1U95B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldhwas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u95B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u95B01
3LZFH 2BNQA 4XNMB 2DQEL 4R8WH 2NW2A 5E6ID 4KTEH 1E28A 4GS7C 3QUMA 3DUHA 5DZNA 2NX5A 3T8XA 1FFPA 2EDWA 4RFOH 4Z7WA 2CRIA 5C0RL 2HH0L 4ZUWA 4POUB 4IDLA 4PS4H 4G8EA 1J5OL 4N1EA 1NGXB 5DFTA 4DQOL 1JYXA 2JIXA 3CLFL 3BRGC 2ERJC 3BSZH 3SKJL 5ACZA 4M48L 1DBMH 3VFMA 1JK8B 1HHIA 2IANE 1T20B 5DJXB 3L6FA 2XPGA 1G0YR 4JLRB 3MCLL 3NFSL 4FTVD 5LGJB 4H5SA 1KCKA 2OZ4L 4JQVA 5FM5M 2PYFB 4P57A 2BFVH 3QIBD 1J9CT 2QJDA 3G04A 4PJIF 4P4RA 4ELME 1OQXA 3SJVE 4IRSA 3QXUA 4TQEH 4TVPH 2FO1A 2KQNA 4I9WD 5FO7B 1DVFA 3DI3B 5DHYA 2V7NA 5LQBH 4U6HB 1A7NL 1JGVL 4XI5C 4PJIB 5CSBA 5L6YH 4X9FA 1J1PH 4G6KH 2EIZB 2HJKA 1PJ9A 2YRZA 4GW5A 2J8HA 1OWWA 3Q48A 2FDBP 1TJIH 4MAYB 2RQ8A 1L7TH 5IWLC 2YZ8A 3ISWA 3I3BA 4URTB 4ONHA 1MFCL 2R0WL 2JKXA 5DRZA 4KHTH 4JREB 1EEUA 2WWMD 4OCNC 3BPOC 3KXFE 4LQFH 5IB3A 1NDGA 4OCYL 3SDXF 2ZSVA 5GHWH 4F7TA 3PGDB 1PD6A 2AJUL 2P5WB 3ZKXC 3U7YH 1T21B 1YJDH 4BH8A 2ENSA 4WGVB 1KIQB 4NN6B 2A6IB 3BH8A 4HFWA 1HK6A 2DDQL 3PJSB 5C0ND 5D2NC 3C2AH 2NY3B 4PGJA 1X5JA 3VXPA 4HWNA 3VWKA 5D2LA 1FNLA 2H9GA 5HGGS 4QXUH 2XZCH 4NN5B 3TLRA 2D9CA 1D6EA 4MAYD 4PJXF 5DHXB 4HGWA 2ZPKL 4U3XA 1A4KA 1UXSB 3GO1H 3GJFH 1NGPL 4J3VA 4ZTOH 3SEPA 1LHZA 3WIHH 1R3JA 4ODTH 5L8JB 4QTHB 4NNYA 1CLZL 3U1SH 2P5WD 3UYRL 3V6BR 4F7EB 1QNZH 1MREH 4UNVA 4KQ4H 3VGGA 4POYA 1CL7L 2EYSB 3PWPD 1QFPA 3QIUC 4E42A 5IB4B 4AM0A 3VFOA 1XF5A 4XPTL 3CSGA 3QUKA 4YEFA 1CFNA 2NY3D 5HGBA 1AC0A 2VXUH 1BFVH 3RX7A 3A67H 3DV4B 1RMFL 4O00A 2O61B 1SMOA 3VXNB 4DGVL 3M17A 1ES0A 5I8EA 4M7KH 2VZTA 4L3EE 3DTXA 4G42A 2BVYA 3O3BA 3FO0L 3X12B 3DGCR 2EKJA 4WW1A 1MHEB 1U6AL 4LLDB 4GXUM 1JZ8A 3FQXA 5CILH 1XGQB 1QBLL 1TQCB 2JB6B 5D5MB 1CU4H 1KT2B 2OXHA 5EBLB 4JANA 3VRLE 3KPPB 4AJ0A 5IT2L 1P4BH 4YHZH 4K8RL 1P7KA 15C8L 1DQLL 3DXAE 3E6FB 3HPLB 1PKQA 5CJBA 5I19H 5CJOL 1M05B 5HGDB 4JRYB 3W0WE 2KZWA 2H2PC 1LP9E 4JZOB 3KYAA 1GVIA 4M61B 1UCBL 1FHGA 1CD9B 3MJ9H 3S6CA 3ES6B 2AJSL 2XZZA 1T22A 4HKJA 4WU7B 2FSEA 1QPPA 3QEUB 7FABL 3ARBC 2YS4A 3R0NA 5HYJE 2JK5A 3MV7D 2OQJB 3PWVB 1V3MA 4P5KB 3RAJL 2DBLL 3ARUA 2E7LA 2E7BA 1Q72L 5DHVH 4GAGH 4CVUA 4MXWH 2AXGA 1G9EA 1KTLB 3NFPA 3SBWA 5C0DB 4LNRA 3RPIA 3EGSA 4JRYD 1TETH 5GGTH 4XCFH 4A6YH 2FJGA 3DGGA 1MNUL 3S3JA 4PGZA 1NGYA 4XP6H 4S1QH 2P8PA 4NKIH 4IRJC 3OKOA 4Y5XA 5CJ5A 5C9KA 4JO3L 1XT5A 1FG2B 4AL8H 4GUPA 4KGJA 3CMOL 3L3JA 1YMMB 3QJFA 2GYSA 1RHHB 1YC7A 5CZVL 3M8OL 4PREA 5IFHH 3T08A 4AG4L 4QRRA 2OCFD 3HUJF 3IDMA 1QLRA 4FXGB 1URLA 3PWUB 3GIVA 4IMKC 1A6ZA 2VL5A 1WF5A 4NKDA 3KPQB 3V79C 2NY1B 5JDJA 4R2GB 1J8KA 3VDAA 1S7VB 1X5HA 2GSIA 3F8UB 3HZKA 5I8KL 3HS0A 2OI9C 2JJSA 2VWEC 1WAAE 3HR5B 4XXCC 2X4TA 4XWOC 3SGDI 1QBMH 1JNLL 1PBYA 5FOBB 4YXLH 3ELAT 3IDYC 3QXAA 1H3UA 5K59E 2OL3A 1QBAA 4MNQA 1WBZA 4NWUH 2IBZY 3IFPA 2MSPA 5D70H 5HDQL 1YMMD 2FO4B 3PHQB 3MXVH 1RAMA 2GIYA 2ED8A 5T5FH 3FOMB 1FAKT 1PVHA 3D48R 5FB8A 3FKUS 2BSED 4KDVA 1FL3A 1UZ8A 4U7SA 5IJVA 1YPZB 4KKNA 3RWCA 1C08B 2NY1D 3CLEL 4JFPB 4R2GD 3PWJB 1U95A 4OZIF 3SDDA 1EAPA 2E9WA 5JOPD 5I0ZA 5JA8B 4OD1L 2AV1B 4Q9RH 1FZKA 4P59L 2WZPD 3PHOB 3TPUB 5C6PB 1MIML 1JWMB 3I02A 2DICA 1GXEA 1V7NL 4PRPB 3KS0J 3SE8L 5F3BA 5KS9B 2ZUQC 1FGVL 1AR1C 1MFAH 1RFDL 5I74B 1HKLL 1PYWB 1WISA 2X1WL 4OF0A 1SEBB 2X4SB 1BPVA 1X4YA 4IJ3C 4PTUA 5CD5C 1G6VK 3JTTB 3OL2A 3UC0L 1EUTA 1EGJH 4PJBB 1YN7A 4O51B 3EOTH 1LO4H 1YUHB 1F90H 4NKMA 5L7XH 5E8OB 1DL7H 1KUMA 3WN5A 1ZLVH 1ZHKB 2ATKB 1WBYB 2AAVA 3ZKSD 4N0UA 2B5IC 4LPWA 1I7RB 4WI4A 4ZUTA 3SCMB 4K2UH 1MHPL 2H32H 3C9NB 4U0QB 1RUKL 1LE9B 4Z5RA 3ZE1F 4X7SL 2P7TA 4XP4L 5BVJB 1HH6B 3BN3B 4PGCA 1X7QA 5IHBA 2D7QA 3ECBA 4LSSH 4H20L 4PRPD 5HHQB 1S7QA 4RQQA 4JHBA 5I30H 1JPSL 3FO2B 5F7FA 4IS6B 3IDGB 2QTEA 2BDNH 1LQSR 3KYNA 3M1BA 1K8IA 2C4XA 2C1OB 2VAAB 4DKFH 2W9DL 4OZGA 2D31A 1U36A 2CDGB 4GRLA 4WDIB 4X6BA 3EFDL 2DWEB 3T65A 2VQ1B 1GH7A 5KSAA 2XWTA 5T3ZD 3SCMD 3WDIA 2Y5TA 4NIKB 1YQVL 3N1FC 3GFUA 1ZV5A 1QLEL 4JZNB 2AJZA 2W0LA 4IIQB 1PZ5A 4AEIH 1YEDA 4RAHA 1RQ5A 3ZDZE 1MCFA 5D1ZC 1ORSA 3L9RB 4J4PC 4UMGA 5EIIB 3TCXA 5BV7C 1EFXA 4WV1A 2I9TB 2R4SH 3ALWA 4F33B 1SQ2N 5AYUL 4X4XA 5F7DB 5EPMA 5KANI 4RWYH 3DMMA 1A7PH 2KZ1B 1ZMYA 3BN9D 2AXJA 3K74B 4S10A 3HNSH 1R3KB 5IEHB 1I8KB 1ZT1B 4N5UA 1I3RB 2H41A 2X4OB 3O9WC 1N59A 5F1KC 2Z31A 2VZSA 3PUCA 5F9WB 3MLSL 3U0TA 1G7JB 2A9ML 4XVJL 3PGCB 5F97E 5FGCE 4HWEL 1IAIH 3H3BC 2V9QA 5DRWA 5FKPB 1AGDA 5DO2D 3UJTH 4LCWB 3DRTA 5T1MA 2CRYA 1ZE3C 1QKZH 1VEMA 4PV8B 3D85B 2NW3A 1P5VA 2J12B 3QHTC 3WLBA 4XAKE 5D9SA 3ZYOA 3MLVH 3WJLC 4AYFA 2X4PA 2A9NH 5DD6B 1U8OA 5DJ6B 4WUUE 5C8JA 1CGSH 3QEGH 3H0TB 1ZHLA 1BLNA 3C6LC 3U2SB 5EN2A 1SHMA 5IW3A 2E9JA 3N9GL 1J0JA 2JJTA 1FNEB 5F3HB 3IJYB 4WY7L 1LDPH 1R5IB 4R97B 5JR1H 5HJ3A 1QSFA 2IG2H 4HGMA 4E41A 5DC4B 4OV5A 5IQ9A 4LCWD 4DOHB 5IQ7L 4CNIB 1K4CB 3OSKA 2EDOA 3D85D 4MCYA 3DURB 3LY6A 1MOEA 1J8HB 3KNBA 1N5AB 1OP9A 1GAFH 2B39A 3LZFL 4HWBH 3WS3B 5B38B 4GG6B 4R8WL 4XPBL 5DSCA 1U3JA 2YMXH 3GIZL 2X1QA 4KTEL 5GISH 1UM5H 3TIDA 3GMRB 4RFOL 2CLRB 4PS4L 4LARH 4PJ8A 3TBSB 4QY8A 1HQ4B 3OG4B 3DVGA 2R2BA 3BSZL 4L8SC 1K5NA 2LFGA 5I6XC 2LU7A 1DBML 4R3SB 1NCDH 4R4NC 5I9QB 3ULVL 2YWZA 1U8PB 5SWSE 3P40A 3VFVA 2XICA 1WTGT 2BFVL 4UBDD 5HHOA 5BS0D 4DZ8B 1X5GA 3MREB 3MX0A 1J8HD 3O2WH 2YD3A 4RX4A 2XKUA 3SGKA 3WFDH 2D3VA 4TVPL 2AERT 4U1JB 3FQUB 2XWJB 2EH7H 3CX5J 2XN9E 5LQBL 3H7BB 4YDLB 3BRFA 1IARB 2Z93B 4Y5VB 5L6YL 5K9JH 1J1PL 4G6KL 5CKGA 5I1EH 4HUNB 4OSUL 5JUEH 5JPMA 1MAJA 5I1DB 3O3EA 1TJIL 2CLVB 2BHZA 2XFXB 1L7TL 5FV1L 1OTSC 1KIRB 1WTLA 4G43A 3WUZA 1AJ7H 4I77H 5CEZH 4KHTL 4H25B 4WGWB 1KB5B 1MLCA 4LQFL 3UTSE 5L0QB 2IQ9H 1FYTB 3LV3B 5GHWL 3UTPE 3U7YL 1KEMH 1YJDL 1WWBX 4JFDE 4LASH 1NKRA 3F5WA 3W9EA 1EX0A 1XGTA 3RWDA 4KH2A 4PLKD 1B0GB 5I71B 3UTQA 2Y7QA 3C2AL 1CLYH 5L9DH 3NGBB 4HUWB 4FHBD 1U8HA 3TYGH 1CTNA 4PGEA 2AK4E 2XZCL 2DYPB 3MV9A 4CMHB 7CGTA 3VA6A 4Y5YB 1DQJB 5GJSH 1KIPB 4OZHE 3CSYB 3GO1L 1QYGH 4ZTOL 3RVVC 4WFGD 3K2UH 3WIHL 2IADA 3UPCA 4ODTL 1INQA 3ZT5A 2G9HA 1NKOA 3O6FC 4OGAD 5DJCB 4MMZC 1FYTD 1X5FA 1OD7A 3U1SL 5IUSA 1D7FA 2JJVA 1X5IA 4NP4H 4PLJD 4XHJC 1HHGA 3F6IA 1QNZL 1MREL 3HB3D 4KQ4L 5LJYH 3VFWA 4F7PB 2AI0H 5KVMC 1AIFA 4HUXB 1JVKA 4Y1AB 4J1UB 3UX9B 3SKMB 2VXUL 3FB5B 1BFVL 1QBBA 3A67L 4Y89A 1J05B 4M7KL 3RKDD 2ARJQ 4LDOB 5IK3A 2DYPD 3MRDB 1GCFA 2GJZA 3MCKB 1AQDB 2CR3A 4YDJA 5CILL 1F97A 3G5XB 4NZDA 4QRPD 4CADA 3CFJA 2X4RA 1JPTL 1CU4L 4LDLB 2XQYG 3DETC 2H3NB 2EYRB 1P4BL 4YHZL 3OAYH 4EEEA 4J7RA 3AAZA 3TC9A 4MJIB 5C0BA 5GQBA 2V2TA 3X11A 4JRXA 3ULUF 4NN7C 2A6DA 5I19L 4K7PX 1JGDA 4Y1AD 4PRAB 3VFNA 1WCQA 1FAIH 1VCAA 3NN8B 1IGTA 2VL4A 4YXHH 1NGWA 2H6PA 5KN5B 5IMOA 3QIWB 2DB8A 3MJ9L 5FECA 3U36B 4LP5A 2N7BA 2VABA 5C0CE 4RMQA 1V3KA 3AGVA 4YC2C 5GRVK 4DGIL 1YNTB 4TSAH 5H35B 2NY4B 4L8BA 5E2UH 4DKAA 3OMZA 5JXAH 3D39E 1C5CH 4M43H 3HAEH 4CRPA 3GSQA 3W2DH 2F8XC 3RGVA 3V0VB 3RHWF 4Z78A 3FHQA 4GAGL 3KAAA 1S5HA 1DJSA 4MJID 4P5TC 5B39B 3OF6A 4PGDB 1T83A 2DQUH 2LV4A 5GGTL 1TETL 3AS0A 4XCFL 5E70A 2AW2A 1IGMH 4MXVE 3EO0A 2BY2A 2P8LB 3QIWD 3FO9A 1UEMA 4LCUB 4S1QL 4XP6L 2Z9TA 4ZO7A 4U1LB 4NKIL 4NRZA 3CFKB 3EJYD 5CBAA 4LKCB 5C08A 3QQNA 4N0FA 5BW7C 1DSFH 4JFEE 4AL8L 4RFNB 2WLYA 3KGRA 3HMXA 2NY4D 4QF1A 4RDQG 1KCLA 2W92A 3QAZC 3OKLB 1NAMA 3MYJB 2Z35A 2E5EA 3RWIA 1CD1A 3C5JB 4R4FH 4YIQA 5EWIH 5DEFA 3SE3C 5GS0C 5IGXH 3NZ8B 3ZKNC 2DLIA 4MD4B 1P7QA 2EDTA 4CDGC 1AGFB 1T2QH 2RBLA 3UJJH 1KXVC 2ZUYA 3QXVA 2DLEA 2FJFA 3FAWA 1HSAA 1I1FB 1OCWH 3QNYA 3EZ8A 5DMGC 5D1XC 5E5MB 3X14A 3QUML 4TNWK 3QSKB 3IYLW 4AY0A 2CIIA 2Z4QA 4I0PA 2HT4C 4RZCB 3VDCA 1QBML 5LCVH 1ZT4B 1T5XA 4YXLL 2NY6B 1Y6NR 4NWUL 4U2ZA 1NH6A 4L5FH 4W81A 5I73C 2MKLC 4YH6A 1RIUL 3OWEA 3RZCB 1H15B 4OLXH 5D70L 5IMLB 3V5HB 1L0YA 3MXVL 5DRXB 1VACA 3MJ8A 5T5FL 4W6YB 5I16B 4G6FB 5GGVY 3QI9B 1I9RH 3OZ9H 5IHUH 2J8UF 4WWKB 5ISZA 2EO9A 1UJ3B 4M02A 4X99A 4HJJH 43C9B 5DQJA 2VXSH 1RJCA 4D9QE 4X7TB 1G7PA 2HKFH 3SO3B 4AK1A 3I6GB 4Q9RL 2VXTH 4Q97A 1W72A 3QO0B 2XY2A 1JCKA 2NY6D 3KPSB 4GH7B 1U8MA 4XGZB 1JHTB 1F4YH 1BD2B 3RZCD 2PO6A 1IC4H 1WLHA 3B8YA 4LCCC 4D9RE 4WNQA 4C56B 1MFAL 3MUHL 4P2RE 2Z92A 5MENA 1RURH 4G6FD 3QI9D 2EDLA 5FGBC 1RZIA 2YA2A 3QO1A 3ZTNH 3WMSA 4NNPL 3QCVH 4WWKD 3RL2A 3U7AA 2D4DA 1EGJL 3LEYH 1H3WM 4I18A 1F3JA 1LO4L 1F90L 1A7QH 2ADJA 5L7XL 2X2YA 1DL7L 2EIBA 3GSXB 4CVWA 4ZOBA 4LSVL 4I3GA 1B6DA 2CXGA 4BJLA 5K9OA 2E6JA 3AREA 4K2UL 5H94B 4BQ6A 5MI0B 2X4NB 1HYRC 8CGTA 4X6DA 1LD9A 5IB2A 2DLFH 3KPSD 5FEBA 5D7LE 3LEVH 5AZEH 3MNWA 4LSSL 2O93L 1BD2D 3FL7A 5GSVA 4M5YH 5I30L 4UQ2A 1G7LB 1CD0A 4RCAA 4C56D 3VXTB 4N8PA 1L6ZA 4FQJH 2BDNL 4LSQH 3RVWC 1ZVYA 3WLWD 1ZA6B 4HEME 3ARZA 3DVIA 1TCRB 3O3AA 4JM2F 3ARDB 5E4EC 1FLTX 2VR5A 1T0NB 4K8RD 2WANA 3ZDYF 4TNVF 1INEH 5FV2A 4NQUA 4LLVA 2GTZB 3I3DA 1HEZB 3IRPX 4OF6A 1SEQL 4PRBA 2EC9T 5MHSD 4GRMB 4JM2B 1NBQA 4HIHB 5IMKB 2P5EE 1NBZA 4AEIL 1NC4A 4XMPH 2DN7A 2HKHL 3R4DA 3C2SA 4F7CB 1UZ6E 1QA9B 5IBLD 5K9QI 4JFFB 4LLQA 2R4SL 4LDEB 2A0LD 1MEXH 3T0BA 1A6AB 1TXKA 2FX7H 3ARDD 4L8CA 1P4LA 4RWYL 1A7PL 1Q9KA 4XMKH 1G7MB 3HNSL 1OL0A 2X4QA 3CZJA 3QQ3B 2HP4A 3VWJA 4PRIE 4FABH 1D9KC 2DMCA 1KJVB 2ZUWA 4EI5A 3LKNB 3QJHA 5SWQA 4JM2D 4JZJC 1IAIL 1MAMH 5F88A 2E8YA 1FZOB 1NEZG 4NQCE 3VRJB 2WLZA 4KJYB 4NYLA 4TTDD 3S5LB 3UJTL 2VLLB 1KJ2A 4O4YH 3WD5L 4EJ1C 2W1NA 3QUXC 4AMKH 3WJJC 1QKZL 1UM6H 5LGHH 3KG5A 2P46B 4JFFD 1FFNA 4GS7B 3ZHLA 5KAQF 2YC1B 3MLVL 4PJEE 5KTEH 2A9NL 2Q76B 1CGSL 4R0LA 3QEGL 2QR0B 1SJXA 3VD3A 3OKEA 4WFHE 4POZD 4MA7H 2V7HA 1T1ZB 5C09A 2ERJB 3IDUA 5FYJU 4U6YB 2L7JA 1OB1B 1M71A 5B4MC 3UPRB 1LDPL 5JR1L 4HKXB 4KKLD 4JO1H 4WI7A 2IG2L 3U6RA 4P2YA 4G6JH 1CFSB 5IFJB 4Z7OE 2DKUA 5D1QA 3AMKA 4M93C 1UACH 1UEYA 4YK4B 3SO5A 4GRWB 3C09B 4LBEA 3O2DH 3KLHD 1GAFL 4YGVB 1A3RH 4OBRA 5EBWA 4HWBL 4Y19E 4G80B 2YMXL 1BBJB 4RAVB 5GISL 1UM5L 4HT1H 5IBTH 4JKKA 2A6JB 4U1NB 4QRUA 1QFHA 5EUOF 4LEXH 3MUGB 3VGFA 4XPFH 5E99H 2FWOB 3LSOA 4HWZA 4ODVL 4LARL 4MQSB 1R3HB 5DR5L 3V5KA 4P4KA 2J4WH 5CBEA 4BM7A 4NO3B 5B8CC 4ESKA 5EUOB 3C60C 4KDWA 4GAFB 2X09A 1NCDL 4JM4H 5E2TH 3IXAA 3P4NA 4JFHE 3DV6B 3BQUA 6CGTA 5J6HB 3ZKXB 4KMLB 3RU8H 3VXOA 1A64A 2BNRA 1ZVSB 3T3MF 2JTDA 2A1WH 3WO3B 2C4FT 3TBYB 4I13B 3O2WL 5BJTB 4JQXA 3GMQA 4QHUA 3WFDL 2YR3A 4FXLA 3UYOD 5D2NB 4S0TD 2DOCA 1XIWB 2EH7L 3WL9B 5CMAB 4Q6IC 4HV8B 1ADQH 3T0WA 4MA3A 2YUVA 1C12A 5E6YA 3RWGB 3DUSB 3E2HC 5F1OB 3ZTJG 3BP6B 2BNQE 4NSKA 3OKNA 5K9JL 5JOFA 2WWKO 5DEZA 3P77A 4NM4H 5I1EL 4PJDB 5JUEL 3STZB 2NY5C 1CDIA 3EYUH 2DM7A 4WUKH 1TTUA 1KBGH 3TVMA 3BXNA 2NY2C 1AJ7L 1EMTH 4ETQA 4I77L 5CEZL 1AGCB 4PJ7F 4ZSOA 2PXYA 4OGXH 3MRJA 4P2OB 4H8WH 5EORH 4JVUA 1E4XL 4CU8A 4P3DB 2C26A 4LASL 2K7PA 2HYMA 4Y4KC 4ODWB 2BSRA 1C5BH 1QSEB 2NTFB 3ZYJA 1XIWD 5FGRA 3LQAL 3LDBC 4BK5A 1P9MA 1I85C 4KZDH 4XNUL 1OLZA 1OOAA 1CLYL 5EOCH 5L9DL 5E6IA 4Y4HC 1KJMB 4G8FA 1OPGH 2DQDH 3MFGB 4UI2A 1JI1A 3I75B 5IMMB 4PRHB 4UNTA 2J5LC 2P45B 3QFJA 5GJSL 4WI5A 1R5WA 5D7KE 1OTUC 4DJMA 1K8DA 3Q6FA 1QYGL 5IW1B 5JHLH 4KUZH 4ZFFA 2XYCA 3K2UL 4OZFA 1CQKA 4ZO9A 4C55A 5I0DA 2DM2A 4U3CA 1AGEB 5T5NG 3FTGA 4LLWA 4P2OD 1W0VB 1Q38A 3RUGB 5ICXA 1BQHG 1U8NA 1LMKA 5IVXA 1EEZA 2DM4A 1QSED 2AI0L 3QIBA 4GG8B 3VXMA 4DVRL 3GUTA 1WBXB 1J88A 1S7UA 5I1AA 4HJGA 4JAMA 4PJAA 2AJXH 5A1AA 3HI6H 1FQ9C 2B1HH 4XNMA 2FCBA 2DQIH 3R0MA 1T2JA 3IS0X 4S1SH 1U91B 2OJEB 4J3UA 3ARBB 2Q7YB 3T4AB 2XNAB 4PRHD 1MCSA 2VLJB 1NGXA 4YFLI 9CGTA 4LQ1A 3AB0C 1FO0B 4C83B 2UY6A 4HCRH 3FQWB 4YWGH 2UUDH 4RWHA 3JWDC 1JK8A 3TFKC 5DJXA 5ICZB 5HYQB 4JLRA 5BZDB 1XH3B 1CBVL 3E6HB 5LGJA 3OKKB 3CDGA 3P4MB 1X3DA 4L9LA 3SPVA 5IG7A 1AC6A 1FAIL 1JMXA 5C0GA 4YXHL 1EAJA 4ZG1A 1HHHA 1JZ2A 3PWLA 2VDRH 1SY6A 4NRYB 2YK1H 5FO7A 4LVHC 1N8ZA 1TLKA 3ARBD 4K7PY 4MJ6B 4LHQB 4S1RH 1B2WH 4AIZB 4N9GA 4U6HA 3O3DA 3O4OC 4ZXBB 3OXSB 2VLJD 3NBNA 1GRWA 2HTLC 5JDSB 3BKJH 2IFGA 4TSAL 2MHAB 5E2UL 4HMEA 4KI5E 5JXAL 4XVSH 1QO3B 5ECJE 3IFLH 5E8DH 1C5CL 4M43L 4MAYA 5TDOB 3A6BH 3W2DL 1BIIB 4YHOH 5SWZB 2BVQB 5F6HI 3X17A 1I8IB 2OI9B 3DVFA 3HG1A 3JVGC 3BEVB 4KRNA 2A38A 4JKPH 1IILE 2DQUL 2E6PA 1H9VA 3PGDA 1N64H 4FXKA 1IGML 5GIRA 1T21A 2BXYA 3K4DA 3P9LB 1EEYB 3BGAA 4JFOB 4BZYA 1N6VA 1PKQE 1KIQA 3P9MB 2VUYA 3BW9A 1XGPB 5KANG 5DD1H 2A6IA 2P8MB 5CGMA 4JE4B 1F45A 2ICWB 1DSFL 4ZXBD 4DZBB 5BOZG 2ZWLT 3OKMB 3VFRB 1MFBH 4EN3C 3QDGB 2OK0H 4QOKB 1AP2A 3LQZB 4ELKB 3V4VH 2HLAA 4LPCA 2EC8A 2OM5A 5DQ9B 4R4FL 3ZYIA 3S3PA 5IGXL 5EWIL 1S9XB 4NQDD 4Z95H 5JZ7C 5IFAH 3CFEB 2X70B 5SWZD 1T2QL 2FJHA 1OD9A 3UJJL 1XF3B 1FNAA 2D7OA 1CWVA 3BZFA 4QTHA 3GRWA 4IM8A 5HGHB 1OCWL 2R56H 4XWOD 1BZ7B 1U8QA 2BZDA 3B3IB 4TVPD 3T77A 3HNTH 4F7EA 5FUZH 3SDYH 1KG0B 3T09A 2EYSA 5LCVL 1IEAB 1NCUA 5IB4A 1TFHA 2IH3A 3ALPA 3SDXE 2ZUQB 3FO1B 5E5RB 3IT8D 4L8DB 4L5FL 2O61A 3VXNA 3BKCL 1OGAB 3QDGD 4IJ3B 4X9HA 4QOKD 3P3YA 5B3JF 3EAKA 5H37G 2DMBA 1G0XA 3X12A 1V7ML 1I9RL 4LLDA 3OZ9L 4WO4C 1XGQA 4XPGH 2JB6A 5D5MA 3MLXH 3S37H 4QRRE 1KN2H 4HJJL 5GRVL 1D5BB 1T6VN 3KPPA 2VXSL 1AXSA 2NLJB 3B8SA 4H8WC 4P46A 1P84J 3E6FA 3C87A 3JV5A 2HKFL 2Z8SA 2MFNA 3HPLA 2Y1VA 4F7MA 1R3IL 2VXTL 3L3KB 3MA7B 4H0GA 1V3JA 5HGDA 1ZHNA 4JRYA 3DX6A 5DQDH 5TH2A 2WBJB 3W11D 1N7MH 1UENA 1AD0B 4M61A 5IOPA 1AR1D 3VXQB 1CDJA 1F4YL 4JHWH 1VEOA 3IKCB 1JGUH 3MLYH 1IC4L 3B2VH 4MNQE 3FMGH 2HT3C 2W38A 5JTWA 1RURL 3CDYA 1NBYB 2P4AB 4ZNCD 5ELIA 3ZTNL 2OQJA 3QCVL 4JPVH 3GMLB 3ARWA 3LEYL 4P5KA 3PWNB 1RK0B 4HJ0C 1A7QL 5BRZB 3ROLB 3GSWB 1JNNH 1Q9OA 2COQA 5F7YC 1NCWH 2EDBA 3O4LB 1GGIH 2DLFL 2WBJD 5D1ZB 3LEVL 1OW0C 4BYHA 2LTQB 1SYVB 4BFEA 3Q6GH 4NKOB 1DLFH 4M5YL 1CLCA 1IBGH 1XCTA 5DVNA 3UAJC 1FG2A 1RD6A 1N0XH 2FLRT 3CUPA 4FQJL 4LSQL 5E9DE 4Z8FH 2BVPA 2HJLB 4K3JH 4RGNC 3B4NA 3TO4C 5IW6A 1T7XA 5J8OA 1INEL 1FVDA 1FNGB 1UWXH 4FXGA 5BRZD 3PWUA 2EDYA 1CICC 4G9DB 3MLTB 5CP7A 1UH3A 2ARJA 3VFGH 3O4LD 2I5YL 1ODAA 4A6YB 1S7VA 3D3VA 1PX3A 4F8QA 4CGTA 2AV7A 5D1ZD 4N0UE 3QNXB 1XZ0A 4DAGL 2J1KA 3VI4E 4XMPL 3BH9B 2D4FA 3HR5A 4J4PD 5FOBA 4HC1A 4RMTA 3SKUD 1CF8L 5FYLD 3OR7B 3JV4A 1SJVA 3I6KB 3UZEA 3G6JF 5DA0B 2IANB 5I1CH 5LBSH 3OJVC 1MEXL 2FO4A 2ITCB 3JZ7A 4W68A 2FX7L 5C0AA 3FOMA 5C6WH 5SX4I 4C58B 1SVCP 4XMKL 4ELMB 1KTRL 3SJVB 5D93C 4HIIB 4OZGE 1YPZA 4FABL 4G3YH 5E4IA 4JFPA 1FP5A 5J4MA 1Q9LA 5A3IC 4OGZA 1T89A 3CFBB 3U0PB 1MAML 5ESVB 5ABDE 1A6TA 3VD5A 2AV1A 4O02H 4UV4H 1LEKB 2L4OA 4HAGA 4O4YL 3FQTA 3MRQA 1MF2L 1U93A 2OS7A 5I8CB 1QVOB 1WSST 3J8F7 4QWWC 3TPUA 1UM6L 5LGHL 3H9ZA 1IGJB 1JWMA 5DJ0B 3JWOH 1ZLSH 1NSNH 2HVJB 3HE7B 1GZQA 2IAND 1XAUA 2EKSB 3MUZ1 4ZFOB 4LLYB 2ATPA 4M7LH 4MQTB 5I1IH 2Z8WC 3C6LD 5KTEL 3KHOA 5KS9A 3GKZA 3MRGA 3KXFB 1VGKA 3QFDA 2X4SA 3W5NA 3MROA 4MA7L 2ED7A 2MCPH 4LSTH 1CE6A 3SJVD 4MA8H 1KF9B 3JTTA 4H88H 3C08H 3QDJB 4PJBA 4O51A 3KLDA 5B38G 1ERNA 1XGRB 3H7LA 5E8OA 4Y88A 1ZHKA 2ATKA 3MZTA 1WBYA 4JO1L 4OB5H 5E2WH 1AE6H 1IZJA 1I7RA 4ZS7H 1O5DT 3SCMA 3TNMA 4G6JL 3WUWG 3QRGH 1HH6A 4BSVB 4APQB 1E27B 4ZYKB 1I7UA 5JIKA 3O2DL 4KU1A 5DYOB 1A3RL 3TYFA 4X6CF 2ZCKH 3FO2A 3KXFD 5C2BH 3GKWH 4HT1L 3IDGA 1KCRH 3NOIA 5IBTL 1BZ9B 3WFEH 2EXYC 4EUPB 4LEXL 4UUJB 4XPFL 2C1OA 2VAAA 5E99L 4XB8A 4U1HA 4LGRB 5ENWB 1AXTH 1DR9A 3T4YB 1LK3H 5CIPH 3UTTA 4Q58C 5E00A 2J4WL 4WDIA 4CW1A 2DWEA 3NPSC 5IM7A 3EYQD 5EC1A 5ESAB 3RY5A 4JQVC 2YUXA 1X5YA 4FA8A 2H32B 2E8ZA 4JM4L 5E2TL 1NCNA 3CH1A 2CUHA 1RK1A 3BT2H 2HN7A 4L3EB 3RU8L 3VRLF 43CAB 4JZNA 8FABB 4E41E 4IIQA 2A1WL 3D87B 1G1YA 4Q74A 4YHKH 3W9DB 4APQD 4XH2B 5E8NA 2V5RA 1KLGA 3OHXB 2YRLA 3D18B 3L9RA 5T1LB 3ZE1E 1LP9F 1ADQL 2CUMA 5TGBB 5EZLB 3ARGA 3DXAB 4X5XA 5INDA 5BCAA 1Z3GH 4I5BB 2V17H 2ICCA 5EU4B 3HR6A 4NM4L 5JQHC 3W0WB 3UBXG 4WUKL 1IFHH 1LP9B 5IEHA 1I8KA 5DD3H 1ZT1A 5AYQA 1FGNH 1P2CB 3O6FB 5INCA 1UA6H 1EMTL 3CC5B 2WSKA 3VRIB 1G7JA 4R7DB 3PGCA 1HI6B 2FYYA 1K4DB 4OGXL 4L3ED 4XCEB 3F7VB 5DVKA 2KL6A 1F2QA 4JKMA 1JHLL 4NQEA 5HGAB 4J3OC 2VQTA 3HC3H 3RNKB 4LU5H 4D0DB 5EORL 4LCWA 1NCAL 4LAQL 3LRGA 5HYJB 5J13C 1C5BL 3VWKC 4CMMB 5T1LD 5F1NA 4XCNA 4LAJH 3WHE1 3LD8C 5MP6H 2GSGA 3DXAD 4MD0A 5EOCL 4OFKA 2DQDL 3ZLQC 3N1GC 4MZ3A 3U2SA 1WWAX 3W0WD 3CZFB 3RVVD 4GKSA 1NUGA 1DQDH 4UV7H 4KROC 3MFFA 4NHCH 3O6FD 2H2SC 5JHLL 1J0ZA 4KUZL 5F6HJ 1FNEA 2B4CC 5F3HA 3VMOA 3IJYA 5F8RC 4G8IB 4XHJD 3V4UH 3BISA 4RAUA 5TF0A 3CIQA 1KEGL 2HFFB 3WHE0 2V5SA 1I9JH 5HYJD 2K7QA 4U1KA 4CNIA 4N90E 5KVGH 5T1DH 4OFYA 1WT5A 4KI5C 2X1OA 1J8HA 3VD7A 1N5AA 1DQTA 4UTBH 2AJXL 1J86A 3ABZA 3HI6L 3WS3A 1IQDB 5B38A 4GG6A 2B1HL 4PJHF 2DQIL 4YC2B 4S1SL 2V2WB 5CS7A 4PUBH 5CP3A 3HE6A 1OSPH 4M8QA 5GS3A 3TBSA 3EDJA 2WBWB 3T0AA 1T66C 3DETD 4HCRL 4YWGL 4E0RB 3ULSB 3D5OF 4Z76A 3IFOB 4P5TB 3ILPA 2AJ3B 1NL0H 1U8PA 5DMIH 4LKXB 2F58H 1RV6X 2ICEB 2A73A 3AXLB 1R24B 2YD4A 3MREA 3SGEI 5AD0A 3AU1B 2A6KA 3KJ6H 4N8VB 3AMLA 1DUZB 4NUJA 3SDAB 3TO2B 1OAUH 4YUEH 4U1JA 3FQUA 2VDRL 2YK1L 1CYGA 3RVTC 1WCBB 4S1RL 1B2WL 2R8SH 1YEFH 3THMH 5HVWA 3F62A 5EO0B 2Z93A 5C2UB 5E56A 3BKJL 4OLVH 5CKAA 3D0LB 2E7LC 2LU3A 3H42H 4XVSL 5CZKA 5HI3D 5I1DA 2R1YB 2CLVA 5DS8B 3IFLL 5E8DL 1KOAA 2XFXA 2YSSB 4GQ9H 2WIMA 1R3LB 3A6BL 4JHAH 1KIRA 2MKWA 1MVUA 3SBWC 3PNWB 4P5TD 2ZG2A 1KCVH 4YHOL 2EZ0C 5D1XB 4H25A 3LKRB 4XNXH 3UCRA 4HUVB 1FYTA 1I4FB 4JKPL 1JZ4A 1DBAH 4UQ3B 4DCQB 1N64L 2DQCH 4IOIB 4Y5XC 2PETA 1JZ6A 4TVSa 2QQNH 3WIFB 3SDAD 2PTVA 3L5HA 1S9VA 4JJ5A 4JRXE 4LVNC 3UBXA 3IJSA 5I73B 3P4OB 1B0GA 5DD1L 5ID1B 3MA9H 3O6LH 3LB6D 3OKDB 1KPRB 4HUWA 2I07B 3UZVB 1MFBL 1MELA 2CMRH 5A40E 1BJ8A 5T3ZH 1HSBB 2OK0L 5M7QA 1QR1B 3ZKND 2R4RH 2GT9B 3V4VL 1YEIH 2DYPA 4JQIL 4ZPTB 3L5WA 1DQJA 4Y5YA 3K4ZA 1Q0YH 5IF0A 3CSYA 4Z95L 3LMJH 5IFAL 2DWDA 3V0AC 3WEXA 3VCLB 1MCCA 5DMGD 5D1XD 2JJSC 1DN0A 4FG6C 5DJCA 3TNNB 3GMMB 5T3XE 3TN0A 4X7FC 2R56L 4ZUSB 3S96B 1U3YA 3HNTL 4A2LA 1OLLA 5FUZL 4KC3B 3SDYL 3OAUH 4RGOL 5CZXC 3V6ZB 1UWGH 3TF7C 1NUDA 4Y1AA 3CK0H 2V5MA 4J1UA 3MOAH 1QEWA 4F9PA 2VDPH 4LCCB 5IV2B 3ZDZF 1G1CA 3SKMA 3AFLA 3FB5A 3BEWA 3B2UD 1V3LA 1NMBH 2C3VB 3RWHB 1HHJA 4PJGF 1NFDA 1MJJA 1J05A 4HMDA 2X40A 2BMKA 4EZMA 3LQMA 3MRDA 3QISA 2GAZA 4X80H 4YFEA 2GK2A 5JO5B 2ZOLB 3RJQB 3VJ6A 3SDDC 1AQDA 4U33A 4XPGL 3G5XA 4QLRA 3MLXL 3S37L 1DP0A 1KN2L 3DNKA 4RRPA 1MIEL 2J6EH 2RR3A 2H3NA 4JDTH 1T6WA 3NFNA 1NFKA 1PLGH 4MJIA 3OV6A 5I1HH 2VLRA 3QULB 5DQDL 4PRAA 4BQ8A 3A0OA 1JF6A 1LILA 3NN8A 1N7ML 2DBJA 5CCKH 2VTFA 1AR2A 1E0OB 4EVNB 1PFCA 4WIQA 4JHWL 2V2XA 3KR3L 2JJUA 3MLYL 2F19H 2VZVA 4X5LA 4JG1H 5FGCB 3D2UA 2LE9A 2HWZH 3B2VL 3P73A 4F2MB 2VUOA 3FMGL 2VZ3A 4LK4A 3KPRA 5E4EB 3MSPA 3WN5C 1A14H 4ODHH 4ZFZB 2MQ3A 4JPVL 2YPLA 2EDJA 3WXWH 1QD0A 4XC1H 5FA4A 3V0VA 4NQXB 2AP2A 5GRZA 2VERN 3KDMB 4K9EC 1HXYB 12E8H 1JNNL 5ISZE 4WUUB 1NCWL 1HXMB 3BDYL 4PGDA 1GGIL 3QDHA 3O81A 4UDTB 1BZQK 1IM3A 1A1OB 3SGJA 3Q6GL 1Z9MA 3CVHH 5I15H 4U1LA 3RVWD 1DLFL 3CFKA 1IBGL 4DTGH 4LKCA 3ULUE 1T1XB 1N0XL 5DJ2A 4GRLC 4MNHB 2YRPA 4MX7B 4MHHI 1N3NA 4Z8FL 4OLUH 3WHXB 3HAEB 3OXRB 4K3JL 3OKLA 3MYJA 2YD2A 4AENB 4XNZC 5ANME 3C5JA 1QOKA 3HI1A 2QL1A 3IF1A 5MENE 3NZ8A 5F7NC 3QWOA 1AGFA 4ZTPH 3AM8A 1CR9H 4JZJB 3MRPA 4ORGB 3T1WA 4WUUD 3MRBA 5DGRA 2DLTA 3WFHB 2VSDA 1A4JA 4RFEB 4HAFA 2B2XH 1W0WA 4P23A 5CP3H 1CGXA 3BZEB 1YY8B 4B50A 4XBGB 2HFTA 1CG9B 3O6KH 1EVTC 4NUGH 4PTTA 2VJXA 3FB7A 4LMQE 4NNXB 4WV1C 1OY3B 2RFXB 1ZT4A 3Q3GB 3VFPA 4OI9A 4MQXC 1P4IH 3DARA 3DMMC 5IIEB 1ZGLA 1KFAH 5I1CL 3RZCA 3O41B 5LBSL 1H15A 5SWSB 1LEIB 4ZUUB 4PJ5E 3V5HA 5H2BB 2PYEA 2QKIA 5DRXA 4K7FB 5F89B 3T1FA 2Z31C 1CXFA 2FEEI 1E4XI 5CJQL 3VFUB 5I16A 3QI9A 3BPCB 3SQOH 5EU5A 3U46B 3UMTA 4OCMC 3FFCA 5B22A 2EYTB 1NUNB 3OGCB 1UJ3A 2ILLA 2XN9B 4G3YL 4W4OA 1RZFH 4FP8H 3SE9H 4KDTA 4X7TA 5EFIA 4M93B 4WEMB 3MV11 4KVCL 4O02L 3I6GA 4UV4L 2EDKA 3WKMH 3QO0A 3KPSA 4FQ1H 1T04B 5I1GH 3JWOL 1CT8A 4XGZA 3GSVA 4AT6B 4MA1B 4HK0B 2HLFC 3KLSA 4M7LL 3FONB 4I48B 5I1IL 1XR9A 1BD2A 1T5WB 4JDZB 5SWSD 4IHOA 5CEXB 5TFSH 3HKFA 3UTSB 4QXGH 3FT2B 3GSUA 1KB5H 4NWTH 3FZUC 4HKBB 4LSTL 2MCPL 5B4MD 5T3XH 4MA8L 5IHLB 1BECA 4JFDB 3C08L 2D7MA 3C60B 1JNHB 1WZKA 1I1AB 3TWCH 3KYKH 2XN9D 3R1GH 3LPWA 1BP3B 4YFLF 2OBGA 1OTTD 2WK2A 4OZHF 4RA3A 2XQYK 1W0YT 4OB5L 5E2WL 1AE6L 2G2RA 4ZS7L 2EO1A 2QV2A 3GMPB 5AZ2H 3CFDB 1CE1H 2J8UE 5HHVL 2PTTB 4LCYB 5FYKE 1SJEB 3VG0H 2AK4B 5GGRB 1OAKH 4ERSL 3QRGL 3MNVB 4OZHB 3BVNA 2CO6B 3TH3T 5FXCH 2P1YA 1NANI 3MGTB 4Q6IB 4WHYH 3BGFC 3EFFB 3ROOB 2Q1EA 3NCFB 5KSBA 5IROA 3F12B 5C2BL 1PQZB 3GKWL 3UTSD 1KCRL 3GB7B 3WFEL 3GRWL 3UTPD 4QXTB 5DDHB 4HIEB 4AH2A 1TCRA 4JFDD 4O2CA 1AXTL 3ZT6A 5ADOL 3C60D 3ARDA 1LK3L 1FL5B 1YECL 2NY2B 1QQDB 1I1AD 1T0NA 4Z9KB 4GLRH 1S7SB 5C09E 3A6OA 1ZS8B 3UTZA 5F7UA 1BVLB 3RP1A 2AGJH 5I1LB 3RZWA 1SYSA 4Z7NF 4FQHA 4TNWF 4H1LB 4J12A 4U31A 4GRMA 3U83A 4EXKA 3STBA 3I9GL 3SGKC 3BT2L 2ZCLH 2AK4D 3NIGE 4ZDHB 1U3ZA 4Y4KB 3QCUH 2VOTA 4HIHA 5IMKA 3U48A 2LVCA 3U9PH 3AVEA 1ZEAH 1DBKH 4YHKL 2XACC 3JV6B 2HT2C 3JSSA 1YZZA 3HC4L 3LDBB 3CAFA 1QA9A 1A8JH 4B5EA 2RCSH 5AWNH 3B83A 1RU9H 4UT6H 2UVFA 4QYOB 4XXDB 4IMLA 4L4TE 4M1CC 5AG9A 5JORB 1A6AA 32C2B 4YHYB 1Z3GL 5J3HD 2V17L 1XEDA 5SV3A 2NY2D 3PF2A 1S7WA 2LABA 1IFHL 5DD3L 4XAWH 2I9LB 1FGNL 3GJEB 2YD8A 1KJVA 4IDJH 4HZLB 4M62H 1F8TH 4EQ3A 4HLZH 4NO5B 3FAXA 3V5DB 1FZOA 1PKOA 3VRJA 1ZSDA 3ZDYE 4Y4KD 3ULUH 4M00A 1PGRB 3HC3L 4LU5L 4JFXB 1DDHA 1SBSH 5MEOA 2D0GA 3D39B 1I3GH 3L3DA 1I7TA 4WCYH 3EUUA 4MXVF 3K8KA 3PXHA 2NXZC 3QQ4B 2YC1A 3CDFA 5MP6L 1FC1A 5E1AB 1OF2A 3B6SB 1JI2A 3MLZH 1OTUD 2R69L 1FC2D 3BP5B 3BAEH 5DVMA 1JWUB 1MJ8H 1XFPA 1T1ZA 3REWA 5J12C 1DQDL 4UV7L 4NHCL 3NPZB 3EDKA 3K1KC 4K94C 5C0CD 3UPRA 2VKXA 4OF7A 4HKXA 5DEGB 3V4UL 4U1MA 3QXDB 4JFEB 3NCEB 3G5VA 5SV4A 1XMWA 2QHRH 2R2HB 1CFSA 4LSUH 4ZSOE 1I9JL 3D39D 4YAQB 1C7SA 1TZGH 3DJ9A 5T1DL 5KVGL 1JRHH 3EYSH 3CXHK 5HPOA 1IAOB 4OCXH 4LVHB 4YGVA 5J7CC 2DM3A 4JDVB 1ZT7B 4G80A 1WWCA 3O4OB 4Z7QE 4RAVA 1T1YB 2A6JA 5I66A 4U1NA 5JW4R 2B20A 4PUBL 3MUGA 3HNVH 4JFQB 1OSPL 3GDBA 5TQ2L 3U0WH 3RKPA 2NR6C 3TT3H 2XWBB 1A6VH 1UWEH 2BC4B 3EBAA 3GEWB 3TFKD 1C16A 3IVKB 2Q8BH 3QFJE 3WSQH 2VE6B 4GKZB 2BCKA 4JFED 4ZUVA 3AY4C 1R6VA 3VFSA 3DV6A 1NL0L 3QA3B 1LE5B 5J6HA 2ICES 1EJOH 4HBCH 1A6UH 3UYPA 4D8PB 2F58L 5EU7C 3VXRA 1JPFB 1ZVSA 3U9UB 3VH8B 3F65A 3TBYA 3KJ6L 5BJTA 5MEPB 3D9AL 1MFEH 1KSRA 2VXQH 4OLWH 1BMGA 1OAUL 4YUEL 2E7HA 4TNVK 4J3XA 4ODBD 3FCTB 4U6XB 3VXME 1XIWA 2HTLD 2LVEA 4HV8A 4YNYA 5DK0B 5JMOC 1JV5B 1NLDH 5EBMB 4EN3B 1YEFL 2R8SL 3RWGA 3C6SB 1FFQA 3KLAA 3THML 3BP6A 4CVXB 1JMZA 2Q6WB 4FZ8H 4OLVL 3RGVC 1GC1H 2FH8A 3UEZA 5EIVA 4PJDA 3MRHB 3FOLB 1BVKB 3ULVF 3H42L 3MMEA 3TP4A 4PGBB 4GQ9L 4HS6B 5FYKH 1M1SA 1XR8B 3AUVA 3HRZB 1KCVL 2CDEA 4PFEA 3H9SE 1AGCA 3KJ4B 4P9HC 4F9LC 4KVNH 4XNXL 4P2RB 4P2OA 1DBAL 1VFUA 2DQCL 2PUQT 4AEHH 4EXPX 4P3DA 1TMCB 1ZKAA 2QQNL 4BELD 1ROWA 2R1XA 4U6TA 3DHJA 1K3ZA 2DQJH 1MQKH 3RPKA 3VDBA 1ORQB 4I4WB 3RGHA 1S9WA 4D9QD 4EN3D 1YEEL 3MA9L 3O6LL 3FRPG 3TGXA 2J88H 1HCFX 4MNGA 4NC1C 4YHIA 2HVKB 1LNUB 1KJMA 4UDUB 1FORH 2BVUA 1TVBA 2CMRL 2UWEB 1MHHA 4HHAA 5T3ZL 1Y6MR 5JZ7D 4PRHA 2R4RL 1G7HA 5ERWB 1YEIL 4PLOB 5D7LB 1Q0YL 4WO4B 2GITB 5GRYA 1JFQL 3LMJL 4KRLB 3IETA 4KRPB 5E2VL 3G6AA 4I0PC 3OJDB 1J0KA 4D9RD 1BREA 2APWA 4OFDA 1AGEA 4P2RD 5FF6B 2XV6B 2W0FA 3RUGA 4GW1B 3INUH 3DX8B 3HG1E 2XTLA 4UT7H 3OAUL 4LPTA 4GG8A 5EU3A 5C0FA 1UWGL 4PJ7E 1AGBA 3CK0L 3CX5K 3O2VH 5ETUB 2N1KA 3MOAL 4NHUB 1JNJA 2VDPL 5C86A 3L7FA 5HDBF 1UZ6F 1NMBL 1U91A 3ZL4H 2EICA 2Z91B 4YO0B 2Q7YA 3R06A 3QHZH 1K9TA 5D7LD 4PG9B 4X80L 2P5EB 4Z77B 4NT6B 4WO4D 3HCVA 4KV5E 4NC2B 1HHKB 2R1WB 1G9MH 4FQIL 1K6QH 4CU7A 4KRPD 4PRNA 5IJKC 1T7YA 1ONQB 1LK2B 2BVOB 5ICZA 5BZDA 2VDQH 4JDTL 3BUTA 3ULUC 2FGWH 3E6HA 1PLGL 3P4MA 4OAWB 4NBZB 5I1HL 1OM3L 4QO1A 2FZ3A 4FQPA 2PO6C 2DAVA 3LHPH 1NJ9B 5CCKL 2B1AH 4PRIB 1B9ZA 1KV3A 4NRYA 2HT3D 1I7ZB 5ITBH 1S9YA 2F19L 4JG1L 1CDGA 1GZPB 2HWZL 2VZ1A 4OUUA 2ADFH 2RIKA 4NQCB 3OXSA 4NZTH 4BSWA 4I18C 1RZJC 4ZXBA 2P5ED 5JDSA 4PJEF 5GZOC 4Y0GA 1A14L 4HJ0D 1FZJA 4ODHL 5I18H 1Q9WB 3AREC 1CICB 4HD9A 1HIMH 3K0WA 2FR4B 5LAXA 3WXWL 5TDOA 2RHEA 4XC1L 2VB5A 2P49B 3V0WH 1GYAA 1U8KB 5SWZA 2X7LB 4PJEB 4GQPH 12E8L 3UZQA 4MZ2A 3U30B 2ZKHH 5T1KB 4KTDH 5CD3B 3HZMA 2BSTA 2QLVB 2VC2H 3F7RA 5D6CB 3W5MA 4PRID 3UAJD 1MVFA 5I15L 2MCG1 1OGTB 1SVZA 4DTGL 2P8MA 4YHPB 4NQCD 2ICWA 4DZBA 1U2HA 5C1MB 3TO4D 4PG2A 2EXWC 3DVNB 3QDGA 4OLUL 4ELKA 2ZUUA 1D5IH 5D93B 1CICD 5DQ9A 3RVUD 4M7ZC 1S9XA 3CFEA 2X70A 4YQXH 1B4JH 3DPBA 4MQ7B 4ZTPL 1CR9L 1XF3A 4Y19B 4CN1A 1EBPA 5T1KD 3TBVB 5HGHA 3ZE2E 1SM3L 2A74A 2PW2B 3FRPA 2B2XL 2GEEA 4WFHD 4HEPG 1MCPL 3WE6A 3CCHA 1M6OB 3QRFM 1OT2A 5DJZB 5ITFB 3PDOB 3O6KL 2FLBT 1KG0A 4NUGL 4DW2H 5DMYA 3VG9B 2NY0B 1HKFA 4JHZA 4CVZB 5ILTH 5J1AA 5ICYA 1KIUA 1P4IL 3ARPA 3FO1A 1IAIM 3L3GA 1KFAL 4X9GA 4S1DC 1OGAA 4ZFGH 3VWJC 1GC1C 1QFWI 1IZKA 3GJFA 4EI5C 1N26A 2IQAA 3WIHA 2EDFA 1A3LH 4X4ME 3SQOL 3IJHA 2V9TA 4Y19D 2R29H 2IH1A 2H1PH 4Z7WF 3EO9H 4WW2A 1U8LB 1D5BA 4BH7B 1RZFL 4FP8L 4K3DL 3SE9L 2ZUTA 3EIFA 3WS6A 2NLJA 1U58B 2BNQB 4QWWD 2VMFA 2NW2B 2G60H 2MNUA 3T8XB 1QRNA 5DD0H 3S7GA 4RNRA 4RGMC 3WKML 3D3VE 4LMQI 4WI6A 4FQ1L 2NY0D 2WBJA 1FSKC 1JIBA 4G8EB 3K1DA 4R0LC 5I1GL 2F74A 4XCCL 4JFHD 4JY4A 2JIXB 1FVEB 3NA9H 3IKCA 3VMNA 2AKRB 6FABH 1T7VA 5TFSL 4ODUB 3PP4H 1HHIB 4QXGL 2AEWA 1KB5L 2X9YA 2XPGB 4ZAKA 1D3CA 4LFHG 5T3XL 3NPSB 3MZGB 4TYUA 1G9NC 5C0AE 3TWCL 3PWNA 1RK0A 3KYKL 3R1GL 5D1QC 3T2OA 4KKBC 4P4RB 2OR9H 5BRZA 1MRDH 3ROLA 1YPZE 4O9HH 3GSWA 2BNQD 5JW4N 3CD4A 1A1NA 1S3KH 5AZ2L 3O4LA 2W9EH 1CE1L 5DHYB 3VG0L 4FOMA 1OAKL 5D1ZA 3CU7A 3MJ9A 4AZ8A 5I2IB 2W9LA 5I1KH 5E24E 2QQKH 1SYVA 2JIXD 3D0VA 4NKOA 3S37X 3SGDH 2EXYD 2DIJA 4Q9QH 4PB0H 3H8NA 5L2KA 3C5SA 1C8PA 4P4KC 2W0PA 5JIPA 5J11C 3F6LA 4XVTH 2HJLA 4G9FA 4PJ9A 3BQUC 1NDGB 5DHVA 5GGUB 3Q2CA 4F7TB 3TV3H 5TQ0H 3WFZA 4NCC1 4DFHA 5MEQA 2AGJL 1K2DB 1B6UA 2PN5A 2ITDA 2YEZB 4G9DA 1FIGH 3MLTA 1UKSA 5D2LF 4GFTB 4GXVH 1CLOH 5GGTA 4TPRH 2FIKB 2VDLH 4A6YA 3KPMB 3KYOB 4JQXC 4HFWB 2ZCLL 3MGOB 1CFTB 3QCUL 3QNXA 4QHNB 3U9PL 5J13B 5D7KD 3QBTB 1ZEAL 1DBKL 3TA3A 1JYNA 5EO1A 3ZDXE 1RIHH 4LPYA 5D7SH 1B0WA 2YD7A 1FO0H 2RCSL 5AWNL 1HWHB 1D6EB 3WJLA 1RU9L 3I6KA 2P47B 4HGWB 4UT6L 3OTTA 2CPCA 2IANA 3QWRA 1MH5A 5DGQA 3BE1H 2AQ2A 1BX2B 3DUUB 2ITCA 1R3JB 3TVMC 1EHLL 3VGAC 2EECA 4NNYB 3W82A 3QQ9C 4KROB 2B7DT 4ELMA 1MCKA 2PXYC 1AQKH 3SJVA 4XAWL 2IALA 4TSCH 4KI5F 1ZA3B 4IDJL 4M62L 3UTTE 1WIPA 2DQFB 1Z2KA 3OJMB 4E42B 3U0PA 3CFBA 1XF5B 1MUJB 2IMNA 1D6VH 5GPRA 2HRLA 3M17B 1U0QA 1SBSL 5I8CA 1QVOA 1I3GL 3DTXB 5E6IC 1GOGA 1IGJA 3O3BB 5DJ0A 3HE7A 4WCYL 1VFBB 5F7MC 2EKSA 2F54E 4ZFOA 4LLYA 3LEXA 4M4RA 3V4PH 4YJZL 1F6LL 3KXFA 5SX5K 3B5GA 4JANB 1D5XB 4KROD 5GRUH 3GMNB 5FUCE 2GKIA 1MJ8L 1P7KB 3G6JE 1CXEA 3RX5A 2BY1A 5EO9B 3QDJA 2HAZA 1PKQB 2VDOH 3CVIH 1XGRA 2IAMB 1FPTH 4U1GB 3QIBC 4PJFA 2QHRL 2V6HA 1QSVA 4KI5D 4XTRD 4LSUL 2EDRA 2OTUB 1TZGL 2FSEB 1JRHL 4NQEE 3ARQA 5C0JA 2Y06H 3EYSL 4APQA 1E27A 4ZYKA 2C3XA 4OCXL 5DYOA 1A7RH 1BJ1J 2XI9A 2JK5B 3CDCA 4JVPA 1BM3H 1WFOA 3CMGA 4F57H 4UUJA 3RRQA 3HNVL 3QZWG 1DUYA 4MJ4A 3U0WL 1G6RH 1EGJA 5FAAA 4JJHA 2VLKE 3TT3L 5GGVH 3NFPB 3FN0H 1A6VL 1UWEL 2PNDA 5C3LD 3PWPB 4LNRB 2Q8BL 2IAMD 5ESAA 3QEHA 4L9LC 5CINH 5D71H 1JZ7A 2H32A 2FJGB 3SDXB 4UINH 3WSQL 4MMXC 4HK3J 4WHTB 2P8PB 3OB0K 5EZJB 3UPAA 5DMJB 4KKCD 1FV1A 1EJOL 2UYLB 3OKOB 4HBCL 5HSFA 4ISVA 4L3EA 1MJUH 2ZZUT 3JTSA 3BGMB 4LVNB 2FBJH 4GUPB 4X0KA 1DCLA 1ND0A 4XH2A 3L3JB 1A1MB 3QJFB 4TUOA 3RVTD 5C0NC 4MHHG 2VXQL 4OLWL 4LRIA 5HD8D 2FECI 1KYOJ 3D18A 5T1LA 2HRPH 1J8HE 1QLRB 4PJXB 4D9LH 3N1QC 2DJSA 3GIVB 4OTXH 1P6FA 3L7EB 3DXAA 5CIPB 1A6ZB 2EDXA 2VL5B 4FZ8L 2BHYA 2VRAA 4NQVA 5EU4A 4X6CE 4JREC 3HZKB 4LVEA 2EZ0D 3ARYA 3DROA 2YZ1A 1AKJB 5FYKL 1XGUB 5DF0A 5SX5H 3MODH 3CC5A 3HMWH 3BO8B 1BF2A 3BIAX 3MRLB 1JN6A 1K4DA 2E9IA 4KVNL 4MNQB 3ALXA 1OAQH 3K46A 5HGAA 5LXGH 3IFPB 3CFIC 4D0DA 2IPTH 4AEHL 2J3SA 1XGYH 4M6NH 4TRPH 5HYJA 5BMFH 3MV7B 1D5MB 2NY3C 4UZGA 1SBBA 2PF6A 1JYWA 2NY7H 1KCSH 2DQJL 1MQKL 4PD4K 4CMMA 5FB8B 3FB8B 3GM0A 4NN5C 3RJDA 2J88L 1I8MA 2PW1A 3RWCB 4S2SB 3BRDA 2P24A 2X9WA 1FORL 3LS5L 3N1PC 3QUZA 1INDH 3OKYA 4U1IA 3CZFA 1PEZA 3ARFA 4HF5L 1EAPB 5HVHB 1H0DA 4L29A 1AKJD 3GNMH 4Y16A 3KWWA 5HPMA 3B5TA 1J1XH 3DRQA 3ET9F 4YR6B 2WBKA 1QG3A 3QDME 5DJAB 2ZG3A 4MNQD 2ZNXA 5BV7H 1GIGH 3P30H 5FYLH 4JFYA 3MO1A 1Z0MA 5E9DB 4L4VA 1LO3H 3INUL 5F3BB 4M1GL 2Z0BA 4UT7L 2W65B 3SY0B 2WUCH 3O2VL 4AQ1B 3VI4F 2JLLA 3GBMH 3OB0H 1KTDB 3FT4A 4E5XB 1IQDA 2GJ6E 3HLAB 4LCIH 3ZL4L 1AO7A 4NKMB 3WN5B 2OMBA 1TQCC 3VGDA 3QHZL 1TZHA 4N0UB 3HZVB 1UJTA 5HXMA 3RVXD 1WAAA 1HYSC 3PV6A 1G9ML 4X6EA 1K6QL 4E0RA 4P46C 1RJLA 4JN2A 3QEQA 5F9JB 3WYRA 3ZE0E 1DQQA 2BNUB 4PGCB 1X7QB 3IFOA 1FH5H 4OZGF 4I0KA 2VDQL 2WV3A 5E9DD 4HH9B 2FGWL 5IESH 3T2NH 5FIEA 4RMWA 4E9LA 5DC9B 3FRUB 4N5EC 3AXLA 1R24A 3QZWA 2FX8H 3EKCA 3KYNB 3MBEA 4HKZA 3T0XA 3LHPL 1K8IB 4HWBA 1F02I 4OZGB 3SDAA 4F80A 1UB6A 2B1AL 5C0IA 4XPAH 1MHCA 5FA3A 4X6BB 1NUFA 2GY5A 2X4UA 1PSKL 3OB8A 4WI2A 3T65B 4LRNH 2N7AA 5ITBL 5DI8A 1T7WA 4YPJA 3HUJB 2ADFL 5EO0A 2AJVH 3GMOB 4NZTL 2XWTB 4XNZB 3BPNC 3MRMA 3RWEA 1JZ5A 3D0LA 3BZ4B 1NFDE 4CDHA 1MY5A 4PJHE 1O0VA 4ONOA 4PJCA 2R1YA 5LG1A 5I18L 3K2MC 4X83A 1HIML 2AJZB 4HBQA 1R3LA 1PZ5B 4XWGH 3CPLA 5CJXA 1YEDB 3PNWA 3GSOB 5DRNA 1J1OL 3V0WL 2IEPA 5BZWA 1JHKH 5D1XA 3OBAA 1EZVX 5C07A 4XZUA 2ZKHL 4KTDL 4HUVA 2G5RA 1EFXB 4WV1B 2VC2L 4X4ZA 5GGSB 2CDFB 1MI5A 3WIFA 1HNFA 5D8JH 5EPMB 5F6IC 2XOTA 3DMMB 2VLRE 4D94A 1VFOA 4TULH 4NO2A 5GZNC 3L3IA 3QWQB 3BWAA 4IRZH 2JCCA 2Z31B 5KJRH 2FGZA 4DUVA 1HSBA 3GSRB 2N4IA 2GT9A 3DX7A 3MNZB 1D5IL 5HYEA 2ZUSA 2NY1C 3KPRE 4ODSL 4OZIB 4JVWA 4YQXL 1B4JL 2X1XR 4OFPA 3WNOA 1ED3A 3OX8B 2R23A 4XNQB 3U82B 3VCLA 1TVDA 4G8GB 2YXFA 3OR6A 2NW3B 2YPLE 5D7JB 4Y2DB 4NZRH 3WLBB 3GMMA 4ZUSA 1EFXD 2R39A 4X98B 4ZO8A 5EU6A 2X4PB 4EUPH 5C8JB 4DW2L 5CJ8A 1ZHLB 4MQXD 2FBOJ 4X6FB 3V6ZA 3BMVA 3DMMD 2FX9H 1RHFA 2WQRA 5FO8B 5ILTL 3FN9A 4LCCA 4QCIB 5IV2A 5K33A 4K3GA 2AEPH 2C1PA 4KJQC 2Z31D 2C3VA 3F58H 1U92B 5HI4C 1UXWA 2I60H 3QPXH 4ZFGL 3MJ7B 1RJYB 4L9DA 1H3PH 4MB4A 4QHKJ 4U3HA 1F6AA 2Z8RA 1DBBH 4E41B 5DWUH 3BZDA 2O5XH 1A3LL 1BFTA 5IQ9B 5IBUG 1T89C 2OP4H 4G8GD 2R29L 2SEBA 2H1PL 4RIRA 3EO9L 5D7JD 4Y2DD 5I8OH 3LKSA 1U8IB 3IDJA 3KNBB 5EOTB 4ZPVA 35C8H 4ZOAA 4NQSB 2IC2A 1S7RB 2ESVB 2G60L 3NCJH 1A0QH 5DD0L 2HLFD 1RUMH 3QUYB 4RMSA 1ZAGA 3WXVH 4QY8B 4EVNA 1SJHB 3DVGB 3NA9L 4NRXA 1BOGB 6FABL 3PP4L 1VDGA 1FDLH 4F2MA 1NEUA 25C8H 4E41D 1FBIL 1X4ZA 1A9BB 5CGYC 4L3CA 1BEYH 1IC7H 3NH7H 2PYEE 3Q5YA 3RTQC 3VFVB 2W60B 4PJGE 3CXHJ 2NTSP 1CD8A 4KTYA 3NZHH 4NQXA 2OR9L 3KDMA 3FFCE 4O9HL 1HXYA 2BVEA 1S3KL 2ESVD 4WUUA 5EIQA 5MERB 1HXMA 2W9EL 4HX1A 1X5AA 2Y36H 3SHSA 5FDWA 1AD9B 3TCLA 3VGBA 3QUYD 4P9MH 1CDCA 1I75A 5I1KL 4WENB 1L9MA 4HG4K 2QQKL 4FQLH 3D69B 2HMIC 1F3DJ 1N2RB 3O3EB 4Q9QL 1UYWH 4PB0L 1T1XA 2J2ZA 2MQ0A 3CFCH 1QPXA 3BIKA 4XVTL 3HAEA 3KPOA 4MCZA 4KPHH 4OD2B 4P2CG 4AENA 3O11B 1KNOB 3TV3L 5TQ0L 1EHAA 4OLZH 1FIGL 5DO2C 5JXEA 4IIQC 3F5WB 4ORGA 3W9EB 2QHLA 1P84K 4GXVL 3V2AR 1CLOL 4TPRL 2R2EA 2VDLL 3MUJA 2AQ3A 1QLFA 3G5YB 3MRIB 2XXMB 4LSRH 4HDIB 4YBLB 2HT2D 3UDWA 3PABA 3CVHB 3L3HA 2BVTA 1HH9A 1CG9A 4ALAH 1IAKA 1U8HB 1S7XB 1WC7B 4HUMB 4NNXA 5FUCC 1MLBB 5EA0L 3ARGC 1RIHL 5HYSG 5D7SL 2X89D 4MVBC 1FO0L 4K7PH 4M1CD 3QHFH 4M7JH 3VE0A 2X05A 3HI5H 3BIBX 5DT1L 3BE1L 1NCBH 3O41A 4ZUUA 2Q8AH 5KSBE 3KPLA 5H2BA 2DKMA 5FYJE 3D1MC 4K7FA 1CXKA 4KRMB 4N90D 5J12B 1YNKH 1QRKA 1RPQA 5BS0B 2FHBA 1N6QH 3X13B 1AQKL 3BPCA 4U6VL 3ILQC 4R9HA 1HHGB 5IKCB 1TDQA 2EYTA 4TSCL 3VFWB 5L2JB 4ZQKB 2XN9A 4EDXB 1BFOA 1IRAY 1DN2A 3QNZB 2DIAA 2BOCA 1D6VL 4HSQA 4LPXA 5TE6H 1JGEA 3KPNB 5JNYB 2XQBH 4R90H 2HH0H 1CFVH 5IK3B 1T04A 5GS0H 2R15A 1F4AA 2GJZB 3F7YB 4Z7VE 3V4PL 1T5WA 4YDJB 4BQCA 4QHLB 4CADB 3CFJB 2X4RB 4PP1D 3FT2A 5GRUL 4XMLH 2ZG1A 4MYWB 1GGTA 5DJDA 3AAZB 3REVA 1PG7H 4TQEL 3P11H 3X11B 4JRXB 2V2TB 2VAJA 3JUZA 3N50A 1I1AA 2VDOL 3B9DA 3CVIL 4LL9A 3VFNB 1FPTL 1IGTB 3RDTA 1NGWB 2H6PB 4OCWH 1HQRB 5E08H 2Y5EA 1I1RA 1VADB 5IMOB 1WT5C 2FIRT 2DLHA 3GSNH 3CFDA 1F3RB 4LCYA 1SJEA 1A7NH 2AK4A 4LF3A 1IC1A 3B9VA 4QRTA 1MWAH 1TCMA 2KUTA 2Y06L 1M7DA 4JFZH 4KXZI 3HE6C 4OCSH 1FVCB 2QBWA 3VXSE 1A7RL 3EFFA 4RISH 3ROOA 3DO7A 1T80A 1PQZA 2NR6D 3GSQB 2BK8A 3RGVB 4F57L 1IAMA 4HXBH 1R5VB 1S5HB 3Q5OA 1G6RL 3L1OH 5GGVL 3FN0L 3WV0A 1R0AH 4JRXD 4YHNA 3B9KA 1FL5A 4HK3N 1I1CA 4D0CA 2QSQA 2AJUH 1BVLA 3EO0B 5D71L 4UINL 5I1LA 5I76A 4H1LA 5TF1H 4GOSA 1EPFA 4NRZB 5FGSA 4QXUL 1MJUL 4ZDHA 4N0FB 4Y4KA 2VIRA 4PLKC 1MFNA 2FBJL 1F4XH 5D96B 3JV6A 4J3SA 5JHDA 3D25B 1YEKH 5E5UB 1NAMB 2Z35B 1UB5B 3OAZK 4QRPB 1CD1B 2VISB 1WICA 4GBXA 1HCVA 5DEFB 4QYOA 1F58H 1UGNA 2HRPL 4XXDA 5T3XD 3RGVD 2FRGP 4P2QA 1P7QB 4D9LL 4OTXL 4BFBD 5JORA 2YWYA 1FZMA 4F15C 2FJFB 2X1PA 4O2EB 2WIIA 4ODXA 3PE9A 5L0QC 1KGCD 2I9LA 1D5ZB 4HIXH 5HYSA 5JA9A 3MODL 3HMWL 3BD4A 1CDHA 1CGYA 3PL6A 4NO5A 3T3PE 1JF1B 3V5DA 1RZ8B 2XA3A 3QR2A 1OAQL 5LXGL 1P5UA 4ZNEA 1A5FH 4JFXA 4K23H 4NFBA 5EUKB 2IPTL 1S7TB 4OIBA 1XGYL 3BYTA 3GGWA 4TRPL 4Z7NE 5BMFL 5KSUB 4R4BA 4KGLA 3SDCA 3VXRE 5HI5C 3MJ8B 1KCSL 3ESUF 4V1DE 1Z9SA 1P7QD 3TM6A 3QQ4A 5JW4M 1GGYA 1JPST 3MCG1 5ISZB 1RZKC 1VB9A 1KPVA 3BP5A 1INDL 1JWUA 1ZHBB 3BKYH 2Y25A 1ZLWK 3STLB 3GNML 3TN0C 1UCTA 2WINA 1W72B 1J1XL 2KH2B 5IVOA 3EYVA 1YMHB 5DEGA 5BV7L 1GIGL 3P30L 1C5DA 5FYLL 5HHNB 2R2HA 4R7NB 4HLJA 1LO3L 4F9PC 5TDNB 2XZQH 5D6DC 5ANMB 5FYJH 5MENB 4JCLA 1RI8A 4G7VH 1E6JH 1X5XA 3GBML 3X3FH 3TZVA 2NPLX 4MXWL 1ZT7A 3RL2B 4X6DF 5F9OH 5ISZD 4LCIL 1J7VR 3RAJH 1F3JB 2ADJB 3WNMA 2WQ8A 1CFQB 4JFQA 2NQCA 5FFLA 4MNGE 4A6YL 4HW6A 5K9OB 3AREB 2BP3A 2EDNA 2BC4A 3OAZH 1T03H 4QKXB 1S9KC 4GAYA 4KY1H 4PYHA 3DBXA 4W6XB 2OLDA 1LD9B 3IVKA 1A2YA 3ULUD 3EYOB 3PGFH 1UH4A 1YN6A 3MNWB 1ETZB 3DSNA 5F96H 2K3TA 3S4SG 5IESL 2MQCA 4PJ5B 2PO6D 2YN3A 3BUYB 4GT7A 1K85A 5IFHL 1XF4A 3O2DA 3U9UA 2C3WA 3VH8A 5GGQH 4WTXA 2FX8L 4UIKH 5MEND 1RUPH 5IVZB 4HZAA 4X8XA 2OTWA 5MEPA 1EO7A 3M8OH 4EOWH 2XRAH 4AG4H 4XPAL 2NY4C 5FOJA 1U3HA 3UBXI 3LRSB 3ZSTA 5GZOD 4LRNL 1IEHA 4LLVB 4RDQF 2AJVL 2Q6WA 3ARED 4KZEH 1CGTA 3BP4A 1I1YB 3MRHA 3FOLA 5EBGA 2KQMA 2WNGA 4PGBA 3TBWA 1NBZB 4XWGL 2IBZX 4ZOEA 4B7IA 2XXCB 1JHKL 2WM0A 1FL6B 4PJ5D 4ZFOL 1IGYB 5J9PA 1ZLWH 2DMKA 4CL7A 4WI9A 4P99A 1U8JB 2R9HC 2CLZB 1ADQA 1P4LB 1ZWIA 2EEBA 1DTUA 1L4IA 1ORQA 2EXWD 4I4WA 1WZ1H 1CGUA 4IRZL 4KI1A 4Z7UE 4UDUA 4EI5B 2EE3A 2GCYB 2UWEA 5KJRL 1TJGH 1KENH 3LRHA 1UADC 2J8UB 2VITA 3QJHB 1E4KA 3V6FA 5ERWA 5F88B 5D7LA 3DHMA 5FHAH 2GITA 4NYLB 1RZ7H 4QGYA 2F53A 4HS3B 1KJ2B 1AHWB 1NMAH 1MRFH 4P23C 5KSVB 2VDMH 1H5BB 2CUIA 3ULVE 5FF6A 4NZRL 1JL8A 1F4HA 4Y4FA 1YC8A 4GAJH 1FFNB 2NY6C 3VI3F 3OPZH 4RGMB 4GW1A 3DX8A 4N1HB 1FSKB 2C3HA 3K8LA 4R0LB 2NY5H 3NIGF 3RZCC 3EOTL 3OKEB 2FX9L 1KC5H 2YA1A 5C09B 4BFIB 4S1DD 4XVUC 4BZ1H 2BY0A 3J7HA 2AEPL 2F5AH 4EI5D 3F58L 3QI9C 1YY9C 3EJZC 2I60L 3QPXL 5FYKD 4H1LH 2RAMA 1H3PL 4KJPC 4YLQT 1UJ3C 4J23A 4CJ0A 1FN4A 1DBBL 3WIIH 4OQTH 2ADGB 5DWUL 3U6RB 2O5XL 4W4OC 2OYPA 4KDTC 1IM9A 5D1QB 1MSPA 2CKBH 4I2XE 3LKOB 3JUYA 5DK2A 3W81A 5I8OL 1ONQA 2AEQH 1LK2A 4JPWH 4LBEB 2APBA 35C8L 5JIHA 4L4TB 2H26A 3DYOA 3HC0B 5EBWB 1EV2E 2NZ9C 2G5BA 4DKFL 5FM8A 1JPSH 1MCJA 3NCJL 4OAWA 1A0QL 4KK5D 3E8UH 5FO9B 3O8XB 5FK9B 3MJ6A 1NJ9A 1RUML 4MD5A 1L7IH 4HWZB 5C09D 3WXVL 4UAOB 5HTSA 4TOYH 3LN4A 3T0DA 3V5KB 5CBEB 1AXIB 5J11B 1BWMA 4YPGA 1GZPA 1B90A 2WUBH 1FDLL 4HIJB 4YXKH 3S4SA 4K8RC 25C8L 3FFDA 3R8BB 4P3CH 3IXAB 2XKSA 4HCRA 3QT2A 3BQUB 1BEYL 1OGAE 5F44A 5D1QD 2HFEB 1IC7L 4KKBD 5HDBE 5F9DC 1G7QA 2IPUK 3NIFF 1LWRA 1GL4B 3DECA 3NZHL 5EC2A 2PKDA 4L4TD 3RWFA 3IU3B 3UO1H 3C5ZA 2X7LA 4QHUB 1IL1B 3IXTB 5T1KA 1VESA 1EFQA 3K81A 4NBYB 1OAZH 3O8XD 1C12B 4P9ML 5IROC 2BRRH 1KXQE 2XKNB 1GSMA 2EE2A 2FEDC 5HVFB 5D6CA 3OKNB 4DWHA 5JOFB 1QRNE 2Y72A 5IB5B 4FQLL 1YDPB 3ZKQD 1UYWL 3JWDH 2DKSA 3TVMB 3BXNB 4BKLB 4RGNE 3RL1A 4ETQB 4DK3A 3CFCL 3BQUD 1MRCH 4Z7QF 3MLWH 2PXYB 4KPHL 4PRDB 2GK0B 4M9PA 5GRWA 4OZFG 2HG5B 4C57C 3ZHDA 1NFIA 3MR9A 2YD6A 4J8RB 4YZFE 2NCMA 4OLZL 4Y19A 3ZKMC 4JEGB 1NGZB 2VLME 4LNVA 3VXUA 1CDYA 1TNNA 3S36H 5C0EA 3ARSA 4LSRL 1CFBA 4QHMB 3UTOA 1U42A 1M6OA 1EBAA 5DJZA 3PDOA 4N8CH 4H26B 1CL7I 4ALAL 1UC6A 4D2NA 3H9HA 1NEZB 3BOVA 5JPNB 4FFZH 2NMSA 3T0EA 3QFJB 1R5WB 3HA0A 3QHFL 4M7JL 3TVMD 1K8DB 3N9GH 4POZC 2DQGH 3HI5L 3QQ9D 4YDVB 4O58H 3MRKB 2ADIB 3GHEH 1NCBL 4WTWA 2Q8AL 4U4BA 2PXYD 5L2KE 1PW3A 3NCBB 3V7AG 1YNKL 1X5KA 3FTGB 1N6QL 2CIKB 4KKLC 3ARXA 5JQ6H 4G9FE 2WP3T 3NCYS 3V52H 3BJLA 1DANT 4RA0C 4PD4J 3H3PH 2CK2A 1EIBA 5D7IA 3VXMB 1IEBA 3BHBB 2GFBA 4HJGB 5I1AB 4JAMB 1U58A 1WIUA 4PR5A 4XPBH 3GJFK 3GIZH 4UNUA 5TE6L 3KLHC 2FD6H 3U7WH 2XA8H 2XQBL 3FQRA 4R90L 1CFVL 5GS0L 3DIFB 3QFJD 3RWJA 4TTGA 4FQXC 3BPOB 2JF1A 3WBDA 1FVEA 4OGYH 3R8QA 3H9SB 5HYFA 2AKRA 2CH8A 4BK4A 4ODUA 1NBVH 1JJUA 5KOMC 2NXYC 3I6LE 4XMLL 4Q2ZB 5A16A 1A22B 1A7BA 3BDBA 3ULVH 3CDGB 2C3GA 4UILH 5KVFH 1PG7L 4L9LB 3P11L 3SPVB 5IG7B 1ULVA 4XI5D 3Q1SH 3VXMD 2DTSA 1E4WH 5C0GB 1UT9A 3TT1H 2YKLH 4FQCH 3Q0HA 4OCWL 3UJIH 3W39B 1HHHB 5E08L 3MV8A 3PWLB 4YK4C 1YQ2A 3C09C 1GGUA 3NA4A 3GSNL 2NX5E 1N8ZB 4PP2B 1P69B 4N9GB 4Z7WE 4X8JB 2IBBA 3O3DB 1Z6JT 5I2IA 1MWAL 4JFZL 3ZZ1A 4OCSL 5IEKA 4X7DC 1MCWM 5GS1A 2IPKA 3EDEA 4OSUH 3V8CA 4RISL 5CUSH 3H9SD 3MBXH 1T1WA 4ZOCA 2IQ9L 4KK6C 4O2FA 5E7BA 4HXBL 4XX1G 1NMCC 3VMPA 3BYYA 1KEML 3QIUB 5L88H 3L1OL 2GJJA 4NJ9H 5CWSB 3HG1B 1R0AL 3S3SA 5FKAB 4PJ7B 5GGUA 5ID0A 4LGPB 4MJ2A 3I50H 2B0SH 4FXKB 4KV5F 5GIRB 5SX4H 3MLPA 1EHNA 4K55A 1K2DA 5J1SC 2YEZA 5F7KC 3QDJE 3BW9B 5TF1L 4IBLT 4OUOA 4M9OA 2FIKA 1WVZA 3TYGL 3KPMA 3KYOA 2DL9A 3MGOA 1CFTA 1XIWC 4QHNA 4WEBH 2NNAA 5DTFB 4PJFE 3WNKA 5KZCB 1F4XL 1T0MA 4FMKA 3V7MA 4NJAH 1YEKL 1AP2B 2A83A 2HLAB 5IR1B 3K4AA 1F58L 3EOAB 4U49A 1EXUA 4FTVA 5EZOH 4AIXA 4NP4L 3DUUA 1BX2A 2FJHB 3MOBH 3QIUD 3EZJB 2QEJA 3BZFB 1PY4A 3HG1D 3TESA 1DE4B 3PIQA 1TVHB 1U8QB 3T77B 2E3VA 4QRQB 5C71A 4HIXL 1ZA3A 4P2OC 5T5NF 3F7PC 2X6MA 3M45A 2DQFA 1CXLA 2IH3B 1QACA 1EA9C 1MUJA 4N68A 3S35H 4BQBA 3O3UN 3E3QE 1VEPA 5KZCD 1A5FL 4K23L 1MQ8A 4KWUA 3BFOA 5D2LE 5D5MF 4ZMAT 1KCUH 1F11B 2G75B 1VFBA 4BSJA 1BQHB 1IKNC 1T20A 2BSSB 1MJ7H 1BOYA 2W59A 1DLHB 3PQYB 4MS8C 2H2PD 1JPTH 3NABH 2PYFA 1D5XA 1KJ3H 4TSBH 3GMNA 1IGFH 1AXSB 3BKYL 4ONFH 4P46B 4IRJB 5EO9A 4F7MB 1NPUA 1ZHNB 3DX6B 3H3KA 3QYCA 2IAMA 5TH2B 3FB6B 1WJ3A 1S8DB 5IOPB 4PJIA 5C92A 2EIZA 2OR7A 1DBJH 2XZQL 2OTUA 3ZE2F 4BQ9A 3TH4T 1MCEA 5FYJL 5TPWH 1L6XA 4NQDB 4DGIH 4G7VL 1MCBA 1E6JL 2AS5M 3X3FL 3PQYD 4X7EC 2D7NA 5BXFB 5F9OL 1IMHC 1VA9A 4F3FB 3BPNB 1HYSD 5EB9A 2P5WA 3B9EA 3P2TA 4P46D 3IDYB 5F9AC 4IRJD 1Q9OB 2O5ZH 1CGWA 1T03L 3PWPA 4OFIA 4KY1L 5IHZB 1RSFA 2X5PA 3EYFB 4XCYB 4NZJA 1OAYH 3PJSA 3PGFL 3SDXA 4WHTA 3AROA 5F96L 1EO5A 1C7TA 4N5ED 5EZJA 3OG6B 5CSZB 2UYLA 1XCTB 5TDPB 3OQ3B 5GGQL 3CUPB 3BGMA 4CJ1A 4OLEA 4UIKL 2R0ZH 1ZLVK 1UXSA 1RUPL 1A1MA 5F6IB 4J2XA 4D3CH 4HPYH 4L4VE 2BVPB 4ZXBC 1Y0LB 4EOWL 2XRAL 5IW6B 4CN4A 5F70A 3BPLC 4J3WA 1IQWH 1G6RB 1FVDB 4PJXA 3L7EA 3ARRA 5CIPA 3ULVC 5DMKB 5CP7B 1HINH 2ARJB 4KZEL 5ESQB 1AO7E 1L0XA 5HHXH 3D3VB 1I9IH 3QUMH 1Q0XH 2AV7B 4YBHA 1AKJA 1XZ0B 2VZUA 4HG4J 2W0KA 2DTMH 1XGUA 3AS3A 3DV4A 3BO8A 4OLXL 3QEQE 3MRLA 3JV4B 2F8OA 4K71C 1YPZF 3LN5B 2D2OA 1EHXA 3K7UA 1RIUH 1MHEA 4EKXA 1UM4H 3MV7A 1D5MA 5IHUL 3CXDH 5GZND 2UZXB 4PG2C 5C0AB 2B5IB 1KT2A 3DYPA 3NCCB 5EBLA 2V5YA 3FB8A 4P5MB 4UT9H 1WZ1L 4MSWB 4S2SA 4BUHA 4LEOB 1TJGL 1KENL 1P7HL 3B43A 1M05A 3D3VD 1Q9LB 5AAWA 1A6TB 4K3EH 4JZOA 5FHAL 5GS2D 2EIEA 5TE7H 1RZ7L 5KS9F 1YJDC 3ZT7A 1NC2B 2GY7B 1NMAL 1MRFL 1U93B 1GPOH 3FQTB 3MRQB 4CN6A 4YR6A 2VDML 4PJCE 3VFTB 5CD5D 3ES6A 4LLAA 2BX5A 2AXHA 5DJAA 1T3FB 1GZQB 4WU7A 3QEUA 4GAJL 2ATPB 2YBRB 5E9DA 3W11C 3OPZL 1IT9H 4PJBF 3MRGB 5C07E 1HWGB 1VGKB 3TH2T 3QFDB 3PWVA 5C0AD 2NY5L 2W65A 4KJQD 3SY0A 3MROB 1KC5L 3LPFA 4Z0XB 3SGEH 1CE6B 1MI5E 1KTDA 5HI4D 4BZ1L 4E5XA 5EH1A 3HLAA 5F7HA 4NNPH 3ZDXF 1KTLA 2F5AL 2D7PA 1WZMA 4PV9B 5C0DA 5EULV 1CQYA 4LSVH 1UKQA 4YBQC 1EVUA 3WIIL 4WW2C 3HZVA 1J87A 4OQTL 2V9RA 2JCCE 3RTQB 5AZEL 4WFEE 3TNMB 4I3RH 1ZTXH 1NC2D 4LPUA 3WS6C 5LKNA 1O7SA 4OZ4B 5BV7B 5F9JA 2CKBL 2CK0H 4HUUB 2BNUA 2YHGA 5CEZE 2AEQL 1I7UB 4JPWL 1PAMA 5GSRB 2WBJC 4HH9A 2YPVH 3TYFB 3IKKA 1YMMA 1RHHA 4Q9CA 4R96B 3L95B 3FRUA 3U79A 3E8UL 3O9WB 4GMTH 1NGQH 1L7IL 4U1HB 5DUBB 5EU6E 1JBJA 4WFFE 2IGFH 4TOYL 4ZAKC 2B4CH 3UTTB 3EHBC 5E00B 3KPQA 5IM7B 3QG7H 3QXTA 4CW1B 1QHOA 5EC1B 5CGYD 3LS4H 2WUBL 2DS4A 3HUJA 4M8VA 3GMOA 4YXKL 4B41A 1SEQH 2ICWI 4P3CL 3RTQD 3CH1B 3BZ4A 2P44B 1RK1B 5F93C 5DFVC 2HN7B 2QADC 3G6DH 4IOFC 3ZO0A 3GSOA 2F54B 2HKHH 5E8NB 3UO1L 3C6LB 3S98A 1KLGB 2CGRH 2ENYA 3PHQA 3B5HA 2AEIT 2BRQA 2LTQC 1OAZL 3O9WD 1ZK9A 3JXAA 3ARGB 2HMID 3G6JB 2BRRL 2LAGB 5GGSA 1GGCH 2CDFA 2GQHA 2M26A 2O26U 4X5XB 4P49A