1KACB

Knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
124
structure length
124
Chain Sequence
GITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the mechanism of adenovirus binding to its human cellular receptor, CAR.
pubmed doi rcsb
source organism Human adenovirus 12
molecule tags Viral protein/receptor
molecule keywords PROTEIN (FIBER KNOB PROTEIN)
total genus 27
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1999-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kacB00
4U1KA 5GISH 3VWKD 3O11A 4PLNC 3NCJH 2JJWA 2P45B 3CVHA 2IAMA 5DJAA 2CIIA 3MROB 4FZEH 1JNNH 4JJ5A 2FIRT 1KIRA 5FHBH 3EFDL 4RMSA 3QI9D 5MEOA 4LU5L 3MRHA 1Q38A 2CKBA 4NUJA 2JJSA 4YPGB 2IADA 5DHVB 4U4BA 4XCFL 1OAKL 4JR9L 1D5ZA 3SDAC 1ULVA 4GG8B 2VDPL 1CGVA 4QRRD 4LGSB 1JZ6A 1NGZB 1X5GA 2J5LB 1QKZH 3FL7A 4NN6C 5AG9A 2P49B 1FZJB 4X8JB 3FN9A 2B1AH 3IXTB 5BXFB 5EA0L 4C59B 3EO1A 3W2DH 1ZHLB 5CGYC 4BZ1H 2AERT 3T08A 5C0FA 1JGUL 3GSNA 3PGDA 2HT4D 5GGTH 1U3HC 2WUBH 1QR1B 2K7QA 5CD5D 2V5YA 5C2BH 3LQAL 5GS0C 2FLRT 5IVXF 1EFXA 1RV6X 4LNVA 1OVZA 1EV2E 3GJFH 1B4RA 3KPMB 4X6CA 2P8PB 4QRSA 4H88L 2GITA 5F9JA 5T1LD 5IB1A 4G8EA 1UJ3B 4WO4A 5FYJE 4O5LL 4C56B 1F4AA 4PJBA 1Y6NR 2NQCA 4TVPD 1SEQH 4Z7UB 3TJEH 4HWNA 3RP1A 1OF2A 2HFEA 3EDKA 3T3ME 3P11H 4TTGA 3TPUA 1DVFB 1E4KA 3HG1D 4CL7A 4HGWA 4JFEA 3BEVA 4NKOA 1A6VL 4K3JL 2X4NA 3VW3H 3CSBA 1HQRB 2EZ0D 4KK6D 1YEGL 3WIFB 1XGYL 5GJTL 1J5OH 4EBQH 2CLVA 4ZYKB 2WV3A 4MJ6A 2X42A 5LAXB 1ZWIB 3NAAL 4KVCL 4PLJD 3TJEL 2YD4A 3D3VE 3O3AA 1NGWA 3CFKB 2R56H 3MRQA 1CF8H 1YEKH 2AEPH 5F93C 4JPWH 3WFDL 3P9LA 4O00A 4WDIA 5D7IF 2BJMH 2EDNA 1LE9A 1MNUL 3JV6B 2C3VB 3TVMB 4ZFOL 2R4SL 5JA9A 2JIXD 4JN2A 4O4YL 5I15L 5E94B 1ITCA 4HWEL 4FTVE 1A7PL 5GGRY 1RZIA 4FNLH 3LEYL 4YNYB 2R56L 1DFBL 1YMMA 4XHJD 2DQUL 5EBWB 5DZNA 2X2YA 4DFIA 4KUCD 3V5KA 4MA3A 1E28A 1HH9A 2EE3A 3HI6L 3KLAB 4NM8H 5E8OB 3VI4E 2NX5D 4TSCH 4OFYA 1FFNA 3GSOA 2W1NA 3SDCD 3QT2A 4R97B 1KTKE 4L3CB 4XNUL 4OJFL 5KS9E 5ISZA 4GRWE 3LQZB 4JPKH 3L3HA 4NZUH 5F9DC 3WIIH 2LV4A 3QHFL 4AG4L 5E6ZA 3U4EB 4UDUB 1UWEH 3U1SH 4OCMC 4MXWH 4BFIB 3S3SA 3LAFA 1B4JL 3HE6D 1TQCB 3FT4B 3RWDA 5IFHL 3KYNB 4P23B 4LLUB 3CFKA 3VFVB 2ITCB 4P46A 5ERWB 4ETQB 4KV5F 3QP3A 5EBLA 1U58B 2NY3C 4AEFA 2VXUH 1A3RL 5E00B 2HT4C 4YHMH 3JVGA 1MQ8A 3RWIB 2SEBA 4AIXA 1FYTB 4W4OA 1FGNH 5E99L 1GVIA 3SGKC 2DQDL 4QHUB 4NQTA 3W2DL 4WW2F 1YMMB 1FE8L 4LIQL 5EBWA 2R2EB 3L3DB 3QIWC 2P8PA 1N5YH 5HI4D 3OJMB 4O51A 4CW1A 3ZKMD 5SWZB 3QEGH 2EE6A 3ESVF 3QHZL 3CGTA 4L8SA 4YR6B 1XR9B 4GLRI 2P8LA 4PD4J 5TQ2L 5SWSA 3L6FB 4EQ2A 4KRLB 3QCUH 4KZDH 4M00A 4YBLC 3NFNA 2WUCH 1VCAA 4QCIB 5F88B 4Y8DC 2GUOA 4NKOB 1B90A 4G9FE 4XWOD 3PL6A 4ZTOH 4N90D 2D7QA 4G6KH 5EFIB 5LJYH 2BVOB 5CBAB 4H8WC 1JF5A 4HAGA 4OKVA 1I7UB 2ZCLL 2AQ2A 3Q5OA 3NPSB 5CGMA 4Q6IB 4ENEC 4AEHH 4N0CC 3AREA 1QFUL 3T3PF 2IPTH 5TPWH 2AXHA 1NGWB 4TUOB 1ZTXL 1HCVA 2R2BB 3TT3H 3LN4B 43CAB 5F7DB 4YHYC 4Y5VC 3T0BA 3MLPA 1D9KC 5T3ZD 3CLFL 5HVWA 4PGEB 5D7IB 2BVQB 1JRHL 4TTDD 4C55A 2BXYA 1OGAE 1T1YB 4UZGA 1AFVH 4OIIH 4L9LC 1S7TA 4G7VH 2VN7A 5J11B 3WUWB 4EN3C 5EOCH 4CVZA 1FH5L 5IW1A 4G6MH 3SKMB 4R4FH 3TN0D 5EBMA 2FEEL 3CZFA 1G9NC 1VGKB 4JFFA 3TYGH 1E6JH 4LAQH 4QY8B 1EAPA 1VA9A 2OR9L 1RPQA 1IGMH 1OAUL 3BJLA 4P23C 1UT9A 1D5BA 3VXMD 2V2TA 4AIZA 1EZVX 2BCKB 3QEGL 1TQBC 3L95A 2Q20A 3AUVA 4NNXA 4JM2A 4QXUL 2ZCHL 3QULB 4FA8A 3F5WA 4LLYB 5I19H 5ICXB 2ZSVA 2ZPKH 5EZLB 2R1YB 4X7DC 4YFLF 4JFXB 1LVEA 2VIRA 1JTOA 3D0LB 2Q8AH 5AZ2H 5MP6H 1U8QA 1BAFH 3OJ2C 5EO9B 2D0HA 2LU7A 2OS7A 4P3CH 5I1DA 1J10A 3BVNA 5AYUH 1RZ7H 4IS6B 1BBDH 1DN2A 1QSEA 3VXQA 4X9GA 4ZDHA 2DYPD 2KL6A 3VDCA 4N9OB 3SJVB 5FV2A 5I6XB 1AQKL 2QKIB 3H9HA 1LD9A 2C7UB 4LSDA 3MGOB 4NOBA 4TPRL 5IW3A 4O2EA 3X13A 4L9LB 4WO4D 4FFWC 2A38A 4Y1AB 4KV5E 2CIIB 1EEZB 2FEDD 5F7MC 4AYFA 3QEHB 2AAVA 4P9HC 5CLWA 4Z7QE 2EC9U 3JTTA 4HEME 2DWDB 2B4CC 4NRYA 4OCRL 3VFTA 4XP4L 4XNUH 1BZ9B 5D1ZB 3SCMB 2UWEF 2X4QA 2W0KA 2APVA 4J3OC 1V05A 2BY0A 4BSVB 4K71C 4BQ9A 4MQXC 4Y4KD 1XIWD 4OV5B 3U48A 1L6ZA 1CBVL 2YN3A 3N1FC 3I3BA 4HUMB 1KF9B 2OCFD 5GS3A 3QPXL 3SDXB 5HGDA 5TE4L 4NQEA 5C71A 3TN0B 1ONQB 4ELMB 4M93C 2NNAB 4JB9L 4QRRA 3QG7H 3CFJA 1HK6A 1J1XH 1DBAL 5CJXA 3QXAB 3L7EA 3MCLL 1NCCH 2H3NB 4H26A 1WIOA 3D85A 4IMLB 1GC1H 2XA8H 1VACA 2R2EA 2Y07H 1SJEB 2R2BA 5C07D 5CWSA 4ODTH 3BGFB 1FL6B 4M1GH 3CFDA 1OP5H 2XOTA 1QOKA 5D7IA 2IPUK 4L1DA 4PRDB 1Z2KA 1RULH 3U0WH 3O6KL 4R7DA 2YD7A 4K3HA 4LRIC 4MJ4A 1T3FA 4GRWB 5K9KA 1KCUH 1JNHB 4QCIA 1W0YT 3EUUA 5FO9A 5H35B 1G7MB 3EZ8A 1R0AL 3P73A 1YQVL 2YWZA 3QDJB 3L9RB 3U9UB 3GJEB 4F7MB 5EBGA 4NN5C 4QNPF 1OSPH 2PYEA 5EU5A 3ILPA 1P7QD 4AL8H 3ME0A 1A3QA 1A4JB 2EDHA 4O5LH 1ZLVK 5DRNB 1ND0A 5I2IB 1EXUB 1R5WB 1ZWIA 1C1EL 3VXUA 3OQ3B 5KSAB 3P40A 3O4LA 4YDJA 1WZ1L 2NTFB 1G6RH 5D1ZD 3SCMD 4D9LL 3O41B 4ZTPH 3BEWB 4G9FD 4PJGB 5CHNA 1J8HB 3H3KA 2A74B 3W0WE 1EHAA 4GW5B 1T6VN 3KYKL 4IRSB 3QUML 1FV1B 4YFEA 3PIQB 3W82A 2ADJA 1QQDB 3H8NA 2NY0B 2PO6C 2NY6C 1IC7L 3KXFA 1SQ2N 4RX4D 1G7QA 2YRPA 3IS0X 1P6FA 2JK5B 3AVEA 2A6DB 1Q9LA 1BJ1H 2NY5L 1T21B 3T1FB 8FABA 4HC1H 1A1MA 5JOPE 5E5UB 1QHPA 1UXSA 1D9KA 4PG2A 3M8OL 4F58H 3VE0B 3FB7A 3JTTB 5HHVL 3CX2A 4CMHB 5DI8A 4U1IB 2J2ZA 4PJCE 3L3HB 4OI8A 3C2AH 3BUYA 3O8XD 3I75B 1MCFA 1BD2E 1ED3A 3ULVL 3GKWL 5LBSL 4Z7WB 4RWYL 2VAAA 4N90E 3DROA 4EIZC 3HZMB 3OAUL 4QOKD 3WIHH 3L5WA 2IFGA 3UTSB 1NUGA 1U0QA 4FQHB 4JY6A 3NCYS 4PJHB 4NC0B 5MHSD 3WFCL 4LEOA 2EXYC 3ZTJH 4ZAKA 4NCC1 2NY2C 4IHOA 1WWCA 4DGVL 3KPRA 2ID5A 3V4PH 2GT9A 1Q9OB 5C0AE 3IFLH 3AB0B 1MI5B 1QBML 3FQWB 4O58H 4FXLA 2QQNH 1YEHL 4OZIE 4QGYA 1ADQA 4X0KA 2HRPH 5DD0H 4HIIA 4R0LC 8FABB 1T0NB 1XFPA 1ZHNB 4FQCH 4OLXL 4XPAH 1Z9MA 4HK3J 5JIIA 4XHQA 3OAYK 4BSVA 1NLDH 4U1NB 4DEPB 4P2CG 3BXNB 2OSLB 3V95A 5D7JB 3QIBA 3ARGD 5IBLD 3FTGA 3SPVB 1Q8MA 4TRPH 2HN7B 4Z7WA 1XGPB 3I6LE 1NC2A 3UJTL 5EZIL 1U3HB 4J23A 4MXQC 4NQED 4HKZB 1X5ZA 1UA6H 3E2HB 5I73B 2FBOJ 3KPSA 4XCCH 1L4IA 2HJLA 3BSZH 4LHUG 4JPIB 3NIGE 3P4OA 1RK0B 4ELKB 2AEWA 3VXOA 5FECA 4PJIB 4OLUH 3QUXA 3IYLW 43CAA 1A9EB 5T1KD 2A0LC 3UTQA 1NKRA 3BGAA 4P2RA 1JHKL 4GXVH 3EJYD 1U8HB 3BH9A 4NQVB 3WS3A 3DX8B 1RZKL 2I26N 3KXFD 2YSSA 3T0WA 4ELME 3NN8B 4Z7WE 3C2SA 2QHRL 1HSBA 4M43H 3UTPD 3SDXE 1R3HA 3O6FB 2ZUUA 3HRPA 4BFBD 2W9DH 1FO0B 1HDMB 1I8MA 4J7RA 2VISA 4HW6A 4I3RH 2X4RA 4MD5A 4OLEA 5BS0B 2ICEB 4P2OC 4RGNE 4ZO6A 2DYPA 5CEYB 1TJIL 1D5BB 5DHYB 1FYTE 4OZIA 3OXRB 3LKNB 4L3EB 5HGHB 3QNZB 2R0LL 1ACYH 2O61B 3BWAB 1DQJB 4JFHE 5T5NF 5C0AA 1LO2L 1AD0A 5FDWA 3OGCA 3NZHH 1NCWL 2MCPL 1P7QA 5J1AB 3MV7A 3RWJB 4GS7B 5C0FB 5BRZD 1LO5A 1WBYB 2X4TA 3RY6C 2MKLC 4KDWA 5CILH 5ELIA 2G9HA 3KVQA 2E7CA 4RFOL 2WZPD 1F4XL 1T7ZA 3OR6B 1H15A 1MRCL 3E3QE 4IRSD 4X7SL 2P8LB 3UYRL 2IMNA 5BV7B 4HULB 3QJHB 1IM9A 1W0WB 4HKJB 2EH7L 5MI0B 1BD2A 1NMCC 4PB0L 5E8EB 4P2QE 1L0QA 1AO7E 1ZHBB 5HJ3A 3MOAL 4K8RL 2FECL 4O58L 4PJCA 1UB5B 2FBJH 5I66A 3MRGA 5HDOA 4CNIB 5KW9H 3HUJB 5CKGA 1G1CA 1MCWM 1MFBL 2NZ9D 2ORBH 4U1IA 1BM3H 2UUDH 4JFPB 3RWHB 1MF2L 1UH3A 5B22A 4MSWA 1IT9L 4DGIL 4Y5YA 2XNAA 2W60B 3IAQA 4BK4A 4JZOB 4I8DA 5GIRB 3UZQA 3FO0H 4HWZA 1IGYA 4J6RL 2MWCA 5HGHA 1MIEL 5F9WB 3HMXL 2HT2D 5HYEA 3FMGL 5C08A 4X9IA 3CAFA 4L5FL 1WAAE 5HYJB 2VAAB 1YA5A 4X4ZA 2XTLA 2P1YA 1QRNB 3S6CA 5CINL 2DBJA 5A2JH 1MCQA 1TVBA 1F3JB 1FSKB 2ATPB 4QOKB 5HHME 3W0WA 3ZZ1A 4BH7B 2QHLA 4HZLB 3S5LB 2P24B 3O2VL 1LO5B 3TVMA 1NAMH 4K2UL 2W59A 5T5FL 1Z0MA 4A2MA 5D2NA 3MRKA 4X6BB 1WGOA 2Q8BL 1U8LA 1YNLH 3UEZA 1Y0LA 1RZGA 5IEKA 3KR3L 1OTTD 5DHVH 1EK3A 1P7HL 4EDXB 2PYEE 4MA3B 5C2UB 3HTLX 4G42A 1FL6A 2R0ZH 3EOBB 1T83C 3STZB 1HKLL 2QR0B 4L4JA 2X70B 1OARH 2DL2A 2IJ0C 1FO0A 1I8MB 2NW3A 1KV3A 3W5MA 1D5IH 1NBYA 3VFNA 4YXKH 2R0ZL 3V5DA 4C56A 2XWBA 3PGDB 3PXHA 4Z7UA 3JV0A 1GPOH 3ULUL 5EN2B 4P46D 1SYVA 3P4OB 3GK8L 3CXHK 5T1LB 4C57C 2HTKC 2UZXB 2Y6SC 4K3EL 3VFRB 1F2XK 2DF3A 4PGBB 3R0NA 1WWAX 2DLFL 2ZSWB 2DWDA 2NY0C 3V6ZB 3FRUB 5B21A 3GKZA 1TCRA 4K7PY 3TIEB 4YDLB 2Y36H 2EZ0C 1AE6L 4ZFGH 2D3VA 2DKMA 5FYKL 3VDAA 2X4QB 4V2CB 1RZ8A 3QQ3B 5D1QA 4R96A 1NCDL 1FNSH 3BKJH 1YJDH 3KLDA 1HILB 2VXSL 3IRZA 2C9AA 4YXHL 5KVGL 4F15C 1UEYA 4NKIL 2XA3A 3KNBA 4EVNB 3BZEB 1F90L 1JZ7A 1S7QA 3B8SA 3EOAA 3OTTA 5FCUH 5DMKA 1K8IA 1OLLA 4OLZH 4KJQC 4BA8A 5DTFB 4OD3H 4ZXBD 3BRFA 1BHGA 3UC0H 2XY1A 5IFAL 4JO4L 3OHXB 5FYJD 5GRUH 4I18A 3VXTB 3SE3C 4B5EA 4JRYA 4K8RH 4LARH 4M8QB 4PGZA 1TCMA 1A1OB 5HYQA 5I8KL 1I1AC 3TO2A 1NBVH 4H5SA 3CSGA 4H8WL 1MJ8L 2R23B 3FONB 3WFEH 2BSED 1QSEE 1FYTD 1MHPL 5ALBH 2O5ZH 4OD1L 1B6DA 3CVHL 3HZMA 1O5DT 4LCWD 2PW2A 4JDTL 2NY1D 4K7PH 3RQ3A 2F8OA 1C5DA 4U0RB 2P24A 1Q0YH 2AABH 1LEGB 2CRIA 3BPCB 5ID0B 2XTJE 5T1MB 4UDTA 1RZ8B 3MRKB 4X6BA 3TH2T 2VQ1B 4LLQA 3TYGL 4ZOBA 5I1JH 4XP6L 1MOEA 4N0UB 4MAYD 5SV4A 2MQ3A 2PW1A 4CMMB 1ITBB 5EOCL 2MPAH 4Z7VF 3VFSA 5I8CB 1NLBH 1H3TA 5KVMC 1EGJH 3ARDC 3LDBB 1YNTB 4WFHE 4PJIE 4JHBA 4HS3A 4JFFE 4KK9C 1YPZE 4EOWL 3UBXB 3IKCA 2IAND 1NLBL 4LLDA 5ETUA 1CCZA 4JO2H 2DTMH 3QDGE 4HLZH 2W9DL 4G8GA 4LSPH 2FX7L 4IRSA 4XP6H 1JNLH 1X5HA 2Q8AL 4ERSL 3MV01 4JFQA 3MLRH 3HS0A 4MGXA 1YECL 2SEBB 1ZS8B 2WIIB 3MNWA 2AABL 1MJ7L 4N5UA 3UPRA 3KPNB 2YC1B 3K3QA 2HFFA 4OKDA 4OD2A 3NACL 4LSSL 3CDYA 1W72H 2XPGB 2X4SB 1BEYL 4IM8A 3TBYB 3CSYA 2F54D 1M4KA 3ZDXF 4PBXA 1IGML 1KOAA 3P9MA 3ZKXB 4G42B 1UA6L 3QCUL 4GXUM 4NKMA 1RJCA 3HPLA 2BY3A 3IETA 1DE4A 4KKNA 3UTSE 3MLXH 4LP4A 5I16A 3R1GH 5EC1B 4F15B 4GBXC 4ZPTB 4L8BA 4XVUD 5CJXC 1GZQA 3SDAD 1X5JA 3MRJB 4NBYB 5A1AA 3LD8B 4X4MA 3GFUA 1Q1JL 3MREA 3H7BA 2FRGP 2AJVL 4R8WH 1U6AH 2BSRA 3PG2A 3O6LL 4ZS6D 5D72H 4OZIB 3HC0A 5DA4A 5BZWA 1NCWH 4G6JH 3MODH 1DQJA 4Y19D 3B83A 4JQVC 3VG0L 5EOQH 3UJIH 1A7BA 2Z93A 1AI1H 5HVHC 5IHZB 1AE6H 4ZFGL 4IDLA 2O26U 5CZKA 2ICES 4QRQB 4Z7VB 4I48B 5T1DH 1RIUL 4XNXL 1NEUA 1ZLSL 4F33B 1IEAA 3ROOA 5E4EB 4LEXL 1VEMA 2N56A 5DUPH 3F12B 3CCHA 4U2ZA 4L8SB 2NYYC 5TF0A 3T8XB 6FABH 5ICYB 4NZUL 2D7PA 1MIMH 4KKLC 1VADA 1GPOL 1BGXH 4Z5RA 5BV7C 4WCYL 3G04B 1DQLH 2R1XB 4TSCL 2CIKB 4TQEL 3TH3T 3I50L 4PP1C 1KFAL 4HJGB 1NC2B 1KB5L 1I1FA 5DWUH 5KS9A 5I1EH 3WS6C 3ZSTA 3ROLA 4FNLL 1R5IA 1RHHA 3MRCA 2CDGA 5DZOA 3GJEA 4F7MA 2W65B 1NH6A 4KHTH 3R8QA 3G5ZA 3MUGA 3GMMB 4ZAKD 3RX5A 4KI5D 1FSKC 3KAAA 3TNMB 5I1DB 4JM4H 4XZUB 2H9GA 4S1RH 5C0EA 4XBEL 1CD8A 2VDOL 1HHJA 2Q8BH 5DFWH 1S8DA 5C0NC 3FQRB 5DVNA 4HGWB 3RKDD 4OT1H 1YPZF 5ID0A 3NCFB 4NIKB 1J5OL 1OP9A 1KCUL 3U4BL 5AUMA 3EYQC 2QQNL 3VFGH 1U8IB 2UUDK 2EYTB 4KVNH 5J1TC 4L8CA 4XNQB 5IBUG 2Z0BA 2BCKA 2LU4A 3BKCH 2BVPA 1FORL 4M7ZB 4GBXA 2FZ3A 1J12A 3C5SA 1OAZH 4WI5A 15C8L 1U91B 5F7NC 5FCSH 3VE0A 2BXZA 3IKCB 4ODWB 3MZTA 4H1LH 4KGLA 4LHQB 2Q3AA 5HI3D 1YYML 5IG7B 1LE9B 2NY4B 1NEZB 3U79A 3KPPB 2ZOKA 1EHLL 1KJ3H 2CK0L 1X5LA 3ARUA 3TO4D 4E5XB 4XNYL 4PJBE 1WIPA 1CL7H 1A5FL 1VKXA 1DQQA 5GZOC 3P0VH 5TQ0L 1VFBA 3B2UC 1J18A 4X98A 1IZJA 1F6AA 1UM5L 1OB1A 1IL1A 12E8H 1PY4A 2NY1B 5HHVH 1SYVB 3ARGB 4KFZC 5GGSB 1WFTA 3VXUD 4EBQL 2W9EH 1YY8A 5H37H 4HC1L 4K9EL 2CPCA 5H35A 1MEXH 3JWDC 1GC1C 4Q0XH 3FRPA 5DLMH 3HCVA 5JPNA 3GMPA 4NM4L 1KPUA 3CJJA 3SDDA 5E9DD 2EDFA 2RR3A 2W9LA 5C0CD 3MBEC 4UAOC 4EDWH 3P11L 1P9MA 2ITDB 3BMWA 4BSWA 1OHQA 4NRXA 3MRIB 4HPOL 3UMTA 3BQUD 2P42B 3NVQA 2VDNH 3C5ZC 4IRJC 2DI8A 4NZRL 4NQSB 4IEFB 3QXDA 4PJEB 3C6LB 4EZMA 1SMOA 2P8MA 3E6HA 4I9WE 3FB8B 3UX9B 5D71H 1WJ3A 1C5BH 5E2VL 1FV1A 4EI5A 5EIVA 5ACZB 3IAPA 4Y5YC 4AL8L 4V1DD 4NRZB 5E4IA 2ADGB 3BE1H 4XPHH 5I1LA 3JV4B 4GQ9L 3ESUF 2FL5A 4FFZL 2CJUL 4NUGL 1DQMH 2WK2A 4ODHL 4FFYL 2XRAL 2OR7A 4GXVL 1JHKH 1Z3GL 1BFTA 2A6DA 2VL5A 1IEAB 5E2UH 3AY4A 5E5RB 4F57L 1A1MB 5C09E 3QIUB 1ZGLP 3IDXL 4YAQB 3ARFA 3LH2H 3MR9A 3ARED 5HY9B 1CFTA 1OAKH 1U41A 4TNWF 1U3JA 4QO1A 1WWBX 4JKMA 1RIVH 4D8PA 4GH7B 4ETYA 4QHNA 2AGJH 1IBGL 2XKNA 3UTTB 2NW3B 2X1WL 4DW2L 2WBKA 2EE9A 5FHBL 2NXYC 4UB0H 1CLZH 1IEHA 2HT3D 5C9JB 5IBUB 1JHTA 3SDDC 2J7LA 4F3FB 4RCAA 3TBWA 5EU6D 2V5TA 3JWOH 5C07E 5KTEL 1EXUA 1R5WA 4Z77B 2NY2B 4PJIF 4YC2C 2R8SL 5LGKA 3OXRA 1J1PL 1MELA 3RVWC 4E0RA 4KTEL 4PIRF 3RDTC 3RBGA 3QXWA 3U36A 5DEZA 2LTQB 5DMIH 3V7MA 2P5ED 1QFUH 5HGAA 4DKDC 2F5BL 3G5YA 4CU7A 2JCCF 4P5TA 1BJ1J 1UVQB 4OLVH 4Z7NF 5JDSB 4HMCA 5SWZE 4HJ0D 2OL3B 1KBGH 4HS8L 4YQXH 1QA9A 2XZQH 1JGDA 2QL1A 2FJFA 3TEUA 3WFCH 4IOFC 4HXBH 3EKCA 2Z91A 2I5YL 1A3LH 1OLZA 2OI9C 3H6JA 4K23L 2R0KH 1F3RB 4XPGH 1N59B 2Y7QA 4KTEH 5D6CB 1AR2A 4WO4C 2X05A 43C9B 1INEH 1G7JA 3GB7B 2X4PB 4NQXB 5L88H 4QF1B 4QRTA 1KLUA 3CMOH 2DQGH 4YDKL 4D9QD 3CZJA 3QDMD 4EJ1C 3GMOB 3HPLB 2OZ4H 1T1ZA 1HHHB 1G84A 5HJ3B 4G8FB 1NUFA 1VPOL 1FFOB 4PJXF 1N5YL 1U3HA 3SKJH 3GI9H 4PJ5D 3BJ91 1BBDL 2GJZB 2W92A 5F7EH 1NL0L 2W60A 5EO9A 1G9MC 1ZA3A 3OWEA 2VERN 1OD9A 5LGHL 2KZ1B 2P4AB 5TE7H 1GHFL 3BPNB 1MJUL 3QUXB 1I1YA 5JW4Q 5C09B 2PW2B 1QSFE 4U0RC 3QHZH 4WI9A 3NA9H 5HHOD 1BWWA 4YDVB 4Y4HB 2VLJA 2AK1H 2ADFL 1S7VB 5FYKU 3MCG1 3S98A 3BPCA 2VLRE 3PHOB 3STLB 5B8CB 1KB5A 4Y2OA 5KVDH 3VXRD 1PYWA 4FG6C 3QDHA 2B5IC 5GSRB 1BD2D 2R15A 1N4XL 1HYSC 3BEVB 5L88L 1NGPH 4L8DA 5BS0A 5I1GH 3V4UH 1YNKH 2CGRH 3DHJA 1MCHA 2DQCH 3U30C 1UH4A 5CGTA 1NCTA 3QIWA 2VDRH 1P4IH 3H3PH 3QNZA 1F4WH 3H0TA 4GAJL 1SBSL 2XQYK 1F3DJ 1OOAA 1IAIH 1RQ5A 1JWMA 4MHHI 2AJUL 3F65A 2YPLD 4PRID 2Z31C 35C8L 1H0DB 1PEWA 5IK3A 1H3PL 1S78D 1IARB 1JUFA 5B38A 5DYOB 1OGAB 4XCNB 3LD8C 5L6YL 2HTLD 4AQOA 2VZ3A 3QUZC 3TO4B 2VDKL 2R1WA 4X7CC 1TVHB 2EXWD 3MX0A 2COQA 2HFGL 3N85H 1AKJB 1RUAL 2AVGA 2D9CA 1CGXA 1MCPH 4PJ8C 1YEJH 3U7WH 3RY6A 3WL9A 4Z7VE 5J13C 1KJ2A 2GFBB 5DT1H 4ORGB 2VZSA 5EH1A 5T1LA 5D2LB 1XF4A 3H9SA 3LRHA 3D2UA 3OZ9L 5K33A 4TOYH 5JIKA 2G75A 3RI5F 2Z35B 4APQB 5IHBA 2RAMA 2XXMB 3L3DA 1PFCA 4JKPL 5I15H 4K71B 4J4PA 4QXTB 1HI6A 3MO1B 5AD0A 1NUDA 1ZE3C 1P4LB 3BKML 4HWBH 1D3CA 1ORSA 1IGYB 4DKFL 3QO1A 1RURH 3SJVD 5HGGS 3HAEB 3WDHA 5LQBL 3LPFA 2G60L 1P5VA 4U1SB 1I7TA 4M7LL 5D7LA 3P3YA 4Y2DC 3DGGA 4YIQA 4P23D 5J4MA 5C92A 5E99H 5HI5D 3RZCA 4NDMA 3RZWA 1INQB 1OT2A 4ISVA 5D2NB 5F21B 5IW6A 3WS6A 1U8LB 1NAMB 4PJHE 1BFVH 3MGTA 2ZOLB 2VDNL 4DUXA 5FUOH 3WHXB 3HLAA 2ADJB 3OX8A 4DGYH 3VH8A 3GHEH 4YNYA 4KJPC 4YDVA 2AK1L 1JP5A 3EYUL 4UIKL 1XZ0B 2AXJA 5BQ7A 5C09D 3WEXA 1A6WH 1EZVY 3HE7D 4OCYL 1LO4L 1OQXA 3D39D 1FCCA 3F7RA 4JCLA 3H2WA 4JFOA 1EUTA 5M95B 2C26A 3DXAE 3HUJA 1ORSB 3V6OC 5E9DA 3GHBH 3BUYB 4MAUL 4N0UA 2CXGA 3LEVL 4PTTA 1ZXQA 4XCEA 2QEJA 1ZGLA 5LQBH 3HI1A 2DAVA 1WBXB 5TQ0H 5J11C 3QFJD 2DWEB 2V6HA 1QRNA 3REVA 3LIZH 4OZHB 5I30L 4YFLI 1YUHA 1INEL 2YMXH 2ATPA 3W0WB 4O2CB 4PRHA 3K2UH 3GSWA 5EG6C 5EC2A 1F4HA 3RU8H 2QADC 3RIFF 1FH5H 4P59L 1MCWW 2JCCB 2V17L 4P9HH 4BQCA 1FIGH 5CJOH 1CDIA 1G7IA 2LFGA 5JA8B 5CZXC 2X4UA 4WUUA 4IOSD 3GDBA 1BPVA 2AEQL 3NIGF 1KCRL 4NHUB 2AJYH 3GBNL 4XVUC 3QEQD 4YAQA 2IPTL 5ID1B 1E4WH 1ZA6A 4YHOL 1NGQH 3FT4A 2E7HA 3VMOA 5M94B 5B8CC 1K4CA 2Q6WB 1WZMA 3QJFB 1JPST 3LPWA 3S4SA 3VXSB 5C0JB 5HHNA 1FIGL 2BNRD 5HYQB 3D0LA 5E03A 2WSKA 3U83A 5L0QC 1W0VA 5IJKC 3RU8L 5HD8D 4XHJC 2AGJL 1I75A 2CH8A 4QHKI 1MUJA 3NIDE 5DD6B 4KZEH 3HZKB 4RMVA 1QPPA 3DSNA 3WO3B 5HDQH 5I30H 4LSUL 4Y5XC 2X41A 2I60L 4CGTA 3ARDA 3BOVA 3MJ9H 1PKQB 1I4FB 3CFJB 5E0QA 2HP4A 1B0GB 3RGVB 5E6YA 3K2MC 4KROC 3D2UB 3HAEG 1IJ9A 3ZMRA 1DQML 5DJYA 5ICZB 1S5HA 3OR7A 1NDGA 2WIMA 3SDDB 1C5DB 4WCYH 2VDPH 2ESVA 2PTVA 1DSFL 1R6VA 3F7QA 1BZ9A 4PRBB 4BSWB 3VGAC 4NJ9H 1IGJA 3WNNA 5DUPL 1KACB 4OQTA 1A6WL 2Z31A 4OCYH 3DV6B 4PRPB 3EYUH 3BZEA 3MLZL 5IROA 3X3GH 2IPUG 1TPXB 4MQ7A 3B4NA 1NANH 3F6IA 3BP5A 4M4PA 4GAGL 2DQJL 4MNGA 4YDKH 1CIUA 1HNFA 5CS7A 1CYGA 3VRJB 3LEXA 4UT7L 3WIIL 2DB8A 2PXYB 2GYSA 4Q2ZB 4O02L 2HVKA 3TBVB 4Q6YA 4LCWE 1U3YA 3FFCD 4QT5B 4R8WL 2AXGB 1HE7A 2JJUA 2FHCA 5JOFB 2UWEE 2EIDA 2VSCA 1W72B 1RUMH 5MENE 5E8DL 4ZODA 5F7UA 1DEEB 2GEEA 2XN9E 1I8IA 2CMRL 4HAFA 4UIMA 3V79C 5IQ7L 4XTRC 1OP3K 3MLXL 3DMMB 1L0XA 4WFHD 1BECA 3ZHDA 2OBGA 4CADA 5C9JA 1S9KC 2R8SH 3GSNL 1TNNA 3FT3A 4U6TA 1MNUH 5DA0B 3QG6A 5L2KA 1BEYH 1EH9A 1Z9LA 2DM7A 4K3GA 5HHOB 4HK0B 4Z77A 2OTWB 4XC3L 1QVOB 5H37G 4FQJL 5CMAA 1NFDB 3IF1B 3U4AA 1F90H 2GY7B 1OQOA 1S7UB 1C7SA 1IBGH 5CLTA 4PJ9C 3SE9L 5JPMB 2NY6B 1ZT7A 2NZIA 2OQJB 1NGYA 2DOCA 4DAGL 4DQOH 4PRHB 3VG9C 3G5VA 1I7RA 5GS1A 5CCKH 1M7IA 4J12A 2MNUA 5B39A 3WJJC 2JELL 1FZMB 1XF3B 3F12A 3T8XA 4OCLC 4N0CD 5IHZA 4ODHH 2NTFA 3IFOB 4HLJA 4LRNL 1RIHH 3O41A 3AS2A 3D69B 5IEHB 2AV1A 2JK5A 2WP3T 1QSFB 4HJGA 3FRPG 4PP1D 4AENA 4PRAB 1OWWA 5AAWA 5HXMA 4PRDA 4HT1H 2E7BA 3WFHB 3EJZD 1D5IL 1K85A 3GSVB 4HIJA 1NGPL 3MRJA 1F11A 3UBXG 2RCSL 1CGSH 3WXVL 5J9PB 5IHLB 2J6EH 3G6DL 5DURB 3AXLA 4KMQA 1L0YA 2BNRB 3DXAD 1FDLL 5D7JC 4ZUVB 1PW3A 2F54E 2D0FA 4ELMF 4JDVA 5BZWB 4PJ5A 2A9NL 1ND0B 2Y5EA 4Q0XL 3RA7H 5HDLA 4BKLA 3QA3B 4G9FB 1UM4L 3BP7B 1EPFA 3AAZA 4N1HB 3VWKB 4OZFG 4WTZG 4PBVC 1QNZL 5C0ND 5ESAA 5ACLA 2IH3A 2RQ8A 1I3UA 5DXWA 4HKBB 3PHQB 1T7WA 3ARXA 2H2PC 2X89A 1A1NB 5C6WH 1AGBB 4K2UH 3UZEA 2BDNL 5JXEC 1MREH 2VXQH 1HZHH 5JOFA 3NCJL 4OAWA 4LCUA 3QZWB 4G80A 4U33A 4LVNB 4QTIL 4KMTH 2VZOA 3MODL 5DD3H 1G0DA 5FF6A 3VFUA 3QIBC 1IQDA 2DJ4A 5I18L 1CXEA 1R3HB 1PG7L 3HMXH 5DFVD 4KPHL 5IG7A 4UTBL 3ELAT 4Y4FB 1LDPL 1IT9H 1KIPB 3EJJX 4LPUA 3U7YL 4DGIH 1NJ9B 4G43B 2YPVL 3CH1B 1TVHA 2R39A 4OLVL 3ZDZF 1S7RB 2L7JA 4D0CB 4CMHC 4XCYA 1HXYB 1UCBL 3DYOA 3BZ4A 3HI1B 5J12C 2VLKE 3X3FL 5CMAB 3KPSB 1MI5D 5F72S 2X1OA 4QWWC 2VC2H 1BFSA 2R23A 5HVHB 2O61A 1UZ8B 3BKYL 5E8PA 1NCBL 2QSTA 3PE9A 4FTVB 2DDQH 3I3DA 3RAJL 3WS3B 3RUGE 3GSRB 2IG2H 4RFOH 3NN8A 4JE4B 3GMQB 1RZJL 4KUCF 1TZGL 4PD4K 2Z92A 1CLZL 2VYRE 5T1MA 4LVOC 1XF3A 3C60D 5C0AD 5A16A 1A9EA 1HSAA 4X6FB 5DEFB 1A02N 1CDGA 4PJEF 4NBZB 1BX2A 3MRIA 4PTUA 2D31A 1A8JH 2X4RB 4MD5B 4EXPX 1AP2B 1A9BA 5CUSH 1U95B 2L7UA 3NCEB 2DQTL 3B5GA 4OZHF 4R90L 3SKJL 2AJXL 2NY7L 1Q9KB 3ULUC 4FFYH 1NJ9A 4R2GD 3O2VH 4HHAB 4KKAC 2CXKA 3QJFA 2OK0H 1U8KB 4ONGH 1WWWX 2DM2A 5DJXB 5IGXH 3G6JE 3B2VL 4S0TD 3A67L 3R0MA 3IDGB 2EH8L 1LP9F 3PDOA 4XPTH 1U42A 4F7PA 2IBGA 5HHXL 2DJSA 3MJGX 5TE6L 2UV3A 4P4KA 4R4ND 1Y6MR 5DUML 2EIZA 4L3AA 4LL9A 3A6CL 4M62H 3OJDB 1QPXA 4GFTB 1SHMA 1J86A 1KIRB 2R69L 1HYSD 1NEZG 5FYLL 3RBSA 3OPZL 5I1AA 4XVTL 5FKAA 5KW9L 1QG3A 3UO1H 3BN9D 2F5BH 5IMMA 3WV0A 1MJ8H 3D3VD 3JWOC 1PJ9A 1ODAA 3PDGA 3RWCB 4LMQE 1YEDB 4BK5A 3DYPA 3FO9B 4I2XA 4FXKB 4OZGF 3UTTE 1UH2A 1T04A 1UWGL 3IRPX 3KPOB 3NBNA 1NGZA 3QIBD 4G8IB 2NXZB 1MEXL 2YEZB 1NDMA 1R3JA 5GRUL 4MLIA 4OFKA 4OGYH 4TSAH 1IGJB 2YWYA 1UJTA 5FYJU 3O4OB 2YD1A 4MXVE 5FIEA 3KYMA 1UG9A 2DLEA 4ZUWA 3RDTD 4JGMA 1LP9B 3OKOB 1X6LA 3FQUB 3TBTB 3VRIA 2ENSA 5F7WC 3LMJH 4Q7DA 2NR6C 4KK5C 4U1KB 2FGWL 3W9EA 5CIPA 3WDIA 5FGSA 1U3ZA 4UMGA 5D1ZC 3SCMC 3HMWL 1NBYB 4Z7UF 1KJ3L 2B2XL 4M02A 3BWUC 5DD1H 2OL3H 2R69H 2J88L 1YDPA 2D7TH 5FKPA 4WUUB 2F74A 5E08L 1UVQA 4QOKA 5TJWK 3VJ6B 4GQ9H 4U6XA 4MB4A 1WTLA 2DLIA 4QF1A 4QRTB 1FFRA 2J3SA 4L4VD 2ADIB 5C0RL 1MRFH 1NFIA 4LSPL 1H8NA 4G8FA 2MOVA 3OKEA 4POYA 4X9FA 4K9EC 3P4MA 4TYUA 5SWSB 3IXAB 1M7DB 2YD3A 4FTVD 4UDUA 2CLZB 1ZHBA 4Z8FH 1G7JB 4YXKL 4H1LG 3BX7C 4U3CA 1J87A 4P2QD 2E9BA 1B0RA 1C12B 3REWA 1A0QL 5ISZB 2NPLX 3PL6B 3GMRA 1IFHH 1VESA 1SVCP 1XH3A 3KYMB 3TF7C 2FX9L 3MXWH 1FVCB 4O2FA 3PWLB 2VZUA 2ZJSL 3D3VB 4F7TA 1MH5A 3ZL4L 3LHPH 3VRIB 5SWZD 4E0RB 3CXDL 1FG2B 4CRPA 2N1KA 5E94A 3QUXD 4PP2A 3VFVA 2HMID 4P46B 4ETQA 4RGNB 2ZJSH 1JIBA 4TSBL 1BFOB 4QTHA 3T4AA 1CS6A 1Y18B 2AI0L 4HKJA 2A73B 1FJ1B 1CI5A 3CVHH 1N5AB 1T1WA 3L5XH 1BJ8A 5IMOA 2HA1A 4D0DA 1AXSA 2BRQA 1A6ZA 5KVEH 1TETH 1ZLWK 4B41A 4U6XB 1QLFA 3EO9H 2IF7A 3B9KC 1NBVL 3JXAA 5TFSL 4Z8FL 1Q0XH 4G3YH 1NFIB 5DO2C 2PYED 1CE1L 2ZUQC 1VGEH 3MBEA 5D5MA 4XXCA 4E42A 3MUJA 2XZAH 5CINH 4DZBA 5IFAH 2Z31D 3BP6A 4M7LT 1MFNA 4LCCB 1U8OB 2V2TB 4YBQD 4P9MH 4GG6A 3RVVD 5KSBA 3UPAA 5GRJH 1RFDL 1IGIL 1O7VA 3P9LB 4PJGE 2B0SH 3LKPB 5FHAH 1F00I 5E2WH 6CGTA 3EGSA 3BDYH 1KJVA 5EOQL 3UJIL 4WV1C 2OI9B 5IT2H 2YUVA 1EVTC 1CE1H 1WVZA 5DTFA 4DZ8B 4ESKA 2YA1A 5BOZG 1MI5E 3VXTA 5GHWH 1E28B 2OXGA 3CVIL 4RQQB 3RTQD 2YBRA 2VWEC 5GS2D 5KVEL 2N4IA 2YA2A 4LLWB 1GIGH 1JWUA 1RHFA 3ARFC 4DN4H 3MUZ1 3G9VA 5CEZH 5KN5A 1GGBL 5KS9F 4LVNC 1NC4D 3GMPB 3WBDA 3OKKA 5LWYL 4X5WB 4LQFL 4X7FC 3VXSE 1BMGA 3CD4A 2EDQA 4XP5H 4K07A 1CICD 1TTFA 1FNLA 1TXKA 2JJTC 3ZT7A 4UQ2A 3X11A 3KWWB 3KYKH 2R1YA 5FYLH 1HH6A 4M4RA 4XPBH 3QH3B 1F6LL 1M71A 2XWBB 4LP5A 5GRWA 2P8MB 1KFAH 3LKPA 3C8KA 1X5YA 4UV4H 4JFDA 4KC3B 4OCRH 4BUHA 4KRPD 1KJVB 1ZHKA 1SM3H 3LN4A 1P9MC 3VXQB 1F58H 4CJ1A 2O5YH 3R8BB 4P4RB 1CLYL 1MUJB 3LRGA 3DOSA 1DL7L 1XF1A 4HDIA 1DZBA 2IANE 3O9WA 4MAYA 4UV7H 3HE6B 1I8LA 4OM0H 2W0LA 2OX5A 3ZE0F 1T03L 4Q9QH 4L3ED 4M5YH 5LCVH 5C8JA 4B0MM 2GCYB 3WN5B 5IB1B 3SEPA 2DQTH 1DDHB 2PYFA 3KJ4C 3R06A 3TT1L 3VG0H 1QEWB 1GOGA 5AWNH 4JQXA 5C6TH 2WNGA 3FJTA 5EUOB 1BOGB 3GRWL 5JNYA 2C1PB 2QBWA 5JMOC 5D72L 1HSAB 1B0RB 4AH2B 1FFQA 2V7HB 4HH9B 4IIQB 1TMCB 1CXIA 3LS5L 5JR1L 4LQ1A 4HS6A 1RJZA 3PWPB 4JQIL 5L8LB 2VE6B 5D70H 3IKKA 3GMLA 1ZGLB 4XGZA 1MCLA 2NTSP 1A7QH 4PB9H 3CC5B 3MLTA 1JPGB 1V5JA 3ARQA 1XGQA 1QTYT 1E4JA 2FEEI 2Z93B 1G0XA 1C5CL 1G6VK 2ZUWA 4YH6A 2E8ZA 4A6YB 1BFOA 5JDSA 4OV6F 1B6UA 3S96B 5D70L 3F7PC 4JM2F 2Z8WC 4L29B 3ULUE 3ILQC 4XRCB 3C6LD 1A47A 4GRLC 4Z5RB 4AEEA 43C9A 2A77L 3ARWA 5TE6H 4WHCA 4EI6B 5TPWL 5LKNA 3FQTA 4OTXH 5DK2A 2DN7A 1T1ZB 3ROOB 1BOGA 5JNYB 1D7FA 5T5NG 3B2VH 2ZP0T 1UXSB 4GW4A 1AGDA 1UGNA 3NH7H 1FFNB 4XP1H 5KSBB 1S7RA 3O8XB 3IU4L 4J3VA 4RAUA 1NKOA 4F2MB 4B7LA 2FB4H 3PWPA 3PNWA 1CQYA 5IQ9A 5T3XD 4M6NH 1UZ8A 1WITA 3O2WH 1MFCL 4J1UA 4MWFA 3L3JA 5D7KD 3FO2A 5BJTA 1XGQB 4UT9L 3Q5YA 1S7UA 5CJ8A 5LVEA 1YY9C 1LP9A 3OKOA 2ICWA 4XMPL 3KYOA 4N8CL 3JUYA 1NGYB 1HCFX 1HXMB 2OP4L 4FQ1L 1QFWI 5DSCB 1S9YB 2P5EA 1JYVA 2YA0A 4PJAF 3PV7A 5JOPD 1FLRL 1BF8A 4NO5B 1X5KA 1LK2B 2Z4QA 3S35X 3DUUA 2IALB 1A22B 1AXIB 3K4AA 4X98B 4LLMB 5I16B 4WTZA 2OTUA 4H8WH 3KHOA 4PV9B 1HNGA 1KYOK 1V3MA 3PQYE 5H94A 1EJ6A 4I0PD 1DBKL 4OV5A 1FQ9C 1T0NA 1RZJH 2BNRE 5ADOL 3HFMH 4P2OA 1WCBB 5J6GA 2PCPA 1T03H 4XAWL 4Q9QL 5KVFH 5HGDB 4ODUB 1K2DA 1LDPH 5DYOA 5M7QA 1M71B 4WU5B 1Z5LA 3INUH 1ZV5A 4PJFE 1YQVH 4FQCL 1E6OL 3C8KB 5MHSE 4ZXBA 2BVPB 3MV9B 3L7EB 3GM0A 2QQKH 4WW2C 5F9AC 1WK0A 1ZHKB 4GMSH 2EDKA 3X3FH 4D94A 5KBNC 2PXYD 3GSXA 1VKXB 2D9QB 3RUGF 1NCDH 2CO6B 4TN9A 1QR1A 3FB6B 4V1DA 2IH1A 3QBTB 4ONFL 3VXOB 1S3KH 3GO1H 3K1DA 4Q58C 4ODTL 3WN5C 2BSSA 1SY6L 4PJ7F 5ICZA 2WW8A 3QUYC 4P99A 1N6QH 4JDZB 3BDXA 5GJSL 4HMEA 5F9OH 1FBIH 2BRRL 2ILLA 5EUOA 1DBAH 4QHKJ 4HCRA 2DQHH 1OPGL 4WRLA 4XRCA 2ITDA 1RJYB 2QSQA 4PRPA 4HG4K 4QLRA 1MI5A 3AMKA 3VXSD 1XMWA 3VFMA 3VXMB 5JDJA 3ZYOA 1OSZA 1T5WA 5JPNB 2UWEB 3CFBB 5HYSA 3SPVA 2DQDH 1FVEA 3CVIH 3I6KB 3OKNA 4Q9BA 3G5ZB 4RBPH 4Y1AD 5C3LD 4WUKL 1KEGL 4GSDH 4LPVA 3O11B 1GGIL 2OSLA 4JFYA 2PXYA 4Q2ZA 5IMKB 4U3XA 3TNMA 3I2CH 4P5MB 5KANI 3QCVH 1KN2H 1TZHA 3HNVL 4ZNEE 5JW4N 4JFXA 1KLGA 4ZAKC 1WIUA 3OMZA 4JHZA 3GSQB 2B0SL 4DZ8A 4EUPB 2DQFB 4HKZA 3TESA 5FUOL 3DYMA 5E1HB 1S9VA 2PO6D 4I9WD 4M1DL 1A0QH 4AG4H 4IOFD 1FNGA 4IS6A 4AIOA 1IL1B 5EDXA 4I0PA 1NAML 1UEMA 3OJVC 4WEMB 3UBXI 4CVXB 4CN1A 3GMQA 1O0VA 4P3CL 1UCTA 4B50A 3BI9X 1R3LA 1CZ8H 2J8OA 4MX7B 1Q0XL 5DJDB 1T2XA 1FVDA 3NPZB 3VWJB 1CD1B 1CICA 2QTEA 3I75A 1FN4B 1YQ2A 1Z9SA 2VTFA 3CH8A 2Z9TA 3GGWA 2I9TB 4N8VA 4O2FB 3GSVA 3QHTC 1A64A 1JN6A 4Y0GA 1FPTH 3Q0HA 3P0GB 1R0AH 2AI0H 2EYSA 3GMOA 5C0CE 3T65B 2D7TL 4PJAB 1WCQA 4LSUH 4QRPB 3KYNA 2FBJL 2IH3B 4RZCB 1K2DB 4FQXD 3WUZA 3TBWB 3PHQA 2W91A 2ZUQB 3UJTH 3AMLA 1HXMA 3TV3H 3QA3A 3MMEA 1FZMA 4NWTH 2YD6A 1IKFL 3VWKA 4YHKH 5I1IL 4L8SC 3NIFE 5CP7B 1Z0NA 3ZE1E 4M8VA 1IM9B 3E8UH 4NSKB 5F7FA 2A2QT 4FABH 4JG1H 5CILL 1BD2B 2HFGH 4XPAL 1ZLVH 1KB9J 3DBXB 1OAQL 4FQPA 5DFVC 3FZUD 3MTRA 1JZ5A 3N9GL 4O51B 4R26L 3MRGB 3SGKA 3D6GA 4U6HA 4MXVF 5JQ6H 4G43A 5L6YH 3LQZA 2P47B 3DJ9A 1NFDE 1DANT 4G6FB 2FATH 2QR0A 4OGXL 2DQJH 4JZOA 1LGVA 1HOCA 3MBED 5GIRA 5GGQH 1JN6B 4WY7L 1XIWB 4PJCB 5IMLB 5C08B 4ZXBB 4P46C 3GJFB 1KTDA 1YEEL 2BC4B 3C5JB 3IS1X 4XAKE 1P7QB 1NCAH 4EI5B 1OAYH 5ACZA 1QZ1A 1PX3A 1T89C 5IVXA 1C16A 4I77H 5EU6E 1S9WB 3DTXA 3BP4B 5D96B 3W11D 2EDJA 1K3IA 5EU5B 5CGYD 1I85C 3V5KB 1N4XH 3B6SA 1U36A 3DETD 1I1AD 3ULVE 4WI6A 1NSNL 4J8RA 1NMAH 1F45A 3GSUA 1LEIB 3NPSC 3O3EB 2AJ3B 3GKWH 5LBSH 2Q1EA 4FFWD 4R90H 3LRSB 4FZ8L 3G6JF 5FGBC 4OGYL 4TSAL 4LVEA 1AD9A 2EC8A 5JLZB 1B0WA 2ARJB 3MXVL 1KJ2B 2GFBA 5DJ2B 3QRGL 1RK1B 1CR9H 4BFIA 1X5IA 4OZHE 1DSFH 4DKEL 4EN3B 1LO4H 2FIKB 4FQLH 2NW2A 4KJQD 5CEYA 4Y4FC 3MNVA 2D31B 4LSVH 1ZT1A 2EECA 3QQ4B 5DVOA 3FQXB 4CVXA 4L3EA 2E6PA 5DC0A 5LAXA 3ZYJA 5F7YC 2GAZA 3GNMH 2NXYD 3IU3B 4MX7A 5DJDA 5KJRL 1NMBL 3BAEH 4CKVX 1FZOA 5GISL 5HYJA 4P4KB 1DEDA 4JVPA 3UDWA 4YHOH 4X8XA 5DD0L 3N1MC 4YHIA 2ZUXA 4JN1L 3JBG7 4JPKL 2VC2L 2AEIT 1DUZB 1KTLA 5DQJB 3WL9B 4ZNCD 4PRIE 3S97C 5T3ZE 3V7AG 3UJJH 5F7DA 2OK0L 3J8F7 3B5TA 4UILH 4YUEH 4UINH 4HS8H 5D2LA 4DK6A 1CDUA 2RB8A 2F19L 1N0XL 4HF5H 1KCVL 1MCNA 1N0LA 3MUHL 3RWCA 5IVZB 1CTOA 4APQA 2M1KA 1ZLWH 1U8NB 1GOFA 1DFBH 1JJUA 4G7YH 4ZUUA 4PUBL 2QKIA 1UWXH 2YEZA 4LEOB 2XQBH 4AH2A 1FNEA 3WIHL 1EDQA 3ALPA 3AY4C 3RUGA 3O6KH 3WJLC 1U93A 1TCRB 1RJZB 4KMTL 2A6KA 3MYZA 4MJIA 2VH5H 2RFXA 4R97C 1TZGH 2KBGA 4XI5D 3QQ3A 4JPWL 1BVKA 4TVPH 3VFTB 1CF8L 4PJ7A 3VXME 4NNXB 3DV4A 2V9TA 3EJZC 5GRXG 1Q9KA 1JWMB 5F44A 3C8HA 2WUCL 4HS3B 1FCGA 3FQNA 4P59H 4DW2H 4UNVA 2XA8L 3HG1B 3T09A 3U7WL 2XICA 3T3MF 3BKYH 1JUFB 3EOTL 1UM6H 2FH8A 1ZEAL 4IJ3B 3WD5H 2JB5H 1K8IB 1MVUB 1IGFL 1K6QH 3SJVE 1GRWA 4WWID 2NY3B 1GH7A 5C7XH 2OMBA 1OL0A 4Y1AE 3MRBB 1PVHA 2WWMD 3S34L 4XT1C 4GJTB 4PGBA 1JCKA 1VFAA 2Y06H 1T5XA 3SKMA 2VZ1A 3TGXA 4DGYL 1MAMH 1G7HA 4NGHH 1H5BB 2AJUH 4X6DA 4KPHH 5GGVL 1QLRB 4GMTH 1RSFA 2GW5A 4WW2B 4OF5A 1XR8A 1FAIH 4LLYA 3MLUL 4F9PC 2I07B 3DSFL 2XZCH 3TZVB 2NMSA 4RNRA 5JW5A 4PG2C 3JTSA 1C1EH 4EQ3A 4PTTB 4MD0A 1KIQA 5IFHH 5DJZA 3KLSA 4BZ1L 1MH5B 1BVKB 4NN7C 5HI3C 1RIHL 5GS1C 4PJXA 3V5DB 1AQKH 4OKVB 5IESL 2BC4A 3C5JA 5TDOB 3M45A 2F8XC 3AREB 1IILE 3V0VA 2Y23A 1KENH 4Z18A 2FR4A 2WM0A 3MV8B 2YPLA 4JREB 3QUKA 1FJ1A 3SKNA 2WINB 3U0WL 4NO5A 1MJUH 1I9RH 2BP3A 4JKPH 4XWGH 3SE9H 2BSTA 5D93C 5AZ2L 3CNKA 3OKYA 5KSAA 4JY4B 5CSBA 5H8DA 3MA7A 4E41E 4LPXA 5E6IA 4DWHA 4MB3A 3V0WL 3QDJD 2C3HA 5DT1L 2GHWB 2K7PA 3WE6B 3M1BA 3QNYA 1J8HA 1J0HA 3P0VL 3E2HC 4MCYB 5FUZL 1LNUB 5L8JB 5FGCE 4KRPB 1VB9A 2FIKA 1AH1A 3CDFA 2VDKH 1E6JL 4WJ5A 3QG7L 4EN3D 1JRHI 2DQEL 1BBJA 1A3LL 5DJ6A 3GUTB 1X7QA 3ZDYE 2MFNA 1JL8A 3DVIA 5FO9B 1SBBA 3TM6A 2HTLC 1U8OA 1CL7I 4NDMB 4EKXA 2WBJC 4ZOCA 5ID1A 4OZGB 1KELH 4L9DA 4NO0D 5E70A 2VO5A 7CGTA 5E5MA 3BPOB 4HJJL 3DARA 3JUZA 3RWHA 1XCTA 3VW3L 4G8GB 3AB0C 5TF1L 5MEPA 1TITA 4BUGA 5F6IB 3SKNB 4YDIH 3PABB 3E1F1 3GI8H 4MYWB 5GRYA 1U8MA 4QYOB 3MLWL 1AGFA 3P9WB 2NCMA 3MOBL 4YUEL 1WLHA 1TVDA 1HHKB 2DQIH 2VQ1A 4GO6B 3MLYL 1SMAA 1A6TA 1W2KT 2E6QA 2YK1L 3U0PA 1CFSA 3RNKA 5MENA 5E6IC 1NAKH 2HH0H 3MRMA 3DV6A 1VEOA 5LGHH 2XQBL 5L2JB 4XB7A 1DJSA 4MS8C 3MRRB 1GZQB 3D25A 3EW3B 2B1HL 2CMRH 3BT2L 4U1LA 3B9VA 3C60A 4BELD 4X4YB 3S8WA 4W68A 2IPKB 4RAVB 2BFVL 4GW4B 4LASH 4UILL 1FHGA 2CJUH 4NUGH 4P4KD 3RWGB 2VXTL 3QH3A 3QWOA 1E4KC 2IMMA 2F5AL 4HKXA 4UT9H 4BQ8A 4K94H 3HE6A 2VR9A 2YUZA 1V8HA 2EIZB 5JPMA 1JZ8A 3W11C 4NHCH 4IRSC 3NIDF 4M1CD 1KNOB 5IBTH 5IFJB 1NGXA 5ISZD 3BPOC 4G7VL 5HVFB 5D9SB 2ESVE 2YPKB 2AXGA 4R2GB 4HBCH 3VH8G 1UKSA 3CMOL 1DBBL 1IGTB 5DJYB 3MV9E 4JO3L 5K9OA 4KRNA 3GI8L 4M6OH 2YD2A 4HV8B 5IUSA 5JW5B 2GTZA 1YEEH 2OTWA 5MEND 2IADB 3MRRA 4JAMB 4K9EH 1KCSH 4FZ8H 2EDDA 4YZFE 4U1NA 4NWUH 4XMKL 5C07B 3IDJB 4P2OD 4P49A 5DDHB 2IQ9L 3D9AH 2DQUH 5H2BB 2X89D 2VQUA 1F2QA 1S7XB 3BRDA 5BXFA 2W65A 4KUZH 4UI2A 2M2DA 4E5XA 2AJZB 2WP3O 2VJXA 3KG5A 4A6YH 1B0GA 4PS4H 4R7NB 2R4SH 2CDEA 2AW2A 2H1PL 3G08A 2CKBL 3FFCA 2H32A 2J4WH 4JREC 5FUZH 2VOTA 3NCYP 1TPXC 5D7SL 4HDIB 4G6AC 3SGJC 5I74C 1DBJH 2EXYD 5JR1H 3AREC 1CLCA 1FZKA 3K81A 3MRHB 1YJDC 3CSPA 1IKFH 2R4RH 1OM3L 4Z78B 4XVSL 4FFZH 3O6MH 4K3DL 1RU9H 1IC1A 4OF8A 4BH8B 5IIEA 4KKLD 1VFBB 5HHPB 1OW0A 3HCVB 4FFVC 3TFKD 2FO1A 5DO2D 4OSUL 4ODXA 3LKOA 1JZ3A 5C6TL 2XN9D 3IDNA 1IEBA 5EZOL 3VFGL 4YHML 3U4BH 4OQ1A 4PJDF 3IDMB 5EPMA 5K9JL 2CRZA 1JI1A 2D7NA 5JORA 1CDYA 4P9HL 3ARVA 5EOTA 1AQDB 4X6DF 4ZUVA 3S3JA 1ED3B 2ZKHL 3LB6C 3CDGB 2YXMA 1UWEL 2JF1A 5ALCL 2F9BT 3RX8A 3D0VA 3U1SL 4APQD 5IQ9B 2BOBA 4RAVA 1ZVSA 4H88H 2ED9A 4CU8A 1KN2L 3T2PA 3PABA 4NJAL 4N0FB 5E9DE 1DQDH 2IC2A 3HUJE 5JXAL 3BZ4B 5F3BB 1KEGH 3F7VB 5L9DL 1MAML 4M03A 3HA0A 4OLWL 4RGNC 4KJYB 3V7AE 4KJWC 1G7LB 4EN3A 1IAOA 1HYRC 1KUMA 1X4XA 3RNKB 4AT6A 4S2SB 1B2WL 4JFZL 3BKMH 3EYOB 1Y0LB 4R4BB 5CJQL 2PCPB 3QUYD 3RTQA 3VRLE 1HH9B 3GRWA 4LCCA 3A6OA 2WANA 4PV9A 3TC9A 1AGDB 2FO4B 5ITBL 1UM6L 5MEQA 1BIHA 1D6EB 5KSAC 1JNJA 1CFTB 3WKMH 3K0WA 2I07A 12E8L 1DE4B 3KGRA 3CLEH 2QADB 3P30L 4KVCH 1T0MB 4XC1H 5D96C 3RVUD 4GKNA 4Q97A 3BQUA 3MQIA 1Z5LB 1BFVL 1WC7A 5HD8C 3QR2A 4OQTL 4PJXB 5CBEB 3T65A 3CIQA 4PJ9D 1VFOA 4YWGH 4U2YA 4JLRA 1A7NL 3DIFB 4MA1C 4JZNA 1OB1B 4QRPA 3STBA 2HJFB 2OXHA 3HPJA 1ZVHA 1MWAB 1KCLA 35C8H 1U8HA 4NQVA 1CXHA 2OJEA 1HQRA 1T6WA 3ARFB 3EDFA 3FZUC 1A1NA 1HSBB 3V52L 4NPYA 1KXVC 5C0BE 1FZKB 3EYOA 4R4BA 1J8KA 3NZ8A 2XNAB 4O9HH 5I76B 1TJGL 2CR3A 2DQCL 2WUBL 3EAKA 3EYFB 5D2NC 5E2JA 3UPCA 4OI7A 2X4NB 3TCXA 2X09A 1JGUH 4JJHA 5DUBB 2GJ6E 3EFFB 4FP8H 2DYPB 1HEZA 1SY6H 4S1QH 2P5WD 5J06A 5EA0H 1JHLH 4TVPL 2A9MH 1OT1A 4NWUL 3BQUC 1RZFH 5K59E 3I50H 1I3VA 1RUAH 2IGFH 3GSQA 3KPQA 5GGTA 1V7NH 1HINL 4XMPH 3K8MA 3GBML 1KJMA 5DGQA 1MIML 3TZVD 3T2QA 1U8KA 1UFUA 5HPOA 3HB3D 4U7SA 1NL0H 3O9WB 1E6OH 5GGSY 5I74B 2VR4A 2A0LD 4YK4B 5I1EL 3TO2B 3LKSB 2XACC 4WTXA 5DURD 4HF5L 1PGRB 1UZ6E 5GSRA 2LVCA 2FLBT 3QQ9D 4PLKC 2W0FA 5D6DA 2OLDA 1OP5K 3V6ZA 3TZVA 3SKUD 4KJPD 2IAMB 5DJAB 3DVNA 1MWAH 1V3LA 3SDCC 5DJZB 2HYMA 1JMXA 3RWEB 1MRFL 4KJYA 2ESVD 1LHZA 6FABL 5GPRA 4XPGL 1YNKL 1BX2B 2VLJE 1CQKA 2CLRA 4UDTB 3VFMB 1TQCC 1MCSA 1YN6A 2AK4D 5TH2B 3HAEA 5CBAA 2VLRD 5KJRH 4RX4A 3CU7A 1U92A 1R5VB 4JDTH 3I6KA 3OKNB 3DRTA 2VUYA 5GGUA 3RDTA 2O5ZL 4M9OA 1DCLA 4EIGB 3F5WB 4LNRB 5JHDA 3QUZB 1DANU 5FO8A 3DMMD 3QB7C 2Y9RT 5E8PB 1CE6A 2OYPA 2FGWH 4J3TA 1L7IL 3NTCH 3N9GH 1I1CA 7FABL 2VIRB 3MFFB 4G9DA 4J2XA 2AJSH 3ZSSA 1QSED 2AV7B 4Q9RH 5B4MC 3LKRB 1ZANH 4JQIH 4QRSB 3NACH 4LSSH 1T2QL 1X44A 5DFTA 1RZGB 5IEKB 5IW1B 2EKSA 3MV11 3B3IA 3NH7L 3A0OA 2PETA 2X4OA 3SOBH 3KXFB 1RUQH 3U30B 1UKTA 2NY6D 2F53D 4ERSH 2HFEB 5F88A 3ZHKA 3TYFB 1U95A 4YXLH 3VXPB 5SWZA 4ZFOA 4I77L 3GBLA 3C5ZB 4IRJB 3RKDC 1XF4B 3H9SB 5FUCC 1OTTC 5TF1H 1EERB 4HGKC 1RVFH 2XZQL 5EU4A 3F7YA 3MBEB 4UAOB 5D5MB 4ZD3L 5IOPB 1FGVH 4NQCE 4P57A 2HT2C 4JAMA 1QBLL 4F7TB 1DL7H 4H5SB 3CX5J 1WEJL 5JQHC 1T2JA 2DQEH 3IFNH 3NGBB 4ENED 4MDJA 2EH8H 2GJJA 4KI5C 1BWMA 3QPQC 4IOIA 4XXDB 2KKQA 1J1PH 2NXZC 4LIQE 3WNMA 4JPVL 2R29H 1A7QL 2XWJB 3K74B 4PB9L 4ONGL 5D1XA 3QDGD 3ZDYF 4JY6B 2A73A 5EC2B 1D5MA 4Z7OF 2ARJA 3PWJB 4FS0A 4NZRH 2VWEE 5LXGL 1BVZA 4OLUL 5ITFB 3JWDL 2DM4A 1EGJL 3KDMB 5T3XL 1PX4A 4CJ0A 3SGEH 2MHAB 3UTZA 3V6FB 1SJHA 4XBPB 3QIWB 5F7LB 3LRSA 1WICA 3T4AB 3DBXA 4R96B 5EUKA 3OBAA 5F1NA 4D0DB 5IMOB 5FK9A 5DGRA 1CICC 4M7JH 2FYYA 4GSDL 5E2TL 4L3CA 5IROC 3UTSD 4RMUA 4L8BB 1K4CB 1IEBB 1SJVA 3FHAA 4Z7QF 3QXTA 3WDJA 2PO6A 5IBLC 3BP6B 4MMZC 4U0QB 1P4BH 2W38A 4NFDA 3L9RA 3U9UA 2F53B 1C16B 1YEHH 4U1MB 1JPTL 5I1KL 3ULVD 5J1SC 1X5AA 2HG5A 1D5XB 2VXSH 3BRGC 5E8NB 1YDPB 1X6NA 5GZOD 1FBIL 2BRRH 2H3NA 4H26B 2GJ6A 1FG2A 4KROD 4R2GC 5BVPH 1A4KB 2BOBB 2ZOLA 3MV8A 3S36L 3WKNA 5CWSB 4XPBL 2AJ3A 1AJ7L 5J3HD 4HFWA 3FO1A 2DBLL 2IFFH 1MPAL 4Y1AA 1QSEB 5C0BA 2Z35A 2BSTB 3AS0A 3SDYL 3DX8A 5HGAB 5GRJL 1AGCB 2A83A 4N9GB 3O6FA 3HC3L 5JUEL 2FEDC 3VMNA 3TA3A 2BY2A 2DIAA 1K9TA 3QEHA 2VLKB 3C08L 2FJFB 1IGFH 4LPTA 4U49A 4PJ7E 3VXMA 5E56A 2ICEA 1RZKC 4QRPE 1QFWH 1TJHH 1G0YR 5GSVB 1GXEA 1DLHB 4LMQI 4MD4A 3TN0A 2E27L 5DJ6B 3DVGB 1QFWL 4OFYD 3G6AB 5ITBH 4MNGB 1ZKAA 1DVFD 5IMKA 2XZAL 4CBPA 1CL7L 4ACPA 3RWJA 1T5XB 4M6AA 4JZJA 4PR5A 5TFSH 4PGDA 1G7HB 2GTWA 3GMMA 3HLAB 3OX8B 5MERA 1YYMH 3AFLA 2BZDA 3KPNA 3S88L 1KPVB 3MRNB 5LGJB 3NCCB 4KTDL 5FOBB 4OCNC 4Z76A 1XZ0A 2H8PA 5CP3A 2DBLH 2IFFL 1MCCA 3L3KB 1P69B 3BKCL 4N0YH 3DX6A 3HE7C 3KPLA 3V0AC 3ZTNL 3Q1SL 3HR6A 4HJ0C 1PKOA 4N1CA 3TFKC 4JPVH 3WO4B 2ZZUT 4HFUH 3KYAA 3WUWA 3QDGB 1CICB 2GCYA 4HZAA 3WN5A 2QQKL 3VD7A 1NDGB 3RL1B 4QGTA 3DECA 2X7LB 4M43L 1BZQK 4HWBA 4TUJB 4L3EE 1T7YA 2P44B 2CDGB 4HK0A 5CEXB 1EFQA 5FM5M 4GBXB 2GK0B 4GRLB 4S1RL 3QUKB 3FQNB 2WBJB 3O2DH 4ZD3H 3MJ7B 3HFML 3THML 3T0EE 1SEBA 4NNPH 3C60B 5DHXB 1HH6B 5LG1A 2F54B 3K8LA 5I71B 4UU9B 5C0GA 2WQRA 1L9MA 2F58L 3C87A 3S5LG 3OKMB 3MOAH 5CEZD 1W8OA 4MQTB 3AGVA 2YD9A 4WHYH 1GZPB 3QRGH 4PJCF 5E1AB 3RIFK 4X80H 1G7IB 2EDOA 4LHJB 3BO8B 5GXBB 1JPSL 2B8OT 4ONOA 2VDLL 1AR1D 3FAWA 1F4XH 2EYTA 1DUYA 2E9WA 2ORBL 2DL9A 5IVXE 4X5WA 5F7KC 3DX6B 5IFJA 2E9IA 2LABA 5AG8A 3T2NH 3R1GL 1HKFA 1L7IH 3ARBD 3LMJL 4F7EA 3TNNB 3S4SB 3BD3A 3FFCE 1CFQA 1OAYL 3D9AL 1TNMA 4LCIL 5E8DH 4UT6L 1MFAL 3L3GB 4Y4FD 2PO6B 3IU4H 1MJJA 4NFCA 4OZ4A 2P7TB 1EEYA 4P5KA 2J8UF 1WCBA 3TZVC 4MWFB 1KSRA 4XP4H 4QYOA 1I7UA 4OTXL 1N3NA 1CK0L 2IBZX 2LQRA 3ZDXE 5HDBE 2X5PA 3MUGB 1S9XA 4X9BA 2XWTA 3PV6A 2A77H 4N5EC 1RUQL 2IBZY 3AAZB 4MA7H 3RIAK 1Q9OA 1MFDL 5C0EB 4YGAB 5ESAB 3T0VA 3UTSA 3O2DL 5E4EC 3U0PB 1MCKA 4M5YL 1T2QH 5LCVL 1WFOA 5EORL 3M1BB 3DNKA 3FFDA 3MLZH 2VDQL 5EU6B 2X9WA 2EIBA 4Z9KB 3EYFA 4UUJB 2MPAL 5DSCA 1YN7B 3SHSA 4UOJA 4RIRA 3OR6A 3QZWA 4OFDA 3PWVA 4J3XA 1YC8A 5K59F 3RNQA 4IJ3C 3VGDA 5BW7A 5C0CA 3ZT6A 4WJ5B 2F5AH 1OTUD 4HC1A 3CMGA 3T2NL 3CFEA 1GGCH 3SE8L 2N7BA 1IC7H 5F6HI 3JZ7A 4LASL 1T83A 1GGUA 3SY0A 1N26A 4AENB 1XCQA 1KLUB 4KKCC 4E41D 4KI5F 2IG2L 1RAMA 3JSSA 2JB6A 2RJMA 3OAZK 1PY9A 3F7YB 1ZSDB 2ENYA 5FM5O 1F11B 3IGAA 4YK4C 1NAKL 2HH0L 2ZUYA 1N3NB 3ARBB 4LHUD 3VA6A 5LWYH 4G6ML 4M9PA 4WWKA 5I2IA 2WLYA 3TT1H 4X6EB 2V7NA 1K4DB 5CJBA 4PJBB 4XMLH 1UYWH 2FJHB 2P5WA 1X5FA 4DN4L 2KPNA 4LFHG 3T0EC 4HZLA 1JRHH 2JJSC 1KB9K 1FP5A 5GGSA 4PV8A 3FQTB 5DK2B 4P2RB 1AGEB 3ARTA 2FGZA 1R24B 4YXHH 5KVGH 4ZUTB 1QSZA 2JJTA 1JE6A 3NIFF 1FIEA 1YJDL 2ZNWA 3KPSD 2YZ8A 3CDCA 4N8PA 5IT2L 2OTPA 3WFZA 4OQTH 4CMMA 5BRZB 2YZ1A 4RAUB 4F2MA 3MLVL 5D1ZA 3SCMA 5L7XL 5CJOL 1T7XA 4PRPE 3DRQB 3DVFA 4L4VA 3PWNB 5BV7L 3MRFA 1MHPH 4R7NA 5ALBL 5FAAA 3S88H 4JFYB 4N0RA 4M7KL 1AJ7H 3Q6GL 4WDIB 5I75C 4NQDD 1QNZH 2IEPA 5C0GB 4OIAA 2GIYA 4F9LC 4CDHA 2EEAA 4APQC 2OMNA 4Q74A 3PDOB 4F7PB 1B88A 2A9NH 4LPYA 4MDIA 3A6BH 4G3YL 4NO3B 3HC3H 4LVHB 1MREL 1ZS8A 3MNWB 5JUEH 3N06B 1N6QL 5JO5A 2V5MA 2H32B 2CKBB 1S9XB 3SDYH 1H3XA 5BV7H 1QLRA 3MMEB 4LCCC 3I84A 3QIUA 4KHXL 2RCSH 1HHIB 2FWOB 3QO0B 5I1AB 5A16B 2APWA 1XR8B 3S36H 4EUPA 4IHOB 2C3GA 3MLVH 1HHHA 2NY5H 4QXWA 2ZSWA 3T0AA 4PJFA 4ODSH 2I27N 4Y8AA 1SYSB 1KEML 1TQBB 4X8JA 3CK0H 5HPMB 3MLSH 3O3DA 5EOTB 5IB5A 1OGTA 4P3DA 1PLGL 1ZHLA 1HI6B 3MO1A 4MLSA 5AD0B 3MXWL 4KDTC 4GRMB 4I3GA 4Y4FA 3G6DH 4OGAC 2YPLE 3INUL 4POZC 4N8VG 4PTUB 4BJLA 3GSNB 3PQYA 2V9RA 4FMKA 4FQQA 1LO0H 3BHBB 1NMCB 1JZ4A 4ZTPL 5IB4B 4I3SH 3WXWL 1P1ZA 2OR8A 1P7KB 2DLHA 5J3HC 3DVGA 5FGBA 4JKWA 3BP5B 4JFZH 3BPNC 2EO1A 2BSSB 3QUXC 5GGVH 4JRYB 1PZUB 1P4BL 1CLOH 2DMCA 2XXCB 1KJMB 4JZJB 2AK4B 3L5IA 3N1GC 3TIEA 1LP9E 3WLWD 3LEYH 2HVJB 1I9JH 3O3EA 3EOBA 2OP4H 4FQ1H 2CKBH 4X6FA 3LY6A 2W0FB 4MA8H 1K6QL 3L3KA 5D2NE 4PRHD 2X4PA 3L1OH 1U8JB 3LN5B 5HPMA 1J05A 5IK3B 3D5OF 4CUCA 4WU7A 4HUWB 1RK1A 3OZ9H 1YEKL 4X7TA 2CLZA 3KR3H 3QPXH 1R24A 2Y07L 1MRCH 5HBBA 1MQKH 1ZT1B 2EKJA 5T5FH 2FD6L 5FA4B 3K4DA 3VWJC 1KCSL 5IVXB 3TJHC 4OCSH 3ISWA 4TUOA 3GSNH 4ZFZA 3PWLA 4OZFH 4M3JA 1UWGH 1A6VH 4K3JH 4L4VB 4HX1B 3BYYA 3FO1B 3VA2C 4YHLL 2APTA 3UTTD 1RUKL 4WNQA 3FAXA 5BO1L 3DIFA 3NA4A 1AGFB 3MV7B 4HBCL 4XVSH 1S9WA 1AO7A 3P77B 4JFFD 3VFRA 1TJIH 1AD9B 1P2CB 5JLZA 2J88H 4MNHB 3U82B 3A6CH 4PG9A 4RDQG 2C4XA 3L7FA 5JO5B 3K80A 1UWXK 3RVVC 5FYLE 3C60C 5I71C 4NJ9L 3ULSA 1YC7A 4PJ8B 3QO0A 5CAYB 1NDMB 1AXTH 1C12A 2VXTH 4OBSA 1E4XH 2ADIA 4P23A 5HGBA 4NHUA 3BAEL 3KPQB 1UJ3C 4R3SB 3GNML 4PRAA 3CXHJ 3MRFB 2NY5C 1BQHA 1YMHA 1ZANL 1NQBA 2BOCA 1FVCA 3K8KA 3WFHA 2ZCHH 3LS5H 1ZMYA 4Z7WF 1KJ2L 2PR4L 5DJ8B 4ZXBC 5HYJE 1RZ7L 1XIWA 2FECI 5BZDA 4RGOL 3FKUS 1U3HD 4DVBB 5EO0B 4XAKD 1REIA 3TCLA 1FYTA 2JIXB 1ERNA 3B43A 5C86A 4LHUB 4M6OL 2X9XA 1JF1B 3O6FD 4HG4J 1YUHB 2IANA 3TA3D 1HINH 1TDQA 4OUUB 3UYPA 4NSKA 3HC0B 1XGRA 3I3EA 1MY5A 4JDVB 4XXDA 5EU7C 1JYWA 2XWTB 5C0BD 1F3JA 4NN6B 3THMH 3D2UD 3GJFK 3OB0H 3MJ9L 3ETBF 3TBSB 5C08D 2JE8A 3UTQB 4JFDE 3MJ8A 4MXWL 3IETB 5ITFA 3MV8D 1E4WL 1F4YL 2LAGB 3WNLA 2HRPL 3QNXA 2MHAA 3V6FA 2HLFD 5MI0C 3HR5B 5FFLA 1ZTXH 1KPUB 4R4FL 5CZVL 1R5VA 3IAGC 1MWAL 2O93L 3QO1B 4RA3A 4RFEB 3PWVB 5DD5H 5TDNB 4HJJH 3KPSE 4WY7H 2BHZA 3MFGB 5GGQL 3LN5A 4DUWA 1JHLL 4YEFA 1GSMA 1NGQL 3MFFA 2E5EA 5JQ6L 1OW0C 4PJ9B 5HDQL 4X5LA 5J12B 5IM7A 1OWRM 2YMXL 1GOHA 3FFCB 3H3BC 3WSQH 1YEFH 4DKAA 4OD2B 3LVEA 25C8L 1G9EA 3WFDH 2YPLB 2FL5B 3WHXA 4JFQB 4NKMB 3V0WH 3MOBH 3RAJH 2MTPA 4PGJA 2KH2B 4DTGL 3RVTD 4LSTH 1K8DA 3M8OH 5AZEH 3T4YB 1DDHA 3B3IB 3HRZA 1KGCE 2QSCH 3QNYB 4ZUUB 1KCRH 1FYHB 5D1XD 4JO1H 5E8OA 5KSBE 1RMFH 3CFCL 5DMJB 1EJOL 2OJZH 4M6MH 2W0PA 1CT8A 4MJ5B 3ET9F 2XRAH 4RISL 3GHEL 3RVUC 3DI3B 1R5IB 2VSDA 3GHBL 3MRCB 2DJUA 1RJLB 3BZFB 2PXYC 3KPMA 3I6LD 4LFHD 5I18H 1CFVL 1FL3A 1QO3B 4ZS6C 2XZCL 5FGCB 5IM7B 5CIPH 3BEWA 4P4RA 3IFPB 5SWSD 2MMXA 3H9HB 4M8QA 2AV7A 1G9ML 4M1DH 4U1GB 3TCLB 4P2QB 3MRBA 4XB8A 4DEPC 5KSBF 4LRNH 1NC2D 4FQ2H 5CSZA 1H9VA 1QBBA 4F9PA 2Z91B 1RURL 5EU3B 1U93B 1RMFL 3CFCH 3BPLB 2H8PB 3UTPE 3CCHB 4HUKB 1GGIH 2WQ8A 3NCBB 3DV4B 3ZL4H 1MCRA 3ECBA 1T80A 4NO2A 1XR9A 2UY6A 4XVJL 2HJKA 1CT8B 4MJ5A 3FN3A 2NZ9C 4GKSA 1I8KB 3UROR 5BVJA 3MBXH 1YY9D 2DKSA 3PHSA 1ES0A 1P84J 1YEJL 1WQVT 2J4WL 1ZA3B 3RWDB 4XNYH 4JFHD 4MHHG 4RMTA 2HTKD 5A2FA 2CK0H 4ZPVB 3OB0K 4NO0A 4GMTL 3PWUA 4TOYL 4RSVA 3BW9A 3MV7D 4F37F 2R2HB 1B9ZA 4NN7B 3EBAA 1NC4A 4RDQF 2Y4SA 1S9YA 5EUOE 3Q3GA 4Z0XB 1N0XH 4LPCA 3RRQA 1SJHB 2WIIA 1QFWM 4LLVA 5D7IE 4FG6D 1W8NA 3FOMA 3IDIA 2KDGA 5CCKL 2NY1C 5DD5L 1YEGH 4WENB 5ACMA 4RBPK 3ZKQD 1CXLA 4HXAH 4X6CF 5T3XE 3U9PH 2MKWA 4JN1H 4NC2B 2XIDA 1H5BC 4V1DE 1F4YH 1AO7D 3EFFA 4LSTL 3P2TA 5B3JF 4ZQKB 3VGAB 1RU9L 4U05A 5TDOA 1A4JA 3MRMB 1BBJB 3GUTA 2OQJA 4I1NB 4I2XE 3UTTA 1VENA 3IXAA 1M7DA 3C09C 4XMKH 4KK6C 3C9NB 4NT6B 4FQXC 1EEUA 2VITB 3AROA 4OCWH 4ODBD 3B9AA 3OB8A 9CGTA 1MHCB 3ULUF 1C08B 4HUVB 2IAMC 4WWKD 4K94L 2GJ6B 5TE7L 3B9DA 1AKJD 1WISA 1CTNA 1QP1A 3QWQB 5I1GL 2NLJB 5I1LB 3PIQA 5HHMD 3QEUB 3BW9B 3BUTA 1A14H 5F96L 5FXCH 2VN4A 2F8VA 3O4LD 1RUML 3OPZH 4I0CC 2B1AL 5IWLC 4PY7A 2NY0D 3UJJL 1Q9LB 3ZO0A 1SBSH 3G6JA 1NSNH 1AXTL 3DMMA 1BIIA 4GRMA 4QHNB 3QRFM 1G7PB 2AS5M 3EIFA 1A7OH 2A6JA 2Q76B 1CVRA 3U0TB 4LLQB 5F7EL 4L9LA 1LILA 2E6JA 4PFEA 4U1SA 4PGCB 4W81A 4UOW0 4OF7A 1MFEL 2NY7H 1A6UL 4NC1E 4H1LA 5EPMB 3BZFA 4Y5XB 2WBJD 3KPRD 4OGXH 4NHCL 3RX7A 2AJZA 3SO3B 4C4KO 5CKAA 4JGJA 2E7MA 2KZWA 1CE6B 2M26A 4NRZA 3LCYA 3L5HA 5FB8B 1PZ5A 4DVRH 2AKRB 3CDGA 1GHFH 4LLDB 1ORQB 3ZKNC 4D3CL 5BOPA 4WTWA 1TZHB 2VLKD 2I9LA 3FN0H 4U1JB 4XPFH 4OCWL 1UXWB 1SJEA 5INCA 2ZCLH 3PGFH 4LGRB 4OF0A 4DN3H 2FD6H 4JHAH 3VH8B 5HY9A 3RPIB 1OAXH 2DQFA 4D9RE 3PWUB 1W0WA 5EU3A 1NGXB 2EDBA 1XT5A 2Z92B 4KZDL 3OAZH 5TQ2H 5F1IB 3GMNB 3BXNA 4KI1A 4MA8L 4HXAL 2ED8A 1T5WB 4D0BA 1HHGA 4XP9L 4XNQA 1DQTA 1CFQB 1IAIM 4U6YA 4WFEE 1U9KA 3RGHA 1PBYA 1JGEA 3HHRB 2FSEB 1R3JB 3MLWH 1ES0B 4OCXH 4UU9A 4HD9A 5DDHA 1Q94B 5DJXA 4D3CH 5H2BA 3KLHC 4FQXA 2HJLB 4ZUWB 4NQEB 5JW3L 1J0ZA 5F97E 3NABH 3IDGA 3S5LA 5K93A 1ADQL 4MNQD 4YWGL 4AZ8A 3WIHA 1G6RB 1JGDB 4I13B 3QDMB 2D4DA 3BO8A 1KELL 3E8UL 1IAII 1FRGH 2VLLB 2PF6A 3IDUA 1DQQB 5I1IH 3H9YA 4UB0L 3FOLB 4LLAA 4OUOA 3LZFH 4LCUB 1IC4H 5T33L 1PLGH 5EOCJ 3SDCB 3H42H 3L1OL 3HNVH 2RIKA 3H9ZA 3MLSL 4YR6A 3H0TB 3ARZA 1IQDB 5I75B 3FB7B 4ODUA 4KKCD 5INDB 4HHAA 1AC6A 3OF6A 2Q6WA 2HAZA 3CUPA 4G5ZH 4UNUA 1FDLH 4XWOC 1N7ML 5IESH 5EO0A 5IB3B 4PPTA 1T21A 5E95B 2Q76A 2D03L 3RY5A 3TWCL 3BQUB 3CH1A 1J1OH 3VI4F 3QUYA 1IAMA 3IJHB 4XH2A 1CGSL 3WXVH 3BH8B 4XCYB 3S34H 1GCFA 1G9MH 1BLNB 1I9RL 1CZ8L 4NJAH 3LS4H 2NLJA 5D71L 5IB4A 1AY1H 1A3RH 1CXKA 3G5XA 3BMVA 4HFWB 1I1YB 4OB5H 4I3SL 3WXWH 3QYCA 3TO4C 2ZG2A 5FGRA 4ZG1A 4OLZL 3NFPB 5EO1B 4JLRB 4FQ2L 1LK3H 5KAQG 3QNXB 2ZG3A 1OAZL 4NPYB 5KZCB 3EYSL 3L5JA 1JYXA 3NZ8B 5I76A 5B4MD 3DSFH 1XGYH 5GJTH 4CNIA 4YGVA 1G1YA 5FYJH 4L4VE 3VD3A 3P73B 2HKHH 4KAQH 2W9EL 3LV3A 4OT1L 5C0DB 4C56D 3L3OB 2EYSB 1KCVH 1SEQL 2NY4D 1JMZA 3LB6D 4HIEA 1A5FH 1TVBB 3IJHA 4F3FA 4HWEH 1HOCB 3A6BL 3OKLA 4PJGA 3D3VA 5CHNB 2ERJB 3RJDA 2X10A 2GJ6D 4S1SL 4WWKB 5SX4I 1XF5B 2QSCL 4LDLB 3EO9L 4J8RB 2CGRL 2P5WE 1UKQA 3G5XB 3Q6GH 1G7LA 1JV5A 3L3JB 5EULV 1QLEH 1XAUA 3PUCA 4Y4KA 5ENWB 1KB5H 5DWUL 3GSWB 4JFEE 4AT6B 3S9DB 1FORH 4YLQT 4JHAL 3MGOA 1NC4B 1AIFA 1R3LB 2XQYG 5IMMB 4W70A 3SE8H 4MNGE 1WT5A 4G6AD 2G75B 3ES6A 4DFHA 1LK2A 5CZVH 3LHPL 3ILQD 3TVMD 5F1OB 2X7LA 4JR9H 5E9DB 3DGGB 5DMGC 3VFSB 4QXTA 5I0ZA 3MXVH 4WFFE 3VXPA 1QVOA 4X6CE 3EYVA 2XG4A 2VDOH 3UBXA 4KKAD 2Q86A 4ONHA 3R4DA 1P53A 4Y4HC 3O3AB 1TFHA 1WT5C 5FDWB 3IFPA 1YEIH 4YIQB 1BQHB 4I0KA 2XT1B 5DMYA 1MHHB 4PBWD 3DLQR 4TUKL 4FQLL 5I8OH 1EUUA