMB 1LHZA 3CDGA 4H26A 3B2VH 3QIWC 1M7DA 2ZUQC 3WFDL 2EDOA 4JPIA 4LLYA 4TSBL 4U6HB 3L7FA 4TQEH 4NKDA 1RHHA 4WI6A 3LCYA 1F4XL 4NCC2 2YA2A 3GB7B 5EU6B 2D03H 1T5WB 2D7OA 3NCFB 2MQ3A 3VXRB 1G9NH 3CXDH 4H8WC 5C71A 4MNQE 2PKDA 5L9DH 4NJAL 1RUQH 5C1MB 2NLJB 1F00I 4FFZH 1Q9WA 2FCBA 2X1WL 3R8BB 3RX8A 1P9MA 1X5HA 3PGCB 5I8KH 4Y8AA 1CIUA 2XICA 3OF6D 4K3EL 1FNEB 4FQXD 5CGYC 5D96B 4F3FA 1HE7A 4ONGH 3BPOB 4FABL 2WUBH 3ESVF 4I3RL 4APQD 1OM3H 1IGCL 1VERA 3WFZA 3ZKNC 1U6AL 3RIFF 2IAMA 4Y4KD 4NSKB 4JRYD 2J4WL 1HZHH 4LCCA 4HW6A 5KZCB 3FCTB 1RUAL 3MRIA 1O0VA 3LRGA 4N90D 4PLNC 3U0TA 1G6RB 2FHBA 1Q9OB 3ZZ1A 3WN5B 3U30B 4AK1A 2B0SL 4FFVC 5D7JB 3VW3L 1ZVYA 3GSNA 1S7QB 1TLKA 1WWAX 3NFPA 3U79A 5HGDB 4YXHH 1RZ7L 2AJSH 5E2TL 2ARJB 5EG6C 4X0KA 5DLML 4O4YL 5DI8B 2EKSB 4XI5D 2BOBA 4XVSL 4NQCD 3C5SA 4YX2L 1RK1A 5D93B 4WO4B 3QXAB 3QZWB 4HX1A 2E3VA 4DZ8B 4JVUA 4DTGH 5I18H 2VZSA 4FXLA 4LMQI 5JXEA 4KKAD 2X4PA 1J1OH 4HAFA 1J8HA 4HT1H 2ZP0T 3GJEA 1MCEA 4HIIB 4C56A 3S3JA 2CUIA 2V9RA 3N85L 1YEEL 3HZYA 2AV7A 1SM3H 4QEGA 4JZOA 2P5WA 4DGVH 3GUTA 1SBSH 3BQUB 1KIPA 1UM6L 4G8GE 2BVQB 2OTWA 4X5WB 5DRWA 5D70H 3L1OL 2R4SH 1YEJL 3LIZL 1HQ4A 1XAUA 2CK0H 4DVBA 4R8WL 3OKMB 1FGVH 1XF2B 5DR5L 2E9WA 1MI5A 1BQHA 2ADGA 3LPFA 4HKXB 3DO7A 1JPFB 5AG8A 2BVUA 4JPWL 3EOYG 3Q48A 3TWCH 1XGPB 1IL1B 5ESVB 1T80A 3EAKA 3V7AG 5ACZA 4XBGB 4N0CC 3PP4L 4KK8C 3KS0J 1P5VA 2WUCH 4YAQB 4KZEL 5E99H 2X4TB 3A6CH 4MJ2A 2FX7L 4W68A 2VOTA 1AC6A 1U8OA 3UBXA 3AB0B 4ZSOE 1Z5LB 5FCSH 5HGBB 3G5ZA 1AD9B 4JDZB 4JGJA 5DQDL 4N0UA 3KYOA 4RBPK 3QA3A 3EO0A 2PF6A 4YHKL 2DI7A 4F9LA 1BZ7B 4HWNA 4WHYG 3WNKA 4U3CA 1FH5H 5DFWH 3W5MA 5LQBH 1I4FA 3QDGE 3VI3F 1U8IA 3TBWA 3T0EC 4QHKJ 1NAKL 3UXFA 5FYKL 4PJXA 3U46A 4U31A 3TO2A 1KB5A 4F7CA 4L4TB 2V2TB 5KSBA 3SDDA 2OSLB 4RGNE 5CGYD 3I02B 4OLYL 3BD3A 3IDYB 4PD4K 1IQDB 2JIXD 3TN0A 4OZIB 1ZLUH 4JZNA 3PWNB 1ORSB 2H1PH 4NC1C 4JQXC 4P3DB 5GS2D 3WS3B 2NTFA 2F54B 3I75A 4LASL 3X13A 2G5RA 4JFOA 1DDHA 4GRWB 1CQYA 1OAQH 3SBWA 5EOCJ 1BQHG 2DQDH 3VWJD 4I77L 2YWYA 1SY6A 3R0NA 4YDLB 1BAFL 3MLTA 1I9RH 1OGAE 2CXGA 2AJUL 3DOSA 2OI9B 5F21B 5JDJA 3FO0H 5D6DC 3LMJH 2X10A 4RGMB 1YN7A 3DMMA 1X5IA 5H2BA 3I84A 4HS3A 1F90H 2A1WL 4TPRH 4Z7UF 5KSUA 5DZOA 1KC5H 5I1AB 2X4UA 4YFDB 2VQ1B 3QUZC 3KPSE 3UBXG 3OB8A 3QDMA 4ORGA 1F4HA 4X9BA 1BFVL 5T3ZD 5GS2H 1BF8A 4XGZA 3VG0L 1FG2B 1KNOA 1OP5K 4JFXA 1BOGA 3D69B 2CLRB 3NOIA 4EI6B 4PJFE 4MMZC 2VXSH 3FB8B 1JWUA 2QADD 3ULUC 1KUMA 2BNQA 4U1NA 5CJOL 1XF5B 1VPOL 4UQ3B 5CGTA 4K7FA 4N9GB 1MQKL 1ZA6B 1M71B 1QP1A 3OGOE 3TBSB 3DXAA 3ZE0E 4GKZB 3HR5B 2W9EH 4LSVH 2XNAB 3AXLB 3L3OA 1DQTA 4LCWA 4Q0XL 5DSCA 4KJPC 5K9QI 4H20H 4MA1B 5T3ZH 3UJTH 2CKBA 3QFDA 1CGSL 4QOKE 4JR9H 1CFTB 3L5JA 3GSOB 4Z7WB 1SEQH 3PWUB 3W9EA 3B2VL 2NY5C 2KBGA 5DFTA 5KS9A 3DLQR 3HC0A 2CDGB 4KK8D 3BN9C 3MCLH 3H0TA 1O7VA 3IF1A 3RWEB 3A6OA 1ZANL 5C0AE 3IVKB 1FL5A 1T0PB 1CGTA 3GKZA 1G9NL 3CXDL 3OXRB 2YPKA 5DJXB 3ZTNH 4D3CH 1CI5A 1RUQL 2FJGB 3BP4A 2FGWH 4PJIB 5L2KA 3FQRB 1FAIH 3PE9A 1ZT4A 1DJSA 1MY5A 1U93A 4AL8H 3GSRA 4G3YH 3PQYB 3MV7E 4YXKH 5I8KL 2FDBP 1XGTA 1WCBB 1X5ZA 4Z8FH 4Z0XB 2VKXA 5FCUH 7FABH 2X9WA 2XG5A 4ONGL 1NBVL 4X6CB 2IWGA 2WUBL 3CDGB 4H26B 1AXSA 1RVFH 3EKCA 1S78C 4IJ3B 4LFHD 1OM3L 2NW2B 4XPBH 3I50H 4LLYB 3MV01 5EIVA 3VXTA 3EHBC 4N0FA 1J0YA 3M1BA 5D1QC 2VUYA 1EGJH 3VD5A 1HZHL 4NNYA 3P4OA 1F5WA 1U8LA 1BJ1H 2NX5D 4OLVH 3TPUA 1E4KA 4MQSB 4PJ9C 5I17A 3F7VA 5DTFA 2DDQL 3GRWA 1MNUH 1Q9WB 1W0WA 5C0GA 4LHUD 4YXHL 2AJSL 4CN6A 2DQTH 2P24A 3I3EA 4F3FB 3RUGE 2WIIA 3OTTA 2QLVB 1VEPA 3T3ME 3P4MB 2X4SA 3SY0A 4LLMA 4GAFB 2DQUH 4DTGL 3M17B 3AAZA 2M26A 1WFNA 4XTRC 4MD4A 1WZ1H 3GJFK 4LCUA 4U1GB 2ZCKH 1W72L 3QUZD 2IAMB 1JHTA 3QULA 1NCWH 1SM3L 4NT6A 5FB8A 4DGVL 5B3JE 1BZ9A 1SBSL 4HK3N 2VDML 4R7DA 1TDQA 2DYPD 4TVSa 4PTUA 1OLLA 4KTDL 2A0LD 5HHXL 2BC4A 4Z0BL 2R4SL 3BIBX 3GSNB 2EKJA 4FTVA 4HLZG 2K1MA 4M43H 2CK0L 3KJ4C 3NFPB 4YDIL 4WUUD 3MOQA 3RX7A 3VD7A 4OM0H 3W0WB 5HYIA 4DFIA 3RGVC 2P8PA 2DJ4A 3S98A 1CGUA 1MLBA 3D85A 5ETUA 3PHSA 2BOBB 2VXTH 3C5SB 3SDCA 4PRPB 3SKMA 5SWSE 1H3UA 1QSFB 2W9DH 2X4PB 1J8HB 1AO7A 1BHGA 3GJEB 2WUCL 3H3PH 4O00A 5EC2A 1FZMA 5KANI 3QEUA 1U3HA 4L4VD 1G7PA 1CBVH 3INUH 4ELKA 3D3VA 4NQDD 1FFNA 2XYCA 1EJOL 3GUTB 1PY4A 4JFPA 1HKFA 1KIPB 3U7YH 2OTWB 2F19H 1QRNE 6FABL 4MJ5B 1R5IA 1I3GH 3KLDA 3S4SA 3N1QC 3GHBH 1FH5L 5I76A 1HQ4B 4DVBB 5F6HI 5E4EB 5ITBH 5GGRA 1UWEH 1MI5B 4YHZH 3BUYA 3SE8H 1I1AD 3QDJD 1DLHA 3DO7B 3QUXD 2Q1EA 4XWGH 4XNZC 2Q7YA 3IFLH 5DJAA 1EO8H 3R06A 2NY5H 3T0VA 3S9DB 3Q1SH 3P0GB 5BS0D 4OI7A 4F33B 2MKWA 1FVEA 1MCHA 1R3LA 3Q5TA 4C4KO 3C5ZD 1RJLA 3RX5A 1IC1A 4IRSC 2E6QA 4ACPA 1XIWB 4GAYB 3UBXB 4ELMF 1HYRC 3MROA 1J86A 2VWEE 4N8CH 3L5XH 2GEEA 1RZKC 5C08A 4I2XE 4I5BB 3QA3B 4NNXA 2FX8L 4FQLH 2NY4B 1OAQL 3MO1A 5I2IA 1EEZA 4UAOB 2HVKA 2DQDL 6CGTA 4XVJL 1U8IB 1UB6A 3TBWB 3VXSE 1R3KA 3EFDH 2Q7NA 4KKLD 1I9RL 4PJXB 2AEIT 1AGFB 4NN5B 1XT5A 5IF0A 1FSKC 2EXWC 3O6FC 3MFFA 1KB5B 4F7CB 3FO0L 3LMJL 3Q2CA 2GT9A 3RWGA 4YPGA 4UDTA 3EDKA 1H3PH 3OBAA 3RTQA 4K3GA 3SDDB 4L9LA 3H7LA 2EDEA 1F90L 4TPRL 3MV8E 3QUYD 2YHGA 1KC5L 3BYYA 4JKWA 1MCSA 1N64L 4Z6AT 4QTIH 1R0AH 4J4PA 2J88L 3TN0B 4JZNB 4ZO9A 1BIIA 3ULVE 2VZUA 5TQ0L 3CUPA 3QRGH 2XTLA 5K9QG 3RP1A 2VXSL 4ZYKA 1WZKA 2F74B 3S4SG 3I75B 3BPNB 4RZCB 4JFOB 1DDHB 3RPKA 1JV5B 3NIFF 1T7YA 5TQ2H 5FFLA 1JPST 1F02I 2EDTA 2QQNL 3PP3K 3BIKA 2QV2A 5E6IA 2I60H 2W9EL 3QEQE 1PQZA 4LSVL 1P1ZB 1EV2E 5JOFB 1TNMA 1JF5A 4N8PA 4Z5RB 1H5BA 1QEWA 5CIPA 5T3ZL 4BQBA 5IHBA 5IVXB 3BP5A 3UJTL 1U58A 3DMMB 5CBAA 2NY1B 4HS3B 5KSUB 4FFWC 4JR9L 1JZ6A 3RGVD 2X4UB 4M6OH 3UTTA 1SEQL 3DI3B 3QDMB 1YJDH 3BWUC 5JR1H 4XGZB 1X44A 1D5MA 1KNOB 1EHXA 4FQPA 4JFXB 3O0RH 3NTCH 4Y89A 1OW0A 5INCA 3BMVA 5I1KH 1FIEA 2VL4A 1A6VH 2PXYC 5KSVB 5A3ID 1JWUB 1OAZL 2WM0A 4U1NB 4WHDA 4U05A 5TDOB 1NGYA 3ZTNL 4D3CL 4K7FB 2FGWL 1JRHI 3IAQA 3OKKA 1FAIL 1FZKA 3DXAB 2WLYA 4NO0D 1FPTL 3OKDA 1EEUA 1XCQA 3LEVH 3L3OB 4G3YL 3H9ZA 1UACH 3GSXA 3SDAA 5DSCB 1I9JH 4YXKL 2CKBB 4Z8FL 2DLIA 5IBUB 2P5EA 1X6LA 5FCUL 2XRAH 4FG6D 7FABL 3KWWA 3MLUH 4XMPH 3MXVL 1TCRA 1RVFL 1SYSB 1F3JA 4AIZA 2E27H 4XPBL 3I50L 1SVCP 3HC0B 3KXFB 3H0TB 1CU4H 2GSIA 4YO0B 2WP3T 2J6EL 3IF1B 1MJUL 2VLRA 3OL2A 4NFBA 1EGJL 3MLZL 4YHNA 4IRSD 3V52H 2EIEA 2NXZC 2UY7A 4OLVL 5FHBH 4TUKL 3H9SA 4Y0GA 4RWHA 4L1DA 4XMKH 4L8SC 1CXFA 3DVNA 1U93B 1MNUL 3QUML 3GSRB 4P23D 3QFJA 2G5BA 4B7IA 4Y5XA 1S7TA 5ADPH 2DQJL 5F96H 3VFVA 1C5CH 1G0DA 5IJKC 1JRHL 1A7BA 1XGTB 2DQTL 5EDXA 1X5YA 4D0CB 1A7PH 2VLLB 4JFDE 5C2UB 1AXSB 2C1OA 2DQUL 3G04A 3ARDA 3V6FB 4YHMH 1WTGT 3JV4A 3EYOB 1KACB 1I8MA 4HWBH 3GK8H 2W1NA 1JJUA 3LEXA 2WBJD 1A64A 4NNYB 4DVRH 3MRGA 3P4OB 2AABH 1N4XH 5C0FA 5I1DA 3TPUB 4L9LC 3W82A 2FB4H 3UTSA 2YUWA 5I17B 3STBA 4G5ZH 3F7VB 5DTFB 2R29H 1WZLA 3PGDB 3SO3C 5DHVH 4BUGA 2VZ3A 4U1MA 5C0GB 3VGEA 2YBRA 1A1NA 4QNPF 4M43L 1G7IA 3KYAA 1K4CA 4Y5YC 5LKNA 3MUGA 1YYLH 3V0VA 4E41E 4OM0L 3H7BA 2P24B 2DI8A 5KOMC 1T4KA 4NQVA 2DN7A 4MDJA 4M7LT 4U6TA 2VXTL 4HGKC 1ORQB 4U2ZA 2X4SB 1YEFL 4LLMB 4PBXA 4EKXA 3KLHD 3V4PH 2J8HA 3JZ7A 4RBPH 3AAZB 4R0LA 2C3WA 3WFCH 2W9DL 2DLGA 3TH2T 4KZDH 3P0YH 1OSPH 3E6FA 3H3PL 3QNYA 4LCUB 3V8OA 3LQMA 3RZCC 1JHTB 4Z7VE 3QULB 2PN5A 3INUL 1C7TA 4NT6B 1UGNA 5D2NC 2C1PA 1BZ9B 1CVRA 5MI0C 3U7YL 5GGQL 2BNRE 4R7DB 4IRJC 4X4MA 4MNHA 4WY7H 4PTUB 3BGMA 1JMXA 1PSKH 1QBLH 5FKAA 4X4YA 3G9VA 1I3GL 2BC4B 1B9ZA 1PLGH 3QUKA 4NRZB 3GHBL 2QJDA 5CMAB 2EEDA 2JJVA 2RQ8A 2V7NA 5ITBL 2GFBA 4FZEH 5E9DD 5BV7H 1JBJA 2P8PB 2VC2H 3SE8L 4YHZL 3NIGF 3OF6A 1MLBB 3D85B 5A2LH 5DVKA 5ETUB 4FQXA 4V1DD 3SE3A 3AC0A 3SDCB 3SKMB 3RAJH 1RZJH 3AU1A 3IFLL 3I6LE 1J12A 1EO8L 4RFOL 4APQA 2ATKA 1D9KA 3I3DA 4M1CD 4I48A 1AO7B 3TCLA 5JUEH 3Q1SL 1WITA 5EC2B 1FZMB 3KPMA 3QEUB 4TULH 4GAJH 5C9KA 4PRDA 3TVMD 4ELKB 3MACL 1FFNB 1LE5A 4Y4KA 4YBLC 1SJEA 1XZ0B 4JRYA 3ZMRA 2GY7B 4U7MA 5BZDA 1OPGH 3PXJA 5ISZD 4ZTPL 2E7LA 2YPVL 5DURB 2VLKD 3O2VH 1W72A 3A67H 4FQLL 1R5IB 4ZMAT 2AJYH 4U49A 5DF0A 3ARZA 3AUVA 3S4SB 2EDHA 5I71B 4P46C 5I76B 5F71A 3VFRA 1EUTA 1R3JB 1ULVA 5GGRB 1OP5H 1GOFA 3DVGA 5DC0A 1DLHB 2VABB 3KG5A 1BFTA 3PWVA 2YSSA 1HKLH 4OCRH 1H3PL 2FJHA 2YD6A 3BP6A 3ALPA 4P5MB 3R06B 1GPOH 3RQ3A 3NN8A 2AQ2A 3V0WH 5J11C 1FVEB 1QFPA 1R3LB 1T83A 1QSEE 5GSRA 3VJ6A 5BW7C 1UJ3A 3VXMA 1JGVH 1T0MA 1RJLB 5T5NF 1M1SA 1FP5A 4QTIL 5F9DC 4QHKI 2YRLA 3MA9H 4LVHB 3MROB 4WI5A 2DIBA 2BXYA 2ARJQ 5D8JH 1CT8A 1P7KB 3SPVA 3DIFA 1WT5C 4UIMA 5ERWA 5C08B 1ES0A 4HMCA 3ARED 1GRWA 1FGNH 3MLRH 1E0OB 2GAZA 5FECA 3BAEH 1U2CA 1EEZB 4LSUH 2HVKB 4KC3B 5TQ2L 4UT9H 1LE9A 1R3KB 2IADB 2EDQA 1GH7A 5IF0B 2I60L 4PY7B 4AM0B 4OGXH 2DS4A 1JVKA 1IEAA 1U8KA 2ZPKL 4BZ2L 1IC7H 1J87A 4OZFH 4YPGB 3VH8A 4UDTB 5GRXG 3RTQB 4Y2OA 1H15A 4MCZA 2VR5A 3K8LA 3MJ7A 4PRBA 4QHLB 1K5NA 1HNFA 5BJTB 4M6OL 2D7QA 4PGEA 2NXYC 3ET9F 4EDWL 1CFBA 1YJDL 4M1DH 4BH7A 1IQWH 5JR1L 1NPUA 3QT2A 2WQ8A 4F37K 1BIIB 3GSUA 4ELMA 3ARFC 3NTCL 5C6TL 3CUPB 4O9HH 5LXGH 5HYJD 5I1KL 4LU5L 3ARGC 4AT6B 4ZYKB 4JY6A 4BELD 4C54A 1A6VL 3RZCD 3VXPB 3IDIA 5D7LB 2DL2A 5CD3A 4NUGH 2Z31C 4Y8DC 1R3HA 5E70A 4PJ8C 5E56A 5EO0A 4OQTH 2M1KA 3BIKB 5E6IB 3BMWA 1EBPA 1JIBA 1PQZB 3BXNA 1CTNA 3P4NA 1UACL 1S9YB 1QEWB 5CIPB 3O41A 3BP5B 3HE7C 1U58B 1NFIA 5CBAB 4RWYL 1ZE3C 4JEGB 3EYSH 3UTTB 5F89A 1XFPA 4BUHA 3B83A 4HWUA 5C9JA 2R0ZL 2MQ0A 2ITDA 3QQ3A 2E27L 3PDGA 1MAJA 1CD1A 1YMMD 2N7BA 5DD5H 4U6XA 4QWWC 5I6XB 2ZWLT 4ZFFA 5INCB 2L4OA 1QFHA 3ARBD 2FH6A 5F8QC 1PYWB 4FQCH 3V52L 1DEEB 4U1IA 3DTXA 5EU4B 3BEWA 4K94C 1NGYB 2MWCA 2BFVL 2XV6B 4G8EA 5IW1A 2FEDC 1X6NA 3ZL4H 4IOFD 5HDLA 3OKKB 4X99B 3VWJA 4X5XA 3OKDB 3VH8G 2NY0D 1XCQB 2ORBH 4CMHB 3GJFH 3GSXB 4PJAE 2XTJC 5CJ8A 4X6DA 1A7OH 5C09D 4F7TA 2WZPD 5ADPL 5F96L 2I24N 1C5CL 2I25N 1T1YB 5DHYA 1I9IH 4Z7UB 2P5EB 2XQBH 3KWWB 1A7PL 3LS4L 2DLTA 5DS8A 4OCWL 4P4KC 4ZTOH 1TCRB 4QRPD 4X7FC 1ZMYA 5F1NA 2CIIA 1F3JB 4AIZB 4Q9BA 4YHML 3Q6FA 5F1SA 4G7YL 3L3HA 4HWBL 3GK8L 4P2RD 3GSVB 3GMOA 1S7VA 2GSIB 3IDXL 2KQMA 3J8F7 1IGIH 2VLRB 4B0MM 3EIFA 3C6LD 5TF1H 2VAAB 2XWJB 4DVRL 1EFXA 2AABL 4PGDA 1CLOH 1Q72H 4ERSH 3RBSA 5KANG 3VMNA 1A22B 2FB4L 3H9SB 5I9QB 4G5ZL 1A5FL 3BN3B 3OAUH 3FB6A 2ZUUA 2H6PA 3DVNB 5CGMA 3F12B 3F62A 4RAHA 2OK0H 3G9AB 1I1FA 2G5BB 4Y5XB 3TPKA 1N5AA 3VFVB 1WAAF 4HS6A 4HLJA 4EN3C 5MENB 1TQBB 5EBGA 1AC0A 2C1OB 2HFEA 3V4PL 1GVIA 5IB4B 1AR2A 3G04B 3ARDB 4IM8A 5EUOF 3THMH 1J7VR 1X5FA 2FECL 2OR9L 3JV4B 4OB5H 3WFCL 4KZDL 1OSPL 1I8MB 2ARWA 1J0JA 3LEXB 2GJJA 2NTSP 3MRGB 4PRID 5C0FB 5I1DB 3R0MA 5CZXC 3RL2B 2QQLH 3UTSB 3S36X 1OTUD 1CGYA 1NANH 4I13B 4LARH 4TNWK 5J1TC 2NY3D 1PSKL 1QBLL 2J6EA 1PLGL 4MD5A 4FQIH 1MH5B 5GS0C 3IU3A 1A1NB 1FYTD 1G7IB 3H8NA 3HPJA 4ODHH 3V0VB 4FZEL 5BV7L 1IJ9A 3H7BB 4D9RE 2VC2L 4OT1L 1T4KB 4NQVB 3FN9A 1P7HL 4MDJB 3QUMA 5A43C 4KK9C 2UWEF 4UT7H 3RAJL 1RZJL 4PY8J 4X4ZA 4R0LB 1GAFL 1IEBA 5BVJA 3E6FB 3AS2A 5JUEL 3QNYB 1CYGA 2ENYA 4BSVA 5CFHA 5T1DH 4B50A 4TULL 5D7SH 2SEBA 1VFAB 1CWVA 1LO3H 3LPGA 2DBLL 4HQQH 4F58L 1Z9LA 2ICWI 4OCSH 1HILA 5H94B 2C1PB 3SGKC 4GG6E 2QSTA 3L95A 4MNHB 3GBNH 3O2VL 3A67L 3BGMB 2RCSH 5FKAB 4KROC 5DT1L 4MLSA 2AJYL 2AXFA 2YK1H 2CD0A 5I75B 5C0RH 3ZYJA 1MJ8H 5IFAH 4JRXB 3N06B 5BMFH 4OF5A 2GFBB 4I0PA 1A6TA 2XKNA 4LHUA 3VGAC 3IRZA 3AS3A 3X17A 2Y7QA 4MVBD 1KOAA 4HMEA 4ETQA 3AU1B 4JFFE 4XB8A 4APQB 1T20A 2MOVA 4M03A 4ZS7H 3V0WL 3TCLB 3FMGH 5TE7H 12E8H 1IAMA 4X98B 3KPMB 4OD3H 3BKYH 2FGZA 4PRDB 5DUBB 3PP3H 5GIRA 1JN6A 3KPRD 3MA9L 1LE5B 4Y4KB 1SJEB 4JRYB 5BZDB 3HG1D 4M1GH 4NBYB 5D8JL 5HHQA 4JFEA 1N0LA 4Y1AE 1HHKA 4BFEA 4ZFZA 3VU2A 1F6LL 1W72B 2CMRL 3X3GH 1FGNL 3MLRL 3LS5H 1A6WH 1F8TH 3HC3L 5ANMB 3BAEL 5D1ZD 1QUNA 4LSUL 1DQDH 5DGRA 4UT9L 3E1F1 1HXMA 1LDSA 4R97C 5FGCE 5EPMB 3O81A 1ZWIA 1MIEH 1K85A 3V2AR 1A02N 4OGXL 5JIHA 2Q87A 1P53A 3PWVB 4UINH 4LFHG 3CCHA 1LO0L 3IAGC 1GCFA 4EDXB 2FJHB 4NQCB 3BP6B 5K93A 5FYJE 3O9WD 3VJ6B 5EU5A 5GSRB 1UJ3B 4G6ML 2MCPH 2YD7A 5C0NC 1JF1A 1IQWL 1FZOA 4CADA 3VI4F 1D6VH 2Z9TA 4NQDA 4O9HL 5LXGL 3SPVB 1TJIH 3DIFB 5ERWB 2YS4A 1ES0B 4YNYA 5HI3C 1H0DA 2C3XA 4JFHE 5FECB 1EO5A 2YC1A 2MNUA 5EIQA 4LHUG 3RNQA 4NUGL 1LE9B 1KIUA 2VN7A 4OQTL 3IXTB 2W0PA 4JHBA 4LCYA 3ES6A 1BZQK 3NCYS 3QIUA 1OD7A 2FX9H 4F80A 1IEAB 1U2HA 1I1AA 3QDJA 4NRYA 2FYYA 2O61A 3QYCA 3AS1A 3QUXA 1H15B 4C59B 3LY6A 3MJ7B 1TMCB 2H9GA 4OGZA 1K5NB 5IHUL 1LEGA 2NY6C 3O6MH 4KHTH 1E4JA 3QI9D 4XVTH 5DD6A 4KK9D 5BS0A 5BRZE 5D7IA 3C5ZA 3GSUB 3VMPA 4ELMB 4R2GD 5DD5L 3VG9C 2AEWA 2CUHA 3ARRA 3QIBA 1PY9A 4JY6B 4N9OB 5FUZH 1S5HB 5DO2D 3IDIB 5HPMA 4FQCL 3CSGA 3MRFA 1IGYB 4XPAH 5JW4R 1ADQH 1CXIA 5DHXB 5EO0B 2LFGA 5BXFB 4G6KH 4KROD 5ILTH 1MRDH 3BXNB 2ORBL 5C0EB 4RSVA 5I15H 1A7OL 1INDH 2FIRT 4MCYB 1NFIB 4NQXA 3WXWH 5GGSA 2Z8SA 2XQBL 5GRWA 1DR9A 1KJ2H 3QUYA 2V5TA 4ZTOL 3QXUA 5C9JB 4HKZA 3QQ3B 1CD1B 2ZJSH 2JIXB 1N7ML 1L7IH 4NFDA 1W0YT 2VSCA 4K8RC 4R4ND 3FHAA 5I1LA 5TF1L 1BGXH 1FC2D 4UQ2A 4U1IB 1Q72L 5DYOA 1Z0MA 1D5BB 4NN7C 1CLYH 5GZOC 4EIGB 3AM8A 4PV9A 5E2JA 1VCAA 3TBVA 3UROR 2P47B 3OAUL 1TJGH 3VWJB 4X5XB 2D3VA 1UH4A 2EYRA 4ALAH 2CRYA 3TC9A 4FS0A 4PP2B 5E8OB 1P4LA 1JFQH 2OK0L 4QO1A 4H0GA 4F7TB 3NABL 1J1PH 4ONHA 4YZFF 3VFOB 4IOIB 2VDOH 3O45A 4I18A 4LQFH 5JLZA 3I2CH 2CO6B 4S1SH 4UV7H 3GMQA 3CDCA 4WFHD 4G6JH 5F1NB 3MC0A 3THML 3ALWA 4OB5L 5JNYB 4FFYL 3L3HB 1UWGH 3V6ZA 1JYXA 3PDDA 1S7VB 3MJ8A 5C0ND 4FMFA 5C3LD 4PGDB 4UIKH 3Q3GA 2QADB 1MREH 3K4ZA 1YNKH 2QQLL 5HHPA 4LARL 1M7XA 4DKAA 3QPXH 1HNGA 5D72H 2AK4D 3FB6B 5ALBH 4Z18A 1KGCE 4NO0A 2IPKA 3UEZA 4FQIL 4LIQL 3ETBF 3LZFH 2HRPL 1N5AB 3EJZD 1F4YH 1U8HA 4HS6B 3RBGA 5JTWA 4QT5A 2H2SD 3T0EE 1QPPA 2QSVA 5E8PA 1UM4H 4UT7L 5TFSH 5D2LE 1NGWA 4NRXA 3L3KA 4EI5D 3NA4A 5DEGB 3MTRA 1A6ZB 1AE6H 5D7SL 4ZFGL 4O58H 1LO3L 5IB3A 4HQQL 4OCSL 3EFFA 4W70A 4HWBA 3GBNL 3M8OH 5TF0A 2RCSL 4NQSA 2XZQH 3ARVA 1JZ2A 1MFBH 2YK1L 3FQXA 4UDUA 4MD5B 3IU3B 5C0RL 5IM7A 1MJ8L 5B38A 5IFAL 1WAAA 2W91A 3D48R 4P23A 5F7FA 4NC0B 5F1KC 2R39A 1UM5H 3FFCD 2R1XA 1U36A 3SN6N 2APVA 1J88A 5EUOA 1IEBB 1NCCL 5IQ7H 5BVJB 4X6FA 3U4AA 4GBXC 3FMGL 1EHNA 5TE7L 12E8L 4LPYA 1DBMH 2HTKD 4BSVB 1MJ7H 3QB7C 5K9JH 4OD3L 3BKYL 2R9HD 2V2WA 5I1GL 2IH3A 3KPPB 1YPZF 4KKCC 4GG8A 2WBJA 1ZHKA 3K3QA 1B88A 4OKVA 3GO1H 1HILB 2ESVD 3L95B 4M1GL 4XZUA 3SJVD 2NX5B 2P45B 3WNOA 3CH8A 4NN6C 1HEZA 3G6AA 3LS5L 1A6WL 1F8TL 1RIVL 2AXFB 4UNVA 5JPMA 2XZCL 4CL7A 3RFZC 1BX2A 4LPXA 2MQCA 5JO5A 5MHSD 1DQDL 3RDTD 3ULUE 4U1HA 3QWQB 5I1EH 2YD8A 5FF6B 1AXIB 2XKNB 2G60H 4LHUB 5JW5B 1J8HE 2V17H 4YDKH 1FBIL 2Y7QB 4IHOA 4C56E 3ZT7A 3IFNH 4UINL 4ETQB 1J1XL 5ID1A 4W6XB 5FYLE 4PLJC 3LB6D 5JHLH 1T20B 3F58H 4NM8L 4J12A 1BBJA 2P5WE 1FQ9C 1A4KA 5E6ZA 1XH3A 2KPNA 1K9TA 2MCPL 1G0XA 4K8RH 5SV4A 2XG4A 1NLDH 2VQTA 3QUZB 1JN6B 5GIRB 5FA4A 5E6YA 4XNXL 1I7ZA 1D6VL 2UYLA 1KCSH 4WEBH 2I9TA 2BCKA 4MHHG 1HHKB 3V0AC 1TNNA 4ZFZB 5F88B 3OJVC 2EICA 2EIZA 1FL6A 2VB5A 5TDPB 4BZ1H 3S5LB 2DYPB 5B38G 4BQ8A 1MFCH 3BP7A 2A73A 5DMYA 5MEQB 4M93C 1I8LC 4WFFD 1ZWIB 3N1FC 4WUUB 2IMNA 5DJYA 2X9XA 5E9DA 3BKMH 4PJ7F 4B41A 4V1DA 5CWSA 3MXWH 3P77A 3VGBA 4ENED 2PR4L 3VFNA 5EU5B 3O6ML 4KHTL 4J3VA 4NPYA 1JF1B 4N0UE 4UT6H 5D9SA 5IG7A 1FZOB 4RMSA 4Q6IC 4L4VB 2I26N 4HPOH 3TVMA 2VMFA 5ESQB 4YNYB 2D0GA 4AEEA 2RGSA 3G6JF 4X7EC 5ISZA 1H0DB 3QO1A 5KJRH 3KDMB 1F2QA 2VLKA 2YC1B 3Q5OA 3MRNB 3RNQB 5DQ9A 4XPAL 4AEHH 1ADQL 2DTML 2WIMA 4NC2B 5KSBE 2AAVA 3W11D 3B5GA 1MRDL 5HJ3A 4DZBA 1G7QA 5FV1L 3NA9H 3UCRA 1I1AB 3QDJB 4YWGH 2ICWA 5I15L 4NRYB 2FYYB 4XC3L 4X8JB 4UOW1 1INDL 3C9NA 3QUXB 1FVCA 3WJJA 4CN1A 3PNWA 3WXWL 3B8SA 1CFSA 3MOAH 1HSBB 3FFDB 1LEGB 4YC2B 3VFMB 1U3JA 2MMXA 3BIAX 5DD6B 5BS0B 5B3NA 3BPLC 2PYFA 5J13C 5GGVY 4IRZH 4OZFA 1II4E 4HIXH 2ZJSL 3IDGB 1J05A 1L7IL 1DN0A 3MRDA 5GS1A 2YXFA 4P99A 4POYA 4GS7B 2R0LH 2EXYC 1KF9B 1PDKA 3AREA 5CP3H 4JM4H 3TH3T 1CLYL 3PJSA 3MRFB 2CSPA 4ODXA 5DFVD 3ZKXC 5JQHC 2BY3A 4YXLH 3JWDC 4TVPH 1TJGL 4YHOH 4ALAL 5CD5C 2DD8H 5FYKU 5IMKA 1JFQL 3C2SA 2JJTC 4C4KT 1IKFL 3SDXE 4K2UH 2C26A 4XPGL 4NQXB 4JY4A 1UKSA 1CCZA 2HFGH 1A1OA 2R56L 3UC0L 4KK5D 3I2CL 2OR8A 4S1SL 2GK2A 5SX4I 3QUYB 4OKDA 4HGWA 3V5DA 2BSTA 4HKZB 4YUEH 4G6JL 3LHPH 4KVCH 3UYPA 2BNQE 1X4YA 3DYOA 4PJEF 1UWGL 1N6UA 2QHLA 3U9PH 1DBKH 4Z76A 5I1LB 1CG9A 3HZKB 1BP3B 3KS0H 4LCWE 4RFNC 1MREL 1FZJB 4FQ1H 1QKZH 4PV9B 2B39A 2OCFD 2EDYA 2C4XA 4ZUSA 2EYRB 3QPXL 1CD9B 3GIZH 5D72L 5ALBL 5F1OB 1P4LB 3GGWA 4NDMA 2PETA 4YE4H 1DQLH 2ERJB 4HEME 2MCG1 3CH1A 2EC9U 1F4YL 2F53D 3FOMA 5KS9E 2JCCF 3KJ4B 1JYNA 1TQCC 4OZFG 2RFXA 5DEZA 3PUCA 3WL9A 2VLME 3OG4B 3RGVB 3FT4A 4OFVA 1UM4L 1BVKA 5TFSL 2D31A 4PJGF 1MFNA 4IMLA 2DLHA 3UYRH 3V6ZB 2CH8A 2EE3A 4AIOA 3H6JA 1YMMA 3PL6C 1AE6L 2DBJA 2JJSA 5FOJA 5L2KE 3MJ8B 3E6HB 4MQXC 3ARBA 1GGUA 3BFOA 4JO2H 3Q3GB 1A7QL 4MNQD 4UBDC 1KXTB 4LLUA 1OCWH 2CDFA 1H9VA 4P4RA 3I6KB 5GZNC 3EW3B 1AXTH 4NO0B 2IPKB 4K7PH 1KEML 1NGXA 1V3KA 4KDTC 1CDJA 1U8HB 1JGUL 3QJHA 5C09A 2C3VB 1CGXA 4D0BB 1Y6MR 1S9XA 3D9AH 1YN6B 1QFWH 2FLBT 4QT5B 3ROOA 2A83A 5EOCH 1UM5L 2RB8A 5MERA 3OXSA 5FO9A 1A7RH 3J7HA 4U6VH 4QRPA 1FRGH 5IQ7L 1VSCA 4OFKA 4WI7A 1VFBB 4YLQT 3FN0L 3FZUC 1MJ7L 5E08H 1VFMA 5J1AA 4P2RA 2EZ0D 3WCYA 3T08A 2R2HA 3C6LA 3SKOA 4IRSB 4TUOA 5JW4Q 5C8JB 5DJ0B 5I1IH 5DK2B 2C4FU 4NQSB 4HUUA 1B2WL 2R8SL 3FQXB 4XH2B 4UDUB 1T6VN 3HMXH 5IM7B 5AYQA 2Y07H 4XAWH 5B38B 4KQ3H 5I1EL 3JTSA 1ONQA 4HH9B 2PO6C 4LNVA 5DHVB 2V17L 4PB9L 5DJ8A 5DXWA 3REVB 4OIIH 4YDKL 1TZGH 5CD5D 1A6PA 3WS6A 3ARYA 3QXTA 4DAGH 5H37H 5JHLL 5EUOB 1S3KH 3F58L 1X5LA 3G5VA 3ZYZA 4X6FB 4GQ9H 5IWLA 4NUJA 1WF5A 2PYEE 4PJBF 2X1PA 3RVTD 3MRKA 5DJCA 3WO4C 2IH3B 1KENH 1NLDL 1U8NA 3IDNB 4GG8B 2WBJB 1ZHKB 4OKVB 5AYUH 4WENB 4XZUB 4PRIA 2AGJH 4FTVE 4G8GD 2E9JA 4OSUH 4K07A 2I5YH 5GGRY 4KTEL 3AMKA 1IM9D 2BMKB 4MJIE 3G6AB 3JWDH 1EUUA 5FM5O 1BX2B 4JY5H 5EA0H 1R5WB 5IT2H 1YNLH 5JO5B 4UNUA 4BK4A 3U2SA 4U1HB 2AJXH 4QY8A 2YKLL 5BO1H 1WIUA 4KJWC 1FYTA 4PPTA 3VDAA 5KVEL 4M00A 3MGAA 2AI0L 1DANT 3BKML 4IHOB 5FUCC 4LOUC 4JKPL 5ID1B 2UWEB 3PV6A 4OZGF 3MXWL 1JNJA 3D3VE 3W81A 5EULV 1BBJB 5BV7B 1A4KB 5D5MA 2B2XH 2K9UA 4M5YH 4I3SH 3VXUE 5I0DA 5I30H 1T2QH 4UT6L 3TZVC 3FQNB 1QRKA 2ZG2A 3RVWC 1YPZA 2E6JA 2FATH 5AAWA 4HPOL 2UYLB 1HHGB 2QKIA 3BHBA 3B3IA 3BE1L 2BCKB 2Q3ZA 3NCJH 5DC9B 1VFUA 1YEIL 5HHOE 2EIDA 3OR6A 4MAUL 3VRLF 3B9KA 4MQXD 3C08H 3LQAC 5KJRL 4L5FH 1QR4A 3S7GA 3BP7B 2IQ9H 4J6RH 2PXYB 3P9MB 5IIEA 5HHVL 2A73B 4WW2F 3QDGD 4UBDD 4AEHL 4K3JH 1SMAA 1KEGH 3P30H 5DJYB 1IKNC 5E9DB 2Q3AA 3NA9L 4YWGL 4MMXC 3VWKC 2IGFL 3OGCA 1VFOA 4V1DB 5CWSB 2IJ0C 5JA9A 3P77B 1CICC 4RGND 2HJLA 1YECH 2BY0A 1GC1H 4LAQL 1N59A 4MSWA 3K0WA 4NPYB 3FT2B 2O5YH 4Z7OF 2PW2B 5HGGS 4DGYH 4EVNA 1YQ2A 4GKNA 2P48B 3IAPA 4HIXL 3TVMB 3V5HB 3O4LE 3FZUD 3HG1A 5D1XA 2ZKHL 5ISZB 1E4XH 4P5KB 3QO1B 3KPLA 5IBTH 2VLKB 5DMGC 2R0LL 4JM4L 4P5TD 3WHE1 3UJIL 3WIFA 3QH3A 4KPHL 4KJYA 1FLTX 1RZ8A 4PRHE 3IKCA 5D1ZA 3U82B 4YHOL 4KK6D 5KSAC 1OGAD 5HJ3B 2DD8L 3JBG7 4PJ7A 1BMGA 5L8LB 4WWKA 3C9NB 3QHZH 4JDTL 4K2UL 2CRIA 3PNWB 3JTTB 3B9AA 5M94B 3HAEA 1CFSB 4BJLA 3CFJA 3SKJH 2HFGL 2Y23A 4ZO6A 3T0XA 4Z7NE 1JNLL 1G1YA 1Q9KA 5ALCL 1X7QA 1NKOA 3U0PB 3HUJA 1R6VA 1CGVA 2PYFB 2V7HA 4OZFB 3QAZB 1MCPH 4XPTH 4JM2D 5C0BA 1Z9MA 2H45A 3LHPL 4KVCL 5HGHA 1WC7B 4GT7A 4OGYH 4QHNA 1J05B 4LMQE 1DN0B 4MA7H 5GS1B 2UZXB 3EBAA 1NUNB 2DQCL 3U9PL 1DBKL 4TNWF 4FHBD 1M4KA 1FE8L 3AREB 2AVGA 3P4LA 1GOGA 4ODXB 2Y25A 1DBAL 4JFYB 3WLWD 4EBQH 5AEAA 3IETB 4LNRA 5D2NE 3SGDI 3ARWA 4MAYD 1JWSA 3GIZL 5E8EA 5BOPA 5IMKB 4YHPA 3DV4A 4YE4L 5AG9A 1YC8A 1DQLL 4WCYH 1CFQB 3LN5A 4AG4L 1ADQA 3WDHA 3KVQA 5FGSA 4JY4B 4QOKD 4QLRA 1KLGA 4UOW0 3WEXB 2A6DA 4FQHB 4HGWB 1MHEA 2BSTB 3D18B 3DRTA 3QI9A 1GZQB 4J3UA 3TA3A 3DHMA 4G9FE 3UYRL 3SOBL 1ZT7B 5HDQH 4Z76B 5HYJB 5C0AD 3RZCB 2A38A 4JHWH 4HUVA 4JO2L 2NZIA 1XEDA 4WFED 5F7LB 1OCWL 4ZUSB 1UVQA 1DBJH 2GW5A 3PWPE 4NQEE 4WHTA 5HGAA 1AXTL 3W9DB 3ILPB 3GGWB 2ZG3A 4K7PL 1NMAL 1ED3A 3HAEG 3MV7D 3QHTC 3VA6A 1UXWA 1JPGA 3FOMB 2HTLC 2KUTA 3O6KH 4Y2DC 2Q76A 4WUKH 1ZA3A 3B9KC 2RFXB 4JZJC 4LLQB 4Y16D 1KCRH 1BEYH 1UB5A 3FT4B 4XMLH 3GJFB 4QXGH 1BVLA 2HT3C 2D31B 5HI5C 4JG1H 4M02A 1HDMA 1FRGL 1MRFH 5EBLA 3V4UH 4IMLB 2ZSVA 5EFIB 3TYFA 1YMMB 3V5KB 5E08L 5DJ2B 2O5ZL 3ARBB 3RNKA 3EYFA 2OJZH 3H3BC 2B5IB 3QFJE 3UJJL 4NP4H 4LLUB 1FDLH 3MV9E 4YBLB 4U1KA 5I1IL 1F3RB 3ARXA 4OFYD 5DMGD 3NAAH 2CUMA 1M05A 2ITCA 2NY0B 3HMXL 4JJ5A 2Y07L 4TSCH 1KT2A 4KQ3L 5LBSH 1FC1A 2P49B 5C09B 15C8L 3H2WA 4HBCH 1S9XB 1QR1A 2LVEA 2JCCA 4LRNH 1GL4B 3ROOB 2A83B 1TZGL 4HJ0C 5MERB 1Q94B 2FO1A 3WKNA 2APBA 5FO9B 4PJGA 2QR0A 1S3KL 4QRPB 1KIRA 4M6NH 3D0LA 43C9A 4GQ9L 2FRGP 2HMID 5FDYA 4NJ9H 1K4DB 4RA3A 5FDWB 2RR3A 3BKCH 5J1AB 3EDFA 4P2RB 1A6AB 1KENL 1G7LA 3ECBA 2R2HB 3C6LB 3SKOB 1A3LH 1WK0A 2AGJL 5IMMB 3GSQA 3SCMD 5KVMC 4OSUL 2EE2A 4Q2ZB 1HH9A 4Z7QE 3DX6A 3V6BR 2EYSA 4HV8A 5EA0L 1YNLL 2GSGA 4Q9RH 2AJXL 1D7FA 1UZ6E 1IGJA 5BO1L 4PG2A 4G6AD 4QGTA 3S88L 5I19H 2VJXA 5E5RB 2ADJA 1CDUA 4C55A 5IMOA 4GQPH 5SWSD 5B8CC 1ND0A 1FIGH 4AQOA 4NUJB 1X5XA 4S1DC 3QP3A 4M5YL 4IMKC 4UNTA 2DI9A 3WUWA 4EI5A 4X4ME 1T2QL 5DJCB 1H8SA 2XA8L 3QCUH 4AENA 3DX9A 4ONOA 4RNRA 2B7DT 4PRIB 4KRPD 4U2YA 2XT1B 1EXUB 4M5ZH 1G9MC 3L6FA 3TFKC 5CZVH 3VXQA 3ZKMD 2GUOA 2PTTA 1QRND 3CVHL 3C08L 4L5FL 3T2OA 2NY3B 2ICEA 2IQ9L 1JF6A 4J6RL 3TO4C 2D7NA 3AY4C 3V79C 3GI9H 2XKUA 5CILH 3D5OF 4QY8B 1KBGH 1KEGL 4IBLT 1FYTB 3P30L 2HT4D 4KKBD 4LKCA 2D2OA 4E42A 1Z3GL 3PDOA 4JPVH 4P2QE 3HE6C 1A1MA 3I6GB 3C5JA 4KGLA 3PV6B 1S7WA 4HDIA 1PFCA 1I1YA 1T1ZA 3FFCA 2XTJE 5J12C 2FR4A 1GC1L 5FHAL 4PJBA 2RBLA 4N5ED 2O5YL 3CMOH 4GAGH 2HT3D 4DGYL 1YPZB 2QKIB 3PHQA 3BHBB 3B3IB 3MRMA 2N7AA 2VE6A 3S34L 3UZEA 3ORJA 2ESVA 2IPUG 1T0NA 4FXGA 1NDMA 3TIDB 5IBTL 2ICES 5IIEB 2OTUA 3L5WB 4U33A 3VXSD 3RDTA 4YEFA 3FL7A 3ZTJH 3D39A 1VB9A 3CC5B 2WV3A 3VXME 1DCLA 3OGCB 4ZPTA 1WFOA 5IOPA 4OZGA 3WUWG 1JNNH 2HJLB 3MV8D 3MFGB 1NSNH 4LHQB 1N59B 1TVDA 4MSWB 5FUOH 2APTA 4HJ0D 2EDKA 3BEVA 1IGTA 3CPLB 4QHMA 3PGFH 2X4QA 4KI5C 1MCPL 3LQZB 4XPTL 4EVNB 1S9WA 4JCMA 4OGYL 3ULVD 3FO9B 3KPRB 5T1KD 5EO1A 5J9PB 3DYPA 3HG1B 1DUYA 1N6QH 1U9KA 2CLZA 4NCC1 1HK6A 4LLWA 3KPLB 3P2TA 2EECA 5GGUA 2P44B 4MB5A 3WIIL 1OT2A 1A3RH 3WIFB 2E7CA 3QH3B 2DQHH 5CJXA 1RZ8B 5D1ZB 3IKCB 5JHDA 4YH6A 4KQ4H 1D5IL 2Q20A 4GOSA 2DLEA 1ERNA 1DUZA 4PJ7B 3HRPA 3GIVA 5IQ9A 3CX2A 2OL3H 5DMKA 4WV1C 5IEHB 5AWNH 4H5SA 3ULVH 1Q9KB 2X89A 1X7QB 2V7HB 3O9WB 2YD2A 5I66B 5F7NC 4ZXBA 4QHNB 3T3PE 4DJMA 5HYEA 4JM2F 5ECJE 1X5AA 1S7RA 2ED7A 2YUZA 4FNLH 4K3HA 4PJFF 4QXTB 4W6YB 3G6JB 4S10A 1KIQB 4JHWL 4PJ5E 4M61A 4HWZA 2FJFB 3EJYD 4P9HC 1QACA 3B8YA 3BH8A 4S1QL 3CDYA 4PJHA 4LNRB 2HYMA 1DBJL 1JWSB 2CGRH 2Y72A 5E8EB 3WHE0 3CGTA 2VITA 4HJJH 3ZE0F 1NL0H 4LEXH 5CP3A 4TUJA 3HNTH 1T21A 3LN5B 1I8IA 3RWHA 4GRLC 1WWWX 4HUXA 3O6KL 1HOCA 1A9EB 1HQRB 1KPRA 1KLGB 3UTQA 5C2BH 5J4MA 1KCRL 1BEYL 2HLFC 3TJHD 4XMLL 2A6DB 1MHEB 4QXGL 3DJ9A 3QI9B 2V5SA 1MRFL 4JKKA 4M7JH 3L5IA 4XP1H 3GM8A 4WTXA 1NGZA 4U3HA 2OJZL 4HUVB 1M6OA 4JB9L 2YD5A 4UU9B 4X6DE 4NP4L 4PLKC 4DEPB 1FDLL 3SGEI 4EQ2A 2ZUYA 2R2CA 4WHTB 5HGAB 1GZPB 3NAAL 4KROB 4TSCL 1F58H 4Y4HC 2JB5H 3MBED 2HFFA 2W38A 4F9PA 1JPGB 1T5XB 4GXUM 5LBSL 1GGTA 5SV3A 3X3FH 4HBCL 3FB7A 2Q76B 4LRNL 4JANA 5KTEH 2XOTA 4JFDD 1T7WA 1A0QH 1WIOA 1UB5B 5DRNA 4ZAKD 4JREC 3VGAB 1AGEA 1BVLB 5C07E 1OD9A 4OV5A 1CDHA 5EBLB 3JWOC 2JELH 2ZSVB 4PJEB 1IAIH 3TYFB 1IC4H 4FN0A 1MELA 3VA2C 1BJMA 4IEFB 3RNKB 3EYFB 3GB7A 3RY6C 4FOMA 2PCPA 3C09C 2UZYB 1A3LL 1PKQB 3D0VB 1T7ZA 4N0RA 1WICA 4OFIA 1SEBA 1OAXH 3QXDB 5IMLB 3U9UB 2LAAA 1IFHH 4AH2A 2ITCB 2NLJA 4JJ5B 1MWAH 1RJZA 1KT2B 4Q9RL 1LP9E 1YUHA 1BIHA 1DP0A 4E41D 1OSZA 3LDBB 2JCCB 2F53A 5ACMA 5TE4H 3UBXI 2BVOA 5C0JA 1IMHC 2X70A 2AXHA 4LGRB 5I19L 4OCXH 4OLZH 3LKNA 3RUGF 4Q9CA 2DB8A 1DVFD 4PJGB 1U8JB 3T3MF 2QR0B 2VDLH 4MXQD 3D0LB 43C9B 5F7DB 1FNHA 4IIQC 4M4RA 4LHJB 4DOHB 2FHCA 1NCTA 3MLSH 1G9EA 4E0RA 3BVNB 3ECBB 4J1UB 1MCCA 1YQVH 3QCUL 3JVGA 1NGPH 1C5BH 3GSQB 4M5ZL 4JO3H 5B3JF 5CZVL 5I8EA 5E03A 4PJDE 2ZUVA 3RVUC 1RUPL 2VQUA 1U95B 3MLPA 1HH9B 2OXHA 3DX6B 3ELAT 4H25A 4NKOA 1U91B 2EYSB 4HV8B 2AK4B 1YEGH 2GSGB 1UEYA 3W39B 3C60D 5CILL 5L7XL 1KBGL 3T1WA 1S7QA 5DA4A 4R9HA 5HGDA 4IS6A 4JPVL 1PJ9A 4H88L 2ARJA 4NZUH 2ADJB 5IMOB 4MZ3A 3HMXA 5DI8A 3I6LD 1ND0B 4D94A 1DBBH 1OQOA 2B20A 4WO4A 4P59L 4DZ8A 1FL3A 4DGIH 4OZHB 4AEIH 1GHFL 2W0FB 4EI5B 4HIIA 2NY6B 3CMOL 4GAGL 3TV3L 5GQBA 3DX9B 4RNRB 2VUOA 5DUMH 3HA0A 2CPCA 5T5FH 2CR6A 4YFEA 5C0CE 3VXQB 3L6FB 2PTTB 4OTXH 4LBEA 4LKXB 3V6OC 4JDVB 1FFQA 2BVQA 1ZV5A