1U95B

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide eldhwas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u95B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u95B01
2E9BA 2AXGB 1K4CB 3CAFA 3O6FD 2VDLL 4ODWA 4PJBB 3U0PA 3GSXA 2WBJA 4K3GA 5EZJA 2PTVA 1YEGH 3X3GH 5T1LD 3H2WA 5CEXB 5FO7B 2EKSA 1MQ8A 43C9B 2C3HA 1EHNA 2FEDD 2FRGP 3U4EB 1QBBA 3D39D 3KXFB 4EN3C 4Y4KA 1IM3A 5C0EA 4XP9H 4MA3A 5JMOC 3NH7H 4ZAKC 4H0GA 5I30L 1OQOA 3MBEC 4PJ7A 2XZCH 4S2SA 3PWPB 5T3XL 5DT1L 4LFHG 4GRWH 4JZNA 1JN6A 2OTPA 4K7FA 2BNRB 3DRQA 4HT1L 5KTEH 5HBBA 4P3DA 3AMKA 2P8MA 4OQ1A 3SE8L 1A4KB 5D7LA 4TN9A 1GCFA 4IRSA 2X4TB 3PV7A 1JPST 3VWKB 4G9FB 4Q6IA 4NKIL 4M7JH 5F1OB 2X1XR 2GIYA 3HUJA 4WJ5B 4LCWA 3Q5TA 1LE5A 1FL5A 2XKNA 4UAOC 3RJQB 2EYSA 4F7MB 4ONHA 2VE6A 4WV1B 1BREA 4IOFC 5MEPB 2ATKB 4YGAB 5IHUH 3DBXA 3WJLC 2FECL 2ILLA 2M2DA 3HNVL 5ID0B 3QQ4B 1FYTB 3CLEH 5I9QB 2FATH 2OP4H 5FHBL 2Z93A 4JANA 4X6DB 3BP4A 1X5HA 4FQPA 4NHCH 1MHEA 4M7LL 2PW2A 5B38A 1NMBH 3BDBA 4PJCF 4Z7WF 5ESAB 1AJ7L 3VG9C 1QBML 1GPOL 1EEYB 4XTRD 1G1YA 5EOCJ 3HZMB 5IMKB 2YZ8A 5DR5H 3RIAK 3BISA 2LFGA 3VCLA 1NANH 1A9EB 2MSPA 4JAMB 4X5LA 1MCOL 4ERSH 3N85H 4O00A 2A6JB 2PTTA 4PBWD 4PJ8D 5CJ5A 4YHPB 4C57C 2D0HA 4TULH 2W0LA 5C07D 5EZOL 1NGXB 5HYEA 2CIKB 3VXTB 1GRWA 1AQKL 1AGDA 2HWZL 1A9BB 4X6DE 5KN5B 1QBAA 4IJ3C 1U8OA 1ES0B 3BUYA 4GG6B 1OHQA 1UCBH 1PG7H 4Y1AE 8FABB 2XTJD 3MRFA 4PJBF 3VA6A 5HVHC 1RFDH 4XMPH 5SWSE 3VXOB 5GGVH 5A2IH 3B5TA 4PJ5E 3TBVB 2H6PB 1NCDH 1A6TA 1EHAA 4MXWL 1YY9C 1KEGL 1FO0A 1H3PL 1WIOA 1TZHA 1Z2KA 2OTUA 3VGGA 2OK0L 1FJ1A 2VDRL 1IAIM 2NXYB 4P46B 4PB0L 2YD8A 3AS2A 5F7KC 3T0EB 4HKXA 3U9PH 4GMSL 3QEUA 2IPUK 1XGYL 1TJHL 3WLBB 3IDUA 2L7JA 3OF6A 3FOLB 1ZLUH 1WWBX 2BX5A 2HFEA 3EYOB 1U8NA 4KHXL 4OF8A 2CRIA 3EOBA 2P1YA 4ZUTA 5L9DL 1BX2A 1VA9A 3VXUE 4GG6E 2L4OA 5HXMA 1PYWA 3QDGB 1FG2B 4JEGB 3RIFF 2ICWB 1L6ZA 3P30L 4N0FB 5FGCE 5E1AB 1CFSB 2ZJSH 1P69B 3LKOB 3NABL 5DTFB 1I7UA 4QOKB 3SDCB 3OR7A 4RMQA 2FX8L 4BZYA 4M1DL 5DVMA 2Z0BA 1SYSB 2VZTA 3WV0A 4NO5B 4P3CL 4F58L 2NY2D 3OKMB 3MLXL 1JYVA 5FECA 2EDXA 3L7FB 2GI7A 3V4VH 2AJUH 4XBPA 1V7NL 4PRAB 4Y16A 3O9WB 3IDJB 3VFOA 1G6VK 4NQCB 3QO0A 5GRXG 1EO7A 1S7XB 3DARA 2SEBB 4ZDHA 3ZYIA 5CEZE 4P2RD 2XZAH 3WO4B 4X6DF 1YJDL 4PR5A 3ZE0F 2X6MA 4KVCL 4XVUC 3DO7A 1MLBA 2XWTA 2PKDA 3QDGE 1JIBA 1INDL 5C0NC 2KL6A 2KUTA 5EU6D 4LHUG 1IARB 4LARL 4HZAA 4E41D 1QBLL 2RR3A 1MRDL 2ZUYA 2R0LL 1YY8A 1VADB 4M1GH 3QUMH 4KWUA 4XBEL 4JPKL 4WFHE 4AH2A 2I26N 2HVKA 2BFVL 4X7FC 2QSCH 1OGAB 2B1AL 5CJOH 3BPCB 5E8OA 2HAZA 5HHQA 1SQ2N 4JFYA 2O93L 4NRYA 4MXVF 2A9NL 2UWEE 4XPBL 3BGFB 1EJOH 3HRZB 1S5HA 5HHVL 4U3HA 1WZ1H 4ZPVA 1WAAA 3MNWB 4G80B 5HDLA 2ZOKB 3OG6B 3FRUA 2ADFH 4MS8D 5DLML 3AUVA 4R8WH 3BHBA 2X1WL 3QUXA 3ECBA 1VKXA 1U2CA 2VLKA 3V6OA 2P46B 4MB3A 2J1KA 4GG6F 3C2AH 5D1XB 1QEWA 3K2UL 1FNEB 4F9PC 1UCTA 1I9JH 4U6HA 4U7SA 3TVMA 2Z92B 3B9DA 1EGJA 1LVEA 2YR3A 3RHWK 2VL5B 4XBGA 4V1DD 3VRLE 4I77H 4U1KA 1GXEA 3FQXA 4ZS7L 3MV8A 4XPHH 2YPVL 4JFEB 3GSRB 2GUOB 2EEDA 3QXDA 2BC4B 1ZLSH 2BSSA 1RU9L 1ACZA 5DK2B 3SJVD 4R4ND 2QADB 1A0QL 4FABL 4FTVB 3TIEA 4QLRA 1OP9A 3DVFA 3LVEA 5I1LA 2FD6L 1ORQB 1KV3A 4YXHH 5D2LA 2OJZL 2VIRA 4P5TA 4NDMA 1F8TH 1G0DA 1M05A 4PS4L 3X13B 1YMME 4Y19D 3L5HA 1EBAA 3TJEH 5DURD 3W0WA 5HY9B 4NNYA 2FZ3A 1UM6L 1XF2B 4ZD3L 4MNHA 1FYHB 3VI3E 4OFYD 3TBYB 5DJ2A 5IV2B 5D7IE 4OGXH 2KZWA 5I2IB 1PLGL 4KJPC 5FKAA 5K93A 3I2CL 3GB7A 1IGIH 2DWEB 4HUXA 3BEWB 5CP7B 3JV0A 5JUEL 3PABA 2FJGB 5I8EA 1FVCB 4NSKB 4PRBB 3DYPA 3DO3A 3QIWA 3BKMH 5ETUB 5CJXA 3LIZH 4P9HL 5HHOE 5EUOE 3TZVA 2R56L 4M62H 3RX8A 1MCIA 3S8WA 5HHNA 1Q8MA 1KTRL 4MD5A 5TH2B 3H9SA 1P6AB 3PP3H 2PYFB 4NJAH 4U6YA 1XCQA 4LIQH 1WUNT 1FPTL 3FT2B 1DFBL 3VXRA 3T65A 3GMRA 3RBGA 5HGAA 5FYJL 3DUUB 1U0QA 5FDYA 1MHCB 4LF3B 4G7YH 4PGZA 3VRLF 3N1PC 4FZ8H 4O02L 3OBAA 1CWVA 5ALBL 1R3LA 4IRZL 2G5BB 1DCLA 1W2KT 4M00A 1S8DA 1JPTH 1EUTA 1NC2B 2X4UA 3HMWL 4WTWA 3SO3B 4YHKL 4M3KB 4WHDA 5KS9A 1YZZA 5EO9A 3MLYH 2K9UA 2WQ8A 1JWUB 5MENA 2C4XA 2MHAB 3QDME 2BNQA 3MROA 3GHEL 3L3HB 5ITFA 1CU4L 4O5LL 3EYSL 1R3JB 3THML 4K94H 1VB9A 5I66B 4CVZB 5I1CL 3JWDH 2CDEB 5C0BE 4GBXC 2QKIA 2I9LA 4LAJH 1FAIH 4LVOC 4HUNB 4U1HA 1G9MH 3W82A 4FQCH 3HE6D 5SWZB 1JYXA 2H32H 1NBVL 3N50A 1XF5A 5K9KB 3JTSA 1HXYA 2Q76B 1ACYH 5JOPE 3T4YA 4R96A 1FBIL 3LY6A 2XIDA 4H25A 4O58H 4QT5B 2GT9A 4ZFGL 2ESVA 3TWCH 3CXDH 2NY4C 4LLYA 1RUKL 4TVPD 1UZ8B 5ESQA 3C9NB 1M71B 5LGJA 4OFDA 5D9SA 5L88H 3RWEB 4Z77A 5I6XB 2FHCA 4OZIA 4KMTH 1JGUL 4YK4B 5I71B 3P0VH 3MR9B 1FHGA 3D6GA 1KIPA 1BD2B 3FN0H 4AL8H 1EHLH 2F58L 1S78D 4PGEA 4K8RC 2QQQA 2B0SL 1HEZA 2F19H 2ADIB 4XB7A 5SWZE 5K9OA 3WIFA 3IFLH 5I1EH 1GGIH 4LVHC 1E4KC 3BZEB 3MUZ1 3TYFB 2VDNH 5IB4B 4WFEE 2ZUUA 1FN4B 1V7MH 4NO2B 2VLJE 1P4LA 5F97E 5F7MC 4P2QE 1A1OA 1FVDA 2D31B 2HN7A 4GXUN 2APTA 4X6CE 4GUPA 5HI3C 4FQQA 4MD4B 1E6JL 3G6DH 1PEZA 5FYLL 3FQRA 2OR9L 3MRJA 4HS8L 5A1AA 2VR5A 1ZTXH 1LO0H 2X70B 4RRPA 4D9QD 4GS7B 1KT2A 3BMVA 1NL0H 4Y4KD 2HRPH 4NWTL 3V4UL 1D5BB 4R7NA 4Q2ZB 1MFBH 3OPZH 1F3RB 2P5EE 4UQ3B 1FZKB 2AK4E 4CN1A 3GSUA 4QCIB 1HHGB 1HHKB 4YEFA 5D7LD 1C5CH 2K1MA 2XN9A 3UTSB 4IRSD 4HGKC 3FRPG 5C08D 1NEUA 2BY0A 1CLZL 1J88A 1DBMH 1UM5H 3H9HB 2GTWA 4N0UB 4ODUB 4LCWD 1B0RB 1D5MB 3MLVL 3NPSC 4GAGL 1NUDA 1AC6A 3KPSD 4EN3B 1HHIB 3KHQA 1MVFA 3MRBA 4PGCB 3C8KA 5KBNC 2PN5A 4O2FB 5GJTL 5D1ZD 3P77A 1FV1A 4PJEE 2AJYL 3ARWA 3RU8H 1ZWIA 3NZHL 5FYKD 3HAEB 5BJTB 2LV4A 4XAWH 4J3XA 2OR8A 5ICZA 1T7WA 2GFBB 2X7LB 3BKCL 4LLUA 1H5BB 4JFDB 5GS3A 5T5NG 1KGCE 3DSFH 3O2VL 3SGJC 5KSVB 4ODHH 3WHE0 3O45A 4J3TA 4DN3H 3QHFH 1PZUB 4FQLL 3W9DB 4K23H 1VGKB 2X09A 3UO1L 1YNLL 2OI9C 1AQDB 1QSFA 2EE2A 5EORH 5L6YH 1IGFH 2IH1B 3WNPA 2V17L 5DK0B 1LO3L 2DBLL 3FB7B 1DANU 4DUVA 4HH9A 1T2QH 5I1JL 4HJJH 1N6QL 2DL9A 4N8VA 4YX2L 4K7PY 3DLQR 2R69L 1N3NA 4NQSB 1MAML 2H9GA 1ONQA 5DVKA 4YNYA 1XF1A 4HS3B 1BBJB 4JFDE 2QSVA 3PWUB 3BQUA 4YPJA 1H3UA 1A1MB 1UXWA 3UJIH 3IDXH 3OG4B 5DHYA 1QQDA 3R1GH 4KI1A 3VXNB 3IVKA 3FO2A 4PJAE 5HYJA 4HV8B 1EXUB 5IVXE 4GRLC 4UINH 4G6MH 1I8MA 4OLVL 4WENB 1ORSA 4OCYH 1BAFH 2R0KH 1LDPL 1HHJB 5SX5K 4NKMB 3OF6D 4NJ9H 1CZ8L 3B8YA 3U7YL 2EZ0D 1VERA 3INUL 3AROA 1E4XI 3QUYA 5HGBB 5GRUH 3ES6B 1SJHA 1ED3A 5HYFA 4IJ3B 2EDNA 4FNLH 4NC2B 5C0FB 5IB5A 1PG7X 5I8KH 1CL7H 5BW7A 4QRPB 1DDHB 2C1PB 4JQIL 3JWDC 3QIBC 4NN7C 2DOCA 3U82B 1WK0A 2VZSA 3SE4A 3ROOA 1S5IH 2AEQH 3P9MB 4TYUA 1T7VA 5GSVA 1U92B 4PYHA 5DQJB 1G9MC 3GBNH 4IS6A 3MRIB 1BM3H 1KLUB 4K9EC 5GS1A 4AM0B 5CIPA 1MI5B 4D8PB 4Y16D 1C08A 3N1GC 3DUSA 3MYJB 4NIKB 3VRIA 2CRMA 1R3HA 4PJ8C 2VXVH 5DUMH 4CMHC 4JFZH 5T33H 3I84A 3QHZH 1GYAA 3UTTB 3RKDC 2ZUQC 1JGVH 2XY2A 4QXTB 3U4BL 1U8KB 4FQXA 4WWKD 3S37X 1X5ZA 4A2LA 5TE4H 3FOMA 3CH8A 4ORZC 1NFDA 4I18A 4MX7B 3L3DA 1KJ3H 2XTJC 2XWJA 1G7JB 1LO4H 1UB5A 4J1UB 4X98B 4QXGL 1YDPA 2VXQH 1T0PB 4F7TA 4WU5A 2V7HA 4KJYB 5DJDA 4JRWA 4OF3A 4OZHE 3ZDZF 5E2UH 3CFCH 3HZYA 1ZHLB 5E8EB 3ULSA 4LLMA 1JTOA 5TDOA 2Y25A 4L5FH 2A2QT 4CVXA 4PY8J 2NY0B 3UTTE 5C0RH 5C92A 3QUXD 4WNQA 2GJ6B 3A0OA 2D2OA 3MJ6A 1B0GA 4FHBD 2X4PB 2A1WH 2VLKD 2DQGL 5F3BA 4FN0A 5EO0B 3PWVA 4XC1H 1LEIA 4DN4H 1ZT4B 3IJYA 2I07B 1UWGL 1AGEA 4NN5C 4PLJD 1ZHKA 5DRXB 3MRRB 4P59L 3I50L 5TE6H 4PY8I 4MJID 1WIUA 3MV8D 4HWBA 3RZCA 3MGOA 2HKFL 4NUGH 4JGMA 2I5YL 2E9WA 3TA3A 4GSDH 2A9ML 5L2KD 3B9AA 2FDBP 5HGGS 4EVNB 3TBWB 1J1PL 3I3BA 1WT5A 3RNQA 2ZCLL 1YEIH 3GM0A 1MLCB 2V9RA 4AG4L 1T0MB 2WWMC 2G75B 4ZUUA 1S7WA 4C59B 5IOPB 5DHVA 3UYRH 1HXMB 3LN9A 3FHQA 1HSBB 2X4OA 5I17B 4M6NH 2G9HB 4LNRB 4KKNA 1NUNB 1N8ZA 4P5MB 4F7EB 4YHLH 5JIPA 5EH1A 5IJVB 4Y2DD 5E9DA 2AI0H 2ZZUT 4UT7H 3ZSTA 3CFKB 4C83B 1U58A 2IPKA 3IDNB 2F53A 4M6OH 5EOQL 1TVBA 3Q1SH 3G5XB 4G9DB 1HDMA 1RV6X 4GRWB 3IDMA 1Y0LB 2X4QA 3G6JB 2EE9A 3MRMA 3TZVD 4UUJB 5GGQL 1CDJA 4TSBL 3SKJL 4NQED 5IBUB 4HFWA 4JY4B 3DGCR 4MS8C 3H9SD 5C2UB 4YEEA 4K3EL 4KHTH 3U0TA 4ZO9A 4L8BA 3NPZB 5EU4A 3FL7A 3GMPA 1T89A 2DM3A 4FFWD 4F80A 3L6FA 2LAAA 1EEQA 3AFLA 1XF3B 3WDIA 4KZDH 1NMAH 1HH9A 2EDKA 3NN8B 1HINH 1T20A 2IAMA 2J5LB 2DQHH 5E4EB 3TT1L 3CZJA 4LAQL 1A6ZA 5KVFH 3JV4A 4HK0A 2NY7L 2CSPA 3L5JA 4GRWE 3DVNA 2P7TB 4JKMA 3GIZL 5DD3H 4LLVB 2NZIA 1OAKH 2MCG1 4U1JA 3QPQD 5BZDA 1F4WH 4HPYL 3RVTD 4DTGL 4UOW1 1NCDL 1QR1A 2BNQD 1W0WB 3O3DA 3AAZB 3VE0B 5I1DA 3RGVB 1KUMA 2OSLB 2V2XB 1EA9C 1RIUH 2FLRT 4R7DA 2FO4A 4MQSB 1IGTA 2DL2A 2VDPL 1LNUB 3FN9A 5CMAB 5FYKU 3K3QA 2IBGA 3MRNA 4KVNL 5B3JF 4G7VH 2EIZA 3QXTA 3ZHLA 3I6KB 4WUUA 1Q94B 1LK2A 2BRRL 4LVEA 3IKCB 3BP7B 1FL3B 3TH4T 3O3EB 1VFOA 2NY1D 4AEHL 3EYVB 4JJHA 3S37L 4OI8A 2E9IA 4FXGA 2BXYA 5CCKH 3T0DA 2CPCA 1F4XL 4BZ1L 3MRPB 1WFTA 3EOYG 2CMRH 3BP5B 4JM2C 5F44A 5IUSA 5EOCH 1CXFA 4Z8FH 1A21A 2E6JA 3VXQB 2J88H 4GAJH 4KY1H 4JHBA 4GW5B 3FFCD 2YZ1A 3LQZB 3ARFD 3CJJA 2X4RB 5EA0L 1FSKC 4Y4FD 5C09A 4QXUL 3HC4L 2JIXB 3MGAA 5F7DB 3RBSA 2MPAL 2XA3A 3STZA 4Z76A 1QHOA 5BOZG 1MRFH 2AJ3B 1OP5H 2CKBH 3OKKB 1H9VA 4QRRB 1RZJC 5BZWA 4KRNA 2F54B 1CFQA 4EDXB 1AP2A 4KK6D 5IB2B 4GRWF 2NW2A 3L5XL 3G6JF 4E5XB 1NGPL 4WI4A 3IJSB 5IQ9B 4OSUH 2NY4B 4YPGA 2D03H 1LEKA 4M1GL 1WFNA 2HT4D 4N90E 3TO4D 5I74B 3V6ZA 3OKDA 5EC2B 3LS4L 4DGVH 1SEQH 4ZO7A 1CDHA 1A6WH 2WUCL 1J0YA 3MBXH 4EJ1C 5C8JB 4GQPH 3GHBL 3F6LA 4PG9B 2QHLA 3LH2L 4FQIL 3ZO0A 2IPTH 4P2OD 3L9RB 1CT8B 1P7QA 4R8WL 2Z31D 3SE3C 5C9KA 1Q0YH 2RFXA 5D7JA 3HE6C 5DJ8A 4YZFE 4I0PA 4LFHD 3C2AL 3SKUD 4ZOBA 3K4DA 3UZEA 4X83A 3MA9L 3ALXA 2XQBH 1EZVX 5IMOA 4C54A 5FFLA 5E6IB 1PKOA 2DD8L 3P9LA 4JLRB 4ONFH 1LK3L 1CFNA 1DZBA 3O11A 3MNVA 4BSVA 3QNZB 4F37F 4G6FB 3VFUB 3QDHA 5DGQA 4MWFA 3QUMB 3RWIA 5CJ8A 5ID1B 2R9HD 2EDEA 4I3RL 1UWXH 3G5VA 4MNQB 1MIML 5C0IB 3NAAL 4PD4K 2W9EL 1I1RA 1PKQB 3BPLC 1KIRA 1XEDA 3TNNB 3HCVB 3OAUL 4JZJB 3PJSA 5E2WL 3I6LD 4I0CC 5FGRA 4C55A 4YXHL 4BKLA 1EK3A 1F8TL 1CDIA 5CINL 2G2RA 1U3YA 3L3IA 4CJ0A 4NBZB 4RSVA 5GS0L 4JG0L 4I2XB 5ITBL 2E7LC 3FB6B 5JMRA 4LLQB 3X14B 3KNBA 4NQUA 4XRCA 1RZGB 1T5WA 4B5EA 4L4TD 2Q7NA 1T03L 4ZNEE 9CGTA 1JF6A 1FZOB 3HNSH 3WIHL 4G43A 3QSKB 2IQAA 3OV6A 5EBGA 1X9QA 4N1HB 1SEBA 1U8LA 1AGBA 4TQEL 3JWNC 1QSFD 4FS0A 1N5AB 3ZKND 1RUPH 4M9PA 4XI5D 4YHIA 1LP9B 4HQQL 1PGRB 1L9MA 3ZKSD 3UEZA 1JGLL 3E6HA 5MI0B 4NT6B 4FFVC 4HC1L 2YC1A 3QQ3B 4NJAL 5KSAA 4EI6B 2FGWH 5IMMA 1QFHA 3ULUD 1HHHA 5LBSH 3S98A 3WFDH 1T04B 4NPYB 2E6QA 5T3ZL 5HYSA 1ZT7A 4YIQA 4CGTA 4FZ8L 5AZ2L 4LEXL 1U3HB 4JN1H 3CFDB 4OF7A 5DZOA 5F1SA 4DKAA 4OQTL 2A77H 2QEJA 3FHAA 5I1IH 4L4VD 3MLTB 5FM4A 5LWYL 3CCHB 3GMQB 1NFIB 5HDBE 4LBEB 1EO8H 3C8DA 3VFMA 4FXKA 4X5XB 1SJVA 3ZTJG 1ZHBA 3H42H 1OAXH 4BFBD 4XWGL 4OF6A 4Y4HD 1I8IB 4ETQB 3OHXB 1NCAH 3WFBL 1BQSA 1QFWM 1ZSDA 2HKHH 3MO1A 3IXTA 4LASH 1KEMH 1QD0A 1J8HB 4GKZA 1C16A 5D1ZC 4OLXL 3HI1A 1JFQH 3OJVC 4EDWH 3QCUH 5I8OH 1PEWA 4JGJA 4MAYB 4DK6A 5D2NB 5TFSH 4HWEL 3OGCA 2P5WA 3BYYA 5JXAL 5C0GB 2VC2H 5B8CA 3R4DA 4BZ2L 4QYOA 5JW5A 3O4LB 1OW0C 4WVRA 2DTML 3TV3H 1IGML 4UNUA 1NBZB 4TUOA 2WINA 4FP8L 5CP3A 3CK0H 3ABZA 3PG2A 1F00I 1FC1A 1OAUH 4RDQF 3KJ4B 4LGSB 5IMLB 1G1CA 4F33B 3B2UC 4XPFH 5F7NC 5EBWB 4Q9QL 2DDQL 4BQBA 3GJFA 1I1AB 3I02B 4XNXL 1A6AB 3HMXA 4OGYL 2J8UB 3FKUS 2XWBB 3W5MA 4LIQE 3E6FB 5C0AB 4J12A 4YFDB 5CEXA 3QIBB 3PL6A 3JZ7A 2FEEL 3V5HA 5GRJL 3LKSB 2QL1A 2GITA 43C9A 3RZWA 3O4LE 4OM0H 3KXFA 3QWOA 3HN3A 3C5JA 12E8H 3BN3B 4QWWD 1ZVSB 1OL0A 3U1SH 1I3GL 2H32B 5LVEA 2ICCA 3ARBC 3WIHA 3QRGL 4Q9CA 1A7NH 1URLA 1G7LA 4NN6B 1RIHL 3CVHH 3WYRA 5JORB 1MSPA 1S9WB 5DWUL 3RY6C 1XIWB 5FOBA 4MA1C 3GKWH 1LP9F 4M48H 4P49A 2EZ0C 2W9DH 2ZUQB 3RWGB 4KJWD 2Y6SD 2UUDH 3FMGL 1DTUA 1KB5L 3OR6B 3MSPA 1CICB 4YJZL 4HC1A 5F1KC 2X4TA 4G9FA 4UIMA 2A6DA 4BELD 1P53A 1PY9A 3P0GB 5EB9A 1RIVH 3HB3D 3IT8D 4MB5A 2DJSA 2GSGB 1IQDB 1RZFL 2CLZB 4LPUA 3HFML 3SKNA 4A6YL 2AKRB 3RZCD 3ZL4H 5MEPA 3NIFE 3VG0L 1NJ9A 2P8PB 4HCRL 4DKEH 2H8PB 3D2UD 1WEJH 4OQTA 3JSSA 4JR9H 2BDNH 1SBSH 3WIIH 1GHFL 4BJLA 1FLRL 4AZ8A 3HAEG 4F15C 2QR0A 1V3MA 3QIUA 3QZWA 4X6DA 2H1PL 5EC1B 1XGPA 3EGSA 4Z0XA 2HLAB 1A1NB 3FQTB 4TUKL 1F3JB 2Y36L 1I3VA 5ESAA 4Y1AA 3NIGE 5IW6B 1EEYA 32C2B 5SWSA 4H0IA 1JJUA 2ORBH 2HJFA 4PJ5A 4CVWA 2FWOB 4WWKC 2Q7YA 2VKXA 2XTJE 3QDAA 3QFJE 3CFJA 3QJFA 4O2EB 5K33A 3MCLH 3FAWA 3UJTH 2PW1B 4JDZB 2DWDB 1I1YA 5EPMA 5E9DD 3KJ6H 3NZ8B 4P4RA 3RU8L 3HR5A 3PQYB 5FA4B 3IDGB 2FECI 4MA8H 3FT3B 4UBDC 2VITA 4RGND 3VFNA 3ZE2E 1Z5LB 4JQVA 5KN5A 1XF4B 3UROR 2LABA 3TP4A 1C5BL 1ES0A 2VWEE 1A4JA 4DN3L 3P11L 3VXUA 4GG6A 2ZPKH 4LQFL 1G7PA 1T1YB 2YK1H 3AB0C 1Z9OA 5CEYB 5CILL 2FHFA 4JO1L 1A3LL 4NRXB 2J8UF 1N4XH 3CDGB 5B39G 4Y2OA 2J8HA 3ULVD 2EDWA 4PJXE 4HG4J 4HUWB 3PWNB 2VQ1B 4U1IB 4K3JH 1RUAL 2ICWJ 4PLJC 2IAMD 4NKDB 3TBTA 3T4AA 3T2NH 2VXTL 4WEBL 5LCVH 1DANT 4LSTH 5BS0B 1E0OB 3QDJB 3DIFB 1M6OA 1IFHL 4WGVB 3UBXI 1DSFH 2OL3L 1X4YA 4ZQKA 2VLRE 4HJ0C 4JN2B 4UT6H 3S4SG 4YC2C 2DTSA 1HQRA 2NTFB 3BSZH 2ICWI 5GS2H 1A2YA 4N8CL 4PRNB 1XGQB 4KTEH 1X5YA 3QDGA 1FG2A 5M7QA 4P2RE 4X99B 3F6IA 4OLYL 3WJJC 5MEQB 4N0FA 4DQOL 4RQQB 3F7YB 3QUZA 4G6ML 2IH3B 4JRYD 5E1AA 1CFSA 4GG8B 3LKOA 5DTFA 4JFXB 3OKOB 4P57B 5AAWA 5DUPL 4UIKL 5EU6E 1QUNA 3RTQC 3QB7C 4HEPG 1D9KC 5IF0B 4QXWA 2HJLA 5K9QG 4E41E 2R23B 4X80L 1DVFA 4WUUD 4QTHB 2ZG1A 1GAFH 1HSAB 2FYYA 2H2SD 2UYLA 1HYSC 2UWEA 1IAOA 4XP1L 4Y2DC 4A6YA 3QDJE 1TVHB 4KK5D 4NQCA 5I8KL 1EMTH 3DGGB 4HCRA 4PRPD 5JPMA 1HZHL 1UEYA 5JO5B 4GAFB 4PRHB 1RK0B 3GI8L 1BWWA 3PHOB 1S5IL 5SWQB 2ICEA 4DKFL 3MOAH 2PXYC 4DK3A 4NZUH 2AVGA 2FX7L 1E4JA 3BZFA 1FFPB 2GK0A 1K6QH 4JY5H 3LPWA 1A3RL 2DI9A 1U95A 4RA3A 1CYGA 1FVEB 4PY7B 3MOBH 4EQ3A 5IT2L 3V6BR 4N5ED 1OCWL 4FFWC 2BVPA 4I5BA 3BPCA 3DSNA 2ITCA 3BPOC 3K80A 4XAKD 1JGVL 3HRZA 2XT1B 3QUKA 4MVBD 5F8RC 3JVGA 2CO6B 1U6AH 2Y9RT 3MNWA 4G80A 4LHQB 4PJ9A 4J4PA 3VRJB 5E2VL 1CF8L 1JUFB 4S1RL 1T7YA 1YMMA 4MXQD 3HPLA 5J57B 2VZ3A 5D1XA 4JM2B 1FNEA 3RVTC 2EDBA 3L3GB 1ADQH 2Z92A 4IRJB 1R3KA 2EEBA 4Y19E 2VL5A 3WUWB 4PJFB 2EH8H 5ERWA 5D7IA 4G42A 1LEGA 3DV6A 1FSKB 3HTLX 5KOVC 3AS1A 3GJFK 4JFEA 3UTQA 1KTKE 3GSRA 3HZKB 1P7QD 1QSVA 2DYPD 2BC4A 2MMXA 4ODTL 2CGRH 5FKPB 3VGBA 5BXFB 3UP1A 5DK2A 2IBBA 4PUBL 5D7JD 4PPTA 3ZDYF 2ZG2A 4AIZB 5IIEB 5HHOA 5EUOA 5HI4C 3MRQB 3MV9B 4XC1L 1UM4H 3MODH 1U41A 5DO2D 4WW2A 3C6LD 2OL3A 4KKLC 1PVHA 3QEHB 5BV7C 5KG9A 3KR3H 1ZA6B 5E99L 5HY9A 1XF2A 1WZLA 5DD6A 3K2MC 5JQHC 1HILB 1SM3H 3K4ZA 4UDUA 4DWHA 3QI9B 5E08H 4ZFFB 1RMFL 4X7TB 5IV2A 2Z4QA 1GGUA 4PB9H 5DXWA 5IESL 4NZRH 5D6DA 3T77B 3EDKA 5I2IA 1U2HA 4POUB 2IBZX 2GY7B 2XZZA 1F42A 3ARFC 1ETZB 3KYOB 3BEWA 3H3BC 3GRWH 1TETL 4KFZC 3TNMA 2FJGA 4Y4FC 4NSKA 4PRBA 1XR9B 5D7SL 2VISB 3VFTB 2CDGB 5ETUA 5DC9B 1TCRB 1J5OL 4PREB 3MV9E 4XC3L 5IBUG 1XZ0B 1JF5A 1HCFX 1OTUC 5AAMA 2AEPL 4M8QB 4OIAA 4EKXA 2NY6C 4H26B 4GW4B 5E70A 3QDMA 2PYFA 1L4IA 4DZBA 1U8HB 2YA2A 2APBA 4M3JA 4UILL 3S35H 3SHSA 4U49A 4HUUA 4LRNL 5D72H 5C3TA 3O6LH 1J86A 2L0DA 4IMKC 2E7BA 5C0BA 3TO4C 1B4JL 1NLBH 1RVFL 4DOHE 2YD1A 1QRNB 4LF3A 1DLHA 1JZ7A 1CE6A 3BPLB 3P4NB 4CVUA 3EDJA 1ROWA 3QO1A 4PJHE 2G5BA 3EW3B 1OD7A 4X9GA 2VXSH 1NC2A 3O2DH 3L1OH 5F72S 3VXMB 1QLRA 4P2OC 2Z31C 3D3VB 3UC0L 3NFPB 4XH2B 1JWUA 4YLQT 2MHAA 1IBGH 3TYGH 1A7QH 4X7DC 5BQ7A 1QA9A 4TVPE 1JNHA 2HVJB 4JM2F 3L3KB 5IVZA 4XNZC 3NA9H 1LO5B 5DFTA 5ADPH 1R5VB 1P4BL 2W0FA 5CKAA 3G6AB 5TGBA 5HHME 5GRYA 5B21A 4Z18A 4W70A 1DQJB 4PJFF 4YHML 6CGTA 5DD3L 5I16A 2JELH 5SWZA 4PP1C 2YS4A 5K9KA 4H5SA 3GNML 4NC1C 3KPOB 4POYA 1H8NA 1AGCB 1ZT1B 2VLJA 4P2QA 4JE4B 3G5ZB 1JYWA 4HEME 1PX4A 3BAEL 5HJ3B 5BRZD 1BMGA 1UB6A 4X6CA 2BSED 5C0DA 1LO2H 4LKCA 3OAYK 3BIBX 1UZ8A 3GMNA 4CAGA 1M71A 3FO9B 4HHAB 2K3TA 2P5WD 1JMZA 2ZKHL 2BJMH 4XNYH 4EUPA 4YDVA 3BWAA 4OJFL 4RFOL 1JHLL 2A73B 5J1TC 1JWSA 1AI1L 2P5EA 3H7BB 2AK4A 4NWUL 1W8OA 5IGXH 3VD9A 3TYFA 2KDGA 1CFTB 43CAB 1FN4A 4NO2A 3B43A 4BK5A 3ZKNC 1NEZB 4YDLC 2D31A 2J6EL 4NKQB 3OZ9L 2W65A 4HXBL 4MD4A 4NO0B 1Z0NA 3S96A 3EFFB 3CU1A 4JKKA 1SJEB 4PBXA 2OCFD 3PL6D 5IVOA 3ULUC 3DVGA 3LRHA 4U6XB 2MWCA 5C08E 1KN4H 1ZXQA 2R2BB 3D85B 3KXFD 5MEOB 4J7RA 1QFUL 3KPRB 3O6MH 4Q2ZA 5CUSH 1J1OH 2F15A 1FZKA 2EIDA 4G8EB 2P45B 3GI9H 3T2QA 1OTSC 3KPSE 3PWPD 4PJEA 5ILTH 1W72H 4ZYKA 4YXLL 1SYVB 5E2JA 4Y4HC 1KJ2H 5KVMC 1HHGA 3DETC 4H8WL 2BNRD 3TN0C 1HHKA 5JOFB 3SCMB 1F58L 3GSVB 3EYFA 5JA8B 5GXBB 4WO4B 3JTTB 1FNLA 5GGVY 5FYKE 5JW4M 2Y07H 2EH7H 1M7IB 3VWKD 4G9FD 5I76A 1EVUA 4DZ8A 5LQBL 1ZS8B 2PYEB 4ODUA 2IWGA 1HN1A 1D5MA 2AGJH 4Q9RH 5FM5O 3NOIA 1TMCB 3FZUD 4EN3A 1YYLL 5T1KA 1OQXA 1JZ6A 3BUTA 3WXVH 4RDQG 4ZS6D 1JNNH 3ARBB 4ZAKA 1TNMA 4FQHB 1KCRH 2CKBB 1SVZA 3MBEA 3K46A 1K9TA 2X10A 2BOBB 1BP3B 3UDWC 1FFOB 3KYMB 3QWRA 4XZUB 2XQBL 1IQWH 4N9GA 2NNAA 3CLFH 2BVYA 1K8IB 3NCMA 3BE1H 1MCQA 3HAEA 2BRQA 3UPRA 4DVBB 2ZCHH 4NM4L 2GFBA 2X7LA 4NBXB 2QQNL 4Y1AD 5D5MB 4JFDA 4XNUH 3P3YA 3BPNB 4KQ4L 1JPGA 1M1SA 3QEQB 3OAZK 1LHZA 5DFWH 3CNKA 4Z7VE 2Q6WB 4JPIB 2J12B 4PJGE 4PJAA 3JUZA 1I7RB 5IVXA 4HLJA 5FB8A 5I0ZA 4GRMA 3K1DA 1N59B 2D7MA 3H9YA 5F9WC 3CPLB 2YD7A 2R0ZL 4QNPF 3WJLA 4QWWC 3CMGA 1CBVH 3NGBB 4KDWA 4U05A 5LGKA 2GEEA 3CU7A 1KNOB 3SGEH 4F15B 3UMTA 2DQFB 1TENA 3CDCA 1KFAH 3OSKA 1G7MA 5FO9B 4XCCL 3S97C 3RGHA 1S7SB 1WV7T 1R0AH 5TF1H 4HS3A 1JCKA 1BBJA 3HC3H 1HH6B 3VMPA 1A1MA 4X8JA 1A64A 4UOJA 4KJWC 2Y6SC 2V7NA 1Q0XH 3O41A 5DMKA 3CFBA 1MIEH 4RFEB 1O7SA 3VXNA 1RUML 1HQ4B 1NSNH 3OKNA 5DJ0A 4HV8A 1JK8B 1F11B 1MPAL 2NXYD 5IFHL 3WS3A 3HPJB 3K7UA 3MJ9H 3T0ED 4QY8B 4LEOB 1OARH 3ARQA 5DMIH 3EOTL 4WI9A 3MLZH 4KRPD 4I3GA 4NKMA 5GZND 4ODSH 5E5MB 3D69A 3KPQA 2G5RA 1WGOA 3RVXC 2VDOL 5CEZD 3U30C 3BEVB 4ZODA 2B4CH 1ITCA 3F12B 5D70H 5L8JB 3QCVH 1DDHA 1FQ9C 3QDGD 2C1PA 5GZOC 4JFFB 5FDWA 5I1IL 2DQCL 3WNOA 5F71A 1JV5B 1NMCB 4Z7UE 3EDDA 3H0TA 3SDCD 4IIQC 1U92A 4WFHD 3HI6H 3MRIA 3EJYC 5BVPH 4ETYA 5K9QI 5DQDL 2AXFB 2R4RL 4PJDE 4LASL 1YNKL 4OZHA 3W2DL 1KPVB 4MJ6B 4BFIA 4F2MB 3IGAB 1YN6A 3JWOC 4D8PA 3MLRH 3O9WD 1JFQL 2DQTH 4HBCL 3L5IA 4KGLA 4NQCD 3MYJA 1QYGL 1MH5B 1DQQB 2F74B 4DGYH 5D1QB 5JNYA 4O4YH 4AYFA 3UTTA 1OAQL 1DQMH 2COQA 3U0WH 5D7KD 1U8KA 3VFRB 3U7WH 1MCPH 1B6UA 4XHJD 2RIKA 3DTXA 5I73C 1ZLWH 4JFFE 3VGDA 4GMTL 5D5MF 4APQC 7FABL 1J05B 2VLKE 5KVDL 3RUGB 1G7JA 4OB5L 1KB9K 1NLDH 4X98A 5C9JA 5DHXB 4JO3L 4DEPB 1OGAD 2DQUL 1D9KB 4Q0XH 3ULVC 5LGHH 5F89A 3MXVL 3V7AE 4MJIE 1MELA 2AJVH 1HIMH 3MV8E 1M7DB 25C8L 3B9KB 3MACL 1F97A 3GSNH 4YXKL 1YECL 1G6RA 4M6AA 4PJ9D 4J4PD 1BFVH 1MJJB 4RZCB 5L2KE 1SJXA 3RL2B 1DL7L 3KLDA 5LAXB 4CN4A 3TPKA 5I75B 5IEKA 5E6YA 5D1XD 2PXYB 1UA6H 1TIUA 1I9IL 4HZLA 5JHDB 3T1FB 3K74B 1RZ8B 5GGTA 1R5IA 5JW3H 4PV8A 1P6FA 3C5ZC 3U46A 4NNXB 4HKBB 3A6CH 3H6JA 5JHLL 4YGVA 1X5AA 1UGNA 3FB5B 4JFED 3KPPB 4X7CC 5EZIH 2XPGB 5IFAH 2XQYK 2QADD 1LD9A 1MJ8L 4FTVD 2H2SC 3H3PL 3C08L 4RA0C 1MLCA 3JV6B 4KK5C 3MNZB 1MCWM 4E42B 5BO1H 1TFHA 5IOPA 4TPRL 1YEJH 1S3KH 4XPAH 5JHDE 1HXMA 4HAGA 2DM2A 4NQEE 3RWDB 4F9PA 3PGFH 5IM7B 1IM9A 3E2HC 4LNRA 3U36B 4XP6L 3E3QC 5CHNB 5EBMB 2BDNL 4ZXBB 4RISL 5E2TH 5IJVA 2UZIH 4MA7H 3CVHB 1RJYA 1GGBL 2Y4SA 3IDNA 3LV3B 4N5EC 1B4RA 4G9DA 2B5IB 4CW1B 1BHGA 4K3HA 3V6FA 1OWRM 3KDMA 4G8GB 4KK9D 1QKZL 2HRLA 3AREC 4JHWH 3QEGL 4L3CA 2EXWD 4OLUL 1KC5L 4OFKA 4X6FB 3PWJB 3LZFH 3EYUL 3LSOB 1MAJA 2VDKH 3QDMD 1GZPA 3WS6C 1HOCA 5IROC 4YFEA 1NDMA 1SBBA 5KS9E 2GCYB 3FTGB 3FT4A 3GMLA 5IBTH 4CJ1A 5A40E 3W9EA 5DD5L 3IJHB 3EYSH 4LLWA 5DFVD 3ZKXC 3S3JA 3IETA 5DVLA 5C0BD 2Q3AA 2VDLH 5FO8B 1N6VA 2A74B 4MA8L 3RUGF 5DSCB 1C5DA 2D4FA 4JCMA 1RURL 4Y5YB 4W68A 3UTOA 3L7EB 3DROA 4YHOL 4K71B 3HNTL 1FORL 3OKEB 4U7KA 4KV5E 1OF2B 1L0QA 1NC2D 4NCC2 4JY6A 2ZPKL 4G8GE 2P7TA 5JOPD 3F7VB 4P9ML 2YPLB 5CSZB 2ARJB 3PDOA 2Z8WC 4HX1B 3EHBC 1CGVA 2QJDA 3IYLW 5F88B 4MAUL 2X05A 5I30H 4MHHG 2NY6B 1PZ5A 3S35X 1CE1L 5T3XH 4YR6A 1TTGA 1AKJA 5DT1H 2OSLA 2BSTB 2GKIA 3OXRA 3C6LC 3LN5A 1LNUA 2VXUL 5LCVL 1FE8L 4HT1H 3VH8A 2OM5A 3UJJL 4IDJL 3SE8H 1RZIB 4WTZA 3FFCE 2FB4L 2PO6C 4KKBC 5SWZD 4OBRA 4NKIH 4J3SA 1TZIA 2ZNWA 3O3EA 4R0LB 4WFED 1J1XL 3CFIC 4XNMB 2R8SL 1EAJA 4NO3B 3RDTC 2N7BA 1OSZA 5F9JA 1KYOK 4P2QD 5F6IC 5IKCB 1PDKA 5EWIL 5J3HD 2YUXA 3IKKA 2VZ1A 4HAFA 3MRPA 7CGTA 3D0VB 3MV7B 3HNVH 1BQLL 3NFSL 2IFGA 5FHBH 3VXQA 1MHHA 4GW5A 5CZXC 2QV2A 4U1MA 1BD2D 4GBXA 1DN2A 5DEGB 4NCC1 2QQKL 3GBMH 4M7LH 3BFOA 5E7FA 4RMWA 4L3EB 1QO3B 2JIXA 1AJ7H 5HHPB 4PRIB 1QBMH 1GPOH 2P5ED 2P49B 2AJ3A 4QRRA 1W8NA 3MOAL 3W39A 1IEAA 1A7PL 1MCOH 3OKLA 4CN6A 4OV5A 5GGUB 5IB3B 5IQ9A 1HKFA 3IJSA 3U6RB 3LEXB 4PLNC 1QVOB 2O61A 3V52L 4M4RA 3VDBA 2FIKB 5EC2A 2N1KA 4U1NA 3ARGB 1AQKH 2A6KA 2ZSVB 4TNWF 3MFFB 5C8JA 4ZOEA 3P73B 3X11B 1WTGT 4OLWL 1EFXB 1BQHA 2I27N 2HG5A 1CT8A 4XB8A 1E4KA 1UZ6E 2HT2D 2AJZB 4MXWH 4NC1E 1KEGH 2VQTA 1A6UL 1H3PH 3KWWA 2OK0H 4GKOA 3MUHL 1I1CA 2VDRH 5KSBB 4PB0H 2B2XL 5AUMA 3SDDC 2VLLA 1C12A 5SV4A 1GGTA 3T3ME 4GMSH 5JZ7D 3QA3B 3UTSD 1TJHH 3LKNA 2DQIH 2EH8L 4JLRA 4EI5C 1KCUL 4ZNEA 3HI5L 1IGJA 3AU1B 3O3BB 3V0VB 4UV7H 3VFUA 3QUMA 5ID1A 2P4AB 3WFHB 3VMOA 4YHNB 4CRPA 2Y5TB 3AVEA 5C0IA 4L4TE 2ATPA 5DA4A 2CGRL 5GGSB 4EN3D 2FSEB 1BECA 1JHTB 3TNNA 4OM1H 3C60B 2BERA 3SDAB 4RAVA 1HYRC 1CDYA 3BXNB 4NQVB 4LVNC 1VPOL 3NABH 2AW2A 3HG1B 4I1NB 4H0HB 3BW9B 4MMXC 2FX8H 3MRCB 1BFOB 4M1DH 4NZTH 4WW1B 3KR3L 4I2XA 3FB6A 4P3CH 4F58H 4LLQA 4LSDA 3X14A 3MLXH 1F6AB 4JFDD 5EO1B 1RZKC 1BBDL 5F9DC 3NCCB 3RWJB 1V7NH 1AFVL 2DJ4A 2YD4A 1AD0B 4NZRL 5MHSD 3ULUE 3I6GB 4K9EL 1FZOA 2BVUA 4P5KB 2PETA 3N1FC 1YJDH 3BO8B 3RI5K 4KVCH 1J11A 4O51B 4HJGA 1INDH 5IFJB 2V9TA 4L4VE 4OZGB 5KVGL 4LARH 1GJIA 1H3XA 1QBLH 3HG1E 1MRDH 2R0LH 4D0CB 1E6OL 5HGDB 5J12C 3B6SB 3ZT7A 4JPKH 4MCZB 3DXAB 4EI6A 2BFVH 1II4E 2R1YB 4U7MA 3QRFM 2B1AH 2DJUA 2NLJB 5D8JH 2NXZC 1NLBL 2A9NH 4XPBH 1CD1A 4XT1C 3SGJA 5HHVH 2O5ZL 3C5SA 4Q74A 4U0RB 1I9EA 4PV9B 4Q6YA 5DLMH 4YWGL 3VWKC 1H15B 5T1LA 1BJ8A 1BQUA 3ZDXE 1BWMA 4UTBH 3BDYH 2N56A 2EC8A 5F9WB 3MCKB 2HJKA 4LKXB 3IFPB 4X7EC 2V5RA 3K2UH 4FRWA 4WV1C 1WC7B 3OHXA 3TT3L 1HWHB 4ZS6C 3FONA 4LPWA 4AEFA 1TDQA 3ROLA 4J6RL 1F5WA 4OFPA 5I9QC 4G8FB 4ZS7H 5KVEH 2YPVH 5KSBF 3QG6B 1CG9A 4M7ZB 3MTRA 4QRPD 1Q1JL 5JW4Q 1FCCA 3NA9L 4ZFZB 5I1AB 5ADPL 1RU9H 3D18A 2X4NB 1CXEA 5C0GA 1A0QH 4U3XA 1YY9D 3KPNB 4FABH 4JFQB 3DMMC 3O4LA 1UKQA 2F8VA 2FD6H 2D7PA 4WY7L 4MB4A 4GRLA 2OJZH 4PS4H 3RL1A 2XRAL 4BH7B 1WBXA 1JRHL 1MI5D 2VZUA 1UWEL 1XGTA 2Y7QB 1UM6H 1S7VB 5DK3A 4ZD3H 2CDFB 4OUUB 1REIA 4WFGD 2YRZA 4OLEA 4LU5L 1H0DB 2EC9U 4GAYB 1IAKB 4UB0L 5E8DL 3LQMA 5EBWA 3UTTD 3C6SA 3LHPL 2Z8RA 3HR6A 4Y0GA 2ED7A 5EFIB 1PLGH 4CKVX 3I2CH 5DRNA 2XWBA 3VFGL 3WN5B 1M7XA 3QIBA 5DRWB 5TQ0L 5DJCB 4P9HH 1VACB 1V5JA 2R56H 2R1WB 4IIQB 4KJQC 5ELIA 5DD0L 1CXLA 2H32A 4F3FB 5J6GB 3DX9A 2XG4A 5KOMC 3K81A 3LMJL 1EAPA 2NXYC 4P46C 3QWQB 5JORA 2AV1B 3DI3B 4JFOB 1S9WA 4JG1L 2VDML 1FPTH 1IC4L 3WEXA 3T0EC 1DFBH 1U8PB 1R5WB 3WBDA 1RJCA 3KPTA 4WI7A 4OZGF 3VWJB 4PJ8A 5FYJH 1AD9B 2NY0D 3VDCA 1E27B 2GJ6D 5A2JH 5H37G 4MNGB 2D7NA 3RWGA 3ZTJH 2X41A 4O02H 1UKTA 5ALBH 3P4OA 3OKYA 4IRZH 1IC1A 5C0ND 2XFXA 5C86A 3WL9A 1ZLUK 4APQB 3HMWH 2FEEI 1KIQA 2B20A 4L1DA 5CSGA 3QFJA 1OVZA 2WV3A 2GSGA 2CLZA 3PGCA 1MNUL 2GK2A 2QQLL 2AKRA 4L8SB 4ZUWA 1SMOA 3SDCC 4LCUB 1QSEB 3O8XC 2LQRA 3GHEH 5E8NB 1CU4H 2VABB 3MRGB 4O5LH 3THMH 3QXVA 1E4WL 3MMEB 3OGOE 5E94B 5I1CH 4BUGA 3QJHB 4ZO8A 4XXCC 4L8DA 3CFEA 3AM8C 3O9WC 4MNGE 1T21B 4RGNE 4RNRB 5JDJA 4JFHE 2DM4A 3MXWL 3MA7A 1NBVH 32C2A 3WO4C 5EU7C 1FGNL 3GMOB 5E8PB 4XHJC 1TTUA 1FBIH 4PJXA 3C5ZB 5I19L 3T1WA 1MHPL 2V2WB 3X12A 4ZFGH 1WCBB 3MZGB 1Z0MA 5IQ7L 3TESA 3NA4A 1GIGH 3ULVE 1U8MB 4RAUB 3CLFL 1KCVL 1OP3K 2IADB 1W72B 4ODXB 1IZKA 5ADOL 5FGBC 1JGUH 4JM4H 2ZG3A 4HS6A 1P2CB 1Z5LA 1KPRB 4IMLB 2EDJA 1KJ2B 1YPZE 5L0QC 3Q3GB 3BGFC 2VLRA 2F58H 1VGEL 4JQXC 3NBNA 5CBEB 1MCKA 3MRHB 3PIQB 1KPUA 2B0SH 1NGZA 3L95A 3VFWA 3QCTL 1T1YA 3I3DA 2AABL 1WWAX 2Z8SA 2NW3A 1BZ9B 1X5LA 5E4IA 1EX0A 3SE9L 1EPFA 5EU6A 3OWEA 4M4PA 4JRYE 1E6JH 5FYLH 4KJPD 1HI6B 2OR9H 4HS8H 3GMMB 3V95A 1D6VL 4R90L 3QDJA 4HUVB 4OT1L 3CXHK 2VYRE 3AREB 1U3ZA 2BMKA 4NWTH 3V4UH 1UYWL 5IEHB 2QADC 2EE3A 4MHHI 4X5WB 1CFVH 4PRNA 4PRPE 3T0XA 4X99A 5MEQA 3RGVD 1AKJD 4RQQA 1FG9C 4GG8A 4ZUSB 2WIIA 2Y5EA 4LLAA 2XA8L 2JB6B 1XH3B 2H26A 3OKOA 3ZKXB 1KG0A 1NCCL 3E3QE 3WXWL 5CS7A 4BH8B 1NAML 5EU3A 4CADB 2WBWB 3LN4B 1BGXL 3VGEA 4G8IB 4QTHA 4LPYA 4W81A 1CLZH 1E28A 3F7RA 1G84A 1TVHA 4MQ7A 2JCCB 3MLVH 4R97C 4B7IA 3L5WA 3QCVL 2W92A 3DGGA 4GAGH 4XAKE 4M93B 1K8DB 2JF1A 3P4MB 2YBRA 3S7GA 4KK9C 4TVPL 4U2ZA 4PRHA 1RK0A 2EDTA 5CFHA 3PHOA 5GJTH 1QLFB 4QRUB 2EXWC 2FJFB 2X2YA 4E0RA 1IEBA 4YDKL 3HI6L 1FFPA 4K3DL 3KG5A 3FO0L 1P4IL 4Y19A 1FVEA 4YBHA 1MCCA 2Q1EA 4PTTB 1BZ7B 1T3FA 2FBOJ 2JIXD 3BKCH 5DFVC 3UPAA 2PO6B 3O2VH 4NHUB 2R4SL 3U0WL 4QRRD 4QHMB 5M94B 4Z7OE 2F54D 5JDSB 4FQLH 4Q9BA 2W60B 3RIAF 3UO1H 5F6IB 4FQJL 4S11A 3SO3C 2V17H 2NY4D 1UH4A 5HYQB 2ZSWB 4HIIA 1LO3H 5F3HA 4JM2A 3CSYB 3PE9A 5I1JH 1N6QH 2JJTC 3L3GA 3PV6B 4YX2H 4ZSOE 1LWRA 4X7SH 5BVJB 1IGCL 2R69H 3QNXA 4PGDB 3WUWA 4HIJA 1MAMH 3MJ7A 3OJDB 1T1XA 1KCKA 4HGWA 1OT2A 3DRTB 3SO5A 4C4KO 4C56B 1IAIL 2MQCA 3K8KA 1N64L 5BXFA 1PJ9A 3QXUA 2CLVB 1MFCL 4U3CA 2ENYA 4AIZA 5IIEA 4RCAA 5DYOA 3MV9A 4R9HA 2EDFA 2CJUL 3IF1B 4WFFE 5C0JA 1EEUA 1VESA 4OLVH 1ND0A 3F7PC 1ZANH 3OXSA 1H3VA 1LDPH 2WBJB 3QEHA 4G5ZL 1IC7H 4XXDA 3U7YH 1ZA6A 1CFBA 2XICA 4G6FD 3INUH 4LOUD 1XT5A 4UT9L 5I6XC 4OZFA 5DHVH 4YK4C 2VERN 1V3KA 2JB5L 5AWNL 4Y4KB 1IM3B 3BI9X 1ETZA 5C0EB 4JQIH 4LSPL 4PJHA 2V5SA 5D93B 3M8OH 3SE3A 3GSNB 5HDQL 1EEZA 4PJ7B 2AERT 5JTWA 4DW2H 2CDGA 3HE6A 3MLSL 1TCRA 1X6NA 2JCCF 4ONOA 3TLRA 1XZ0A 4L29B 1PW3A 3NTCL 4HWZB 2JTDA 4JZNB 2P24B 3K4AA 3SDDB 1KTDB 4H26A 4K7FB 4WDIB 4CUCA 2ZCKL 4XCFL 1F13A 4XVSL 4EI5B 4IRSB 2GYSA 4Q6IB 4D0DA 3HUJB 4LCWB 4YDIL 1LE5B 2XKNB 3U4BH 2EYSB 5ISZB 3O6KL 5I1HH 4JKPL 3QPXL 1ZMYA 4GLRH 4J3UA 2HLFD 3DBXB 3EJZD 4LVNB 4GXVL 4IOIA 2IQ9L 1Z6JT 4HLZH 4PRDA 4OBSA 4QXGH 2EDLA 4Y7MA 4JANB 4U0QB 3BP4B 2E7LA 1A14L 2YA0A 2PW2B 5B38B 1BIIA 4S0SD 4PJCE 4Z7WE 1NBYA 5EIQA 5CJQL 5BRZE 3PDGA 4HPOH 5JZ7C 3KLAB 1FO0L 3R0MA 1U3HD 4OCXL 1LO5A 4L8CA 2P5WE 3EJJX 3VCLB 4XWOD 5F96L 3WFZA 2IGFL 5ISZE 1V3JA 5T5NF 2DQGH 2PTTB 5C0CB 1UWGH 4TOYL 1VCAA 1UQSA 2HTKC 4P59H 3I50H 1J8HD 3RJDA 5J12B 1AGDB 3ARZA 2HKFH 3STLA 4PGBA 2I5YH 1MVUA 3CX5K 1YQ2A 4MAYD 1PBYA 3IRPX 3FO9A 2NXZB 5ANMB 3BUYB 2F5BL 5LXGH 1CVRA 2A9MH 1VHPA 1TJIL 4PJBE 3MRFB 2AP2A 1H5BC 1YA5A 3D0LB 4H1LA 1J1PH 2OZ4L 2VAAB 5C08A 5KW9L 1A6TB 2DN7A 2ZCLH 3O4LD 3B2VL 3ARYA 4AG4H 4GRLD 2A73A 4LMQI 3MRLB 3QFDA 2VLMD 4HFUL 3KXFE 3BRFA 1AGFB 3KPSA 5C0CE 4NQDB 1KOAA 1YEKL 1N5YL 4LGRB 3QEUB 5B4MD 4AEIL 2HA1A 3O2WL 1G7HA 4RMRA 3REWB 1NEZA 2GW5A 4HF5L 4PJ7F 5D1ZA 2HFEB 1U8NB 3PWPE 1I1AD 3GGWA 4NO0A 4WEMB 4ZUTB 1BX2B 5EOQH 5JLZB 5C0AD 2BNRE 3GBML 3QIBD 2ITDB 3WNMA 1PYWB 2FGZA 1EDQA 1LILA 5F7EL 5GGQH 4G9FE 2GJZB 3DMMB 1OW0A 5I1GL 3BD5A 1I7UB 1P7KA 4TSBH 5TPWL 3SKJH 1C1EL 1KYOJ 1UVQB 3HUJF 3OR7B 4QRSB 5F1IA 4G8EA 4K3EH 1YYML 5FECB 1XIWD 8CGTA 1MFDL 3DV4B 4XBPB 4NBYB 4HKZA 1SYVA 1Z3GL 2YUWA 4Y16B 4QHLA 5H2BB 4W6XB 3VFOB 3QO0B 4JFPB 3RKDD 1FYTE 4CNIA 2C4FU 1FH5L 3GSVA 3TT1H 4LAQH 1CICD 5T3XE 3ETBF 3ZE0E 5FOJA 4PR5B 1M7IA 5C6TL 3M17B 1QFWH 2NY7H 3VD5A 1MLBB 3DO7B 1EGJL 2EE6A 4GKNB 4Z7VA 3GIZH 3QFJD 4D9RE 2HYMA 4PJGA 1I1FB 2QLVB 5J0BA 4HPYH 1UKSA 4HUKB 4DTGH 1YY8B 4XP5L 4MSWB 3UZQA 4AH2B 1BOGA 2HVKB 3ARBA 4OCNC 5E8OB 5HHQB 1EBPA 4ENEC 3BDXA 3KYMA 4JFYB 4MXVE 3RY6A 5GISL 2VDPH 4JO4L 1S5HB 4TSAL 4X4XB 2EECA 3LKQA 4ZPVB 3MQIA 1TXKA 2DQIL 3CSGA 5J13C 1EUUA 4DVBA 5K59F 4KVNH 3FRUB 5JQ6L 4UV7L 4Y8DC 3BHBB 3T04D 4EQ2A 3ECBB 4LDLB 1CGYA 3B9VA 5GHWL 2BRRH 3UBXB 2X44D 4AEHH 3EOAA 4OM1L 1QEWB 4JPIA 2Q6WA 3S37H 1OGTA 4TUJB 4U6HB 3TVMB 2DF3A 1F4XH 4N68A 4KRLB 4XBGB 4BZ1H 3PQYD 2NMSA 3FQXB 1FZJB 3O8XB 4P48A 2OZ4A 5H35A 4NZTL 5KSUA 5IBLD 5INDB 3T0EE 3QXDB 4EIZC 5F70A 1ITBB 5EA0H 4KTDL 2VLRD 1CGSL 2RCSL 3FQWA 1SVCP 1S7SA 3HC4H 4QXUH 2FNBA 3TIEB 2WWMD 5I1LB 2MPAH 2JJSC 2NY0C 1QHPA 1HH6A 4OZ4B 5D2LB 4P5TB 3Q2CA 2KQNA 4NDMB 1M05B 1I7ZA 35C8L 4I4WB 4WWKA 4UMGA 3W0WB 3T3PF 3QAZB 3LKPA 2FZ3B 4NNYB 4Z7UA 1QNZL 2DI8A 4HK3J 4ODVL 3RAJL 1F11A 3L5XH 4MNHB 5CLTA 5GGSY 5EOTA 2FIRT 1NGPH 1YMHA 3HPJA 5DJ2B 3ILPB 1SY6A 2O5YL 3P9WB 4QOKE 4PJDA 5HTSA 1FAKT 2WNGA 1GC1C 4U1LA 3GB7B 4HUXB 4D9LL 3QDJD 3LS4H 1Q9OB 1MFEL 2IFFL 3CZFA 5L0QB 3N1MC 5D8JL 2WUCH 1Z9MA 3QIWB 1ZGLA 3GFUA 3BEVA 1OY3B 2Q8AL 3TZVB 3GHBH 4NQCE 3ZT6A 3LH2H 3BOVA 4FQIH 1IC5L 3MUJA 2BK8A 4YHYC 4JFFA 2OJEA 4MD5B 4UTBL 5EU7E 3BDYL 5D7KE 1J0KA 3KPMA 3N9GL 1XCQB 4JPWL 4BQ8A 4GXUM 1TQCB 4FFZH 3VXRB 5LG1A 2X4SA 1JF1A 3HZVA 3MA9H 2WBKA 3BGMA 2DLFL 2DD8H 1FNFA 3FN3A 3IGAA 4PJIB 1LK3H 4MJIA 1AH1A 3QXAB 1OGAE 5KVEL 1R3LB 2Z91B 2V5MA 1K4DA 4I3RH 1S8DB 5CP3H 1MIMH 1WIPA 3NAAH 2X4UB 2W9EH 5BV7L 3BIKB 5L2KA 3SGKC 1WAAF 4PRHD 2XACC 3OAUH 4Z0BL 4LCYA 4DAGL 5E2WH 1L7IL 1AY1L 1YEDA 5MENB 3GJFH 3WJJA 3MROB 3HMXH 4LSRH 5CINH 1DEEA 4H20L 1D5IL 5GS0H 4JG0H 5ITBH 5INCA 3RTQA 1I3RA 2QKIB 1D9KA 4JREB 4KUZL 3RPIA 2OTWA 2I9LB 4FZEH 5T5FL 1S9YA 1T1ZB 4ONGL 1T66C 3MV11 3CSBA 2P8LA 4PJIE 4U1HB 3LDBB 4J3VA 1T03H 1ZA3B 2J5LC 5E4EC 3AMLA 4Y2DA 2I60L 4OI9A 3WIHH 4JFEE 1XF5B 2R39A 4R97B 3JTSB 5IK3A 4TQEH 3T4YB 3TCLA 4R96B 5L2JA 4H25B 2PF6A 4FTVE 5HD8C 4RBPK 2GT9B 2ESVB 2MCPL 2PXYA 4JM2D 3B9EA 1UG9A 4M1CD 5ESQB 5JHDA 4HQQH 5LGJB 4NQEA 5D2LF 1JGLH 4Z77B 1JBJA 4IRJD 4OZIB 4HC1H 3BVNA 5DJZA 4JKWA 4BSWB 4HKBA 4R4BA 3KYNB 2WWKO 3RGVC 3S5LG 2XTLA 1PSKL 1UJTA 6FABL 2IALA 3D9AL 2FBJL 4XVTH 2XPGA 5T3ZH 5K9OB 1ZGLM 2ENSA 4XPGL 2AJSL 1FFNA 5AZ2H 4LEXH 4OQTH 3MV9D 1WQVT 2DICA 2MQ3A 3UX9B 3QR2A 1P4LB 1KJVA 5LWYH 3JV6A 1FVDB 2XI9A 5ECJE 2HN7B 1JPSH 4GUPB 4FQQB 4XWGH 1U91A 4PLKD 4P3WA 3WFBH 5MP6H 3FFDB 1WJ3A 3QQ9D 5IM7A 1S7TA 3QI9D 1T7ZA 1FIEA 4OLXH 3GDBA 4OD1L 2AS5M 4M03A 3CVHA 4MJ4A 5MERB 2J8OA 3WLWC 4EXPX 4R7NB 4HWEH 5JXAH 2C5DC 4CW1A 2CXGA 1R3IH 4PJIF 4U1SA 4G8GA 1P5UA 4BZ2H 4UNVA 5ABDE 2DTMH 1JWMA 1IGMH 3PWJA 1N2RA 3LSOA 2R2HB 4FP8H 3PUCA 1OAYL 5J6HA 2XN9B 2LAGB 1Q9LB 3BH8A 1UH2A 1GIGL 2GTWB 5I74C 4AY0A 3SDXB 4Q9QH 2DDQH 1QRND 5HHMD 4JM4L 2CKNA 4XNXH 5JA9A 4OGYH 3FFCA 3L7EA 1EERB 3RA7L 1K2DB 4AENA 3ARFA 3FO1A 4YUEL 2WAHA 3OAYH 4YDJA 4TSCL 1DE4A 2XG5A 4Y4FA 5GRJH 3WFCL 2ZNXA 3VI4F 3VXMD 3VFSA 4ELMB 3F7VA 2HFFA 1MFAL 3D3VD 1ZWIB 3V8OA 3ULUL 1XGUB 5IR1B 3LRSA 1I3GH 5IG7A 4PYGA 5J8OA 3QRGH 2IPUG 4FFYL 3DECA 1X4XA 1RIHH 1VEPA 4LLUB 5DWUH 3DUHA 4NQXB 4JDTL 4XGZB 5E6IC 4IMKA 3O45B 3TO4A 3SDXE 3FAXA 1WBZA 4OZIF 4LOUC 1J18A 1TCMA 2EICA 3FMGH 1KB5H 1BD2E 4O9HL 1QSFB 3T8XA 3AXLA 3WKML 1P9MC 4JZJC 3SKOB 1CFVL 4ELME 4FFVD 4P2OA 1E4XL 2Z31A 1RZFH 4N8VB 3HFMH 4OIIL 2HTLC 4A6YH 4AJ0A 3VG0H 1N3NB 4HCRH 4KI5F 1CN4A 5CD5D 3GJEB 2H9GB 4YNYB 3BJ91 1BJ1H 5C71A 3L3OA 2YEZB 4M5ZL 1GHFH 5ACZB 1RK1B 1FLRH 1NUFA 3BQUB 4OTXH 2AV7A 1UXWB 3TBSB 2H1PH 5DEGA 4KAQL 4ACPA 3IVKB 3TO2A 5HYJB 1T1WB 2QSTA 4TUKH 4L3EA 3LEVL 2Y36H 1J9CT 3DVIA 5C2BH 3NFNA 3OJMB 2JE8A 4NYLB 3CC5B 4UDTA 4I0KA 4MJ2A 5AEAA 2VUYA 4JB9L 3G08A 3W11C 2HLFC 3VW3L 3EJZC 3QUYB 4BQ9A 1D6EB 5MI0C 1ED3B 5IB3A 3U6RA 4NO0D 3OB0H 1QVOA 1A3QA 4AT6A 1D5XA 2FIKA 2QHRH 3LQAL 2OXGA 1S7RB 5HPMA 1A5FL 5AYUL 5GS0C 5K9JL 3UTSE 4GT7A 1NDGA 3MFFA 3D85D 3ROOB 1U93A 4L4TA 1C5BH 4QRTB 5FYLE 1PAMA 4N0UE 2FO1A 5GSVB 3KPRD 1N6UA 3P11H 5DI8A 3X11A 3SDXF 1U3HC 4LQFH 1EFXA 4IS6B 3SQBA 1GGYA 5CILH 4NZDA 4JO1H 1A3LH 4XWOC 5GS1B 4QRQA 4HK3N 2WW8A 3NMEA 5CIPB 5CGMA 4HDIA 1C08B 3WHXA 4L1HA 3B2UD 3CVIL 5AYQA 1A6VL 3VRIB 1R3HB 4ELMF 1RUAH 1I75A 4OCMC 3SCMD 4JZOA 4HMDA 2VXTH 4WO4D 1KIUA 4WEBH 4YBQD 4X7SL 3PXJA 4HIEA 3SOBL 4FQXB 1VEOA 3B3IA 2PYED 4XNQB 2G60L 3AU1A 3O3BA 1IFHH 1NFDB 1F3DJ 4LGPB 4MAYC 2OL3H 3L3DB 5D2NC 2Y5TA 3BD4A 2XWJB 2NY3C 4HWBL 5MHSE 4AMKL 1TITA 1YDPB 4N8CH 1Q72L 3ARBD 3I75A 1R24B 2V7HB 5B39B 3CMOL 4OLYH 4DQOH 1FCGA 3ZDZE 4L4VA 4WHTA 3CIQA 1FP5A 2BSRA 3NCJL 4KQ3L 3HG1A 3NIDF 3HZYB 1QSZA 1ZANL 3ULSB 5CWSA 4LLMB 3MRCA 5DUPH 4UIKH 5B4MC 4Y4HA 4J23A 1IC7L 4CVXB 3IU3A 3KJ4C 4N8PA 4K7PX 3TN0A 1JHKH 4X80H 4WNQB 4OAWA 1Y6MR 4I8DA 2LTQC 3RY5A 1B0GB 3RWJA 4LSUL 3TPUA 1JGDA 1KBGL 4YE4L 3E8UL 4XP1H 1I1AC 5F3BB 2MQ0A 3QEQD 4FQ1H 3S4SB 4ZFOA 3PWVB 4K94C 1LEIB 3IJYB 3O3AA 4Z7QF 1QLEH 5C6PB 5KJRL 5GSRA 1HZHH 1U8IA 3JWOL 3M8OL 1UC6A 3GI8H 4DW2L 4O51A 4DKFH 3MGOB 1Y18A 2FX7H 1XGRA 3SKMA 2E5EA 4OZGA 2NX5B 4U6VL 1A3RH 2GSIA 3UDWA 2CO7B 3TA3B 2BOCA 4DKDC 2BVTA 4NN6C 3B6SA 2A0LD 5IP4A 5IT2H 2C3WA 1XIWC 1FDLH 5J13B 5B38G 4XCYA 1OCWH 3U4AA 2CH8A 4KH2A 2JJVA 2NLJA 1SHMA 1O5DT 1DLFL 1S7WB 2P48B 1RULL 2RQ8A 1CICC 3ULVL 5DHVB 4QRPE 2W1NA 5I1HL 1BEYL 5F1NA 3IU4L 3VU2A 2X4OB 4JHAL 1YN7A 1P1ZA 1GZQB 5E2VH 1CF8H 4WI8A 1N8ZB 1BVKA 4LHUA 1YEEL 4S1RH 5D96C 3MCKA 2YXMA 5A16A 3MGTA 3IFPA 5E9DB 4Z7NF 2IPKB 4UBDD 2F53B 2EYTA 1CGWA 1J12A 4M61B 1HDMB 4TNWK 1MI5E 3IDMB 2Q86B 2NYYD 3MRMB 4HPOL 4WFGE 4XX1G 4JGUA 1AHWC 4ZFZA 4ODTH 4HFWB 3RVVD 4JFFD 2X4NA 1OLLA 4PUBH 3MJ8A 4RWYL 3D25B 4JFQA 4L8BB 5EU4B 3VJ6A 1UJ3C 1NFDF 3GMPB 3DOSA 3L6FB 2V5TA 4B41A 3GSQA 1HH9B 3S36X 2ZUTA 3O0RH 4EUPH 1FNHA 1QG3A 1XR8A 1P84J 1KCSL 5B22A 4RMSA 5E99H 3GSOB 5JW4R 3O2DA 1S7VA 1A6ZB 2CDFA 4OUUA 3G5YA 4WEUD 1T0NA 3JV4B 3H7LA 4HK0B 1H0DA 1RMFH 4NOFA 5D1QD 4OCWL 5DVOA 3D2UA 5LXGL 4HJ0D 3DVNB 5LKNA 5IESH 1MJUL 2V2TA 5IBLC 3BWUC 5DJYA 1FZMB 2JK5A 5EFIA 4U1JB 1DUYA 2AXHA 1TETH 1QR1B 2GJ6E 4YHYB 4MJ5B 3O3DB 2EYRB 5DRWA 2VR4A 5D7SH 4YAQB 3RRQA 5I1DB 1J5OH 2MFNA 1VACA 4XC3H 1YC8A 2R1WA 4IIQA 1K5NA 1U8QA 2FO4B 2XZQL 3RTQD 3LB6C 1D9KD 1F4HA 2AEPH 2E7HA 3B5GA 3FQUB 2FLBT 2W0PA 5B3JE 1JRHI 4UILH 2AV1A 2EIZB 4JFOA 5SV3A 1HYSD 4WUUB 1CIDA 3B9KD 4LRNH 1GH7A 1LK2B 2FL5A 1RI8A 1B4JH 4PTUB 1LGVA 1RVFH 4WRLA 4WU7B 3FCTA 4MGXA 4MNGA 1MUJA 1CIUA 1Q9WA 3NCYP 3HLAA 1NFKA 2M1KA 2ZOLA 1T22A 1G7QB 3IXAA 2PXYD 3ARSA 5JHDD 4JVUA 3KLHD 4APQA 4NM8L 3U9UA 1INQB 1MWAL 2LVEA 3UC0H 2D7OA 1KULA 2KBGA 2DIAA 4LCUA 1QSEA 5E8NA 5C09B 3MRGA 2VSCA 3MMEA 4M9OA 3UAJC 1L0XA 2WP3O 4K7PL 1YPZA 4RGOL 1P4BH 2R1XA 4ZUVB 1KJMB 5EIIA 3ESVF 1CFQB 1QFWL 3CD4A 2DKUA 1I8KA 2C4FT 1AP2B 1DJSA 2NW2B 4YHMH 3G6JE 5E00B 1A7RH 4QO1A 1H3GA 3UBXG 1FRGL 4R26L 2EO9A 1GOFA 2X42A 4YPGB 3GNMH 1NCNA 1NCWL 3V6ZB 3OKDB 3C5ZA 2V2WA 3BAEH 4TNVK 2VB5A 4ZXBD 4JRYA 3SQOL 1U8MA 4F7PA 5ACMA 3WNKA 3LPGA 1KACB 2H41A 1W72A 3WD5L 2ZKHH 3ARTA 4G6AD 4G8GD 4E9LA 2WUBL 2RFXB 3Q3GA 2P43B 1KLFA 5HI4D 4OJFH 4RFOH 2ERJB 1JHLH 4QF1A 5CBEA 3V5DA 5JIIA 2IC2A 4I0PB 2BP3A 1RHHA 2HH0L 1AI1H 4PRPA 4NWUH 1BIHA 2Q8BL 4KKLD 4F7CA 3VMNA 1BZ9A 1HKLL 4JCLA 1CFNB 4BSVB 1IGYB 4M1CC 5H37H 4MWFB 3VGAC 3RNKB 2J6EH 3OZ9H 4HXBH 4CU7A 4FXLA 4IRJC 2GTZA 1GOGA 4CU6A 5H94B 4CMMB 5DQ9B 1KIRB 1CGTA 3GMMA 5E5UB 3EFDL 3IB4A 3VD7A 5FCUL 1Q9KA 5EUKB 1NAKL 4HUVA 4Q7DA 2YPLD 3UTZA 3AREA 4BKLB 5IB1A 4L9LC 1QFUH 2VAJA 2BVOA 4UV4L 3L3IB 1OTUD 3JXAA 4HGMA 5TDPA 4X5WA 2NY6D 1S9XA 2VRAA 3V4PL 3WS6A 3JBG7 2AQ2A 4BSJA 5IROA 3KNBB 4XRCB 4GQ9L 1J0IA 4NNPL 4YXLH 3VGHA 1T5WB 4ZO6A 1OB1A 2JB6A 4YQXL 1F90L 4PLKC 3S36L 3TH3T 4H8WH 4G43B 3QQ9C 2IQAB 1JYNA 3EO9L 4EOWH 3U83A 1F58H 1SEBB 2C3VA 3QI9C 5DMYA 1AGBB 3QT2A 4G8IA 5DRZB 3SGEI 3DX7A 1MWAA 1X3DA 3VFPA 5LQBH 3GBLA 1EFQA 5ALCH 1YQVH 3LD8C 4D3CL 4ZTOH 3J8F7 3RX5A 2DYPA 3E6HB 5T1MA 1YYLH 4QRRE 2YC1B 5DD1L 5KSAB 2F54E 3KPLA 1MRCH 3S34L 1Z9LA 2HMID 1RJLB 2VH5L 2B39A 3MV7D 5IMMB 5IJKC 4FFZL 5DEZA 1VSCA 1G9EA 4JPVL 2ADJB 2NZ9D 3C6LA 4ZSOA 5HYSB 1ZT7B 1HNGA 4YIQB 5HHXL 3MJ9A 1PQZB 4PTTA 4WI5A 2EKJA 3FRPA 4KTYA 4NM4H 4L3ED 4FOMA 1AIFB 2QQNH 1KELL 4M7KL 3QBTB 1A22B 2PO6A 2C9AA 4KQ4H 4PP1D 3VFMB 4FXKB 3VXSB 2QSQA 3TJHD 1ZHBB 3TIDB 2BVQA 3BT2L 5EN2A 1IL1A 3JV5A 3RDTA 1RZKL 2W60A 1ZSDB 3MO1B 3IXTB 3ZYZA 4GKZB 5GS2D 3CUPA 1C16B 3TH2T 3PNWB 5BMFL 3QXWA 4KMQA 3HMXL 5SX4I 4LSRL 2R0ZH 3HI1B 4F9LC 2ZSWA 3CSYA 5IHLB 3PV6A 4FZEL 3OGCB 4JHZA 3FB8A 3M1BA 5HGHB 1J0JA 4ESKA 1KENL 1TPXB 2BNUA 4XCCH 1CR9L 5JW5B 1EFXD 1OTTC 4ZTPL 1NCUA 4MNQE 4OKVB 1FGVH 3GUTA 4TUOB 3VXSE 1PKQE 2WINB 5DJAB 1RUMH 2CLVA 5GIRA 5D6CB 3TM6A 4Z95L 2FHBA 1MPAH 1AXSA 5IFHH 3IF1A 1QR4A 4KKAD 3EOTH 3GJFB 3CGTA 3H8NA 3UZVB 3R06A 2ADGA 4I2XE 4RRPG 5IW3A 5EZLA 3PL6B 5CD5C 2YKLL 3V5HB 2VDOH 4XVTL 2GITB 5TDNB 1I9RL 4HIHA 4HXAL 3QWOB 1S9KC 3C60D 4ZOCA 3C5JB 3IFOA 3SDAD 1IAII 1DBBL 4MD0A 1OTSD 4W6YB 5LJYH 3GSNA 2DQCH 1G7LB 3DPBA 3HG1D 4LPCA 4S1SL 5E1HB 5JIKA 1JPSL 4HIXL 5FOBB 1OAZL 1EVTC 4L29A 1LP9E 3DETD 1T5XB 5MP6L 4HWZA 5DQDH 2P24A 4OGAC 2R4RH 3TN0D 2ICES 3SDDA 1YNKH 1KTDA 3W2DH 4LCCC 4WDIA 4PJCA 4Z7WA 2CK0L 5BRZA 4HBCH 1KN2L 4EI5A 2ZUWA 1F2XK 3QULA 4PP2B 1QYGH 4UIMB 2A6DB 2E7CA 3QYCA 1OAQH 3L3JA 4BFEA 2NY3B 2J2ZA 1R3IL 5IHZA 5ISZA 3IAPA 4HMCA 3SKNB 1FFRA 1V8HA 5CAYB 1JE6A 2XXMB 5ICYA 1CDGA 4GMTH 4S1QL 1NJ9B 2D7QA 7FABH 2GAZA 5KVDH 1I7TA 3HS0A 3MREA 4OB5H 3REVB 4R3SA 3V2AR 3Q6GL 3DXAD 2KH2B 4JO3H 2QR0B 3QIUB 3QZWB 2DQUH 4N5UA 1XGPB 3NCBB 3EGSB 4MQTB 4QGTA 4Z0XB 2WLZA 3HC0A 1J8HE 1S7UA 1XCTB 2AXGA 1K4CA 3MXVH 2LTQB 5D4QA 4S10A 3EUUA 4Y1AB 3SCMC 25C8H 5TQ2L 4PJBA 3MACH 3ARDC 3KLAA 4WO4C 5SWSB 4YXKH 4U6TA 4YBQC 2HJFB 4PJ5B 1YECH 5D2NE 1GL4B 2Q7YB 5FO7A 4YO0B 3MUY1 3I3EA 3CFJB 3QJFB 2ARWA 1DL7H 4LHUD 4KROB 3U4EA 1I1YB 5T3ZE 5EPMB 4MCYB 1NGYB 2VL4A 1I9IH 5C0CA 2ARJQ 1EIBA 3HR5B 4P4RB 4B50A 4KZEL 1NGQL 1IVLA 4ALAL 4HWNA 4FQ2L 2VLME 4N8VG 4NQTA 4KPHL 2VITB 3VFNB 5CEZL 1F6FB 5JHLH 3PWPA 4Z6AT 2XY1A 5J1AB 1MOEA 4M02A 3VA2C 3TGXA 4OLZL 1A4JB 3K0WA 5ANMA 3VXUB 2AAVA 2BNRA 3U2SB 1G7PB 1ZHNB 1A4KA 1MJ8H 2J8UE 4H8WC 3D0LA 2YPKB 2VUOA 5C0AE 2VAAA 5FGCB 3BPNC 3VWKA 4OUOA 3H3PH 3B83A 3C08H 4N0YL 4WJ5A 3F5WB 2F9BT 3PHSA 3MRLA 2X1PA 4TPRH 4F7MA 5D96B 3T4AB 4XP4L 1AGFA 3TBTB 4NQDA 2OMNA 4WV1A 1EO5A 4EBQL 4KRPB 2ATKA 4Y5VC 3REWA 4XP6H 5FM8A 2P42B 5ID0A 1M6OB 3QQ4A 3N0PB 3RVXD 3NGBC 4RISH 3X17A 1FYTA 1F4YL 4ZQKB 4OTXL 5CJBA 4W4NA 3HE7C 1GGBH 2A0LC 1AHWB 1HQRB 5JLZA 4FA8A 5GZOD 5E24E 1A2YB 2ITDA 1QKZH 5C2BL 1J7VR 3QEGH 3QUZB 3HZMA 1Y6KR 2GJZA 5IMKA 1UJ3B 3DMMA 4OLUH 1KC5H 1KB5B 2FX9L 1UVQA 1CK0L 2VZOA 3EJYD 3EYUH 1BPVA 2W07A 4QRSA 3KYKL 5F7UA 1A9EA 4BA8A 4JAMA 2HJLB 2QTEA 4K8RH 1DVFB 2A6JA 5DD5H 3MC0A 3DV4A 2FYYB 2UYLB 2UWEB 1IAOB 3VWJD 4A6YB 5IWLC 4M5YL 5H2BA 4YHPA 2QHRL 4JFPA 4X9HA 1H8OA 1RURH 1NGXA 2CIKA 3VXTA 4B53A 5JPMB 4JFHD 1A9BA 1FNSL 4YHOH 3WSQL 2NYYC 4KDTC 3HNTH 1FORH 1ZLVK 1D5ZB 5A2FA 2X1QA 3M17A 1F2QA 2ICEB 4APQD 1OP3H 4GKNA 3P0YL 2DLGA 8FABA 3S88L 2VN4A 3BZFB 4P9MH 2GK0B 2NY5L 1I3UA 3LPFA 1QRKA 3RVVC 1I1FA 3VXOA 2CXKA 1U95B 4QEGA 3TBVA 2H6PA 2XKSA 4MSWA 4MAUH 1NMCC 1QSED 5FAAA 4I5BB 1CE1H 2BVPB 4P46A 4EEEA 3RWCB 4LP5A 2ITCB 1F45A 3T0EA 3PQYE 5JXEC 3QUKB 4X4XA 4C4KT 2VXUH 3V79C 1FE8H 1QPXA 3WLBA 4OD2B 2PUQT 3UJJH 3FOLA 4IDJH 4P4KC 3BZ4B 3EYOA 3ZHKA 4KUCF 4PJ9B 5D1QC 2FB4H 2ED9A 3UBXA 3A6BL 5DEFB 1YMMB 1A7OL 4JO2L 3HPLB 1PD6A 1J1XH 1P7HL 1LE9B 2R8SH 2IANB 4NZJA 1L6XA 4WI6A 1P84K 4K2UL 4M8VA 4TUJA 3C5ZD 5EWIH 2AK1L 4X0KB 2ICWA 1R3KB 1J0HA 5DJXB 5ERWB 4OD3L 5D7IB 1A7BA 4QOKA 3SDCA 4G42B 1LEGB 1FZJA 3O8XA 3DV6B 4N1EA 1JNLL 4V2BA 15C8L 1ZLWK 4DEPC 1BQLH 1SYSA 3NFSH 3UTQB 4PLOB 5INDA 4NO5A 1JHKL 4POZD 3OKMA 4XXCA 3IDYC 4P23C 4IHOB 1I85C 3L7FA 5EDXA 3AM8A 1EJ6A 2QQKH 3ZDYE 4PRAA 5BS0E 4DGIL 1WWWX 3B9KC 3O9WA 4FQ1L 5HHOB 5EUOB 2DQEL 3IDJA 4CU8A 4HH8A 3V0WL 5L8KB 1S7XA 1QLEL 2SEBA 4OZ4A 4U1GB 1AXTL 5DMGC 1MEXL 4WW2B 2OL3B 4I4WA 2IANE 5I75C 2NPLX 3PGDB 5KG9B 4UTAL 5DD6B 1A7PH 1W0VB 1L0YA 3KLHC 4UDUB 1BOYA 2VO5A 3ILPA 2Z4QB 3U7AA 4WCYL 5FHAL 4LPVA 1VADA 3V52H 1TZGL 1MCLA 3K1KC 3BMWA 1IKFL 4MDIB 2NQCA 1FDLL 5J11B 1OGAA 5FGBA 1Q9OA 1TJGL 1G9NL 3TNMB 1X5IA 3ARED 2GJJA 2YA1A 2UWEF 2B1HL 1S9VB 4JQXA 2F5AL 4OLWH 3WCYA 2ZOKA 1MY5A 5FUOL 3WFEL 4LSVL 2J4WL 4HBQA 3QDMB 1UADC 4PRHE 4DZBB 1CLOL 1A6UH 1F3DH 5EU5B 4HUUB 1BFTA 5C7XL 4ZG1A 1NGWB 2BVEA 3VGAB 2B2XH 5C0BB 4NGHL 5GRZA 1GGCL 3PF2A 3C87A 3DJ9A 1MF2L 2R0WL 2W38A 1IMHC 1DLHB 1CE6B 4HLZG 3KYAA 4JRXB 4PJIA 4ZXBC 3QXAA 1KCUH 4TRPL 5D71H 3HI5H 1CGXA 3QO1B 1DBJL 5J9PB 2Z91A 3G9AB 4LPXA 2GUOA 4PG2C 2B5IC 3HRPA 4H88L 4LSSL 1CVSC 3BIKA 4L9LB 4WTXA 3SBWC 1QLRB 3EHBD 3LOWA 4G6AC 2UV3A 1JP5A 2VMFA 3MLWL 4FTVA 4LCIH 1N0XL 4I3SL 1VEMA 4XCNB 3PWLB 4GKSB 1ORQA 1VPOH 3MPCA 3X13A 5BQ7B 5J56B 4F57L 2X5PA 3O0RL 1QA9B 1JNHB 1PX3A 5IVZB 3DHMA 4YHZL 2W0FB 5TGBB 1T1ZA 3TBYA 1BBDH 1DN0B 3VI3F 2PO6D 4KKBD 4PJFE 1AFVH 4JRXE 2AJXL 4Y5YC 5D7IF 5FV2A 1ZA3A 5I16B 4K9EH 5DC4B 5DUBB 4K71C 2DWEA 3LD8B 4H5SB 5CP7A 3RDTD 3RIFK 3AY4C 5BCAA 1FVCA 2VLJB 4WFFD 4P2QB 1QZ1A 1UB6B 5EUOF 4X6CB 5C0DB 4X6EB 4LKCB 4HW6A 3GMNB 5KVGH 3X3FL 1E6OH 5CZVL 5TH2A 4WW2F 5CZXD 4IBLT 4BSWA 4KKCD 3ZYOA 3KYNA 2OBGA 3FT2A 4M6ML 4EUPB 1INEL 4YDVB 3BWAB 4C56D 3DUUA 1JWSB 1MHCA 2O5ZH 1JZ8A 3Q5OA 2P5EB 3MUGB 2AK4B 4RX4A 1JGEB 3NCEB 3KS0J 4YWGH 3WNNA 4W4OC 1YEFL 1ZK9A 4R0LC 4R4FH 5M95B 5DS8B 1O0VA 2J7LA 4AEEA 4R2GB 1WSST 1UACL 2W65B 2WBJD 3WUZA 3S96B 1OWWA 3TT3H 3FFDA 2HMIC 2JJTA