3ZHNA

Crystal structure of the t6ss lipoprotein tssj1 from pseudomonas aeruginosa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
b'PPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA_0080
molecule tags Toxin
source organism Pseudomonas aeruginosa
publication title Structure of the T6Ss Lipoprotein Tssj1 from Pseudomonas Aeruginosa.
pubmed doi rcsb
total genus 31
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12790 T6SS-SciN Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zhnA00
4A1RA 3ZHNA 3RX9A 4Y7OC
chains in the Genus database with same CATH superfamily
4NPKA 4LIQH 4JM2A 1CF8H 4LVOB 3MGTA 1LHZA 4M1GH 5CU9A 3QFJE 3MYJB 4AYFB 1A6WH 4OD1H 4GG8B 3QAQA 1AGBA 4UAOB 3GSRB 4TOYH 3DRQB 1M7IB 1NEPA 3E2HC 3FT3B 3FO0L 4WK4B 3L7FA 2X05A 5D5MA 1PBYA 3QDMA 1EHLL 1TEYA 4HLZH 4QCIB 3BP4A 4GUPB 3TFBA 7CGTA 2A0LC 5CGBA 4RFEA 4TQHA 1M2VA 3K0YA 1BF5A 4RDBA 2E8YA 3L3OC 4N68A 2ZG1A 1JPTL 3G6DH 5KYNA 1UXWB 3AT0A 2MCG1 3B43A 4DZ8A 1U3NA 5JPNA 1MKFA 3NJGA 3T0DA 2Y1ZA 5D7LB 5F44A 3EJYD 4JN2A 4P5KA 4JZNB 2IDUA 3ZTCC 5I0VA 5IBTL 4XN5A 2QADB 5CEXA 2Z8VC 5IB1A 4JKNA 1PJ9A 3TJEL 1R3HB 1UB5A 5L8JB 4LSTL 3I75B 3PQYB 4KKBC 4XVJL 1P7QD 1SJEB 2YMOA 1KYDA 2OMUB 3U1SH 1I7ZA 2B1OA 3LPOA 2WQ8A 1ZHBB 1QASA 4NQED 5JOPE 1P4BH 1UB6B 1LDPL 4XOBA 2I7OA 2XWTA 3L4TA 1B2WL 4XGZA 4EN3B 2N01B 2X1QA 5JPNB 4IIQA 1YN7B 1YSOA 1L9SA 3NIDF 2BNQE 1OGTB 2P5WA 4NT6A 5AAMC 3V4PH 2E86A 3QEQE 4ZOCA 2OI9B 5FO9A 3MJ8A 2Q8BL 3DOHA 1RUPH 1MJJB 1V8HA 3HNSL 2WXPA 4PWGA 5DRXA 3DX0A 4OFIA 4UM8B 4S1RL 2YPVL 1FPTL 1B3JA 2NY0D 3D52A 4H4NA 5JHDA 1WH0A 4PGDB 2R2BA 5EBMA 3S48A 3UGXA 4DUWA 1I7ZB 2XVKA 1JWUB 1KGIA 1S9VA 1MHHA 2B39A 3HHSA 4JRYA 3SY0B 3U0TB 3W2DH 3I3EA 1A8JH 1UB6A 3C09C 4W6XB 5ECGA 1AC6A 4X42A 3TT3H 2GUYA 1ZWIB 4ZX4A 4B50A 1OSPH 1DUZB 2JKRM 4LMQE 1UD2A 1RAMA 4MRBA 1PG7H 2PTTA 2HLAA 4G6KH 2JWYA 5CJBA 4POZC 4QRRA 4TUOA 4NI3A 4RZKA 4I48A 4FQLL 1YAZA 1RP8A 3ILQC 2XA8L 4LLUA 4X6CF 1Q9KB 5DURB 5L4IA 3T2LA 3TURA 3QQ9C 3Q6FB 5DJZA 4PY7A 1N19A 2E9JA 3S5ZA 1U8NB 5ID0B 4OJCA 1VZHA 3GBDA 1MHHB 2DOCA 4MXWH 2J43A 3B5HA 2H1PL 4IBQA 2GJ6D 2X89D 4MA3B 3RKDD 2P42B 4FTVE 4NX0A 3KPRE 4LCVA 4ODTL 5IEHB 3W0WE 4JFXB 5DTFB 3FTZA 5C08B 2F15A 1IBBA 4WGVB 3S3JA 5HYJA 2JCWA 4MGXA 3AREB 2XWJB 3L4CA 4AVJA 1RU9L 3A21A 3SPVB 5ABZA 1RQ5A 1VFBA 2W07A 2X88A 4K94H 2WK2A 4JQXA 1OARH 2UZXB 1BZ8A 2WLKA 2ZUVA 5EU3A 5MENB 1BXXA 2RIKA 2WV3A 3HPLB 4PY8J 3FSWA 4U1HB 1R5WA 2J4WH 3RG1C 4KXZH 1M1SA 2MCPL 4DO5A 5LKNA 1BMZA 4BFGA 1KMGA 5CGYC 4IJTA 2DWXA 4Y5XB 3KM1A 1NCBH 4KOBA 4WK2B 4XN9A 4S11A 5GS3A 5F9JB 5KVMC 2MWCA 4DTGH 3GMNA 2WVUA 1ACYL 2CO2A 3ISYA 3ZT5A 5IG7A 4PJBE 1MF2H 4CSZA 1YDPA 3NZ8A 3QG7H 3SPHA 2YXMA 3II3A 3BKMH 4UILH 1AP2A 5F7NC 1DBBH 2XWJA 2DQFB 3IF1B 1DJGA 3OR7A 3PFQA 3GUTA 2OW7A 2UZXA 3HUJF 4AG4L 1O75A 3U30C 4G1EB 3VACA 1IGTA 2BOCA 2YAQA 3H53A 2XETA 4BFKA 3K6IA 3IFNH 5JHLL 3M86A 3SDYL 3GSXB 3PABB 4XTRD 1I9IL 2Y7LA 4RH4A 2FX9H 1A66A 4EOWL 4DEWA 2GABA 1SXSA 3FTGB 3HZMA 2ZTBA 2WLLA 3VRJB 3EYOA 1GSKA 1XGUA 5TE6H 2G2RA 4ODSH 1B90A 1GHFL 5F96H 5F93C 4OLZL 4YBLB 2C3VB 4QRRD 4OF7A 4E36A 4R83A 4JFQA 1OZTG 3C5JA 4JKLA 4L3EB 1S7WB 5FW7A 5KVEL 1Y6NR 2WVSA 1T0PB 3LZQA 3R8BB 3MRNB 3ULUE 3IAQA 4UT6H 4L8BA 3QHFL 5E00B 4OF6A 1H3PL 1K4DB 1RJZA 2I27N 4GXVL 4ZFQA 3L81A 1XDTT 4IDJL 4KKQA 4J3OC 4WRLA 1GOGA 3S3PA 1FE8L 4HFWB 5E2UH 3WJJC 1OGAD 1B2WH 2DTMH 2WM0A 3MFFA 3DMMD 3VRJA 4HJEA 4XPTL 1F97A 3MJWA 2VSKB 1F3JB 3M1BB 1QR1B 4HZLB 1DEEA 3VW3L 3Q8BA 3T0AA 1WFNA 1MCSA 4OCMC 1XIWD 2YAOA 1SZNA 4O02H 1MSPA 4WNSA 1OT1A 2I24N 3OTTA 3QAZC 3V0EA 4W93A 4KKNA 2FEEI 1KPVB 3IFOA 3ISWA 5EBLA 4A67A 5IV2A 4HHGA 4ZSOB 3X14A 5IB2B 2CU9A 2EE6A 3ZMEA 3K4ZA 2UWEF 1BVNT 4G8GE 2CUHA 1JFQL 2D7MA 4Z3HA 1AO7A 1KB5B 4KK8C 1RHHB 1OQXA 3NJLA 1F13A 1AXTL 2Q3AA 1L7TL 4AQ8A 1F6AA 4JDEA 4XP9H 1QUNB 2QVIA 5FIEA 4C56A 4X7SH 1NDTA 2FK9A 3ULVE 2BFVL 4M3HA 5J3HD 2OS7A 1G9MC 2YPLA 1CFTB 1WFUA 2AVFA 4J4PA 4NHUA 5F7YC 2ICEB 1FAIH 2GYSA 3E8VA 3LKNA 5JHAA 2MHAB 3BPOB 5B1BB 4FNUA 4QEGA 2XXGA 4TLKA 4Q6IB 4NZ8A 2J2ZA 5FA3A 5JDSA 1ANUA 4P0DA 3CZNA 1SMOA 4GP5B 5TTRA 5TF0A 1DL7H 1CD1A 3O3BB 4GQQA 4JG9A 1Q1JH 1TQSA 5I8EA 1RL1A 4LPYA 3FN0L 3LN4B 2H1LM 3MV7B 5FCUH 3HTLX 3ARBC 2YPLB 1IL1B 4N6RA 1JZ3A 3MA9L 2YBRA 1U8LA 4P23A 2X4TB 3T77B 4XMKH 4A68A 3ZTNH 2YQGA 5H37H 1QLRB 3CLFH 1JOIA 2HRPH 4Z7WE 4PGJA 4P57A 1KCSH 3KCWA 5D1XB 2YD8A 4NPYB 3U7WL 2Y22A 3LRHA 5J13B 1R75A 5A43C 1RERA 2N3JA 3SJVD 4IGBA 1GMEA 4WZ9A 4HIJB 3SCMA 2WAHA 1T1XB 3EO0A 4LAJH 3U46B 4BFEA 4F2FA 3RX9A 3BVVA 3QUYA 1W16A 3PHOB 1CT8A 1M71B 1E4JA 3IMTA 2R2EB 3SE8H 4TQEL 5EEZA 4PVMA 1T04B 5D70L 1FN4A 1IC5L 3ES6A 2WMPA 3CSTA 4D3CL 4ZW5A 1MREL 3S5YA 4N2BA 2BZ7A 3QIWD 4WSGA 4NOFA 2AV1A 3QIWC 4HH9A 3ZYIA 4U1SB 2FX7L 1NKGA 2GTWA 1TJIL 2XU9A 1S5IH 2DQGL 2FEDD 5HDRA 4DKTA 1KELH 1OEZW 5I1IH 5I1LA 1QSEB 4KUCD 1TJHH 4OQTA 2G4EA 4OZIE 3WE6B 1G7IA 5IW3A 2X6AA 4HX1B 3V8OA 5IOKA 5GSRB 5BQDA 3NIGB 3NFSL 4KU1A 5E9DA 4ODBD 4QO1A 4AQZA 1S6NA 4G43B 3ZBMA 1ZIBA 4OSUL 2C9VA 2CUMA 4LSUH 2LU3A 4PBWD 4L2YA 5HP5A 4DT2A 5IIEA 5FHBH 4KHXL 5I1AB 4Q9QL 3QZLA 4PM1A 3IRPX 2HPTA 3KPSD 3KPOB 4M6NL 1CFSB 2UX6A 3MVSA 4KMLB 2QPFA 2ARWA 1K2DB 4XPAH 3MNVB 4GRLC 4YSDA 2C4XA 3N43F 43C9B 1RPQA 2ADGA 1EDHA 2PCFB 4D9LH 1NCAL 4HKZB 1GZQB 3NIGF 5KJ4A 3K6NA 3EH4B 3P4OB 3L3DB 5A6MA 4M7LL 1CXIA 4UWQB 4D8PB 4HPHA 3UC0L 3FO2B 2EVHA 4PJGA 4WU7B 4FNLH 1TYRA 4MJ5B 3K4AA 2APSA 1IE5A 3KPOA 1ACXA 4PJIB 1CI5A 4JQIA 2ZT9C 4MYPA 5KG9A 3SYQA 3SKJL 3W0WD 2NSMA 2D2CC 3TNMB 1OCRB 4GH7B 4Z7VE 5DVKA 4NZTL 4DVRH 1EV2E 4HS6A 1D7BA 4RX4A 1BZ9B 4PBXA 4AIEA 3MLSH 2A9AA 2Q0ZX 4ZT1A 4HCRH 5CMAA 2KLTA 2YEZA 2XPYA 4XNQA 2Y7SA 1TQVA 5LN4A 2FQEA 3D3VD 3AQDA 1I8LC 5F1KC 2NXYD 3VRIA 3SE4C 1XD0A 1I3GL 4OFVA 4NIKB 5CHNB 2FD6H 1ZTXH 2YJLA 3APFA 3NEOA 2MTAA 5IHUL 1HILA 3CFQA 3FQTA 3CD4A 3GRWH 5KZCD 5E2VH 2AABL 2FJFA 4LLDA 5CJXC 4ELKA 1JL8A 3I9IA 4N0CD 2EP6A 5EULV 2C1OB 2EIDA 2DLFH 2VR9A 3B2UD 3O41A 4YLQT 2AEWA 4AGLA 3F65A 4LHUB 3QUYC 5E9NA 5CSGA 2H8PA 3VFPB 4PJAF 4LCYB 1FDLL 2A6KB 5IQ7H 2X4RA 3PXLA 4QIRA 1M05B 1NANH 4EE2A 2L8AA 2UYLB 1PFOA 3RL1A 4DP0X 2QV2A 3HBGA 1J8SA 1F86A 5E99H 3S96A 3FQTB 1GYAA 3JYCA 1P6FA 4UU9B 1QLFB 1KDJA 3GF8A 2CLRA 3PHQA 3RX5A 5CO1A 5F0MB 2F19L 2NRDA 1RCYA 4HEPG 4OFPA 3ALWA 4Y9EA 5JXAH 3GRGA 1CLOL 1J87A 3LH9A 4JL2A 4XH2B 5EU4A 1ZPUA 3VSVA 1PX4A 3FONB 1UM5H 1C7SA 1SN5A 1KIQA 3QJRB 4I1PA 2CK2A 1N0XH 3H2QA 3IMUA 1AQ8A 4PJ6A 5A2CA 3PLYA 2QSCL 3MRDA 3I9GL 4YHYB 2PXYC 4JZJA 1TTAA 4G6ML 2QT6A 2FQDA 3KPQA 4N2MA 2WCSA 3MLXH 4PJGE 4Z7UE 4LCCB 4X2UA 2WAQA 2YUVA 4N1EA 3DUUB 2JFCA 1FUNA 1S5IL 3FB7B 4APQD 4PRHB 3S5LG 3LVEA 2XRAL 4NFBA 4XBEL 4E42B 1TETH 1N2RA 3LS4H 4UM9D 3V4PB 2YD2A 1AG0A 3MV11 4JFEA 2VZVA 4ESKA 3BP5A 4R8WH 4HIHB 4FMVA 4OLWL 1KEMH 1PYWA 1DP0A 4OAWA 5H4YA 2NUTA 2ZX9A 4TSAH 4LEXH 4F7EA 2FBRA 4N2IA 4JO5A 3GJEA 1BOGB 4MNHA 5BZWB 5LAPA 4R96A 1XCQB 3VM5A 1L9OA 1HEZA 4JFED 4WEBH 2IDCA 3KPRB 2VITA 3FT2A 4PJXA 5IMMB 3QT2A 3K71A 1JK9B 4HUMB 1I1YB 1SOXA 5DC4B 3WAJA 3D25B 3KGRA 2G5BA 4PJCA 5FKAB 4H5SA 2OAAA 4U6YA 3OF6A 4MKMA 2CXGA 3SOBH 4ZMAT 2ALAA 1NC2A 4Z7OE 4QYOA 5F0LB 2B0SH 3NESA 3P1VA 2XKUA 5HHQA 5KW9H 3TBBA 2BSSB 5HYSB 2Q76A 3ARED 1FO0L 2FYYB 4EI5C 2B1HH 3TESA 1I85A 3ULVD 1YNKL 3S3CB 3B83A 3FFCA 1YG9A 5D7JA 2OL3L 1UA6L 5FA4A 4AY0A 2A6JA 2ICES 1IAIL 1OTSC 1Y07A 4F9PA 1CGSH 1M56B 5DJ8A 5CCHE 1HH6B 1EX0A 2VABB 3S3SA 4IHOA 4OD2A 3WMSA 4AJYV 1U8JB 4PRNA 2AXWA 5JW3H 3IAPA 1E4KA 3D25A 3EDDA 2XT1B 1M7DA 1UTDA 2VDLH 3BSHA 3MLYH 2F0CA 4MNGE 1X9UA 4LBEA 3DNKA 4QYOB 1H8LA 4LLQB 4IIQC 1XB3A 2P8PB 2BZCA 3SGEH 1E4WL 1UZGA 1WCBA 3V6FB 3MYJA 4AYFA 1GVIA 4Z7UF 1MLCA 3WU1A 1BFOB 3GHEH 3FFCB 2SODB 1N5AB 4OR1A 4HCRA 1DQKA 4J3OH 2GITA 5IMLA 1LEIB 3EJQA 3DDFA 4JKMA 4CUCA 3VX1A 1KJ2A 2CRZA 1ETZB 5EZPA 2NY2B 1AI1H 3BP4B 1CFVL 1T2QH 4LVNC 4OD2B 4Y19D 3TH2T 3MV9D 3REVA 4J2XA 3KXFB 3U2SB 3P54A 3M1CA 4ACTA 3HEIB 4ZPTA 3KYKL 3VFUA 4HUVB 1MCQA 4TVSa 3SY0A 2Y5EA 1MRFH 4APQA 4UNIA 5HPMB 1HYSD 4HOMA 2VQTA 5HDBB 3A24A 3FO1A 1BXUA 2V7NA 4HG4K 3US0A 1KWKA 4NNXB 5DWPA 4IDJH 4F2MA 1EGJA 2R2CA 5EMYA 3MZTA 1U95B 3TO2B 1KJ2B 3AABA 3N42B 3PY9A 1RJCA 4XPGL 1F3DJ 5ICZA 1MAML 3WY4A 3PP3H 3MV7E 2ZNXA 1MFUA 5H35A 3IB4A 1U4FA 3VD9A 4CADA 5F7EL 4RMRA 1ZHBA 4FG0A 3HRZA 4HWZA 4N2OA 1G7HB 1JNLH 3FFDA 4P04A 2BM3A 3NABH 1YEWA 3QRFM 1CICA 3AQZA 1MJ7L 3KL0A 4M56A 5F1NA 1CGYA 1MIMH 1ZS2A 3QRBA 4ZFOA 4AL8L 4X5QA 1B3IA 3UL4A 1AOHA 3P9LB 5I1CH 1JGVH 3SDCB 5CWSA 4MS8D 1AJ7L 5JHDB 4QXVA 4LZKA 4L1SA 3RVUD 4ZOEA 3ZUCA 3TJEH 1L6XA 2NDFA 2AGJH 4M1DL 2ICWI 2CGYA 3ZMNA 1HDMB 4LSRH 4PJDE 4ZUWA 3ESUF 3SDXB 3V5DA 3DX9A 1TETL 3KPSA 1OZUA 4GI9A 3GSWA 4N0YH 2ICCA 3QXWA 1U58A 2ED9A 4UMGA 4UOJA 3HG1D 1QI4A 4ELDA 5CN1A 3TPUA 2Z4TA 3DO3A 4N2GA 1A7NL 4QRPB 4Z95L 2OYLA 3VMPA 5JXED 5KVDH 4Q9RH 3BKML 4UILL 3MLTA 4JFYB 2FT8A 5C71A 4XCNA 1EFXA 4X4YB 5CWSB 3WN6A 3AXLB 3R4DA 1BXVA 1HHHA 2P5PA 1OP5H 5TQ2L 2GJZA 4A38A 2L04A 3KPLA 4EDWL 2A9MH 5BRPA 4ZMZA 3G6JF 5DD3L 1WEJL 2BSBA 3BZEB 2FQGA 1OAZH 4GT0A 5C0FA 5DVMA 1ITCA 2F8OA 2ZOKB 5ANMA 2FB4H 2YD1A 3IXTA 3KJ4B 4N0RA 3C6LD 4OGXL 1T7WA 3C6LC 4ZO8A 5J9PB 2HUHA 2GTQA 1JF6A 5F9OL 2VSCA 3B2MA 3CVIL 1F3DH 3JWOL 4FI7A 4M8UA 4DGIL 4DPRA 4RGND 1HHKB 3FTSA 2B5IB 4DF9A 1N0LA 5MP6L 4PD4J 3C09B 5F96L 1IAIH 1UC6A 1JI1A 4GO8A 3CCHA 5B4MC 4Y16C 1MFCL 1U3HA 4QHMA 1WIUA 3CFKB 4TQEH 5ITFB 3VCLA 4G7VH 4CJ1A 5D70H 4QJ5B 4B9IA 2Z35A 3U9UA 1HI6A 2X70B 1S9WB 1A14L 1I8KA 1NCTA 2FCBA 3GKWL 4QPEA 4D2NA 2WSDA 3H85A 3JT2A 4Y4KB 5IVOA 3GMNB 4FAAB 4KZ0A 2C9PA 2Q87A 1X5AA 3MR9A 1D5MA 1M3JA 3EYFA 4GI8A 1YA5A 4OZFB 2K1MA 2WB1A 1FG2A 3DV4A 1P7KB 3IU3B 1HHKA 5IB5B 3U4AA 4BFJA 5E9DD 1JMXA 3CQFA 5EN2B 4F27A 3LRSB 5GJSL 5ICXB 3CCHB 4PRAB 4ZNEE 2TSAA 4J1UB 5IWLC 4G1EA 4W4NA 2ZUWA 1RZ8A 4O02L 4Y1AE 2IALA 5DHXB 1MHEB 3MV9E 1XL6A 4R90H 3ZHKA 3INUH 5AZUA 2WJ7A 5HGGS 5EBGA 3PWPA 1LNUA 3KLDA 4BK4A 1G6RA 4HXBL 3X1NA 1PZ5B 2WPGA 2Z31B 3IFOB 5GJTL 2QSQA 5IBLD 5L8LB 1MFMA 2NQ3A 1QQDA 4OZFA 5D9SA 5LQBH 4ZPVB 2VZSA 2AJZA 1VKXB 4FLQA 3GLAA 3EYOB 4JJHA 5T5NF 2OKMA 2UUDH 1KIUB 2EDWA 3UAFA 4AEHH 1LK3L 1BG1A 1YYMH 2DLIA 3LKRB 4C56B 1EO5A 5L7XH 1EXGA 3P73B 4ZW7A 2F53D 1VENA 3EF7A 4RESB 1KV7A 1QA9B 3HLAA 4CVXA 4Z8FH 4K3JH 3LZFH 1IM9B 3IJ9A 4GY4A 1M1XB 1NCIA 5H94B 3E7JA 2J2ZB 5JDSB 5AYQA 3DC0A 5FWQA 3NJKA 4D7BA 2TSBA 2A74A 4NKIH 4KROC 4S1SH 1A1NA 2R1XA 1DZBA 3BPLC 1OPGL 5IB4A 3L3KB 4EI5B 5I15H 4ANKA 4AK2A 1QVOA 2QTEA 5D2NA 5DS1A 2C7UA 4LRIA 2VWEE 3K7UA 3AU1A 3BSZL 4NUJA 5I1EH 3MRGB 1HZHL 5FB8B 4FXGA 3V6OE 5AVSB 2DQEL 2KDYA 2ODIA 1J5CA 4KDVA 5TQ0L 4WAFA 2F5BH 4L5FL 2DYPB 5C0AE 3FMGL 4JEGB 4PJ5B 4HETA 2XBTA 2WQAA 3CHXA 5T3XE 25C8H 1AO7E 2NCEA 2YXFA 5D1XA 5M95B 5EIIB 4NZUH 4F58L 4HHAB 1FE8H 1ZLWH 3SGJC 1B0IA 3VXTA 1ML0A 3Q7JA 1QFWI 4QUOA 4OZ4B 1YEFH 1XH3B 2LGNA 1MJ8H 1CFQB 1TTRA 2B4CC 1C12B 1Q1JL 3CZSA 2DMCA 4KK9D 1FFPA 2DD8H 3PNRB 3CVBA 2QVTA 1XGQB 2NOYA 3FN3A 3QG6B 5CUSL 3S0PA 4FMKA 3EJCA 1YUHA 2MHAA 3PWUB 2HT2C 2QQLH 1G7PB 1MIEL 2GY7B 4ZMNA 1AQDA 5DRZA 3CMGA 3O6FD 1AR1D 1DQTA 3ZR5A 4YDKH 1R1CA 3ARFC 3ULSB 5IFAL 3CXFA 2O72A 5EIIA 3CLFL 2ZXWB 1QP1A 5I0ZA 4GYBA 6FABL 3RWIB 2AXJA 1FNGB 1CD1B 4M02A 3L9RA 5H4ZA 3FTUA 3UPCA 4JPWH 3L54A 3GXTA 4YPGB 2BNUA 3OB0H 3QFJD 3QUZA 4G82A 3BIAX 4UQ9A 3SDAC 4HX1A 3NSJA 4B9JA 5E4IA 1FAKT 3BQUC 3BOVA 3NCJL 5DDHA 3DX4A 2F54A 3BQUD 3WCYA 1JNHA 4HUCA 1CD9B 1EFQA 1WWBX 3I9AA 2VDOH 3QDME 2BP0B 1C08A 1YUHB 1A7QH 1DFXA 3REWA 2ZWSA 4O4YL 2OTWA 3ZDXE 5I6MA 3OMIB 5DRZB 1BFTA 3MX0A 3OR6A 3QIUA 4FL4C 3FOLB 3I6SA 4U6XA 1FVEA 4GMTL 1HZKA 4TTDC 2HFGL 2ZWNA 1GAFL 1DDTA 3F12A 1S7QB 3BX7C 4PP2A 2HWZH 4YDMA 4C83B 2ZSVB 5FS5A 1HE7A 1RZIB 4P06A 1UXSB 2MCPH 2R0KL 4NUPA 4IQHA 15C8L 1AQKH 2LLGA 1UASA 4LL9A 3D06A 5TH2B 2ICWB 3AS3A 4P2RA 1AD9A 1I1FB 2A2QT 3BW9A 3T6ZA 5I8CB 5GS1C 3REWB 1ILSA 4B9ZA 1ZY9A 3UYRL 2FECI 3K72A 2R51A 3GXDA 3VWKC 3UTTB 3MGOB 1BGXH 4R0LA 5IM7B 4JRXB 3VG0L 5GHWH 4N90E 5SX4H 4Y4HB 3SD5A 1G9NC 1MDTA 3B3IB 4NZDA 3ZKSD 2ODHA 3QHZH 3B6SA 4B41A 4FCHA 4CGUB 9PCYA 4UCFA 4ODWB 1HSAA 2XPGA 3C2AH 4P2OA 3HG5A 4UAHA 3EHBB 4Z7UA 3WIHH 3FULA 1UVQA 1LD9A 2ENPA 1MXDA 1E8ZA 5I1JL 4FA7B 1H8SA 2D3NA 2ZXAA 1TVBB 1TSHA 1SNRA 5AVTB 2XQYA 4CU8A 2G60L 1CFSA 2H5UA 4U4IA 4F7KA 4NC1C 1MNUL 2N7SA 4FGMA 5C07B 4HXBH 1SYVA 4NKOB 5IVZB 4UTBL 5KVEE 1IKOP 1KLFB 1JTTA 3WUZA 1RUML 1QWHA 5TPWH 2X2YA 5F3BA 5B7EA 1CD0A 3N1MC 5F7AA 2DN7A 1I7UA 3FT1A 1SEQL 3P0VL 1UKQA 4WU7A 1NGPH 2I7SA 3GLEA 4P46A 3TIEA 3WSQH 3OJDA 2VDLB 2V5MA 1R5VB 1A4CA 2R23B 4RAUA 4CN6A 2YAEA 2HN7A 4YHIB 2Q7AA 3COOA 4XO8A 1DQJB 2AXFB 2E9IA 5F1OB 3B9KB 1A6ZB 2FIRT 3SPCA 3GZQA 1T0NB 4WJG3 1M4KA 5GRZA 4KTDL 3MOBL 2VLJB 2XTJE 3F7KA 3HJ0A 4K7FB 1I7UB 2V5TA 5HBBA 1FYHB 3WNPA 1BQUA 4NM4H 2PYEA 3JV6B 4MWFB 3RVWC 1FDLH 3HI5H 2X4OA 4R5VA 3HB3B 1OAUH 2X7LA 3MRMB 1WDAA 3NIDE 4G3YL 4NO3A 1HKFA 3TN0D 3DGDA 5T8IA 4JFFD 2MNWA 5KANG 1GL4B 4XP6H 1MIEH 4WNQA 2FJHA 5T1LB 3FB7A 4URKA 1MY5A 4XNYH 5KBLA 3QEGH 1FF5A 4BV1A 5I76A 3CPUA 3ZYJA 3ZQ9A 3EOTH 1DSYA 1ND0A 5CF3A 1AAJA 4E41A 4LCYA 3BQVA 2XQBH 3AG4B 4F7EB 3OHXA 1BQKA 3RTQD 1MIML 4JANA 2QDVA 4DZBB 4YR6A 2VXQA 4KMQA 4WWKB 2EDLA 1I9RH 2OTPA 2R4SL 4IBZA 4M8VA 1P7QB 4NXKA 5FYJU 2PP8A 4A04A 4NQEB 4UV4H 2DQCH 1QTPA 5L4FA 4BFIB 4JJ5A 2F5AH 2DWEB 3AJ7A 5I1KL 4XVUC 3NCEB 4IDLA 3VFWA 1HE8A 4OIBA 4PJDB 4WWKC 4B9GA 1KIQB 4OLWH 4G7SB 4PJAA 1FFNA 4MHHG 5F7HA 1PSKL 4R4NC 3QUXC 4UOQA 3CLEH 5MEOA 4R4ND 4EBQH 4JANB 4DZBA 1NEUA 2O61B 3EDJA 2A3TA 1YEDA 1QLEH 4F7CA 3U6XS 3WUWA 1RZKC 3QJQB 1NTDA 1EUUA 2YFOA 1GTFA 4GJTB 3AY2A 2YK1H 4P46C 4WI9A 1NCNA 4OLXL 1HN1A 2NPLX 3KLAA 3QNYA 4U05A 2EEFA 1M9WA 3UTQB 3ESNA 4MMXA 4Y2NA 1EH9A 2A9NL 3TU6A 4NQTA 3DA0A 2ENJA 5ACZA 4XN1A 1JV2B 3QARA 4HCIA 1SHSA 3KD4A 1RZJL 5E5MA 5GIRA 4NN7B 3VVVA 3FH5A 4Y5YB 1YQVH 4AJVA 4NRYB 1D5BB 4MMXC 5E8NA 2M1KA 1L9MA 1Y6KR 3IDIA 5CBEB 2APVA 4Y5VC 3HNVL 4OLYL 1G1KA 4CSTA 4WTWA 3DYPA 4JFFA 2AJXL 3ZIMA 3ZTJG 5GRYA 3E6HA 1EEUA 4YUEH 4KWUA 5TPWL 4PB9L 3OZKA 4R4FH 5BUGA 3N1FC 5JHDE 4PJGF 2YMXH 2D31A 4QXGL 3M17B 3FT3A 1D5IH 3MLRL 3OAZK 3W82A 3QUXA 3KYOB 2OYPA 3STBA 4MNQB 5D1ZD 3MUHL 3QJTB 2VUKA 5IWLA 5HI5C 3NGBB 4M7JL 3UTPE 2IC2A 3GBMH 2WINB 1YPZB 2N59A 1FZOA 1VA9A 5IW6A 1JWSB 2E4FA 2AEOA 5E6YA 2XI9A 2E9BA 4JDZB 5HVGB 3DV6B 3JSSA 3QWRA 2BP3A 2ZZUT 4OCXH 4EKJA 3IXAA 1KN2L 3L1EA 4N1CA 2DICA 3NSDA 5EUOA 3M17A 3P69A 2DPKA 3QPQC 4Y9CA 3DGGB 5K9QI 2YD4A 3MBXL 1U3HD 3OHXC 5DSCA 4JLRB 4X6DA 5LQBL 2Y7QA 3MHZA 2NY0C 4ZUUB 4E68A 3UCRA 5JW5A 1XAKA 4EUPB 2YMTA 3QDJA 4G8AC 3TF4A 3K6SA 4E5XB 3OJVC 4PV9B 3D08A 1YEJL 4WHDA 1U3ZA 3JVFC 3CZFA 1PEWA 3O4LD 4UT6L 3V5DB 2OJZH 3C6LA 2VW7A 1NGQH 1RJYA 2FZ3B 1R3JA 1DJYA 4M43H 5I2IA 3TFKD 2WVTA 1J05A 3HZVA 3VA2C 5SV3A 2PXYB 2QSTA 1J9QA 5MEQA 3N2JA 2YARA 1R5IB 2EZ0D 1XGRA 3H42L 1ZEAL 3UFIA 2HLFD 4ORGA 1GY1A 3I2CL 1OGTA 2P5WB 4HAGA 3HC2A 3IETA 3X3FH 4LVEA 4H8UA 1JZ6A 1BW8A 1MVYA 4HWEL 3FTWA 3EJYC 1MVUA 3B8SA 1O7DC 1MLBB 2KLRA 1HOEA 3RHWF 4GI6A 4H1LB 4X4ZA 2ARJA 3QA3B 4LCWB 1M7IA 1RKRA 3WEAA 5BZDB 5AB0A 3EXLA 2CJ3A 1V7NL 2WTPA 5CIPA 3BSZH 2C9UA 2LOEA 5F7LB 5D7IF 5J11B 1Q0YL 1DVQA 1NC4D 3DROA 2A77H 3QFDB 1MRFL 3K8MA 1S9XB 2AANA 3CMOH 3JBG7 1THAA 3SOTA 2WJ5A 5KS9E 1Y18B 1G87A 5E1AA 4JDVA 2OJEA 4F15B 5BO1H 1X6LA 4TLTA 4WUUD 5DJAA 3IDNA 5GGRY 1NMBH 3N1PC 4GAYA 4PUBL 2A1WL 3BFWA 3BT0A 4LFHD 3KPTA 4NZFA 2BIIA 2X6CA 3RBGA 3V0IA 5HYFA 2VQUA 4N2AA 1LEGB 1OCOB 4LRNL 2MCAA 1MJUL 5CN2A 4I0PB 4XPGH 2ORBL 4LKCA 2PABA 3QIBB 1YEFL 5DJZB 3RI5F 3S35X 2JJTC 4AUJA 4B60A 3ZKXC 2FR4A 4HCGA 4JZOA 1EZSA 1I9RL 2IEPA 2J6EH 3B9KD 1RUQL 5KAQF 1HI6B 2A9ML 3TBVB 4AT6B 5CEZH 3LPGA 1DANT 2GFBB 2VAAA 3ARFB 2JKJA 1U58B 3WL9B 1OARL 2DY2A 1G7LA 1VGEL 3EDFA 3WHE0 4AVHA 2ROYA 3QJHA 1I1RA 2P52A 4K9EC 4UT9A 1SF5A 2VE6B 2ZUXA 4QXTA 3GXPA 4V1DB 2W07B 1T4KB 3J07A 4LKCB 5G4OA 3ETTA 4PJ8D 2J8HA 1MRCL 1XF5B 2UWEA 5C2UB 2FTAA 1QLEL 1RZ8B 1NGYA 4JM4L 5DHYA 1KBKA 4R0LC 5CEYB 2KL6A 1MJJA 1OCZB 2W0PA 5DA4A 3MFGB 5ICYB 3CFDA 1XBDA 2F68X 4X5WA 1MW0A 1G7LB 4A7TA 1K8IA 2V2XA 3OWEA 1A4KB 4X80H 2EIMB 1EDYA 4EUPG 3HE6C 3IJEB 1JF1B 3LTVA 1GPOH 5EU6B 1W0VB 4G9FA 5E51A 1CLYL 1QTYT 5I75C 2P48B 3T0ED 4IRZH 3TYGH 2L7QA 2N0MA 1FO0B 3VMNA 1UQSB 2XLLA 3HRPA 1ZWIA 3V4VH 5HDBF 3ENEA 4N5UA 1EANA 1ODAA 2ZXDA 3ERXA 2P5ED 4W9HC 4AE0A 4AM0B 3VCLB 1KXQE 3WO4B 1LO5B 4FQQB 3FUJA 4Q2ZA 4Z8FL 1M53A 3T1FA 4GRLB 1FYTD 1KBPA 2ZOLA 2WXRA 2CO4A 3F6JA 1MOEA 4DOHB 1YPZF 1FNLA 3OGCA 2B14A 4L8DA 1JZGA 1IEAB 1LQBC 3V4LA 5C0JB 5BUAA 4K23L 3VFRB 3VI4E 1HEHC 5JQHC 4AGOA 3GSVB 1OAQL 4F93B 1JXJA 3SKMA 4NS0A 1FO0A 4ZXBC 3Q2CA 3KVDD 4HCFA 4Y7MA 3KJ4C 3LQAH 3ZE1F 3O6LH 1CU4H 2VLJE 1I8IB 2HX9A 2Z4QA 3EJSA 4FC3E 3QQXA 4Y2DD 2NYYD 2WXJA 4PREB 4K3JL 5I8OH 4EPSA 4YZWA 4RZCA 2EXWD 2K6WA 3FTXA 3V0AC 1LL1A 1K8DA 1DQIA 2LAGB 2KLSA 3ZHDA 1A21A 4TMPA 2FWSA 2HKAA 1T20A 3MFFB 4YHPB 4U1HA 1KT2B 2DI8A 3U9PL 3VWJA 4UUJA 5EC2A 4H88L 2EILB 4HUXB 3NRQA 2ZIDA 4HMDA 2VT0A 4YC2C 5BVPH 5I6NA 1NINA 5FECB 1QSZA 1I3RB 2JB5H 4PRPE 2E7DA 2IIJA 3WNNA 5LDSA 3QYMA 1FGNL 3JWNE 1BQ5A 2VIRA 3POHA 3WKNA 5ETUA 2RQ8A 2DTSA 5TDOB 4GLRI 4HGKC 1SBSH 2DJUA 2V17H 3DHPA 4W81A 1AQDB 4K94C 1SXBA 4GRWE 2K7PA 4FXKA 3HVNA 1EFXD 3JT0A 2EUXA 4BSWB 5JIHA 3MV9B 4OZHF 2VERN 1AO7B 3EFOA 4NQEE 5J89A 4MCYB 5JOPD 1NDGB 4C47A 2YZ8A 5TF1L 2P8LA 4JG5A 2BDNL 3MOAL 4YSOA 4Z23A 1KN4H 2AJ3B 4Q6YA 4ZFZA 1NIBA 3DURB 3VFGH 1CC3A 4N2FA 2YUZA 4F7TA 2Z8WC 4ANVA 4OJEH 4JPIB 1WWWX 4J28A 4LF3B 2IH9A 4S1RH 3QGVA 1TENA 4KJQD 1A7QL 4FG2A 1IQWL 2FYVA 3EJZD 2EYRB 1N4XH 2DKSA 3EJZC 3JXAA 4JNXA 2QV4A 5FUZL 3T71A 4TNWK 3MREB 1DQML 1JV5A 4AUYA 4BWUA 4KNUA 5L2JB 1S7WA 1NCJA 4O5LL 5LGJA 3A6CL 2G3NA 2EIEA 2RAMA 2HJFA 2ZUQC 1CQKA 2P8LB 3QS3A 4MBOA 2DQHH 2FO8A 3HE7B 4P2QA 2PP7A 4WFHD 3TV8A 1USQA 5HGHB 2KI6A 4QTHB 4K3GA 4J8RB 3NCYS 3DX7B 4FNPA 3PXJA 4WTZG 3CZLA 3FRPG 2VC2H 4KPHL 2HKFL 3F7YB 3O11A 5DK0B 4XBPB 5FF6B 3V7AG 4ZFFA 5D72H 3BGFB 3TZVC 3MRCB 2EDQA 4M03A 1EMTH 2X09A 2B2XL 4PRPD 4YGVA 1FHGA 2ADYA 2W59A 5EOCJ 5EU7C 5FUOH 4XN7A 3DWTA 3HPJB 4XI5C 4PJ5D 4HOZA 4DAGH 1OAZL 4OF3A 4X4ME 5HYEA 4DETA 3RLSA 1UM5L 2RFXB 3HUJE 4HQQL 4BE5A 4HPYH 4ZSOA 3LQZB 5IB2A 1ZLUH 4QTHA 2R0KH 3AB0C 4ODWA 3C5ZD 4LSQH 5DJDA 4A2DA 1PKQA 3A4DA 5EUOF 3T4AB 2HVBA 3VTAA 1N64H 1S7SA 5I1JH 1UVQB 1GCYA 3D07A 4K94L 3OKMB 3UOAB 5AOMA 4JO4L 4DPCX 5JIQA 3D2TA 5AAWC 3I6KB 3U4EA 4DQOH 4JQVA 4FNQA 5EF1A 5DJCB 3KW8A 4QTIL 5IESL 1QRNB 5HYJE 1F3RB 2H2PC 3QC6X 5EORH 4F9LA 3WO4C 3WDIA 2H2PD 5FFLA 4Q89A 3INOA 2WYZA 3SYOA 2ILLA 3UACA 4X83A 1NOFA 5C9JB 1YJDH 4O58L 5G4MA 3VWKB 2VRAA 2I9TB 4ZG1A 3LQAL 4FDWA 3NCJH 4F9LC 5A2IH 1BBDL 3U36A 3TIEB 1E4KC 5DZPA 2NNAB 5ENWB 1LO2L 1N6UA 4JL1A 5EBWA 5J06A 4YNYA 3ETBJ 2OX5A 5IJKA 4OGZA 3TBCA 4O02B 1HHIB 1L9RA 1E5UI 2GCYA 3GGWA 5CILH 5JHLH 3EHBC 2ZNWA 3SGKC 4AWJC 4P23B 3EGSB 1FVCA 3E6FA 2Z7UA 2D8KA 2PR4H 3CSPA 2VAJA 3KS0H 3T1WA 1CTNA 4K71B 3G5YB 5DO2C 4OD1L 1MFEL 3FTYA 4U1KA 2YAHA 4ANUA 3K74B 2FEJA 1FGNH 5AW7B 4DPBX 1DTUA 1CT8B 1QUPA 3N43B 1NIDA 4X4XA 3C8KB 5KVEH 2OCCB 3GS7A 5HJBA 1KDIA 4K5LA 5JPMA 4LLVA 4L2LA 2NMSA 1KYOK 3Q3GB 1FORL 1R24A 4PB0H 2V9TA 3RGHA 3WTSA 3QO1B 2OMZB 1JDDA 1FZMA 1RIUH 2EXYD 3FCTB 3UIYA 2EXYC 2FJUB 2J8UB 1ND0B 2AI0L 4YDZA 1T7VA 4P3CL 4P2OD 3AADB 3H54A 2AQ2A 3U9WA 5TFSH 1MCKA 3D05A 5DO8A 4GPVA 4X9GA 3QUHA 2EC9U 3NA4A 1JZ4A 4NCC1 3KLLA 3P9MB 5CSBA 4N0FA 5EZJA 4IS6A 5JPMB 2DM2A 3BI9X 3HRZC 8FABB 1BG9A 4BYHA 4M1CD 1U2HA 2WBKA 3Q3GA 4PH8A 4MXVE 3ME0B 4TULH 1AC0A 4MJIA 3AU0A 3JV0A 4FJZA 4MQXD 1F02I 4LNRA 1EJOL 4JPVL 4NQDD 1ADQH 3VB9A 4M43L 1LJMA 3HBQA 2X4RB 3VFNB 1PFCA 5LJYH 4X7DC 3H9SD 3IDMA 4GG6A 2H45A 4WFGD 3KVPA 5I30L 3KPNA 4APQC 2D3LA 5E6UB 3FBQA 1FAIL 3RHWK 3QUGA 3FCSB 4XXDA 3ME0A 2PPEA 3DVNA 3B34A 5EIQA 1NUGA 1JGLH 2FLMA 2NT1A 12E8L 1WISA 3RB5A 3FAWA 2WO4A 5I73B 3UTQA 4U1MA 2EXSA 2V5RA 4PBVC 4HIQA 3T6WA 2ZOOA 5ACZB 2YPKB 5CXPA 3BZFA 3HBPA 1CIDA 3ZHLA 4A1RA 1O0VA 3ARDA 4D0CB 5GZNC 4BZ2A 4GO9A 4U7KA 1YC7A 1P4BL 1PG7L 4GFXA 1TMCB 3WFHA 4MMZA 3WHXA 1JAEA 1T21A 4YE0A 4I0KA 3OKEB 2R69A 5AWNL 4MD0A 3NCWA 5DHVH 4PWKA 3CFIC 2ZAGA 2PWFA 3EOAA 3X3GH 4ALAL 3V0DA 3F7LA 1HHJA 3O8XB 4YUEL 4FXTA 4QD2E 2NUTB 3L45A 4HGMA 4NFDA 3QQ4A 5FV1L 2RBLA 5CFAA 4FL4B 2D31B 2IDSA 8PAZA 5LGKA 1FJ1B 1ZGLA 5CJOH 1SEBB 3ASWA 4U6TA 4MDRA 4O51B 4ODHH 3ZDXB 2NNRA 4AQAA 4JY5H 5G2NA 1DN2A 4GG6F 1RJLB 3CN4A 4C55A 1PGRB 4FXLA 5E03A 5EH1A 5DGQA 3PDDA 4MQTB 3RBSA 2XCMC 1HL8A 4H5SB 2ENSA 2V3EA 5D1XD 3DJZA 4OV5B 3H3PL 2YRPA 3DV6A 2OSLA 5LBSL 4RMBA 1YLBB 3NCMA 3UG4A 3W11C 2Q2EB 4I5BA 4O2EA 1A6VL 1TJHL 2WQWA 3UJIH 4BSVA 3TH3T 1KBBA 4Z3FA 4Y1TA 2NT0A 4OLUL 2BVYA 3FHEA 5B21A 4J8QA 2WLJA 2WUBL 2GEQA 4MXQC 4TOYL 2WZPA 4QWWC 2BP5M 1DN0B 3RYMA 4RFOL 1DEDA 1PNCA 3H9SB 2DEYX 1KTDA 4CJ0A 4TV3A 3GK8H 1WTLA 2X2HA 1A7PH 3DPBA 3QPKA 3K8LA 3GBML 4N85A 5ERWB 2XZCH 4JFFB 3OAYH 4LSDA 3UO1H 1UT9A 3ECUA 3C6LB 2P24A 5JW4N 5AOZA 2WZAA 4XPAL 3DBXB 4PG9B 1LP9A 1DBML 2CG9X 1Q9LB 4OBRA 4X9IA 2PXYA 3SZ6A 4BD4A 3N6YA 5AZEH 2JQZA 1ZEAH 3B2PA 2WKOA 1T0MB 3H2PA 3WTVA 1E43A 1X5LA 1C5BL 2G5UA 5AOIA 2J4WL 2JIXB 4GRWB 1KOAA 3V4PA 3Q2WA 5C0NC 4QJ3B 1TITA 2CLZB 1TJGH 1SM3H 1XZ0A 2VL5A 2P49B 1FNFA 2B1AH 2O4EA 4LASH 1MLBA 3NSFA 3ARGB 3G08A 1AGEA 1MCNA 1Q72H 1QYGL 3G9VA 2J1ZA 4H13C 1ACZA 1MWOA 5CIPB 4LXFA 3MNZB 4HUVA 5B39B 3MMEB 4YSRA 3LXAA 2HRGA 2YQBA 4QLRA 4JO8A 2Q20A 4KK6D 4V1DE 5I66B 1JCKA 2P26A 2HMID 3TEYA 3IEAA 2A1WH 4G80A 1NGWB 1NFDF 1HXKA 1QKZL 3L95B 3DHMA 4WUUA 1JVLA 3HAEG 1N7ML 3H0TB 4GG8A 1ZVYA 1GGIH 1AGEB 2ZKXA 3MRKB 2CO6B 3D4CA 4H1LH 1TXKA 3VFMA 1NJ9B 1BQRA 1QLEB 1G7QA 3BXNA 3HRZB 4KFZC 4PY8I 3RVXC 5I2IB 5L88H 2G2NA 1KN2H 4YO0B 2E27H 3HUJA 2AJUL 2Q86B 4PWIA 2VXVL 4PVBA 3Q2LA 2BY2A 3BUTA 4FLSA 1OLZA 2VXUH 1FZKB 4YBLC 1U6AH 3BKYL 1WCBB 5CZVL 1GH7A 3QEHB 2R15A 4GW4A 4P48A 4OQ1A 4U3SB 1B2YA 3ZZSA 4ZMVA 1R3KB 1WBXB 2BDNH 2CO6A 2HH0L 1KCUL 3MOAH 5TE4H 2OQJB 2X1XR 1CDGA 3VXSA 2Q6WB 2P8MB 3MV8A 5T3ZH 4UINH 2PR9A 3IDYC 3I84A 2OZNA 3RAJH 1UWFA 1IARB 1MAMH 1NEZG 5FYJH 25C8L 5DZJA 3SDCC 5A3ID 1TVHB 3WXWH 1JRHL 4HC1H 2TRHA 3DETC 3BCDA 2GSGB 2YD0A 4UQ2A 1YNLH 2IDTA 1Q90A 1JRHI 1J7VR 2P5WD 4P2QD 1NOLA 4OFKA 2UZYA 1MRDL 5B4MD 1RLWA 4JY5L 3ETSA 4YDJB 3TWCL 5AVZB 3CUPB 4JM2D 3QDGE 4LSVH 5E6ZA 4P5TD 4MA1C 4DGYL 3FF7A 4YSCA 3QZBA 3DVFA 4Q52A 5L0QB 4S10A 3TEZA 1YMHA 1SXAA 1VEOA 4GRLA 4WJ5B 3JUYA 1U8IB 3VFSA 4D7PA 5ALBH 2BHYA 5C0FB 3ASNB 2QSVA 4M1DH 4YWGL 2VM3A 5I9QB 4L29A 3BUIA 4S0HA 4FNRA 1LM8V 2AV7A 4FLOA 1IKFH 5I17B 4N9OB 4FTDA 5FYKU 3GI8H 4Y0GA 4XMPL 1KCSL 1MPAL 4EQ3A 1QPKA 1UACH 2E59A 2Z7WA 4H20H 4HIIA 4GRMA 4X0NA 2FUQA 2Y72A 1U8OA 4FZ8H 1C16A 2W95A 1PY0A 2VOTA 2KMWA 5EU6E 3I02B 4J6RL 3TA3A 4I0PD 3GBEA 1ET5A 1DUZA 2V7HB 1J0ZA 2V2WB 2XVGA 1QNIA 1SDYA 1PU0A 4LEOB 5FO8B 5BVJB 2ESVD 2MEJB 4F5CA 3CFEA 1RUKL 1I8KB 2OK0H 3V4UH 2DDQH 5EOCH 5T1DL 4KVCH 3RTLA 4Z7WF 4JGNA 1DJSA 3E80A 2QPSA 3SEPA 5IHZB 1HDMA 1R3LB 2C9QA 4K9JA 2B0SL 3O2VH 2OMUA 4TYUA 2EABA 4PGCA 4L4VD 1PQZB 5IHHA 3KPSB 3S36X 3WFCL 1M7UA 5IZ7A 1FO0H 2JCCB 3AC0A 3TF7C 2IDQA 4H8VA 1RVFL 3TZVA 2BHFA 3IJSA 3P4MB 1UM4L 1YN7A 3ARPA 5AW9B 1OE3A 4IBSA 4OH2A 2OXHB 3BWAB 3WO3B 2JB5L 1SJHB 4ELMA 3DVIA 4GBXA 3KYMB 4D94A 1P6AB 3EIFA 1CLVA 3PV6A 3HOGA 5SWSB 3VI3F 4HK0B 3CFEB 4ZMQA 1IRAY 3WKMH 1Z5LA 1NBQA 1ZVSB 3EFFB 3QJOA 3MLUH 1EPFA 1RLBA 3D3VE 5DJXB 5CCJA 5D7LE 2GHWB 2KHAA 2DJ4A 4P23C 5DD6B 2XBDA 2EO9A 4TNEA 3MV9A 1JWUA 1S9VB 3HHSB 1DBMH 2Y06H 3ZL1A 1QX1A 2PWGA 4NHCH 3GXUB 3GSVA 2WNGA 4OCXL 7PAZA 3T0EB 3C87A 4DPAX 3ULVF 1NCAH 1QBAA 1GJWA 3FRUA 3OXSA 4U7MA 3CU1A 2Y6SC 5I5MA 4HS8L 2IMNA 3T6XA 1AHMA 2IWEA 5J6HA 2CK0H 3ATDA 5ALCH 3V9CA 2D03L 4ZTEA 3UTSA 5BCAA 3VH8G 1VIWA 2ZCKL 3HHMA 4LLYA 2ADJA 1IC4L 5BV7L 3BUQA 1MFEH 3IMVA 3JTSB 3P11H 4PJFA 4YC2B 5JTWA 1JWMB 2BSTB 4RMSA 2WNXA 3L1GA 1S8DB 3ARYA 4PY7B 2BVPB 3TYFB 3ZL2A 2GIYA 2OXGB 3K1DA 3KCPA 4YAQA 5C2BH 5EF3A 2SEBA 3BH9A 4J4PD 3MLVH 2I60H 3KXFD 4N8VG 4DVRL 5ACLA 1T22A 3Q6GL 1Y0LB 3CFJA 1PLCA 3M7FB 4Y4KA 4NN6B 2HFFB 1YY8B 5FGCE 3FFCD 3OB8A 4BQ8A 1OT2A 1ZV9A 2XN9B 4JO2L 4ODXA 1SUJA 2W9EL 3BLKA 3ZKMC 5CR8A 4R7NA 4KKBD 2HKFH 3JTSA 3BGAA 3F7YA 3V52L 5FF6A 4ZS6C 2DV6A 4A2HA 2QELA 2ISDA 1O7SA 1YEHH 2YXVA 1MCPH 1OB0A 2E7MA 4IBTA 4PLKD 4Z18A 1I82A 3ULVL 4Y9GA 3V5KB 3KLKA 3ZW3A 3T6QC 3C8HA 2CALA 3GEWB 3L3OB 4PJXF 2DWSA 1YUKB 4KZEH 2QKSA 4OZGE 4M62L 1NCDH 2PW1A 4KQ3L 3FSVA 2XRAH 1NFDA 3W5MA 2Z8SA 1MFVA 1S46A 4ZUSB 6FABH 2XVLA 3M88A 3TWYA 5ADOL 3LNGA 1H3TA 4XAKE 5HDQH 1MCJA 1BVLB 4APXB 4GLRH 3KPPB 5EO0A 5AB2A 3VXOB 3ARGC 3IF1A 3IJYA 2VC2B 2IG2L 5JR1H 2KH2B 3IGLA 4V11A 1IBYA 4UQDA 4HUUA 1OM3H 5KYUB 4L8SB 1QRNA 1AD0A 1FYTA 3FMGH 5IW1B 1DVZA 1H9VA 2YPVH 1Z0NA 4FYSA 4CNIB 4ZYKB 1JXFA 1F90L 1CFNB 1EIBA 2WNWA 3MRLB 4POZD 4X5LA 3F8UB 3IJHB 2P45B 1JZJA 3PV7A 1ZVHA 1AGFA 5BRZE 5G5DB 2A74B 5JXAL 1TU2B 1YYLH 2Z65C 1BBDH 1C08B 1CS6A 3FKUS 3DTDA 3LB6C 4KGJA 4LOFA 4M93C 4MA1B 5INCB 4WDIA 1IT9L 2Z92A 1ONQA 5KYUA 1K6QL 3OAWA 1PY9A 1FVEB 3D48R 2FX7H 5C0EA 5IW1A 2YWYA 3LH2L 4S1QL 3ARBB 1ES0B 4P2AA 2OMTA 3MV7D 3MN8A 3DO4A 4JFDB 3JWNC 2VN4A 1MPAH 5HY9B 4M6OH 2MSPA 3ELAT 4IRSA 4XMVA 5FYLL 4V2CB 5AYUH 4TSAL 1QSFD 4B53A 4LSSH 2OSWA 4HZLA 4IOFC 3W39B 2KERA 1I1AA 1UGKA 3MV7A 4QRPD 4MMYA 3MCLH 3UZEA 2UX7A 1FI8C 5CSZB 4PJ9C 5IQNA 1KULA 4R0LB 5HDWA 1RUKH 4ZD3L 1RUAL 3A0OA 4AV4A 4OCRH 1MWAB 3GM8A 3FW6A 4OUOA 4ATTA 4PSPA 2IAMD 1AZBA 4UIKL 5F89B 5DZ9A 2ED8A 2YA0A 4U1JB 1W0WA 4E9LA 2PR4L 4P2RD 5C0IB 4N26A 1G5AA 1RHHA 2E7CA 1FL3A 2XV2A 2VXTH 4ZAKC 5I71B 3U46A 1QFWM 2G4GA 1IFRA 2WO2B 1ZT4B 3AT9A 4MCZB 2VZ1A 4F3FB 1EHXA 3LOWA 3P0VH 3A47A 5J1AA 4FFYH 4IEFA 1QSVA 2JF1A 5HYSG 3IDXH 1MN4A 1B0RB 3DUSA 5J8OA 2JELL 2RHEA 2OTWB 1AS8A 2V9RA 4DP7X 2BW5A 5TDNA 3VI4A 5C97A 2Y7NA 1N5YH 1EJ8A 4CVZA 2IGFL 2YMXL 3AG1B 4QXGH 1V7MH 2NR6D 4LHQB 2QKIC 2NNFA 4XCCL 3BPCA 4MJJA 1I9IH 5HVHB 1N6VA 1T5WA 5FLUA 5HHOE 1QSFA 5I8EB 3RWJB 4X9BA 4EI6A 4ES8A 5IQMA 2XZZA 3MOBH 4XCYB 3EBIA 3ARZA 3CN0A 3FOMB 3CXDL 3IRCA 3KWTA 2NUPB 2P5EE 5GSRA 1JUFB 4RQQA 3WIHL 3VW3H 1DSWA 4WW2C 4U6HB 3DX2A 2W65B 5LDUA 5T5FH 4HIEB 3GTNA 4GAGL 4RMVA 2EDYA 4P57B 2ZD0A 3FK3A 5F7MC 5DK2A 1CGVA 5A2BA 2IFGA 3HI1A 5GZOC 3K81A 1L3WA 2BWDA 4YBQC 3RY4A 5GZOD 4N9GA 2NXZC 3RWGA 2BSEA 3LHPL 1C8QA 3CNKA 4JRXA 5ESVA 1FQ9C 3DKHA 4EI6B 1AE6H 1CDBA 4HWBA 3S9DB 3QDJD 4KVNH 4LARL 3D34A 4PRIB 1FN4B 4PJXE 2XFXA 5CJQH 4WNQB 5AWNH 4KK5C 4ZAKA 2F5BL 5HVHC 3T6VA 3WXVL 4MJIB 2DBLH 2V33A 5JUEH 2RALA 5FK9A 2GBUA 5IP4A 4QR7A 1KYUA 5DK2B 4ZMOA 3H9SE 3CJJA 4PRDA 1IM3D 4XNBA 3VFNA 4J12A 1XF2A 3MBWB 5K9OB 3WG7B 4BFNA 4LPWA 4CDGC 3A6CH 4AQAB 1JHKH 3RVWD 5IOPA 1YJDC 1Z9SB 5DF0A 1WAPA 5LO7A 3A4AA 1M2OA 4GXFA 3VQMA 2BIPA 5CM1A 1V7NH 3GSQB 2XG4B 4QRTA 3TCLB 3HKZA 4JJ5B 4L9LC 4ODVL 1MFBL 3OLGA 5I5JA 4OGAD 2VB5A 2RGSA 1QBMH 2BS71 5FK9B 4YXLH 1SHXA 2JE8A 1CYXA 4LHJB 3DIVA 2CDGA 4ENED 4G7VL 3WD5H 3RNQA 2NTFA 2CR6A 3MBWA 3V6OC 4QOKA 4RIRB 3RPBA 1KTLB 3HNTL 4WKZB 3NABL 3VRLF 2BH0A 4AZUA 5IOPB 2VSDA 3P4OA 5LXGL 2C4FT 1TVDA 1NBCA 3SDDA 3RJDA 4ABVA 5DJYB 3D69B 3VNYA 2WYTA 5HI3C 1KLUA 1YRKA 4LKXB 4D0BA 4L4VA 3DX3A 4HJ0C 2JKSA 1A65A 3OKDA 1NQBA 1RMFH 5C3TA 5DC2A 2ZYRA 5F6HI 3UO1L 1RUAH 2H2SC 2X0VA 1E6JH 4NO3B 4P3WA 4XP4H 4XMWA 2BIOA 1G1OA 5E4EC 1OTUC 5DD3H 3LDBC 5E2TH 1S3KL 1U8QA 2WWKO 4RGOL 5D1ZC 4HG4J 1DVXA 4RIRA 2AW2A 2B1HL 4DCQB 4N0YL 2VL4A 2CBPA 2WUBH 4FKHA 1U91A 4Y16B 1YAIA 2F9BT 4YZFE 1U41A 3IS1X 4E41B 3DARA 2ZG2A 4YHNA 3ARGA 3G08B 5MP6H 1DLFH 4L0PB 3CLEL 3ZRSA 3BJLA 2JKIS 4NQXB 4F92B 5I1HL 1WIPA 1A02N 3B9VA 1TIUA 4IHBA 4UBDC 3HIZA 5E6SB 3ZR6A 4CKVX 3U6RB 4YDLC 3VM7A 5ELIA 4R7DA 4L9DA 3FQRA 5IVXB 2Q10A 1QSFE 2EDBA 3P3YA 1EGJH 3G6DL 4JFEB 4HXAL 3EAKA 4K5NA 1QHQA 1IB5A 2AZUA 1AHWB 2VISA 2WINA 2XXFA 5BW7A 1KEGH 4WI2A 3DI2B 1AFVH 3WNOA 1ET8A 2A0LD 1UM4H 5C0CB 5FGCB 1XGTA 2EDXA 1YQVL 5LLIC 1J9SA 4C8XA 2EAEA 1JXGA 2R8SL 3KBPA 1S9KC 4BH8A 2CBTA 4PGBB 3FHAA 4LDOB 3GJFA 4WFFD 3K71B 4XNXH 1G94A 2DH3A 3PIQB 1YEJH 3FQRB 1NCGA 2O30A 3ZDYF 1TQTA 1KGCE 3O3DB 2WQRA 4AQ1C 4KOCA 1TG8A 1A3LH 2BNRA 2X4PA 4FQPA 1C8PA 1WICA 2DJMA 2GIXA 4U3SA 1T7ZA 1NDMA 3DMMB 5KSVA 4WI6A 3QW9A 3NAAL 3SODB 4XHJC 4X8XA 2BSCA 3D85D 4MD5A 5AOLA 4M6AA 4JMXA 4JZJB 4Z7VF 5ANME 2XYCA 1JPST 1OK0A 2XIDA 5A7BA 4KUCF 3NZHH 3TBWA 1S4IA 2J12B 3VDBA 3O3DA 4P5SA 1YEEH 4B5ZA 4LDCA 3BP7A 4PJ5E 2CGRL 3LS5H 2ARJQ 4P05A 4MVBD 5HHMB 1S7VB 5D4QA 1BIHA 3HE7C 3MBEC 1JGEA 3UTZB 2CH8A 3Q8CA 3OQ3B 1AE6L 3MBED 4NI6A 4OF8A 4L1LA 3VGGA 1BD2D 3MLZH 1IAII 4ZFOL 1JNNH 2ADIB 3PF2A 4H40A 3IBOA 1J86A 2EDKA 3OSVA 4LSPL 5GRUH 3LPFA 2AK4B 3UJTH 4TN9A 2P80A 4NN5C 4S0TD 1R3HA 1UB5B 4NO0A 4FFWC 4OGQC 2F54D 1U33A 2CHWA 4BH7B 3PQYD 1NC2B 3O2DL 1SJEA 1E3ZA 1KJ3L 2OSXA 4OM1L 1NC4B 2NY3D 4KV5F 3QI9D 2XN9D 2ZAHA 1J0IA 5KS9A 3AZUA 4UM9B 1NFDE 4GUQA 1KCRH 4AYSA 3ZDYE 3WHE1 4L4JA 2XZAH 2Z6FA 5AKSA 1IQWH 1U95A 2O5ZH 1XQ4A 3AAZB 3C6SA 3QQ3B 1DJIA 2BJMH 5E6IC 2PW2A 3TPKA 3PGCA 5CUSH 1XH0A 4H7VA 4R3SB 2CJUH 3WL9A 2NY0B 3FQUB 3L2MA 1E30A 1IUZA 1AS6A 2BXZA 1HC1A 3X12B 5FYKE 5HHVH 4O5LH 1FLRL 2AJUH 5KZCB 5G4NA 3JQOB 3ZKXB 4YX2H 4JRLA 1MW2A 3KXFE 3IPFA 3N0AA 4O9HH 3LS4L 4TQ8A 3CIAA 1CICB 1G9EA 1KJ2L 3QDAA 1JE6A 2Y4SA 1PSKH 1WBZA 4PV8A 3V4VB 1AVAA 1YMMA 2YD9A 4ZFOB 5GS1A 1HJBC 4LEXL 1G6RL 3FUMA 2E74C 2BP8A 1AY1L 2LT9A 2OW6A 2VO8A 5AQ0A 3FSAA 4R3SA 1N0XL 3DXAA 4QF1A 3FH8A 1B88A 3SE6A 4W9CC 2CIKA 1JRHH 2WTRB 1FL6B 3I9GH 3EO1B 4HC1L 1SDAB 2UVEA 3ATBA 3WTWA 2AEPH 5GQBA 2HRHA 4CAGA 2ENYA 4MAYA 5C0BE 1YN6B 3O6FB 1SDDA 1U8MA 3HR5B 5DD5H 3D0LA 3LKPA 2P7TA 5SX5H 2OJEB 1WBZB 4PV8B 4QTFA 2XTJB 4JAMA 4P5TB 5LWYH 2LU4A 3APDA 4QRPA 3MJ8B 3UP6A 2CPUA 2YKLH 4LP8A 1F4WL 2DQIL 4NZRH 4XCNB 4TNWF 2C5DC 4LMQI 1E5YA 1F4XH 2XG5A 2I5YL 3ALPA 3HAEA 3CX2A 3KBHE 3OGCB 1CU4L 1M2VB 3M45A 2H3KA 1R46A 4KJWD 5F9WC 5IHZA 1JYWA 4AW7A 4AXWA 3L3JB 3UEQA 1IC5H 3C75A 1ZVNA 1DVUA 3SBWA 2ZE0A 3ARFA 2VAAB 4JPQA 3W9EA 5LG6A 3PL6B 1R33A 2HLAB 3T0EE 3NJNA 4JFFE 2ETWA 3ARDC 1ROWA 1A6TB 2IGTA 3P3UA 5SWSA 2EDNA 3ABKB 2DQFA 3N1GC 5B38G 3V52H 3DTUB 1WIOA 4ODUA 4P4KA 3TV3L 3IDUA 5DS8B 2F7IA 2G75A 4YHKH 3SO3B 1U8NA 2GJ6E 3ZKQD 2J44A 4KKAC 4YVUA 1A6AA 2XQYK 2PNDA 1E28B 1FG9C 1OP3H 3EFDH 3MUGB 1EEYA 2ATPA 4X5RA 5E1IA 3EZ8A 4W70A 4HUXA 3VXNA 3CXHK 1OD9A 3QO0A 3BH4A 1J5OL 2JK5A 4B6ZA 1AKJB 1ASQA 1J1XH 2F54E 1A4KA 5IBUG 1PCXA 3QPXL 3TTYA 4P59H 1XIWC 1NLDL 4FERA 4P5MB 1CVSC 3W5NA 3DX6B 4JHVA 1U0QA 2R2BB 3LRSA 2RH0A 1GA2A 4XP9L 3BPOC 3X1FA 1JDCA 1VCAA 4L5FH 2BVOA 4JFQB 3CU7A 1BQHG 3PAVA 2IJ0C 2NY7L 2NZ1A 3F5WB 1NZRA 4LOUC 2SEBB 3BH9B 1JG9A 4AM0A 1NMCB 2KC0A 4LLWB 1PLGH 4K3EH 1NSNL 1GTNA 3OF6D 3VXNB 3GMQB 4UT6A 1IIKA 5BUPA 5IBTH 3I2CH 1JPSL 1XMWA 3RTQB 1JYXA 4KITB 1PD1A 2EE0A 4QRRB 1MJ8L 1MJ7H 2GI0A 3GWJA 1P7HL 1I1CA 1X3DA 5DZNA 4ELMF 4WGKA 2WGNB 1Q9WB 3UAEA 4WV1C 3NDZE 1EXUA 1N3NA 1TCMA 4JFTA 4XP1L 1T5XB 2Z4QB 2YPVA 4WO4A 3U9UB 4I2XB 4LCWD 4HBQA 2YRZA 1LO4H 3DK0A 2OMTB 3LSOB 2DBLL 2W91A 4JRFA 4LPVA 5IKCA 1H3PH 1OSZA 4Y4FD 3LEXB 1FPTH 3UERA 1IGMH 5DYFA 1D5MB 3EYFB 3QNXB 2OMVA 4AGQA 1QG3A 3D6GA 2YJQA 5D5MF 2VDMH 1DBKL 3GEFA 4KJYA 4U1GC 1VFBB 3RDTB 2VDMB 4GSQA 2VDOL 1QUNA 4WWNA 5DZAA 4JQIL 1DUYA 2DQJL 3F58L 1RK0B 2ALWA 1U2CA 3BGMA 5C6TL 2AQNA 4XOEA 1X5FA 2NCMA 5D7IA 1T1YA 2Q5BA 4LAQH 1LNUB 1BPVA 1KC5H 4DKFH 4GAJL 4ORZC 5DD0L 4QHKJ 4Q6IA 5IG7B 4JUSA 4WSJA 4HAKA 4B96A 4OBSA 1IBDA 4IMLB 3WY2A 2UY7B 2OMXA 5ADOH 5FOBA 3UYPB 1XH2A 3MBEB 3QFJB 4F7PA 1J8HD 3BAYA 4DUXA 4I9WE 4YHYC 4NQSA 3CX5J 4MDJA 1Z2KA 4TVPE 1L5GB 2XWDA 4MMZC 5HHMD 5C0RL 1E2WA 4Y5YC 2AJSL 3VXME 1UCBL 2E5EA 4XAWL 1MUJA 4KO5A 3V8CA 2F8IA 4KMTL 2F7RA 2VR7A 4JN1L 2VLRE 4CVXB 5I18H 3OX8B 5CCKH 4OI7A 4L37B 2IH1B 2Z64C 4O00A 4YFLI 1SN2A 4EDXB 1E40A 5EDXA 4XBMA 1P4IH 2B2XH 2YKKA 4BZ1A 5IJBC 2PWDA 1Z9MA 3FTGA 3HZMB 2Q1EA 4MNQD 4X6CE 5D1ZB 1ZOXA 5DO2D 2Y1VA 2KZ1B 2PO6A 1A1NB 1M57B 2NX5B 2PYEE 2VR5A 3UBHA 4QDGA 5F7WC 4IOIB 1T6BX 2OR7A 4Z7QB 3QI9B 5AVVB 2GW5A 3ZGHA 1WO2A 1J10A 2QPEB 3BVNA 3CXDH 1S7XA 4QGTA 1RIVH 3MBXH 2OTUB 5D2LE 2D7PA 1F1GA 3UTTD 2KS0A 4NKDB 4EJ1C 3UBGA 3FQNB 3DOSA 4G8IB 2X6MA 3ZDZF 5E08L 1KB3A 4U1SA 4IBUA 3ZT6A 3CX5K 1BZQK 3FUNA 1VZIA 2QPUA 3KEDA 2R2HB 4QOKE 1WD8A 2COQA 3HLKA 1UD4A 5AW2B 4ZO9A 1N5YL 2X9ZA 3LNHA 4YK4B 5C0IA 1ORQB 4N9GB 1CE1H 2RCSH 2P5EB 3LNIA 4JG0L 3F2LA 3AM8A 4FI6A 1DCEA 3T65B 1B4TA 1FFPB 3JZ7A 3VNZA 3O6ML 3NIFF 5IBLC 2CE6A 2Y07L 5L7XL 3L5HA 2ROXA 3QDGA 1IZJA 1WZ1H 3EO9H 3LZNA 1TTBA 1Q9OA 3BZ5A 1DBAL 3OKMA 4FKEA 4MQXC 4UDTA 4YHKL 4PLNC 5EUKA 2R8SH 2VYRE 3D51A 2CGZA 3BZDA 1PS3A 3QORB 3RZCA 5C0AB 2YGVA 2C3HA 1F45A 1BFVH 2AJXH 4HKZA 5JW3L 4L0ZA 1KJMB 5FEBA 2I32A 1F58L 5JPMC 3QHFH 2GB2A 3H7BB 2B1AL 4LASL 2WZ6A 1ADQL 4FI8A 4OJAA 5BNXD 3C5ZA 4N8UA 1Z9OA 4XBGA 1CN4A 5CS7A 2WLZA 2VNCA 1TZOA 3N0PB 4P2OB 2JSFA 4LIQE 4XMTA 4XP6L 3FU7B 2HCZX 3Q1SL 2VN6A 1LK2B 1HJCA 4Y8DC 2GTWB 4GW1B 4AGNA 3KPSE 4NXSA 1G9HA 3B2UC 4QAWA 4AQ8C 3BEVA 4OQTH 1LP9F 3BDYL 3WD5L 1R3IL 2BRQA 1HCVA 3TNMA 1V7ML 2BVTA 4OUUA 4UV7H 1G7IB 3NCBB 3P0GB 4K8RH 4A6YA 2EO7A 1JZEA 3MROB 4EZKA 2O5YH 4GG6B 3QIBD 3H7BA 3WS6C 4ONGH 4Q4EA 1DYZA 1M6OA 3MXWH 3PL6D 4YFDB 4W9LC 2R4SH 3T77A 1HNFA 3APMA 4FQXA 4WVRA 4PRBB 1SY6L 2DYSB 4JKKA 3DK2A 5BZZA 1KWGA 4MQ7B 3D4GA 4L05A 5B7MA 4R5XA 3Q05A 1XV8A 3K5RA 1LO4L 1SLWA 4OIAA 2EIJB 1TQBB 2QR0A 5B8CA 1Z6JT 3GZKA 3HB3D 1ZS8A 4R26L 2BSRA 3IFLL 3BPNB 3MLSL 1NAMA 1A5FL 3FU5A 1BQSA 5K39A 2JKNA 1X7QB 3G3LA 5LXGH 1I8MB 2QLVB 4MASA 1CLYH 3H7LA 1ZLVH 4MWFA 1F4YL 5D7JC 4MJ5A 3VYPA 3QJFB 4BGDA 1RUPL 3VGBA 2A83A 2APFA 2WIIB 1H0DA 3BPNC 3VI3E 1BAFL 2XZQH 3P3SA 3I9PA 1KPRB 3WFBL 4QKXB 2YSSA 2BSRB 3RX8A 3TM6A 1ZDSA 3KW7A 5E8OB 3DO7A 4XNUL 2NY6B 4I88A 4LNRB 4S1DC 4BCZA 4ZTOL 3PQYE 4W6YB 4HMCA 1QTSA 1NMBL 4PUBH 1MZYA 4P46B 2GBVA 5HJ3B 4FQLH 2JJWA 2NZ9C 3MU3A 2HN7B 3HFML 3GRWA 4LE8A 4UANA 2HFEA 5LGHH 2NZ9D 3NIFE 5D4IA 1PZCA 4I1NB 5GGSB 1F18A 3V0VA 5AVWB 4EIBA 1BQLH 4U6VH 4I8DA 1QSEE 2ADGB 2PCFA 3R1GL 5I8KL 2PCPB 4DFHA 5D1QB 2IPTL 4Y2DA 3W9DB 1XCTB 4MX7A 2OJ1A 5E1QA 4UZUA 3I3DA 2EE3A 4Y4HC 2W0KA 4N22A 1KBVA 4Y4HD 1L6ZA 1YEIH 1DBJL 2A6DB 1J0YA 1JZ5A 4ZMTA 1KELL 3VWKD 4E9WA 5HTSA 3S34L 4NKMB 1G9ML 2X4OB 4HMEA 4PJBB 1YNKH 5L9DH 2VXTL 4HJGB 2XYBA 3BRDA 1LP9B 1T21B 4AYDC 3NZHL 3U6RA 1NAML 3LKSA 4OLZH 4F7PB 3TBWB 5KBMA 4KX9A 1BZ9A 4JY6B 4YIQB 1MCCA 1KLGA 1GOHA 3KLAB 3P77B 3SY6A 4PJEE 4WHTA 4UTBH 4BKSC 2AQSA 3NJFA 1CGWA 4NJAH 3K2UH 3CDYA 5CBAA 1VERA 4NB7A 4QWWD 5TE7H 1FC2D 2FGWH 1A7OH 3ARTA 4KKLC 1A14H 1NIAA 2DLTA 2FECL 3VRIB 2JQAA 5GGUB 5K5YA 4XVTH 3J27A 3V0GA 1BIIB 5FA4B 2V2TA 2EH7H 4PV1C 2OMYB 3AUVA 4CBZA 5FM5O 1A4BA 2DQDH 3KPQB 1TT6A 5DUBB 2FJFB 1X9RA 2FHCA 3C60A 3IKCA 4LLDB 4AG4H 4ELKB 3G6JE 3T4YA 4BWTA 4A63A 5GSVB 4F8OA 2HUEA 2XSKA 2E6JA 5HHNB 2BS8A 2DI9A 1KJ3H 3TO4D 1ZV5A 4QT5A 3W0WB 1T0OA 2YC1B 3RWEB 4HIHA 3WNJA 2KBGA 3IYLW 2B9BA 3RRQA 3QC5X 3GINA 1FFNB 1W72L 1PLAA 3GSNA 1WBYA 1KCKA 4UMSA 1P84J 3EYUH 3R19A 4PS3A 1UUNA 3F7QA 1W72B 3FT2B 1N9PA 5IB1B 3MA7B 1FFOA 2DIBA 1II4E 2F1EA 4HF5L 1AXSA 1JDAA 4RISL 5AAMA 4P99A 3O3AA 2QHLA 4NSKB 3D2UA 1OLLA 4AV0A 2AF2A 3IFLH 4HT1H 1EVTC 2RD0A 5EUOB 3BZ4A 4P4KD 1AZZC 3GBNH 3GSNB 1BAGA 3LXBA 2J20A 4P4RB 4KTDH 4WW2F 1FBIL 3CWGA 5FYJE 4AJ0A 4XCEB 4AVIA 4WKXA 4NKIL 5LN8A 4Z5RB 1QABA 1B4RA 5JOEA 1U92A 1M6UA 1SOQA 5LHDA 1Z32X 2YQ3A 3HCVB 3TEXA 2GSIB 2YGQA 4OCWH 1HOCB 4Q74A 5AL0A 4E41E 2AEPL 4E9YA 1CG9B 1QFWL 1I7TB 5JPNC 4QHUA 4NSKA 1DQDH 5E56A 3BEWB 3IDJB 1MCEA 1PYWB 4OAWB 1I4FB 4Q9BA 3NJJA 5KS9B 4BQBA 1ED3A 1U8KB 3TNNA 5DD5L 1SHMA 2DMHA 5C08E 2DF3A 1LEIA 2PTTB 2HLEB 4JAMB 5FUCC 1A6UH 1HEZB 4JZNA 1F41A 4WUUB 4F15C 4KHTL 2EC8A 2G0LA 4A2FA 5EC1A 2GC7C 1CDYA 3UJTL 1FZOB 4F37F 4JM2B 1T1ZA 2YPLD 1PD0A 5I17A 3BKCH 4UINL 3PQYA 4WWKD 5ISZD 4UQEA 3F7VB 1O5PA 1GS8A 3BEWA 4ALAC 3T8VA 4B9KC 4YZFF 3CZUB 1NL0L 3D39D 2WXHA 5FOJA 2B15A 3KNBA 2V2WA 3TYGL 3MODL 5DD0H 3RWFB 4JM2C 3FB8A 4A7VA 4QY8A 2C9SA 1V3LA 2COVD 4L4TE 3B2VL 4WTXA 4JCMA 4PGDA 3ECVA 4X9HA 1OVZA 2WVVB 2FL5B 3FC8A 5IROC 4KRLB 4CADB 1B0GA 3PGDA 4K15A 2CBOA 4LSRL 4LCWE 2AMGA 5JOFB 3N5AA 4RMTA 3D18B 1BHGA 2AQQA 2WQVA 2ZOKA 4FD0A 4IYKA 4DZ8B 1DJXA 3VRLE 2P7TB 2Y6SD 4XT1C 1CXFA 2RJMA 4ORGB 1MXGA 4ELMB 4QHLB 3MDJA 2YRLA 4UQ2B 5ID1A 2XOTA 1G7JB 5GGQH 3O6LL 3P2DA 5BQ7B 1R19A 1PIGA 1KXTB 5DWUH 4MSWB 4M61A 2FIKA 4M7LT 3M8OH 3UC2A 4E0RB 1SRDA 3FH7A 4ZQKB 2BVOB 1ZXKA 3VFUB 2WQSA 1CJYA 2IANE 3DX9B 1AQKL 2Z35B 4U7SA 1H15B 1PMYA 4FMFA 1XXFC 5FX3A 3ZRCC 1JTPA 4AV5A 2R0ZH 3TEUA 2VDRB 3FT4B 4W9JC 3VFTA 3VXPA 4WFGE 2XTJD 1QRNE 4ZTPH 5HYJB 1JGUL 4MZRA 1NBVH 4JE4B 3WN5A 1BJMA 2EKSB 1A7OL 4F24A 2BVEA 4HIPA 2Z8RA 1H6TA 4G59C 4J27A 4JG0H 3JWNG 2H6PB 5DS8A 4DVBB 2V7HA 4GKLA 1EERB 4ZXBB 3GXFA 1EXUB 2D2OA 5EB9A 3KBFA 4WIQA 2DQEH 4Q2ZB 4OTXH 1SQMA 2NY7H 4N2HA 4KROD 4NIYE 1QWNA 4MCNA 4Y5XA 2JIXD 1BVKB 3QO0B 2Y7MA 1XFPA 3MLWH 3QVAA 1KYOJ 1Z5YD 2HFFA 2CDEB 1UXLA 1ZLSH 3S5LB 1OWRM 1JHTB 3GD1C 3HG1E 1N7MH 4HEPA 5DUML 12E8H 2BO0A 4NRXA 3ARGD 1PQZA 4MZ3A 3D39A 3H56A 1Q9KA 1X5MA 2ZWYA 3SKMB 5DQ9A 1L0PA 1XF5A 2NSQA 3LKRA 2X38A 1D7DA 3TV3H 3GNML 2XN1A 3S4SA 4KXZI 1QA9A 3HLAB 4KQ4H 2ZCKH 3GSWB 3GSXA 1NGXA 4L3EE 4X5WB 2Y25A 5I5IA 4JFEE 4RISH 3GXMA 4G71B 1VESA 1VADA 4Y9BA 4ZUSA 4EXPX 5DD6A 2ZSWA 4QRQA 5D2LB 2L7UA 4NUGH 4F33A 3WLWC 4WO4C 1IGML 1DQQA 3L08A 3AGWA 3OZ9L 3WLWD 4GP8B 3EBHA 5TGBA 3CDGA 4HDIB 3QRGL 4PVNA 3J7HA 4PJ7E 3VO0A 3ZE2B 5TE4L 3W3BA 5TK2A 3NA9H 1H3WM 2H0FA 1UYWL 1BSIA 1YVLA 3OX8A 2WUCH 3T1FB 4PLKC 2ZJSL 1XR8B 3SKNA 5KTEL 2HP4A 4DERA 3QXVA 1FFRA 5FKPB 1CIUA 2EO1A 4F8LA 1OSZB 1BAWA 2EIZB 4RSVA 1G4MA 3MRPB 2ENQA 1QR4A 3H3PH 2HVKA 4IW4C 2IH3A 4MCYA 4XMKL 3OC5A 4IOFD 4DHLA 3HC0A 2F74B 3FQXA 4RAVA 1DUYB 1ILUA 3P73A 2Z93A 4KQ0A 5HHXL 1OPOA 5JHLA 5F88B 1A9BA 1RULL 2WZ5A 3Q8AA 1TZHA 4N6RB 4R4BB 4TVPH 1NGZB 5AVYB 1T2XA 2VR3A 3U79A 3SPIA 5J12B 1G6RH 2C9XA 5LG1A 5I30H 1EEQA 3OKLA 3S37L 1RK7A 4OIIL 2UXFA 2K45A 3BD4A 1ZLVK 4NPYA 1Y1DA 4OZFH 3RWDA 5KSUB 2BSDA 3VJ6A 4I3SH 3V5KA 4FZ8L 3D87B 4M5SA 2EYSB 3RL2A 4ETYA 1GPOL 4A66A 2HVJB 1H8NA 1FNEB 2C7UB 2X5PA 4DEUA 2PMZA 3FFCE 3HE7A 4P2QB 1U8PA 3P2TA 3MACL 4XTRC 4FXGB 3ZGIA 4PCYA 1WV7T 5DLLA 1AR1B 3UIZA 1Z1WA 3K46A 1Q94A 5AOKA 4FHBD 3UTPD 3QE5A 4GW5B 4V1DD 1RK1A 1TJGL 4YBHA 3ML8A 2AJYL 1VB9A 3ZQXA 4YHZL 2ADFH 4NLAA 2ZP9A 3OR6B 5KSUA 3RWDB 2O6DA 1ZHLA 1M9SA 4X7FC 4Z7VA 1OKEA 2UY6B 4CNIA 1JHLL 2CKBB 1TQUA 2JB6A 4ZUTB 5LAXA 3B7TA 4Z7OB 4ZZFA 2NQCA 3PJSA 1ACYH 2QGDA 1GW0A 2WQXA 3MRHA 4NO2A 4RBPK 3LQZA 3V0FA 1AIFB 5BXFB 5A16A 3PE9A 5E9DB 1Q94B 3EH3B 5KVGH 3TIDB 3WI9A 4RDQF 3BUYA 1E2ZA 3Q9QA 4TSBL 4FNSA 3M6DA 1X7SA 3V79C 2OL3A 3E3QE 3W57A 4PB0L 2NY1D 1ADWA 2IAMC 1QO3A 5DJCA 5DXWA 1CTMA 1XF3B 5PCYA 3SGDH 4Z7VB 5JIPA 5T5FL 4OB5L 3NPSC 2MOVA 2HWZL 1G0DA 2VWEC 4Y4HA 4R90L 3D1MC 3CVHL 2ITEA 3PWVA 2OZ4L 5BS0E 4CC4C 3L3DA 5A1AA 3MRHB 3IMSA 4KK5D 4NUQA 3MZGB 1RIHL 1I7RA 3RIAF 4AIOA 2FAUA 3LKNB 4Z7UB 3QWRD 4XWGH 3V6ZA 1M7XA 1GHFH 1P7BA 4HCRL 2BSED 4XE0A 1T7XA 1HT6A 4MJ2A 4MMYB 1P1ZB 1N26A 3VFOA 3KLHD 1MCFA 1ZGLM 3O4LB 4R7XA 1UWXH 4Y88A 3MRFB 4O02A 3UTOA 1SOKA 2F53E 5DZLA 4M6ML 1FHNA 3ZIYA 1UD8A 4NKOA 5IVZA 3K6DA 3A6BL 5J3HC 1KPUA 4Z7NE 1ZV2A 1RURL 4MAUH 1S2EA 2WWMD 2Z7YA 2O5YL 1J0KA 5DJDB 1UJ3B 2QQNH 3EH5B 1FFQA 3BAWA 1JGDB 3IT8D 3KL5A 1CD8A 4P2RB 4RA0C 4TS6A 1CXHA 4FQCL 3T3MF 3R7RA 5HGDB 4GRWF 4OGAC 5KBPA 4H25B 5BRQA 2LAAA 3TBYB 2HJLA 1T2QL 1UWXK 3N1QC 3ZYOA 4L5FE 3OG6B 3RUGF 3KWVA 3RVTD 1CMOA 4NWTL 3MUJA 3ARRA 3GLDA 3IMWA 3RTQC 3VWKA 3H6JA 2J8UA 4D8PA 2OJZL 1HSAB 1LP9E 1JXKA 2XPGB 1F8TH 4K07A 5EU5B 3IJ7A 5IJDC 3LHPH 1HZLA 3GSQA 2BP0A 2E46A 3BYTA 5D8JH 2Y2WA 1OAYL 1OP9A 4E9VA 5T1KB 3L9YA 3G5XA 3V6OA 3CTTA 3PWNA 5CP7B 1OM3L 5LXVA 5KSBE 2Y23A 2WW8A 3I85A 2CDGB 4KKCC 1JUFA 2ATKB 2D3JA 4Z76B 4NC0B 4G5ZH 5T1LA 4NAMA 3VDCA 2ESVA 4LFHG 3A67L 2W65A 2ZCHL 4OLXH 1CI3M 4Q9CA 1PAZA 4WKZA 1QPPA 1MCDA 4TNVK 2J72A 1BZ7B 1EA9C 3MJ9H 4CC1A 3OKDB 4A2EA 5I8CA 4NQDE 2DQHL 3SBRA 4B5EA 3NRPA 2VJ8A 4Y89A 3LY6A 2FT7A 3HI5L 3N41B 4G6KL 4DTGL 3DYMA 1KEML 4AENB 4ES9A 2VXQH 2E3VA 1UD6A 2QZQA 3DIDA 3ML9A 1E4XH 4PHXA 5L8KB 2I26N 1D3CA 3STLB 3TJHC 4G6AC 4XXDB 3C5ZC 1T0NA 2J71A 4I4WB 2YBGA 5GRWA 2D0GA 1IC7L 1J8HB 4K55A 1HS6A 2ZICA 3BP5B 1BZ7A 4E41D 1FFTB 3ARBD 4G42A 3Q9PA 4LL4A 1GIGH 4X0KA 4EUPH 4JK0D 2A9NH 4JRXD 4PJAB 3ZRFC 2UYLA 5K9OA 1EAOA 4HJ0D 3T5WA 3HS0B 4CW1B 4HXAH 1EXHA 1PZAA 4FG6D 2QKIB 1YY9C 2K78A 3LMJH 5EO1A 3S96B 3ZE2E 1MH5A 1NPUA 3H4HA 1RZJH 4URTB 5L9DL 3CFMA 3CC5A 5C07A 4ANWA 4GKNA 5IK3B 2WNKA 1QI5A 2D03H 2EDJA 3BH8A 2Y5QA 3LVTA 4KC3B 1TQCC 1N67A 1XCTA 4MX7B 3U0PB 1J8HA 1UZ6E 4QT5B 1OAJA 3VH8B 1JK8B 3UXFA 4X7CC 5EU4B 1CF8L 1IGCL 1HINL 1TYEB 5DD1L 1NANI 5EN3A 1BEXA 3U25A 3WLBA 3K2UL 3JV4A 5DR5H 2GAZB 4OY9A 4IKLA 2VZUA 1V3KA 4X6EB 2X6VA 2OMBA 1RJLA 3FZUC 2CO7B 3NFPA 3GZOA 5C9KA 5IUSA 3D30A 3RUGB 4Y19B 3NT0A 4JB9L 3HVDA 3NQKA 5KWYC 1U30A 2QGEA 4KDTC 4Y7OC 5F1IA 1MEXH 5IROA 4IMKC 4JFOA 4CU7A 1CBVL 3A6BH 3NJHA 3VGHA 1AI1L 3M07A 1N6QH 1UZ8A 2JJUA 5IQL