3ZHNA

Crystal structure of the t6ss lipoprotein tssj1 from pseudomonas aeruginosa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
PPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PA_0080
publication title Structure of the T6Ss Lipoprotein Tssj1 from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12790 T6SS-SciN Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zhnA00
4A1RA 3ZHNA 4Y7OC 3RX9A
chains in the Genus database with same CATH superfamily
4V1DA 3VA2C 1NGWA 1K2DB 3TCXA 2W91A 4RMWA 2MTAA 2HVKB 3ZOAA 3BQUC 1QA9B 5C0CB 3QRLA 3QI9A 4Q4IA 2H6UA 1L7IH 2BSTA 2CBTA 3ME0B 3KXFE 4FLQA 5FCSH 5INCA 1G1CA 5FOJA 2PCYA 3IF1B 5GS0L 1ACZA 1XSOA 4HHGA 2D9CA 3MUGB 5KS9F 3MV01 4QRRD 2GVYA 1YEIH 3PQYE 4RFNB 5FUOL 4YX2L 5D1ZI 1NTDA 5F0MB 3GBNH 3EO0A 2XRAH 4MNQB 3IFLL 4NN6B 1XEDA 4BKLA 2F1BA 3U0WH 3VRIA 3CUPB 4JJHA 4HUKB 2HTLC 3QORA 2FT6A 3IVKA 3AROA 5ECGA 5F1NB 3LKSB 3J07A 4L4TE 4PJAF 4NIKB 5TF1H 3CZGA 4YHLL 3L8QA 3FB6B 1K4DA 4Z6AT 3QFJD 1F45A 3TO2A 3BYYA 2LE9A 3M8OH 5A3ID 2A83B 3PWVA 5IVNA 1IEBA 3QDMB 1IC7L 3DIVA 5KSVB 2VN3A 3AVEA 2A77H 1X5YA 4F8OA 5I17A 2E76C 1MWOA 5IV2B 1K8DB 1S8DB 2XKSA 4LLUA 4UI2A 3V0WH 1SJXA 3H1ZA 3OL2A 1MRCL 3WXVL 6FABL 5EEVA 3CZLA 3MOAL 4HD9A 4YDKL 1S7VA 1HIMH 2OSLA 2EC8A 5EB9A 5IMKA 3RWDB 3FQ1A 1SBSH 3DK0A 1Q0YL 2X0VA 5D7LD 3UYPA 1Q9OA 3IDYB 2HG0A 1VCAA 4XCFL 5HD8C 1DO6A 4QRRA 3HFFA 2WBXA 1N0XH 2QHRL 1JK8B 2X4QB 4U2ZA 3TBVB 1M1SA 5T1MA 3HVDA 4G7YL 1H15B 3K0YA 3N06B 4JQVA 2BVTA 1YPZF 3ARXA 5DSCB 3EDJA 5IJCC 3ZT7A 2X70A 4H8HA 2NRDA 1TPXB 2NY2D 1HK6A 2FHFA 3TIEB 2Z4TA 4FRWA 2FL5B 2XWZA 1CR9H 4P3CH 2NTSP 3G5WA 2UZPA 3MGTA 3GI9L 3ELQA 4BFGA 3NCJH 3IJYB 1HHHA 1UG9A 2CO7B 4G8EA 4JY5L 4UM8B 1Y0LB 1YN6B 3N41B 2EDMA 3IGLA 3MV9D 2QHLA 5GXBB 2UY6B 4ZUWA 4MMZA 5JPMB 1U58A 3MBXL 5CINH 1MCWM 1R9FA 1FYTE 5F7BA 1NLDH 3ZTEA 1CI5A 3V9EA 1HINL 1E4KC 3GZPA 3T3PF 3MC0A 3PL6D 4Q89A 3FN9A 3TONA 4H8VA 3LS4L 3N44B 5J1SC 2NX5B 2Z31D 4HF5L 4N26A 4Z8FL 1IFHL 3BUPA 4NZJA 3KE0A 5LAPA 3T2QA 4HQQH 5D7LA 2YJQA 5IFJB 3VGAB 4QIRA 4ORZC 1P6WA 2BIQA 1MCIA 2UXFA 4KAQH 3TL5A 4BH8A 4DZ8A 2OW7A 5DJDB 1LYQA 3EIFA 1JZ7A 1V3LA 2F53D 3A23A 5L0QC 4OLUL 3NFNB 3DYMA 4RDQF 3GIVB 1NDMA 2JKWA 4R7XA 3T3PE 2N7BA 3EYUH 4NO5A 2YBRA 5F96L 2A6KB 4BFIB 1A1MB 1BQRA 4JCWA 1MUJB 3CFKA 1L0QA 3O6MH 4ELMF 5ERWA 1UM6L 1CICC 2NDFA 3E80A 4KK8C 3V6FA 1G7HB 1NCUA 3O3AA 5FO8B 1R5IA 1A4JB 4R5TA 3D25B 4HUMB 4ZSOB 4PJDB 1VADB 1ZXQA 3ZE0E 2JCWA 3AG4B 5C0GA 4M4PA 3MV9A 2PXYD 3VTMA 3WIHA 2AQQA 1YY9D 1TTRA 3QQ4B 4NZRH 5CSZB 5D96B 4ZDHB 4OV6F 43CAA 1IGIL 1PJWA 2EYRB 4HPOL 3TBBA 3V55A 4P4KB 4I89A 1F4XH 3IMSA 4QHUA 4WY7L 4P3WA 4PRNB 2NYYC 3ARBB 1DVSA 3DROB 3PL6A 1YO4A 3CJJA 5A6LA 4DP0X 3WEAA 4LARL 5CCHE 2Y6SD 4LOFA 3RGVD 4XT1C 2Z31A 3L9RA 4N1CA 4NGHH 1UWGL 2FYYB 2EXSA 4BFJA 3MJ7A 2MTPA 1YEKL 1RJYA 3FU7A 1H3PL 5C2BH 1A7QL 5FYKU 1NMCC 4LHUD 1U3JA 2G3MA 3L3GA 4X6BA 4P23C 4XN7A 1KLFB 3APCA 1F3JB 2F53A 1PG7L 4MBOA 3FC8A 3ECQA 1ONQA 3QFDA 1HSAA 2DQJL 3QJQB 5E8PB 4WHYG 1FFOB 4L3AA 2CUMA 3TBWB 4XCYB 4M03A 5CMAB 1KZYA 5B4MC 2N0KA 1YDPB 1QVOA 5EBMB 5ISZD 5HDRA 1QWHA 2ZWSA 4XC3L 4K8RL 3L3HA 1QBMH 1HHKB 3CCHB 3SODB 3BKJH 1NPJA 5MEOA 3N1QC 2RFXB 2K3TA 4UCFA 3FRUB 4MCNA 4IEFA 3JV6A 2J8UF 4U0QB 2FECI 2TRYA 2V3FA 5LGJB 4YR6B 1CE6B 3EJSA 2BZ7A 2D7PA 3GJFA 5KBKA 3AUWB 3ULUD 2CBPA 4O4YL 1LEKA 2EH8H 4S1QH 4PJ7B 4LBAA 2XN9D 4IJTA 3KEHA 3J8F7 3FO2A 4M8UA 3MUUA 5AOIA 1AR1B 3BQVA 3CFDA 2KUTA 1FH5H 2KHAA 3BUQA 1MCDA 3W39A 4LHUA 1T2QH 2NY0C 3NABH 1QX1A 1DJHA 1QTPA 3EO1B 3GSOB 2M83A 1FCGA 4OFPA 1CFMA 1GOHA 4NWTH 2G0KA 3LRGA 5D4HA 3SBPA 2VAAA 1UJTA 3HS0A 3LB6D 4L1SA 4G71B 5EO9B 3TM6A 5AZ2H 2GK0B 3BUYA 2IQAA 4IJ3C 4PSPA 1J9QA 5HHMB 3FYIB 3AG2B 5EU5A 4EBQL 1XH3A 4M6NL 2VDQL 5LGHH 2VZUA 3N40F 4OLZL 5ISZA 1BF8A 3VXPA 2MJWA 5ICXA 3EUDA 4LVOC 3W0WB 3QJHB 1KTLB 3FOLB 4X8JB 4Z77B 3T0VA 5HGBA 3UTSD 1S9VA 4Q52A 1TTFA 4WHCA 4GP4B 1E43A 1FORL 2A6DA 2AF2A 5D7JC 5EZLA 4G70B 3MA9L 1F86A 5TDOA 3VFOB 5T3XD 1DVFB 1NEZA 2VB5A 1P5UB 3TJHC 5J0BA 3LSOA 4XP4L 3I9GH 3BT2H 3RZCB 5EDSA 2WZ6A 3LPOA 3M1BB 3BMWA 5I19L 4NN7B 1E27A 1XZ0B 5M94B 1U21A 1DANT 4X7TA 4GXVH 1IO4C 4KZDL 3IJEA 5KVGL 5E24E 1S7TB 5F72S 4H40A 1AI1H 5EC2A 3ZVVA 5DRWB 1CIUA 5EOTB 4WEEA 2AZAA 3VXOA 1KGWA 3M45A 1MFEL 4J3BA 4FNPA 4OCWL 2XQYA 3MRQB 3PXLA 1MHPL 3CPUA 5DD5H 3TVMD 2OXHA 5SWZD 1LD9A 2XG4B 3NQIA 4FTVD 2VERN 4L9LA 4WHTB 1SVZA 3GI8H 1XGUA 4XO9A 4V1DB 4KVPA 1NGWB 2B1AH 2PTTA 1XD0A 4L0ZA 3V10A 4Y4HD 5E2TL 2NY4D 5EEWA 4YLCA 5JW5A 1PG7W 3KGTA 5C07D 1MFDL 4XHQA 5D5MF 3SPCA 1VFAB 1NIBA 2G0LA 4Q6IA 1WIOA 5EO1B 4HJUA 3UTSA 3M07A 3SKUD 1NDTA 5TK4A 3IBEA 4IIZA 3SD2A 4IRZA 5FFOA 3EDEA 3FTUA 3TF4A 4UQ3A 3UDWC 4LOUC 1I9IH 2IFFH 2MEJB 5KANG 4BKLB 1Q72H 3HAEA 2CHNA 3EADA 2ZOLA 3VRIB 5I1GH 1K5NA 3EH3B 1BG9A 3QORB 2ZP0T 2Y1VA 1IBYA 3V5KA 4XMLH 2D0HA 3IVKB 4N1HB 2ENQA 3GJFH 4KUZL 5DVMA 4PJEF 3D33A 4FQIH 3QFGA 1K4DB 2FEEL 3TO2B 3L4UA 3TVMA 3B37A 1X5AA 5SWZA 1L9PA 4NZDA 2XIBA 5J1AA 4FTVA 3U48A 5F88A 5I17B 2VRAA 2WXJA 2DTML 2X12A 43C9A 1ILSA 1MFNA 3T0ED 4YXHL 3V6OE 2ZIDA 4P5RA 4Y4HA 1NCTA 3G3LA 1XCXA 2WB7A 2B1OA 1ZHBA 4Q9QL 1S7VB 1DQDL 3DPBA 2OSLB 4JRWA 5C0EA 5IMKB 5C07A 1A9EA 2WJ5A 2EIDA 4PJEE 2IF7A 4WO4C 4Z78A 1XF3B 2DBLL 4JM4H 4XMTA 1MG3C 2JV6A 4PJ5E 3UYPB 1Q9OB 2JCCE 4M7KL 4MCYA 2R4SH 5DS8A 3F7YB 4QRRB 5EU6E 5FKPA 1AZNA 4JN2A 4ERSH 5CBAA 1GGYA 1UURA 1AE6L 1W0YT 2EIBA 1T22A 1CLZH 2VQTA 2WXMA 5T1MB 3OKOA 1H9VA 3PQYD 5EU7E 4XCEA 5E00A 5F9OL 2X70B 5GIRA 5AB0A 3GWJA 4HH9A 4RH4A 2XNAA 4LCCA 2BLFA 1IEHA 1U41A 4JG0H 1EANA 3U2JA 1RI8A 3RURA 3ULUH 3MGTB 2IG2L 3W2DH 3HUJF 4ZMXA 5TH2A 2UWEE 1HHHB 3ATFA 3QCTL 4G8EB 4NZUL 2EIMB 5BO1L 1UXSB 4XPAL 4RFEA 3P77A 3HEIB 3QFJB 1WZMA 3ZUCA 5FGRA 1E6JH 4MMZB 2ZX5A 1U58B 5CR8A 4FS0A 3CBRA 4K3EH 2JIXD 2YK1L 2R0ZL 3D5OF 4DIXA 7PAZA 2KBGA 4MJ4A 4L8DA 3T0EA 1WH0A 4KRPD 4TF4A 4EI5D 1QI5A 5I8EA 4W4OC 1OAYL 5I75C 1G4MA 3X3GH 1R46A 6PAZA 3WFBH 3ZSSA 1CL7H 1OK0A 5CJXC 3KPOA 5GRVL 5D7LB 1QYGL 1WWWX 5KN5A 4HK3N 3KXFA 4D7PA 4BH8B 1TNNA 4DZ8B 3RIAF 3R8QA 3GT6A 4NJ9L 5KW9H 4YSAA 1U2CA 3T71A 1E9OA 2HRPH 3GSXB 5AAMC 2P46B 2IGTA 2AQ3A 4KKCC 4ZQKA 1L7TH 3PQYA 1NDMB 4GEJA 4FXTA 5FHAH 1A66A 5I8OH 3R1GH 4J39A 4NO5B 3MV7B 5IGXH 1ASQA 3GS0A 4QRPD 3MCYA 2NY2B 4WW1A 5T3XH 3NIGF 4IRZH 3WFCL 4DQOH 3CFKB 4DKFL 5ERWB 3MR9A 2ZXWB 3VXUB 3V6FB 3HAEH 1AANA 3O3AB 3BKYL 1R5IB 4NUJA 4GT7A 2BC4B 3LD8B 3SQOL 3QCVH 3P9MA 1UA6L 4KHTH 4HWBL 3MV9B 3OTTA 2Q5BA 4WTQA 5LHDA 3LMJH 5DD1L 43CAB 3VWKD 1DVYA 3UEZA 5KS9A 1VFMA 2JIXA 1D6VH 1P69B 4QHUB 1ETB1 3RJOA 3TNMA 3O2DA 3L3DA 4OCNC 1FYTD 3PL6B 2XY1A 2AJUH 1UQSA 4NO2A 3SO5A 4AE0A 5GZOC 4YUEH 4EI5A 5IT2L 3BZ5A 4XN2A 3RWJA 3A4AA 1CBVL 2Z31B 3L9RB 4TOYL 4JE4B 3RX5A 1I7RA 3UYRH 4APQC 2L7EA 1FDLH 3MJ7B 4ATTA 3OG4B 1RJYB 3FU7B 1RK7A 3KPLA 3KPSE 1JYVA 1EEYA 1MIML 2VXUH 1ZA6A 3L3GB 1H8OA 5D72L 4QHMA 4X6BB 3BX7C 5ADPL 1H3VA 1EGJL 4RSYA 5MHSE 5KSAC 4LSPL 4XPTL 2PPCA 1ONQB 3QFDB 2XETA 5ENWA 1HSAB 1Z9LA 3O6KL 1KEMH 4HZAA 4G9FE 2V33A 4FOMA 5GJSL 2XTSA 3RYMA 3CC5A 5B39A 1I3VA 3L5WA 4KROD 3CDYA 1QVOB 3ARFC 3N85L 4YC2B 1OTUC 3L3HB 3MLZL 5MEOB 3G6JF 3WFHA 4ZTPL 2PXYB 1N64H 4IEFB 3ET9F 3DHJA 4K3JH 1GZHC 3VWKA 1OV8A 5BV7C 1W80A 3U46B 2NMSA 1PX8A 1IAIM 4BZ2A 4GINA 3CZJA 3RLSA 1MCOL 3PP4L 1FYTA 2J6EL 3GJFB 5HDBB 3Q8BA 1YPZA 3NJVA 5LVEA 1LEKB 4LRNL 4NKDA 3RGVB 2YBGA 4X42A 4LL4A 4X8XA 5AALA 2WM0A 3U9WA 2WINA 4GRWE 3TFKD 4PGEA 4FQ2H 3HC2A 4KZCA 3LXUX 3W39B 2EE9A 3G6JE 3WS3A 4LHUB 3UZEA 3A6CH 2CK0L 5DURD 3RIAK 1FZKA 4PCKA 5AVXB 2OULB 1Y07A 3L7EA 1X5MA 5DC4B 3B4NA 4RBPK 5IVOA 3ARGC 2VAAB 3HS0B 4BK5A 2A0LC 3EF4A 4Y9FA 5ABAA 2K4WA 3WU1A 1M05B 3BUYB 5EOCH 2IQAB 2FJSA 3ZIYA 2XVKA 4N2AA 3WO4B 1XH3B 3RWEA 4NM8H 4MA1C 1BHGA 1LO0H 5HPOA 1C5BH 3Q1SL 5J12C 5KVEE 3VXPB 3IGAA 3UL4A 5ICXB 1UA7A 3B34A 2HH0H 3FL7A 5HGBB 4YBHA 1MVYA 1S9VB 5EZOL 1O9WA 5EZIL 4KPHH 2A6DB 5HVFB 4O2CA 3DX9A 5CZXC 2JKSA 2CKNA 3ZU8A 1X5IA 3MLVL 5TDOB 1SJHA 1NEZB 3LSOB 1WV7T 4YIQA 3IPFA 3QNYB 4XXCA 2ZAGA 1JTTA 2HX8A 5C0AE 2EE3A 5T8IA 4AYBA 2XN9B 1E27B 3O2DH 1N5AA 4X7TB 4HPYH 3IJEB 4ELMA 3IKCB 3TJEL 5EC2B 4MYPA 3TTYA 1Y6MR 4RA3A 3VXOB 4XN1A 1QMUA 1BQHG 3SDCD 1UATA 2OXHB 1LD9B 5AENA 1R0AH 3WKML 3S4SB 4L8BA 5E2WH 4E9VA 1LK3H 2LGNA 4L9LB 2J4WH 1NKGA 3DX8A 4M1DL 4MMYA 5DHVA 5SV3A 1XGUB 1LVEA 4HDIA 5KZCD 2ATKA 5GJTH 5DEZA 1HEZA 2PTTB 4PCTA 1CD8A 4XBEL 4F7PA 1LMIA 3RWHA 1EX0A 3R18A 1CBJA 2KPWA 3TWYA 1RZ8A 4XPBH 4QOKB 3K2KA 5F9WC 3OGCB 2ZAHA 5C0DA 5LXGH 5HGDA 3TA3C 3UZVB 2CDFA 3IXAA 3S88L 4UQ3B 5EEXA 4TQEH 4P07A 1AHMA 3HE7C 3SYAA 3AY4C 2LV4A 2N1KA 4KNSA 1JS4A 3W11C 3HAEB 3K2UL 1NUDA 3G6AA 2CXGA 5C70A 3P4NB 4BZ2H 2Q1EA 3CXHJ 5TK2A 3V5KB 1E8ZA 4OD1L 4GMSL 1WGVA 5DVNA 1WGOA 4X5RA 2R0KL 3O6LH 3U4KA 2DI9A 3SPVA 5B8CC 4IGBC 3P0GB 3AS2A 3E6HA 1I3UA 4NZFA 3T77A 3S8FB 4ZS6C 3SDCA 1WFOA 4U0RB 4O58L 2AV1A 3TVMB 3U0TA 5SWZB 4Z7OF 1BDYA 1UC6A 1JD7A 5J1AB 4WWOA 4FTVB 2J8UA 4FX5A 3OJDA 5F88B 4RFNC 4PCSA 3H4HA 3VX1A 43C9B 2H9GA 3KM1A 2V5TA 1WUZA 2VXQL 1KELL 3HN8A 4OGYL 1XH0A 2CCWA 4Y4HB 3TEYA 2NY4B 3DPBB 2DEYX 4YSQA 1FHGA 4Z76A 1T7WA 5C07B 1A9EB 1VIWA 4Z78B 5CN1A 5DO2D 1CDJA 3L6FA 3X13A 1G5AA 1P4BL 3CVIH 1X7TA 4MCYB 1T83C 4U6TA 2O1AA 5CBAB 1TJGL 2O5NA 4I5BA 3VQ2C 2JLLA 1T22B 1EUTA 1X9RA 4JKKA 1A7NH 1J0KA 3OKOB 3WFZA 4XCEB 5E00B 3AW5A 1DBAH 5GIRB 4HH9B 4NNPL 1YEEH 1F90L 2XNAB 1JWSA 1DFBL 1DANU 1Q0XL 4QGTA 3C6LC 2H3KA 1UFUA 2N01B 5TH2B 3L9BA 3T0WA 4XMPL 2AI0H 1M57B 1TZOA 2JI1A 2AQTA 2V17L 3P77B 4RFEB 1HSBA 3IDYC 1CDUA 3CFIC 1LEGA 3ECUA 3VM5A 3WY2A 5DK3A 1QAWA 2EO9A 2ZUYA 3CLEH 1HYRC 3CH8A 1N59A 5CKGA 4L8DB 2WWMC 3T0EB 3UC2A 3IB4A 3F7RA 2H3NA 4NOFA 5I8EB 2WLIA 1YEFH 2LU7A 1JZ8A 1BYPA 1TPXC 2F61A 5BS0B 5DHVH 3D39E 4KXZI 4ABWA 5IESH 1WC7A 5AZEL 3M1CA 5KN5B 1AY1L 5CLYA 2BM3A 3O4LE 4PJ5D 2W88A 2BOLA 4MQ7B 1WICA 4LGRB 3S37X 1E9OB 4HG4K 3H85A 2F7OA 5JPMC 5DDHA 3PQYB 5KSUA 1FLRH 1JV5A 3INUH 2GTWA 5JXAH 1Z9PA 5CJOH 5IROC 5JTWA 1A8JH 1H3TA 2SEBA 4KNQA 4WW1B 3BCFA 1MF2L 4X5QA 3REVB 3MR9B 2GJZA 1RVFL 4NUJB 1TTBA 1WITA 1OSPL 5D5MA 1F13A 2V0AA 1AQMA 4OCXH 3VGAC 2YD8A 5AW4B 3DUSA 1DJWA 2WXPA 3ULVC 3FO1A 5KS9B 4JKLA 2JIXB 3ECWA 1CPUA 5FV1L 5AEAA 4LU5L 1BWWA 2F8IA 3TNMB 1TJMA 5DS1A 3HE6D 1RERA 3L3DB 4M1GH 4J1UA 4ZO7A 1VGEL 1KBBA 1UQSB 4NO2B 2DB8A 1JRHL 5HYIA 1CDHA 4HSQA 2R0LL 4KRPB 4J3WA 4EI5B 4WCYL 4M9OA 3RWJB 1JGIA 2BVOA 3BZ4A 3V6OA 2ZP9A 3AZUA 1G9EA 4Q9CA 5I1DB 4LDLB 4ZX5A 3BUIA 3KPLB 5C08D 1EEYB 4LP5A 3DX3A 1OLLA 1ZA6B 4PJAB 4PJEA 3WO3B 4DW2L 4QHMB 1XSJA 4PJ5A 5FA4A 2WOBA 3V4LA 3TZVB 1S9WA 3KYKL 2PWHA 4ENEC 4EO5A 4PYHA 5D96C 3L45A 4GIOA 1R5WA 1EO8L 1RZ7L 3FUEA 1OW0A 5J9PA 1W72A 3IMWA 3NG5A 5ENWB 3TEWA 2V8MA 1OO2A 4P4KC 1RJZB 4FNLL 4IOFC 4QRPB 4CMMA 4TSCL 1BXAA 2RH0A 4JFOA 1U6AL 4NYLB 1WYJA 3CC5B 5B39B 2CRZA 2ZX7A 1TYEB 1XGYH 1LM8V 1A7OL 1IFGA 2Y9RT 1NANH 4EIUA 5D2NE 1DJGA 2KZWA 4NKQB 1RPKA 4CAGA 3WFHB 2XQBH 4RNRA 3GZKA 3P11H 2UWEA 2WZ0A 2OJ1A 5D8JL 3TT3H 2X3AA 4X83A 2OMTA 3KH3A 3DJ9A 1ROWA 2HFEA 4J8QA 4O2FA 3CVHL 4S0TD 4A2HA 3HE6A 2EUXA 1FYTB 2I60H 3KPRE 4Q14A 1JBJA 1OGSA 2GABA 4OJAA 2F54E 1HI6A 1JGLH 1YPZB 3CHXA 3IM1A 4FE9A 1OQOA 4NKDB 4MDJA 2DM2A 2WINB 3BGFB 1DZ0A 1EMTH 4PGEB 3TYGH 1UOVA 4PR5A 3VG0L 5E4OA 5C08A 4XXDA 1WFUA 2AGJL 4N2LA 3WS3B 4DSYA 4AQOA 1NBQA 2JJTC 5AW0B 5I0ZA 4HAFA 1H9DA 3EYFA 5DZPA 4HP5A 4X6DF 4IU3A 3VACA 4WGVB 3L7EB 2YRLA 3OKMA 3FCSA 1P6AB 3TA4D 3GRWA 2WCSA 1KBWA 5JQHC 2D4DA 1KXVA 2WIIA 1IEAA 3T3PB 1UD3A 4HUCA 1BVLA 2Z7YA 1MFCL 1SJEA 3H56A 4G9FD 3RWEB 5B38B 1KC5L 2P5PA 1PY0A 3IGAB 4Y8DC 5A2AA 2YHGA 3TV3L 5G4OA 1AR1C 3SE4C 1WO2A 3CZFA 2AJYL 1MN4A 4UMSA 4P5SA 3SPJA 4CN1A 3DX9B 1F4AA 4TSAH 2YMXL 1RZPA 3U6XS 4CMHC 5BO0D 2H6PA 2D7OA 1B6DA 2ICES 1SJHB 4RAHA 5IR1A 4FNTA 1WFTA 4BH7A 1XGTA 3GB7A 1JZ2A 3SE9L 1OIOA 1AG0A 3TIDA 4JY4B 4HK0A 1IT9L 1R34A 3UBXA 1NBZA 4WFEE 3QR2A 1KTCA 1PPIA 3DGGA 3HR5B 4OT1H 1J1XH 4M43H 3U83A 1N5AB 3WJLC 1FJ1B 4JFUA 3OKYA 4ELMB 2Y1AA 3V6BR 4NQED 2OYLA 4HYTB 1HZHL 2DQ6A 4J4PD 1NMBL 4OUUA 5DURB 2YRZA 4KKPA 5CGYC 3NSXA 1DQJA 4JW3A 2X0WA 4L8BB 1TDQA 2IBGA 12E8L 1DVFC 5FYLL 4RWHA 1P5UC 1PF3A 3DX8B 2V2WA 4LBEA 5DHVB 4OD2A 4UTAL 4HDIB 2GI7A 3RHWF 1G94A 1ODAA 2ATKB 2DLIA 3CH1B 4DPBX 1HEZB 5IBLD 2BY1A 4RLDA 3RZCC 2OYKA 4G9FA 4F7PB 3ZKMD 1NFDE 1MY7A 5DD0H 1W0VA 2EDOA 3RWHB 5T1JA 4OI7A 2G2RA 3WL9A 1RIVH 1SOQA 1SXAA 4AGPA 3QGVA 1RZ8B 4U6XB 3VXTA 4LCWD 4R9HA 4F15B 4PRPD 3BJ91 2P8MA 5C0DB 4UIKL 4X7EC 4BRVA 5JR1L 3GGWA 4LIQL 2HLFC 2CDFB 1A8ZA 5CCKH 5FV2A 5IIEA 3Q9QA 3IXAB 4O9HH 5IMMB 3FTGB 4HUWA 2DIBA 1KGCD 1U8KA 2VDOL 1NM4A 4KMLB 5DCCA 3G6AB 4KOBA 4JFZL 3JXAA 1E8YA 3U1SH 5DUBB 4G7RB 2EINB 3DX4A 3OMNB 3JV0A 1FFPA 2QFRA 1BECA 3P4OA 3QI9C 4NQEA 3LOWA 3MXWL 3SPVB 4J4PA 4N0UB 2H6OA 4MKTA 3E6HB 4HUXA 3T77B 3AWEA 4W9HC 3MNMA 3SDCB 3G6JA 3BKML 2AV1B 3U0TB 4JANA 4PMEA 1EHKB 3AT0A 1FRGH 3FXIC 2J8UB 3NCYP 4XPHH 3IE4A 1ET8A 3OB0K 3OJDB 4LKCB 2BMKA 35C8H 4N90D 2H9GB 3Q48A 2EDWA 2X3BA 5KZCB 4YHMH 1SDAB 4B9YA 2XUWA 4UV4L 1KJ2A 3Q5OA 4Z76B 1M3JA 3QORC 2IWFA 4TLTA 2EYSA 3NCYS 1EQWA 2VDRL 2ED7A 1NQBA 1IC0A 3WFEH 2UXGA 3L6FB 4GSUA 4GP8B 4OGXL 3X13B 2AK1H 1E4XL 4LCWA 4TNEA 4WK2B 3WLWC 4ODWB 9CGTA 4PRPA 1YEWA 2LT9A 1FH2A 2XJLA 5A2FA 2UY7A 1B88A 1GZQA 2K7PA 2XTJD 3OAYH 4I5BB 4MB1A 3MX0B 4PS4L 4XO3A 1FZOA 2MPAL 2EE2A 3DHUA 5F7DA 2IQ9H 4G6KH 4K5MA 2BRRL 1I9RL 4HXAL 4L05A 1TEFA 3DV6A 1C5DA 4TQHA 4BIKA 2DIJA 5L2KE 3INOA 3ULAB 1LDPL 1UKTA 3N1PC 1FNEA 4GG6F 4OFQA 5FYKE 5FUCC 1U8PA 2NNCA 1HSBB 1OCRB 3DWTA 3BVXA 1CGUA 4AL8L 3HJEA 2GITB 1G6VK 2BCKB 4QRTB 3U7WL 1T7ZA 4WLCA 3ZE1F 1N6VA 4WTZA 5HXMA 4JQVC 1HWWA 2H3NB 4NO3A 4KVCH 4JO1H 3ZZLA 4RISL 4QLRA 4GXFA 1D6EB 1UOKA 3FQXA 2RBLA 3B2MA 1WC7B 4A04A 4F5CE 1LK2A 2AVGA 1I8LA 3MBEC 3O0RL 1A3LH 1V7ML 3QIWD 4LCUA 5DRZA 5A3IC 4MMZC 2VN4A 1VLXA 5DDHB 1I3GL 2XWCA 1LWJA 1SZNA 1JV5B 5KSUB 1T6WA 2GTWB 4MZIA 3H9YA 1JK9A 2SEBB 1HH6A 3TT1L 4AH2A 1EXHA 1IC4H 4DGYL 2VLMD 4G6AD 4LHJB 4U6YA 3ZDZF 4GQRA 3QS2A 1G7QB 2YLHA 4PLNC 3FKUS 2GJZB 4PTUA 2E8YA 3MNWA 1AGFA 1OTSD 4NC1C 4O51A 4OAWA 4AGQA 4UMGA 5D5MB 1N6QL 3T6XA 2BVPA 5GS1A 3W38A 1JXGA 3DSFH 1S4IA 2DEXX 4OCRL 3DUSB 1EHXA 3UJTH 4NBZB 3FO1B 5E6SB 1YECH 4ZW3A 3AU1A 1BQUA 2C4XA 4B60A 1WQVT 1CS6A 1FC1A 5KJ4A 4JUTA 1E5UI 1D2PA 1E8WA 4GSDH 3VD9A 4X9IA 3BZ4B 1HESA 2BP8A 2NY2C 3QH3A 5CGBA 3L1OL 2R29A 5DYOA 3SDXF 4GAYA 1NCWL 1SHXA 4ONFH 1JPST 3M7OA 4PJIF 3LPPA 1K6QH 3HZKB 4R4FL 5EOCJ 5GISL 4M6OL 1RIHL 2QVTA 4PJEB 1NSNL 3JWOL 2JKTM 2ROYA 3TCLB 5IHUL 4PJ5B 5FA4B 3AC0A 2G4EA 3L5JA 5IHWA 3APMA 1U92A 3QIWA 2YR3A 5L7XL 1CFTA 1KF9B 4ZS7H 5J9PB 4LCIL 1R5WB 1NOFA 1IARB 1W72B 4JUSA 3KLSA 4PLJD 4B95C 1KGIA 4CVZA 1NAMH 3KYOA 1FE8H 3ZRSA 1KUMA 3PDOB 5L8JB 1A64A 3IDUA 1WEJL 3PL6C 1YEDA 3VI4E 5I1KH 4JFOB 4KMQA 2VRQA 4F57L 2BIHA 3RB7A 4GUOA 1FNGA 1ZCRA 2Z31C 4QDGA 3DDFA 4WRLA 2WTOA 2AITA 1OZUA 4GB9A 4X9FA 2HKFL 3LEVH 1UM5H 2ZUXA 5CR1A 4LDOB 3C12A 4RNRB 2UWEB 4HMEA 5DJ6A 5I15L 1A3QA 1JVLA 4A7TA 1KDJA 1RURL 3P02A 1ORQA 1A1NA 2CHDA 1A9BB 2HFEB 1WG3A 1NMAL 4O2FB 3HE6B 2KI6A 3T8VA 1H6UA 2W65A 3UXFA 1HI6B 3GQFA 4H7VA 3ISRA 2J71A 2Y4SA 1SLWA 4N2KA 5A7BA 4MDJB 4F8LA 1DQKA 1HDMA 4OCSH 3AWFA 4PR5B 5C08B 4MB3A 4XXDB 4YC2C 1QNZH 3HUJB 1PDKB 2F15A 3KAAA 1NLBL 3C2SA 4W9EC 3HTLX 3EYFB 1YY9C 3O4LA 4IU3B 3U4AA 1I8AA 3LXBA 3TEUA 3FCSB 3EJRA 4D9LL 2QSQA 4FQLL 2OMBA 1KCUH 1IEAB 3ZKND 3WIAA 3IWVA 4XMKL 1BVLB 2XIIA 4LHQB 4M7LH 4N3UA 1PZ5B 2FBJH 2BVUA 2Y6SC 1SJEB 2BSED 2B3RA 4LSQL 5D7SL 2KYIA 3FONA 1DDHA 3NJIA 3QUMA 4XI5D 1YJDH 4HIXL 4J3UA 2WLKA 3QIBD 4AMKH 4HIJA 1BLIA 5F7KC 4U4BA 4XNAA 1NCBL 2CU9A 2WSKA 4OGAD 4PRHE 2R8SH 3EKCA 3E3QC 2H6PB 3CLFL 5E8NB 3NVQA 4ZUSA 4GW4A 4QAWA 5IR1B 4YFDB 4AEHL 4DCQA 4BH7B 3GB7B 3NFSL 3OXRA 1SN5A 1ZLSL 3HS0C 4HK0B 4XNYH 4ZUUA 1NBZB 4ORGA 4PFEA 1JCVA 2QSTA 3KPRD 4QJ3B 5KSBF 4ICWA 1UM4H 3NIGB 4UT7L 1S7RA 3P3TA 1ZEAL 3D1MC 2WTRA 2BJML 4R3SA 1DE4A 1ND0A 4Z95H 3WNOA 2R29H 4XPFH 4XP5H 1WWBX 3EHBD 5B1JA 4JZNA 1S5IL 3V0HA 1IGYA 2NY1D 1DQJB 4LB8A 1J8HD 2V2WB 4LBEB 1GKEA 4OD2B 1OZTG 1A0QH 5IBUB 1INDH 2ZPKL 3ULUC 3RVVD 4GJTB 1MW2A 3GMPA 1DBJL 2BSEA 4G9FB 5ALCH 3ULSA 2XPGA 4I1RA 1A6AA 1E50A 2ADJB 1W0VB 3K4DA 4ETQA 2X28A 2PUQT 2G2RB 5FA3A 3WL9B 2UZYA 2EEAA 4HV8A 3QIBA 4YHZH 3ABMB 3FUJA 4M7JL 3VXTB 3D85D 3QZPA 5D2NA 2KKQA 4D0DA 3VXNA 1KBGL 5DMYA 4I3RL 4U31A 4CRPA 3GGWB 2QGBA 2VXVH 5IUCA 1E4JA 2ORBH 1RUKL 5HGHB 2F5BL 3FFCD 1YYMH 3HPLA 4HUWB 4L9LC 5DFVD 2JJVA 3LB6C 4JG1H 3S34L 5A6MA 3F8UB 3KPRA 3WD5H 3U9PH 2HRLA 3ECBB 1W8EA 5JW3L 1OOAA 2R2EA 3F7LA 3LQAC 2DJMA 2EABA 2WQXA 2H45A 4WFED 4A2FA 4WUUE 4JR9L 1FFPB 4NQEB 3P4OB 3QPXL 1GL4B 1OTTD 2VSCA 1ZHLB 3LH2H 4Q6IC 4UUJA 5E6ZA 4HUXB 4GLRH 1LO2H 2V5RA 3G6JB 2FD6L 4ZX4A 1HJBC 1MWAL 4JPKL 3HI6H 4JANB 3OLGA 5EOQL 2P4AB 2NDGA 1MSPA 5DZNA 3EBHA 1J8HA 4UTBH 1CGTA 4LHUG 3ROOB 4OZIF 1PNCA 4H0LC 1QD0A 2YD6A 3I6KA 2APBA 4R26H 4UT9L 4BHUA 5DQ9B 1RZFL 4NAJA 2IC2A 2GJPA 3G6DH 3I3DA 1KJ2B 1VEMA 1MRFH 3VO0A 4FDWA 4JQXA 3V4VL 1PL3A 2EYSB 4WEBH 7PCYA 1AIZA 3KR3L 4AXWA 1Q8MA 4YSEA 2VM3A 2WUBH 2XBTA 1FGVH 3D85A 4LCWB 1N9PA 1IBDA 4PRPB 3CVBA 1QSFD 1YC8A 4NHCH 4H26A 5C0IA 3RFZA 1GZQB 3QUMH 3TVMC 1XCTB 3B7YA 4PV9A 3MCKA 1W6LA 1FNSL 1FZOB 2AJXL 3FFCA 5AOZA 2CCLA 4FYQA 2X87A 5KBDA 4NQVA 4NCC2 4KITB 4NI6A 5F7DB 4C56E 2Y7NA 5GGQL 1KV7A 1OOWA 2CPCA 2X5PA 1NEZG 1E6OL 1IGTA 1N4XH 2A9AA 4XTRD 3DV6B 5F7EH 4YZFF 4Y4HC 1C5DB 4BGLA 3WEMA 2X3CA 1NIDA 1IGMH 3GXFA 3S6CA 3SE8H 2JQZA 1E9QA 4IHBA 1VERA 1FNEB 3PABA 1H5BA 2COVD 4KV5E 5CWSB 3FRPA 5FS5A 5FYJL 3W3BA 4S0HA 1BF5A 1U8PB 5ADOH 4M48L 5DA4A 5J56B 3EOAA 1UZ8A 4A7SA 1I1YA 3A4FA 1Z9NA 1AOHA 2VDLL 4XMZA 1IAKA 2DWYA 2XQYG 5GSVA 1AACA 1D5RA 1GW6A 4UV7L 3L48A 4NO3B 5JMOC 3QARA 1EPFA 3S4SG 3B2VH 3DGDA 4LCCC 1DLHA 1M7IA 4EZKA 1PYWA 2G5BB 3FQXB 1N67A 1NFDA 2DD8L 2B2XL 4P9HH 3H3KA 1N6UA 4K55A 3N40P 3T0XA 3V4UH 5E6UB 1LK2B 4HA1A 1FGNL 1QSFA 4ECNA 2IPKA 2XTJB 4LCUB 5DRZB 3T5WA 3AT8A 2QKIA 3WEXB 4YSSA 1UWFA 4UDTA 1KCLA 1BJMA 3RQ3A 5ABDE 1JK9B 5HHNA 1MAML 3QR1A 1HH6B 3QWRD 5E6RB 3T0EC 5INDA 1KIUA 1QW8A 3KWXA 4O02L 4AH2B 1NANI 2BOCA 4U6YB 1WBXA 2HLAA 4D7BA 1BOYA 4PTUB 3MNWB 4XP9H 2GBVA 3HAEG 2X4UA 1FFRA 1AGFB 4FTDA 4O51B 2EC9T 4OAWB 2BVPB 3VD0A 2F7RA 3D09A 1XL6A 2P5EE 4WKXA 5FYKD 3SGDI 3BWUF 1ILUA 3S36X 3L4CA 1RAMA 3AU1B 3EH4B 5KYXA 1S3KL 2OP4H 4WI3A 3ZL4H 1RP8A 3WE1A 2H1LM 3NEXA 3QEUA 3ZDYE 4JDVA 2NNAA 1J1OH 3TBYA 1NGQH 1VEPA 2AAVA 4BSWA 4CBPA 2HKHL 2BP8B 3JZYA 5DYOB 3NJFA 1MFVA 2GY5A 4N9OB 5D2LF 1JERA 4TNGA 3V8CA 4JO4L 2O5ZH 5ESQA 5EU3B 1KN2L 2YEVB 1UD5A 4TTGA 1OPOA 1DBML 2LHAA 4X5LA 2NNXA 1U92B 4KI5E 3QIWB 4YWGH 2VZOA 2VXSH 4JLRA 1G7MB 4Z7OB 5I1EL 2DMGA 2DW5A 3SOBL 3VGGA 2X6VA 2K45A 5C6PB 4GQ9L 3KYOB 5SX5H 3ZTJG 2DQUH 3M1OA 3QWRA 1YEDB 3I6GA 5CSBA 3UABA 4KRPC 4EI5C 2HKAA 2Y1ZA 1V7NH 3WIIH 2R39A 5JQ6L 1FNGB 1U8MA 1EXGA 3SDAD 5L2KA 2BXZA 3T2NL 1JMXA 3CXDL 1SY6A 5DJ6B 4QPEA 4BQ8A 1GYUA 4Q56A 3IU3A 3OZKA 1L0XA 4E5XA 4GPVA 1AXTH 4AYMC 3MRIA 1ORQB 4JL1A 3SDYH 5E94A 2Y23A 4R0LB 3SEPA 2WIMA 2W65B 4OSUH 4Q9BA 3Q8CA 4LOEA 2F19H 2K0RA 4WFFD 1KEGL 1U9KA 3FZUD 5ACLA 1IBBA 4G59C 3UAAA 2WO4A 4EDWH 4D0BA 1X4XA 1PU0A 1YEGH 2HUHA 3MV11 3JYCA 2JJUA 4F5CA 1N68A 1NIEA 4I0PD 4N2GA 4QKTA 5J13C 4Y9EA 5E2VH 3E8UL 2IH8A 4IBSA 3VWKC 1MIEH 3CN2A 1CLOL 1OGTA 1WFIA 3N50A 4PY7A 2IAAC 4DP8X 3D18A 1B90A 4DKEH 3MGOB 5IZ7A 4LLMB 2N7AA 1TU2A 5AW1B 4R7NA 2I9TB 2H0EA 4I3SL 3B83A 4Z7QF 3MPCA 3DO7A 3BGFC 1TZAA 3FONB 1DDHB 4QXWA 3QUMB 3SDAA 2PP9A 4U33A 3GMRA 4GFXA 1P7HL 4HIJB 4K7PX 4OJFL 4MKMA 3UZEC 4YSPA 4OIAA 4LL9A 1GCFA 3DBXA 1DZBA 4ZUSB 2XYBA 3VMOA 2DMCA 4DCQB 1V10A 4GQZA 4P8QA 1N7ML 2E7BA 3OXRB 3LKOA 4H2CA 4UT6L 1BXXA 5CXPA 3WLBA 3PUCA 3EDKA 4BK5C 1ASPA 1DL7L 4ORGB 4ZUUB 3IXTB 4GKZA 3TP4A 1Z9OA 2R59A 2NY3D 4XBMA 4Z7QE 3OPZL 1S7RB 3WJJA 4F24A 4HCGA 4KROC 5LN8A 4HJGA 3ARDB 1N8OE 3MTRA 4LSVL 1ND0B 1ACYH 5IJVA 3RVTD 2X9XA 3LRLA 1EVTC 1KTBA 4I0PA 4BZ1A 5KBNC 1JGEA 4JZNB 4LLQA 1IGYB 2WQ8A 3TOPA 5ILTL 4RWYH 2O6EA 1KTJA 2UYLA 2YKLL 5K1JA 4IKKA 4GI6A 4ES9A 3VD2A 1MDTA 3LVTA 3ZW3A 5D70H 2B15A 4LAJH 3VNYA 1HL4A 4I9WE 1NCIA 4M3HA 4XXCC 4PRDB 4NAQA 4B5EA 3GMPB 5ES4B 3BRDA 3ULSB 4F20A 3VI4A 1ZLUH 3PJNA 1TKWA 2IPUK 2X4OA 4OJYA 1L0PA 1MFBH 3TFKC 5FA3B 4ETQB 5ALBL 2UZYB 1OAXL 1PLBA 3AG3B 3QIBB 4PJIA 4U1MB 3WV0A 1R3HA 4LKXA 1Z0MA 1Z9MA 5D2NB 5B39G 1TR7A 3VXNB 5DVOA 3POCA 3T2PA 4JCLA 3S35X 2CPUA 1FWXA 2CGRL 3B6SA 3C08H 2WYTA 3HNTH 1Z32X 3K8MA 2R9HD 5FYKH 3VYOA 5AAWA 2WZPD 3KPRB 4Z18A 1OM9A 3MYJB 3BT0A 1A6WH 5A16B 7FABL 5DHDA 4QCIA 4FL4B 3QQDB 4QNPF 4UUJB 4AEIH 5K93A 1CWVA 5BPPA 3FB7B 3PU7A 3EHBB 3CFMA 1RJCA 2VDPB 3PFUA 1OAZH 2NY1B 3APNA 1WBYA 3GFUA 3N1MC 3GSNL 4X9YA 1J8HB 3HMWL 2AABL 4U2YA 1SYSA 4YS4A 2C3GA 3I6KB 2EUZA 2X09A 2AEQH 2LFGA 4XAKE 4EQ2A 5DR5H 4OLXL 4HKBA 4OLVH 5GS0D 2OYMA 5H94A 4OLWL 1TVDA 1CVRA 1NKOA 4JFFE 4QNPE 2HVBA 1DSFL 2J6WA 1E0OB 3D85B 4XX5A 5IFAH 2BDNL 3GK8H 5A2KH 5B38G 2NZ9D 3I2CL 3Q2WA 1EH9A 2UVFA 1HYSD 4Q74A 4H26B 4UQIM 5C0IB 3SDCC 2X53A 3WSQL 3RFZB 2X41A 4PV9B 3MCKB 1LO3H 5ICZA 2XT1B 3FFCB 4KJQC 1LE9A 4NQVB 4YVNA 3VMPA 1UGKA 4TSBL 2WZPA 4DEPB 1Z5YD 3ZE2E 1QASA 4PRIB 1ZANH 4PJFF 1GOGA 2Y2TA 3AB0B 4RDQG 1TQBB 4AGMA 3EGXA 4ABUA 4MXWL 2EKSA 2H5UA 1E9QB 4MHHG 4AEFA 4WUUD 3PABB 3FRPB 3SZKC 4Q9RL 4IM8A 2XXFA 3FPXA 1I53A 4G1EA 1ID2A 2X1QA 4P0DA 1O75A 1UZ8B 3GMQA 2ID5A 4YDJA 3F58H 3QG7H 3SPIA 1GSMA 1C7TA 2DH3A 1IAKB 2A9ML 5FCUH 1P1VA 4FFTA 5GSVB 1HAUA 2KDGA 3G5VB 4YDNA 2C3HA 4BFOA 2X40A 3MA7A 4OM0H 2OYPA 1JOIA 1WTLA 3IMUA 4XVOA 1BBJA 3S8GB 4D3CH 1DLHB 1M7IB 1GGTA 3FQNA 4ZODA 3MRKB 4UNTA 5C6TL 5J06A 5T33L 3C09B 4J7RA 3PHAA 3S3BB 2KQNA 2WNKA 3TBTA 1U33A 1QSFB 1TQUA 1RUQL 5TQ2L 3EDFA 3DI2B 2QKIB 3L2NA 3EOTL 4OF6A 4UDTB 1WAPA 3PPSA 1HHJA 4UOQA 5BNXD 5DFTA 1DVXA 3LEYL 5GRZA 4B7IA 1CTOA 5HHNB 4OCYH 2G3ZA 4JO8A 1KIUB 4XWOC 4CKVX 5INDB 2BOCB 1WTGT 4TUUA 3SKJH 1WBXB 2HLAB 1PKOA 3KYNA 4E9RA 5K59F 1T6BX 2FWLB 3PIQA 3FO9B 4R90L 1ASOA 2XV2A 2X4UB 4X6CF 1Z0NA 1A7RL 2WQVA 4WUUA 1RFDL 4YFLF 1R3IH 4Z3GA 2QLYA 4OZFA 1CZ8H 1KB5L 1S9XA 1NCAL 4M3JA 1IGFH 5KVFE 4JG5A 4XVTL 1INQA 2EDNA 4OU3A 4DK5A 5KYXB 1R75A 4TRPH 3QEUB 4JM2F 4JDVB 1IE5A 2NNAB 1C5CL 3QHZL 4XVJL 3FT3A 3TBYB 1DQQB 2D03L 3ESVF 2OA9A 5FYJU 4BSWB 1OB1A 4GYBA 5EU4A 5CM1A 1GJIA 5AVVB 3KL0A 1OSYA 1BVNP 1JI2A 1G9ML 3ZUNC 1M2VA 4G8IA 4OB5L 1WK0A 5ESQB 3KWVA 4NUGL 4QTFA 4K3HA 1TQCB 1E2ZA 2E9BA 1YQ2A 5F9DC 2P9RA 3VAEA 5IEHB 3W5NA 3OC8A 1UZ6F 4JLRB 3WY4A 3H3PL 3WN6A 3S5LA 5LCVL 1JPFA 5GRVK 3W1ZA 1BFTA 3II3A 3Q6FB 3I6GB 3OX8A 5FXCH 2HWZL 4DP7X 3V6OC 4YHIB 2JB5L 4S10A 3OF6D 1E65A 1E5ZA 4PJ9D 1U8MB 5I8CA 1L3NA 2LVEA 4R7DA 5FW8A 3UX9B 4RZCA 5ANHA 1VFBA 4NLAA 1TNMA 3IU3B 1UZ6E 4BELD 2ATAA 1A5FL 3FNKA 2IOMA 3MRIB 5AYTA 5IK3A 1LQSR 1U93A 5E94B 1F18A 3B3IA 1MRDH 1OW0C 2BH0A 2CDEA 5HHOD 2FZ3A 3VI3F 1E4WL 3FULA 3EXJA 5IB2A 4PJBE 3BAIA 4Z7NF 3LN9A 1NCDH 4MDIA 4F8NA 4D0BB 3ETBF 2RGSA 5I76A 1Y7VA 4BKTC 1J11A 5D55A 2FB4L 4EOWH 3VGDA 2ZCKL 4X80L 4LSRL 3SO3B 4F7TA 5GS0H 4ZMWA 3IU4L 4GG6B 2P26A 3BUTA 4PEEA 4YO0A 4FKKA 2NZIA 4X6EA 4DGIH 1JIBA 4H8QA 1MJ8L 4KMTH 1CI3M 1TMQA 2HP4A 1JGVL 1OGTB 2WTPA 5E8DL 2YPLE 1EAOA 3HE6C 3VI3E 3D18B 3ZE1B 4KQ3H 5C3LD 4K8RD 2IMNA 4Z7NE 1MLCA 1TU2B 3UADA 1OCOB 5EBWB 3DO7B 3OF6A 2EC9U 3HW7A 3EGDB 3SDAB 1KTDA 1WWAX 4ISVA 5MERA 1XB6A 4ODVL 1BMWA 1R3JA 1DJYA 2C1OA 5MP6H 3L4ZA 2BWIA 3EZJB 1EA9C 3DBXB 3VVVA 1UYWL 4JZJA 2DQEL 4YH6A 4OZFH 3MLXL 1B6UA 1OXYA 3LKOB 5HHOA 3WLBB 1P2CA 1QI3A 3GO1H 1KXVC 1MRCH 4AQ1A 4GKNA 1A6ZA 3BP6A 4GKZB 1I3RA 2D3LA 3C2AH 6FABH 3MOAH 3ZDZB 1SMDA 1FFNA 2XWBA 1WZAA 2EJ1A 4HJGB 1Q0YH 1YYCA 2BINA 5JHDE 5IJVB 5CEZL 4GH7B 3VXSE 4L8CA 1PLCA 4I0PB 4NPYA 5J6GA 1JGEB 4ZTOL 4AE1A 4LLQB 4M6ML 1R6VA 1NM9A 2UYLB 4AJVA 4FABL 2LU5A 3BKCH 4XPGL 4LSUL 4G7YH 1AO7E 4CC1A 1ZGLA 4FEIA 2I5YL 3ZTCC 2CJ3A 4FJYA 4JFSA 1YEHH 3P9WB 2E9GA 2DMKA 1QFHA 1CF8H 3B1TA 5KG9A 5F9JA 5D7HA 1FO0H 2ODHA 4JB9L 3FQUA 2Z7UA 3M86A 3DNKA 3HC0A 2X4OB 1RUAL 3BSZL 4NEHB 3SDXB 4EIBA 1C1EH 1RP9A 4JRFA 3T4AA 4U1LB 4PJIB 5DU7A 1R3HB 1R3LB 1BD2E 1R33A 4LKXB 4X6FA 3WTUA 1EJFA 2GPZA 1AD9A 4L2YA 1XFPA 4CKQA 1I85A 1JFHA 2R4RH 2GK2A 4JFHD 3LZPA 3RBGA 3B6SB 3U7AA 4L5FE 1NZRA 5E6YA 4ZQTA 4PP2A 1UOLA 1GGCL 1X5FA 5DJXA 3EJZD 5C7XH 3LS4H 1EZVX 2NY3B 2O26U 1TZGL 1KULA 3FAXA 3NTCH 4Z8FH 4HZ1A 1GH7A 1IFHH 4HGKC 1BFVL 2Y72A 3NJJA 2DYRB 2LQRA 2VH5L 3UZQA 4ZUTA 5F7FA 1SOKA 3TESA 2FUTA 3QNFA 4WI7A 1EHNA 1WBYB 3OR6A 1I7TB 4NZTH 3V0EA 4C8XA 3V2AR 1BIIB 1HKLL 1LMKA 1E90A 2BHUA 1A6VL 2JKIS 2C9RA 2ZSVB 3CSTA 3KG5A 1SYSB 4XNDA 3PWNA 3FSAA 5E51A 5F96H 2CO4A 1HQRB 2VDMB 4S1RL 5DZAA 1AZUA 1EDHA 1J5OL 3L17A 4I9WD 4X98A 1AZVA 3KJ6L 4E42A 4H1LH 4HKBB 4N2HA 5AUMB 4YDLB 5BXFA 4P06A 5L88L 3WIFA 2XZQL 1OT1A 3QDGE 5H94B 3GM0A 2XN2A 3LZLA 1HXYA 2CLZA 4PW9A 4NERA 1EAQA 4J4PC 1HXKA 4YDVA 1BZQK 1G5GA 3SY0A 2FIKA 5JHAA 1F56A 4HPOH 4RAUA 1P9MA 3EBAA 1YMMD 3D9AH 4E9XA 3VD7A 4WY7H 1LE9B 3M88A 1Q4NX 2W38A 3GXUB 4KHXL 3BAEH 2YN5A 4D9QE 2Z4QB 3D51A 1JGUH 3O41A 4HC1A 2K70A 2OZ4L 3LYRA 2YXFA 3ZKMC 2I7SA 2PTUA 1ZOXA 1UWGH 4AQAB 1IQDA 1MEXL 2EKSB 3OM3B 4FZEL 2CBQA 1H3PH 1HVXA 2VT0A 3NAAL 4P2RB 4AGLA 2BW5A 4YBQD 1O6SB 4G1EB 2GCYA 4G5AA 1COBA 3GMQB 1RUPH 4K3DH 4FFYL 5T1KD 3IJHA 3O3UN 3OMIB 4JHAL 3GEFA 4YHPA 3V7AG 4NRZB 3KHQA 4JFQA 2FR4A 2Q20A 3ZMNA 4JN1L 2DQJH 2V8LA 3WNIA 3MA7B 1KLUA 2AXHA 5EN2A 1OP9A 1BBJB 1KENL 2X4RA 4M5SA 4ZOAA 5KSBB 5IBUG 1JXFA 3FQNB 3QXTA 2X6MA 1R1CA 2W59A 1YUHA 3L81A 5AQ0A 4K8RH 4MA3A 3T1FA 3HMXL 3GTNA 4XBPA 2Q3AA 1WZ1L 2DLFH 1A4CA 3QCUL 1KG0A 4MZ2A 4XODA 1HQ4A 4Y16D 5EF0A 1YMMA 1INEL 2RACA 1OP5H 1IGCL 4XMXA 4JZOA 4JRLA 4IBQA 5BQ7B 3ZT6A 4JJOA 5B22A 5JHLL 4HKJA 3KYNB 3D7PA 4ZMZA 1R47A 2FX9L 3PIQB 3NP3A 3IRPX 1P4UA 1QSEE 4G42A 4OD3H 4BA0A 1RZGA 4ZK8A 4OZFB 1S9XB 4PS3A 1E9PA 2R1XA 3DYPA 4QYOA 2I26N 2VDKL 4M5ZL 1I8LC 2HN7A 5T1KA 1GJWA 1I9JH 4ONGH 3ZGIA 2AQPA 2XTJC 5EC1A 3CTTA 4MA7L 5F3FA 2HYMA 3FT3B 1YUKB 3I9AA 3AWGA 5C0JA 3QEHA 3IAGC 1OB1B 4X99A 3EYSL 5EU4B 1YJDC 1UD4A 2F58H 2A9NL 3NDZE 2NCMA 1M2VB 3C6SB 4G8IB 4KXBA 4WSGA 4GG8A 4AM0B 3N43B 5B7EA 1GHFL 1NBCA 4P2AA 1T04B 3BYTA 4KQ0A 4KZ0A 5CJ8A 5GS1C 4Z5RA 3U4BL 2CO2A 3WY3A 2MQGA 2VISA 3MA9H 2YQ2A 4Y16A 2APVA 3NRQA 4LPVA 5ESVA 3S5LB 4XP4H 5I6XC 4S0SD 4AGOA 2M1KA 2FAUA 3S37H 4OZIB 2BVQA 4N28A 4L4JA 1AQHA 2YZ8A 5HI5D 2NCEA 2LABA 3OX8B 1IM9B 3PWUB 1DFXA 1THAA 3NCWA 3MUY1 4CNIA 3EZ8A 4HT1L 1KJVA 1QQDA 2QADD 5I8CB 3MSPA 3G5YB 1IMHC 3IRCA 2GHWB 4R7DB 5LDUA 4RZCB 4HC1H 1OPGH 1OGAE 1VFBB 2EE6A 3FN0L 5D93B 1KJ3L 3UO8B 4MJHA 4N8CH 1F2XK 4ZOEA 5IK3B 3QIWC 1U93B 3FT2A 3B3IB 3N5AA 2CHZA 4N20A 2F0CA 5HHXL 2CDEB 4TM9A 2FZ3B 5I2IA 2W9EL 1ZRUA 2BSSA 1WISA 1H3GA 4G3YH 4Q0XL 5IB2B 5IHZA 2X4PA 1NL0H 1F58L 1ERNA 2ESVE 3MLUL 1T4WA 4PIRF 5LNEA 3TO4D 4CU8A 4G6AC 4PJFA 4ZPVA 4PB9L 5EORL 4MDIB 4WTZG 3IAQA 3K72A 4RZKA 1Z5LB 3A22A 3CVDA 1YEJL 1OTSC 4KKAD 1XF4B 4APXA 4F7TB 1S9YA 3HBPA 1DEEA 4YO0B 3MUZ1 4HGMA 4R4ND 5DJ8A 1GYAA 4FQXD 5IW3A 1HZKA 3C5JA 4BFKA 3QUYD 4K3GA 4M9PA 4U6HA 3L4VA 3MREA 4JM2D 3RG1C 1ROCA 2XV0A 4LLDB 4BM7A 4JQIA 4Y19E 4F1ZA 1OF2A 1AHKA 3B9VA 1OM3H 2VWEC 3I9IA 2IPTH 4FP8L 4LEEA 4HWBA 4M4RA 4PJ9B 2YC1A 4KUZH 1KTDB 4ISVB 5MERB 4H13C 1R3JB 5GGTL 1NCJA 4NOBA 1H3WM 2C1OB 1CLVA 5SX4H 1L9OA 5B1AB 5FECA 2PLTA 3NEEA 2ZG2A 5C09D 4JZJB 4N24A 3DV4A 3SQRA 5HHOB 1F41A 4PLJC 1RULH 1P2CB 3BP5A 3IDJA 3ZDYB 2XPYA 1XXDC 1ICTA 4XMWA 4YXHH 1A6ZB 3BP6B 4NS0A 3VSTA 3TO4A 2D2OA 2PPFA 4EN2A 3KPQA 1DQDH 2FEDD 1DBBL 3F62A 1FFNB 2XWBB 2P42B 1DQLH 4NX0A 2VMDA 1CXLA 1O9VA 4X6CA 1G6RL 3VFPA 2BSRA 5CZVL 4L8CB 2IDUA 3LEXA 5C0CE 4NPYB 2Q3XA 5J6GB 5DS2A 4FQXA 2PO6D 2YPVL 4UOJA 3W81A 3KD4A 5TQ0L 4BWTA 5KBLA 1JNLL 4WI6A 3QUYA 1MG2C 1BZ7A 1EFQA 1OAKL 3PWJB 5J6HB 4U1GB 1A3RL 3VU2A 5EF2A 1T1WA 4JM2A 3NSJA 2BY0A 5F9OH 2BERA 3NACL 4QO1A 2YPLD 5F9JB 3R7QA 1O6TA 5K9JL 3FQUB 3GTTA 2CO1A 3QUGA 4OF0A 5D1ZD 1R3KA 2XKNA 3BE1L 3HC0B 1HCZA 2JE8A 3APFA 3F83A 4LIQE 5CU9A 5D2LB 1ZLWH 3T4AB 2GT9A 2A6IA 2Y6TE 5BO1H 2VTFA 2XWRA 4X6FB 2UUDK 2VLJD 1AD9B 1IU1A 5AOLA 5JORA 2J6EA 2VZTA 3L08A 4UM9D 2YXWA 1LP9F 3ULVL 5C09A 2AJ3A 5B1JC 1IAII 4LXFA 5I6PA 5JUEL 4G9DB 2FH6A 4GY4A 3DVFA 1FPTL 3VXRE 4PP2B 3CQQA 5HY9A 5DJXB 2BP0A 1MPAL 2Z8WC 3ZKNC 1NUNB 5ID1A 3QDME 3S8WA 5CP3A 4AGNA 4P9HC 5B3JE 1OP4A 4TPRL 4L8SB 4WU7B 3AXIA 5AWNH 4DP9X 3KYAA 4Z7UF 5EWIH 4XI5C 4FXKA 3QIBC 2ZKXA 4XCCL 4ZUTB 3UZQB 3WTTA 3IGKA 3FQRA 3QULB 4MQTB 2PO6A 2Y06L 5D2NC 4AOFA 4OGAC 4UF7C 3O6FA 1U0QA 3OR6B 4NFCA 3D3VB 1QEWA 4LAQL 4UQCA 3MJ8A 1IE4A 5DT1L 5SWQB 3KVPA 1QLEH 1J0IA 5GGVL 4QTIL 5J5EA 4HIEA 2YPLA 4FHBD 3VFMA 5JNYA 2QGEA 1JZDC 3MJ9L 1JDDA 3VI3A 5D1ZA 4F2FA 4E42B 4X98B 4M8QA 5BXFB 5F97E 1HL5A 3LRHA 3S35L 1AGDA 2CUIA 3HB3D 4DKFH 3WIFB 2QPUA 3OHXA 4JG9A 4RMSA 1XH1A 4R8WH 3LV3A 2Q76B 4JQIH 1HXYB 2CLZB 2MCMA 4DGWC 4B9KC 2RCSH 1JWUA 3SQOH 1KOAA 1UKQA 2HJLA 5DZ9A 1AZCA 2VLJA 4HWBH 1CXFA 4YDVB 4UM9A 3SY0B 2FIKB 3GHBH 2MQCA 3EHBC 2E9IA 2NY1C 2H0FA 1T0NA 2P44B 3L5XL 4HLJA 2FCBA 2N7SA 4DGVH 3KBFA 3QXVA 1EDQA 1CD1A 4M61B 1VAHA 1L7IL 1EBPA 1PZ3A 3O41B 3RVVC 3C87A 1OL0A 4TOYH 4JPIA 3E0GA 4JQXC 1RHHA 1ZPUA 1IQDB 2VR8A 3EFOB 4Z7QB 3DOHA 1HNGA 1U8QA 1OHQA 1BQ5A 2NX5E 1BVNT 5E7BA 4LESA 2BOBA 4R2GD 2YAMA 5CIPA 5ADPH 3U0WL 1IAMA 2A2QT 2PPAA 4YHPB 2WQSA 4JCMA 3RFZC 5HHPA 5HI3D 5B7FA 1QI4A 4NO0D 4ZW7A 2UZXA 5DFVC 2OMUB 3PS6A 4OIFA 5EN2B 1FVEA 2JWYA 2CIIA 3SB3A 1J10A 3BFQG 4CBZA 5TF1L 5FR3A 4M8RA 3CNKA 3AB0C 1YUHB 4MRCA 1TQBC 3N85H 3T1FB 1WS8A 4MA3B 2NT1A 3M8OL 3SCMD 4XBPB 1OTTC 4PB0H 3UP6A 1H5BC 4ZTPH 2DMBA 1JZGA 4V33A 1MW1A 1JDAA 1KG0B 2A77L 1BD2A 3V0WL 4U7KA 4Y7OC 1HQ4B 1ZLDA 1CLCA 4PJDE 1YMMB 2DQHH 2Z1KA 3JWNH 5DMIH 4JZOB 2J44A 1HIML 3OMZA 3EJUA 1TTGA 4M02A 5E4EB 4LRNH 4OVVA 4HKJB 5EG6C 4D9QD 1UOWA 5HYEA 4G42B 5I5MA 2W94A 2ROXA 4E9LA 2B5IB 1RZGB 3I3BA 2YJLA 5CP3H 4B41A 3OAZK 1E9PB 1CFVL 1S46A 2DWDA 2WCPA 3C09C 4QYOB 5DRXA 3T0BA 1WJ3A 5I0DA 1ZPLA 2HN7B 5T1KB 5IMLA 5DUPH 4G6JH 1F02I 1BAFH 5EC1B 4KTGA 4NO0A 3WS6A 2QKIC 2OJEA 3ILDA 4ZNEE 1CR9L 4P3CL 4R4BA 3KW7A 3QEHB 1KIQA 2X05A 3IDIA 3NCJL 4XTRC 5IFHH 1OD7A 3D2TA 3Q1SH 2Z35B 3EOYG 3ECVA 5JPNA 4OTXL 5KYUB 1OP3K 5AVWB 3SCMA 4JDTH 5CINL 5JHBA 4FHKA 4UAOB 5F70A 5EZOH 4B97A 4LRIA 4Z5RB 4LVEA 3NZ8B 2HVJA 2O61A 5DXWA 2NW3A 2VISB 3J7HA 4WWID 4Y16B 4YE0A 4HEME 4N8PA 3GSQA 5ESVB 2VR5A 1PCXA 1CDCA 2BVQB 2OV0A 4NP4H 4UBDD 4N87A 2IDSA 1XWVA 3GS7A 1ET7A 4I3GA 4WI4A 2JMRA 4W9IC 4CNIB 5J3HD 2O93L 1KJVB 1QQDB 4FFVD 4QXGH 4DWHA 1KBKA 2M2DA 4RGOH 3LQZA 4PJ7E 3MNDA 3V0AC 4JO5A 1QSED 3CFEA 1JZEA 2FJFA 4XO5A 1TQCC 1KCRL 2WSDA 1SOSA 4XO4A 3ZL2A 2ZONA 3UPRA 1KACB 5J1TC 3FT2B 3FRPG 5HDLA 2G4GA 1ZE3H 2V5YA 3O6ML 3N3EA 4FZ8H 3HFML 4M1DH 1OLZA 5D7IF 4QTHA 3SYOA 2D3VA 2BSSB 4W9JC 5CIPH 4UQBA 3FS9A 5IHZB 4TUJA 1QACA 1W16A 4ZFQA 2VR9A 3MXVL 4ZPTA 5IB4A 4XBEH 3EJYD 4PJFB 1NOAA 4ZPVB 1BGXH 3KGSA 1D9KD 1F6AA 2LLNA 4KGJA 3K72B 1ZHNA 2HFGL 4I77H 1XGQA 4NZRL 5HHME 2D73A 4APXB 1PIGA 1S9YB 2XX0A 1F4XL 2ATPB 4GRLD 5DJ8B 3QSKB 3ZQ9A 4DH2A 1AZBA 5CO1A 4XP1H 2NY7H 3UAJD 3W0WE 15C8H 2EDJA 3K71A 3C5JB 3BGAA 1PZBA 2BXYA 2W95A 3S88H 3WTSA 5D7IE 4ILDA 1E3XA 4NGHL 3HHMA 3CG8A 3K2UH 1C12B 1OF2B 3F12A 1F00I 5LBGA 5LNGA 4JBSA 5C2BL 1NCNA 3O11B 4M4RB 4GMSH 5CGTA 3US1A 2QADB 2YC1B 2KZBA 2YIHA 1X9LA 2A9DA 2R0KH 5AKVA 4AZ8B 4JGNA 4LF3A 1OGPA 1QSEA 3AMLA 1NIFA 4K7PY 2WKGA 4AC2A 1QLRB 1MJ7H 1I31A 3NJGA 3SO3C 3DTXA 4DK6A 3KNBA 1SHMA 1FA4A 1U4EA 4Y0GA 3DV4B 4HCRL 5MEND 2QJDA 3T04D 3KS0J 3VRLE 3VMNA 2X6BA 4EI0A 1EAPA 5FHBL 1K85A 5IG7A 4YDZA 1RPUA 1P53A 3TO4B 1J12A 4HXBL 3BKJL 4XH2B 1TTUA 1K8IB 4V1DE 2ETWA 5IQOA 1AYRA 2CKBL 1IFRA 4X6CB 3VFPB 2BSRB 2YPKA 3SDAC 1P4BH 2EXYD 3LEXB 4NNXA 2OMZA 2GG1A 4LSTH 2NUTB 4GRLA 1WIPA 1PSKH 3C60D 2EICA 4P99A 3UAJA 4JVPA 3AADB 4RGND 2DV6A 3NFPB 3QUYB 4S1QL 1BZ7B 1FNHA 3V7MA 4BBWA 5K33A 4FI6A 4JM2B 4IKNA 4ABQA 4B53A 2WYZA 3FQTA 1G1KA 2YSSA 3FZUC 4X4YA 2XKNB 1F42A 4UQDA 1T2QL 2H1PH 2JLPA 4WDIB 1W0WA 2MQ0A 2CNYA 2H26A 3CN3A 3WJJC 1KT2A 5K69A 2GT9B 1X6NA 2A6IB 2FO1A 4BUGA 3WTVA 2EDYA 4TKWA 3CVHA 5JORB 2WXLA 4ZW5A 5HYFA 4I0PC 1OGAA 2IBBA 3HI1A 4RX4D 5AZ2L 3Q5YA 5C09B 2AJ3B 3NP4A 4HHAA 4M00A 5MENA 1G7IB 1IVLA 3NN8B 4N0YH 2QFPA 3QHTC 2BP0B 1AP2A 5ID1B 1VHPA 4CW1A 2J1KA 2GC7C 5DMGD 2X89D 4JFXB 3STBA 3D0VA 4FLRA 3LKRA 1AYOA 1PFOA 3M17A 5FF6A 3SGJA 4IYKA 1AY1H 1VEOA 4KDWA 1R5VB 4FXKB 1FCCA 2IAMD 5FYLD 3CGTA 3K6DA 3C60A 1TQTA 4JMNA 1QEWB 2EVFA 5G5DA 1SDDA 1EBAA 1P7KA 4QRRE 1MZZA 4HIEB 2A74A 4H25A 5AAWC 2YPLB 4GXVL 3ZDXF 3VFMB 1B0RA 3L9EA 5JNYB 1CDYA 2WQRA 3VI3B 3EJCA 5DQJA 1AI1L 4M8QB 2Y7QA 1KNOA 1ZT1A 3VFVA 1OKEA 4XNZB 1AGDB 4Z7NB 2NY3C 3QRFM 2C9XA 2ZUVA 5E9DE 5I18L 1P6FA 4BWUA 4I0KA 5I66A 1KV3A 3AABA 5DD5L 1JWUB 3ASOB 3QHFH 2VLJB 3UJJH 3SQBA 3QS3A 4V2CB 4HFUH 3RVTC 4RX4A 4AUUA 3GI8L 3IGUA 3FU0A 3UBFA 3NCFB 1F97A 1T0NB 3Q06A 4HWNA 5DJYA 4HISA 4LU5H 1IBGH 3QFJE 4O2EA 4ZD3H 5F2FA 4P4RA 1CD1B 1O5DT 1TXKA 3EH2A 2WO3B 2Y1YA 2AFNA 2KZ1B 4Z3FA 1UB6A 3FBQA 3VXRD 4WCYH 3ZDWA 4JKPL 4R97B 5LUMA 4JPIB 4C54A 3SPHA 4KU1A 4PREB 2WV3A 1RHHB 4YDLC 4B7LA 2CQVA 4AM0Q 4PHXA 2ZXQA 4WWPA 1YC7A 1U8QB 4FF9A 5CN3A 1FFTB 2IAMA 4DW2H 3DX2A 4UTAA 3DURA 2BOBB 1I9IL 2IFFL 2OXGA 2W80C 5CIPB 5C0CA 1Q72L 1U42A 4XAWH 5I1GL 1EO8H 1RZ7H 2X2YA 3PP3H 5D1XD 1YHPA 3B5GA 5HHPB 5IVZB 3ZJAA 2UZXB 2VXTH 4XMLL 2R9HC 2B9BA 4FNLH 4YXLL 3QNZA 2J21A 1FVEB 1U6AH 4A7GF 2CIIB 3BO8A 3G5ZA 3HB3B 4IW4C 4FQIL 3MV7E 5F7AA 2APTA 1A6UL 3LHPL 3U25A 5H4YA 4TVPE 2YZ1A 3CUPA 4AYGA 3AS0A 5JW4Q 4PRAA 1ACXA 4MRBA 3VXUE 4N8VA 1AG6A 5HDWA 3RP1A 3LNEA 2DN7A 3NCXA 2FT7A 2PWEA 4J2XA 4JFTA 3T6QC 3FB6A 4PY8J 2KERA 2K6YA 2CUHA 3VXRA 5BVJA 1BAGA 1I4FA 1AXIB 3CSYA 4AYSA 4JM4L 3SJVB 4C83A 4AV5A 5GS0C 5C0BD 1O7DE 2ZX6A 4OQTA 2R4SL 5IV2A 2XZCH 3OKDA 1K8DA 3EF7A 3UGUA 3VG0H 3FU3A 2Q0ZX 1CF1A 1J1PH 2NXZD 1TJIH 4ERSL 2C8NA 2AGJH 4DP4X 3QR0A 1HHGA 1P7QD 2DWDB 5DRXB 4AQ8A 4R2GB 1O9ZA 2NZ9C 2P3YA 2QPEB 1HYSC 5ITBH 1L5GA 1UENA 2CXKA 3OJVC 5A40E 3FUMA 1LP9A 4DN3H 5D1XA 4NO0B 3VG9B 2Y22A 2OJEB 2E0PA 1DUYB 4JG0L 1TLKA 4R4BB 3ULUL 1J87A 1MREH 1KIQB 3V0VB 2VQUA 2Z7WA 3IDIB 1MFCH 1JK8A 4JPWL 3PXJA 1H15A 2GBTA 4N2FA 5DSCA 4LPUA 4MMXA 5DC2A 3RDJA 2B9AA 3U6RA 1U95A 4K3EL 2OJZH 4Z7UA 5E5MA 1I8MA 1U8IA 2O61B 2HVJB 3LRKA 1NCHA 2YMXH 2NW3B 3B2DC 4M5YH 1NPNA 3UTTD 4F2ME 1E5BA 3H6AA 1USQA 2WKLA 1XF1A 4PS8A 2YGVA 1LO4H 1MLBA 1Y0LA 1UJ3A 3ALWA 1CL7L 3UMTA 3D8MA 2UY6A 3SE6A 1ID5I 1HNYA 1NAKL 5AG8A 3KH4A 3IN2A 3MBWA 2ISDA 3P3RA 2F1EA 4UB0L 3O2VL 5C0BA 5HDBE 1A6PA 4LL1A 1B4RA 3ARBD 2FEEI 3LQZB 3HPJA 4XOAA 4ESKA 5KW9L 3OMAB 3CFEB 1HZHH 1P7QA 5LQBH 1FVCA 1MCPH 4J28A 1OARH 2FJGA 5LBSA 1G7JA 1OWWA 1T2JA 2VMEA 3ABZA 3R1GL 4XNUL 5I8OL 3UPRB 5IGXL 3R4DA 5IB3A 4N5UA 5FYLH 3QB7C 2OTUA 3S36H 3E3QE 4JGUA 4KXCA 4DQOL 3S96A 4QTHB 2FEJA 2A73A 4TUJB 5DJDA 5AVUB 1MAJA 2ZQKA 5IB4B 5CN2A 2C26A 1A14L 2GQHA 3QCVL 3MACL 3QPKA 4Q6KA 4KHTL 3P4LA 1F6AB 3RPBA 4F58H 1CD9B 1X44A 3B9AA 1T0OA 1XGQB 3LMJL 1KXHA 2YD7A 4L2LA 3RY5A 4IDLA 4BFIA 3SIKA 1SVCP 4G72B 1BQSA 1HTYA 1Z5HA 4DO6A 2O72A 2WGNB 5BMFH 1U3ZA 5D93C 2AJUL 2EDQA 4I85A 4MX7A 4OZ4B 4QXUH 4LIQH 3UTTA 2H2SC 4YUEL 3K71B 1G7HA 2W0PA 1I1FA 1T89A 4FKEA 3BAXA 2WC7A 2NYZA 3WHE0 1RPQA 1Q94B 4JFZH 5BCAA 3VA6A 3NESA 4KGLA 5T3ZE 1YG9A 1W9XA 2VXUL 2P24B 3D0AA 4CL7A 3JTTA 1SXNA 3ARBA 3GBML 1QSEB 2XN9E 3LHAA 1CE1H 4OKVA 3DTXB 3BXNB 2EIEA 3BKMH 1D7CA 3KNBB 1NICA 4OQTH 4W9DC 4DTGL 1F4WL 4OZFG 3GLEA 5KOVC 2VQ4A 2WCGA 5TJWK 4AV4A 5IOKA 2YMOA 4CVUA 3BAYA 1EAPB 1KLFA 4PWJA 4FG0A 4U1SA 3HZYA 1D9KB 1Q1JH 2QZQA 2VDRH 5ACZA 1N64L 4K3JL 2LU3A 1HCVA 1S5HA 2YPKB 5E8PA 4ZZKA 3V8OA 1QBLH 1A1OB 4NNXB 2OMZB 4GRLB 1BFOB 2GBUA 2NSQA 2EEDA 2FQGA 1NFIA 4PS4H 1VPOH 2H0PA 1EIBA 1XAUA 1CB4A 2MPAH 4JZJC 3S3DB 2JVUA 4Z3HA 5LWYL 4QOKE 4HEMA 4NC2B 5T3XE 3FQTB 3B43A 3NGBB 1KCKA 5E56A 1UXWA 3MRFB 2YSSB 2E9WA 4AQ1C 3S5LG 1AOZA 4X4YB 5L4MA 1W0WB 4H0GA 2H26B 2RA1A 1KT2B 3K74B 4JHVA 2B3IA 3CVHB 3D4ZA 3BPLC 3F7KA 4GIPD 3HI1B 1T5WB 4RESB 5CD3A 1Y1DA 5E8EB 3E1ZA 1XCWA 1WCBA 3HN3A 5F7NC 5EOCL 2YFOA 3BWUC 5MENB 2E8ZA 3L13A 4ODTL 3RIKA 3U7WH 3MFFA 2NY5H 2R0WH 1N5YL 5LBSH 1AP2B 2BY3A 3BIAX 3EO1A 4CW1B 4FTVE 1EZVY 3GSOA 4K8RC 2HH0L 4OF5A 3NSDA 3D0VB 4KPHL 5FF6B 1RQ5A 3M17B 1PQZA 2CK2A 2YD0A 3T4AC 2BIOA 5C07E 5AYQA 3WGUB 3C60B 1PD0A 3N04A 4YFLI 2FO8A 4RAVA 3IS1X 4RGNB 3O0RH 4CSPA 4YGAB 3GHPA 3PAYA 1I85C 5DQDL 4ES8A 4HW6A 5I0XA 5G5DB 1SDDB 5KVMC 1P7KB 4X8JA 2JELL 3DO3A 2A74B 3GKWL 1KGUA 3O2DL 4H25B 3F5WA 4HPYL 5D7IA 1B0RB 5I1AB 5DQJB 2Y7QB 1KNOB 1ZT1B 2WXFA 4X5WB 3VFVB 3VFOA 4BA8A 1BYOA 1NWPA 4PJHF 4IBVA 4W6WB 3ZIMA 3NCEB 5I66B 3P3SA 3Q6GL 2OFQA 4MCZA 4FQJH 4BE6A 5E2WL 1LK3L 2IO5A 4OCRH 2J4WL 4FCHA 3FFDB 2P47B 3RU8H 5GJTL 7TAAA 3U7YL 1ETZA 5DJYB 4L37A 2BWDA 2K78A 4O2EB 3D6GA 2Q10A 2ADGA 3P3YA 2KL6A 2BSDA 5E4AA 1UB6B 2RQEA 4W9CC 1EHAA 1E3FA 1NFAA 5ABZA 3N6YA 4E9QA 4KJPC 3MFGB 1TZ8A 2MRYA 3T0EE 3E9UA 3OG6B 4YDIH 4AK2A 4WHTA 5GISH 2LFEA 5D1QD 5LXGL 4M6OH 2QSVA 2CZNA 4XHJD 5FLUA 1RIHH 2IAMB 5BS0E 2Q6WB 3DURB 3QBTB 4TQEL 2OXGB 4N5ED 3GLAA 5L7XH 1ZTXE 4LCIH 2YFNA 1VFAA 4PJ8D 5ID0A 4DOHB 4ZFOL 3DBSA 1P9MC 5EO1A 1ZA3A 1J0ZA 4WFGD 1S7WB 1RSYA 3QNZB 1WEJH 3EJZC 3ETBJ 4X9BA 5I6KA 3BO8B 2AQ2A 3G5ZB 4U6VH 3L1GA 4MNGA 4BE5A 5JZ7D 2J43A 4TLUA 1BREA 2HKFH 3HNVH 5DJ0A 2OR8A 5E9DD 2EQDA 1HILA 2I27N 3H8NA 4R96A 1KGXA 2FIRT 2L7UA 3W5MA 4PRAB 5I15H 4N8VB 1AFVH 2VDOB 1G9NH 1JPSH 1X7QA 3LXCA 3W37A 1TZHA 1Z9SA 3MRHA 2DQFB 2B0SH 2CSPA 2JKXA 3UC0H 1NMAH 2P8PA 2VUYA 3VB8A 4DAGL 2J5LB 5K1VA 5JOPD 1FIGH 4JRXD 1UB5A 5D6CB 2X1XR 5BJTA 3VXRB 3H3BC 3B8SA 2ZZUT 5BVJB 5KS9E 4XMUA 1I4FB 3FH8A 3CSYB 1LNUA 5EBGA 5D71H 3JWDL 3CVIL 3G7TA 4C83B 2Z9TA 1HX0A 2WZAA 1MWAA 3OKDB 3P2BA 5EUKA 1D5IH 5D1QA 1N8ZA 4ZMVA 3VTAA 1HHGB 1A7NL 4Y1AE 4KFZC 1JZ4A 4JO2L 5C3IA 3AXLB 1L5GB 1DBAL 2Y69B 3IMBA 1LP9B 1YEEL 4PJ8A 5D1XB 4PJAE 4D9LH 5DD3H 1XF3A 4MXVF 2FWUA 3V4VA 3CVCA 1E5AA 1JTOA 1UT9A 2VDRB 2ZOOA 1ZAGA 3F7YA 4N0FA 5CFAA 3D2UD 2L3BA 2OTWA 1M7UA 5E4EC 3DX7A 2DQGH 5A2IH 3ISWA 3MCLL 3EAKA 3CK0L 4QRPE 4C4KT 5ECJE 1J8RA 2KT6A 5E08H 4MMXB 2YUVA 5E9DA 3ARZA 3HNSH 3VE0A 1YY8A 2B5IC 3MV7D 3U6RB 1U95B 4Z7UB 5E5MB 1I8MB 1NCBH 4YBQC 1XGRA 4F7CB 1H6TA 2L4OA 1U8IB 2IGLA 3ARSA 4TVPD 5JHMA 3LNFA 5EN3A 1FAIH 3DVNA 3VXUD 4AEHH 2YQBA 1TCRA 1JWMA 3CWGA 4AJ0A 5BUGA 1MLBB 1ETJA 1UXSA 1UJ3B 2J3SA 4JRXA 1ZLSH 3QFJA 2M8XA 5JXED 4G7SB 3CX5K 2XOTA 3MBWB 2D4FA 1M4KA 2EZ0D 5C0BB 1N2RA 5D7KE 4MNHA 1C7SA 2XX1A 1YPZE 3VW3H 4CADA 2NXZB 3HPJB 3VFUA 3WKNA 2E27L 1AIFA 1P7QB 4PTTA 4QEGA 3FB5B 4D94A 1PY9A 4UAOC 1FVCB 5GGUA 3KHOA 3INUL 2FJGB 3NYKA 1G7JB 1XHHA 5JXAL 2BK8A 5CJOL 4W70A 3QUKA 2ED8A 2RTTA 5CJQH 5IB3B 4Y16C 2OTUB 2XCMC 3BDXA 3EG9B 3FUFA 1TLMA 3S96B 5I1JH 5AVSB 2A73B 1QHQA 2CA4A 3CLWA 3D2UA 2PF6A 1AAJA 1ADQL 5C86A 3GSXA 5CUSL 3AS3A 2Y07H 1BXVA 1ZLVK 3R4RA 2Q7NA 4H0IA 1IUZA 2IV9A 3MV7A 4OFDA 4MLSA 1BPVA 4QRQB 4M7JH 4I88A 2Q8BH 4XO8A 1TQVA 4M1GL 2PYFA 3O45B 2W92A 3GHEL 4I3RH 3UTTB 3OLIA 4MX7B 3VXUA 3NIFF 3HI5H 2XXMB 1I1FB 1RUKH 2BC4A 2JXMB 2XICA 5IBTH 1NBVH 4CJ0A 3BIBX 1J9TA 5JXEA 1JPTH 4E41D 5CILH 2X1OA 3SYQA 1GJUA 2WLNA 4Y4FD 3SGEH 4A7GA 1KB9J 1BQLH 4AJWA 4JR9H 2Z91A 3JTTB 1BEYH 1JZ5A 3A6BH 2JTYA 3L3JA 4I87A 4JEGB 5F1OB 4BSJA 4ETYA 4G7VH 1EO5A 2XBDA 1EEUA 4OKVB 3CN1A 4ELME 2VLKD 3VTTA 4HKXB 1A65A 4KNTA 1T0MB 3CFBA 2G2PA 1FNLA 4KXZH 1WS7A 2YAFA 1Z3GH 1BJ1J 3LZFH 4U1SB 5HI5C 3ARTA 1AGCB 4BRJA 3O9WD 4LQFL 1MCHA 3HZYB 2NYKA 2N4IA 3S48A 5FM4A 2RMNA 1B9KA 4K9EL 5KBMA 3V4VH 2IANE 2XQBL 4OZGF 2WXKA 3P11L 5ACZB 5BRZE 2KS0A 4N68A 3F65A 4QXVA 2BW4A 3TF7C 2QADC 3ZGHA 4E0RB 1S5HB 2YAQA 3ZK0A 3T3MF 4MD5A 3MHZA 2NT0A 3BPNB 1XCQB 3WXWH 3FTXA 4PWFA 1CXIA 3D34A 2OMWA 2HCZX 2R83A 1NFIB 1QABA 3O3EB 3QUHA 1JGLL 4MBRA 4ODUA 4Z7WF 3BH8A 4ANWA 4N22A 4RRPM 5GHWH 4F2MA 5I28A 4LPWA 1EMTL 2PXYA 4CU7A 1EFXD 5EEYA 2UZIL 3GMOA 1E6OH 1B4JH 1CFNA 1UXWB 4GAGH 3RAJH 3JTBA 1ITBB 2GSIA 3U46A 4Y4FA 2WYHA 3TO4C 5C6WH 3CZNA 3UIYA 3UAFA 5T3ZD 4FQCL 1MFMA 3GXDA 4WJKB 3ROLB 1JCKA 3U6XA 2EXTA 2ICEA 4KKAC 3RGVA 3QAQA 2VLKA 4R4NC 5CD3B 4FQXC 2Q8AH 1WCBB 2ZKYA 1E4HA 1T1YA 3ATBA 1JRHI 4N0UE 5I8KL 3CSPA 4IBZA 1V5JA 1GC1L 2DWTA 1GGBH 1EZUA 3QUYC 3K6NA 4PJGF 3MFFB 2EO7A 4JM2C 4LMQE 2FTAA 2J8UE 2E7LC 3O9WA 3JBG7 1ES0A 3H2PA 2FJUB 3RNQB 1PQZB 2K7QA 4TSAL 3U1PA 5AB9A 1CYGA 1M05A 3NUKA 3RGHA 1BF2A 4S1SH 3K6IA 4Y4KD 4TL4A 5E9NA 3JWNC 4RAVB 3V4PA 5I0VA 3DXAE 2EH7L 3I50H 5AG9A 4HJ0D 1JZ6A 4JRYE 2WVSA 3K0WA 1DJZA 1WAEA 4G8GD 1J1XL 4PRBA 2MOQA 4TVPH 5GGRA 3R8BB 1EFXA 3F5WB 2RR3A 4JKWA 1NA8A 3OLDA 4KQ4L 4QOKD 1AKJD 2KLRA 3PUUA 4X7FC 5D7IB 5EV7A 3OZ9H 4A37A 3ZPDA 3RTQB 4AIOA 2FEDC 1XR9A 3W9EA 3WIHH 4WEMB 1MI5D 3QNYA 3AAZA 5HHQB 3SN6N 4MCZB 1K72A 5FGSA 5HBBA 1S7UB 4FG2A 2Y25A 4UT6A 1ZHKA 1C9SA 2XN9A 4FXKC 2CMRL 3R06A 4X4ZA 5ETUA 2PO6C 1HCFX 2UV3A 4ZO6A 2TSBA 5E5RB 1FSKB 1S3KH 2WQWA 3AJ7A 3