3ZHNA

Crystal structure of the t6ss lipoprotein tssj1 from pseudomonas aeruginosa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
PPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PA_0080
publication title Structure of the T6Ss Lipoprotein Tssj1 from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Toxin
total genus 31
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12790 T6SS-SciN Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zhnA00
4A1RA 3ZHNA 3RX9A 4Y7OC
chains in the Genus database with same CATH superfamily
5ESQB 3RNQA 4O5LH 4KROC 3ZPDA 5D1XE 1R75A 2HMIC 1QO3A 1U6AL 3FFCB 1YA5A 3OHMB 5I1KL 3WY2A 1T7ZA 4MS8C 1A3RH 4X5WA 1JF1A 5DD3H 1SOKA 5EU4A 4CAGA 4PJBB 3TT3L 1NCDH 4ZJ9A 1ZS2A 1W8OA 3VA6A 1JPGA 3KPSD 1XZWA 5CINH 4NN6B 2NYZA 4FNRA 4GI6A 1HQ4B 3IBEA 4F7MA 3ZGIA 4MQ7A 2EZ0C 5HHPB 4EJ1C 2ZX9A 4J6RL 5EUOA 5K9JL 1BIIA 2J25A 2BVEA 4PYHA 3DMMB 5LWYL 1WA0X 1VGEL 3K80A 4LIQH 1TKWA 3Q5YA 3GMPA 2DJSA 2YEZA 4R7DA 1LWJA 2HTKC 1H9VA 2BXYA 2YAQA 1IC0A 4LP5A 3SPGA 1JRHH 3SKJL 2VH5H 1G94A 3WFEH 4OIIH 1KGWA 1TG8A 2FEDD 3TPKA 4X42A 5FWQA 4EBQH 1ZVYA 4MMXB 3V0JA 2BVUA 4TMPA 3VFTA 3L5HA 4LRNL 5EOTA 1C16B 5TDPB 3P0VH 3HOGA 4KXCA 3WEMA 3CNKA 4NCC1 4RWYH 3D48R 1MEXH 1FN4B 4NWUL 3QFGA 1CCZA 5IB4A 5HHXH 4WU5A 5JZ7D 3HBZA 4F3FB 5EF2A 1JGUL 5CD3B 3PQYA 4AGNA 3JYBA 5I0YA 2IV9A 5KVDL 1BP3B 1HL9A 2GSIA 2IF7A 4XMTA 1JWSA 1UEYA 2WN3A 2Y7OA 5F9WC 1YMHB 4AQEA 5AYQA 3RFZA 2ADIA 1RPQA 2FO4A 2P42B 4P3DB 1JXKA 1OTSC 3PUCA 3BWZA 1YEJH 3H0TA 5FLVA 3MNVA 2ROXA 1XR9A 1MJ7H 2D7NA 1HKFA 4GAFB 1XF3B 4NQTA 1NCCH 4UTAA 1Z3GH 1Z3RA 1YEIL 3QEGH 2XYBA 1GPOH 3HR5A 4JE0A 4J3BA 4WTWA 1KBGL 4ODUA 2K7QA 4ZW3A 1FYTB 2YN3A 4OM1L 5I73C 2VL5B 3N50A 4TUJA 5GGRA 1PJWA 3CH8A 1I8MA 2OMUB 4JFQB 4MAUH 2WNKA 3AGVA 4YSUA 4P2RD 4YHIA 3LKPA 1UJ3B 2JKSA 2K3TA 4LQFL 3BPLC 5FCUL 3BKMH 2VYRE 5GGSA 1Q9KB 2XFGB 4AQ8C 4TS6A 1XZ0A 5I16A 1QQDB 2YD3A 4LCWD 2EVFA 2XA8L 1WS7A 1WBZB 4KXBA 1F4YH 5E4EC 3MPCA 3V5KB 1T3FA 4XMZA 2PO6C 2EIZA 3PF2A 3U4EA 3UH8A 5I1LB 1SEBA 1NEZG 1S7XA 2VISB 3MUZ1 3DTDA 3B9KA 1YEFL 4PJFF 2G9HA 1BGXL 1BZQK 4OGAC 5DHVB 4UOW0 5DJ2B 1I7UA 3QUYA 1O9VA 1X9QA 3N9GL 1JGLL 5B8CB 2AEIT 1URIA 1DVFC 4O9HL 3HG5A 3ULVH 2V6HA 3QIUD 3PV6B 1LEIB 3FT3A 2NY3C 1NCOA 3D3VD 3FPYA 5IB3A 2R0KH 3RKPA 3Q48A 1RJLB 1J5OL 1RFDH 1HWHB 1FNGB 4NDMA 4PG2A 4KNSA 1DBBH 3NDYE 5I75B 1IKNC 4KY2A 2VLRE 4WSGA 2VT0A 4UAOC 2PW1B 5DJYA 3SGJA 3X3GH 1CXKA 4JQIA 4B95C 4XMXA 5FW6A 4M03A 1KXVC 3DJTA 3JV6A 2AK1H 4ZFQA 2DRUA 2EIEA 5IB1B 2QPFA 3QARA 2ZKMX 3OKMB 2E7LA 4EIBA 4FDWA 4R3SA 3MRRB 5FGBC 3WCYA 4S2SB 3KD4A 4J39A 3NFSH 1A3ZA 4M6AA 4LE8A 4LEOB 1ITCA 2BFGA 4KC3B 4JKPL 1NFIA 5AQ0A 2F53D 4YSTA 3OMZA 5KW9H 1EMTL 1NMCB 2F68X 4IOSD 4ZMVA 2X0WA 4PD4J 3IDIB 4H88H 5F3FA 3T1FB 2R0ZL 2H2PD 5GZNC 4PBDA 4W9DC 3QJXA 1E8WA 2IWEA 3HEIB 3K74B 1KIQB 1QFWI 4PJGE 2HJLA 5J4MA 1R9FA 4C56D 1SBSH 2PF6A 3WJLA 3HZKA 1F4HA 3OJ2C 2JI3A 2RFXA 4Y89A 2X4TA 4MB5A 3LVEA 1SJVA 4RA3A 3SE8L 3FCTB 4Y19A 4ZODA 3ASNB 3F01A 4WDIB 1OCRB 3KYNB 1LO2H 4P3DA 5DK0B 2QL1A 5CZRA 4G9FA 1EWHA 1R0AH 1IGFL 5AVXB 2GTQA 2ZKXA 2BX5A 4FGMA 4UB0H 2NYYD 4OCWH 2WVTA 1MXGA 1E4JA 1IAII 1U3JA 1BQLL 4P2QD 3NEEA 5EZOH 1J1XH 2A38A 4YHKL 1U3YA 1H0DA 5D7LA 2WUCH 4N0FA 4HV8A 1UM6H 2XZQH 3H3BC 5A2IH 2P47B 5DFTA 1J0IA 3IMTA 3NGBC 1JK8A 4WI7A 2SODB 2Y25A 3AMLA 4ZXBB 2V3EA 3VFOB 1Q0EA 2VXUH 1TO4A 4Z7OE 2R9HC 3IGKA 1Y6NR 3OM3B 3VXRA 2F54E 4JO4H 4HUXB 1CBVH 4NQSA 5KJRL 3ZDXB 5C3LD 3BD4A 3ARBD 1IAMA 3REWB 4ADJA 1L9OA 3C5SA 3NSYA 2GJZA 2JB6B 1QSVA 3RL2A 1LO0L 2FGWL 1CXEA 1RIUL 4IGBB 3O3DB 4OQ1A 5F9OH 4A67A 4K3DH 5GRJH 3U7YL 1WT5A 3CHSA 5GSRA 2W5PA 2J56A 3SCMC 3V95A 4N3TA 5MEPA 2LR4A 1EFXD 3KWVA 4BSVB 3NJLA 3QUMB 4EDXB 4PWGA 1B0IA 1D5XA 4G6FD 3SDAA 3V8OA 2R59A 5E6IC 3LZPA 3RTQB 3MRMA 5HJBA 4RMWA 5MEQA 2QSCL 3RY5A 4NRYB 3FO0H 5GGTA 3MRQA 4C54A 3MJ9H 1A0QL 4MX7A 3DX9A 5B3JE 3NCXA 3MOAL 1H6TA 3CZFA 3F83A 2Q6WB 4PGBA 3GC3A 4Y16C 3H7LA 3L6FA 1UTDA 4YJZL 2OCCB 2W0FB 3I6GB 1ILSA 2ATPA 3RBSA 1UXMA 3NT0A 3QNYA 4UQ2B 3W11C 2OM5A 2W8CA 4GH7B 4QWWD 3O6FB 2HJKA 2VR8A 2P5PA 4XBPB 3WIFB 4S2SA 3GHBL 3HI1A 4FQHB 1UM5H 1AZRA 1MLBB 5HI4C 4POZD 2XZZA 4UIKH 5IW1B 3BKYL 1A3LL 1TQVA 4LU5H 5IBLC 5T5NF 1JE6A 1N26A 1PZCA 2GJPA 2HCZX 2I32A 1MAML 2EDBA 3IJHB 5EZJA 2EC9T 1IKFH 3BAKA 4KKBC 4LDCA 5IVXF 2OBGA 3DGCR 4PJDB 3JTTA 5JIIA 2YPLE 4G6AD 3D05A 5KTEH 2WQUA 1T2QH 2WO2B 4ZBJA 4J2QA 4G9DB 4Y2DD 3E1ZA 5ELIA 3QCTH 2G5BA 1PZ3A 4OCLC 3UYPB 4AQ1C 3NCJL 3ES6B 3NVQA 4HZ1A 3RGVD 4ELMB 2APSA 3WXWL 4ELKA 3KWWA 3EDDA 2JWYA 4U7SA 1U41A 4WDIA 5KUMA 3QT2A 4FNQA 4JM2B 1CLYL 2Z4QB 3VFUB 5CEZL 3QXUA 5TPWL 2WWOA 3PL6D 4YBLB 4N9GB 4D7BA 4LAQL 2ED8A 3CXDL 4RGND 2G75B 2XJLA 1Z32X 1BZEA 2AXGB 2DQGL 4NAJA 1LO3H 2Q76A 1BM3L 2B9BA 1QEWB 4XC3H 5CILL 4OY9A 4JREC 4LOFA 4JKNA 4MDIA 5I5JA 3D87B 4ETQB 4BZ2A 1QA9B 2E5EA 2R7EA 4NUJB 4XP4H 3ZO0A 3RGHA 3VB8A 3DHMA 4HPOH 4K23H 3UZVB 1ZV5A 1VFBA 2HFGH 2FWUA 1A9VA 4KRMB 4F8LA 5HYFA 2OI9B 3IFOA 4WW1A 4X80L 3WY1A 4OV6F 5GIRB 4CDHA 1AKJA 4JZNA 3UJJL 2ROYA 4KI1A 5BRZA 3S6CA 3QQ9D 2JQZA 3QDGD 4KGLA 1OM3L 4R0LB 3GZPA 4FJZA 2FHCA 1HWGB 2CHDA 2YFOA 4CADA 1U58A 4NUGL 4XMPL 1QABA 1MHHB 1GAFL 4WGVB 1NIAA 1I1AB 1HINH 5IM7A 1UUSA 4XBGA 1AHWB 2A3TA 5J06A 1G7LA 3BO8B 3CH1B 3TVMD 1GGUA 1DTUA 4X7SL 4HS8H 2MCPL 3RDTA 1YJDL 4L8SA 1S7VA 1MCNA 4NRYA 3NESA 3FB5B 2I25N 5D7JA 1V55B 3ILQC 3UJIH 1HH6B 2GEEA 2YRLA 3TA3A 4F7TB 4J5VA 1Z5HA 1IGCH 1KZQA 3RNKB 4PJEA 5FYKH 3OLIA 4PMFA 5ISZB 4Z7VB 5IEKA 4DN3L 2XYCA 2VO5A 3EJQA 3FOMA 1I3RB 2EDDA 4M7KL 4X98A 3AVEA 4HJIA 2I07A 2Y3AA 5E8PA 1LWRA 3LRHA 4YGVB 3QC6X 1ZT1B 3HC3H 3HG1D 1YMMA 1UYWH 1WPCA 4PY7A 1H8OA 2JKNA 4GYBA 2F5AL 4IOIA 3WJMB 2BSRB 4IBTA 4HKJA 1CS6A 1SY6H 3FUMA 4KJPD 5DZJA 1WS8A 1QFHA 1ZLEA 3LQAH 3TJHC 1IX2A 1ZLSL 3ZE0F 3IFPA 3RTLA 4A2HA 1H15A 3ZTJG 1SXSA 1UZ6E 4G7QB 1A25A 5IW1A 3UCQA 2VDOL 2ZPKH 1T89A 4K9EL 1JERA 5FYJL 5AOLA 4PS4L 3SDCB 5DZ9A 2CR3A 1RPKA 3E3QE 2CPUA 1P4UA 3N40F 2NUPA 5LNDA 1EBPA 1L7IL 1PZAA 2VR7A 4GKLA 3RVVD 5E2JA 4AEIH 2MIZA 3MGTB 4F27A 4XN9A 4E9WA 1D5ZA 4W93A 5AOJA 4FQ2L 2VXQL 4JRYA 3EFFB 4NHUA 3WNKA 3FUDA 5C0ND 4YO0B 5H35A 3UYPA 3QIBA 5E2WL 4G7RB 3AT9A 3LZOA 3QRLA 4XI5D 1YZZA 5HI5D 3REVB 1IO4C 4IQHA 1D3CA 2UY6B 3CFDA 4TOYH 3LYRA 4AYID 3HMWH 1DQDL 3PHQA 3VFUA 3BJLA 1ZVSA 2HFFB 4JG5A 5CJ5A 1PBYA 2PTTA 3NACH 5DJ0A 2OV0A 1NCBL 3S7GA 4Z7NF 1NCAL 3D25B 2N7SA 3IJ9A 2BWDA 1U3HA 5BRQA 1Q4NX 4JL1A 5T1KA 2VO8A 4IHOB 4PJCA 1XB6A 2NXZC 3VI3F 5F3BB 3K2KA 1WGVA 3CXHK 3QJFB 1EEQA 1TJGL 4G43A 1HOEA 5EUKA 3H3PH 4TUKH 5JOPD 1HYSC 5D93C 4KKCC 2J57A 3F7QA 2G2RB 5A7EA 2BP8B 1KACB 3P2TA 4U1SB 1G43A 1UB6B 2YD4A 4PGCA 4TN9A 1AZVA 3JV4A 1QWHA 1QZ1A 4UM8B 3GHEL 1E5ZA 3IDGB 4Y88A 4WGWB 5EWIL 1KUMA 2JE8A 4ZX5A 4YAQA 5AD0B 1UH3A 3OWRA 4AENB 2E7HA 4KX8A 4PRDA 2C4XA 5D70L 1UKSA 2FJHB 1XGTA 1ZV2A 5C0BE 4KTEH 4X7TA 4X83A 4A6YA 1ZANL 3SOBL 2IWGA 1OSYA 4NNPL 1GHFH 1RMFH 2CDFA 1U95A 3G9VA 4AGOA 1DJSA 1WJ3A 4X0NA 3EFDH 2OPCA 5J3HC 2AJUL 1YJDC 3NSJA 1ZGLB 4QCIA 1NAMH 3PFUA 3GDCA 3VM7A 2R2CA 1FZMB 3QCUL 4ZS7H 3TZVD 1NA8A 2Z92A 5FO8B 2F58L 5DVMA 4AV5A 1MQ8A 2CGZA 2HRLA 3NTCL 5IIEA 4KTGA 3UP6A 2DMKA 5AW4B 3VWKC 3P2DA 4HIHB 3H1ZA 1ZSDA 4BINA 1ORSB 4HDIB 3WXVH 3A24A 1EAQA 4JN2B 5FC9A 2IG2H 4XCFH 1UFUA 5GS0H 2NW3B 3IDJA 2ZCZA 4CMMA 5JIQA 4XT1C 1WC7B 4HH8A 4FFZA 1B2WL 5IVZB 1N59B 2GITA 2QHRL 5D6DA 3PUUA 4BSJA 1KGUA 5D1QA 3FTSA 4NJ9H 5ISZA 2R29H 2Z35B 4WK0B 5MHSE 3VJ6B 5F7YC 2Q3AA 2Z8VC 3BESR 4KPHL 4XVUD 2NY0C 2E4TA 5DQDH 7TAAA 5IWLA 1T6VN 4K9EC 1N5YH 5F44A 1KC5L 5DS1A 4AYFA 3QIWA 3ARSA 4KKZA 2BVOA 5FEBA 1Y1UA 2BY1A 1WD9A 4AYEC 3PGFL 1RULH 1MFAL 3EYFA 4G8GA 1S7WA 4DPAX 4L3AA 1S3RA 2VM9A 2OTPA 4XVJL 5A43C 4G6MH 3TC9A 3H54A 5I76A 1UGKA 3KZ8A 1XBRA 1IV8A 2ZYIA 1YNLL 1OANA 2SEBA 3MUJA 5E6YA 4IBZA 4J4PD 1FZJA 1ZHNB 5DHYA 2VDNB 3UPRB 1CGSH 1X5ZA 3ARED 2VDRL 3GQFA 3EO0A 5F89A 3JT0A 3PDOA 1MCOL 4BFFA 1KCKA 2AJZB 4ZX4A 1F2XK 2EUZA 4H26B 4JO2H 3ROLA 5HD8C 2XBDA 3NFNA 3MBEC 4EKXA 1G9NL 4V1DB 4UQCA 4IGBC 4L8DB 2NUTB 2VJXA 4M48L 4JFFE 1TZAA 5L2JB 1AGDA 1DQTA 2V8MA 4BWUA 4Y4KC 1XH0A 1SBBA 4PJ7B 3DRTB 1OSEA 1DVTA 3FFCE 5AZEH 1RHHB 3ULUE 2ZSVB 4KMLB 1YYCA 3EBIA 1IC7H 1EXUA 4P0DA 2G60L 1NBVH 1OAXL 4D9RE 4KVNH 3VFRB 4NS0A 5FYLE 4PJBE 4JFUA 5M94B 3DJRA 2ENQA 5FUCE 3BCFA 4UM8A 3KPMA 3GXIA 4DH2A 4QTIL 1KBVA 4JCWA 3CX2A 2P3YA 3RY6A 1KCUL 1KEML 4PLJD 4MAYB 2NR6A 2WUBH 2G0KA 4GW1A 4NXKA 1FFOB 4DUXA 5HYSA 3HNSL 4JGJA 5D5MF 1EA9C 1F58H 3VRIB 3TT3H 2MTPA 3IDNB 2XWZA 2HT4D 4ZAKC 1P5UA 1I7ZA 5F7FA 4R8WL 4HMDA 1TLMA 1HQRB 5KVMC 3DX0A 1F6AB 1IEBB 3V9FA 3TXAA 2E9WA 3B2DC 3IAPA 1R3IH 1E4KC 4J6RH 5K9JH 4MZRA 5F72S 1ORSA 4HU2A 4YL4A 2FGZA 1FORL 2J8OA 3DIFA 5IZ7A 2JJUA 5LWYH 2ZOKA 3MNMA 4HWBA 5C09D 2BW4A 4KFZC 5DCCA 3OXRA 5TQ2H 3SGDI 4XTRD 4RZKA 3TBVB 1KJ2A 1QRND 3S3CB 3VXNA 4LCCB 1DLHB 3U25A 2XQBL 1ZLWH 5KWYC 1C8PA 5CHNB 1JK9A 3LPWA 4B60A 1T5XB 4LOVA 4DFIA 3CVHL 3MJ9A 4L23A 2BHZA 4L9LB 4XMWA 2XPGA 4ZMWA 3LRSB 4ZFOB 5BOZG 2VZTA 4NYLA 1IGTB 3EO1A 5DLML 2Z35A 2OX5A 3GSVB 1RKRA 4LRNH 2PPAA 5G4MA 4DOHB 1BXAA 4LVHC 4GQQA 5IHZA 4JM2C 4OFYD 3F65A 3Q8BA 2ODIA 1PD0A 2IBZY 2K1MA 3T8VA 4LKCB 4X5XA 1A6VL 4UV7H 2HXAA 5CZKA 5C08D 4G7VL 1JGUH 1U8CA 4JAMB 4AIZA 2F18A 4CVXB 2BSEA 4PRAB 5KVDH 3NIDB 1RURL 4KI5E 5CD5D 3EOAB 3G08B 3NZ8B 4HALA 1AYOA 4K7FA 2X4UA 3K4ZA 4XODA 3U36B 4XOCA 1FYTE 2VSMB 4HUNB 1GC1L 1CFVL 2FAUA 1KB9J 2ZQKA 4OBSA 3RX8A 5TDOA 4EI6B 2ZKWA 3THML 4KY1L 1BJ8A 4KTDH 1QLEL 4W1TA 1G9NC 3ML9A 2ICWI 5AFAA 1RUML 1AACA 1KLGA 2G0LA 1AR2A 5JHDB 2BIOA 3EGDA 3SBWA 1YEIH 3DVGB 2AK4A 3WUWA 1WIUA 2LW3A 3FQRB 4IHBA 4UZUA 3ZUCA 1TSRA 2K6ZA 4W9FC 5DURB 3CLWA 4TYUA 1HL5A 3NH7L 2D31B 1N3NA 2H8PB 4AITA 2GJJA 2WAQA 2BPBA 2H1PH 1T04B 4U1IA 1COBA 4NFBA 5FKPB 4JDZA 4X6FA 4OZFG 3QORA 4L8DA 4LQFH 1TCMA 3QAZB 4Q74A 5DA4A 5F1NA 1MRFH 3OKOA 4AQAB 5HGGS 1S9VB 2V7NB 3BN9D 2VAJA 4GKZA 2OTWB 2NZ9C 1YN6A 1Q9WA 3APDA 3DRTA 4OLWH 1BMZA 4GP5B 3RB5A 1P4LA 3HB3B 4FQXD 1T2JA 2FL5A 3B56A 3KPOB 1RLWA 4HHAA 4AGLA 2KHAA 1YEFH 2G3XA 4XWOD 1I4FA 1BGXH 1XGPB 5SWZB 4E36A 4K55A 3PWJB 1BD2A 15C8H 5A2JH 2NNCA 4JFYA 4WI8A 3VXUD 2J2ZA 4G3YH 2VDLB 3MV7A 3N9GH 1JGLH 3EFOA 2XWJB 3OHXB 5DMKA 3H42H 4OF8A 3VYOA 1D6VL 2WBJC 4MDRA 4ZT1A 3VI4A 4U6YA 3T6VA 4EN3D 4U05A 2ZX6A 4KK8D 1PD6A 1RZGB 5IVXB 1J5OH 3IDNA 4A2LA 1YRKA 5F71A 3C8KB 3K91A 5E9DD 3X13B 3GEWB 5E4IA 1NAMB 2EXYD 1U8NA 4GRLB 4Y2OA 4U1GC 1D5RA 3BUIA 3PP3K 4YSAA 1IE5A 1G6RA 4RX4D 4Y1AB 4YBHA 1JGDA 1T22B 3B3IB 3Q2CA 1M9WA 4OLUL 5HPMA 1SLXA 1HX0A 4JFDB 3B8SA 5E2UH 5FOJA 3TFBA 3IB4A 4X4ZA 5FA3A 1EQWA 1W72A 2EICA 4GSRA 5INDA 4IDLA 1I8AA 5HYSG 3E8UH 5LG6A 5BO1L 4DP2X 4PJXB 2XKNB 4XB8A 4P07A 3QWOA 1C5DA 4A66A 3N04A 2ESVD 4P2YA 1T5XA 3HG4A 2DL2A 4JFED 4JKPH 4QY8A 5CR1A 2Y2WA 3PWLB 4FQCH 3FFOA 1EMTH 2NY2C 4XP5L 5A1AA 4KRPB 1CLZL 4LSVL 3QJTB 3ALWA 4N0UB 5FUZL 2PR9A 3VXTB 1H3XA 2R0ZH 1HJBC 1GC1C 2VMJA 3SZKC 4BEIA 4KZCA 4KFMA 2O72A 5DYFA 2YZ1A 4NM4L 3RWEB 1SY6A 2YMXH 4MJ5A 1K3IA 3BUDA 1DN0B 3SE8H 3C5ZD 3B5GA 1IVTA 2HVJA 5TH2A 1JPTL 4WEEA 4DGYH 5I6LA 1NCUA 2J1ZA 4AIOA 1OALA 3ARGD 3K7UA 4JEGB 1NUGA 2RHEA 3HI5L 3O4LD 3ZY7A 5CM1A 1FL6A 1PZUB 1S9WA 4O00A 1DUYB 3IJSB 1D9KB 1RK1B 4FJ6A 4GAYA 4CU6A 4PV9B 3U1SL 4RIRB 3KPNB 2Z93A 5I1GH 4CC4C 1M05A 4RH4A 3APNA 1SYSA 1BQLH 3GSXA 4N2HA 1IQWL 4KO7A 4M6OL 1CURA 4MZ3A 3O2DH 1LP9E 3HFFA 3DX3A 3NEXA 2EYTB 4R4ND 1KF9B 5I8CA 5I1HL 3ZDXE 2P8LA 3ZOAA 1T04A 4FQIL 4IRSA 1T4KA 4U1HB 5KYYA 4JZOA 3VXMB 1PLCA 3W2DH 2ADGA 2KUTA 1U2CA 4IMLA 2IGFL 3MV9B 1FBIL 4ICXA 3CHXA 1T20B 3KXFA 1E30A 4LAJH 3DXAA 4X6CB 2LFGA 3UMNA 5LGJB 2DQFB 3MRKB 2UX6A 4NGHL 2V4LA 2NX5A 3UGUA 3MLRL 5DVKA 2Y06H 3TF7C 1JG9A 4DO6A 1LO0H 5D7SL 5C0DB 1IBZA 2FGWH 3LDBC 1XIWB 2Z1PA 4DGUA 3VRJB 3U7YH 4BCZA 3ZE0B 1GGCL 4E9RA 1ET7A 3C5JB 3TO2B 2ZF9A 1HHJB 4M5YH 5C0AA 2QMJA 2HKFH 1GZQB 5EC2A 4TM9A 2A6DB 3AQXA 2P28B 2IDQA 4YE0A 4F15B 3T3PB 2X2IA 3IN0A 4JRXD 1JV5A 5FDWB 1I9RL 4J3OC 4LZKA 4QRQB 1QVOA 5L4FA 1HT6A 4LSQH 1A0QH 4EPSA 1X5JA 1NQBA 4K9JA 2OMVB 3F05A 3D51A 4GG8A 3MFFB 1A6UH 4LNRB 1O5PA 4HJ1A 2KDYA 1Q72L 4AMXA 3S96B 2F2HA 5EF3A 5D6CA 4EI5B 4R26H 4AEHL 1NEPA 3G04B 1E3FA 1N0LA 1UUNA 5SWSA 1G5GA 3KNBA 3VFGH 4JPIB 4GKSB 4Z3GA 1KCRL 1JXGA 1BM7A 1FNEA 3Q5OA 4LPVA 4X6EA 3U0TA 4PJDE 1QEXA 1ZAGA 3GHBH 4GXVH 3QUHA 4AL8H 2ZJSL 4IIQB 3IVKA 1SN0A 1F13A 3PAUA 3VI3B 5ICZB 4NLAA 3SD2A 2GUOA 2CJTA 3BKYH 1A3LH 2WKGA 3UTSA 3NBNA 4ZDHA 1M1XB 3PQYD 2WVVB 4Z7IA 2L7UA 2R29A 4ELME 1ZLVH 3QPQD 4HX1B 3GXMA 2VRQA 1ETZB 3O8XB 3B7RL 3DUSB 3KCPB 4U3CA 4H1LG 5KYXB 4DW2L 4DVRL 2QLVB 2AEQL 2OQJA 3RWEA 2Q7AA 2FJSA 3G5YA 3TS8A 1M6OA 2IQAB 4RETB 1HZKA 1ROWA 3NCJH 5H4ZA 2JKJA 1GY1A 5DJDB 1S5HB 1RU9L 2X4NB 5T3XH 4BHUI 4LGSB 2GJ6A 2X1QA 2CALA 3LPFA 4R5VA 2X1XR 5IHUL 1P84J 1D9KA 3FUIA 5TPWH 1F4AA 2QGDA 4N0YL 2GI7A 2MCG1 5GRXG 4LAQH 3K6OA 4XNAA 3CN0A 1S7UB 1TJXA 2QVMA 5C0GB 1OVZA 2I5YL 5LCVH 4YWGL 3RY4A 3T77B 1AI1H 2HH0L 2CBMA 3QBTB 1FFNB 4JUTA 4P9MH 3DK2A 4DGWC 5I2IA 3AG2B 5CILH 2WD0A 3UBXB 5D4HA 3U9UA 1P2CB 3OBAA 1KFAH 1U8QA 4RAUB 2IANA 3QG6A 3OB0H 3BGAA 1CDIA 3IJ8A 4YHNA 3RVTD 1DZ0A 4HGKC 1WDAA 5HDQL 4LASH 1E67A 3D4YA 2XWDA 4M56A 1EUUA 4K71B 3QUYD 2C1OA 3UJJH 3WTTA 3WGVB 3OKNA 3U6RA 2BCKB 2B5IB 1GA2A 3P3RA 2ZIDA 3QB7C 3LEVL 3EJZD 3ULVE 5BRPA 2DM2A 1UM4H 1Y7VA 1ZA3A 1XF4A 4IJTA 4ZK8A 4BWWA 1CFNB 4NUGH 2PWGA 4PVBA 1G1CA 3CDZA 4I5BA 1F5WA 1GAFH 4QXUH 1MCCA 3WNLA 3VFSB 3QISA 4NENA 4E9YA 3OGCB 2WOYA 1A1NB 4YDLB 4Z7VE 3F7RA 3TLRA 1A1OA 1WBYB 1KTRL 1SHMA 2A2QT 1KY6A 2MCPH 4D8OA 3QO1B 4JY6A 1YJDH 3BPCA 3ATFA 5AVTB 3DK0A 1BQHB 2DZEA 1P4IH 4MXQD 1CPUA 1NJ9B 4ZOEA 5KANI 2DWDA 3EGSB 2JTDA 2FWSA 3BWSA 1DVFA 3DGGA 5KJ4A 3FPXA 1N4XH 3KDPB 4DN3H 3MFFA 5KVGH 4QHUB 4M7KH 3WFCL 1QSED 1TR7A 3BFQG 4AWJC 3QR2A 3N85L 4GEJA 3BZFA 5JIMA 4M02A 3FH7A 4FNTA 1NPNA 1GJUA 4MJIA 2F5AH 2J88H 2KYIA 3MRHB 3U0WL 3E1F1 2AV1A 5DJ8A 5I8KL 1QR1A 5TTRA 2N59A 1AGFB 3LKNB 1IKNA 4IIQA 2LLNA 3WENA 1EHAA 2EIMB 3IETA 4HS3A 4PRNA 3JYCA 4PS7A 5EOQL 2K9FB 2VDOH 3UABA 4K9EH 3UTQA 5FYJH 1TOXA 5HJDA 1DQIA 3F12B 3ZQXA 1KXVA 4UDUB 4ODXB 4ZUTB 1J88A 4Y19D 3ME0A 4FAAB 4QHMB 3FZUC 3F04A 4PGZA 3CLEL 3HPLA 5FGBA 1V8HA 1RZ8A 2EIDA 1YDPB 2VXQH 5HHMD 2Q10A 1LEKB 4X4ME 3LHAA 2X3CA 3L3KB 1E40A 3QJHA 3HA0A 1OGTB 1WFMA 3II1A 1KIPB 1DFBH 1EAOA 2EDRA 3MBXL 5AWNL 3WTYA 2EACA 3QUXB 1YYLL 5J11C 5D7LD 3C09B 5GZNA 3K8LA 3UO8B 2BS71 4H40A 1U4FA 3COOA 2XG4A 4JANA 3LH2L 2V5RA 3C8DA 1NCAH 4DO4A 1N64L 3DURA 4ISVB 1DO6A 1AR1B 2W65A 4F7EA 3A6CL 1JZ5A 1SXNA 4ODBD 1VDGA 2APVA 2LAAA 5C0GA 1ORQB 3Q2VA 1E9PB 3BI9X 3PYCA 1FFNA 1TJGH 2N7AA 2WNXA 3FTVA 3JTSA 4FFVC 4WJKB 1IT9H 3VXRD 1R3HA 3ZVVA 3CSTA 4AXWB 1LGVA 2HRPH 2AJVL 3SY0A 1T03L 2CHZA 1KV7A 3PIQB 3Q6FB 2WNGA 3IGAB 1YEDB 2AVGA 2YD8A 1OAJA 4ONFL 3GSNB 5EWIH 4BZ1L 1U36A 1QNZL 4NNYB 1XL4A 2X4QA 3HHRB 1I1YB 3TN0C 5CLYA 2NNAA 3FB8A 4PRPD 1I53A 1ZLUK 3M88A 1ZANH 3UROR 1JMXA 3SOBH 5FB8A 4NNPH 1EVUA 1ZGLM 3HFML 2FLBT 1P7QB 5JZ7C 2AJUH 3VDBA 1RAMA 1TQSA 3SDAD 5JIDA 2FO1A 4ORGB 4BFGA 1N7ML 1IGYB 4Z0BH 2N1TE 4JFHD 4I88A 1WFJA 3E0GA 1BZOA 3CDYA 1T0OA 4U3SA 1KWKA 1DL7L 5AW8B 2WTPA 5HVHB 2YGOA 5HHQA 2QTVA 3DX6B 3QW9A 1A1NA 5JO5A 3WL9A 3ZTCC 1JNNH 3LRLA 2EE0A 4FKHA 1FSKC 1HHGA 3HUJB 5DK2A 2NSMA 5T8IA 1KLUA 3NSXA 4MVBD 4H20L 4H25B 3KVQA 1CL7L 3VYNA 1H5BC 2AJXL 4LPUA 3QNXA 4WGKA 4YE4H 4NRXB 3SN6N 2YXMA 3C12A 1CFQA 1TZHB 3A0OA 1NGZA 4G1MA 3BZEA 1BREA 2X70B 3BSGA 3RA7L 3CZEA 4TV3A 3HRZC 1O6TA 5D8JH 3QHZH 2OMBA 4M7JH 3RYMA 3V0AC 2DI9A 4E41B 2OS7A 1G0DA 5F6HJ 3GBMH 5LG1A 4KPHH 3QDJB 4LARL 2ZOTA 4UBDD 3O6KL 4PG9B 4NQUA 3TO4B 4WIQA 3EJYD 1TNMA 1ES0B 4Y4FC 5K1JA 4PQXA 1NIDA 3FUEA 1SFDA 2WLNA 5EZLB 1Z6JT 3PGFH 1H3TA 3LS4L 1MFAH 1LO5A 4CW1A 4W4OA 3IGLA 1D5MB 4TNGA 2CUAA 1I31A 3HBQA 5DUBB 3DO4A 3L7EA 4NNXA 5GS1C 4XNQA 1SOSA 2C9XA 4FTVB 4XVJH 4Y16A 1BFVL 5IMMB 3DOSA 2C1PA 2BSTB 3HZVB 1Z5LA 3MJ6A 1D5IL 4MCMA 3VE0B 5LXVA 1EFQA 2DMBA 4V1DE 4TF4A 4Y2NA 4HQQL 4LESA 3MGOB 3TBSB 4C57C 1NFKA 3JT2A 1OWRM 3CFEA 4OGQC 2R2HB 3HNVL 2IDCA 2XNAA 5INCA 1U8JA 1DHKA 3AWGA 4IBSA 2VDRH 4XN5A 5A2FA 4RQQB 2E7MA 4PJ7E 4EVNB 5J57B 2WV3A 1CQYA 2OSYA 1MVUB 2ZNWA 3VRLE 5K5YA 2OXGB 4OAWB 3X1BA 4ZSOB 2NY1C 4AV0A 3TCXA 2ORBL 3OR6A 2WSPA 3DI2B 3UTTA 4KJYB 5IBUG 2E6JA 5C0JA 5C8JB 3QWNA 1PW3A 2XVGA 2CH8A 2DQIL 3R19A 1T0NA 1F3DJ 5JPMB 4NQVA 2BNQA 4KQ3L 2IIJA 3BGMB 4WEBH 2QKIC 1KB3A 1I7RA 3N44F 1D7BA 2YIHA 3V6OC 3QFDA 2EYSB 1OAXH 2YD1A 3QQ4A 3ML8A 1GJWA 4NZFA 1RCYA 5C0EA 4WTZA 4QRUA 1QBAA 4RGOL 2EINB 4DZ8A 5L9DH 1EJFA 1KCUH 3QZNA 3GT6A 4XZUA 1AXSA 4ZNCD 5IJDC 1CDGA 2M2DA 3LN4A 4PBXA 5ECJE 1H3WM 5JORA 5DD1L 3CFBB 5MEOA 2A6JA 4P57A 3ETTA 5SX5K 4BA8A 2NSXA 1CU4L 1IGJB 4HMCA 3GLZA 4K07A 4UQ9A 1A21A 3OC8A 4AK1A 4JDVB 1AQDB 4GQZA 4QOKB 4R8WH 4YHPA 1XF2B 2LGNA 2HKAA 2EDYA 1E28B 3RDTD 3RWCA 2DWYA 1RIHL 1M42A 4DP6X 3I85A 4LK4A 4NQXA 5BQDA 4ZZKA 2LVCA 4XMKL 4G8EA 3TA3D 4HEME 4BFRA 2J3SA 3P9LA 5FYKE 4JRWA 5DLLA 2YPVL 1MWAB 4A39A 4LLYA 3ZT7A 2IGTA 4CL7A 2C3GA 3H56A 2AJSL 4WRLA 4Z3FA 3W3BA 2XQBH 3ZHDA 4OCMC 4DOHE 1TT6A 3IDMA 3O8XC 2OULB 3I9AA 1YMMD 3IMVA 4L0PB 3CVHH 1ZCRA 1JRHI 2CBOA 5LQBL 3GM0A 1JV2B 1MI5A 3NIDE 4IK6A 1QHPA 4OM0L 4JO3L 1L9PA 4XVTL 1G1YA 1CD1B 2PR4L 2B08A 1UC6A 2ZG3A 2VUKA 2ZAGA 1ICTA 2BCMA 5I5RA 1MPAL 2GT9A 2BS8A 1A6VH 4NKOB 5CIPH 1N8ZA 1PJ9A 4N86A 2KMWA 5JHDE 5F1IB 5F7NC 5DUBA 2OJEB 1RURH 4Z1PA 5JXED 1O75A 5B39A 5MENA 1OLLA 4TNWK 4GT7A 2C9QA 4D0DB 2X4RB 1FH5H 2ARJQ 2FBRA 2VKXA 5CP7A 5C71A 4U0RB 3BRGC 1GC1H 2WKLA 1CFVH 2GC7C 3ECBA 3L1OL 3K0WA 3LPOA 2KL6A 3UP1A 3FRUA 3ZKXC 3WJJC 4KY1H 5KSVA 2YLKA 1QLEH 2BNRA 2X53A 3FMGL 3Q5TA 3W81A 1KCBA 2VN6A 4K3JH 2FQDA 2P7TB 4G6KL 5LAXB 1S5IL 4JGUA 3HE6C 2XPYA 1FHNA 1QNIA 1V3LA 4UYPA 4S1DC 4X7FC 1U3HD 4JG1H 4WW2C 2AI0L 1N70A 2P49B 4YFLI 5T1KD 2YAOA 2ZXGA 2IH3B 3WMQA 3K6SA 3S36L 4PSPA 1CFTB 1T1WA 4K3EH 3U30B 2AC0A 1TPXB 2WQAA 5CFAA 1MN4A 4LDOB 1SQ2N 1NH6A 4AYBA 5AW7B 3B4NA 1SMOA 1PF3A 1C1EL 1NCTA 4DTGL 4HCFA 3B2MA 3Q9PA 3MLSL 5KOVC 3GXUB 4MLIA 4NPYA 4UDTA 1YQVL 1PEZA 2X28A 1OQOA 1G9EA 2ZKHL 5LCVA 2RTTA 5DWPA 2I27N 4QWWC 1D5BA 4W6YB 1P7HL 3W0WD 3WKML 2EYSA 5E95B 4XO3A 5IVXE 2Q8AL 4KQ4L 2AQTA 3T2LA 2A99A 3BUQA 4R2GD 1JBJA 5EBWA 2ALWA 5HY9B 1WAAA 4RFEA 4FQJL 3V7MA 3L7FB 5FHAL 1AGCB 2H5UA 4LBEA 1CDYA 1PAZA 3OVUB 3BRFA 3W39B 2LTQB 1JD7A 4Y1AE 3D0VB 5D96B 2A73A 4MD5A 1MW1A 3S34H 3M7FB 2OMXA 4JZJC 4PJ5D 2I69A 4JFDE 3X1EA 3OPZH 3HCVA 4OJEH 4WWNA 4AJWA 1ASQA 3PGCA 4HLZH 1OPOA 3BP6A 3HAEB 4PJXE 5FFGA 1DLFL 3EUUA 4HJJH 3G5ZA 5CS7A 3HG3A 4WTZG 5DZAA 3VB9A 3V4VH 4OLUH 2MOVA 3E6FB 4J3OH 1NUFA 1VA9A 3CZNA 4N0UE 3RUGF 4I1PA 3PWPB 4X4KA 1MELA 2R1XA 2HLAB 5D1ZB 5T3ZL 1RXLA 1XCXA 1J9CT 2E56A 2GVYA 4O58H 1M7DA 4UILL 4U1LA 3KBFA 3QIWD 4WI6A 5I1IH 3QI9D 1V3MA 4G5ZH 2YA2A 3VWKA 2RQEA 3GD1C 3GSOA 2JKLA 4YR6B 1CLZH 3GF8A 4LSVH 1AIFA 2VXTH 4N90D 3KBHE 3FSZA 4G7SB 2ARJA 3QUXC 3QFJA 4MB4A 5ABDE 2PPEA 4YK4B 4TVPL 4RLDA 3T4AB 1JNJA 1FG2A 4DZBB 4S11A 3TIDA 4NM4H 3CIAA 4HKBB 1MCSA 4NKIL 4WO0A 3V5HB 2BVPA 1QTSA 2R1YA 3QUGA 3QQ9C 2EDMA 5JDSB 2WB7A 4U6XB 3L48A 1JPTH 3IPFA 4CJ1A 1N10A 3D18B 1PL3A 1TMCB 4J6IA 5BQ7B 2ITFA 3VSUA 3UDWC 1IFRA 5KANG 5C07A 4I2XB 5ICXA 3EHBB 1ZIAA 1A4KA 1OTTD 3ULAB 3I75B 2OZ4H 1SN5A 3IU3B 4PM1A 3P4NB 1KPRA 5E03A 1JMZA 3U1SH 5HYJA 1FA4A 4EIGB 3BEWB 4NSKB 2A9NH 2VSDA 3VXME 3ARDC 4GJTB 1BPLB 3CN2A 4TNEA 4M6ML 5IKCB 4P23B 2AQSA 3MV9E 1IQWH 3L3IB 2VXQA 4M6OH 4PLNC 5AB2A 4BZYA 4KNQA 4X6CE 2WTRA 1TLKA 1GCYA 5LDUA 5I1HH 2CCLA 4FERA 4FQIH 4UQBA 4RCAA 4XPFL 3EBAA 5E5UB 3P4OA 2C7FA 4XH2A 3GMOB 1E8XA 3VVVA 1FBIH 1KXQE 1AD0A 4X5QA 2VC2H 4N87A 1OM9A 4FQPA 1KTLB 1SMDA 5FA4B 5FW8A 3ZE0E 1IL1B 5HGBB 1TEYA 5C0FB 1T6WA 2DKUA 1Q9OB 2N4IA 1RH8A 3MLRH 1IC1A 1G1OA 3GI8L 3QYMA 3GB7A 4UM9B 1YPZB 1KGCD 3MBEA 1RVFL 2NR6D 3VM5A 3MCKA 4XX1E 3T3PE 5EA0L 2EE9A 1KPVB 1GCFA 2VXVL 3U2SA 2MCMA 1GW0A 5DTFA 1NMBL 4Y4KA 5ETUA 1VSCA 4HUUB 3ENEA 1CE6B 2NQ3A 4ESKA 1WISA 4M1DL 3W39A 3X14A 3IJEB 4LL9A 1NGXA 1JZJA 3RVVC 1I9RH 1A1MA 2CBQA 1OK0A 4JPVL 1N6UA 1MOEA 3AS2A 4IS6A 1NANH 4QF1A 4D9QD 3HZMA 3IBOA 4G42B 5HI5C 3M7OA 1SXAA 3MI6A 3VI3E 4OZ4A 4LVOB 4AEHH 3RKDD 1XO8A 3MACL 3MRLA 3CBKB 2NLJB 2ERJB 4HPYH 3PGDB 2RJMA 3ULSB 3UMTA 1V54B 4MJ6A 3MREB 5IQNA 1KCRH 2B20A 4ZAKA 3NJMA 1WIOA 1DO5A 1ZHKA 1G1KA 2ZJSH 4ZPTA 3IF1B 3RTQC 4HGWB 2IMMA 3GLAA 2J8HA 1DUZB 2Z0UA 1YEWA 3VW3L 1E4KA 1WD8A 2NCEA 5I8EB 1MAKA 1M7UA 2JJWA 3AAZB 4HUMB 2BSED 3FTXA 4P48A 2NT1A 1ZPLA 3O45A 4GBXB 4HF5L 4MMYB 5AW2B 3RU8L 1EAJA 2WOBA 2JMRA 3CJJA 3D30A 3KGSA 1S78C 4PPTA 1E9OA 2EP6A 4KK9C 3T4YA 3T4AA 5AAPA 4JR9L 4Q6KA 4DVRH 5TF1L 1A4AA 4DW2H 3L4WA 1BQ5A 2AEQH 2VIRA 3OR7A 4JDTH 2XBZA 1J0JA 5E08L 5TGBA 4RMBA 1TJIH 3CU7A 3VG9B 1RU9H 3Q05A 2X4SA 3VGAB 1BBJA 2AK4D 3QEHB 2J1KA 1KTDA 3ZIYA 3RJDA 5IHUH 4XZ4A 4LHUA 4UQIM 4GG6A 3KM1A 3I6LD 5B38A 4N0YH 3DHUA 3DYOA 2F7PA 2BHFA 4APQB 1L5GA 5CF3A 3WFHB 3CCHA 3R06A 1J9RA 2UZIH 3P11H 1U8IA 1CICD 3NQKA 2WXFA 1JSYA 3E6HB 3QORD 5E7BA 4TQIA 1RK7A 2HH0H 2VE6B 5H37H 2VWEE 1U3ZA 4AMKH 4P8QA 4LCYA 4MA1C 4L8CB 1V27A 1XGYL 2XY2A 1PFOA 3DBSA 1AIZA 3IAQA 2NXYC 3AWFA 4S10A 3WEBA 3LS5L 3P77A 4FZ8L 4Y2LA 4YHLL 2DY2A 2JKWA 4P46B 4QO1A 1CI3M 3BDBA 5HDQH 4HG4K 1O7DC 3BZ5A 4F33A 5HYQB 1NFDF 4XVUC 2E6QA 3LEYL 3AFLA 3KPRB 5D7IF 4ES8A 1FNSH 4HZAA 4WUKH 3MV7D 2YWZA 5ID0B 1R3JA 1K8DB 3WIHH 2IBGA 4DKAA 4QIRA 4PYGA 1YPZA 5F1KC 1NGPL 5CZXC 2QPEB 1YEHL 2Y5EA 1E3ZA 1ZS8B 2WYTA 2HB0A 3JWNC 2ZXQA 1ZT7A 1X6NA 5T1LB 2BXZA 4QRPA 2AABL 3C2SA 3LD8C 3WFBL 2EUXA 4YDJA 5EU7E 5FS5A 3AABA 1S9YB 3UZQA 2OL3H 2N1KA 4NP4L 1J05A 4J4PC 5F7LB 3CXHJ 4ODHL 2WYIA 4H0IA 4L5FL 4EQ3A 5IMOB 2FJGB 1FFPA 1A2YB 1EBAA 1T6BX 4Q9RL 2AXFA 3AXLA 4X8JB 5IP4A 5H94B 3BVWA 1OP3K 1VADB 3AM8C 2B7DT 2WBJA 1IM9A 3WFCH 1G87A 5D2LB 3N85H 4OFDA 4OW6A 3V4VB 2GTWA 4OCRH 4IKIA 2Z31B 1Z9MA 4Z77B 2HFEB 4K94H 5A16A 3U0WH 1AQMA 3RZCD 3S5LB 2H3NA 4ZO7A 4FFWD 1CWVA 3VUAA 1AS6A 1B3JA 3ZE2F 2UWEA 3FT9A 4N2FA 5I8EA 5EOQH 3CVHA 4GINA 5J1AB 3LZRA 3N44B 3JBG7 5J6HA 5LGHH 3WLWC 5BZDB 3F7VA 1C9SA 4OZHB 1MCJA 4I0PA 3CLEH 1QR4A 4NI6A 2XI9A 3PHAA 5DJAA 3QS2A 3A4EA 1K6QL 1U8LA 3FRPB 4PLJC 3FQ4A 3EF7A 5FYKU 5I1CL 3BZ4A 5CIPA 4ZNEA 4J3UA 1FL3A 2E9JA 3SDDC 3MBXH 5AWNH 1GGBH 4ONHA 4D8PA 1CIDA 3ZK0A 3VFMA 1GYAA 1YYLH 5E1QA 3LRKA 2CO6B 5AVVB 4OI9A 3TCLA 4QPEA 3MODH 4K8RD 5IB2B 4J8RA 2Q9OA 4TRPL 4G70B 1CGTA 2R23B 1UG9A 3BWAB 1NBZB 1N64H 4BH7A 2NY7H 4IRSD 3A6CH 3ASOB 2WYHA 5F6IB 1UD4A 4XR8C 2IQ9L 1UOKA 4U1MA 4GAGH 4O4YL 4U0QB 1OHQA 3P73A 4X9GA 4ZW8A 3TV3L 3KXFD 4V11A 3DXAD 1CN4A 3HR6A 1IZKA 3NAAL 1A9BB 2NX5D 1T03H 5DJZA 4BZ1H 3GUTA 4ONFH 2EH7H 1QNZH 4H8HA 4CC4A 3GMMA 4QT5B 4LHUG 5FGSA 4JO1H 2VC2B 1SDDB 5HYQA 1RUPL 4YUEL 5HTSA 3L3DA 4J23A 4GNKB 5B38G 4LLMB 1NGQL 1AS8A 1SHXA 3MJWA 5ID0A 4UWQB 2ZOLB 4Z6AT 3B1UA 2AKRA 1BWWA 4YLBA 4WLCA 4JDEB 3HUJE 4WF7A 3MLXH 1QUPA 1UXWA 3MRFA 4OD3H 2IPUG 2HWZH 3G6DH 3ZHKA 2MSPA 3FFDB 4IBQA 2RQ8A 4F80A 2FYYB 2JCCF 1CFBA 2EDEA 2VQUA 3MBWA 4AM0B 4E9XA 1DL7H 4PJIB 2ZCHL 1P5VB 5JHMA 1X5IA 1R3LA 5AZ2H 1VCBC 3Q1SL 4BJLA 1K2DB 1AO7A 1X4YA 4JY5L 5GHWL 2WNWA 3O0RL 1OZTG 3OC5A 4KROD 5AUMA 4E41E 2HMID 3P9MB 5C92A 4IRJC 3X12A 2XWBB 3CFCL 4XVSL 3QDJE 5CGBA 4MS8D 4A68A 2LV4A 3MRBB 4P5TC 1X7SA 4R4FL 2F74A 4PEEA 2H0PA 4QAMB 3CBJB 4QGYA 5CSZB 3D2UA 1ZSHA 3EYQD 5H94A 5ADPH 1WZ1L 1ETJA 1A4JB 5E2VL 2OFQA 1BXVA 1NKGA 2HG5A 1N5AA 5LHDA 5LO7A 2CAKA 4LARH 2D2OA 3C6LB 4OF7A 1OF2A 3ZL4L 4Q97A 2EZ0D 1PLGL 4FTVE 4WSKA 4BXVA 1CDUA 2CJUL 2YPKB 3VD5A 3BN9C 1LO4L 2J4WL 3DV6A 5EDXA 4PLKC 4F7PB 4QHNA 3WDJA 1BFOB 4FQXC 4MCNA 2PYFB 3CK0L 4OV5A 3S2AA 2WXIA 4XBMA 2HTKD 4PJ9B 4GQPH 4GSUA 1RJYA 3IGUA 4CN1A 4ZRGA 2CWRA 1BFVH 1RIVL 4XWOC 3RWDB 4YSDA 3AS0A 5J1AA 4H7VA 5TE4L 3T0EC 4PJFA 2PXYB 4LNVA 1Q9LA 5T3XE 1G0XA 4P2OB 4OKDA 5DJXA 3H4FA 1EGJL 4ZSOE 1VIWA 1FP5A 3OJDA 4YXHH 2MQCA 5I9QB 1WZKA 3K4DA 3GSUB 2V33A 3BPOC 2R1WA 4Y5XC 5CJQL 2DEWX 3DJSA 4N5UA 3K5RA 4NO0D 3QUKA 3FS9A 4PRIB 2NY6D 5CU5A 4JK0D 3SDXA 2EXYC 3OQRA 1I8KB 4GKNB 3U6XS 1AGBA 3SQBB 3D39E 3IDXL 3MXVL 3S3DB 5I1DB 5IW6B 2L7EA 3PNWB 4BUGA 4Y5VC 1OTSD 1MLCB 4P4KB 1MIML 4O2FB 4WWPA 2IAND 2DQIH 4Q58C 3NRFA 4MNQA 4PD4K 4D0CB 1VGKB 3FQWB 4KQ3H 1IM3A 2A74B 4ZFFA 3G7TA 4YDVA 5J6SA 1VEPA 3MOBH 3SBPA 3KPSB 2PKDA 1ZEAL 4QXVA 5I71B 2X10A 3O6LL 4UAHA 2WIIB 1L9NA 4L18A 4BWTA 5EU6A 1B4JH 2IEPA 4PTTA 4QOKE 2CLZA 2Q1EA 4M1CC 4RGOH 2NT0A 2DWXA 2WC7A 4UOW1 3HS9A 1Z9SA 2ZXDA 5F9AC 5LUMA 4U1KA 4U4BA 1IBBA 1L4IA 2CKNA 2GFBB 1H8NA 3DUUB 2EVJA 3X11A 3IMRA 3BGFB 3V6ZA 5I15L 2CUMA 5E99L 2OKMA 4F8NA 1BVKB 1CU4H 2J44A 3FO9A 4GUOA 3RWIB 1SEQL 3CHPA 2PO6D 3SO3B 4TTGA 5EIIA 3U2IA 4MNHB 5A7BA 4Z78A 4ICWA 4WJ5A 1A14H 4OGAD 1CGUA 4F91B 1EAPA 3DTXB 3HMXL 4PJIA 3FQXA 2NY4C 2W60B 4XCNA 2D7TL 4DEPB 4GW4B 3SGKC 2FZ3B 4KUCF 3PHOA 1BMWA 4GW5A 3RVXD 1DVFD 4XXDA 4UMSA 5KVGE 5E00B 3AU1B 2OL3B 3V0FA 2XN9A 1S7RA 4DGIH 5I28A 2NY3D 5F7MC 2EO1A 3V9EA 3P2BA 3UG5A 1SOQA 3I84A 3OSKA 3RAJL 1L7TL 3QA3A 2X2HA 4R4NC 3CHQA 4OBRA 5E8NB 3VXQB 1I1CA 3BFOA 5PAZA 2FECL 1A4JA 3SPVA 4HIXH 1DSFH 4G72B 4JO3H 4UUJB 4XVTH 5I5IA 5FIEA 1TQBC 1P4BL 2PR4H 3WS6A 5DD6B 2IBZX 4FEMA 2YC1B 1MPAH 1CYGA 3EBHA 1E2VA 1R46A 2ZWZA 1RY7B 4L1LA 5E5MB 5DZVA 4HUVB 3KPQB 4CILA 2QMKA 1Q0XL 2H32B 2OW7A 2X42A 3IM1A 3PHSA 2MWCA 5HVWA 4FOMA 2IPTL 4AGMA 3WTUA 1V7ML 5DD5L 4I77H 2V3DA 4QTHA 5JHLL 4NN5C 1AP2B 4TSBL 3ZMNA 4NWTH 3GJFA 1KLFA 5FOBA 5IF0A 1PSKH 3FTGB 3L1OH 2ZYHA 5HHVH 3WY4A 5EBGA 3FUNA 3HC0A 1XQ4A 5J13B 2EDKA 4H0GA 2AZUA 1K9TA 4MWFB 2EDFA 3EYOA 3D9AL 3RE0A 1D6EB 1XGQB 2R2BB 3FCSB 4LCWB 5K39B 5KSAD 3TNMB 1ZK5A 3MTXA 4G6KH 4MB1A 5F8QC 2FB4L 5ACZB 2IAMC 2NZIA 1PYWB 4EI0A 3LNHA 4HETA 3WNOA 5GZOD 2AW2A 4KHXH 4M62L 1AXIB 2MOQA 4LBAA 1KCVL 1OD7A 3G5WA 3K6DA 4XN4A 3UBXI 5BUGA 4MS6A 5EB9A 5KYUA 3TGXA 4PUBH 3EG9A 4BQ6A 5JQ6H 3E9TA 3KEHA 3KGUA 4BK5A 2VN7A 3US0A 4PJGF 1BVLB 3T1WA 5IW6A 1TF4A 3QIUB 4CUCA 1XB3A 2NTFB 3MLZH 3MUY1 4ZUSB 4BFEA 3L5WA 1YQVH 3ZL2A 2XTJC 3VXSB 1R33A 4JVUA 4D0CA 3VFVB 4EQ2A 5KYNA 2XG5A 4JFPA 5H37A 3MRPB 1A7NL 1IE4A 1RZIB 5HHOB 4HUWA 5F0PB 3WKMH 3NJKA 1G7MB 3V7AG 4CVUA 4Z5RB 1RV6X 1AQKL 2P48B 4X6BB 1B0GB 3BH8B 4KQ4H 1YO4A 5C9JB 2E9GA 2VLKA 3S3BB 5BZWA 2O5ZL 3PWNA 3DHJA 1AMYA 5FHAH 4MLSA 2L8AA 5BS0A 4JPKL 2C3WA 1WHOA 2YHGA 4GSDH 3WE6B 1GL4B 4HJSA 3IN2A 3IKCA 1QKZL 3BVTA 5BCAA 5KN5A 1OAUL 1ED3A 5DYOB 5BPPA 2AXWA 1P1VA 1BV8A 1FPTL 1MREL 4PHXA 4ANXA 1IFHL 2F53B 3WHE0 3PWPE 2R15A 2TSAA 1U8OA 1IC5H 1QD0A 1MJJB 5EBMA 5BMFL 4HKZA 1GOGA 3D50A 2I9LA 3RWHB 3TN0A 3V4LA 1TETL 4GW4A 3UG3A 1QLFB 4JFZL 3SCMD 2ICEB 3VACA 2YAMA 2VZ3A 3OX8B 3IDYB 1FDLH 4TQHA 1B4LA 4L29A 4C56B 2N0KA 2UUDH 3ZZLA 1BQKA 5E6ID 5T3ZH 2WXLA 1KJMB 4XXWC 4UILH 2XFXB 1MFBH 4XN7A 1TVHA 3FT2B 3FONA 1IAKA 3C08H 4OGYL 3S35X 5AVQB 1WUNT 1V5JA 2EKSA 3VXQA 1PTZA 1DVYA 2X6CA 1VPOL 4MA7H 1OOWA 3MRCB 1FZOA 2R56L 4MHHI 4Q7DA 4OTXH 1HHHB 3SKNB 1ASPA 2UV3A 5I6XC 3RVTC 1H5BA 1U91B 1ND0A 3PABB 1DCLA 4BELD 1BJ1H 4Y16D 2PMZA 4I2XE 2PYEB 4E0RA 5IW3A 3MNZB 1VERA 3RRQA 3SYPA 1C7TA 4L4TA 4NKIH 4W81A 1ZJBA 3HRZA 1NFDB 4RRPM 3H2PA 4OUUB 2DYRB 3A22A 2D03H 4GFXA 4NT6B 5T1JA 4MXWH 1YHPA 5D7IB 1KPUA 4R7NB 4IEFA 1L0YA 4WU7B 4Z7AA 1BA9A 2CDGB 2D3LA 5D2NC 1T0PB 5IT2L 4P2RA 4HCGA 1YECL 4A7VA 1IC4L 3C60C 5IBLD 3F3HA 4Y4FA 2BVQB 2F9BT 4YLQT 1FHGA 1BEYL 5K93A 3GINA 1HSBB 2QQNH 3CVIL 4PS8A 4XOAA 4NO2A 3OAYH 4L37B 3GIVA 3FCSA 4ERSH 1WYJA 4PRHA 2UZPA 4KKBD 4M6MH 1DVXA 3ARBB 4ONOA 3HC4H 3P40A 2A6IB 2V5YA 4NQEA 4OZIA 3QJVB 1GTNA 1FNLA 2A4ZA 5GS1A 1HXMB 1LNUB 3O2VH 5GGVH 4X9IA 5B22A 2W9DL 1UGNA 1MCEA 2WQWA 4P5KB 5CGYC 4ECNA 2DTSA 3X2QB 1J8HA 2EIBA 2QPUA 2Q7NA 1LK3L 2MMXA 5FF6A 2IBBA 1EFXB 4BFNA 3BP4A 4XAKE 3KG5A 4XP9L 2YOAA 1NGWA 3D0LB 1UT9A 4TNWF 4HJEA 5K1VA 4EDWL 2CGRL 5EBLA 4ZTOL 2NTFA 4H2CA 4UTBH 4ZUSA 3T3MF 1F8TL 3D3VA 5J1TC 4HJ0C 4FA6A 2C9UA 1UJTA 1SUJA 1UQSA 2V9RA 3ZKND 2VDKL 2BMKB 3GI8H 2CLRA 5GS2H 3UTPE 3V6FA 3DBXB 4PW9A 3ZSSA 5CEXA 1CTNA 5EU5B 1XTMA 5EA0H 2VXVH 2YBRB 4NOFA 1TUPA 3F6JA 5DRZB 1N8OE 2I9TA 5HGHB 1KXTA 3LPGA 5B3SB 5FYLD 4BZ1A 1HYRC 4HFWB 2X12A 1R5WB 3HZYA 3ZE2B 2QLYA 2JKIS 2KERA 1O6SA 2QKIA 3ZDYF 3LV3B 4R97C 1A7OH 2ZAIA 3KR3L 3V6OA 4KGJA 4I1NB 5AW9B 3H53A 3PWUA 2OR9L 1K85A 1UT2A 3G5VB 5H37G 3JWNH 1N6QL 4KITB 4WFGE 4M8QB 2BZCA 1A6PA 1QWUA 1R3KA 1JGEA 3CMGA 3P30L 4XPGH 2HFTA 2V2XB 4I4WB 3VQ2C 3MACH 1MCFA 5CR8A 3DIVA 2A1WH 2ENYA 2FCBA 1H6EA 3BQUC 1MI5D 1U42A 5HGAB 5T5NG 4HAGA 3FJTA 3MNWB 2WWMC 3FB6A 2FNWA 4Y2DB 1PU0A 2ZP8A 4OCSL 3N6YA 1JZ7A 3RGVB 1ZV9A 5EO1B 1UOLA 4NQCB 3ILQD 4AK2A 3OKEB 3VCLB 3OJVC 4RMQA 1OV8A 2VXSL 3PL6B 3FXIC 4N2EA 4P5MB 3T0XA 5F96L 1WVZA 3Q8FA 3CDFA 4HF5H 5MEND 1UH4A 1WTLA 3UPAA 2ZSWA 4RAHA 4RGNB 4ZPVB 5AZUA 3S37X 3ECVA 3TEUA 4P2QA 3MNZA 4PWFA 2V2WA 4YGAB 1UURA 3NFPA 5C2BL 2BNRD 2R0WL 4F5CA 5E08H 5ICUA 3HVDA 3L5XL 1AKPA 3UL4A 3RPIB 3GMQA 1G7PA 2A77H 3VDCA 3VSTA 4M3HA 4U7KA 3RPBA 2B3IA 4L9DA 3O3BB 3CC5A 5DMGC 3X3FL 1FYTD 3M45A 4Z7UA 3LIZL 4EUPA 1HSBA 3BAXA 5KYWB 2OMNA 4QRSB 1PDKA 2R4SL 2AQQA 4CNIB 2BY3A 2PN5A 4MCZB 4G71B 2JCCB 3ZDZF 4WWKC 1J0ZA 5CCJA 5E1GA 5IB5A 2EEBA 4JM4L 4HLJA 1UZ6F 5G4NA 2Z9TA 4MVBC 5CEZD 4LLUB 4L8BB 3EYSH 3OKDA 5HHNB 2VMFA 4FYSA 5DWUL 4DVBA 1GS6X 5K9KA 3KPRE 5F6HI 1XGYH 2ITDB 4X5RA 3LZFL 5G55A 4ABUA 2CLVB 5A6MA 3LKOA 2CKBL 3WJJA 1VRSA 2XWXA 5DMIH 4HZLA 3H6JA 3KL0A 4FZ8H 3SO3C 3DX4A 4KMQA 4YHLH 2MFNA 3BDYH 3RVUC 3LPPA 3GKWL 4I3RL 3D0LA 5C6WH 1MFEH 3QPXH 1HIML 2J6EL 3HE6A 3PV7A 3FU7A 3C6SB 4H8WL 2YKKA 4I9XA 3NSCA 1A6AB 2WJ7A 1MDTA 4GMTL 4WW2A 1O7SA 4P59L 5F7EL 4DETA 5LN4A 3GSQA 1BJ1J 1RZQA 1NGPH 3L4XA 1PY9A 1MZZA 3I50H 1YEHH 2IXQB 3RWGB 1OP5H 1HYSD 3ATBA 3MVSA 2O5YH 1TQUA 5JPNC 3FQNB 1JGVL 4MCYA 4LMQE 1GYCA 5E94B 4B9PA 4HK0B 5CZVH 3BHBB 5ICYA 3G5XA 3OSVA 3WFBH 3RQ3A 3MUHL 1G7HB 2ZKYA 1ZTMA 4RAVA 1FUNA 1U8KA 2EDQA 2WQVA 4WV1B 4YSPA 2EUVA 4PTUB 4OCYL 2K8MA 5IV2B 2BIQA 4NP4H 5D2LE 4DP0X 4L5FH 3ZRCC 4RBPH 4S1SH 2R2EB 3TL5A 4E5XA 1QFWL 4Z9KB 2H26B 4M8QA 3WTXA 3RX9A 1LEGB 1AY1L 3B6SB 5J3HD 1HHKB 3QGVA 4WFHE 4XC1L 1R19A 2BRRL 3LB6C 5B21A 5KS9A 4NQDA 4YHZL 3FDWA 3QULA 4N20A 1O9ZA 2Q5BA 3F6IA 1SVBA 1DQJA 5I0VA 3K2UL 1J9QA 4IU2B 4ZTPL 1EHLL 2VDQB 4JZJA 3VWKD 1K5NB 2XRAH 4WK4B 2FATL 5GRUL 4A7TA 2BP3A 5J13C 4Q9QL 4F7CA 2GK0A 2IALA 4L3CA 5DT1L 1FVDA 4OZHE 5F9JB 3ATDA 3W9EA 1GZPA 1KEGH 1AFVL 1IAIL 2Z0BA 5JMRA 5FFOA 4Q0XL 1PFCA 2CNZA 4XCCH 3B5TA 5GPRA 1MRDL 4Y1TA 4YQXL 3P1VA 5L8KB 3G6AA 4AIXA 4HSQA 2XPZA 4HIEB 3F7KA 5ANMB 1A6TA 1DDHA 4NZTL 5I15H 3MJ8A 4K5OA 2KPNA 2ZWLT 2CK0H 2NY0D 3CUPA 5DC0A 2DQUL 5EEXA 5I18H 3F84A 1JZFA 2GIYA 5JW3L 3MTRA 1WWBX 4LKXA 1NPJA 4AGPA 4FG6C 1GS8A 2EDHA 2VZOA 4XN2A 4NC1C 2FSEA 2H0EA 4FLQA 1A8JH 3DWTA 3WD5L 5D5MA 4GLRH 1HCVA 4GQ9H 3NABL 3DRQB 3L3GB 4JM0A 3PJSA 1KENL 4QHKJ 4TRPH 2FD6H 3VH8G 3QR1A 3L3JB 1EJOH 3O3EB 2ZXWB 1VFAA 1XGZA 1BZ8A 5G5DA 2QSQA 4BCYA 5JW4R 4L1TA 2VDPB 4F2EA 2IQ9H 4ZXBD 3QDGA 3BVUA 3MROB 1X5GA 4O4YH 2A9AA 3TV3H 3VGEA 5FYJU 4H8WC 1PNDA 1NINA 3DSNB 4YVNA 1AGEA 3GBNL 3UDWA 2V5MA 4WHCA 4X99B 1I85A 3TOPA 4GSQA 3U0PA 4AEFA 1U93B 5F9DC 2D4DA 1W91A 5HD8D 3MBED 1GZHC 1UATA 3MYZA 4G2AA 3SOTA 3EBGA 4IGBD 1OP4A 3TVMA 3WIAA 4EUPG 4L1SA 3HS0B 1LE5B 3VD2A 2FR4B 4L0YA 3CQFA 4URTB 1NDMA 2YD7A 4Y4KD 4LF3A 3VG0L 5E8EA 1GGTA 4ZMLA 4QRRB 3FTZA 3SQRA 4L2YA 5IK3A 2FJFB 1QMUA 1ZD6A 4LLVA 3CFJA 1YUKB 4XNZB 3MUGB 2R69L 3QVAA 1OK8A 2IH9A 3I2CH 4JFSA 5D9SB 1S7QA 3PRZA 5J7CC 3EOBB 4A7GF 1GXEA 5E94A 1W0VB 4JY5H 3HG1A 4Q9BA 2IFFH 3ULUF 5J5EA 4DP5X 4I3GA 4NUMA 4XVSH 3CFCH 4PTUA 2WPGA 3CFUA 3GYRA 5D1ZI 4PJBF 1J8RA 4R4FH 1SJHA 3GXDA 3TP4A 2WMPA 4U4IA 3UIYA 1J0YA 2Q20A 2YLHA 1XB8A 1JZEA 1FVCB 2KLRA 1AZCA 4ZAKD 1WZ1H 1Q1JH 2R4RL 3ZXAC 5E2VH 2VW6A 5D7KD 1V3KA 1BFTA 1RJZB 4EOWH 3Q6GL 4J3SA 3FN9A 3PREA 2UY7B 1LO4H 1MIEH 1RI8A 1X5LA 1G7QA 3OXSB 3QEQB 5MI0B 6TAAA 1RZKH 2KLSA 2BDNL 1QFUL 3DVNB 5F0JB 3UX9B 5DEZA 1NC2B 2L3BA 3JVGC 1O6VA 5JOFA 1BQHG 2GSGA 2MNUA 4F2MB 2VDMH 1UOVA 1RZ7L 3CFKA 2P43B 2EDWA 1BF2A 5BV7L 2BM3A 2H1LM 1AHKA 4HIEA 3ATAA 3FSWA 4HXAL 2J71A 4NKDB 4PRIE 4Y1SA 5DQ9A 2J6WA 4YSCA 1K5WA 2VR9A 1JD9A 3GSRA 1EGJH 3HN5A 2Q2LA 1OW0C 2Z64C 1QOKA 5IR1B 3N41B 3ARFB 2AERT 1MH5B 1P7KA 2JXMB 4FS0A 1SF5A 4I18B 4JM2D 4LHUD 4GRWH 4J3TA 5DHMC 5J6GA 1ODAA 1M53A 5CNHA 3ZTEA 1E4WH 3HE7C 4YSQA 2DQHL 5I8OL 5CJQH 1R5IB 1F3JA 1YNKH 2JKTM 1M57B 1UD6A 4Y4HC 3KPSE 2HLFD 4LVNB 3HS8A 3MXVH 5ESVB 3ZTDC 1T7VA 1CD8A 3IJYA 4JLRB 4MA3B 4FKKA 3CPUA 4UYQA 1MIMH 2BFVL 4HH9B 4PJHA 2YJLA 4J28A 1BVNP 2BSCA 1TZIA 2OTUB 4H5SA 4WI4A 2ZUQC 3CBRA 3EADA 4C59B 1JVOA 4AMWA 1QUNA 2WXQA 1HI6A 1JNHB 1CXLA 1R24A 3O6LH 3TZVA 4WO4B 2YAHA 4MD4B 3SGEH 4G7YL 2ICWJ 4HUKB 4Z7WA 3QI9C 3WFDL 4BH8A 1MCLA 3MR9B 1XMWA 1DEEB 4EIUA 3FQUB 4LCIL 4KDWA 5C09B 1AHMA 4GMSH 3P02A 4ES9A 1N0XL 1XF5A 4OFQA 3N42F 1QRNB 2WCGA 2NZ9D 1I1AD 2ZE0A 5E99H 1PLAA 4HHWA 4QRPD 3QNZB 1DQML 4XMLL 3QYCA 1SEQH 2EYRB 2FJFA 4CVZA 4AKPA 1OSZB 4XWGL 2OW6A 1W15A 2GQHA 1AE6L 3V0EA 2AV7B 7FABL 3WN5B 4MSWB 3IS0X 3H9SB 3L1GA 5CBEA 2D7TH 2WLIA 3BEVA 3I6SA 3PXLA 5D9SA 3TWCL 3S88H 3K2IA 2M8XA 1YEKL 1ZLWK 1GIGH 1ID2A 3L3OC 4UINH 4HIIA 5BJTB 3ZGHA 4BSWB 1P1ZA 1CG9B 5C08B 1IM9D 1LQBC 1ZA6A 1UXSB 1KTCA 2VLJA 4M93C 4NX0A 3EGXA 5F0LB 4UTAH 1W6WA 2W80C 1IJNA 2IPKB 3OMIB 3RAJH 3WIIH 5IJVB 3EYVA 2RALA 3ELQA 3H9ZA 4L4JA 1U2HA 1FVCA 5AG9A 2A83A 1HESA 1PQZB 3GSWA 3L4ZA 1DQQA 3CVBA 1J1PH 3GMRB 1JYXA 3HHSB 5T33L 2L7QA 1OARH 5HGDB 3MV8B 4XP6H 1P4BH 4A2FA 1P9MC 4EXPX 4WUUA 2ICES 3QQDA 4J4PA 3CGTA 5BV7C 4MBOA 4G8IB 5E6RB 1X7QB 1CTOA 3AREA 3BP7B 4R4BA 1L9SA 1Q0XH 3V5DA 2Y5TB 2FQGA 4LCWE 4I89A 2IPTH 3UTZA 3T3MB 1EEYB 4OLXL 5DD5H 3AM8A 4MJ4A 5JHLH 1Y18B 3W5NA 4G1EA 4TSBH 1PX3A 1VZHA 3SB3A 4L3EB 1TJHL 2DWEA 3HNTL 3NA9L 3U6XA 4OI8A 5IFJA 1UZGA 3KLSA 3LNIA 1MJUH 4YIQB 3QRFM 2NY2D 3L9RB 3U46B 3D9AH 1INDL 2R0LL 3I02B 4LGPB 1W0WA 2P80D 4N8CL 3D85D 4P4RA 4AKQA 2H0JA 5D1XC 3WEXB 1FAIL 5JLZB 4ZUWA 3R7RA 2W07B 4AH2B 1P6AB 3AG1B 4P04A 5F7AA 4AIEA 1F11B 5E8OB 1R5VA 1N18A 1YSOA 3TYGL 3ZDYB 5CXPA 5IG7B 1JFQL 3VXSE 4NC1E 3PG2A 3TF4A 2E7CA 5HVGB 3VXUB 2ZX7A 3ISWA 5EV7A 1LK2A 4ANWA 1XV8A 5DR5H 2DLHA 4D2NA 1ZTXH 2W1NA 1AVAA 4QRAA 1VKXB 2ZNXA 2DQDH 32C2B 5HHOE 4ODSL 3B2UD 2JH2A 3GK8L 1HSAB 3B9VA 3O2WH 3TBWA 3MRIB 4B27A 3ALPA 5SWQB 4EN3B 2UVFA 1WP6A 2VGLM 4Q6IC 4LLQA 2AITA 1MY5A 1INQA 3LN5B 4LGRB 4M61B 3SDDA 4QUOA 1A7NH 4YDZA 2YSSA 3BH9A 3LQZA 2JSFA 1A7PH 4MNGB 2NTSP 43CAB 1VFUA 1HXYB 4LCUB 5CWSB 4H13C 5FWRA 3NN8B 3MA9L 1QBML 4MGXA 3V55A 4ABVA 3ZIMA 5KBPA 1G7IA 4ORZC 3ABKB 2LU5A 3QUZC 2F53E 5CLZA 5AVRB 5E8DL 2P4AB 4GQRA 2K3HA 4JPKH 4J8QA 3VO0A 1U21A 1BOGA 3ZMEA 2BY2A 1JPST 1ILUA 5CJBA 4PGEA 4AT6B 2ESVB 3ZZ1A 2P5EB 1FPTH 1MREH 2XOTA 4C56E 3MAWA 4LMQI 5IFAL 4NRZB 3Q01A 3WN5A 5BMFH 1S6NA 4I48B 1FZKA 5DSCB 1TETH 4LLWA 5IEHB 2APWA 4LXFA 3PAVA 4JFZH 3BISA 2KC0A 4MMZB 4XGZA 3NCFB 3AMKA 3D2UD 3GMNB 3UADA 2IH1A 3VDAA 5M95B 2XZAH 2W59A 5I74C 1MFDL 3L16A 3BH4A 3AACA 3PWVB 4ADIA 2P52A 1ESOA 2J20A 1G84A 1B88A 1X3DA 3CLFL 5GRVL 3C5ZB 4BYHA 4TLKA 1OAKL 2PYEE 3ZDZB 4POYA 3L9YA 2IPKA 5EDSA 4FFYL 5F7DB 3AXHA 1NEZB 1IEAA 3ARGB 4QJ5B 4K8RL 1IGIL 3O4LB 1NFDE 5DRXB 1OCOB 3KH3A 1WITA 3NSFA 5D7IE 3BAYA 2Q86B 1B2YA 3VX1A 4B3EA 4IRJA 2ATAA 3QXVA 5EN3A 2Y7NA 5TFSH 4OQTL 1TTAA 2BNUA 4P5TA 5ERWB 4NO3B 2P9RA 3VTTA 4G8IA 3A4DA 1V05A 2BOBA 1RZFL 4YPGA 3IXAA 4BIKA 4DKTA 2YK1H 1SVCP 2MHAA 4KVPA 5JUEL 4JJ5A 1Y6MR 5EO0A 3FH8A 4PGJA 1BX2B 3BPNB 1EEYA 3UERA 4NC0B 1LYQA 1QRKA 5IT2H 1IQDB 4YXKL 1IC4H 2VDMB 4N2BA 3OGOE 5L2KB 2GCYA 2Z65C 1EVTC 2HRHA 4YBQC 4XX5A 1HZLA 2UYLA 3G6JB 4W68A 5AOMA 5ESAA 2FLRT 2FUQA 2P5WB 3AG4B 2VMEA 3FQTA 3MRNB 4PJDF 3GPSA 3FOLB 1FO0B 3RNQB 4FQXA 4V1DD 1IFGA 1QO3B 4AH2A 3NCCB 2VW4A 1KDIA 1FWXA 4GRWB 2W9DH 3N5AA 1PPIA 4X5WB 1JF1B 3CMOH 3STBA 4ODVL 3TBTA 4ELMF 5EU4B 5PCYA 4RFOL 5GGTH 1IM3D 3FAXA 1M7IA 3T0EA 1LWHA 3ZTJH 2DI8A 1G7JA 1I7TA 1JPGB 4GI9A 4NPJA 1CYWA 2DWTA 1OPGH 1YG9A 1F4XL 2CO1A 4EDWH 4F7MB 2CGRH 4ZTOH 1RZPA 2VN5A 4MQ7B 2J5LB 4LO9A 4PJCF 2QV2A 5EUOB 5EU6D 4Y5XA 5T1DL 3ZE2E 3VWJC 1BIIB 2DQTH 1XR8A 3RZCC 3FTWA 5E9DA 1CF1A 4YFLF 1TKWB 2DQJL 1NOAA 4OLVL 3GMPB 4FXTA 2IO5A 2YEZB 4R7DB 4XRCA 2FT7A 4PB0H 4B7LA 4RX4A 4UQEA 4Y5VA 2VITA 4CMHB 4OB5H 4OUOA 3RWFA 1JTOA 1FC2D 4L4VE 4W9CC 4ZMOA 3WLBA 3WHXA 3VFTB 1EEZA 1T1ZA 2C3VA 2ICCA 5EOTB 1S7SA 4XB7A 2EJ1A 5B7FA 2OR9H 2D3VA 3L8QA 3MXWL 3AROA 4CRPA 4XBEL 4JFEA 5C0RH 5I1AA 1N6QH 1BAWA 5KAQF 3MJ7A 1F97A 3V9CA 5C3IA 5IB4B 2CM6A 4RGMB 4WU5B 2XWCA 1NANI 2XN9D 3PQYB 4MZIA 3ASWA 2PCFA 3UC0L 2GSIB 4I48A 4IDJL 3S5YA 1JWSB 4AQEB 3DVFA 4NQCE 4K8RC 1Q1PA 3RFZB 5IHLB 1YYMH 1HNFA 1QBBA 4HG4J 2ADIB 4FCAA 4F37K 1A9EA 2EXSA 3ULVF 2XN1A 3NZUA 2FO4B 1SNRA 1ZHBA 2DAVA 3VQMA 2C3HA 4NN7B 2GAZA 2DBLL 3H0TB 3MNVB 1XR9B 4GB9A 4D0BA 4LCVA 3BIAX 4OCSH 4RGNE 4AEEA 4AVJA 2BY0A 2CCWA 3IXTA 5FO7A 3HR5B 1ZLVK 4ODUB 3UO1L 4PH8A 1CO1A 1E5YA 4TUJB 1T5KA 3HAEG 1CR9H 2WVSA 5DS8A 5F96H 5GGRB 1I8MB 2GB2A 3HIZA 4CA4A 1CFMA 4FXGC 5DDHA 1JXFA 1NCJA 4Q9CA 1DN2A 4YHIB 3HJ0A 3LKPB 5I19H 4H8PA 3BUYA 2ED9A 1URZA 1MFNA 5GGSB 3GTVA 1I9IH 2E3VA 2IADA 1XZ0B 3U83A 5I16B 2JCCE 3D06A 3GTNA 1NGYA 4IKNA 2DQCL 5JHDD 3I3BA 3OAUL 3Q9QA 3KJ4B 2BJML 3SKOA 2EIZB 3U4EB 4U31A 4OT1H 1SEBB 1S7XB 3IWUA 2UZYA 3X3FH 4KKNA 4Y7MA 2G9HB 3LIZH 1TU2A 4XPAL 3F7YA 1GKEA 2PCPA 2D9CA 1QHOA 1I7UB 3QUYB 2KI6A 1TVBA 1UCBH 3SPJA 1I9JH 1EGJA 3NZHL 4FXKC 4JM4H 3VVWA 1O5DT 3FZUD 2OZNA 3E2HB 4B9IA 1SYVA 5DWUH 3OB0K 4W6WB 3RPKA 4YNYA 3FT3B 5DGRA 2D0FA 3LZFH 3EOTH 3BXNA 5IB3B 1WFIA 2CKBH 1K3ZA 4HOXA 3DO7A 3HB3D 4HVBA 2GC4C 4NDMB 4D9LH 3CN3A 3EYQC 1OE3A 4Y9EA 3GKWH 2BERA 4I3RH 1OAYL 4X4XA 4JPWL 5ILTH 1HIMH 5DJYB 2IAMA 2COVD 3KEDA 1JCVA 4LFHG 1JHTB 4ZTEA 4H8WH 3SY6A 2Q7YA 2VLKD 4YMPA 2AS5M 1XGUA 4JRXA 3O41A 3JWDL 4GMTH 4DKEL 1ULVA 3MA7A 2PNDA 4P59H 4XO5A 4OJFL 5F7EH 1OT1A 3PP4L 3JV6B 3K72A 5BS0D 3LNFA 4FFVD 3QXDA 3KYMA 4ZMTA 3OKKA 4YEEA 4JJHA 1HE7A 4OZGA 4R3SB 2RAMA 2Z7WA 3L3HA 4PLOB 2AJYL 4E2OA 3ZYIA 5AB0A 3QQNA 4U7MA 3CFNA 2C4FU 4RZCA 4JGNA 1JGVH 1WAPA 2HT2C 1MFUA 3V4PL 1MG3C 5CN3A 4TPRL 2QHLA 3O9WC 1NFIB 4Z8FH 4QRBA 2W94A 1CXIA 4EN2A 1B9KA 1TQTA 1HEJC 1GH7A 4OCYH 4AUJA 2Q3ZA 3TN0D 1LTXA 1OB1A 3GO1H 4Y1AD 2BWIA 3U4BL 1NBYA 1LDSA 5LNEA 1DJWA 1CDBA 4Z95L 3NCYS 1QFWH 2HJLB 3GI9L 4K3GA 5CN1A 1F00I 4ZMZA 5CFHA 1H3GA 4K5NA 3HZKB 5BNXD 2RFXB 2X4TB 4XC1H 2BRRH 2JJSC 5AKRA 4K15A 2H6PA 2NY6C 2HN7A 4YHZH 5JW5A 3HMXA 2GI0A 4Y19B 5B1CA 3QQ3A 3TIEA 1A6WL 2JK5A 5I5MA 5ID1A 5CCHE 3WYRA 3K2UH 4ZQKA 1TYJA 2WINA 1NCNA 5FW7A 5GRUH 4BFIA 5IMLA 4G9FB 5A2KH 4Q9QH 3BMWA 2ZUTA 1GOFA 1XGRB 5ANME 4QAWA 1IIKA 3FT1A 4N2GA 4W4NA 1AFVH 1IAIH 3DJ9A 2CR0A 1PIGA 2B9AA 3SQOH 4PJ8C 1IBGL 1WSST 1MKFA 5D7LB 1H0DB 4N0FB 3ZJAA 1I3GL 4L4TD 5JOPE 4HV8B 1X9UA 4N8VA 3L4TA 3BVVA 3TBCA 2JNZA 5CMAB 2RCSL 1JK8B 1CYXA 2C34A 3FO1A 3SBRA 1MCQA 3VFNB 4O2CA 1EJ8A 3A6BL 3QP3A 3SJVA 1KIRA 2OMWA 3DLQR 3FCBA 5DEGA 2DQUH 3PS6A 4XXWA 4Y4FD 1XCWA 2DLFL 3VXRB 1VZIA 1X9RA 4KRLB 5D4IA 4A6YH 4ODTL 3FO2A 4NQSB 3F85A 2IH8A 4AG4L 2MPAL 4N6RA 3N42B 4PRHD 5GS3A 3LXBA 3RHWK 2VZSA 1EH9A 3WD5H 2H3KA 4NQED 5JHLA 1AH1A 3NJFA 3C5SB 2D4FA 2A9ML 2GJZB 3S8WA 3RL2B 3NABH 4PWIA 4NI3A 1VFMA 3GPEA 3Q8EA 3GHPA 4QHLA 4UCFA 2FX9H 4LOUC 3NPSB 3W9DA 5AL0A 5GSRB 1J8HD 2A6KA 35C8L 4Q2ZA 2ZZUT 5C7XH 4NJAH 4JCMA 1BAFH 4JFXA 5MEPB 3GRWL 3RVXC 4MXVF 1TYEB 1CGVA 3MV9D 2BRQA 5D2NA 3RWJA 1D5XB 3GIZH 2JLPA 4LDEB 3SDAB 1BW8A 1KB5L 3GBNH 3P3YA 3MRMB 3JWDC 3C60A 4YDIL 2Y36H 1V7NH 4JQXC 2O6CA 1MQKH 4AE1A 5DFVD 1SN2A 4QRRE 5MEQB 5EOCH 2Y7QB 2L04A 4FFZH 2X40A 2J43A 3PXHA 3MRQB 3BKCL 3WKQA 1BG1A 3K2MC 1HCZA 1JS4A 2DYPA 3EJUA 4G6JH 2AHIA 4DP8X 4MX7B 1XXFC 3DX9B 2NZ1A 4NQQA 5CCKH 2DLIA 1DEDA 3CZFB 2NY1D 4JFOA 3TX4A 1JHTA 2D73A 5C0IA 1PZ2A 4PJ7F 4PGBB 1R1CA 3HW7A 5E9NA 4ZX3A 3VG0H 1A8ZA 3L6FB 2XIBA 3MCLL 1L0PA 3EH1A 3VRLF 2WGNB 1KGIA 1CC3A 1ZWIA 3OD3A 4PJAB 2ATPB 3QNYB 1FGVH 2EO9A 1B6UA 1FIEA 2E7BA 4Y5YA 2HJKB 3CVDA 4M7LT 3ZHLA 2DW5A 3D6GA 1YQ2A 3O4OB 1QSEA 3HI1B 3MLUH 4RISL 4U6HA 1DJZA 1C08A 5CUSL 4ZUVA 3DHPA 1GYWA 2QR0A 4OZFH 1OB0A 3MX0A 1I8UA 2BSSA 3Q3GA 3E3QC 5EZJB 5KSAC 2WBWB 3BAIA 3MHZA 5EFIA 2NQDA 5LLIC 5IGXH 3P69A 3JTTB 4DFHA 5C0CA 1XX9C 1Q90A 4PBWD 3U7WL 3QEQE 5GZOC 3K8KA 4DK6A 4DO5A 1JWMA 3AZUA 2G5BB 2O6DA 2OJZL 2VZVA 3IE4A 3SDYL 2P8PB 3FT4A 4ZD3L 3KWWB 4JHBA 4ELKB 1ECZA 4F2ME 4UOZA 4ZFGL 3V4UH 1XEUA 2K0RA 3B3BA 1XHHA 1E3XA 2BP0A 1F4WL 4OI7A 2E59A 1DE4A 3BFWA 4HWEL 1BZDA 1XGRA 2RA1A 2VR3A 3MRJA 2BDNH 3R4DA 4ANKA 2O6FA 1M2VA 5CN2A 3O8XD 1MCBA 3ZBMA 1FFRA 3EJJX 2Q76B 4O02L 1RZ7H 2Y7SA 1JHKL 4P9HL 5CMAA 4MDIB 2R7EB 4AX3A 3VFNA 3V0VA 4JO5A 1HAUA 1XH1A 1IBDA 1VFBB 1RHFA 3KPLA 2IOOA 4I3SL 3IFOB 4WW1B 4XO9A 4FC3E 3ULUL 4LEXL 2DYSB 4OF6A 1AKJB 2XICA 2Z7ZA 3ZMRA 3NIDF 1TTGA 2LU3A 3M07A 4JZNB 5JYLA 5MERA 1E4XI 1Q0YH 3K81A 4M4RA 5BRZB 3KDMA 5C9KA 4G8AC 5FYLL 4FP8L 2BVYA 2YRPA 2ILLA 2CUHA 4YHYC 4QEGA 4N8VG 3PNRB 3ABLB 1PG7X 4CADB 5T1MA 1U58B 1HCYA 1JVKA 1ETA1 4KO5A