1KACB

Knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
124
structure length
124
Chain Sequence
GITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/receptor
molecule keywords PROTEIN (FIBER KNOB PROTEIN)
publication title Structural analysis of the mechanism of adenovirus binding to its human cellular receptor, CAR.
pubmed doi rcsb
source organism Human adenovirus 12
total genus 27
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1999-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kacB00
3I75B 1X4ZA 4LU5L 2QSCH 3LEXA 5IQ9A 5EUOF 2EYRB 3UPCA 2ZOLB 1A5FH 4N0UA 3CGTA 1N64L 1Y6KR 2YD4A 4X6DB 4XNMA 1C5BL 3MRCB 1L7IL 4KI5C 2YPLB 3IJSA 1PZUB 5F9WC 3KPOA 2AP2A 3K7UA 3HPLA 1ORSB 5FUZL 4GAYA 5GGQH 4EXKA 4LEOB 4PRPD 2K9UA 3P4MA 1WZ1H 3VXRD 1GHFH 3OKDB 3DHJA 5E5MA 4PD4K 5I1GH 4RFNC 1CE1H 3HKFA 2UZIL 2K3TA 3AY4A 3UDWC 4KU1A 5EOCJ 3PUCA 4L8CA 1MCWM 4YFDB 2WMPA 2EZ0D 1U8HB 3U4AA 2CXGA 2BNRA 3LD8B 4JFFB 3PWLB 3W82A 4NO5B 3PHSA 2YMXL 2VQUA 5HGHA 4N5ED 2MMXA 5IWLA 3MGAA 1BJMA 4JKPH 1AHWC 1BVZA 5ACLA 2Z91A 3WNKA 3VXUD 3BUTA 2IC2A 3GBNH 3BXNA 4ENED 1I1YB 5LXGH 3QDGE 1QR4A 5JHDE 5CKAA 1BOGA 4GXVH 2ZG3A 3FO0L 4MD4B 1B0WA 1MFEH 4NT6B 1RZFH 2VITA 5AD0A 2D0GA 3QUKB 3C6SB 5F6IC 4HWNA 3IDUA 4LLVA 1FFQA 5B8CC 3L5HA 5CP3H 3GMRA 4NQVB 2RCSL 5TDPA 5D7JA 1NSNH 1J10A 5GGSA 5GS0D 1MWAH 3L3KB 5CINL 3B9KA 3VFRB 3DIFB 2AQ2A 2NY1C 2JB6A 2P5ED 1NC4D 4ELKB 4JO1L 3I2CH 5I19L 2DLIA 2Y4SA 2QHRL 5L2KE 5EIVA 1GPOL 4HIIB 4NHCL 3BEWB 5C0ND 1ZHLB 4HPOL 3V6BR 1XF4A 2PO6B 5EA0L 3QYCA 3O6KH 5T5FL 3LKPB 4RGOL 3FB6B 2ITCB 1RI8A 3FN9A 4P2OB 2D7QA 5C0DB 5EO0A 4JFED 4OCXH 2CIIA 5IVOA 3ILPB 4MCZB 3SQOH 2R23B 1Q9KA 2P46B 1J87A 1LE5B 5E8OA 5C6TH 1RFDH 1EUUA 4PJGA 2BNQE 1A2YA 4BH8A 5CKGA 5FYKL 1WTGT 2BFVL 4E0RA 1MHHA 3CSGA 3FONB 4U6HA 3NIDF 3RX8A 3PG2A 3F58H 4BYHA 3H3BC 4HEPG 5DQDL 2R1YB 1I7ZB 2PYEB 4JRYB 4KUCF 5HGAA 1XF3B 3VD4A 2WZPD 4MA8L 5D5MB 4JFHE 1AGEA 4JGJA 4URTB 5LAXB 3WNLA 3IS0X 3O4LD 1DBAH 3VFSB 1G7HB 1DBKL 3O6FD 2ZSVB 1DDHA 4JPIB 1JWUA 4JY6B 2DQFA 4XPGH 2FLBT 4QKXB 4I48A 3FQUB 3WNOA 3V6FA 4ZUWB 1JTTA 5BRZE 2VZ1A 1FL6B 1MJUL 5E9DB 3RVUC 5IMMA 3KNBB 1PY4A 3VXSB 1EEYA 4PB9H 2OTUB 3KWWB 3Q3GB 5AZ2H 3STLA 1FIGL 4P4KA 4KKBC 2DQTH 2YBRB 2ZUXA 1Z5LB 3B43A 3MRQA 3OTTA 1WWCA 4I18C 4IRSD 2EDTA 4PJDF 2D4FA 5JIIA 4LHUB 5CILH 1DBJL 3ZE1E 5KSAC 3FTGA 5GRXG 2CUMA 2E7CA 4LASH 4PRPE 2CKBL 1LO0H 1PEZA 3VXRE 2CH8A 3BN9C 4UV4L 3SDDA 2J2ZA 2PF6A 3QRFM 3MRDA 3T09A 1N3NA 2G5BA 1AQKL 4HWEL 5EU5A 3UTZA 1T03H 1HKLH 4HGWA 3VFUA 3D69B 2W1NA 4G9FB 3O2DL 4J3OC 4MAYA 4HWUA 1JRHL 1BVLB 1YN6A 4Y1AB 4WV1A 4Y19D 3GRWL 5H35A 3JWDC 1QFUH 3MV9A 5C1MB 3QUZA 4PRNB 2MPAL 3B3IA 2AK4B 1Y6NR 4NYLA 1TVBA 4AIOA 1XCQA 5B39A 3TCLA 3PV6A 4MS8D 3VXUE 1V3KA 1OSPL 5I15H 1T21A 4J7RA 3RVTD 1QSFD 2XFXB 1OQXA 5ENWA 4GG6A 4UOW1 4NNPL 4FQQB 5TDNA 1AR2A 1ODAA 3SDXF 3C5JA 4HK0B 1YDPA 5D7LD 3GMQB 4OV5A 3QEHA 3RUGF 3AVEA 2W65B 5HHNB 3MNWA 5DT1H 1MCNA 5D2LE 3EYVA 5IV2A 3L5XL 2O5ZH 1FNFA 3GNML 4NWTH 2Y72A 3S35H 3PIQA 2HT3D 4ONFH 2Q20A 4UNVA 4W6WB 4PGCB 4S1RH 1JWSA 1WF5A 2P5EE 1CF8L 1QTYT 3ZE0E 1D5XA 2VXUH 1M7IA 5CEXB 1K85A 1X5YA 4KQ3L 4RMUA 4RSVA 2R1XA 5IROC 3C09B 1JGVL 4AM0B 4LCWB 3MV7D 2EH7H 1JZ6A 4KRMB 4MJ5A 2DRUA 1JBJA 3GIZH 5IHUH 4OAWB 2WNGA 3MR9A 3N85H 2AXFA 3PV7A 4YDJA 5I74B 4ODTH 3UCRA 1ZT4B 1BBJB 3Q6GH 4AT6B 4KHXL 5CLWA 3ZO0A 4JFEE 4G42A 4L4VD 1TFHA 3V5KA 3F62A 1T83C 4NN6B 1HINL 3WE6B 5IT2H 2Q87A 1CFTB 4P3WA 3QUXC 3NFPB 2LTQC 2MHAB 2FSEB 1DL7L 1IQWH 1X9QA 3LD8C 3VG0H 1S7QB 3ULUD 2QKIB 3GMPA 2WINA 4M48L 4CBPA 2DOCA 3UYRL 3D39E 2QADD 1JWMB 3DUHA 4NM8L 1IAOA 1YPZE 3WNNA 3CSYA 1JPTH 2FB4L 4FP8L 5F7KC 4ODHH 4ZAKB 4ZPVA 3QXVA 1LEIA 3BGFB 1H3PL 1SMOA 4EIZC 1KB5A 2VLRB 2ORBL 2EDDA 2P8LB 3RZCA 1HDMA 3O4LE 4DCQA 3LV3B 5JPMA 3L3IA 2LAAA 2VZOA 1QLRA 1AGFB 1IKNA 4H25B 3VXNB 1G9ML 1MY7A 1S9YA 3DJ9A 4LSSL 1E4KA 4Y5XA 4ZXBD 3QCUH 1DBBL 1F11B 2OSLA 4OFVA 4X7SH 2X4NA 4XH2B 1XIWC 2DQDL 5BZWB 1AKJB 1PG7H 2AXGB 2APFA 2QTEA 4OCSL 1EH9A 4UIMB 5CSBA 4KY1L 3DPBA 5GZNC 4GUPA 2VDOH 1ND0A 1LK3L 1FGVH 5LGKA 3EO9L 2GCYB 1FZMB 4WGVB 4HWBL 1A7QL 4K7PL 2BSSB 4Q6IC 2HTLC 3ARDB 5LG1A 1YNLL 3T0ED 4M1GL 1PEWA 3Q1SH 3ZE2E 4X4YA 1YJDH 1ORQB 4O9HL 1E27A 4Y16D 4QHNB 3NTCH 3QJFB 3R8BB 4P2QB 4P2OC 4X6EB 4Y4HC 1DEEB 3S37X 4E9LA 3EFDL 2AQ1A 4BZYA 5LCVL 1QACA 4P2YA 3TEUA 4WI7A 5GGUA 4IIQA 2YD7A 4Z7WE 1T1ZA 3FCTB 5LBSH 2ZUUA 4QRQB 2C5DC 5I2IB 3P9WB 1UM6H 3N1MC 1QFPA 3HZKA 1CWVA 2Q3AA 1YEJH 1NUDA 5JO5B 1M05A 1ZVYA 4JJ5B 5J7CC 1QSFE 3FFCB 3KAAA 2V5TA 2BOBA 1IZKA 1H3VA 3SDYL 5C09A 2Z8WC 1D5MB 1NBVH 2X9WA 3V4VH 3MSPA 3SDCD 3MOQA 5D7LE 1C16A 3IKKA 2QSTA 2X4SB 3DARA 1MCKA 4BUGA 4M62L 1BFOA 4BZ1H 3LKNB 4NSKB 1ZMYA 4NUGL 1F3RB 5EUKA 5TF1H 1CD9B 3ET9F 3UAJD 5CD5D 1BF2A 3CVHL 5ALCH 5I1LA 3WIFA 3C5ZD 3L5IA 4GLRH 3WFBH 2J1KA 3K4AA 3L5JA 2PNDA 4MNGE 5ESVA 3FQRA 3AU1B 4KDTC 5GZOC 2NXZC 1J1PH 3BYYA 3CJJA 4ZFFB 1WICA 5E6ID 1EJOH 4KROD 3FAWA 3L3JB 3MV7E 4UNTA 3VE0A 1FYTA 4E5XB 1RIHH 2IAMC 3PGFL 2D7OA 1OW0A 4OZFG 5DD3H 1A7OL 3MUJA 4OZ4A 3BMVA 4WJ5B 4BFIA 3G6DL 1MAJA 4WW1B 1RHFA 1XGUA 4G7YH 3E8UH 1CE6B 3ZHLA 4JHWH 2C7UA 4OFYA 5EOCH 5EZLA 3SCMD 1CBVL 1U95A 2HLAB 4L4VE 3KDMB 1HZHH 1VPOL 4HDIA 1QLFB 1SYSA 5DJ8A 4L9LB 4LEXL 4UUJA 2FO4A 4GAGL 4R97B 1FCGA 3KYNB 4UILL 3O9WD 3BQUD 3ULUE 2VDQL 1ZLVK 3H2WA 3C08L 4J4PA 4BKLA 3QIBA 1YQVH 4JFQB 3QWOA 3BH8B 3CMOH 3H7LA 5D8JH 1ADQA 1CFVH 3DX7A 3PWPD 3WD5H 2EC9T 4PJIE 6FABH 4L3EB 1N8ZA 5FOBB 4OGXL 5HYSG 5JORA 4ZFGH 3HE7B 4V2CB 1GXEA 1UYWH 5IKCB 5FF6A 2Z93A 2APWA 3MLYL 3OKMA 5E70A 3IFLL 5IB3B 1LNUA 4M6OH 4JFYB 2D7NA 4RQQA 3P40A 4HV8B 2PXYD 3GZKA 2R69L 5C07A 3FMGH 4KJYB 5TFSL 5GS0H 3QIWA 2GT9B 4NN5C 5IF0B 4G3YH 3UTQA 5DUPL 2D7MA 4HUUB 4F8TA 4UT7H 3WLBA 1FL5B 3I6LD 4HULB 3B2VH 3NN8A 2J4WH 2J88L 2Y5TB 3CZFB 4YHOH 2F53D 1YNKH 5I18H 1X4XA 1S7UB 4NN7C 1U3HD 2JJSC 4HLZG 1MFAL 4O51B 3VFOA 1RULL 4U6XA 5DD0L 3P30H 1INQB 3T0EE 3GIVA 4RDQG 2ID5A 4JM2A 5F7YC 1FDLH 2AEPH 3SOBL 2QEJA 2NX5D 5ADOL 2C3GA 3GGWB 1A3LL 4WW2F 2IANA 5MP6L 2ENYA 2EEDA 4QY8A 3U1SH 2HKFH 3ARFD 1I85C 4Z0XA 4EI6A 1MCLA 3CVIH 4PJ7E 2YD8A 3MV8E 2H1PL 2WBJD 5BJTA 2ZUTA 4TRPH 2SEBA 4WTXA 1ZE3C 1K2DB 3BKCL 1NCTA 3QFJD 5F71A 1NDMA 4WTZG 5IJVA 2H6PA 3VFGL 5I9QC 1T80A 4UQ3A 1W0YT 4JPWL 1YUHA 3IDGA 4G80A 3DV4B 5E2TH 4L9DA 2VDLH 1U2CA 4N90D 3PGCB 2IQAA 1F02I 1N2RA 5KSUA 2EYSB 4TTGA 1F97A 1T2QH 3PL6D 3WKMH 5E94B 1U3YA 1G7MA 5D2LF 3MXWL 2Y7QB 4Y5YB 3L1OL 4X4MA 1DBML 2W0FA 4HX1B 4MJID 1L6XA 2Z35A 2GJ6B 4P5MB 5ADPH 3U4BH 3S36H 3AB0C 1NEZG 4FS0A 1WAAF 4HFUL 3SKOA 3PJSA 3WO4C 3ZE0F 3DVIA 4D9QD 2J7LA 1XCTB 2B1HL 3D3VD 4FRWA 1FC1A 3JVGA 4KV5E 5EC1B 3GMOA 4NQSB 4U33A 2FGWL 2MSPA 4O2EA 4OT1H 4U1GC 4YAQB 5HDBE 3JUYA 4I3RH 3V0WH 1MHPH 1U8NA 1VGKA 4J3SA 3W0WB 4LK4A 2F54D 1YEEL 4NQEE 4JPKL 1MFCL 3CMGA 4RISL 2APXA 4FFYL 3T65B 3VFTA 1RJLB 2ZWLT 3QQ3B 4XNUH 4HHAA 3HG1A 4H88L 4LSVL 1N6UA 4JZJC 4X83A 1NMBL 2K7QA 3BOVA 1OT1A 1OPGL 1Y18B 3L95B 3T0VA 4M5ZL 1YPZF 3VWJC 4JZOA 2VLKD 4M7JH 1S7XA 1XF5A 3PWPE 1RJZA 3BPCB 3U82B 4HIHA 1BBDL 4OI9A 3MRHB 2X09A 2JTDA 4LCCA 4NWUL 5ESAB 1BWMA 3WFDL 1ZSDB 3RWGB 3WSQL 1R5IA 2UYLB 4I1NB 1FNHA 2F5AL 3U0PA 1MRCH 1BIHA 3CFIC 3NPSB 1K5NB 1XH3B 4UT6H 4ONGH 1BD2D 1TJGL 5FXCH 1A6WL 1QQDB 4Z0BL 1Z0MA 5C0EA 2YEZA 4H1LH 1BIIB 4ZUUB 4DZBA 4OM1H 5FYLL 4A6YH 4FN0A 2FD6H 1Y6MR 4XRCA 1D9KD 1GGBL 1OGTA 1TVHA 3RHWK 1N7MH 2G2RA 2J12B 1HXYA 4FQXD 1ZVSB 2F53E 1ZHKA 4TVPL 1QNZL 4JVUA 4LLMB 3KGRA 5EPMB 3O8XD 4WFFD 4EVNA 2OMNA 1OWWA 4KAQL 2JB5H 4R4FH 5F3BB 1I1AC 2NX5E 3VRJA 1MELA 2OR7A 4FQ2L 4HZLA 3ZE2F 3O4OC 3U46B 3LKQB 4L1DA 4WUUA 3TJHC 2CKBA 5BXFA 4KKLD 5T3ZD 1KG0A 4L9LC 4GKZA 5E8DH 5DHVH 5DFVC 1C08B 2NXYB 3WXVL 1EFXA 3FRUB 4XPFH 4Z7WF 5JIPA 4APQD 1KCLA 1RMFH 3O2DA 1BGXL 4LSRH 1R3IL 5EU3A 5JXED 1BLNA 2CLVA 3ULUH 3GRWA 1YMHA 3D39B 5IEKB 4G6KH 4MSWB 5HXMA 4JQVC 3DX9B 3QFJE 5DUBA 3ZDXE 1TZIA 5CMAA 2F19H 1JNNH 3CD4A 3HE6C 3RWIB 3P11L 4V1DA 5E4EB 2J5LC 1MCEA 2WBWB 4KKNA 2DIAA 1A6UH 1ZLSL 3SBWC 2GK2A 1Q0YH 1EO8H 3G04A 3LHPL 2DTML 2DL9A 5INCB 5K9OB 3LRHA 3MROA 4N90E 1KLUA 2DQGL 1KIPA 2W07A 3W5MA 2O5XH 4NO0A 4FXKA 3VG9C 1JF1B 4QRTA 3CXDH 1K8DA 3ARTA 3BUYA 4AJ0A 4YHPA 2KKQA 4JN1H 3GM8A 4MJIE 5KSBE 2V2WB 1RZGA 4P46A 3LS5H 5EB9A 2I9LB 2H26A 3BKJH 1NAML 2DICA 1CXHA 5DD6B 2X4UB 1MJJB 3NFNB 2DAVA 3C2AH 4JFZL 4GT7A 5IIEA 3KLDA 3VRIB 3PQYB 2EEAA 4D9QE 5GGSY 3QA3B 4TSBH 3D3VE 2HJFA 2VC2H 3ES6B 5B38B 1G7PA 1HHKA 3JXAA 2AGJH 1JGEA 3VFPA 3TBVB 1IGTB 1J1XL 4U1HB 5HBBA 3P2TA 1CGVA 7FABH 2GW5A 3DI3B 2PR4H 3EO1B 2DLEA 1Z9MA 3SE8L 3QDJA 5A2LH 4PRAA 3QXDB 5IK3B 4IOSD 2F54E 1NBZA 3P0VH 5FK9B 2R4RH 4JPVL 3SHSA 2BNRD 1S3KL 3F65A 4O2CB 1SBSH 4GAJH 3BYTA 2XRAH 2BVUA 3ULUF 3GKWH 3T0XA 4JO3L 3TNMB 5E5RB 3LQZA 4PJHB 2KH2B 5J1AA 4PLJD 1V7NL 1S7RB 4BM7A 1JPSL 2BCKA 5JOFB 3QHZL 3REVA 5JA9A 3BSZL 3BT2H 43CAB 4PLNC 5D7SL 1PYWB 1U2HA 1K6QH 3CFBA 3LEYH 4JREB 4PJIF 5D7JD 1ZGLP 5T3XL 3QCTH 4OLYL 43C9A 2BHZA 4ZUTA 4JB9H 2R8SL 3V8OA 3EHBD 1KBGH 1BD2E 1D3CA 3B9KD 2R1WA 1EV2E 3HI1A 3PWVB 1D5ZB 4GKOA 4Y5YC 1AR1D 3L3GB 1UC6A 3MYJB 2OZ4L 5DJCB 4KDVA 3RTQB 4YBQC 1FFPB 4LIQL 3WJLC 1ZHNA 3KPRA 1FAIH 4WCYL 4YWGL 4NKDA 1KCKA 2XG5A 1NL0H 2WUBL 1DSFL 1RK0B 3CDGA 1KCVH 1V3JA 3UZEA 1LD9A 4M6MH 1P2CA 4WFFE 3QB7C 4NHUB 3DLQR 4W6YB 3BP5A 5FHBH 3EOBA 3RL1A 1T6WA 3FB5B 3ESVF 4XXDB 4HWBA 2ILLA 4AY0A 3DUUA 5D2NC 1Z3GL 2WW8A 1GL4B 5JR1L 5JW4M 3CFDA 2GTZB 5T3ZE 2MQCA 1BZ9A 4N0YH 1UB5A 4RCAA 4K8RH 1RU9L 2H9GB 2Q7YB 1JYWA 4OI8A 2VR5A 3MRNA 1QYGH 4MNQB 1BJ1H 4DGIH 4PJ7F 3MLWL 4RRPG 4L8SC 1QFWM 4XVTL 4Z7VE 5E2VL 3C2SA 4LSQH 4F33B 1UB6A 1OLZA 2PW1B 3IJYA 1GGIL 2D7TL 4P59L 3HB3C 3BVNB 1OTUD 4GQ9L 4AL8L 1JP5A 4Z7UA 4XPHH 1G7LA 2B2XL 3QIUB 1JGLL 3HR6A 4MD0A 4LPVA 1CGTA 1I7RB 4NJ9H 5F8QC 5C8JB 5T1MA 3TYGL 5ABDE 1O0VA 3AC0A 3GK8L 2VUOA 1JYXA 4QXTB 4MXQD 1UENA 3MUY1 3EFFA 2MCG1 3OGCA 3FO2A 4Y88A 3B5HA 1JZ2A 2APVA 3CIQA 1OAZL 2A9NL 4LGRB 3OKEA 2BZDA 5HDOA 5J6HA 2L7UA 3FQTB 4GRLB 4PTTA 4N0UE 1AGBA 4P4KD 1UVQB 4X8XA 5F7DA 3CVHA 2XIDA 2FBJH 2NLJB 3WFHB 2D9CA 5DSCB 4YUEH 4JO2H 3EJJX 1YMMB 4MZ3A 4P57B 4KV5F 4OF3A 3GSNH 1AC0A 4PGBB 1GIGL 3SDDD 1DQDL 3VFNA 3ZKXC 5D1XB 2J8UA 3QUMB 4UIKH 3ARQA 4M1CC 1GZPB 5HDBF 5FUCE 3IAPA 4XHQA 3TV3H 1B9ZA 4MAYD 4IDJL 5FKAA 1T1WB 1AC6A 3VGFA 1E28B 3MV9D 4HPYL 2IGFH 3K1KC 1CD0A 1H0DB 4M7ZB 2XG4A 3QUZD 2OXHA 3ARBC 3VFWB 4XNXH 1JI2A 2NXYC 3N0PB 2BSRB 1JPGA 2VWEE 3MV8B 4NO3A 4JGUA 1DFBH 5J56B 1JK8A 1ZTXL 3C6LB 5ICYB 3TFKD 4TSCH 4YDIH 1ZK9A 5DMJB 5E4EC 4EN3A 3KYKL 4OLUH 4GRMA 5FFLA 3SGDI 1X5IA 3KYMA 3MXVH 4DTGH 3MLXL 1A1NB 3W9EA 2DKUA 2EDJA 4KPHH 1CL7H 4LKXB 5KS9B 4YZFF 4HIJA 2FECL 5KW9L 4MJ6B 3WXWH 4DFHA 2VLLB 1OAQH 4PRHA 4H20H 4HIXL 1J12A 2Y07L 4DQOL 3SGJC 5I1JH 4FQLH 4GQPH 2FJGA 4HT1L 4NCDA 4XNZC 2DWDB 3OB0K 4NFCA 2GIYA 4OZGF 1JHTA 4GSDH 3MNZA 3P0YL 1DVFC 1KT2B 4P9HC 5DMYA 3NCJH 2D0HA 4XCNA 1HH6A 4DN4H 5ESQB 5I1DB 5EU6A 3NCEB 1NUGA 5IMKA 1A8JH 3REWB 3FT4A 3WDIA 3RU8H 2VXVL 3L9RA 1A6PA 3MUGB 1T1XA 3EDJA 3S3PA 2ZCLH 3FQWA 4AIZB 5IOPA 3TVMC 3RL2B 1IGML 4J1UB 4LLAA 1GGTA 4NQEB 2Q86B 1NGYA 3MLTA 3GI8H 3OAZK 1KNOB 3MREB 2EYTB 5CBAA 3A6BL 3HNVH 5JW5B 3L3DA 1Z9SA 3DSFH 4WEMB 1F8TH 2X1WL 3V6OE 4MX7A 3DV6A 4NZTH 3SKMA 3RZCD 2LU3A 2RR3A 3ZDXF 1V7ML 1IFHH 4X9HA 4OTXL 1VESA 1JVKA 1OAXH 4OZHB 1MAKA 3F7VA 2GSIA 2YXMA 4L8BA 2NW3A 2FYYB 2CIKB 4ELMB 5CIPB 2FX9L 1UGNA 5JZ7D 3B4NA 3O11B 4RZCA 4L29B 5FA4A 5FUOL 1FLRH 1U6AH 3LKRB 1J88A 3HZMB 3OKKB 4MXWL 3QI9C 2PYFB 2GAZA 3VH8A 2YUWA 1TXKA 1TETH 2E7HA 5KSBF 3RTQC 2V7HB 3T77A 4HK3J 2ICWA 1FNAA 3E6HA 4EDXB 5BZDA 4N1CA 2AJYH 5LGHL 4N9GB 5EC2A 3EOAA 4PRDB 5EZOL 4NZUL 5JLZB 2EE6A 3GSOB 4JFPA 3UO1L 3NFSL 2FATL 3W2DL 4OV6F 2RFXB 5F6HI 1XT5A 5AYUH 2C1OB 4PGEA 4XGZB 1UEYA 1RJYB 1S5IL 5BW7C 4HCRH 4XHJD 3BZEB 3MLZL 3MV9E 5T33L 2O61A 2E6PA 1DTUA 4ODUA 1DQML 2P43B 4RWHA 5ID1B 1MHEB 1A9BB 2CUIA 5T3ZH 1LE9B 1U8JA 5KVGL 5ICXA 4QT5B 4XP4H 2ARJA 1C1EH 2DLTA 4BZ2L 1NJ9A 1SM3H 2WP3O 3BIAX 4GG6E 5C09D 5I8EA 2H2PC 1FN4A 1DN2A 5C0FB 3UBXB 2P5WE 4BSJA 1ZT7B 3AXLB 4LQFL 1RZKC 4HF5L 3LS4H 5E5UB 1NLDL 4U1SA 4Y89A 1UG9A 2COQA 3K8KA 2BSTA 1CXLA 1GGYA 2KQMA 5ANMA 2AJUH 4AQ1B 2YC1A 4XWOC 3H7BB 5CEZD 4QRPB 4G6FD 1JV5A 1XF2B 2BC4B 3RWJB 4GRLC 2ADFL 2JJTC 5K9KB 1RUPL 5AYQA 3MOAH 5CZKA 4KKAD 3PE9A 5FGCE 3CFEA 2YD2A 4QXWA 4XCYA 3O3DA 2V17H 5IFHL 1FYTD 4YDKL 5F70A 3R8QA 5FYJE 5I76B 4JZNB 1F90L 2H2SC 4K9EC 4JHAH 4Y4KC 1DCLA 4OFYD 1LQSR 2AJSL 5C0GA 3LOWA 4Y5VB 1HEZA 3SKNA 1ZAGA 3FL7A 2BVPA 1KACB 3LB6D 4OJFL 1WCBB 3WJJC 1HYSD 4BJLA 5BQ7B 1YC7A 3GUTB 3ARGA 4RAVA 1I8KB 5T1KA 2VE6A 1FO0H 2FECI 4J4PD 1H8OA 1U41A 1JHKH 1N0XL 3QIBD 4PTUB 3BP4B 4C59B 2XXCB 5KJRH 2WWKT 1XGQB 1NEZA 4L3CA 1TJIH 25C8H 2A83A 4NNYA 4NC1E 5E8EB 2I60H 4WWKB 1R5WA 1RUMH 2IG2H 5FCUH 4Z7VF 1X7QA 1O7SA 4KXZH 3DRQA 1MCDA 3OKLB 4D8PA 4QOKA 5DD1H 5L6YH 2ZG2A 3MRJA 4YGAB 3STZB 5DD5H 3DGGA 1CT8B 4I5BB 1ETZB 1I9IL 1MPAL 3I75A 1UZ6E 5J1TC 3GSVB 3SJVB 3GBML 2EYRA 2XQYK 2ZOLA 1UWGH 3LH2L 5IFAH 3OMZA 2VXQL 4X6DA 5K9JL 3IRPX 3MRCA 4PJXB 5C07D 2YPLA 5EORH 5IROA 5KVFL 3QIWD 1E4WH 4FZEH 3SEPA 3UPRB 3VW3H 2FR4B 4UB0L 4RMVA 1TZGL 4I8DA 1ORSA 5C6WH 5H37H 5HHXH 1CICC 4LEOA 4OLXH 3IETB 5ELIA 5C3LD 1PD6A 5DS8B 5SX5H 1MCHA 2R2CA 3OKDA 2YN3A 3RY6C 4I9WD 1QFWL 4LLUB 1EVUA 4B5EA 4ZNEA 1BHGA 3UYOD 2XXMB 3U6RB 4RA3A 1DUZB 5TE7L 4JM2D 1FNLA 1PBYA 1U8HA 4TNWF 1INEH 3AS0A 4JFFA 3PWLA 5DR5H 3LAFA 4NO5A 1BQSA 1WC7B 2IAND 1S5HB 5IBUG 4OSUH 3MUHL 1YEFL 3PP3H 1KCSL 5EWIL 5F7UA 1VEOA 3QO1B 3CK0L 1HWHB 2X9XA 4MNHB 5INDB 1ONQB 2Q1EA 3U0WL 4YXLL 1I1YA 4HSQA 2VDRL 3QNXB 4YDVB 2XZCH 5HYJB 4MD4A 5CGMA 3S34H 1Q9WB 4CMHB 3F6LA 3V6ZB 3HNSH 5DHYB 3QUKA 2BY2A 3VXMB 5HDQL 3C6SA 1DN0B 4FMFA 3ZKMD 1TDQA 4Z7VB 1KLFA 3BPLB 2X10A 1HCVA 1MIEH 4HGMA 4NQVA 5C09E 4EDWL 4R4BB 4JFXB 1B90A 3WIHL 3L3KA 1PLGH 2NY2D 5L8KB 3OPZH 2DYPB 1V3MA 2QQNL 3TGXA 3VFRA 3DIFA 3B9AA 3RKPA 4KFZC 4ELKA 5C6PB 5FO7B 4OLZL 1ZLWK 5DVOA 3U7WH 4LAQH 2CSPA 4HIIA 3BEWA 5CEZE 1ZHLA 3HC4L 1T4KB 2F58L 4LSUL 3MODH 2PO6A 12E8L 4TNVF 5AWNL 3V2AR 1YECH 5I8OH 5F97E 5HHVL 3LKPA 2WLYA 3FB6A 4CUCA 2ITCA 2OZ4A 5IGXL 3V4UH 1FYTE 1KV3A 3STBA 3S6CA 2PCPB 4P2OA 4Z9KB 5C0DA 4ODSH 5D1QB 4YHML 1ERNA 3IAQA 1WIOA 3ILPA 4MCZA 1AXIB 2R23A 1LE5A 2V5MA 3I85A 2NZ9C 4L4TB 4G8IB 1CK0H 4XWGH 1KB9J 2R0ZL 1LVEA 1MQKL 3JTTB 3RVWD 3VWKD 1AFVH 3FONA 2GJJA 4U0RB 4DGYH 3D18B 2OM5A 3LZFH 1VGEL 3GSRB 1JZ7A 2R1YA 4Q74A 1I7ZA 2PYEA 4JRYA 1XF3A 3HG1D 5D5MA 1XGPB 4LPTA 1EK3A 5LAXA 3VXPB 4FFZH 5F9OH 4XMLL 3VFSA 1CLOH 2FEEI 1G7HA 2ZSVA 1G9NC 3RDTC 5FYKD 4JPIA 2IMMA 1RIUH 4JY6A 3FQUA 5DRXB 1LP9B 4ZUWA 1OF2B 3KVQA 4WIQA 1SBBA 4XCEB 1FL6A 5E9DA 4QXUH 3KNBA 4NP4H 5GSVB 3VXSA 2OTUA 3KWWA 4PLKD 3Q3GA 4Q2ZB 4KDTA 1YYML 1N59B 2YBRA 4PJAB 1FORL 1Z5LA 2NY0D 5C07E 1ROWA 1PG7W 1S78C 3ARPA 1VFMA 3I50L 4LHUA 4LDOB 5D93B 4Y2DC 3NA4A 2BOCB 4L1HA 3I6GB 1KLGB 4I9WE 5F1NB 1LO5B 1KYOK 1VFUA 3ZT5A 3D69A 4G9FA 1KN2L 3IDMB 3H9YA 1KEGL 1BVLA 3GO1H 4Y1AA 2IANE 2DI7A 3HI6H 3LQMA 3BIKB 4PRNA 4JCMA 2AK4A 3RIFF 1FBIH 5GS1C 1JTOA 2E3VA 2DBLL 1EFXD 3P4NB 4P3DB 4R0LB 2XFXA 1NBYB 4GW1B 3WKML 4FQQA 1J86A 1FZJB 1ZANH 2ZUVA 4HK0A 1MIML 5DJ2B 3I02A 3GMQA 3QXUA 4EZMA 2HMID 4X7TB 1JZ5A 2W65A 1NGPL 4V1DD 5HHNA 4GG6F 3D9AH 1UH3A 4BA8A 1KB5H 3G6AB 1BFVH 3BH9B 5L88H 4NO0D 2EDHA 4PGCA 4JAMB 4XP9H 5DUMH 4FFVC 1DLHB 4JO4L 3SO3B 1HI6B 1UCBL 3K2UL 5E2WH 5CEXA 2XA8L 3L7EB 4I3RL 4P46D 3BMWA 4NZJA 5DRWB 1DEDA 4AM0A 4XCCH 4LCWA 5HI5D 4GBXC 4OBRA 1OCWL 5L0QC 1OP5H 4OAWA 4GXUM 2VDNL 2H32B 4U1JB 4X6FB 1FPTH 1T22B 1ZT4A 2NY3B 4LSTH 1CGXA 1BBJA 4AT6A 1F58L 5DMGD 5A16B 1CQYA 1I4FB 2JJVA 5SV4A 1QOKA 4RMTA 4M43L 4GLRI 3WE6A 1CFTA 2YK1L 1QP1A 2AK1H 3NFPA 2MHAA 2FSEA 5TE4L 3QDJD 2DF3A 1S7QA 2QKIA 2R9HC 4JDTH 2EDRA 1JWMA 4X98B 1KJ3H 3AREB 1QBAA 3RFZC 2B5IC 3HAEG 1CIUA 4YXHL 2PKDA 2ZG1A 4ZAKA 4K3EL 1I8MB 5ALBL 4Z7OE 2DDQL 1EHLL 3HG1E 1MCOH 5BMFL 3S96B 4K7PY 2VLRA 2XTJB 2P8LA 2LABA 4JY5H 5GISH 1CDHA 1NAKH 1BP3B 4N8VG 1W2KT 3LV3A 1F6FB 5FYKE 2OMBA 3BN3B 1CDBA 4WUKL 1BREA 1AGFA 5E08H 3BPLC 4H25A 3VXNA 1MRDH 2DJUA 1P4LB 4XBGB 4CNIB 3RGVB 3OAYK 1F11A 3PABB 3HMWH 1FV1B 1QBLL 3JV4B 2P5WB 2ZUQB 4XH2A 5BZWA 1A9EB 1EGJL 4DJMA 1AKJA 2AXGA 5E8PB 4O58L 2YZ1A 4KRNA 4UIMA 1UZ6F 4G9DB 1CGYA 3MQIA 2WUCH 3M17B 3I3DA 1N5YL 2BHUA 2GCYA 3O0RH 1FZMA 4OF5A 5LQBL 1T2JA 3KPQB 1A7NH 3QEUB 4DW2L 1PZ5A 3KPRD 3X11B 2BSSA 3FOLB 4XXCA 5CJXC 3ARDA 2FX7H 4KJQD 4MZ2A 5CEZH 2BHYA 9CGTA 2ZUYA 1ORQA 3UJTL 4PD4J 4QHNA 2DQHH 4RGND 3QJFA 4P2QA 4X6EA 3RGHA 1DEEA 3TN0C 5D1QC 5DJAB 2ZP0T 5I71B 5IJKA 3MRGB 2X5PA 4XBEL 1UJ3B 4RMQA 3FCTA 4QRQA 5DZLA 1OTTC 5I2IA 4X9GA 4IOIB 4IRJC 4XMKL 3D6GA 2EDXA 1LEKB 1S7VB 4U0RC 1AI1L 4HKBB 2JF1A 1AJ7H 3D25B 5JO5A 4JJ5A 3TO2B 3FFCA 3VA2C 2XWTB 3UJJL 2O5XL 2GEEA 3LDBC 1CR9H 4OIAA 5BV7H 3IXTB 1D5MA 3GI9L 3O2WH 4Z95H 1OSZB 3SKJH 2XWBB 4PUBL 1HH9B 2X4SA 1X5GA 2XWJB 3LKNA 4NSKA 4V1DE 3HN3A 5IVNA 4P23B 1U8OB 4RWYL 1IGCH 3MCKB 1ADQH 4AIXA 4I77H 5DWUL 1KCRL 4I3SH 3INUH 3BD5A 2L0DA 4F57H 4P2CG 1P4BL 4UBDC 2EIEA 3VI3F 2XZAH 3AU1A 4NJAH 4XMPL 4LF3B 2YD6A 1FQ9C 1V3LA 4ZFFA 4BH7B 5HI4D 5AAWA 1T7YA 3L3JA 5F3HB 1KF9B 5HJ3B 1NCDL 4E5XA 1Z9LA 4L5FL 1OT2A 3QPQD 1FSKC 4U3XA 3OR6B 4WJ5A 1MQ8A 4WW1A 2AV1B 1RZJL 3DMMB 5DJ0B 1CE6A 5EBGA 3DNKA 1AXTL 2CGRL 1LDPH 1R3KB 2IBZX 5DJXB 2HLAA 4LU5H 2X44D 3NVQA 3KDMA 2VAAB 1QLFA 4L9LA 1N64H 2R2HB 1ITBB 1C5BH 3V5HB 3KYNA 3QDJE 5LGJB 1L7IH 2AXJA 3AMKA 4JEGB 5FUZH 3GJFB 1IGIL 4JFQA 5DVMA 5I1IL 1M71B 4JQVA 3BH8A 3PWNB 5F96L 4A2LA 4TTDD 3QCTL 2UZIH 4YBLB 1CGWA 2PUQT 4L3EA 5FOBA 5K59E 3CFCL 5J13B 1N6QL 2WSKA 3HE7A 3SDAA 4K7FB 2C3HA 5IKCA 2YMXH 5E2JA 4EN3D 1RZ8B 1BQHB 4KJPC 3F12B 5IB3A 4S1QL 3WFEL 4JFYA 4KRPB 2ENSA 4CN1A 4HV8A 4UOJA 4KJYA 1BECA 1VKXB 2GT9A 1X5HA 5DK2B 3MLSL 5IF0A 3OX8B 3FO0H 4HUUA 4PRHD 3SO3C 4PJ9C 3PHQB 2E27L 1FL5A 3GMMB 5EBMA 2Y5TA 3CZFA 2RCSH 3ZYZA 1S7UA 2ZPKL 4O51A 2NY6B 1RUKL 1INQA 3UBXG 1BVKB 4FXGB 2M26A 5CINH 1WBYB 1KELL 2W0KA 3GGWA 3GSXB 2UVEA 2WWMD 4JO1H 4NQTA 4M3JA 5EU6D 2N56A 5I19H 4LPUA 1T3FB 2QHRH 3ZYIA 4JM2F 4BK4A 1GPOH 3WKNA 4P5TB 4XP5L 4NHCH 1FL3B 4HPOH 4XPBL 5DTFB 5EA0H 3VGHA 4QRUB 5T5FH 1YJDC 4RGOH 1GC1L 1K2DA 1ULVA 5KTEL 2FL5B 3FB7B 3SN6N 4GS7C 1CXFA 3DV4A 4PG2C 5CEYB 2GK0B 3HCVB 1G9EA 2FDBP 3PGCA 3GHBL 4Z7UE 4TULL 5J11B 5JMOC 1Y0LB 4BSWB 2EYSA 5J6GB 5FYKH 2BFVH 2Z31B 3EKCA 5E94A 4C58B 2Y7QA 4Y5YA 4QHMB 4MA1C 5D1ZC 1YC8A 2OR8A 4HX1A 1QRNB 4O02L 5DQDH 3ZKNC 2GJ6A 5EO9B 2DMCA 3ETBF 4P5MA 4MA8H 2X1PA 3WIHA 5DRNB 4QWWD 2BX5A 4ZTPL 4AZ8A 2A6DB 1U93B 1AP2B 2VR4A 1XF1A 1XCTA 4X6CB 4H5SB 4U49A 5ITFB 5EC1A 4PJCB 4GMSL 4NQSA 3B2UD 4NGHL 2NY4D 3EYQD 4G6JL 4YAQA 4FQIL 3ZZ1A 3FHAA 5SX4H 4I0KA 3SGEI 3JTSB 1MJUH 3R06B 4YFLF 4O2FB 3W0WA 4H0IA 2ICWJ 4KK5C 4NIKB 1MCCA 2J8UE 1FIGH 1AD0B 3V7MA 4RGMB 4ZSOB 3T65A 1RJLA 3QQ3A 3BAEL 1MF2L 5CUSL 1DBJH 3LN9A 1U92B 4BSVB 1CXIA 4NBZB 3HHRB 1WWWX 1Y18A 4LDEB 3L95A 5IR1B 1I3VA 3DX8B 2CKBH 2VMFA 4UV4H 4Z7OF 3BPCA 1AQKH 3MO1B 4WW2C 3SE4C 3MRHA 4HWEH 4HEME 1ACYL 4X7FC 5ESAA 5DHVB 1ZEAL 3O2DH 3ALWA 1ZSDA 1L0XA 3RWGA 1T5WB 4W4NA 2UYLA 1JRHH 5F89B 2EZ0C 2ICEB 3GRWH 1D7FA 1K5NA 1FHGA 5JOPD 1XH3A 4FQLL 1BEYL 2MPAH 2DLFL 5GGTL 2X4TB 4N5EC 4MB5A 1QQDA 3W9DB 1SJEB 4R2GB 1H3TA 1OSPH 3ZTNL 3EGSB 4KKBD 1BIIA 4ZUUA 5C70A 2DB8A 2BY1A 4KI5E 4NRYB 5F72S 2ARWA 4ENEC 4NNPH 4PRHE 3G6JE 4YC2C 3N1PC 3FRPG 4DVBB 4R7NB 2VTFA 4GOSA 1A6AB 1ZVSA 4LLMA 2A2QT 4K23H 5EPMA 3L5XH 1VEPA 3GNMH 4GFTB 3P77A 5F3BA 1OGAE 5FYLD 1S9WB 3DMMC 5GS0C 3U46A 3LKQA 5GS2D 5B3NA 2VDPL 4K7PX 4M93B 4MVBC 5EU6E 1CF8H 5GPRA 5MENB 4JQXC 4TVPD 5IB1B 5EZIL 4M8VA 1C08A 2NMSA 4KQ3H 3FRUA 1JGVH 4UMGA 2BRQA 3ARGD 5T1KD 1FH5L 5L8LB 4WI8A 3D39A 5IEKA 4MSWA 4MWFB 4FMKA 3DX9A 4K94L 1X3DA 4KHXH 4HH8A 3CUPB 3RWIA 1CI5A 4YBLC 4FQCL 5I75B 4WI2A 2CO7B 1KPVB 1J8HB 4ZODA 3VXOB 2CRMA 1HINH 5J13C 5INCA 5K9OA 3G5ZB 1DL7H 2V2XB 3BGMB 1ZA3B 4QOKD 1C12B 1JF1A 4IJ3B 4P2RE 1T66D 4M48H 2CJUH 2CR3A 2MKWA 3UYRH 2OS7A 1X6LA 4NM8H 3N9GL 4G6AC 2FB4H 3CSBA 1T6VN 4FP8H 2V2WA 1U8QB 4JFOB 4DEPC 1OY3B 2I9LA 1H3PH 4JR9L 1MHCB 4TUOB 2YRPA 4XNQB 3BIBX 5DD6A 3UC0L 2X4UA 1MJJA 3NFNA 2FX8L 2ORBH 3NBNA 2YPLD 3RNQA 3VRIA 3PQYA 3K8LA 3QA3A 2EE3A 3ARVA 2OTPA 4HUWB 4PJEB 5ISZB 3ES6A 5B38A 3DETC 3QFDB 3O6FC 4KTEL 5B3JE 4OFPA 1UH4A 3TBVA 1EAPB 1G9MH 4LSSH 1IGTA 3ORJA 3W39B 2RBLA 4U1HA 2B0SL 3C8HA 1DBBH 2H41A 3U30B 3EO1A 2P7TB 4P49A 2IMNA 2DQDH 3QXDA 4F7PB 5IK3A 1E4JA 5FK9A 4OCSH 4QNPE 4NQXB 5E2UL 4KY1H 3MA7B 4JFFD 3LVEA 2AVGA 4O2CA 4HIEB 4XP4L 2CRZA 5I8CB 3S98A 3EO9H 4RIRB 4PLOB 1P1ZB 1VEMA 4HWBH 1I8LA 4IRSC 1A7QH 4K7PH 5D6CB 3TNMA 4WTWA 4PJHA 4LGSB 1YNLH 1VERA 3O6LL 4M1GH 4CVZB 1S7RA 3T4YB 4O9HH 1FZKB 3K80A 5AG9A 5JOFA 2D7PA 2CDEB 1JF6A 1DANU 3ZT6A 43CAA 1PYWA 3EFDH 3FOMB 1VHPA 2EKSB 1S7TB 3MRMB 5LCVH 1FNEB 5K59F 4UQ2B 5JOPE 4Y4FB 1IMHC 3QQNA 3X3FL 1D5IL 4PR5B 1RZIB 4OCRL 1IAIM 3PWVA 1D5ZA 1QLEL 4AH2B 3L3GA 4FQ1L 3MYJA 4MS8C 3QEQE 3RWFB 5GZND 1IEBB 5DJCA 3RTQA 5T1LB 3KLHD 5LWYL 1LDSA 1FFPA 3SDYH 1FNSL 5JOEA 5ANME 3RVTC 4C56B 1CTOA 3WN5C 2E7MA 3O45B 1EGJA 4S11A 1V8HA 5BS0B 1RK0A 5ITBL 4M3KB 4M62H 2PO6D 3GMNB 3UBXI 4ZUVB 4TUJB 2EDFA 4M02A 4HMEA 4NHUA 1MEXL 4NUGH 5JDSB 3FB5A 5TE6L 4KI1A 5FYLE 1M6OB 4P2OD 4XXDA 1EFQA 1CL7I 1NDGB 3P73B 3CVHH 5AEAA 2HKHL 4JHZA 3S3SA 2EXWD 2GTZA 5I1HL 1OAYL 4U1LB 2NTSP 2XKSA 1P7QD 4TVPE 2H9GA 2Q7YA 3RJQB 5IFJB 2LE9A 2ZOKB 4RGMC 4GKSB 5DFWH 4PYHA 4MNQA 1ZWIB 4X5XB 5B21A 3F8UB 3PGFH 2W60B 4F15B 1A7OH 1U58B 3G6DH 2PYED 3B83A 4JRYD 4F33A 2PW1A 5JW3L 3GJFK 5CJ5A 2FNBA 3BVNA 3ZKQD 1I1CA 3DYOA 1BQUA 1CBVH 3HZYB 3QIUA 1VPOH 3KXFE 3A67L 1I7RA 4LEXH 3HRPA 5C8JA 4GAGH 3CLFL 4UILH 4ETQB 4QOKE 2KBGA 1A7PL 3BKML 4QXTA 4Z7UF 2VDQH 1H3UA 3C08H 3IDNB 3AROA 3ULUC 3M8OL 5E9DD 1ZA6B 1EIBA 1W8NA 3VXSD 1X5FA 2E9JA 2QADC 4G8GB 4ERSL 1L0QA 3FQTA 1X5JA 3CH1B 4R2GC 4GRLA 5SWZB 4X6DE 1UVQA 1KPUB 1AQDB 2P48B 1KJVB 2YPLE 3EO0B 1F4WL 4X7EC 4LVEA 2NLJA 3WFHA 4OGXH 1RV6X 4LHUD 5DSCA 2VSCA 5MHSD 1YMMA 4W81A 4P57A 3LPGA 1WZMA 4PGBA 4I3GA 3MLYH 4Q0XL 3IFLH 2EICA 5D1XA 4ZNEE 3QUMA 4ZXBC 1GZPA 2R69H 3O81A 4G9FD 5TFSH 3T2OA 4P48A 4Q9RL 1GCFA 3ECBB 1S9XB 1T1WA 3BW9B 5GRUL 1P53A 4JFFE 4Y1AD 5DUPH 1E28A 5TH2B 1UA6L 3B8YA 1H0DA 3RWHB 2J8UF 3VFWA 2AKRB 2AK4D 2J88H 2ATKB 2BSRA 3ZMRA 2FO1A 3MV8A 4PRIB 1HHJB 1MFAH 3UTTE 1RULH 5DD0H 4M61B 2RJMA 3SOBH 2C4FT 3C6LA 2R0LL 4ORZC 1YNTB 5ADOH 5ICYA 4YHZL 1A3LH 3FFDB 5TQ0L 5MP6H 4Y16C 3RNKB 4WEBL 5ICZB 3BISA 1Z9OA 1G0DA 3QJHB 3MRKB 1A1NA 2X4PB 3R1GL 5A2IH 4G43B 1RUQL 4LKXA 4QEGA 5KS9A 2H1PH 2H3NB 2H8PB 4YHLL 1J05B 4MJ6A 1H5BB 2VLLA 1J5OL 2MQ0A 4IMLB 1R3HB 2X4OB 1KJ2B 3BKCH 4JDZB 2IPKB 4DUVA 2YXFA 1AGCB 2DWDA 3VFGH 1RURL 2VB5A 4JPWH 4KI5F 4TSAL 5HSFA 4LCWD 1ED3B 1KT2A 4AEHL 2W92A 1QBBA 3DWTA 3QEGL 2Y1VA 5ESQA 1NC2B 3MXWH 5BO1L 3D85B 2AS5M 2CRYA 5F7NC 3L1OH 3REWA 1DBMH 4WU5B 3BRGC 1G6RB 4LLQB 2Z8VC 5CD5C 1SYVB 3MUGA 3IKCB 4AIZA 2X2YA 4E41B 4HFUH 3PWUB 4J1UA 2P8MB 3RL2A 4PG9B 5EN2B 4NQEA 2Q86A 2B1HH 3U9UB 5EZJB 1P9MA 5E6IC 1KNOA 3MREA 4ZD3L 3WS3B 2EYTA 2C4XA 4KROC 4ZAKD 2FGWH 4AENB 4UTAL 2F15A 3RPIB 2PYEE 4JRYE 5JW5A 3O3BB 5D5ME 1I7TB 1FFNB 4CL7A 2VLRD 3OR7B 4G7VL 1H3WM 2X05A 4KTDL 1YEEH 4EN3C 4ZG1A 3DHMA 4K8RC 3VDBA 3SCMC 3MLVL 4JPKH 1IM9B 1MFCH 3ARRA 4OZHA 4RISH 5DVKA 2OCFD 1NMCB 1A14L 3KHOA 4FFYH 2FYYA 1SJHB 2CIKA 4ELMA 2XACC 5CIPA 3TZVB 4Y4FC 4H88H 4LSVH 3BQUC 2FZ3B 3O11A 5HI3C 1NMBH 2VXSL 4L29A 1OPGH 1AKJD 3LKRA 3HZMA 3OKKA 5CZXD 2PYFA 4M5ZH 1U8IB 1XGRB 1M1SA 3EZJB 1L9NA 2V7HA 4U1MB 2J3SA 1BBDH 4CJ1A 1QFHA 4NWUH 4YE4L 4F3FB 2IFFL 4EDXA 3WFDH 3PDDA 5FYJL 4LRIA 4N9GA 3RQ3A 3VGAC 3WSQH 1MOEA 5F9WB 3HI6L 4PRDA 3G6JB 5MHSE 3GMLB 2F5AH 4XAWL 3ARDD 5JLZA 3GSOA 3PDOB 1BQHG 5B3JF 2XZQL 1F13A 4EBQL 1TJGH 2HN7B 3B9DA 4RFNB 1A6WH 4P2QD 2RFXA 4ISVB 4Z0BH 1IVLA 1OGAB 4LCIL 4G9FE 1B88A 2C1OA 4XGZA 4LL9A 1MNUL 2PXYC 5FYLH 1RJYA 4Y1AE 2VL5B 1GGBH 4QNPF 4WI4A 3BZEA 5F88B 5GS2H 1J0YA 2YOCA 4F9LC 5ID1A 1MHEA 1A9BA 1MH5B 5IHZB 2AK4E 5IBTL 1EMTL 4KH2A 3S37L 1HXMA 3FQNB 1LE9A 4TVPH 1QNZH 1AHWB 2RGSA 4KRLB 4CW1B 3TF7C 4KAQH 3FFCD 4QT5A 1U3HC 2PW2B 5FHAL 2XY2A 1BX2B 1PX4A 5C0FA 3UBXA 2DLHA 3FQXB 1ZT7A 3AXLA 1FO0B 3UXFA 3UZVB 5F6IB 5B8CB 1T89C 3ARFC 4L8DB 3WXVH 5JQ6L 3D5OF 3GJEA 2YA2A 1BGXH 4JANB 4Y2OA 1R3IH 3T2PA 4P2RB 5IVXB 4F9PC 4S0SD 3WLWD 2WBJC 1VB9A 4DK3A 2GFBB 4KUZL 3H7BA 4HW6A 4QRPA 1XF2A 2BC4A 1NUFA 2NY1B 3RWJA 2O93L 5GGTA 5K9KA 3P11H 4V2BA 5AD0B 1ZLSH 3H9HB 2LQRA 4LCWE 5IB2B 3LHPH 2DTMH 3VGGA 5C0JB 3ZSTA 5J57B 1K4CB 1U8MB 2DQGH 3FHQA 5I76A 4JZNA 1VSCA 5B4MD 3X3GL 3LN4B 4FZ8L 4Y5VA 4YHKL 3PL6C 4XP6L 1L4IA 3G9AB 4NCC2 4FQJL 4ZQKB 1WCBA 2P24B 5BQ7A 2VYRE 1LO3L 4LSDA 3GHEL 3GUTA 1F42A 4QGTA 1QBML 1I8KA 1J8KA 4JDVB 2CKNA 1ZLVH 4LP4A 4PTUA 3QHTC 3BP4A 1IAIL 1XGQA 1L0YA 3NH7L 1BAFL 1J1XH 5E8EA 4WWKA 3WUWB 1AY1H 2VN7A 3S8WA 4B50A 3OKLA 3SE8H 3DO7B 2A9ML 4L3ED 3DX6B 5JHLL 3MYZA 3QP3A 4HJJL 1G1CA 4JPVH 3HE7D 1S3KH 1CT8A 4I5BA 1ETZA 4UTBL 4MLIA 4GO6B 1UWEL 4WDIB 1CS6A 1PW3A 1U3JA 3GSVA 3SJVA 4XP1L 4JO3H 4PJXA 3S97C 1TITA 1H5BC 1V7NH 3UPRA 2BRRL 5F7WC 3WNPA 3S4SB 2FR4A 1NGWB 1JPSH 2IFGA 4QYOB 3QHZH 2A6KB 5GGRB 3QEQB 3BSZH 3IETA 4KKCC 4CMMB 4X6DF 3BD4A 3ARXA 5D7SH 5DS8A 3RX7A 1KTKE 4I18B 2Z0BA 2ITDB 4LLUA 5KSAB 5T3XH 5MEOB 3U6RA 3V6FB 4OLYH 1VCAA 1DUZA 2W0LA 2X1QA 3B5TA 5DEZA 2R8SH 2BJML 5C0RL 1XEDA 4H26B 4M8QB 4P2QE 5EU4B 1WC7A 4R3SB 1S5HA 1JZ8A 2P45B 2OZ4H 1NGXB 4U2ZA 3QO1A 4MNHA 2X70B 5INDA 4LIQH 1ONQA 2D03L 4WO4B 3C60B 4WCYH 4YWGH 1RK1B 1D9KC 2WUBH 3QNXA 1DSFH 1NCNA 5HVHB 5HYJA 3LEVL 2FH8A 4XAKD 4FQXC 1Q9WA 3V6ZA 4ODWB 5DHYA 3VXMA 1I3GL 3FFCE 1DN0A 5BVPL 3INUL 3O8XC 4Z7VA 1IZJA 4OZIB 4PJ8B 2B39A 1Q94B 1Z3GH 1CG9A 3LPFA 4R4BA 4JFXA 4NKMB 5JR1H 1X5AA 4R4ND 3DUSB 3QAZC 1JGUL 4ZPTB 1RU9H 2DYPA 4KKLC 3KXFB 1HKFA 5I30L 4ZTOL 5IM7B 2W9DL 1Q9OB 1CN4A 3CPLB 5FO7A 3MBEB 3MLWH 4Z5RB 4PREB 4ZUSB 4XVTH 4APQC 5E2VH 4W4OC 4YBQD 2GJ6D 5DK0B 3DRTB 5JXEC 1GGIH 1GH7A 2D7TH 4P59H 1T4KA 4LVHC 1F5WA 4GQ9H 3W11C 4MB4A 4AL8H 2B2XH 2VZUA 1JGLH 3PNWB 5DJ6B 1J1OH 1MJ7L 3U0TB 1YA5A 2PCPA 1YEHL 3ULVL 5D1QA 3TYGH 3GK8H 5IV2B 5HHMB 3VGDA 3MGOB 2IBBA 3BE1L 5D96C 4L4TA 4G8IA 1OAZH 2A9NH 3TM6A 3W0WD 4LHJB 4QLRA 2IF7A 3JTTA 3JWOL 4ZYKB 4HH9B 1MUJB 1YY9C 3D18A 4YX2L 3QUXB 4XPTL 2LTQB 4ZOAA 5J3HC 3GSRA 2C3XA 4KZDL 1KIQB 4KMTL 5E7BA 2CK0L 1XGPA 3MTRA 3MJ7B 3FKUS 5I0ZA 3QH3B 4RX4A 2MJWA 3QPXL 5FGBA 1YEKL 3VXPA 4OLVL 5DURB 4I0CC 4PPTA 1GIGH 5IESL 1MVUB 4JE4B 1DQDH 2WV3A 5DJYB 3UTTB 5DRXA 3T08A 1LP9A 5D5MF 1OF2A 1PKQB 4L3EE 5H94B 3M07A 4IDJH 4XCEA 2YD3A 4R9HA 4TQEL 4Y7MA 2JJUA 4WWID 5FUCC 1ZGLB 3QWQB 4HPYH 5GSVA 4P0DA 1OM3L 3V8CA 5C2UB 4Q2ZA 4LBEB 5IWLC 1N59A 4PJAA 1EHAA 2HT2D 4WVRA 2HFFB 4M4RA 1LK2B 1XIWB 5E99L 5DMKB 3KPNB 2NY7L 1ZTXH 3U4EB 2LU4A 4AMKL 3T04D 1IC4L 2BOCA 4G8EB 2AJZB 3KYKH 3I6GA 1QPXA 1IAII 1KLGA 2FBOJ 5F1NA 4ACPA 1LO5A 5CJQL 3MLXH 5CP7B 4AYFA 1N0LA 2UV3A 5D7JC 1MCQA 4Q6IB 4DZ8B 3MLUL 3IDMA 2QQLL 5KW9H 4F7TB 3KYOB 3EHBC 3ZDZE 1JNHB 4HIXH 2HYMA 2Y07H 3B9KC 3BIKA 5ETUB 3CXHJ 4DQOH 2BVTA 4Y4HB 1CU4L 1AR1C 4NZDA 2KPNA 4HT1H 1PFCA 2BP3A 2NXYD 1AIFB 4LVNC 1GOGA 3P4NA 4P3DA 4MGXA 4AG4L 1KFAL 3P0YH 2XI9A 3TIDB 1P7QB 4R0LA 1NBYA 3THML 4XAKE 4GW1A 4LVOC 2YUZA 1FZJA 3D39D 5DA4A 4C57C 5DJ2A 3TA3B 2ZNXA 3MCLL 5HHOB 1A4JB 5ERWB 1QSEB 2BSED 3C5SB 4X7TA 1YN7B 3QULB 4GMTL 2WWKO 2VXVH 3TT1L 3V6OA 2Q76B 2NY5C 3G6AA 3S35X 1TPXB 1IGMH 3BH9A 4TYUA 3TO4B 4JAMA 5CD3B 4RAUB 3FN3A 1U0QA 1DLHA 3MV11 1NMAL 1HI6A 2V9QA 5HVGB 4WHDA 3TYFB 3A6BH 2EC9U 3L7EA 2GJ6E 5DRWA 4GRWB 3OJ2C 2RHEA 4PY7B 2E7LA 1A0QL 3RHWF 4DN3L 1Q38A 1W72B 3PQYD 2DI8A 4UU9B 2XOTA 2NXZB 1V7MH 1OLLA 1OTUC 2H32A 4OTXH 4U1JA 4X6FA 3SE3A 1T22A 1X5XA 3QZWB 1DE4B 2ZUSA 3IFPB 5DC0A 3ROOB 2VNCA 2KUTA 5A16A 1WBZB 2IAMB 1I4FA 2EH8L 2CXKA 3Q48A 3EOTL 2FX9H 4X7CC 5E95B 4MXQC 4XTRD 3JSSA 3W0WE 5FUOH 1RIVL 4MXWH 2D4DA 3IF1B 3BD3A 4WHCA 2QQKH 4X98A 3AREA 1H15B 1J7VR 4OD3L 3OXSB 3QDMB 4P4KC 1I8MA 4WO4C 2IPUG 3C60C 3M1BB 5GQBA 5IW1B 5LGHH 3V52L 2GY7B 3MRBB 4XC1L 5EZOH 3S96A 5HVHC 3IU3B 4NZUH 3BJ91 3R0NA 3UO1H 2YPKB 3HNTL 3NFSH 2FATH 4QHUB 3EW3B 1HIML 1PJ9A 3W2DH 3MA9L 3SDDC 4LRNL 4MLSA 2KQNA 5DZNA 3G5YB 1P4LA 4XBGA 4PJ8C 4CNIA 1JGDB 3RGVA 2B4CL 2ADIB 3PABA 3AMLA 1S5IH 4MAYC 1FV1A 2DQJL 3DBXB 1HQ4B 3JV4A 3MLZH 2HJLB 2P5WA 5T33H 3HUJB 1DQMH 1A9EA 3BFOA 5E8PA 4WV1C 2VZVA 4OF6A 3QWRA 4XI5D 3B9EA 2BVQB 4K23L 5IB4B 1PG7X 3QUZC 4G9DA 1G0YR 3M17A 3MJGX 3OG4B 3MBEC 5KVGH 1ZLUH 1OP9A 4KVNL 3RTQD 1HNFA 4BZ2H 5DHXB 3KPQA 1FC2D 4NN5B 3QEUA 1E6OL 4XBPB 1TTGA 2ED9A 3X11A 3FOLA 4GW4B 1IGJB 1EHNA 3FZUD 4EUPB 1SVZA 4LQFH 1JN6B 4HF5H 1NLDH 4Z8FL 4NN7B 4LGPB 5DJAA 4NKIL 3SQBA 1JHLL 4N0FB 3MRGA 4LNRB 3JUZA 3WMSA 4OIIL 1EZVY 1KCUL 1UJ3A 2HT4D 2J8HA 3VFMB 3B6SB 1TCRB 1KUMA 4K71C 3OHXB 5AAMA 1NLBL 4HD9A 4IOIA 2ADFH 2VKWA 1RUPH 5CGTA 1LEKA 3SY0B 1S7VA 4E42B 4HKBA 1HN1A 1I9JL 5C86A 4BUHA 3D25A 1AXSB 4POZC 3TO2A 4MNQD 2XWTA 5IFHH 4YDKH 3IXTA 2QLVB 4M9PA 5L9DL 2CJUL 4U6TA 1F90H 2R0KL 2CMRL 1OSZA 5GSRB 2XWBA 3C9NB 1HH9A 4YFLI 2AJSH 2XWJA 5AG8A 1I9RL 3QIUD 4P23A 1U8OA 5IUSA 3PP3K 5I9QB 3MCKA 1W0WB 4OJFH 4HWZB 2IEPA 1T2XA 4DVRL 3KPSB 1FVCB 5D7IB 3T2QA 3CX2A 5E24E 3BP6B 5BOZG 4OQ1A 3T8XB 5I17B 6CGTA 1N0XH 3E2HC 5GXBB 5FGSA 4LF3A 4BH7A 4GRLD 1TQCC 4OF8A 2LFGA 2VIRB 4NC1C 3K2MC 5F3HA 5HJ3A 2PTVA 5SWSE 3OR6A 3K81A 3PQYE 3AB0B 1E4XL 2AV1A 3DMMA 5DJ0A 1CCZA 3RZCC 3WO4B 4RBPK 4B0MM 4JFDB 1R3KA 5DJXA 1MPAH 1I9IH 1YMMD 3DSNA 1IE5A 3GBMH 2VAAA 3LH2H 4U1GB 5D1XD 1E4KC 1IRAY 4PJFB 4Y5XC 2VXQH 3ZSSA 2R2HA 5K9JH 4QTHB 3V5HA 5LGJA 3O3EB 5JZ7C 5KVFH 3TBWB 4UB0H 2FRGP 1TZGH 4PGDB 2JIXB 3FB8B 3GJFA 1MCFA 2AJXL 5L8JB 2Y06L 1M71A 3IDYC 3PWNA 5C7XL 4S2SB 2AI0L 1RY7B 3VMNA 1QFWH 3QXWA 2CUHA 5SX4I 3MV8D 4PJHE 2AXHA 4JZJB 4ONOA 3BDXA 5TE7H 2UUDK 3HZVB 2MKLC 1LO2L 5EO1B 1KPRB 3HC0B 3TWCL 3C6LD 3TA3C 4K3DL 4YNYB 2OLDA 1M7DB 2W9LA 3VWJB 4K7FA 4F58L 4R96B 3WYRA 1KJ2L 1YEFH 3LQAL 4HS8L 1KCSH 1RZ8A 5EWIH 1BQHA 3CK0H 3F12A 5HPMB 3WBDA 3U0WH 1TPXC 3CFKB 4IIQC 4YXLH 3TO4C 1VKXA 2ZZUT 4IOFC 4XHJC 2VDRH 4D0DB 1ZGLM 4KHTL 5DK2A 2I24N 3OX8A 2P4AB 3TPUB 3MJ8B 1B0GB 2QBWA 5SV3A 3PHQA 3HLAB 4FOMA 5HDQH 2C1PB 3GMMA 1Q9LB 4N8CL 5EIIB 4IHOB 1G6RL 4EDWH 1JRHI 1G7QB 3OB0H 4OGYL 4HXBL 4XVUC 3WIHH 1BVKA 4X99B 4FXGA 3F6IA 4NCC1 3RVVD 1WBYA 4M9OA 5F8RC 2QQNH 1KYOJ 1GZQB 3GSXA 1CVRA 1EERB 1PAMA 4OLZH 5EBLB 4YHNB 1X4YA 1I1AB 5CSZB 2UWEB 4P5TA 1FL3A 4JQIL 3O4OB 4TPRL 2I25N 3HC4H 3ZDZF 2F58H 1QZ1A 4LSUH 4Z76B 2R56L 12E8H 5DTFA 5AWNH 4QRUA 4NQED 4N5UA 5HHVH 4G5ZH 5IGXH 4MNQE 2A0LD 3OAZH 5L2JB 3FB7A 4G6ML 3VH8G 4YHMH 3OQ3B 3IDXL 3I9GL 4X80L 1OW0C 1BJ1J 5CEYA 2GK0A 3HCVA 1LHZA 4UNUA 4MAUL 2AABL 3BHBB 2R0ZH 3HE6B 1Y0LA 4BSWA 1MQKH 5J6GA 2J5LB 4WUUB 1MAML 2Z31A 2XZZA 4QHMA 1KG0B 1RD6A 2OTWB 3LB6C 1QRNA 1VGEH 2OXGA 2YUXA 3QQ9C 4GKZB 1HYSC 5EO9A 4FQPA 5KVEH 3VG9B 5DRNA 4J4PC 4QCIB 2AEWA 2A6DA 4OD2B 2QJDA 2UY6A 1U93A 4U1KB 1AP2A 4XMLH 3S36X 3WUWG 4X6CA 4H5SA 5ITFA 4PJCA 4K55A 2VZ3A 2WQRA 1FCCA 2HFGL 1A21A 1U91B 5F44A 2EEBA 4X8JB 1FG9C 3JTSA 3R06A 4U6VL 5ACZB 1YMME 1NANH 4HS6B 4O2FA 4LAJH 3CC5B 5EBWB 1LEGB 4F2MB 5JNYB 1J11A 4FFWD 5KG9B 3WFCL 5DDHB 3ZE1F 1AD0A 1YYMH 3EYSL 5IHBA 2VJXA 1FORH 4TOYL 4M1DL 4ZSOA 1GGUA 1CZ8L 3TH2T 4JG0L 3ISWA 1XR9B 3I50H 2EXYD 3QIWC 1U92A 1WQVT 2DQCL 4LKCB 1FYHB 4BSVA 1RZ7L 1OP5K 5IR1A 3K4DA 3DX8A 4PJ5E 5IQ7H 5EIQA 1IT9L 4DGVL 3O2VL 4P3CL 2DQIL 3FO1B 2EDKA 2V2TB 2AEQL 4H8WC 3MO1A 3ILQD 3SE9L 4NUJB 5DHVA 1IILE 1KN2H 3LN5B 1T5WA 1KEGH 5JPNB 1NCBL 5F89A 2ICEA 3N1GC 3KJ6L 4JY4B 2X4TA 3I84A 1MCRA 3W9DA 1SJEA 3WHXB 4LFHD 4WGWB 2DBLH 3EGSA 1QKZL 5KS9E 5TPWL 1HK6A 1TVDA 4N0RA 4NRYA 2YWYA 1S78D 4NQCB 2CDFB 3H9SB 1EX0A 5DYOB 1MIMH 4QRPD 2VR9A 5ILTL 2W9EL 1A6AA 1NGPH 3V7AE 3ZKMC 1KN4L 4LLYB 1S9WA 4P9ML 5GGVL 2MCPL 2ZSWB 1BM3L 4YBHA 2NY2C 5A2KH 4M7LL 1AO7B 4PJBB 5GJSL 4JO4H 5MENA 4YFEA 4J6RL 2I26N 1UCBH 3K2UH 1NGZB 5IB1A 2XA8H 5D2NB 1IL1B 5DFTA 5MEQB 4HUKB 4OUUB 4WEUD 3HRZB 3V79C 1OCWH 1EXUB 3WV0A 2VDNH 2NY5L 5GHWL 3VWKA 5KAQG 3CX5K 3AAZB 4FG6C 4MWFA 1F58H 3CUPA 3JVGC 1U8LB 4L8SB 3BGAA 4YDLC 4WWKD 4YIQB 2YR3A 1KPVA 1J8HA 3VXOA 4M43H 1RHHB 2F74B 2YK1H 3DVNB 1C7SA 3G5ZA 5TE4H 2Q8AL 2V2XA 3BGMA 1RUAL 1ZA3A 3BPOC 4U7SA 5I73C 3IVKB 1C12A 2IADB 5IG7B 5GRYA 5CZVL 2OQJB 2AV7B 3TT3L 4OZHE 4YXHH 2VDKL 4K3EH 3ROLB 4ELME 5ALBH 3SJVD 1U8QA 4JFOA 1MI5B 2DDQH 5EFIB 1EHLH 4NKQB 3VD9A 4TUOA 4XNQA 1MHCA 2CR6A 4OF0A 5BMFH 4W6XB 1X5ZA 1X6NA 3VFVB 5DGQA 4HUWA 4PJEA 3DXAB 4NM4L 5ISZA 4WUKH 3AM8A 4POUB 3QFDA 2VQ1B 3M45A 1EAPA 2G60L 3RPKA 3W39A 3NA9L 4LCCC 3MRRB 1QBLH 2P7TA 3IU4L 3JWDL 2VOTA 1EGJH 4F7PA 4O58H 5IW3A 4NQXA 3OGCB 3MA7A 3V0AC 4PLKC 3ZKXB 2Z4QB 2R9HD 4L3AA 4HXAL 2FHCA 4HIEA 4KK9D 1BQLL 3H0TB 2ERJC 1N5YH 5I8CA 4O4YL 1R3JB 4RIRA 1P1ZA 4ORGB 5LQBH 1XGTB 4PP2B 3EYUL 5D6CA 4DW2H 4U1NB 2ARJQ 3MPCA 1BFSA 4U7KA 2Z92B 4CVZA 3ARBB 3T4YA 5HYJD 1FZKA 3RVXC 2F9BT 3UJTH 2CDEA 2XNAB 1A64A 3PP4L 5KN5B 3T0BA 3VXMD 1V5JA 3FOMA 1JUFB 4PJHF 2EKSA 1AD9B 4PGZA 4DUXA 1S7TA 3MRMA 4X7DC 5I1KL 4XBEH 1FNEA 3VXTB 1OVZA 5FOJA 1ZT1B 4UQ2A 5HYIA 1QRKA 4X0KB 4Y4FA 1XZ0B 4HKXB 1A1OB 4YJZL 4PR5A 1RZIA 4XMKH 2DYPD 3NIGE 3WEXB 1AI1H 4AH2A 3V4PL 4HKZB 4DKDC 3G5VB 5CHNB 3RWFA 1IEBA 3NAAL 5T1LA 3UJJH 2XY1A 3SGEH 4C56A 3E3QC 3GI9H 1IKFL 2HFEB 2JLLA 3O45A 3TIEB 4QRPE 4PUBH 3DROB 5BS0A 4HBQA 8FABB 3GMNA 1M4KA 4PYGA 2HMIC 4ZUVA 4UV7L 4TUJA 2E8ZA 4XNZB 4I0PB 4RWYH 4XVSL 5JDSA 2XN9B 3ALPA 5DWUH 5SWSB 1KCRH 1M6OA 4YO0B 5A40E 3CDFA 3HAEH 3D2UB 1DVFB 1NDGA 4OM0L 3P73A 5D1QD 4Z18A 1NH6A 4JGMA 3GM0A 4HKJB 1P4BH 1OARL 3VA6A 3LSOB 2ESVB 4L4TD 4XMPH 4JG1L 4U1LA 4NNXB 1NPUA 1AY1L 1R5VB 5IFJA 1K3ZA 3DGCR 2ZOKA 4GKSA 1ZWIA 4X5XA 4P46C 1NCDH 3N50A 4L5FH 2W60A 1U58A 3TVMB 1W0VB 5KOVC 3NCYS 1TNMA 3VJ6B 5HI5C 1RZJH 3QZWG 5ACMA 4QXGL 1AXTH 2CGRH 4RX4D 3OJDB 4G8FB 4U2YA 3SGKA 4AQOA 1NFDB 4LHUG 5CCKL 5DMGC 2JELL 2ICWI 1G1YA 3T3ME 3O6ML 3X14B 1KB9K 1KXQE 2HLFD 4ETQA 1EO7A 3L5WB 3OKNB 5MI0B 1T5XA 3IDNA 1ZA6A 2Q6WB 4CADB 3LKOB 1IGIH 3QQ4B 1D6EB 4UBDD 5CJ8A 5I1IH 1UM4L 3SJVE 5F96H 3CH1A 3UJIL 5SWZA 1UZ8B 4N0CD 4W68A 4KDWA 2KL6A 1KPUA 4PJXE 1AQDA 1KJVA 3EO0A 3RP1A 3ZL4L 2HA1A 3CFCH 3PDGA 1N6QH 3H9ZA 3QI9B 4MMXC 5HYQB 1I9EA 4OZFB 2WANA 3MCG1 4QRSB 2Q8BL 4NQDB 3BJLA 2K7PA 3A6CL 1TNNA 4S1QH 1TIUA 3WFEH 3F7VB 2GSIB 1MCJA 1WVZA 5C0AE 3S88L 3ECBA 1S9XA 3MLSH 1D5BB 3BW9A 4X6BB 3QISA 4ZS7L 2OJEB 2IQ9L 5TH2A 2E27H 3RWHA 1T0NB 4F7MB 2AKRA 2EDQA 5ECJE 4KGJA 4DKFL 2OP4L 2ATKA 1G9MC 4ZDHB 3IRZA 3JV6B 2ZPKH 4PRIA 1HHJA 1RUKH 1NFIB 2Y25A 4CRPA 5JIKA 4M61A 1QR1B 5HYJE 3O3AB 2P47B 1YNTA 1KELH 3FFDA 1C5DB 1CFSB 4UDUB 5M95B 3RNKA 3VXME 5ICZA 4RGNC 3WIIL 5HYSB 3QJHA 1G84A 3H8NA 3TH3T 5J0BA 3MRKA 4MXVE 3EJYD 5KANG 5IBLD 3BZ4B 2X4PA 1ACZA 5KZCB 4XP5H 5CAYB 4G43A 1E6JL 3MZTA 4KQ4L 2H3NA 3GSWB 2H8PA 1J05A 1W72L 4QTIL 4XPAL 4XPBH 4AEIL 1H5BA 3BRFA 1J1OL 5I66B 5IVZB 1R3HA 4EI5B 2X4OA 1GC1H 5KTEH 1KJ2A 4JDZA 1R3LB 2IPKA 5KS9F 1AGCA 5F7EL 3MBXL 4LQ1A 5CIPH 4XCFL 4KC3B 3WS6A 2Y9RT 1P69B 1ED3A 3GHBH 4YPGB 1IEAB 1PQZB 4TULH 1GOFA 3BDYL 5C3TA 4KZEL 1VENA 2NY3D 3BKYL 1NC2A 3D85A 1PSKL 1VADB 4ETYA 4NRXB 5IHLB 4PBVC 3BWUC 4WU5A 4O02H 1VFOA 3MMEB 1G6RA 4LLQA 2KZ1B 4LP5A 4XNYL 4RAHA 1SYVA 1A7RL 4R26L 4Y4KB 4L4TE 4DK6A 4ZTPH 3IKCA 4E41A 2E6JA 3PWUA 2P8MA 4PG9A 5EN2A 2MWCA 1P4IL 2JCCB 5DVLA 3UTPE 2OK0L 1SEQL 3U9UA 4GMSH 5EZJA 3ARED 5HI4C 3WS3A 4DWHA 4NGHH 4AENA 4R8WL 1Q72L 3NZ8B 3RPIA 1HOCB 4Y0GA 4G6JH 2X1OA 3O3BA 3QPQC 4FQIH 4WNQB 1I7TA 2NNAB 3IFOB 3LKSB 1FFNA 4MDJB 2XTJD 3OR7A 4PJ5B 4XX1E 3BESR 2X6MA 3TCXA 4OLWL 1IM9A 2AJ3B 2ZKHL 1LP9E 1G9NH 4K07A 3ALXA 3RGVD 1SJHA 3QSKB 3BAEH 1MF2H 4KVCL 5CUSH 3TZVA 3OAYH 2FZ3A 4MQXD 2P5WD 2DQEL 1YZZA 3U79A 4KK8D 3QWRD 4OZHF 2VLJB 1CDJA 1U8IA 2XQBL 1XGRA 4ELMF 4I2XB 4PJAE 4U1MA 1NEZB 2E8YA 4TTDC 1OP3H 5FAAA 1ACYH 1JMXA 4F3FA 2OI9C 5MEPB 1ZEAH 2PTTB 5C0CB 3G6JA 3GMLA 1CFNB 3OGOE 1WITA 1CICB 1FNGB 4UAOC 1BEYH 3PDOA 2DLFH 5GGTH 4I0PC 3ME0A 4QHKI 2HN7A 5GRZA 5MERB 4ZS6C 4ISVA 4YEFA 3UDWA 5TGBB 3ZTNH 1OGAA 3KJ4C 2MNUA 2VABB 4YGVB 4H8WL 5FYJD 4CAGA 4HS3B 1N4XL 3MC0A 1KTRL 4CVWA 1WT5C 2VL5A 1T0MB 5F88A 3Q5OA 5CFHA 4ZFZB 5D71L 1MH5A 3IFNL 1J9CT 2ED8A 5IHZA 2IPUK 3LIZL 3OAUL 1LO4L 2NYYD 3FQNA 3JWNC 3QG6B 1AHWA 2HRPL 4IMKC 4CW1A 3WL9B 2PW2A 4FABL 3I3EA 4DOHB 5IMOB 1NAMB 3QBTB 1BX2A 3MGTB 5DZOA 1F4YL 5KOMC 2VDPH 3FQXA 4M5YL 1FO0A 1UADC 4BFGA 2GQHA 4QRRB 4BQCA 2B20A 5B8CA 1F3DJ 2WWMC 7CGTA 1H3XA 4P23D 1HHGB 5EZIH 4L8DA 4WFED 4KJWD 1H8SA 1YYLL 5MI0C 3MLRL 4JANA 2I27N 4P2RA 3F7YB 5IVXA 1FH5H 2GFBA 1TCMA 1FVEB 1RSFA 3NIGF 3HMXL 1I1FB 4K94H 2VISB 4KGLA 5D70L 2OL3B 1FP5A 4FQCH 1IM3B 3H9HA 5FV2A 2HVKB 5FA3B 5IB2A 5C0JA 5IW6B 1K4CA 1U8MA 3IJHB 2EIBA 3ESUF 4U31A 2HH0L 1OAKL 1OD9A 3DMMD 2QQKL 1P5VA 1NCWL 3LN4A 2NR6C 2ICCA 4J8RB 1VACB 5C2BL 3N9GH 1IAKB 2LAGB 4FNLL 4MVBD 1ZS8B 1GSMA 1KTLB 3PF2A 4J3WA 4ZQKA 4JR9H 5TJWK 2P24A 5EUOB 1BPVA 3UC0H 2FX8H 3QUYB 4OD1L 2HRLA 1MFNA 1NUNB 4OCWL 4QWWC 3WHE1 4JDVA 3N06B 2A6JB 4KTEH 4F7EB 2I07B 3WUWA 1B3JA 3GSUB 3B2UC 2B0SH 2NY4C 3EYQC 2FGZA 2XTJE 1OOAA 3DO7A 3DX6A 1CFQB 4Q7DA 3B9VA 1A1MB 5E2UH 2A73B 3RDTB 3LRSB 3V5DB 3MNVB 3CZJA 3T3MF 4D9LL 3UYPA 1FJ1B 4WDIA 3BPNB 4G6AD 5C08B 1MVFA 4KRPD 1L7TL 1EEQA 3T2NL 2BNUB 3O6LH 3S4SA 2XTLA 1NGWA 4EI5C 5FDYA 5J1SC 5L7XL 4QYOA 2A6KA 5GGRA 3QEQA 4CMMA 1GGCL 1U8PB 3DETD 4PJXF 4I18A 2R4SL 3RY5A 2ITDA 5KSAA 2NY6D 5MEOA 5F1IA 5C0BB 4Y2DB 3RAJL 2B1AL 1MFDL 4UINL 5FM5O 2Y36L 5D4QA 3X3FH 1D5IH 4H26A 4WI9A 4LCUB 2EIDA 4M8QA 1OAUL 4OCRH 5EU4A 2DWEB 1QLEH 4R3SA 4JRXB 4LDLB 4FQ1H 4J3VA 1NGXA 2GSGB 1F00I 5DQJB 5LWYH 1SEBB 1FNSH 2X70A 3TBTB 4WO4A 3C60A 4P5TD 2R39A 3RWEB 3B5GA 3G08B 3K0WA 1RK1A 2R0WL 5ITBH 3L6FB 2N1KA 1ITCA 5I1AB 4YXKL 4S1SL 1AE6L 1GOHA 5HVFB 1MEXH 4ODWA 5GS1B 4PV9B 4U3HA 5TE6H 4JHBA 4NOFA 4OZIA 3EBAA 4S1DC 4PIRF 4PJ8A 4HUVB 2EE2A 2E6QA 1Q94A 2HKHH 1KEML 1N5AB 3QG7L 4NKMA 5C0IB 3MRIB 2N7BA 3T0WA 5KANI 3DUSA 5I1HH 1OAYH 4ZPTA 3U9PL 1D6VL 3H42L 2VL4A 4HGKC 3KXFA 1P6AB 1SVCP 4DKEL 4WFEE 5IM7A 4U7MA 1Q9OA 2Z31D 1SY6L 4MXVF 2YHGA 3CPLA 3MBEA 4Z5RA 4PREA 3U7YL 4ZUSA 1QRND 3CH8A 4JJHA 3FO9B 1IGYB 5DK0A 3DRTA 3ARGC 5JW3H 3TLRA 2FJHB 3NACL 4MDIB 1R6VA 1JTPA 3BX7C 3E6FB 4JVWA 4C54A 4ZO9A 4ODVL 1R0AL 3PNWA 5DJ6A 3I02B 3A67H 4TUKL 3U0TA 1S8DB 2MQ3A 5I6XC 3CLFH 1B4JL 4HUMB 2DBJA 4GBXB 1A7PH 1MWAB 3BKMH 3BZFB 3MGOA 5L0QB 4ODBD 2D9QB 4NRZB 3NZHL 2A1WL 3M8OH 1T66C 4CU7A 2FEDC 4Q9QL 4Y8AA 4ERSH 2DN7A 4ZYKA 4HH9A 1WAAE 1MUJA 4MMZC 1T83A 3SPVB 1IC5L 4OCYL 3ULVD 5C0AB 3QUXA 1F4WH 1UM5L 4X5WB 1GVIA 3NCYP 4J3TA 1KIQA 2O5YH 2Y6SD 4PJDB 3MJ9L 1PKOA 3MJ7A 3QH3A 4ALAL 3KPPB 3HI5L 4PY8J 2B5IB 4CDGC 1MVUA 1PDKA 3PGDB 4Q0XH 1RVFL 5DJYA 3UTTA 3GDBA 2IPTL 1PKQA 5CWSB 2HWZL 1JNLL 4Q9RH 5H94A 1FRGL 4OKVB 5CGYC 1ZGLA 2YPVL 4NT6A 5GRUH 2R15A 4HJ0D 1TJHL 1UA6H 5KSVB 1CXKA 5HD8C 2VQTA 1INDL 2D2OA 1LP9F 4LBEA 1T1YB 4R2GD 3BRDA 3UPAA 2HFFA 5HY9B 1TENA 1LK2A 1XIWA 5DMKA 3KPNA 1QSVA 3U4EA 3HS0B 2R0LH 1EA9C 3BWAB 4YHZH 5TQ0H 5JW4Q 4WEBH 3WNMA 4PJAF 3SDXB 1IBGL 4G8EA 2AJZA 1NGQL 3MOBL 3RUGB 4DKAA 5CP7A 5IEHB 3R1GH 4FTVB 1B2WL 2DTSA 3CNKA 4Q6IA 1RUQH 3MFGB 4DZ8A 3MFFB 4YHLH 3KYOA 4F7TA 2O26U 1FFOB 2UY7A 4G5ZL 4UT9L 4AEFA 2H32H 3T0AA 1JNHA 1J5OH 4BQ9A 5ETUA 4Y4HA 3TN0B 5MEND 4IEFB 1OB1B 4D3CL 3KLHC 1RURH 1AIFA 3QUYC 4TSAH 1C5CL 5DO2D 1A6VL 3TIDA 1P7QA 1FZOB 4AEHH 3F7PC 4HBCL 1PZ5B 4IRJB 4OGAD 4YR6B 2GITB 3QEGH 2MFNA 2PO6C 4WU7B 2JKXA 1IC7L 2AW2A 5HHOA 3TA3A 1B0RB 1A4JA 1F3JB 3BP7B 1QSEA 4R7DB 5ERWA 5BO1H 3C5SA 1YN7A 4PRBB 1NCAL 3QULA 5CSGA 3QCVL 5KVEL 3LDBB 5B38G 1J8HD 2YKLL 5JUEH 2Q76A 3OB8A 4HAGA 5T1DL 2EXWC 3LPWA 3RKDC 4HC1L 4Y19E 3TO4A 4OB5L 1AGDB 3RWCB 2DKSA 5CD3A 4RAUA 1OTSD 3BPNC 4HG4J 1V05A 4ZD3H 1EAJA 1QRNE 2A6IB 3TYFA 4UTAH 5EOQL 1JFQL 4PY7A 1W72A 2VH5L 3MRPB 4G7VH 4UU9A 4K3JL 1CGSL 4KTDH 4PGJA 1Q0XL 4X6CE 4FHBD 3QZWA 5ISZD 3V0VB 4PJCE 1DE4A 3MLVH 3IFPA 3ROOA 1WBZA 1A14H 2IAMA 1FSKB 3NCCB 1WLHA 3LMJL 3UTSB 4X4ZA 1T04B 4OQTL 5IQ7L 2VXSH 4N8PA 1DQLL 1PX3A 3AS1A 2YSSB 4GAFB 2XQYG 2W59A 1FG2B 3IF1A 4OFIA 2G5RA 4PB0L 1H15A 1QG3A 3ULVE 1QPPA 4ZSOE 3OXSA 3QDMA 3M1BA 1ZV5A 2IFFH 4YE4H 5FYJH 5IW1A 5F9AC 3DI2B 3MRBA 3IU3A 4XAWH 15C8L 4PS4L 5DA0B 1BJ8A 5GRJL 4U6YB 4N1EA 5E1AB 4F37K 2YPKA 2XZQH 3RY4A 4EBQH 4QHUA 4UI2A 4D0BB 4K8RD 1YQ2A 3G5YA 4LCIH 4M7LT 1K8IB 1JGDA 5FO9B 2ADIA 4AEEA 1NCCL 4JN2B 1MNUH 1UWXH 1P7KB 1F3DH 3NIFE 1DLFL 3DBXA 5C9KA 4ZFOB 1HQ4A 1F6AB 2HJLA 3HUJA 4Y4FD 1CLZL 3RI5F 4EKXA 5HI3D 2BVQA 5IB4A 5IBTH 1EMTH 3S37H 5I1CH 4CU8A 4HK3N 1XGYL 1NBQA 5A3ID 5I1EL 1WZLA 5J9PB 1OD7A 1QFWI 5BVJB 1P84K 2QL1A 2LVEA 3EJZC 5T1LD 5TQ2H 5FHAH 3QHFL 4P9HL 3EYFB 3TBYB 1F2QA 4C56D 4XBPA 4GW4A 5IMLB 1MCPH 1IGJA 1A7BA 3QDGB 4S10A 4PJ9B 4EUPA 5BS0D 3O41B 5JHDB 3P4LA 1JN6A 3SDAB 3EYOB 3P4OB 5F9JB 4EQ2A 4HUNB 4P5KB 2JJSA 5JQ6H 4Q9CA 4N0FA 4LNRA 2GUOB 1A6TB 5DLML 5E0QA 3VFMA 3B6SA 1TCRA 3T4AB 1KENL 4KUZH 3EAK