3ZHNA

Crystal structure of the t6ss lipoprotein tssj1 from pseudomonas aeruginosa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
PPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDTAFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDRATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the T6Ss Lipoprotein Tssj1 from Pseudomonas Aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Toxin
molecule keywords PA_0080
total genus 31
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2012-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12790 T6SS-SciN Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3zhnA00
4A1RA 4Y7OC 3RX9A 3ZHNA
chains in the Genus database with same CATH superfamily
5E00B 1DQQB 4ALAL 4RMSA 5C2BH 2W1NA 2WV3A 4NDMB 3RWIA 2R0LL 1N7MH 3H0TB 3C5SB 3NK3A 1U8LA 3QORD 4YL4A 2Y6TE 4HP5A 5I8EB 2DKUA 4ZDHA 1EDHA 3FH8A 4JANB 3RY4A 1FZKB 1KPUB 2ZXBA 2GJ6B 4OZIA 1B9ZA 4PRPB 5DEFB 2DLFH 1YSOA 3VFTB 3C60A 2CAKA 3HLAA 5D7JD 5LCVH 1CLVA 1UJ3A 2WANA 4KK6C 2WD0A 3G08B 3PGDB 1ZE3H 3MBEC 4X6EA 4KY2A 1IRAY 2OP4L 3H3PL 1JWSA 2X9XA 3O3UN 1JRHH 3AVEA 2V5TA 1WF5A 4L3FA 4PN6A 3MLWL 1B3IA 3OKOA 3RHWK 4TYUA 3D4CA 1A4BA 3VACA 5FIEA 3K2UH 4UZSA 3AAZB 5EWIL 5D9SB 5KVGE 3W9DA 2HFGL 4OZGF 1DVTA 5GGTA 4BFGA 1BF2A 3FT4B 4M6NL 4LDEB 5MP6L 4ZPVB 3S35L 1X9QA 3V9EA 4YLCA 5EFIB 1FF5A 2XNAB 3C8KA 4MA8L 2AEPH 5EFIA 4NENA 1GXEA 1YEWA 2BK8A 3UFIA 1ESOA 4YHYB 2ITDB 2GUYA 4X6CB 4U4IA 1IFHH 3N41B 4B41A 2X6VA 5TFSH 1S8DA 2AAAA 3MRGA 5DZ9A 4PWFA 4H44C 4JFFA 1I3GL 1RUPH 3S0PA 5AW0B 1JIBA 3TBBA 3GBLA 5DMJB 1AQKH 1XAKA 4JY4A 1DQMH 5D9SA 1H9DA 2BVTA 4HFUH 5HDLA 1HINL 1I9IL 2EEFA 4LARH 1E28B 2GIYA 1WBXA 1LQBC 2CKNA 4DWHA 1QHOA 3ELAT 4LCUA 5AVQB 1H15A 1JNNL 4WFHD 2B4CC 4I7ZC 4PP1D 4LLUB 2E7MA 1U92A 2A6DA 5DHMC 4JFQA 4B9FA 4LPYA 3VWJC 3CDGB 5DXWA 5KVEL 4HHAA 4H88L 2CD0A 1EAPB 4QRTA 4ZUVB 1DJZA 4L3EB 3GSVB 1IGMH 4BQ6A 1UD5A 4EQ3A 4NN6C 4CN4A 4Z7UA 3STBA 3QIUD 2YPLA 4EUPB 3L2NA 2F68X 4ZFGL 5IEKB 2ZWZA 5AW3B 4N2AA 4YBLC 3AWEA 4X42A 4MAYB 4QRPA 1T6BX 3ROOB 4X6DA 4M61B 1A0QL 3V6FB 4C4KO 4QXTB 1JFHA 3CSYA 3OKNB 1Q9KB 4XCFL 4D94A 1UWEH 1GYWA 4ZMLA 4QRPD 3KLHD 4X7DC 1NEZA 1WK0A 4LLUA 4HHWA 1OK0A 12E8H 2YD3A 1ZWIA 3EHBC 4ADJA 4K8RC 2X2UA 3N40F 5BO1H 3WTYA 1QFHA 1Z9SB 1AGFA 2VZVA 4Q6YA 3QQ4A 1MWAH 1TITA 2FEDD 3IT8D 4PRHB 4G1MB 3SD2A 2XVKA 2OFQA 3ZJAA 2BSEA 3UG4A 3DVGA 2DQJL 2AABH 2FBJL 4QJ5B 1IFRA 2WWKO 3S88H 3F5WB 1U21A 4LSTL 4LKCA 5KVDE 4F37F 2WQWA 3L81A 4ZMWA 1CT8A 3K6FA 2HRLA 1NGWB 1HHGB 4UF7C 5HDWA 3H7BA 7FABL 1P2CB 4KAQL 3KWUA 2UZIH 5LBGA 4F33B 3T0WA 1DJIA 1T6VN 4OZFA 5SV4A 2GHWB 1NM9A 2VZUA 4N28A 1MVFA 3K3QA 5F70A 2FD6H 2WOBA 5AVYB 2ZOLA 2NCEA 3X2QB 1OF2B 3B43A 4JM0A 2MQ3A 1W0VB 2I7SA 4P9HC 1MI5D 2BXYA 2R2HA 3E2HC 3KPRD 4GUCA 4P9MH 2QADC 4PCSA 4XZUB 4QOKD 1OT1A 5DVPA 4JGNA 2VITA 1T04B 3MTXA 2QPEB 2RALA 5FV2A 4X5WA 1HEZA 1M2VA 1NOLA 5HGDB 3WJMA 1MI5A 2F58L 3KPRA 2BZ7A 2VC2L 4OCRL 1F45A 3ZHFA 2HXAA 4ELME 4WO4B 5D2NC 3UCQA 1F90H 2L7QA 3DOSB 3N1MC 4N2NA 4KQ4L 1F13A 4KXDA 3KPOA 2BWIA 4AK1A 4YXKL 4JFFE 5I1HL 1O7SA 3MLYH 2I7OA 3P73B 2VSMB 1C12A 3SE6A 1UA3A 2VAAB 1Y6NR 2XYCA 3MCLH 3BT2H 2R2BA 4P5RA 5DURD 2XYBA 3DGDA 1DQQA 1LO2L 3L4UA 4GAGH 3UC0H 4ZXBA 4NZUL 1NFDE 1YO4A 5D4QA 1CDCA 3FHEA 4NNPL 1WT5A 3RA7L 3OKOB 2GSMB 4HPOL 4NN5C 4B9JA 2IGLA 1F4HA 2C8NA 4JFHE 5SWSE 4EBQL 5I19L 4FNSA 2DQFA 4HUWB 4YVNA 1QNZH 2DD8H 3LQAH 1JPST 3ETBJ 2HFEB 3LSOB 3UTPD 4P2OA 4JG0L 3MO1B 1M71B 1ZANH 2Z8VC 2ZPKH 1M9SA 3IEAA 4FZ8H 4PRHD 3VVVA 2X40A 2ZIDA 1R3KA 1L0PA 3DX6B 5DFWH 3FRPG 1QVOB 4YXKH 1RUML 3Q05A 1E4KC 3Q8EA 3QXAB 2OMWA 2ZQKA 4WY7H 5BZDA 5I8OH 5FK9B 1Q94B 4X7SH 4H8WL 1OAQL 2EE6A 1UWXK 4HKZB 5AKRA 5KJRH 4HCRH 5IGXL 5GZNA 3UDWA 3T3PF 1P7KA 4A2DA 4PGCB 4I0KA 3Q1EA 4MNHB 2OZ4L 4XN7A 5DEGB 4HC1L 3P54A 5B1BB 3NJIA 4ODXB 1LE9A 1KPRA 3INUH 5E8PA 3AU1A 1GIGL 1MDTA 3B9DA 3QJUB 3QPQD 4AW4A 5F7EL 5B7MA 2AKRA 3AY2A 3VFOA 3FQRA 3BWSA 4AZ8A 1QTYT 1SPDA 4RFNC 4ZUUB 1R0AH 1JPGA 2V17L 4DFHA 5KW9L 4N9GB 2C3WA 3SCMA 4X7TB 3TONA 3TCLB 5I6OA 5LNDA 4ZTOH 2F19L 2X41A 3AROA 1P53A 3FOMB 1Z0MA 2ZAHA 3MODL 1K8IB 2NY7L 4U1JA 4PREB 4XNUH 3RWEA 3BW9A 5LN8A 5ENWB 1WC7B 3FUNA 3S37L 1CDJA 5GZNC 3NIDB 4WI0A 1VZGA 4MS8C 3MAWA 4FKKA 2Z4QA 1A6WL 2FYYB 3BUDA 4Z3EA 5CXPA 4OTXH 3DMMA 4LEEA 3UZEA 2RACA 5C09B 4EZLA 2F54B 5F7EH 4NUPA 4XMLL 2PXYB 4YDIH 4JFWA 3AS3A 2P47B 2XWCA 1KTDA 2HJKB 2CKBH 4KK9C 4JVPA 5DHDA 3FO2A 4X9FA 3F7PC 5IMMB 1YNTB 1UT2A 5E2UH 1URIA 2N1KA 4G8GB 4P4RB 4OKDA 4B96A 4AKOA 4WKZB 3OSVA 4LVEA 2H45A 4LAJH 5HHNA 5F3BB 1JV5A 3FQWB 1CGWA 1JNHA 2ZUUA 4XR8C 4JM4H 4P9HH 1OARL 4IBWA 3ENEA 3V55A 1BECA 3E9TA 3QG6A 5EORL 1FBIH 1JGLL 4G6AC 3TPKA 1PZBA 5DUJA 5HGGS 2AMUA 3OKKA 4PV1C 5D7LE 5F3HA 1AFVH 4PVMA 1MWOA 2VKXA 1U93A 5EF2A 1LP9E 1FRGH 2A6JA 5DLML 1CGUA 4LOUC 4WHTB 3BH8A 5HI4C 1CGVA 4AYMC 3CSTA 1UCBH 1PLGL 4WO4C 4F7MB 2DLEA 1F8TL 4LP4A 2MCG1 1DQTA 2Y1YA 4I2XB 1G0XA 1IEBA 2EADA 4KI1A 4IKNA 1XFPA 4FI6A 4BCYA 3GSRA 4XVUD 1QI4A 4PJBA 4QXVA 1RZJH 4NUGL 4S1SL 2N3JA 2WN2A 3AREB 3M1BB 4QXUH 4BSWB 32C2A 3KR3L 3VI3A 3SE3C 3HC0B 3HRPA 4FTVB 4ZODA 1S7RB 2CLVB 3UDWC 2H3NB 4HPYH 4P46B 3P2DA 1EDYA 1NCNA 1OSPH 1IGJB 4PY8J 1JCVA 3QYCA 4PJ7A 5F9OL 3QUXB 3OBAA 4M56A 2RAMA 4HX1A 4LPXA 2NY0D 1AMYA 3I2CL 2PTTB 4G43B 1D3CA 4O4YL 1HXYA 3QEQA 4EI6B 4XC1H 3IJEB 4RDBA 4GSDH 1T20A 3D09A 4WO4D 3U9UA 5LG6A 5DZAA 4ZOCA 5HJ3A 2J21A 4HG4K 1HHJB 4KX7A 3MCLL 2OXGA 2V4LA 1KTCA 4PJ5B 4N85A 1VGKA 1MFVA 3MGOB 4HGWB 4XAKD 4MVBC 3U36A 1WBZB 4HIJA 1ASQA 3RL1A 4FXLA 2W81C 4LVOB 5DF0A 3CFEB 4XH2A 5EBWA 1N26A 5IB4A 3C5ZA 1PZUB 4KHXH 2WBWB 4UQ2A 4D9LH 4OR1A 1XXFC 1E50A 3KPSD 4ORGB 3INOA 4U1LB 1ZA3B 4NLHA 5JPNC 4CW1B 3QNFA 5EU7C 1AQDB 4WFGE 3OLEA 4LHUG 3GXUB 4X98B 1JHKH 4NKQB 5L2KB 2JJWA 5B1AB 1XX9C 4DEPC 5IQ7L 3WGVB 3UTQB 1A3RL 3NN8A 1TTAA 2I5YH 1P7QA 1NCOA 2BDNL 5SX4H 1TCRA 2EXYD 2ODHA 3CX5K 3KEDA 4P4KC 4EE2A 4JO5A 5IROC 1AP2B 4MVBD 4IKJA 4YSOA 3ES6B 4JKLA 2OQJB 1DDHB 4M8QA 4UNTA 4JZJA 1C5CL 3CZKA 4G42A 2OP4H 4OIAA 1KB3A 1R46A 4V1DB 4G42B 1MFDL 4OV6F 3O0RL 5KJ4A 3CSPA 5T1MB 1IM9B 5IFJA 3CMGA 4LEXL 25C8H 4GQPH 5I2IA 1FA4A 3U7WH 2W38A 2VISB 5I16B 1NDMB 4Q4IA 4M93B 3QDJA 4LXFA 3SB3A 5C0EB 2GW5A 1HQ4A 1J1OH 4XZ4A 3MRNA 5DHVH 4UQEA 4JDZB 5AAWC 5DA0B 4LIQE 2ZG2A 4ZD3H 3RDTC 1MQKL 5C2UB 3MFFA 5TDOA 4YHZL 4ZW6A 2QTVA 2B14A 1RSFA 5FA4A 1EEUA 3FTWA 1TVHB 3I6LD 2BCKA 4QIRA 4BRVA 3FCTB 3OGCB 3C8HA 3CLFL 3L1OH 2L04A 4ONFH 1YNTA 4XOEA 1I8KA 5I6NA 3OR7B 2YHGA 3I2CH 4P2QA 2X44D 3ZKMC 1AGBB 3B56A 2IMMA 4TKWA 4I0CC 1EZUA 2Q86B 4CC4C 1AQKL 1TU2B 5HHPB 4JRYE 3SPJA 3W9EB 4WK0B 5J6HB 2CBPA 4LSRL 4EN3B 4EI0A 2NY1C 1A8JH 4TULL 1BZ7B 3GMMB 2ADFH 4U3SB 3IAPA 3SZKC 3B3IA 4B9PA 5BCAA 1NPNA 2QBWA 4UIMA 2BOCB 5L88L 2C3XA 4N2GA 5D7HA 4G1EB 2Q7AA 3II2A 3HZMA 3MNZA 1P84K 3DI2B 3FN0H 5DZJA 3D85D 5JXEA 5CIPB 2C4FU 4TVPD 4Z5RA 2W80C 1SBSH 1UJ3C 4HS8H 3IMUA 1ZKAA 1S6NA 3QUXA 3F8UB 4JFZH 5DD0L 1X7TA 2D0GA 4ABQA 4AG4L 1QEWB 3T6QC 4KJYB 1AD9B 5DHYB 3TCLA 2PCFA 3GQFA 4LSQL 3WUWB 1OLLA 4WWNA 1ZHKA 2R0ZH 4G59C 2XQYK 3T3PE 2YD5A 3DRQB 1PYWA 3V9CA 4WFFD 1UXWA 4NO5A 2EH7L 4H1LG 5MEPB 3ZHNA 4DNLA 2VXUL 4XNQB 3TO2A 1KJ3L 4TOYL 1TTFA 3OM3B 2X6UA 1SHXA 1S78C 4BH7A 3CFEA 1YECL 4ODVH 4XH2B 5MERB 4A2FA 5KTEL 3L9YA 1LL1A 1NGZB 1WFOA 4N86A 1F2XK 4IRSA 5B7FA 1ZCRA 3ECBB 1SOQA 3QFJE 4HAGA 3UYPB 1Q72H 5L6YH 1MHHB 3SYCA 4WHTA 1CZ8H 3T08A 1P7BA 1TZHB 3HE6C 1LMKA 4HC1A 2WLYA 5BV7B 1DVFD 3X14B 3EXJA 1MFMA 3QAZC 5JHBA 3M86A 4PY7B 4KO7A 3VM7A 4HHGA 3K5RA 4OLXH 5FUCC 3ARGA 1T1YA 4J3SA 4UM8B 5LBSA 4B3VA 4XOAA 1AOZA 3DSFL 4FTVA 1L9OA 3LZPA 1UXSB 5TE6L 1OB1A 3IK2A 5IQ7H 1WGVA 5IREA 1T1WA 2YK1H 1YNLH 4UM9A 1LNUA 1EBAA 4O2FA 1KTLA 2BNQA 2CPUA 3FMGH 4HUWA 4X8CA 1QZNA 4PLKD 3NZSA 1Q0EA 4LMQI 1G4MA 1AD0A 2XN0A 1J5CA 2C7UA 1NBYA 2V9QA 3U46A 4AX3A 4HULB 4GB9A 2BERA 5AKSA 5B38G 4IRZH 5I73C 5J5EA 5KSBA 4JL1A 1ASOA 5KSAA 3FQYA 3L5XL 4NPYB 4B9KC 3DJZA 3TZVC 2F19H 3I85A 4WSJA 5HYQA 4WAFA 3GJFH 1CS6A 2FYVA 3MLPA 1J5OL 2BS9A 4M7KH 2EIZA 4V2BA 3DK0A 3F6LA 2PCXA 1IVTA 3F6JA 3NJVA 3X12B 3SDXE 4TUKH 3WS6A 4IEFA 2AJYL 1LO5B 4F58L 5I1KL 1TQVA 4ZAKA 2GAZA 4KJQD 1T7WA 2Y23A 3FB6A 4P06A 3UIZA 4LE8A 1WPCA 1NGYA 4H26A 1CIUA 1K8DA 2BIQA 3NJLA 4N5EC 1HTYA 4K9EC 5A2BA 1T1XA 5D8JL 4KTEL 4NEHB 4PFEA 1ACYL 2VXVH 3ARFB 2DW5A 3FCGA 4X6DF 1FNFA 2O6DA 5JW5A 1UM4L 2E8ZA 3SCMB 2E7BA 3WN5B 4YEFA 3PAVA 2JJUA 4TTDD 4KDTC 3B7SA 3MCYA 4G71B 1EXHA 5GRJL 4DZBB 1JPEA 4E9WA 4TSBH 4A38A 5A16B 3SY0B 3RWGB 2YGVA 4NQVA 5AOMA 3JZ7A 4XMTA 5I8KL 3IDUA 1TQTA 3PQYB 4YWGH 2NUPA 1SN5A 5LQBH 1V8HA 5HGAA 5I19H 3LEYH 1EJ8A 4LKCB 5G4OA 3SYQA 1T1ZA 2Z4QB 3K6NA 4Y5VA 3QZWA 2OYLA 1PX8A 5EO9B 2WXIA 1U3HC 1AXTL 3VW3L 3RWJB 4RH4A 2JKXA 3WL9B 3H56A 4ZD3L 4CKVX 1V7MH 2YEZB 4IBYA 3MLXL 1T5WB 1YCSA 2BP3A 1QSFE 4MFHA 4AGOA 4Z7UB 3VTAA 4PB9L 3CN2A 2RB8A 1GPOH 4PGEA 1N64H 5EBGA 1RV6X 4MRCA 5D5MB 1NCHA 4N9GA 1TQSA 2W91A 4ZO6A 1FNSL 3HUJB 1KXQE 4JFUA 1JGLH 3O3AB 2PLTA 1GKOA 1K4DA 1ZPLA 3FUHA 4N0YH 1IKFH 3QCTH 4S1SH 3OKNA 1WZ1L 4J3OD 4QXTA 3VWKD 1C7TA 3ARXA 4LF3A 5I30L 3BLPX 4M61A 4PHXA 1WQVT 1XF3A 4KUCF 1XCXA 3JXAA 4AE0A 1Q9KA 4EDWH 1I1YA 4CVUA 4F9PA 5IB5A 3G6JA 5BVJA 4UT6L 5ELIA 4JFYB 3DGGA 4P23C 4XMXA 4PD4K 2H3KA 2IALA 5EU6D 2CIIA 4WK4B 1UB5A 5FW7A 3NTCH 3ESOA 3ARFD 1IX2A 3S3SA 1ACCA 3GRBA 1RQ5A 3L3DA 1BXAA 1JGVL 1FVEA 4AKQA 1CJYA 1G1CA 2R0LH 5BOJA 1TQBB 4ALAC 2VRKA 3QIWA 4EJ1C 2IAMB 5F7DB 2P7TB 2CRIA 5HYFA 2Z31A 3VXUA 2K4WA 1CDGA 1EAOA 2C3VB 2GITA 2QEJA 5K9JL 4RRPM 1INEH 4EN2A 2WXQA 2H2PD 3QRBA 1U0QA 2J2ZB 2DS4A 4HFWA 2FEEL 1N5AA 3X1EA 5KBKA 4FQ2H 4DN4L 5GQBA 4GXVH 2IPTL 3H9ZA 3UX9B 4Y5YB 1TG8A 2K6WA 2A6IA 3V0DA 4X5RA 4OZGE 4KUCD 3C08H 4Z7NE 3K2KA 1FSKB 4YSSA 2X70A 5J57B 3EGXA 5F3FA 2EIBA 1LEKA 2N0KA 3RNKA 3EGXB 3VFSA 1ZEAH 3UERA 1JD9A 3L7FA 3EOYG 3QCVL 3QNZA 4HWBH 4K4KA 3U6XS 5L7XL 4L8CB 4YDZA 1D9KB 1YQVH 5BRZE 5L4JA 2QDVA 5C0ND 1PD1A 4WO4A 1JERA 2A77L 4NN5B 5E8EB 2MQCA 2J2ZA 4M8VA 5FHBH 1MI5B 3KPRB 2P9RA 4WEUD 4YMPA 5HGDA 1P7HL 2NCMA 4G6ML 3KXFA 3UGUA 4QNPE 1Q9LB 1FCCA 4MDJB 2G2PA 4J23A 1MCPH 3ZXAC 5AL0A 4X4YB 4GT0A 3UACA 3QEHA 3HRZA 4EDXB 1EXGA 4M6MH 4JHUA 2W95A 4ADIA 4PCYA 3PNWB 2VJ0A 1UZ6E 3UTTB 1H5BB 2K9UA 5BW7C 5C3TA 3V0JA 3N55A 3ZL4H 3RA7H 3FHQA 2ZCHH 4WU7B 4BQ9A 5I8CA 3KNBA 2ZOKB 3L4CA 3VJ6A 5HHXH 3GM8A 2VUYA 4HQQL 4DVBA 1BQ5A 3QYMA 2XV0A 3QUMB 3NESA 2O6PA 2MMXA 4WWKC 2J5WA 3RVTD 3IPEA 3CQPA 3KH4A 4I1NB 4RGOL 4UU9A 3RZCB 4BZ2L 3F7VA 5DZPA 5CBAA 1P4BH 3T6VA 2QVFB 4NQDE 1NC4D 1G7LB 2DICA 4L3EA 2HMID 2HG5A 4DUVA 2ZTBA 2KKQA 3F7RA 4GKNA 2AQTA 1YA5A 3EJUA 1MPAL 3IS0X 1ZY9A 3CFUA 5F72S 4E9TA 3FQXB 5B1JC 3NZUA 4GXUM 4Z3TA 1UKQA 3EIFA 3E0GA 4G6AD 2I07A 3QDAA 1IO4C 5DLMH 1M7UA 3GDBA 3RIAF 3NIFF 1AC6A 3V6FA 1JXFA 1W0WB 1F6AB 2YEZA 3PWJA 4ZO9A 1AE6H 5GHWL 4NHCH 4UU9B 2J8UF 1J12A 3WL9A 2N01B 1CICC 1UB5B 2MQGA 3QHZH 1A3LH 4HT1L 2WLLB 3VWJB 4ERSH 2EKJA 1JHTB 4HJSA 5DQJB 3S5LA 4GT7A 4IKKA 1WBYA 1TLMA 4JKPH 4LF3B 1C5DA 4HCIA 1YDPA 2XZCL 5BS0B 3QDMB 3VXTA 5FYJH 5G5DB 4ZZFA 5H4ZA 3WN6A 3M07A 4JFXB 1XGPA 3NJNA 4QHUA 3GSUB 4N0UB 4WHYG 4OJEH 2NW2B 3QDGE 5FA3A 3WIAA 5IIEB 4GUQA 1AS6A 2OCFD 4OGXL 5B39B 2HT4C 2Z6FA 3SDCD 3TZVA 3JWNC 3BAXA 1UWGL 1G6RL 2EDJA 1HHKA 1IQWL 1GMIA 4HF5L 3PY9A 4G8FB 3DBSA 3LKOA 4KV5F 3WE6B 3MZGB 4D9RD 5ACZB 5GS0C 2Y3AA 1EJOH 3K8MA 4NQDA 2F0CA 4W4OC 1R3HB 3GSWA 2AV1B 3BX7C 5E8OA 1YMMA 3C2SA 3F58H 1S9VB 5MHSE 3MJ8A 2NUPB 1BD2E 3WTSA 3MBWB 1KCRL 1YEEH 1ZGLM 2KZKA 3GHPA 5DJ8A 3EFDH 2PF6A 2XZZA 4M48L 1DN2A 1OZTG 4HFWB 1SGKA 5IESH 4O2FB 2DWDB 3MN8A 1U91B 3L95A 2IG2H 2E47A 4U7KA 4JPIA 4XMKL 1EO5A 4F57H 3ALXA 5DQDH 1TYJA 3O3EA 4C4UA 3OJ2C 5HHOE 4QRQA 5CSGA 2BINA 1N59B 4N6RB 1OGAA 2A4CA 2XICA 2CMRH 5ITFB 4L8CA 5IUCA 2C3VA 3AGWA 4KX9A 2R23B 1T1YB 4W4OA 4YXHH 5C1MB 2OTWA 3ZE2F 4WW1B 1MCBA 3KPMA 1RJYA 3L3GB 4JZNB 4AT6A 2ADIB 2ICES 3T0EB 5IROD 2QLVB 4MX7A 1L7IL 2FEJA 4YLBA 4F1SA 3MUGB 2ZCHL 1KV7A 4U0RC 5FYKL 3VH8B 2EUVA 4IRSB 3BSZL 1Z1WA 4PIRF 3QUXD 5HGHA 2MWCA 2RGSA 2DQ6A 2AEPL 5I6PA 4JO8A 2UXFA 3EH3B 4A2HA 3RWIB 4ODWA 2NUTA 1U8KB 5LO7A 1K6QH 2RFXA 1EMTL 1EERB 4JZOA 4LL4A 4XPGL 4KV5E 3RTLA 3AMKA 2B0SH 4YUEH 1BJ8A 1LGVA 3JWDH 3OKDA 4G82A 5DHXB 2CSPA 2J71A 4WJKB 4QOKB 1LJMA 3S3JA 3B6SA 1XIWD 5JORA 3TVMD 1CL7I 3ZQXA 1JZGA 1NGPH 4XMLH 2X4NA 4JJ5B 4YR6B 4P5MB 3B4NA 4FLQA 3T1WA 1DQLL 2VO8A 1D7DA 2OPCA 3QP3A 4N3TA 2DQGH 2ICWA 3P02A 3QQ9D 2XN1A 4Y16A 5L8KB 4OD3L 3UP1A 5IB3A 1YUHA 4G11A 1AHMA 2PXYD 4JFEE 3PV6B 1SLVA 4HIIA 4XPHL 2KMWA 1E3FA 3W9EA 2FQEA 2LLNA 3MJGX 4XGZA 1XBRA 1G1YA 3STLB 5C9JA 4ERSL 3FRUB 1BZ7A 4MMYB 4P48A 3K2UL 3JVGC 3ZMNA 4WI8A 3U4BH 2P24B 2FQDA 5I17A 4A7VA 1MWAA 1KEML 4ZW8A 3ZTDC 1DFXA 2VXQA 3IDGA 4YDJA 2J4WH 3I6KA 5J3HD 1GZPB 3BP5B 3PLYA 4XP5L 5B8CB 1F86A 5E1QA 1WLHA 3GRGA 4JCLA 3QNYB 3SE3A 2VLRA 2HB0A 2R1XA 1E5YA 5KJRL 4O2EA 4CL7A 5IW1A 3TTYA 2ADYA 1NAML 3JUZA 3LTVA 4LCIL 1JZ5A 1VESA 4XOBA 3UBGA 4TOYH 2PYED 2XI9A 1HQRB 2A9AA 3ZR5A 4TRPH 2QMJA 1LTXA 4JPKH 1AIZA 4Y8DC 4HUKB 3KR3H 1QLEL 1S4IA 2PYEB 1SOKA 4KDTA 3ROLB 4HBCH 1MVUB 4Z23A 2OMVB 2VB5A 5DK2B 3QHFH 4OVUA 5BVPL 3L45A 3W5NA 1SEQH 3K6SA 1RIUH 2WCPA 4GFXA 1KYAA 5DMGD 1ROCA 3DROA 5JDSA 3RU8L 4O51A 3DX9A 3TO4A 3ZE1B 4NWUL 4NOFA 2DQCH 3U4KA 4G83A 1VFBA 4HMCA 5CINH 2ARJB 4OFPA 1UCBL 1HJCA 1KFGA 5DZVA 2NNCA 1MAJA 3O4OC 3MOAH 2AANA 4UILH 3RUGA 3FF8A 5J6GA 1QHPA 4PI2A 5DMYA 3C5ZC 4Z7UE 3ZDZB 5DJYB 1BIHA 1YEEL 4Y2DC 1S7XB 4ZFOB 2Y06H 3WMPA 4ACTA 3S9DB 3HI1A 1ZHNA 5F7HA 2FR4A 1UYWL 4N25A 4QXUL 3G5XA 1X3DA 4POZC 3U6RB 1R24B 4PRNB 1T7XA 1N4XH 3P30L 2FX8L 4G3YH 1FNEA 2PO6B 3GIZH 3L7EA 2P5EE 4ZTPL 5AALA 2OMTB 2FB4L 1MHHA 4XT1C 4OCRH 2EYTB 5C0AE 3U46B 1MJJB 2Y07H 3MRJB 1PLGH 4P2QD 4XO9A 2VLRE 3P11L 4LCCA 3SJVE 5FECA 3GGWA 5A7EA 2ED6A 4P2QE 4YLQT 1G43A 1JNLL 3GGWB 4NKIL 4H2CA 1I3GH 1PW3A 1RUPL 3DO4A 3K72A 5DS8A 5FO2A 1PYWB 4XB7A 3IJEA 3QJTB 3NZHL 3GBEA 1A7OL 3K2MC 4XNAA 2JELL 4F15C 2H2SD 2WXFA 3RY6C 1UXWB 4NO5B 1EEYA 2XZCH 1V54B 2VM3A 3UG5A 5IQNA 3JZYA 2WVUA 4S1RL 3VFUB 4FX5A 3NQIA 5AZEL 1PGRB 1QTSA 1XGRA 4Q0XL 4Q89A 2ZCLL 1GC1H 2A77H 3S4SB 5K1JA 2EDDA 3D0LA 3SOBH 3RJQB 1HHHB 3TBTA 3UYPA 1AQDA 1P5VA 1NINA 4XB3A 2AJVH 1FE8L 3Q48A 4L0YA 4FLHA 4Y5XA 3HPLB 3E6FB 3RNQB 2G5RA 5IVZB 4ORGA 3ZIMA 4WI5A 1G0DA 4XNYH 3WO3B 5ESAB 4LLVB 4KXBA 1Y0LB 1B90A 3QC6X 5CNHA 2GTZA 4BFOA 1NOFA 4NC1C 5GRUH 2DL9A 1JF5A 3HI5L 3NEEA 4OKVA 3VNYA 1VAHA 1DL7L 2BY0A 4P59L 35C8L 3G9AB 2G2NA 2PPFA 2XG4B 2NY6D 3FSAA 2EECA 3EDKA 3V4PB 1S3KL 2KI6A 4MJIA 3V5KA 4OD1H 4A37A 4PR5A 3CPUA 1SM3H 2Y36L 1HNFA 4OM1L 4KRPD 3VXMB 5DYOA 2BVPB 1M6OB 5C9KA 3AU0A 1NWPA 4LU5H 4NS0A 3V0WH 4FQHA 2WQXA 1HXYB 3QEQB 5EMYA 3H6AA 1SHSA 2VM9A 1ZVYA 2EXSA 4P2RD 1I3RB 3ETTA 3IFPA 4PJ7B 1T7ZA 2ZXEB 3JYBA 4WJ5B 3C87A 3V5DB 4A2EA 1S7WA 4WWOA 4ZSOB 1E65A 2B1AL 5LBSL 2YSSB 3MV9B 5HHMB 3DMMD 2J1ZA 4XCCH 4LDOB 4WW2C 1WS8A 2MNWA 3R4RA 1GGYA 2GIMA 4F7EA 4GXFA 3I6GB 4WV1B 1M1SA 5F71A 2PWFA 5TQ0H 4PHZA 2FAUA 2YOCA 1Z2KA 1YEFL 2YUXA 4JEGB 5ICUA 3T0AA 1THAA 4PJAF 2HVKB 2QADB 2QKIC 5DR5L 4DO6A 3QQDA 1EIBA 3GXIA 3RPIB 2DIBA 3ECVA 1EAJA 4GP5B 4YHPB 1F4AA 2C9XA 1J9QA 3P4LA 5E24E 5IBUB 3L54A 4JB9H 5ABDE 1ZTXH 3WNOA 3H9SE 1TVDA 3DJSA 1YUHB 2PR4H 3QUZB 4N0CD 5DC0A 3T3MF 4ABWA 4UDTA 3IFPB 4ZNEE 5F97E 3V4LA 2AQ1A 2J6EA 2QTEA 1YEHL 3QDJB 3IAGC 2P80D 1A47A 2V3DA 3UBHA 4RWHA 3BE1L 1I8LA 2DQTH 4PS7A 3A23A 2APFA 3DX3A 2F8OA 1KUMA 1YEFH 3QIUA 4LLQB 3BZDA 4H88H 4KK5C 2HLAA 3K80A 4PJAB 3W82A 3DXAE 3DURA 1SMDA 5EU6A 2VABB 1RERA 4P05A 4M5TA 3U0WH 3UBFA 5AZ2L 3FSOA 5D6CB 1MRDH 1U8OA 2Z0BA 3ARZA 4FXGB 5FECB 2ZWNA 1M7DB 4PH8A 5I1KH 1KDIA 1A1NB 4J5VA 4QXWA 5CLYA 1GZHA 3QXDB 4TQIA 1OAJA 2BJMH 4JPQA 3SY6A 2XXCB 3HI6L 4KBPA 4AOFA 1GHFH 3KPPA 4YDLB 3JT2A 2V0AA 3BZFA 2NX5A 5TQ2H 3SQBA 5HVHC 1KJ2B 1CO1A 3ARSA 5C0BB 3MREB 3V4UL 3PF2A 4JM4L 3U6RA 4OT1L 2R29L 2BS8A 3NJJA 1CVRA 3CFMA 3KPMB 4WGKA 1KG0B 5JIMA 2EKSB 4ODTL 1CTNA 4M1GL 3DVNA 4GSRA 2ZF9A 4GYBA 4QXGH 4P99A 2YWZA 4FRWA 1DBML 3G6AA 3GSNL 3KCPA 4I77H 3EJZC 3JV4A 4N6RA 4QWWD 4XPFH 5DS8B 1XSOA 4NX0A 4Z18A 3UAEA 1IGIH 1M2OA 3GNMH 5ETUA 4PTTB 1SVZA 3O3EB 3NVQA 4ONGH 1CR9L 1KC5H 2G30A 3HC3H 4IHBA 2GBVA 2XWDA 3QJXA 2YGPA 2DYPD 3LZQA 1KJMB 1MCRA 1OT4A 3VRLE 4DGIH 1NMAH 5AAWA 4RZCA 3V4UH 1OM9A 2JIXA 1J5HA 4TL5A 3CIAA 1WITA 3GJFA 4W9FC 3V8CA 4PJIB 2OMVA 5CSZB 4LHUD 1HZHL 3WJLC 2PWGA 4WW2A 3CFIC 5AVVB 4BCXA 1S5IH 2PW2A 4WWKD 1MN4A 2WAHA 3FW6A 5GJTL 1TNMA 2NNXA 2CUIA 1JI2A 3LHPH 4U1NA 1NAKL 2OMNA 3ZYJA 2HT3D 2PP8A 3GHEH 4YHML 1G6RB 5D7KD 4MMXB 4NQSA 2X4SA 1A2YB 1UEMA 5TK4A 3LPWA 5E5MB 4OQTH 3AREA 2FO8A 1IL1B 3B7YA 4IOFC 1AXSB 1WT5C 1O5DT 3IFLL 5IB1B 3T2LA 2XWBB 3LDBC 1GW6A 4XNMB 1KWKA 1IKFL 3QCTL 3DETD 2XZAL 3P2TA 3V5HB 3UAAA 5DJXA 1UOVA 2MQ0A 2CDEB 4KKPA 1N4XL 2OYPA 3VXRB 1I8MB 2I60L 1KJVA 3PFQA 4XMPL 2HJLB 4F2EA 1UVQB 3GMPA 3IDYB 4RISL 4HIXL 3LNFA 4F33A 4I4WA 4PJBE 3DUUB 1TSRA 4KJWD 2EP6A 5JIIA 1IGML 4M9PA 4Z7QE 1FFRA 4NRXB 3WS3A 1G94A 4OIIH 1F6LL 1JZDC 4M5ZH 4UOW1 4Z76B 4O02B 4P2OD 3RVWD 4CVWA 2X4QA 4F57L 3QPXH 4WU5B 4X4KA 3BZ4B 2NNRA 3BE1H 3QSKB 1G84A 1BQHA 1MRCL 3EH4B 5AOKA 4BZ1A 2FQGA 3EF7A 3IDGB 2VITB 1AY1L 3PWJB 3RKDC 2VDKB 3FSWA 5HD8D 1H3GA 1NJ9B 2BSSA 3GB7B 3LEVL 2P24A 1UUNA 1KTJA 2D7OA 3H53A 4JB9L 3LN4A 1XSJA 2QSCL 2Y22A 2A5UA 5GIRB 3NJKA 4NQCE 3I9IA 5IMOA 5CEZD 1S3RA 2HMIC 1NIFA 4WEEA 2Y1VA 3NA9H 1PL3A 1VEPA 4ZOEA 4FEIA 4NBZB 4LSUH 4QRPB 3JWOL 4TVSa 3P3TA 1BREA 4JFOB 5J4MA 4ODXA 4FA7B 4OD2A 1FIEA 4WI0B 3JSSA 3V7AG 4BH8A 1M05A 1OSEA 2EACA 1MJUL 1A6VL 4L3AA 5ENWA 1Z9MA 2R4RL 3II3A 2AXGA 1ZLVH 3FFDA 2RA1A 4J8RB 4Y1AA 3ARUA 4JFHD 4QTHA 1MCSA 1HNGA 4NNYA 2YFNA 2CM5A 2ID5A 4MS6A 3BUTA 4TNWF 1BAFH 1F6AA 1JNJA 5K9KA 3HE7C 1I7RB 3M7OA 4OJCA 4R4ND 2UZIL 3SDDB 2WOYA 5TE4L 4YDNA 1N3NB 3KM2A 3I02B 3NOIA 3O3BA 1FH5H 4MNGE 4BK4A 4F9LA 3O8XD 5AB9A 4QRQB 3S96B 1CU4H 1TO4A 4MBRA 1ZA6B 5I1GL 5I1AA 3QBTB 5FO8B 1LD9B 4FQCL 4Z0XB 1ETZB 4KTDH 2YAPA 5D2LB 3VXOB 2KYIA 3NZ8B 2FJHB 2QHRH 2PO6A 3L7EB 2WTRA 5HYJB 2EH7H 3VM5A 5JYMA 1XVSA 4JZNA 2BRRL 1A21A 4QTIH 2XA8L 3QEGL 5DRZA 4D9QE 5IK3B 3MUGA 5EZLA 3UYRL 2VTFA 2CRZA 3QARA 4A1RA 4D9QD 3TJPA 4DEWA 3P11H 4FQXB 4GAJH 3M1OA 4NP4H 1HHKB 4FQQB 3NCWA 5A3IC 1PNCA 4HWNA 5DD0H 1BQHG 2WZPD 5B39A 1F02I 1EMTH 1UM5H 3AM8C 5GJSH 1CXFA 1WZMA 3G9VA 5KVMC 3WUWG 1I4FA 2VIRA 4MYPA 4X5WB 5FFLA 1TCMA 1T03H 1HKFA 1A7OH 3VSTA 3WDJA 1FG9C 3N2JA 2GJRA 4X8GA 3BVNA 3SGDH 4AQAB 4F37K 1WUZA 4JN2A 4MS8D 1NH6A 1UZGA 3MLVH 4ISVA 3ZQWA 1CXLA 3EYOA 3RTQB 5CCHE 1GGUA 2ZOLB 1HH9A 2IIJA 4E41B 4LSQH 2L7EA 1A6PA 5DJ8B 3VD7A 4FFWC 3ELQA 5F0PB 1UJ3B 4PJ8B 2DQCL 4KZDL 3MJ6A 1ZVHA 4K9JA 4FQQA 3GS4A 3TZVD 1TO5A 5LN4A 2FJGA 1RK7A 1KENL 1VZHA 1SYSA 5CCJA 3RU8H 3TO4D 3JQOB 4PJ5E 3RX9A 3GINA 5JR1H 4KOBA 1NBZA 1NANI 3PNRB 1KLFA 4TN9A 4GRLD 4HW6A 5I8EA 3WEMA 4J6RL 3S7GA 2X70B 1TJGH 2B4CL 1MFBH 4N87A 4JANA 1LE5A 5DWPA 4FG4A 4KJQC 4M7ZB 2H32B 2FGWH 4JQVC 3TBSA 4PJGE 3GMOA 3B8SA 4J3OC 2Q9OA 2CO2A 5I75B 1R3JA 5TD4A 2UWEA 1QBAA 4LCIH 1X4YA 4LEBA 4NQCD 3SGDI 2DWTA 4AWJC 1G7MA 1CLOL 5E6UB 1KCRH 3ZDXE 3QCUL 4KQ0A 3L1GA 5HGBA 3PJNA 4QRAA 5IBLC 2EABA 2EUXA 3TESA 3O2WL 4FNLH 1G9NH 3MBED 4U7SA 5EUKB 1BVLA 2EDHA 1ZSDA 3MR9A 4J3WA 3RFRA 5I6XB 4LRNL 1QUNA 5D70L 4HBCL 3V6OA 3CPLB 1QLEH 3ARGD 2COVD 1FNLA 3ZSTA 2Z31C 4X7CC 1ZGLB 2YLHA 3NAAH 1V7NH 1WCQA 1BPLB 2EIMB 1XCQB 2ZX6A 2X4NB 1OB0A 1QSZA 2QVIA 2ZYIA 1BZDA 5K59F 5GGVL 3BKCH 1C08A 4X99A 1RMFH 1EAPA 4OTXL 1GJUA 4W9ZA 2A9MH 5CGYD 1J48A 3QFJD 3UJJL 4UB0L 1WFJA 5AKTA 2DQGL 4J8QA 5FDWA 3PNWA 3HR5A 4QRTB 4DESA 4AVHA 2VERN 4UMGA 3AXLA 3VGDA 4APXB 1VB9A 3REVB 3I50H 3LZRA 2WKOF 2CGZA 2F54D 4NM4L 1T0NB 2NY7H 3TA3A 2FRGP 5T5NG 5E2UL 1DDTA 2XA3A 5F89B 3TPUB 5BUAA 4HWEH 1IE5A 3KGTA 3LS4L 4LCUB 5DVKA 2YRBA 4ZYKA 1CXKA 3KJ4B 1VLXA 5ILTH 1F5WA 4OCLC 3ARDC 4OFKA 5C3IA 2B0SL 4IMLA 4YUEL 1NLDL 4PAZA 4GI8A 4MXVF 3SKUD 3O8XA 4PTUA 4WZ9A 3QQNA 1KEGL 3FFCE 1YMHA 2FUQA 3QUXC 3QUMA 1TKWB 1DVQA 1T0PB 3GS0A 3QZWB 4RAUA 3ZKXB 1JK9B 4NZTL 4UIKH 4XPTL 2GSGB 3WKML 5C0RH 1RZKC 2XWTA 3BSZH 4NENB 4W9DC 4ZMQA 1OE2A 2BOLA 5E6SB 2CLZA 2J5LC 5AAMC 2J44A 5EOCJ 1A02N 2X2HA 4N90E 1VFUA 4KU1A 1GPOL 3VD5A 4X7SL 2VJ8A 5ID0A 5K39A 1YVLA 5E99L 3VXOA 3OR6B 4JLRB 4MQ7B 4CVZA 1KCKA 4MZIA 1ETZA 1ZS8B 1JF1A 4L1TA 3BKYH 2WB1A 4Q8BA 3LRKA 2E6QA 4JPWH 4MSWB 2E8YA 1OIOA 2ZUQC 1I75A 2ADJA 4FNTA 3WMSA 2HVBA 4QT5A 1B9KA 3Q6GH 4U6HA 3QJVB 3GKZA 2C9QA 3Q0HA 1IIKA 4A68A 1KIPB 1W0YT 1MFAH 3QFJA 4F91B 4UQ3B 2H1XA 1JK9A 5I0XA 4NB7A 4QHKJ 3HHSA 5K9KB 2NMSA 3H3BC 4XMKH 1YMHB 4C55A 2A4ZA 2SEBA 3WE6A 5ALBH 2FLBT 2FBOJ 2IALB 3MKGA 4HCFA 2VQ4A 1BEYL 2GJ6E 4OU3A 5D2LA 1A7NH 5AG8A 4L8DA 5BJTB 1TZGH 2YBRB 4M7LT 2XVGA 3ZYZA 4IRJD 3BVNB 1FBIL 4BQBA 5IEHB 1P4IH 1KJMA 3W11D 3PPEA 4IBLT 4P04A 5MERA 4JG0H 4OLVH 4WUUA 3PDDA 2NSXA 4J2XA 5I6LA 5DD1L 3MA7A 2GITB 3NIGB 5AW8B 1YQVL 4U1MB 4NGHL 2BOBB 2ITCA 4WSGA 4PS8A 2Z34A 5FM5O 3PWPA 4PPTA 2ZUXA 1OAYL 3VI4A 3WFDL 2VLJE 2ZUYA 4WFHE 4PRPD 2OMYB 5G2NA 3UPAA 3NDZE 1HXMA 3PGCB 4HUUA 2J8UB 2ITFA 3QDGD 1XO8A 4X5LA 1UZ8B 1DVFC 5B39G 1ZGLA 5C70A 3RFZC 2KC0A 3GLAA 5D7IA 2QR0A 3PJSB 1TOXA 2JB6A 4FQLH 4Y4FA 4GRWF 3MNVB 1U8MB 2C34A 3WO4C 4YE4H 1KBGL 2N7SA 4G5ZH 4G1EA 4M6NH 4QDGA 1NGXB 4QEGA 1FVCB 2GK2A 3II1A 4ENEC 2JI3A 4MWFB 1FV1A 4ZXBC 5CFAA 5CHNA 3BIKB 4K5PA 3BC9A 5CKGA 5TJWK 1T80A 3TEUA 3EYUL 4XCYA 2AJZB 3F7QA 1VDGA 4FMFA 5F7AA 5HGBB 2AABL 4XPAH 3VSQA 5A16A 3O9WC 4GRMB 4NQEB 5CBEB 5EUOE 1SXCA 2YQGA 4PW9A 2D7MA 2XY1A 4XVJL 3UBXA 3H8NA 1OP5K 3AACA 1QOKA 1YJDL 1J8HB 2IJ0C 3GXTA 3FT2B 1AXSA 4AIXA 4FQPA 4GQRA 4OZ4B 1HK6A 2G9KA 3R1GL 5C86A 3EDFA 2W0FB 3MFGB 4IJ3C 4KXZH 1LO3L 4DVBB 4CSSA 2FSDA 3L3KA 5E4EC 1IB5A 3DUSB 3OKLA 4YHNB 3KNBB 1ZDQA 1OAUL 1T7YA 1WAPA 4YOKA 2Z93B 1OOAA 3IDIB 1UVQA 2CK2A 3CFJA 4OSUL 2AXHA 3WNMA 1J1PL 4Z3IA 4F5CE 5IMOB 3IXTB 3GDCA 5HI3C 4G9FD 5IVNA 1A9BB 3F01A 1HFUA 3VQLA 3GMPB 2X7LB 4KNUA 1P4UA 3WD5L 2CIKB 4G7YH 4BKLA 4L29A 2H9GA 5D1ZA 3PHOA 4BZ2A 2HWZL 3N1FC 5C08B 4WV1A 4AJ0A 1DDHA 4MB1A 3RIFF 2EZ0D 3VFMA 5EO1A 3IYLW 3TF4A 3NIDF 3FCSB 1NA8A 1BOYA 2WBXA 1V3MA 4KROC 4J3UA 1AXTH 2FWOB 2ENPA 3V8OA 4IDLA 3TA3C 4RVBA 2H1PL 2QKIA 2Q76B 1IGIL 3GNML 5DJCA 1O6SB 1H3XA 4AEHL 2VLJA 5J89A 2G3XA 3GBML 4TUJA 4M1DH 3TBVA 1P0SE 1HL9A 2WZ6A 4HFUL 5D7SL 4PJCF 1Q1JL 1HOEA 1DBKL 3GUFA 3HG5A 3M17A 4NJ9H 1RFDL 4UI2A 1OAKH 5FYJD 4PBVC 5AWNH 1LP9A 2FJHA 3PHQA 4LSSH 1B0RA 4BSJA 1FZMA 1H8SA 4OJFH 4NUJA 1ODUA 1RUAL 3TV3L 1UCTA 1G9MH 2WLIA 4YDLC 2G3MA 4AGQA 4HWBL 1XZ0A 4UM9D 4PG2C 4NNPH 1Z9NA 1YEIL 5FGRA 3BPOC 4IIQA 2SODB 3ALWA 5I1EH 4L4TB 1MLCA 4OI7A 2DQEH 1SLUA 4MA8H 5DUBB 1HDMB 2BY1A 2OQJA 3DX7A 4G6KL 4KGLA 1JXJA 5EOCH 3VG9B 3WY2A 4O5LL 1XF5B 1DVFA 3KCPB 4NQED 5B1JA 1QASA 4YSCA 4K0OA 3VD4A 3UP6A 1A6UH 2E7LC 5IFHH 3LX9A 4D0BA 1CE6B 1NCAL 2Q7YA 1JZHA 3OB0H 5EU6B 1SJMA 2VW6A 4RFOH 4XXDB 4KJYA 4TUKL 3R0MA 3DMMC 4OCWH 5KBPA 2YQBA 4EI6A 4CMHB 4FABH 5IW6B 4HIHA 3WUWA 7PCYA 2NY0C 3MLWH 1G7HA 1VCAA 3N40P 1MY5A 4RX4D 4ADGA 1BAWA 2B39A 1PD6A 4KHTL 3L4TA 1EGJL 1KWGA 2DBJA 4JDVB 1CQYA 4XRCB 2IPKB 2K4AA 3BZFB 1RUAH 2WXGA 1HI6B 3G6JB 5IQ9B 1F00I 2PKDA 4JK0D 2Z1PA 2GBAA 4JN1H 2LT9A 3D69B 2KDYA 4KI5E 4PRAA 4L4TA 1M57B 3FCBA 3GI9L 1YUKB 2P8PA 1XR8B 2ZOOA 4QWWC 5BRZA 4I3GA 1XGYL 2RD0A 3MRPA 1IC0A 4BQ8A 1OPGL 4E9LA 1LWRA 4NNXB 1IT9H 4PUBH 5HYJD 2DQDL 1NCTA 2BLFA 5I9QB 2R4SH 2WB7A 4L8SC 2W0KA 4XWOD 3SDYL 2V5MA 1IQDA 4UOZA 5JPMC 4DCQA 3MROB 1P9MC 1PG7L 3CFKA 3BI9X 4HEPA 4RGNC 5AOZA 3LZNA 4G72B 3QUYC 1QFOA 5DEZA 1JPFB 3TVMC 1DBAH 4ODVL 3IKCB 1U8NB 3C6SB 1CFBA 1AIFB 2CDGB 1T5XA 5DMGC 1G0YR 1SN2A 3MLZL 2J1WA 4NKOA 2ZOTA 3WIHH 1F56A 1FVDB 3IFOB 5DO2D 1RZ7L 3CVHB 3D1MC 4UT7H 5T1MA 1FFPA 3QRLA 3BJLA 4PJEB 2DEYX 4WDIA 4L29B 2IV9A 1WHPA 4TXVB 5D1XC 4RAHA 2QQLL 3QIBC 2BRQA 4GO9A 4I2XA 1CXEA 3ZW3A 1CLYL 4AH2B 2XWBA 5DJ6B 4A6YB 4AGNA 1AZNA 3US1A 1DQKA 1BOGB 1A0QH 5FYKU 3P3YA 3VD1A 3D33A 5E5MA 3VFNA 4XN8A 2YPVA 1TPXC 3F7YA 1E90A 1CGXA 1QTPA 3ATEA 4OF3A 1LK3L 2CG9X 3NSFA 1E5UI 4HS6A 5FXCH 3W1ZA 4FA8A 5JDJA 3K46A 3HPLA 1DHKA 5FA4B 4HS6B 3V6OE 1AO7A 1KGUA 2W0FA 2CJSA 2TSAA 3IMRA 3OF6A 4UWQB 4YX2L 1AO7B 1S7WB 4ZSOA 2G5UA 1HHHA 4MNQB 2V3FA 3TBTB 3KW8A 3CDYA 1KLGB 5IR1B 3R4DA 4B60A 1TJHL 4U1JB 2AK1L 2Y0SA 4RBPK 3D4ZA 4FL4B 5CLWA 1FFOB 2AXFA 1AH1A 4JM2F 3LN5A 5I1CH 2NXZC 4H0GA 3DARA 5DJ6A 3RVUD 4A6YA 4PJEA 2DQIH 4AH2A 4KXAA 5DYOB 3HHRB 2EE3A 5GRYA 1PZAA 1QWNA 5F7FA 2VCOA 3V4PA 2D7TL 1S5HB 5I74B 1W9XA 3LRSA 2QPFA 5C9JB 1MEXL 3NK4A 3TN0A 4JZJB 1IAIM 4ONHA 1S7QA 1YEIH 1JTOA 1H3TA 1K3ZA 4Y7OC 5HXMA 5CN1A 4XMVA 2F1EA 5A3ID 4MCZA 3W0WE 2AHIA 3QC5X 2QLYA 3D39B 3QZLA 3PE9A 2OR9H 4R7XA 2ENQA 3T4AC 4GG6B 1VFMA 2E0PA 3Q01A 2OMWB 3D2UD 5BZDB 2WO2B 3BGMB 4GKOA 1WRFA 4P46D 1BFOB 4D7BA 1RZKH 1X6LA 1UM6H 4Y4HB 3QA3A 5DI8A 2J88H 1VPOL 1E9OB 3CTTA 4BWWA 4OQTA 2JKTM 5HP5A 4MZ2A 5BZWB 3ILQD 2DWSA 3SQBB 3MRDB 2R69H 5E8NB 5LWYL 5MI0B 1FH2A 2FWSA 4DP9X 2J5LB 3CXDH 2W92A 4EI5D 4LDLB 3GXDA 5C0CB 5KG9B 1YEDA 3GO1L 3GK8L 1TNNA 1YEDB 1UOKA 5L2JB 1QSEE 1YRKA 2WIIB 3DX8B 4FXKB 4G2AA 5JZ7D 1JE6A 4A7QA 1J1XL 1OTTD 1G7QA 2A99A 4KFZC 2O5XH 4L8DB 3MODH 4E0RA 2R2CA 3ZE1E 1B0RB 1MW1A 1SMOA 1B0GB 1VGEL 3KL0A 4Y4HA 3SDXA 5JW4Q 4IK6A 2Z92A 4G8AC 4POUB 5DD3L 4U2ZA 3KJ4C 3BKJH 4JDVA 3SEPA 4Y0GA 3V0GA 3NIFB 2Y69B 2W60B 3TF7C 4QD2E 5FGSA 3CE1A 3ZDZE 4KZEL 1AR2A 2UWEF 5E2WH 3WOVA 5LGHL 3IWUA 3O6LL 4AQ1C 3HZMB 5SWSB 1ZVSB 2X4PB 5F6HJ 4Y9GA 5F1OB 4KO5A 5JQ6L 4G6FB 3ZMRA 4WTWA 1JV2B 5TDNB 4JBSA 3QWRA 1WA0X 3KYNA 3P0YL 2JI2A 4JPIB 3L95B 2HKFL 4YSPA 3LVEA 3OQRA 4WDIB 2NT1A 3BDYH 4XOCA 4XC1L 4QRFA 4BCZA 3IDNA 4NO3A 3I9AA 1M1XA 4AMWA 4HGMA 2VLKD 3PHQB 1M3JA 4L1BA 1RULL 4JY5L 2PWEA 4AENB 5C0DA 5KSVA 3HFML 3V4VB 3GMLA 4DFIA 3IMSA 1DFBH 1U8NA 1SYVB 3IDXH 1IAMA 2NZ1A 3OKKB 4DIXA 4DP0X 3MYJA 3K4ZA 3OPUA 8FABB 2YMXH 3UAJC 3LAFA 3T5WA 3G5ZA 4WTQA 1MCEA 4Y4KB 2DJ4A 4LIQH 3A5VA 2VDPB 3L1OL 4BZ1H 5J06A 5T3XD 1OSYA 2K8QA 1UKSA 4MTMA 4M7JH 5IW3A 4XNXL 2F2HA 3CQQA 3U1SH 2XSKA 2R2HB 1T0NA 2F53A 5T1KD 3SPHA 3ULUH 3K0WA 2VSCA 5IJDC 2AXWA 5AB1A 3OKDB 4BGLA 3PDOA 2VN7A 1GJWA 1X5YA 3NSCA 4KQ3L 4EI5A 5D1ZB 4RA0C 1F4WL 2FGWL 3ARDD 2NY3C 1DJYA 5EOQH 5I0YA 1MJ8L 1Q4NX 3IMWA 3MBXL 3MNVA 5F1KC 1T22A 4NKOB 4PRDB 3EJSA 1EHLH 4UOQA 1WFIA 2DEWX 3MU3A 4ODUB 2WXNA 3IKCA 2ICWB 4FFZA 1ZLEA 2EDWA 2APBA 3NCBB 1G1OA 2LU4A 5IB3B 2B3RA 3BLKA 3VG0H 4ZMTA 4FQXC 5F44A 2J43A 5CWSB 4Y16B 1KFAL 4YHLL 5ITBL 2WINA 4AQOA 4QYAA 3WHE0 1T83C 4UT9L 1OTUC 3O2DL 3AW5A 2BY2A 3MLVL 4HALA 3V0IA 1SY6L 1F4WH 4Z78B 3RFZB 1HKLL 3B6SB 5IHZA 3P4OA 5I74C 4K7FB 4PLNC 1GYCA 3ZTJG 5FYLD 5JNYA 2W0PA 4Y4HC 2NYYC 4YHIA 2FX7H 1IBGH 5EU4A 4Z3FA 2AKRB 2ESVD 3GSNA 3RHWF 1J5DA 1XD0A 2DLGA 3WIFA 1R34A 1OE3A 5AVTB 1BZQK 2FT7A 4KZDH 3EOTH 4YNYA 1NANH 4K2UL 5AEAA 1LP9B 3CVDA 4OZIF 5T3XE 2LU5A 1RZJC 3M17B 2VH5L 4HV8B 2NY1D 3QXAA 5F8RC 3WIHA 4R7DB 1KBWA 2DRUA 2BVQA 3Q2CA 5IEKA 4XAWL 4XVSH 3N85H 1OCZB 1RULH 4FTVD 4JY5H 4I2XE 1MH5B 4TUOA 3TNMA 3D9AH 2XN9E 3I74A 5CJXC 5C6TH 4M93C 4DGVH 1E4JA 1ICTA 3F58L 4Z6AT 3CZNA 4U6HB 5EOTB 3TFKC 2VLRD 3NMEA 1T3FB 4DN3L 3NYKA 1UH4A 2DIEA 1EV2E 2LR4A 2X9WA 4Q6IB 5FWRA 1HILA 3UJIH 3TZVB 3OB8A 1OGSA 1HL8A 4HAFA 4WO0A 2WZPA 2AF2A 2WXHA 3CZEA 3A4DA 4I18C 2XVBA 4OIFA 5JDSB 1PG7W 1EFXB 3RTQD 3MGTA 4F92B 4I13B 2X6BA 1FJ1A 1E5CA 3CZSA 2YN5A 3LNGA 1LK2A 2PABA 3UG3A 1U3ZA 1TTCA 3EGSB 4M7LL 2DY2A 2DQUL 3X13B 1AI1H 2WGXA 1C5DB 5EZPA 4M62H 3ULUF 3MBWA 1CT8B 4G7RB 1S78D 1GGIL 2D4DA 3T4YB 2VN5A 1A7QH 4AVIA 4OJYA 3CHOA 4TLKA 4TVUA 1EXUB 5F0LB 3ILPB 3FQ2A 2Y24A 5AYQA 1H6UA 1MCOL 4NQQA 4YVUA 2GQHA 4HCRA 1MJ7H 1F8TH 4L4TE 4MCNA 1I1CA 3MBEB 4GJTB 1QPPA 3FDWA 4Y5YA 3ZTNH 2O72A 2F61A 5F9WB 2OAAA 2UV3A 4JY6B 1LD9A 5E00A 3L2MA 5CBEA 4YEEA 3L2LA 4L4TD 2VLKA 3KYKL 1PKQE 2HKHH 4KWUA 5D2LF 1WA1X 1NBVL 3L3JB 5GS3A 4ZW3A 3ZVVA 2CE6A 3TP4A 3V4VL 2XN2A 3MJ8B 1MHCB 3ALPA 5E9DE 3KYOA 3A6CL 4MD5B 5HPOA 3MV7D 1OGAD 2MOVA 4XC3H 2VDQB 4ZNEA 3MA9H 2HH0L 1HHGA 3DYOA 5LAXB 5E70A 5IHHA 3TBCA 2V5YA 3HAEA 5JW4N 4W9IC 1IUZA 4YAQB 4R4NC 1QMUA 4AI7A 2XTJB 3B3BA 1YAIA 1IMHC 4XMPH 1HXMB 4JUSA 1HL4A 3O8XC 4YDVA 3D52A 4M7LH 1GCYA 5J12C 3V4PL 2B3IA 5C6PB 2IQ9L 1WFUA 1VKXA 3C5ZD 1OEZW 1O75A 1ZSDB 5FUOL 3VXME 5IHWA 4E9SA 2BFVL 4K7PH 4JR9L 4LNRB 4JFED 4WCYH 4POYA 2I07B 1U3HA 5L0QC 2MTPA 2P8LB 2F7QA 1RIVL 3UZVA 3VRIA 3LKRB 3AABA 2VN3A 3HMWH 4XMZA 3WHXA 3UH8A 1U92B 2A6DB 5JOEA 2Y2TA 4ENED 3CFBA 2MKWA 5E8PB 3PG2A 3KPSE 3FS9A 4FKHA 3DPBB 2H26A 4LZKA 3RP1A 1UURA 2Z91A 4YX2H 1MQ8A 5T1LD 3WIHL 3KXFB 3PWPD 4HK3N 1G7LA 1QFWI 3HB3B 4RISH 2Q8AL 5KW9H 4XO5A 1GKEA 1NICA 3Q13A 4K3EH 3ZKND 2B2XH 4EUPA 2Y2WA 4OBSA 3HC4L 1OT2A 3BDYL 3GXNA 1EO8L 3RPKA 4DZ8A 2HLEB 1V3KA 3MR9B 3SDAD 3TN0D 3W3BA 5A2CA 3D3VE 3MOQA 3RL2B 2KL6A 1NM4A 4AGLA 3W11C 1DJHA 1T1ZB 4FCAA 2VR4A 1ED3B 3QUYB 3CN0A 43C9A 3QO0A 4ZPVA 1X5GA 1D6VH 3FT4A 4ZMNA 1E7UA 2KZ1B 4NN7B 3BUBA 5ANHA 2HG5B 4PEEA 4Z7OF 3G04B 2W07B 4GMTL 3N85L 5F21B 1M7IB 4P5KB 3EYFB 3BYYA 1ACXA 5CEZH 2GC7C 4L3CB 1JYXA 1PEWA 1FH5L 4BA8A 4N3UA 1I9JL 3TIEB 4GIPD 1NOAA 3FB6B 2NQ3A 5T1KA 4DKAA 4OW6A 4UV4H 5ACMA 2VDMB 1XGUB 5I0ZA 3DX0A 1MCHA 3TA3D 1BZ9B 2XTJD 1MAMH 1KCLA 2O5YH 1B4JL 2HRGA 3MOBH 4UNIA 5C0JB 1P5UC 2VLLA 3QZOA 4QT5B 1PEZA 3RAJL 3APFA 3EOBA 3MGTB 4CNIA 5I1HH 2LW3A 4JFYA 4KRLB 4ELDA 1GAFH 1IM3A 2FH8A 5DWUH 3NJMA 2EH8L 1D7FA 5D4JA 4HDIB 3BKML 4MQ7A 2V2TB 1L9SA 1OF2A 3J27A 3SDDA 1Z3GH 4OAWB 5TFSL 4MAUL 2BIPA 2AK1H 3QDMA 3G3LA 4K8RH 3VXTB 1MCCA 2W9DL 3WMQA 4BUGA 2CRMA 4CVXA 2R8SL 3G5VA 5C0BD 2IOIA 1ZRUA 4KMLB 4K7FA 3NQKA 3BAKA 4J1UA 4OF7A 2Y6SD 1NBVH 1QKZH 2EKSA 2YPKA 3U25A 3GKWH 3WS6C 3T2PA 3QZWG 3ISYA 1ACZA 1U8JA 1B2WH 1ZHLB 4H5SB 2FJSA 4L1HA 4ORZC 4PTUB 3MLYL 4KJPD 4DGYL 2Y5TB 5AW4B 5HYJA 3EG9A 1SDYA 2X87A 3DJTA 3TEWA 4P2RB 4FQ2L 1CFTA 5IK3A 2YD4A 1BLNB 2B7DT 3VMPA 4DEUA 1CLYH 1F42A 4NDMA 1KB9K 1HIML 1HHIB 4ZQTA 1U8LB 2YD2A 2F53E 3NSJA 1OAZL 3RWDB 3OWRA 4W9CC 3ULVH 4JRWA 1I9JH 3R8BB 3R19A 3C2AH 5I9QC 4PJIE 3WFCH 2CCWA 2GKIA 1F4YH 2AERT 2QPDB 2Y72A 6TAAA 4FDWA 3CCHB 4CA4A 3WE1A 3I9GH 4Y2LA 1RK0B 3QUGA 5DDHB 1OSZB 3QAQA 1RK1B 5JIPA 4A2LA 2ERJB 3U6XA 3HZYB 4LPTA 2VDLL 3N1GC 4RFEA 2NW3B 4XN1A 1X4XA 1HESA 3B1UA 1WGOA 1AAJA 5IWLC 3DDFA 4KI5C 5FPIA 4DKDC 1WO2A 3B9VA 3N9GL 5HI5C 3BZ4A 3FO1A 1RZ8A 4ALAH 2CDFA 2Y3NA 3MV7B 5C2BL 5K9OA 2VDNB 3FU0A 1DJXA 3HG2A 3L9RA 3LPOA 3O41B 4LHJB 2G5BB 4V33A 4AYID 1U3HD 3VMNA 3RJDA 3MRCB 1H5BA 1KY7A 4HWZA 2E4FA 1F11B 4HUXB 4LP8A 4QMEA 5CR1A 2CDEA 2ICEB 2KT6A 2GPZA 4MMZA 3QQDB 3AGVA 4KKBC 4PB0H 1JXGA 3BAIA 1AG6A 4R4FL 4WI6A 5DVOA 3QZMA 2EAEA 1TTBA 3SKOB 4FXGC 2EC8A 5E2WL 1ET8A 1CWVA 1LILA 1SXSA 3ARFA 5EF0A 1DP0A 2OL3B 3O9WB 2WXKA 3MUHL 5ESVA 3VXSA 3ZDXB 1EGJH 1XMWA 1IAIL 1IL1A 3AY4A 3QIBD 4F7CA 3EADA 2YSSA 3CHXA 3MV9A 4NCC1 3S35X 4OLUL 1YNLL 3WS3B 4NBXB 3U7AA 5ABZA 1NFAA 4DUXA 1XCTB 3FUMA 5C0AA 2QQNH 3QNZB 3BWZA 3ARWA 3C09C 2MPVA 4WRLA 1NGYB 4H26B 1H5BC 4Z77A 3OJMB 5D1XE 2VW4A 4B0MB 4I0PC 1I7ZA 3KPQA 5FCUL 2KZWA 4Q58C 5DURB 5FO7B 4PJIA 4X7EC 4HJTA 5D93B 4CADB 3U7YL 1IM9A 4KGJA 3VYPA 3WIFB 3HJEA 1IBDA 4FLRA 4AQEB 2PR9A 1UH3A 1ACYH 1Z3GL 3S96A 4XCNB 4HEMA 3BVWA 3QWQB 2YAOA 5D7JB 2N7BA 3H4FA 5JIKA 5LXVA 3UC2A 4TLUA 2GTZB 3S34H 3P1VA 2J6EH 1FYTB 2ZONA 3FN9A 1G7JB 3DIVA 2BP0B 2XPYA 4HIEA 3IGUA 4Z78A 4PS3A 3RFZA 1I9IH 2ATKB 5KYYB 1CURA 3CFDA 1GSKA 2WQAA 4X8JA 5AVRB 3TNMB 4ZAKB 2Z7YA 4NCC2 2AW2A 1T3FA 1HOCB 2CRYA 3DVNB 4JM2D 1W72L 3GM0A 2NR6C 3QI9C 4FKEA 3U4AA 1I9RL 4CRPA 3OPZL 3EDEA 1T83A 4JREB 4APQA 2DIAA 3H2WA 5E2VH 3SGKC 3APCA 3A0OA 4TVPH 2Z65C 3D39A 4R90L 1RH8A 4MAUH 5CP3A 4JFOA 1ZT1A 3X11B 2J6EL 2QVKA 1A1NA 1RU9L 4NJAL 2XZQH 2XWRA 4YXLH 4LLWB 1PSKH 3GUTA 3AT0A 1CXHA 5I1AB 4A04A 2Q6WA 3V79C 1CB4A 1NDGB 3L5WA 4H25B 3WXWL 4XTRD 5EWIH 3MRDA 1E43A 3BQUB 2BNUB 5CZKA 4DOHE 3HBPA 1RHFA 1U8CA 1FN4A 2AS5M 1MF2H 4I3SL 3L08A 4X5PA 5HY9B 2A9NH 3NIDE 4MDIA 4JHWH 4R4FH 4YE0A 2YXVA 1BZEA 1O9VA 4M43H 5HD8C 3OKYA 5E6ID 2DI7A 2HLAB 3MRRB 2EVFA 1VF5C 2HRPL 5D55A 2WCGA 1UB6A 3QWRD 4HEPG 4OGYL 3S3BB 3WFHB 2N1TE 5DJAB 3OAYK 1A9EB 5DJ2B 1BA9A 3L16A 4A67A 2J4WL 4DO5A 5DJYA 2K45A 3AS1A 4OQTL 4HJEA 1KV3A 1TR7A 4UT9A 5H37A 3BAJA 2FO4B 4UTCA 3RUGB 3Q2NA 4JCMA 4AENA 5GZOC 2WXPA 4Q74A 1PJWA 2NX5B 1UUSA 1XR9A 4S0TD 1CL7H 4EN3A 3TT1H 3OHXC 5SWZE 1REIA 3RVTC 4AGPA 3AY4C 2GYSA 4W9KC 4S2SB 3D12B 2IH1B 2CBOA 3H55A 2E27H 1IIIA 4JN1L 5I1JL 5IVXB 1CDHA 5GGRB 4LCWE 3ULVE 1DCLA 4K2UH 4FQLL 2J56A 5D96C 1KZYA 5HVWA 5D7LB 4EKJA 2A6KB 3IF1B 3O0RH 3QUML 3R18A 1BDYA 4UDUB 1A7PH 1U8IB 4N8VA 5F96L 4IKIA 4X4XA 3MV8A 4LHUA 2VAJA 5KAQF 5DEJA 1NIDA 3K6OA 3MV8B 1A5FH 2MHAB 4JFDB 3N50A 2FJUB 4I87A 3BP6B 2X6AA 5I76A 5L9DL 4HZAA 3ZRSA 2PW2B 1JS4A 4IEFB 2DMBA 3O6KL 2R56L 4AJYV 5LLIC 2C7FA 1F58L 3GZOA 2HJLA 5EG6C 3SOBL 3WIIL 3PS6A 4EUPH 3V5KB 2AVFA 3ME0A 5L2KD 1D7BA 2NSMA 2I9TA 1T0OA 1U2CA 4JRYD 4NZFA 1DANT 4S2SA 4ZTEA 1HXKA 4E9XA 3VXMA 4GAAA 4QLWA 1X5HA 3AMLA 2WNXA 3OB0K 2RQ8A 2ENSA 4KFMA 3SN6N 4V1DA 2ZAGA 2GJJA 4LLVA 4Q2ZA 4AJWA 3S8GB 4G6FD 3MLUL 1R3LA 3FZUC 3NFNA 5H94A 3SQOL 5IVZA 2VDNL 4Q56A 3EH1A 1RJZA 1A2YA 2ZJSL 5KBMA 5ICYB 4DP2X 1AP2A 2WVTA 2WSKA 1VGKB 1RP9A 1S7SB 1I9EA 2LV4A 3D6GA 2D0HA 3GTNA 3BP6A 4GBXA 3ULSB 3C6SA 3ARGB 4Z95L 5I76B 2JJTA 4MXWH 2VR5A 4QLRA 3ZN6A 2BWQA 5BQ7A 5LAPA 4BRJA 1L6XA 1X7QB 2K8MA 3HG1E 1IBBA 5GS1B 3ILEA 4GO6B 2GEQA 2DI8A 1JWUB 1BF5A 4AUJA 2P5WB 3O2WH 4FNLL 3VB9A 4TNVK 1U3JA 4D7PA 5DJ0A 4HUNB 4Z7OB 4J4PD 1JPSL 4LFHG 5J11B 2HWZH 1PAZA 1I8UA 1OSPL 2IEPA 4OCNC 5KZCD 2ODIA 2PP7A 2X1PA 2F6AA 3F7KA 1MHEA 3VGEA 3QS2A 1OTUD 2RFXB 2BC4B 4FG6C 4AYFA 4NI6A 1GJIA 1Q1JH 8PAZA 1QQDA 1MLCB 3AU1B 4OKVB 5GGSY 1MCNA 1MW3A 2F08A 4LVNC 3OX8B 3TJHC 3NN8B 4OZHB 4IS6B 3GWJA 1TJIH 5HJDA 3TEYA 3PUCA 4X0NA 1D6VL 1SEQL 2R1WA 5E8NA 4UOW0 3GZKA 4H40A 4FEMA 4LSDA 4DPBX 3E3QC 2ZYHA 4GQ9H 5T1DH 3FJTA 2Q7YB 1G7HB 1JWUA 4Z7VE 2AJUL 5J6GB 5CZRA 3VE0B 4DGWC 3FTYA 4OZIE 3ZYIA 1EO8H 2BZDA 3K4DA 2JMRA 2XQYG 4H20H 3KPPB 4CC1A 2Q5BA 4ANKA 1N8ZB 4TNEA 1V27A 3QG6B 2CH8A 2BNUA 5EO1B 1SVCP 3WFCL 3DROB 3BUYB 3L5WB 1JUFA 5CZXC 4PJXE 4P23D 2X53A 3LQMA 5AW9B 5FX3A 4PJHB 3TCTA 1MJJA 4F8TA 2VE6B 4IYKA 1UWGH 2H5UA 4BD4A 4F7KA 5KS9A 1FHNA 1AR1C 3QHZL 4HT1H 2VDML 2K7QA 1IVLA 1KGJA 4RAVB 5TE7L 4QRSB 3HNSL 2ZXDA 4Q9QL 2AV1A 1FL6A 2FEEI 4PRID 5E8OB 2NXYB 2R1XB 2VJXA 4YDMA 1JPTL 2YN3A 4RESB 5I15H 1JDAA 5IFAL 2XIBA 3D51A 2CHDA 3TLRA 1S7RA 3QUZA 4HD5A 1S7XA 1Q0YL 5FYJL 3KE0A 5JOPD 4DCQB 2BSED 1NUDA 2EXWD 3IXAA 1MCQA 1AZBA 3Q5TA 1LQSR 2HRHA 3CVCA 3KW7A 1EHLL 1G1KA 1DR9A 2YKLH 3KDMB 4GRLB 3JTTB 4U6XB 1QA9A 5F9JA 4R7NB 4U3XA 2ZXAA 2ZT9C 4FABL 4TL4A 1CGSL 5HHQB 2ZX9A 2VO5A 4GEJA 3AG1B 5GGTL 4FFVC 3A6OA 3QEUB 3T09A 4YS4A 3RAJH 2KH2B 1KDJA 2BSTA 4IBUA 2CDFB 5DD5H 5IMLB 3WYRA 1E5AA 3NA4A 5I1LA 1JVKA 2IPKA 2E46A 3O41A 4F93B 1DJWA 3MRLB 5DA4A 2NPLX 5EORH 1D5IH 1OCWH 1XTLA 3L9RB 4AE1A 2J73A 2F7PA 3L4ZA 1A6AB 2VXSH 3DPDA 3NACL 1R47A 4JO4L 4Y4FC 1BAGA 2EEDA 1IILE 1QO3B 1GS6X 1TVBA 2V2WA 3Q6FA 1X5FA 2ZSVB 3ZTCC 2CUMA 3O6KH 4JJ5A 2NY4C 2BVPA 4MLSA 1YC8A 4G8GE 4RMBA 1IEAA 1FPTL 2VDOH 3P0VH 4JRXA 4HGKC 5D7SH 5F9AC 1NCWL 2ZKHH 1YN6B 2R0KL 4PV9B 4FF9A 2O5ZL 1CTOA 1OHZA 1JPTH 5DMIL 2OSXA 3TVMA 4U1SB 1X9UA 1BXVA 2GY5A 2QQNL 2EJ1A 2YPVH 4KMQA 3TWCH 3STLA 1SEBB 4ODBD 5EU3B 3ZL4L 3MRCA 4N68A 1MJ7L 5MEOA 3OHMB 3TIDB 1IEHA 1PG7X 2ADIA 3T0EA 4AM0Q 2VLMD 3MV9D 5HHMD 3QXVA 3PGFL 3WKPA 4WW1A 4ZX3A 2EC9T 1O7DE 1C12B 4PRIB 4MKTA 1YHPA 3D0LB 1DBBH 1EX0A 2DBLL 4ZS6D 3GHEL 1EFXD 1ZK5A 3KPOB 3SKJH 2JQZA 3NFSH 3RUGF 3IPFA 3KXFD 3QORC 1YG9A 3ECQA 4IIZA 3P9MA 1J1PH 5GRXG 2XDHA 4MD0A 5T33H 3F2LA 4X7TA 2YD8A 3BISA 1QVOA 1S5IL 2VC2B 4PY8I 5L8LB 1J05B 4GG6F 3K4AA 1A7PL 3MKKA 4C59B 2F8VA 2B9BA 3R8QA 2VH5H 4ETYA 4NM4H 1KYOK 3TFBA 5D2NA 1RLBA 4U6TA 4ANWA 1U8KA 4LVNB 3UYOD 1JAEA 1NUFA 1KSRA 1X5LA 1DJGA 3PHOB 3Q44A 1TENA 5AB2A 4OFYD 5D7KE 5JLZB 1PX3A 4WV1C 4MNHA 2BFVH 2DJMA 1U8PB 4ZW7A 2HPTA 3FHAA 3SO3C 1BF8A 1R5WB 4Y9EA 2XA8H 3VFWB 5MENB 2NRDA 2D7QA 3QUZC 4WY7L 2RBLA 4YHMH 2ZICA 3VRJA 2VWEE 3IXTA 4CNIB 1RUMH 2AITA 5FK9A 5JHDD 1U9KA 5T33L 5CN2A 1NCWH 2ZKHL 4PJFB 4OQ1A 1VPOH 1G4RA 2XWTB 4R6UA 5C0GA 3SCMD 1Y1UA 1GTFA 1H0DA 4ICXA 1E2WA 3SJVB 3LYRA 2GB2A 3IGFA 1BYNA 3C2AL 3EYSH 3UEQA 5FW8A 4AV5A 4DP4X 3K91A 5K9JH 1EZSA 5IM7A 3SDYH 4LSPL 4TLTA 3PWNA 4IMLB 1G9EA 4L18A 2IAMD 1HVXA 1YPZF 3PQYD 3ZZ1A 2QGBA 4QHUB 4JHWL 4GKZA 1IBGL 3GJEA 3F12B 3I6SA 4DQAA 4A63A 5B3SB 3ILDA 3WXVL 1IC5L 1AKJD 3UMNA 3FSZA 3MMEB 4DPAX 5FDWB 1G9HA 2ESVB 1INQB 5IWLA 2FECI 4DKEL 2XG5B 2EEXA 1FGVH 4BFFA 3G6DL 5ISZE 5E6IA 3WDIA 2B4CH 3OZ9L 4MDRA 1NCDH 4K94L 3LKSA 3IRPX 4OM0H 5C07D 4N0RA 1E6OL 4XNBA 1G9ML 4O2EB 1BM3L 3KBHE 2GJ6A 4X80H 2EEBA 2APWA 2EDNA 1LO4H 2IQAB 3KL3A 4HBQA 3KS0J 3DHMA 2OV0A 3BPCB 5I8KH 1JZ8A 1WIPA 3V6ZB 3CXFA 2K3HA 1KIRB 2WVVB 5HDOA 1F58H 3AM8A 1I1YB 2FVNA 5JOPE 2A83A 2OMUB 3UTSB 3U0TA 3PWPB 4UNVA 5IFHL 3FB7B 1NPUA 1MRDL 2ITCB 3ZTNL 5JOFA 4W6YB 4ANUA 4OLUH 3S34L 5KUKA 5CCKH 4OZFB 3EBIA 1MLBB 4J6RH 4NSKA 5F96H 1A1OA 3WNIA 2VOTA 3LD8C 3POCA 1GOHA 3SKNB 4BZ1L 3V0AC 1XBDA 3GYRA 1HHIA 2UZXB 1JNNH 4Y4FB 3S88L 4FMKA 4ZX4A 2D2CC 5AUMA 4EKXA 3O6FD 3JWNG 4HLJA 1NSNH 2ZUVA 5FCUH 5ISZA 2XU9A 5DVNA 4MX7B 3V6ZA 2F74B 4ZMXA 3TFKD 3VJ6B 2EQDA 4PJIF 2HT2C 5GRJH 2YUWA 1H3VA 4MQXD 1RK1A 1U4FA 2HP4A 5FYJE 1LEGB 1IFHL 1MCKA 4BBWA 3X1NA 2VZOA 3H2PA 3U83A 2WZ5A 2DQDH 3I3EA 2EINB 3FQTB 4JGJA 3LXCA 4MA7L 4TF4A 3L1FA 3VI4B 1U4EA 4LCYB 2QL1A 5DHVA 4GKNB 5CD3A 5EIVA 5MP6H 3H3KA 3W9DB 5E1AB 1U3HB 2CJ3A 5KAQG 2BP8A 4HETA 4P5TC 1CI3M 1G7MB 4AYSA 4X6BB 3RZCA 3JVFC 5C0NC 2OYMA 3RZWA 3GRWL 4KOCA 2X1OA 1OY3B 3QQ9C 4X6CA 4QTIL 4F8LA 1INEL 1PY9A 3VRLF 1JYWA 1ZJBA 3P0GB 2WYHA 4OFQA 3EHBD 1N0LA 3SKMB 2UY7B 3ARFC 3HR6A 3H42H 4LU5L 3GRWA 3B83A 4KHTH 4FQJH 2EC9U 4Q97A 2M2DA 1L5GB 3Q2LA 4JRXE 1PSKL 1CR9H 1KC5L 1LO5A 2R59A 3DSNB 3OD3A 5H37G 3RVVC 2FJGB 3DV6B 4OH2A 2PTUA 3KPSA 3KVPA 5TK2A 2CO7A 2I25N 4RFOL 3NCJH 4GSQA 5CIPH 4P5KA 4YSQA 3ZDYB 1I3UA 4XWOC 4Y88A 3QNXB 5F6IC 1H15B 3DC0A 3VWKB 4B5EA 1S7VB 5F89A 3IJHA 1F18A 1VENA 1VSCA 2OI9B 3WKQA 1OE1A 4M43L 3IRCA 1UADC 1KY6A 1F4YL 4EDWL 1KCBA 2OK0H 3C60B 3HLAB 3UO1H 4BKLB 1Q72L 5CGYC 3NIGF 1N19A 4N2KA 1WBYB 1WJ3A 2CJUH 2XX1A 3CZLA 1I7RA 3QG7H 1BD2D 4RAUB 1J9TA 4XWGL 4DHLA 2EH8H 3V10A 3K6DA 1PLAA 2HTLC 2YC1B 1WVZA 5HDBF 4OCWL 3SKMA 3VXUD 5IQOA 1GY2A 4P23A 1KPVA 1WS7A 3CZFB 2PCPB 1X44A 3ASOB 2Q3XA 4K07A 3FF7A 4AMXA 2O6EA 2R39A 3RL2A 2HX8A 3AC0A 1OGPA 4L8BA 2COQA 5EIIB 4E9RA 4Z0XA 1OKEA 3VNZA 2FX9L 1A5FL 3BFWA 3CUPA 3P9LB 3UZQB 5IIEA 5DTFA 3MC0A 5EU4B 4JL2A 1KB5B 2GJPA 5BVJB 2HT3C 3G04A 2NW2A 1HN1A 5FGCE 2J8OA 4Y16D 1MXGA 3IMTA 3TASA 2Y9RT 1MFNA 3D0VA 2FB4H 1NLBH 3SE9H 3WTUA 2BVUA 2JK5B 5GRWA 5ICZA 3MNMA 4EIBA 5D5MA 3SGJA 3DRQA 4EZKA 1E27A 1MQKH 3G5WA 4XNZB 1HWGB 5EC2A 5D1ZI 5L9DH 3FRPA 3BPCA 4EOWH 2OULB 2C9UA 2DQUH 3D18B 2HUHA 5J1TC 1RI8A 2WLZA 3SBQA 1XT5A 5DU7A 5HHOA 3BH9A 4Y1AB 4XX5A 1PF3A 3FFDB 4J8RA 3BH9B 4IRZA 5E6IC 5TF1L 3P3RA 3ZYOA 1FO0A 4YAQA 5JW4R 3FU6A 1DBAL 2JLPA 2WJ5A 1KCSL 4QRUB 2XBDA 4MNQD 3V0VB 2XG5A 3QZPA 4PIBA 1E67A 3CLFH 4UZGA 5GXBB 2VDRH 4LKXB 3EJCA 3QJHA 2QQLH 3HJ0A 4GKLA 1K2DB 3O6FA 4JQIL 4PJCA 2O93L 1UTDA 1QX1A 3SKNA 5IQMA 4FLSA 2AQRA 4EI5B 2WBJA 3B2UC 4YL9A 1LXMA 2F7OA 3KHQA 2EUZA 4F27A 1A3ZA 1TTGA 4PLJC 4ELMB 5EN2A 1R3JB 5G55A 4Y19A 3LS4H 5DQ9B 2VLKB 4P2CG 4MAYC 3FB8A 4UYQA 4KTDL 2XTLA 5F7NC 2H32A 4MNGA 4B95C 4GRWE 3L6FA 3U0TB 1ORQB 8FABA 3V0FA 4NQDD 3OGOE 3AADB 4R2GD 3NBNA 1UEYA 1QO3A 4TQEL 4BHUA 1BD2B 3Q8FA 4OD3H 1S9WB 3QIBA 2OR9L 4FYTA 1ZAGA 1ODAA 2LHAA 3QW9A 3KPNB 3TBWB 2EIZB 1C9SA 1RPUA 1MHPH 4FA6A 1L7TL 3O6ML 4GRWH 4N2IA 4PUBL 5CS7A 3MRQB 3SE4C 4AC2A 5I26A 4XNYL 3MLTB 3QUKB 5GS2H 1UOLA 1YY9C 3FQ1A 3U4BL 2YZ1A 2D7TH 2Y25A 1I1FB 1KJVB 2VN4A 2BCMA 4XNMA 3UMTA 2ARJQ 3H2QA 3I9GL 3N43B 3PDGA 5BQDA 4ISVB 3BPLB 4MHHI 1PDKA 4LCVA 2YRZA 3KJ6H 3UADA 1WAAF 1YECH 4ZO7A 5IB2B 1FGNH 1KTLB 2BNQB 1BWWA 3ULUE 4EZMA 3N04A 4X6EB 1EHNA 1QRNB 1Z6JT 4FADA 4W93A 1BZ8A 4KXCA 3TH4T 2QPSA 4UINL 4G80A 3T65A 3KPSB 5EZIL 3LKPB 1J05A 2H7WA 3IB4A 3EUDA 1XGTA 1ILSA 1JXDA 1RFDH 4PY7A 4XAKE 3AQDA 3AREC 1JL8A 4ZK8A 4KQ3H 3KG5A 3ZK0A 1GGCL 1BGXH 2XVLA 1KCUH 5IHUH 3MCKB 2JCCB 4ZUWA 3AB0B 2O5NA 4WI7A 4OF6A 3NCJL 5H2BA 2VQTA 5F0MB 1CCZA 3BUIA 1NBYB 3AS2A 5LXGH 1U8PA 4JFDD 5EOCL 4LPUA 5FC9A 3IDJB 1N2RB 2D31A 1RIUL 3FT9A 5C7XL 2YUZA 4PLKC 2CJUL 5MENA 4G7VL 4MJ2A 4P8QA 4YHIB 5LG1A 1DEEB 2R1YA 4D8OA 5FUZL 5E1HB 2YRLA 4L4VB 4KDVA 5JPNB 1DN0A 1PZSA 2ZE0A 5BXFB 1BX2B 3ET9F 4N0CC 4Z7UF 1KNOB 4LT7A 4F8OA 3QA3B 5HI3D 4JGUA 4JO3L 2LLGA 5C0CD 5ES4B 3B2MA 3OVUB 5M7QA 3RGBA 4YZFF 4FFZL 4QYOB 2GG1A 3P9WB 4R7DA 1A4JB 3ARED 3MOBL 4PJDE 4WU5A 1JP5A 2CUHA 5FF6B 3VI4F 1F3JA 2CMRL 4DK6A 1UM4H 2Y6SC 4P9HL 5E6ZA 3HZKA 3OJVC 2VXVL 3CH1B 4DN3H 2EDTA 4XP9L 2A0LC 4Z5RB 4YNYB 3U9PH 4OZHA 4NFBA 1IC7H 2PNDA 5FUCE 5CILH 3MCG1 4AIZB 1TMCB 1USQA 5JXAH 5CUSL 3HMXA 4N9OB 3IDYC 3FBKA 1FRGL 1T89C 1I1AA 3QI9B 1EWHA 3N6YA 2BSCA 3GI8H 2RCSH 3LXUX 3VX1A 3BESR 1Z5HA 4NWTH 3FB5A 1CFSA 4ILDA 3PP3H 3L3IB 4IOSA 1UENA 5HVFB 4MGXA 1T7VA 2OMUA 4WHYH 4ZRGA 1ROWA