1H6FA

Human tbx3, a transcription factor responsible for ulnar-mammary syndrome, bound to a palindromic dna site
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
184
structure length
184
Chain Sequence
DPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription factor
molecule keywords T-BOX TRANSCRIPTION FACTOR TBX3
publication title Structure of the DNA-Bound T-Box Domain of Human Tbx3, a Transcription Factor Responsible for Ulnar- Mammary Syndrome
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 1h6fA00
2X6UA 2X6VA 1H6FA 4A04A 1XBRA 4S0HA 5BQDA 5T1JA 5FLVA
chains in the Genus database with same CATH superfamily
2GIMA 4MCZB 1MQKH 4P4RA 5AAMA 2H41A 3PJLA 2OJ1A 4PG9A 5LUMA 1I9EA 3QDMB 3RNQB 3UZVA 2XIBA 1QLFB 2XZQH 3QORD 5EO0A 3NT0A 2J8UA 1IEBB 4NZUL 3PJSB 3MOAH 1R1CA 4YHKL 2NDFA 3DHPA 3V0DA 4XCFL 4P2OC 1UXWB 4TL4A 3FKUS 2P45B 1DBKH 3N2JA 5GRJL 3WOVA 4G6KL 1XV8A 3NQKA 1MN4A 4NGHH 4BWTA 3DUSB 1FBIH 1ETZB 4AVIA 3KPSE 4L4TD 3QXDB 1SOSA 5K39A 4M6OL 1IT9H 3UEQA 1VFBB 5GS0D 3AS0A 1MNUH 3OHXA 4XWGL 3U7YL 1KGCD 3V5KB 5D1ZB 4KK6D 1TQUA 2MQGA 1KF9B 3R0MA 2Q6WB 1J5DA 5I82A 4J4PA 2VDLH 4X4ZA 5DHYA 4DEUA 4WHCA 8CGTA 3MRDB 4QWWC 2W38A 1WFIA 3I2CH 1IGYA 3OG4B 4HJTA 5ADOH 3BUTA 4YBHA 5JYLA 1XGPA 1CL7H 2CDGA 3QI9B 4N6RB 2BNRA 1G6RL 1A6PA 3FUFA 1ASPA 3EGXB 1KLGA 3IFPB 3B5TA 2OMYB 3D2UD 3QUMA 4JDEB 4X9IA 3RIAF 2TRYA 4D9LL 4QJ3B 1OCCB 4JCWA 4MXVF 4U1MA 5CEZD 1M3JA 1OY3B 1WS8A 4QRQB 2A9BA 2F18A 3G6JF 2HKAA 1KCSL 4LRIC 2D4FA 1XGUB 5I5IA 1M4KA 2L7EA 1IEAB 2DQGL 2XX0A 3CFDB 5FCUH 4LCWE 4ZMTA 3BKJH 3K4DA 3VXUD 1D9KD 3BKMH 5JOPE 1LJMA 2ZPKH 3SCMB 3W37A 4FFYL 4LVEA 1QASA 4YDLB 2MKWA 1JHKH 1V05A 3HBGA 3WHE1 4XPHH 2J12B 4C83B 4M7ZC 4TQEL 1K8DA 4JFEB 1RJYB 1E0OB 1AS8A 3CUPA 4JZOA 5K9KA 1NCDH 3BPLB 2EVFA 5JIQA 1CFSB 4OTXL 1PZ5A 3PRZA 3QDJB 5GSVB 4LL4A 2GI0A 4WUUD 2XACC 3B43A 3TEZA 1YO4A 4H5SB 5E6ZA 4ZUUA 1WT5C 2WBJA 5IM7A 1J1PH 3B9KD 3OXRA 4RAHA 2QADC 5D2LF 2CIKA 3RY4A 2X1OA 4PJBE 4UQ2A 5IIEB 3BRGC 2P5WB 5C2BL 5IVOA 5C07B 1QEWB 3IKCB 4MXWL 3ZDXF 1O9ZA 5I30L 1IGTB 1PSKL 2QSQA 3Q01A 3QZWG 5DVLA 2XTJE 3MLWL 3SPHA 2W1NA 1DVQA 1F58H 1EZVX 5C0DA 5IB1B 2UZYB 1WCBA 4WK0B 4UIMA 5IESL 1MFEH 1JN6B 5D2LA 4HKXB 1QO3A 3FONA 3DGCR 2EUXA 4HWZA 3SGKA 1KLUA 2QV4A 4NAQA 3F00A 1U33A 3FZUD 1NM9A 3OMAB 1T04A 3OKLA 3ZZSA 1VFAA 2Y72A 1G7LB 3VGHA 4J3OD 5IMKA 3UAJC 5AVSB 2O5ZL 3SE8H 5FFGA 2COVD 3KPPA 3MRFA 4OCLC 3DMMB 4RWYL 3TO4D 1MJJB 1YY8A 3N85L 3HBZA 5MEPB 4PFEA 3KLKA 4O58H 1NH6A 3LQAC 4IRJA 5H94A 1UUSA 4TL5A 5I6LA 5IJDC 3QUMH 1CXEA 2O5YL 3G5YA 4JRYA 4ALAL 1A9BB 3C8KA 1ND0B 3LZOA 1A6UL 3GHBH 3GI8H 4Y89A 1BF8A 1TEYA 1VHPA 4FKKA 5DK0A 3DV6A 3SHSA 5DMGD 3EYUL 3IJSB 5C0BD 1ZT7B 4FZ8L 4X6BB 1FPTL 4MDJB 1G0YR 3P1VA 4NSKB 5I71C 2VERA 1WA0X 2IWKA 2VLMD 1UYWH 2DH2A 3AU0A 1OXYA 3D18A 1IFRA 1YQVH 1A7QL 4F8NA 5DK2B 5DZ9A 1OAZL 4OIBA 2Z7YA 4BQBA 3A6CH 1ZAGA 1U2CA 2QVFB 3RWFB 3LOWA 4YJZL 5KSVA 5IROD 5IWLC 3NJHA 3KLDA 2R4SL 1Q0YL 3BQVA 2YLHA 3ZTDC 5SWZA 4BEIA 5E8PA 4M7KL 4G7RB 3BVNB 3V4VA 3U48A 3PV6B 1A2YA 2ZWZA 1I7RB 2RFXA 4OFIA 4DQAA 3S37H 1A3LL 4FXTA 2H9GB 3F83A 3IN0A 3SPVA 3C08H 2DBJA 3RBGA 2B77A 4FHBD 2C26A 1T0OA 3NN8B 1GAFH 4CDHA 5E5MB 4EN2A 1ZHLB 1VIWA 1CN4A 4XXWA 1YG9A 5C0JA 2ZUTA 1KBGL 1ZEAL 2P8PB 3HB3D 2B9AA 2R8SL 2XZAH 4TULH 1PNDA 3A3YB 4C4KO 2ARJB 2VO5A 3G7TA 5DYFA 3RWEB 2Q76B 3AU1A 1ZANL 3PXLA 4HGKC 3IGAB 4Z95L 3R7QA 2G60L 1NOLA 4N2KA 4PTUA 3FB5A 4LSPH 2RR3A 4S1RH 1NGYB 1OAUL 2Y6SC 5LDSA 2NQ3A 4LHJB 2VDLB 1AD9B 1Y7VA 5FUCE 5CP7B 4X7EC 3IT8D 2EINB 2CJ3A 5JDSB 4EI6A 3WKNA 5C0IB 2XA8L 3P30H 5EH1A 4XO9A 1BLNA 2BW5A 4LHQB 3MRNB 5C0AE 1E9PA 2XPGA 3GBLA 3BH9B 4MNGE 4TUOB 4Y19D 1NGPH 3BVDB 3PP3H 3V6OE 4ELMF 5A3IC 5SWSE 3GLAA 3MLTB 5GRYA 3EFDL 3STLB 4YQXH 2X6CA 2DBLL 1SVZA 2B4CH 4DH2A 2ORBH 1X5MA 1CU4H 5DHVH 1BJ1H 3VSVA 1DHKA 2DJ4A 2EEAA 3L1OH 1JGIA 2M2DA 4PW3A 4Z5RB 4JFOB 5T3ZD 1AKJD 2ZOWA 3EYSL 1YMMA 3QEQD 1IGIL 1EX0A 3PNRB 2ZXAA 2EC9U 2P80A 3LZPA 2NTFA 3MBXH 3ZPDA 4ELMA 2FBJH 3RDJA 4DGUA 3OAUH 1F5WA 5HJDA 1EJFA 5B1JC 2JJVA 1H0DA 4LPCA 5GRUL 2BVPA 4FN0A 4UAHA 1RERA 3ARWA 3B5HA 3WCYA 5HHQA 4AL8C 3CQQA 4F15B 4HCFA 1R47A 2X4TA 2BSRA 4LRNH 1CVRA 1UJ3B 3IU4H 2WV3A 1E2ZA 1FF5A 3L3OB 3VJ6A 2ROXA 1QSED 3DJ9A 2W59A 2W07A 1DBML 3SDYH 3CDFA 3C5ZC 3ZQXA 2HTLC 2OW6A 3BFQG 2AKRA 4P4RB 3X1FA 2IC2A 1X4XA 1BBDL 1G6RA 1TTAA 3DKHA 4PG9B 3LHAA 3HRPA 3UZVB 4RGMB 1OAKH 5EA0H 5CZVL 2J8UB 1JTOA 2VRAA 5M95B 3BLPX 2N1KA 2NRDA 4FQ2L 2ETWA 4Z6AT 5EBMA 1N59A 4QR7A 2GEQA 2BHFA 1C8PA 1FH5H 1DJHA 2H2PC 4OCSL 4AZ8B 4GAYA 1BQLH 1BJMA 1W8NA 2J88L 5K39B 1JF1A 4M5TA 2QQNH 3MRMA 3OHXB 32C2A 3HZVA 4ZSOE 5KS9F 2WO2B 4QHKJ 3QA3A 4WENB 4ZMYA 2DF3A 3FTYA 2X89D 2E9IA 4KDWA 5FGCB 2NZ9C 5DHYB 4H4NA 1RZJL 3PP3K 4N2EA 4S0TD 2Z4QA 1JVOA 3QHZH 4UT6L 3MJ6A 4N8UA 2X28A 1YEJL 3IBOA 4I3SL 4ZI8A 5I1DA 1T7YA 3FU8A 5DCCA 1XGPB 2CDGB 3FH8A 2BNRB 2HPOA 5B39G 3O8XC 4FABH 2EP6A 2H3NA 3FSAA 3P02A 1KLGB 1C7TA 3SBQA 5KS9A 1HL4A 3QUMB 3NBNA 3T0DA 3ZE2E 5IUSA 2AJSL 3D39B 2A1WL 4UYQA 2AMGA 4U1MB 4ELKB 2YS4A 4I9XA 3K8LA 1PJ9A 4QCIB 1CMOA 4NZUH 4YHKH 5DRXB 4MYWB 2BCMA 5IBLC 3W57A 2W81C 4XCFH 3KCPB 3ZKXB 4AMXA 5C8JA 4Y16A 1CDYA 5GRJH 3LXBA 4A2EA 4G6KH 2J8OA 1RSFA 4GLRH 3ARTA 1YAIA 3HAEG 1J87A 4YBLC 3P3SA 5E1IA 4HBCL 4JQXC 5ES4B 2FATL 4M6OH 1R4XA 4LCWA 4RESB 1K8DB 4XWGH 1GS6X 2GQHA 1D7CA 3CN4A 4JZOB 3U7YH 3VX1A 5K9KB 4PRBA 5DJ6B 4MJHA 3CCHA 1RLWA 1UHVA 4S1SL 1IM3D 2AJXL 2RIKA 3WFCL 1DLFL 2NXYD 2PPCA 4YLBA 3AY4A 3UPAA 3ZDYE 3QC5X 4EEEA 1SQ2N 3HZMA 1T1YA 3MA9L 1WQVT 4CADA 1CXHA 1JVKA 4ZUUB 1YEHH 2RAMA 2WBJB 4Z7QF 5HVGB 5IM7B 1G6RH 3OXRB 1FC2D 5KYUA 3WLBA 1T2XA 3UGXA 3LY6A 2OW7A 2ADIA 4F2MA 4D8OA 5B38A 1R5WA 1RY7B 1KCSH 3H3PL 1QI5A 5C08E 3MA7A 3OKEA 4JN2A 1DLHA 1EBPA 1F8TL 1KBBA 1FE8L 1WCBB 1ZXKA 5FYLL 3RGVC 5C0DB 1HH6A 3U2IA 1PLBA 5IQMA 5DUPL 4UIMB 4X9YA 1TU2A 1UGNA 4FFYH 1JNNL 2GJJA 5D2LB 1JPSL 3ZHKA 3VRLE 3SGJC 1QO3B 3EYQC 1E5CA 3FONB 4K3GA 4HZ1A 1KLUB 3CZEA 3RWCB 1T04B 3OKLB 3Q6GL 1VFAB 4TQEH 4EI0A 5D93C 3KBHE 2XJKA 3GFUA 5IMKB 4PD4J 3ILQC 2CDFA 3KPPB 4OTXH 3MRFB 4X8CA 3F6LA 2L7QA 4R4BA 1YY8B 4YVNA 3KGSA 1RUPL 5DQJA 2QTVA 3LEYH 3QFDA 4J28A 5EO9A 4IRJB 5ACMA 5H94B 4AKQA 4WO4A 5B4MD 3KWXA 1ZS2A 2HLAA 4GXUM 4L18A 3DO4A 5AVXB 5CZKA 3I6LE 1AGFA 3C8KB 4JRYB 1QOKA 4PJ8D 3VU2A 5T1LB 5HYSA 3KEDA 1JDDA 2EC8A 2X3CA 1IBYA 1LTXA 1PYWA 5D1ZI 4RGND 4F92B 1JYVA 4MXWH 4JGNA 1FJ1A 5I30H 1ML0A 1YJDC 4H8PA 2GG1A 1PSKH 1J1XL 3DV6B 4NQXA 1WBXA 1QWHA 2IAAC 5DHVB 3B9KC 2YR3A 3MLWH 3S34L 4F57L 3KL3A 5JNYA 3RBSA 1Y18A 2MWCA 5T1MA 4Y5XA 5GIRA 1MZZA 1QSZA 1QWUA 3BCDA 4JG5A 3WTUA 1S5IL 3LEXA 4M5ZL 1IBGL 2VSCA 5IESH 4KQ0A 1CGWA 5DHXB 5EEUA 3IM1A 3BH4A 2N3JA 1OKEA 1S5HA 2Z31C 4KROD 2VO8A 1RUQH 3D18B 3PREA 3EDKA 4JG0L 5G4MA 5D7JA 4R6UA 4DP6X 1ZV9A 5I5RA 5I17A 4WI9A 3HMXL 2F61A 2O5ZH 1THCA 4YH6A 2BDNL 4YNYA 4CU6A 2PWDA 1JV5A 5BO0D 4KXZH 5KSVB 4RWYH 2Y06L 3N85H 2VN5A 1D5IL 3HC4L 3LD8C 3EDFA 2DMCA 5SWZB 5E8PB 4J3OC 3OMIB 1BEXA 1CG9A 3QXAA 4IGBA 4GRWF 2GBVA 3K72A 5HPOA 4U7SA 2QPDB 4HAFA 2NT1A 2O5YH 5D7SL 4ALAH 3WAJA 2RFXB 3TO4C 1B0IA 3GSUB 1A6UH 1S7QA 1XGRA 4PJCE 4YSAA 1QLEL 4WO0A 1BYNA 3SPVB 4HKJA 1AXTL 3RY6A 1FPTH 3HJ0A 4QHMA 3D12B 1BPLB 1H8NA 2V9QA 3UJIL 3VD4A 4WSJA 5C0JB 3NABL 3V0IA 2P3YA 4C8XA 4G9DA 4PBVC 2XVGA 4JRLA 5DD6A 5F0PB 3AU1B 1GGCL 2VDQL 4ZZFA 3WXWL 2F8XC 1OGAD 2ZX7A 3RKPA 2HT3C 1OALA 4IS6A 4PTUB 1OAZH 3FB5B 4FNQA 4JO4L 5I6PA 2Y4SA 2PYED 3QCTL 2R4SH 1Q0YH 1Q0XL 2B16A 4F5CA 5DMKA 4WV1C 1BLNB 3ZT5A 3GZOA 1E9PB 4PS4L 2XPGB 4M7KH 3QGVA 5HI3D 3DTXB 4Q6YA 1P7HL 5DZLA 5DEJA 2QV2A 4QRUA 2HFEA 4GIOA 2KQMA 3BKYL 2B39A 5KYXA 2JJWA 5TPWL 2GIYA 4QKXB 2YAPA 1A3LH 3SYQA 3H6AA 2M83A 5D7LE 1PX8A 1UD2A 3F2LA 3V6OA 4U6YA 2UYLA 3IFLL 1MCBA 1YMMB 1RJLA 1T0MB 3KBFA 3GT6A 1U41A 3A21A 2KZKA 5J7CC 3QWRD 1MLBA 2NTFB 4ELMB 4WCYL 1KBGH 1ZEAH 3BWAB 1XIWD 2R8SH 4Q58C 1OHZA 3F12A 1H0DB 3E2HC 3MV9A 1PMYA 2ZP8A 5IF0B 2BVPB 4HXBL 3TH3T 3HPJA 2D3NA 5HHQB 4TRPL 1ZANH 1BIHA 3KVPA 3REWA 1JZ5A 4Z95H 4KZDL 5CSZA 2G60H 2YGVA 4FQXD 3P11H 4GKOA 4JY6A 2XG4A 1KNOA 4MJ5A 2DYPA 1OAUH 4U1HA 4UM9D 4KMTH 1XT5A 3VJ6B 2CLVA 4RMSA 1YAZA 4NQDE 2J1YA 3HIZA 1UXLA 5JW5A 1VFOA 1GJUA 2AKRB 1W6WA 3PLYA 1G6RB 2X3AA 3VNYA 1PLAA 3Q2NA 1NEZA 3EFDH 4MAUL 1DEDA 1KSRA 8FABA 2DBLH 2ICWJ 1MW0A 2QQKL 1DQTA 4PLKD 4TNVF 4X6CA 1L9PA 1FL3A 3WFDL 2WXQA 3QFJD 3KVQA 4JRXD 3O11A 2ESVE 3O41B 4KUZL 3AAZA 2VISA 5EBMB 1KCWA 1QMUA 1S9XB 2PCYA 1ZGLA 4JFQB 4UDUA 5T1DL 3EYSH 2O61A 4PVMA 4WWOA 2LFGA 4YHPB 1IGIH 4UQAA 4NN5B 3EHBD 4ONFL 4JN1H 3OXSB 1JF1B 5HDBF 3MRMB 5E24E 32C2B 3HZVB 1ILUA 3GTTA 3MROA 1PFOA 1TITA 3HG4A 1LK3H 5GRUH 3WNKA 1XTMA 5A6LA 1GJIA 3VGAB 3ZYIA 1J8RA 3NEXA 1IC4L 1PU0A 3KPSB 4PRIE 2AXFB 3CVDA 2WTOA 1HL9A 1YZZA 4XAWL 1IIIA 3GXUB 5I1DB 5BO1L 3UG3A 1E7UA 1HFUA 1HOEA 4G5AA 2YIHA 1DBMH 4M00A 1J18A 2FE0A 1OSZA 1RMFL 2F53D 2H3NB 3DHMA 4JLRB 4P9HL 7FABL 5KS9B 3A67L 1GYCA 1BBDH 3Q13A 3NCYS 5LB1A 3MYZA 2Z1PA 2R9HC 5JMOC 4E5XA 5CZVH 1ZGLP 5DT1L 1G7MA 3N1PC 5BUGA 4MZRA 4FQ2H 5C8JB 4Y16B 1DUYA 4JPKL 1HHGA 3HN3A 3NZ8A 4WLCA 4FZEL 1Z5LA 5D1QE 3ARFD 4OCSH 1CL7I 1EAPB 1Y6NR 3V4PL 4Z3IA 3AB0B 2J88H 5HHXL 3HRZC 4K9EH 4IRSD 4LCWB 4N0UE 4DP0X 5I1JL 2DIJA 3F7KA 3T1FA 4G11A 4PRBB 1T66C 3S8GB 1U2YA 3CCHB 1IAIL 3IJEA 4HLJA 2OSXA 4LVOC 4MB4A 5AW9B 3TFBA 2VMCA 5E1AB 3SO3C 9CGTA 5D6DA 1RZJH 1UENA 1GYWA 4UT6H 1YEJH 4GKNB 4I3SH 2WY3B 3SDAA 2V9RA 1LL1A 5F0LB 1EXHA 1EH9A 4R83A 3FK3A 3G6DL 1V7NL 3ETBF 3UTZB 2G30A 4YHLL 2CO4A 1AYOA 2G75A 1I4FB 4HUXA 3GTVA 1HXYA 1YC8A 4HFWA 2ZKWA 1WCQA 2AJSH 5CGYD 2JMRA 2A1WH 5IOKA 5FB8A 4NM8L 2ADIB 1R5WB 3T6XA 2WTRA 1XCXA 5D4HA 5JQHC 1P1ZA 3BT2L 3TTYA 3HG1E 4O9HL 1BOGA 3BPNB 3MA7B 3OKEB 4FTVD 1T0NA 4JN2B 2FR4A 5J6GA 1DLHB 3APCA 3B7YA 1HH6B 3KD4A 1U8NB 3BAXA 4AITA 2R83A 4F80A 4QRTA 1TU2B 1JXFA 3BP4A 1WFOA 3QR1A 3EIFA 4HBCH 3KYNA 4WU7A 2AXHA 4TUKL 2FATH 5C08A 4AJWA 4EQ3A 5EU4A 3V55A 4I88A 2VQ4A 2KDGA 1IRAY 4PJHE 5T5NG 2X0VA 5CLYA 3RILA 4CSZA 2NYYC 3RFZA 1AD0A 2VDKH 1FAKT 4WFFE 3FTXA 4R4BB 3WFCH 5DQJB 4M61A 3H9SA 1GRWA 2FJFA 4MA1C 3CFMA 1JHLL 3QFDB 3WJMA 4TTGA 5EO9B 4F2FA 4JFFD 3NEOA 1CWVA 3MA9H 3WDJA 2J1XA 4WO4B 1IC7L 4IKJA 1FLTX 2HLAB 4FMKA 1P84J 2XA3A 4BUGA 1AGFB 5HYSB 4DTGL 3FN3A 3O4OB 1PYWB 2NNFA 4G59C 5B1AB 4HJGA 3IU3A 1N7ML 4XN5A 1FJ1B 3CN1A 2X70A 4KQ3L 4NQXB 1WBXB 1L3WA 4U3XA 3VQ2C 1IC1A 4JFXA 2IDFA 3LIZH 4PJGE 4WI8A 3WUWA 4HOZA 4Q6IA 1Y18B 3H3PH 3ZYOA 3ZSTA 4FJ6A 5T1MB 5JIMA 1BZDA 3VFMA 3QWQB 4O51A 1F8TH 1FE8H 5F6HJ 5FYLH 3VFUA 1PEWA 3DXAE 1N2RA 3LEXB 3N3EA 3VFNA 5J1SC 4P2QD 3QQNA 5GGQL 1JNNH 2I26N 1PGRB 1JPSH 1UT2A 3C60C 3DK2A 4NZ8A 3T3PE 4BSWA 1N6VA 1S5HB 4G6JL 3OSKA 3RTQD 5D7JB 1DANU 3Q6GH 5A2FA 2D0FA 2VLRD 5I17B 1YPZE 3GPSA 5E9AA 2ZWYA 4FGMA 1DFXA 4YNYB 3BEVA 4EXKA 1JV5B 1KBKA 1ZVSA 1DQQA 3FQUA 3HZ3A 3SE3C 1SEBA 2FIRT 3CC1A 1RUPH 3TTSA 4JFDD 3ZBMA 3V4UL 3KBPA 3SBRA 3L5JA 5EUKA 3IGFA 1OCWH 2IGFH 2MCPL 5EO1A 3QXAB 1CG9B 2YEQA 3QJXA 4IGBB 4M03A 3SB3A 4Z23A 1TVBA 4Q89A 1BA9A 3K72B 1ZXQA 3S8FB 2IAND 3P0VL 3CIQA 4Y9FA 1GL4B 4EI5A 1NBQA 3FUEA 4GKZA 4ZYKA 1XGRB 1ZLDA 3HE7A 4X80H 1BQRA 2P44B 2L3BA 3N44F 2X53A 4F37F 1X9LA 4HUWA 1J1XH 1H6EA 4HKJB 2Q20A 4WUKL 3DK0A 3S34H 2P5PA 4DN3L 4F57H 2YXWA 1WJ3A 2VMJA 3QWOA 1AQMA 3T9WA 2EIMB 1NUFA 5E94A 3FB6B 3IDNB 3ROLA 4AQAA 1S5IH 4WFED 4K7PX 4JX0A 4M5ZH 1IBGH 3QCUL 2D3VA 3AROA 4G9DB 4HKZA 2LU4A 3WNJA 5DD6B 4JG0H 4FNLL 1KELL 1XR9A 5HP5A 5C97A 1AZBA 2YAFA 4O02L 3HMXH 4GO6B 4IS6B 1OHQA 4PB0L 2IDSA 2QGCA 4J3OG 2NNCA 2MMXA 2BDNH 4O2FA 3PNWA 4LLVA 3WO3B 4F7PA 2BIHA 1MCOL 3LVEA 4KROC 2RCSL 4NAMA 2Y06H 3BLKA 3S96A 5DMKB 1D5IH 3HC4H 3PWLA 3W11C 3JWDL 4HJ0D 4DO6A 3DVFA 5D1XC 2WP3O 5DVOA 5A43C 3MREA 4QRUB 4DFIA 1PG7X 2NY3C 1XGQA 2BX5A 2HFEB 4BRJA 1FNHA 3CFCL 5D7SH 4AW4A 5KW9L 4W9JC 3JV4A 4GG8A 1W16A 2IWGA 4DETA 5IHUL 1SN0A 3WE1A 1E9QA 2HUEA 1DSWA 3FULA 2V2WA 3FO1A 1QLEH 4MNGB 4U6YB 1AXTH 3RGBA 2UYLB 4P05A 4NB7A 3MGTA 2P49B 2KPNA 3TEXA 5JIIA 2H0JA 3FSVA 3UJIH 2OZ4L 1MLBB 1JAEA 4L37A 4OF0A 1NAKL 3NABH 3I9PA 4FS0A 5CGTA 3WXVL 5D7LA 4AJYV 1N6QH 3F12B 4L1SA 3HC3L 3MV9B 1GYVA 1JXJA 3LNGA 3D0AA 3HPJB 1GGCH 2VDQH 3BAWA 4AV4A 3ZE0E 4TQIA 4Z0BH 5B8CA 1EEUA 1NGQL 1ROWA 5CSZB 1JIBA 4JY6B 2CUMA 2IO5A 3CZFA 1KNOB 4MJ5B 3LB6D 4MXVE 2DYPB 2X89A 4JO4H 3B56A 3QCTH 1TPXB 4QOKA 2JKNA 4WTWA 3T0XA 1Q0XH 2HUHA 2CLVB 2QL1A 2NY0B 1EAJA 4PS4H 5JW5B 3QWNA 1MW3A 1JPGA 1J8HD 1NEZB 1ODUA 1U30A 8FABB 3BKYH 1DP0A 4HAKA 2XLLA 3F58L 1FFOA 3IXTB 4L2LA 4MA8L 1FL3B 4X6CB 4MCMA 5TPWH 4NQDA 4QTIH 5FYJL 1AR1C 3C2AL 1U42A 1X5GA 3O11B 1EQWA 3AAZB 5BOPA 2VISB 4JMNA 5HI3C 3VRJA 4AYFA 1ZGLB 4UDUB 5GRZA 3IFLH 2O61B 5INCA 3F65A 3QIUA 4WCYH 3V4PA 3GSXA 3K1DA 4UQ9A 2EIZB 2ESVA 1FZKB 2D0HA 4IDJL 1SF5A 1OZTG 1LNUB 3MROB 1W0YT 4HXBH 3OQ3B 3TIEA 4J3XA 4TRPH 5TDOA 1YY9D 4K9JA 3V8OA 4KZDH 5FDWA 3GEFA 1LYQA 4DP4X 3HLAA 2WLMA 3QDGA 4BYHA 2FLMA 3II2A 3OZKA 4ZSOB 3E6FB 5DJCB 1KUMA 4FQQB 1VESA 1MJUL 4P2RE 1KXHA 3ESOA 4MZIA 3MYJB 3Q5OA 4YHNA 4FQXC 4JL1A 3SQBA 5C9KA 5EC1B 2MCG1 1QR1B 4MAUH 1KG0A 2QEJA 1E28A 3ILPB 4PRHD 4E5XB 2QQKH 3KYOA 2ZUSA 3HHSA 4WWKA 3WFDH 1FYTD 1ASOA 4AQ8C 4KUZH 1DUYB 1HHGB 2X0WA 4D7PA 3ZE2B 3NZ8B 1J5IA 2OCFD 4WW1B 4B0MM 1Z5LB 1JZ7A 2YQBA 4M8VA 5T1DH 2QVKA 4GRMA 2MPVA 3VGFA 5LHDA 2CXGA 5GZOC 2J2ZA 3H56A 3S3PA 4CRPA 4ONFH 5FWRA 4AK1A 2GK0A 1TETL 4MNQD 3FO2A 5E9DE 3LKQA 4FXLA 3T1FB 3CHQA 5DMYA 5D1QA 4CMMA 3EJRA 3OF6A 4NJ9H 3IJEB 3DOSA 1IC4H 3WLWD 3UDWA 4ZMAT 4EDWL 3EHBC 4NWUL 4XB8A 4KNQA 6PAZA 3JQOB 4DUVA 2AK4D 4XAWH 2HVJA 5BO1H 4PJFE 4OFYD 1HCYA 1F6LL 5DS1A 4MX7A 4XR8C 4QJ4B 5HHMD 1RMFH 3WKQA 2GBUA 4HUXB 3FFCD 4P9HH 7FABH 3A67H 1R3JA 1B9ZA 2WBXA 1RUAL 3KS0J 4HFWB 2YPLE 2FJHB 1JZ2A 2IAMD 5FB8B 2P8MB 4HD5A 1E5UI 1KIRA 2GY7B 4J6RL 1BVKB 2WTRB 4PCKA 3GMNA 5DT1H 1P1ZB 5KANG 2J56A 4YHML 2YD3A 1BOGB 2FTAA 1PG7W 5E95B 3D05A 4NO0A 5IBUB 3VDAA 5J6GB 2FR4B 4JPKH 6PCYA 4P3WA 1MDTA 4M29A 4FZEH 5EFIA 3AM8C 2BVTA 5AD0A 5HDQL 4QRPE 4RMBA 3BP4B 3V4PH 2JH2A 3NFPB 3W0WE 4RVBA 1C8QA 4K0OA 5C71A 5HHXH 1EWHA 3KYNB 3O9WB 4WU7B 4XBEL 4AGPA 4AQ1C 5I1LA 5C08B 5IB2A 5EU4B 3U4EB 5I1JH 1HE7A 4KDVA 1ET8A 1NC2D 1BD2D 1PCSA 5DFAA 1YEKL 3KYAA 1WAPA 2ICEA 4W9KC 1IAIH 5E6SB 3TA3A 1AD0B 4UIKL 4UTAL 1HSAA 4H88L 2AC0A 4M61B 3H9SB 2IH8A 2FJFB 3CIAA 1KB5L 3EF4A 1YYCA 4IRSC 3LEVL 3WJMB 2FSDA 2B3IA 3QEUA 1AG0A 5DO2C 4PJHA 1HT6A 1TJHL 2P5EE 3AC0A 4ZX3A 5EPMB 3G6DH 3CLEL 1FVEB 2ADFL 2BP8A 1CGVA 4YHLH 1QZNA 3UROR 3BRFA 1DJZA 4Z7AA 1UM6L 3JBG7 4HJGB 3IU3B 3D85A 3QQ4A 3ULUL 2ZXWB 3PE9A 4NM8H 5AKRA 1RIHL 2Y24A 3NMEA 3KL5A 1LEGA 1E27A 3MBEA 3WN6A 4JFXB 2WVUA 1SJVA 3BT2H 3HI1A 4N0YL 3WUWB 4Q6IB 3FCGA 3MGOA 1JRHL 1QLEB 3D4GA 3EO9L 4O9HH 4X6DF 5AKTA 1YECL 4O51B 1AS7A 5J57B 3M1BA 4X6FA 3PWJA 4LDEB 4JHAL 1N2RB 2DLFL 1S7XA 1X7QA 2NCMA 2C3GA 3Q8EA 1MEXH 3ZK0A 3ZO9A 4YFLF 4BSWB 1XSKA 1X5YA 3CVIL 4TUKH 1MCKA 3BAIA 1G9EA 1UT1A 2NX5A 2QKIC 3CBKB 3TL5A 3TIDA 5E2TL 2VDQB 4OCRL 4TLKA 3DXAA 1FV1A 4AMWA 3BEVB 4LCCC 3FQUB 1ZVSB 1DQQB 3MHZA 3BGAA 4O02A 4X6DA 2AJ3A 5FUOL 2QELA 1NCCL 5F1KC 1JHLH 2C5DC 3OKDA 1C1EL 3NSXA 5EUKB 2ZUVA 1CYXA 5EO1B 3GMRA 1IC7H 2K1MA 4PGJA 4G1EA 1C12A 1TVBB 2CD0A 4DKTA 4EI5B 2X4NA 1G43A 4DTGH 4ZYKB 1S6NA 3AQYA 3MNVA 5I6KA 3HE7B 4M6NL 1MW2A 4GKSA 1N7MH 1VLXA 4Y4HA 1AE6L 2I27N 1SJMA 4KQ3H 2ZOLA 3KLAA 4XP6L 4FA7B 1HQRA 5E8OA 5EOTA 5IW6A 1IC5L 4CW1B 2R1YA 2CLRA 2JKXA 1UWGL 3BRDA 4OLVL 3KPMA 2OYKA 3W3BA 4LESA 1I82A 5CD3B 2JKTM 3ROLB 2CA3A 4AQAB 5KVEH 2O93L 3EH2A 2ZSVA 2VZTA 3T6VA 4EBQL 2H0EA 2OZ4A 2EDFA 4PY7A 3VFOA 4G6JH 4HKZB 2Y7QA 3UAFA 3FBKA 4R2GD 4XMTA 1XR9B 3DX2A 3GIVA 4CBZA 5E4IA 5D96B 4PWEA 3FQ2A 1XCQB 1OB1A 4PR5A 5DJ0A 5KZCB 1E4HA 1MCIA 5MI0C 2D7OA 4O2FB 3QS3A 4LPXA 4BKTC 3PNWB 1NEUA 1CXKA 4F7PB 1MVFA 2DV6A 3ZQ9A 3RTQC 3PWLB 3V4UH 4ZMZA 1T6WA 3F85A 2MCPH 1T4WA 5JW4N 2K4AA 2APBA 2C7UB 3MODL 3CLFL 3P0VH 3VXMD 3NAAH 5I6OA 5BCAA 2WOYA 3JV4B 4GG8B 2F68X 3RZCA 1E9QB 5CCGE 5JDJA 5IGXL 3DX1A 2M26A 2XXGA 3FO1B 1R33A 4WUKH 1MWOA 5AOMA 4KX8A 3WFZA 4DN3H 3MGTB 4HPHA 3V52H 5HYFA 2HG0A 5F3FA 4QHNA 4L37B 1J1OL 1XGYL 3EXLA 2X40A 3VD2A 5D7LB 1IC0A 3QCUH 5CMAA 2VKWA 2JE8A 1CB4A 1XO8A 4XOEA 3T08A 2VH5L 3KXFE 4Z0XA 4AJ0A 5KSAB 4FNLH 4XGZA 1E6JL 1KELH 1NANH 3CX5J 3DHUA 5B8CB 3EBAA 3ZSSA 3C6SB 2XZZA 4O02H 4H8HA 4ODSL 5GPRA 1D7FA 2R0ZL 3CZFB 4PB0H 3UMTA 4LASL 3ETBJ 4HEME 4ODXA 1ZV2A 1KPRA 4QOKB 1CIUA 1MG2C 4P04A 1MCOH 2RCSH 4PJAE 3X1BA 2DQMA 3U4KA 1QUPA 1KTLA 5INDA 3MV7E 2WQUA 3JWDH 5J11B 2YZ1A 4FERA 2QZ5A 1JCKA 1ZVNA 4FKEA 3O4LD 4CVWA 1B2WL 3LQAL 4IOIA 1A4CA 2D3JA 2F53A 3CFCH 3MC0A 2A0LD 1F3JA 3MUJA 3QNZB 5GRWA 5LGYA 5KW9H 2F54D 1RULL 4AC4A 1IB5A 3CH1A 4NQDB 3KJ6L 1T7WA 1JD9A 3V4LA 5GJSL 3SDDA 3X17A 2ZOUA 3P4OA 3VRJB 4AYFB 4M8QA 5INCB 5I0ZA 1WAAE 1WC7A 4NLAA 3GZQA 2OZ4H 3WNIA 3QIUB 1NAKH 4XMVA 4ANXA 5F8RC 5KBPA 3V4PB 3GSXB 2ENPA 4FQ1L 4N25A 3WXVH 1GPOL 2ESVB 3HC3H 5B3JF 2WXPA 2Y3AA 3TIEB 4EOWL 1DJIA 5TDOB 1NGQH 4JB9L 1QX1A 1XF3A 1LM8V 5FDWB 4FLHA 3HLAB 1RKRA 2L8AA 4Y1AE 2G9KA 3QDGB 1OAQL 2EDEA 4I0CC 2CM6A 4W6XB 1F00I 4NC1C 1A25A 2X4SA 3TOPA 4P23D 4G8AC 3SD2A 3BZEA 3O3AA 3BVTA 5E0QA 4YHNB 3FU9A 1EFQA 2FBOJ 3EYFA 1ZV5A 5CKGA 3WNNA 3LB6C 4XN7A 3SQBB 3UTPD 1SUJA 4A7VA 2ZNXA 3TH2T 3ARGD 1KG0B 4J3TA 2XPZA 4QRAA 1E28B 2BERA 4MA8H 1DJYA 1RIVL 3F58H 4LZKA 3HHSB 4WWKB 4R0LA 3AWFA 1TTFA 3Q2CA 1NICA 5AB0A 3WIHH 2IVFC 3C2AH 1Z3RA 3DX6A 5DJ2A 2XICA 4MAYA 3OHMB 3H53A 4XPAL 2D7NA 3MPCA 5D70L 2EILB 1PDKA 4UAOB 5DFVC 5CSBA 1KXVA 3IJYA 2J2ZB 3P9WB 1P5UC 3HS8A 4XP4L 3W9DA 3B4NA 4S1DD 3CX2A 5L8KB 1TQCB 2KS0A 1JZ6A 2GK0B 5ILTL 1N64L 4L8SC 3FO2B 4JANA 4IDJH 3VTMA 1RHHA 1X6NA 5D5MF 5HSFA 2VCOA 1G94A 1X5KA 4F93B 5D1QB 5DFTA 1K8IA 2D8KA 3MACL 1GOGA 4HPOH 5C86A 4WSGA 3R19A 1L0YA 5G2NA 3ZGHA 2HWZH 3ULUF 4EDXB 4M3HA 2HVJB 3CFIC 4JAMB 4UTAA 1JUFB 3BQUA 5LNEA 1GZHA 4DO4A 5AYQA 1DJXA 1KB5A 1KLFA 1AI1L 1MJUH 1YEEL 3B2DC 2XKUA 4JFFA 4GQ9H 4RRPG 5D5MA 2B2XL 1M2VA 1R3JB 3P2BA 5FLVA 1A6AA 1T2JA 1SPDA 3BEWA 3OPZH 1I8LA 4PYGA 1KIRB 2BCKB 5T3XL 4XNMA 2J6EA 5BRZA 1FP5A 1XTLA 3D8MA 3T8VA 4NO0B 1ZLVH 3BC9A 4OU3A 2F5BL 1OSYA 4AENA 4HWUA 2YPLA 1P7BA 5EFIB 2FNWA 1NWOA 4RGOL 1CS6A 2VOTA 3ARDD 1DBJH 1DDHA 5I1LB 1CVSC 3HG1B 3WL9A 1HU8A 2YHGA 2OQJB 5TGBA 5IB2B 2IH9A 2GTZA 3OJMB 4WVRA 2WQVA 1M7DA 1SEQH 4NO2A 2ICEB 5CLZA 2FSEA 2Y7OA 4QRPA 3DUHA 1HE8A 4X5RA 3TA3B 4XRCB 1HSAB 3ARED 4GBXA 3HC2A 4NWUH 1ZVHA 3GB7A 1CLZL 3UABA 4AL8L 2CG9X 3QEUB 1KACB 4PJHB 5J06A 2XNAA 2CO7A 5F7FA 2H3XC 2B5IC 4FNRA 4R90L 3D3VE 1H15A 2A77L 1DYZA 3FMGL 5HHOD 1RUAH 1WUNT 4ZAKC 4FNPA 3D85B 1U3YA 3QQ4B 2Q9OA 3P2TA 2X88A 4GRLD 4PLJD 4AGMA 3PQYD 4HUUA 4J6RH 4KRPD 4L4VD 1K72A 1U9KA 3H8NA 1LEGB 2P5EA 3MBEB 4JW3A 3RVUD 3WG7B 5CAYB 3IGKA 3JV0A 5DFWH 4B27A 4YHMH 1ZCRA 4Z7UA 2WUBL 1CFNA 3IE9A 3M1BB 1YEIL 3MLPA 3PWJB 1MIEL 1OAXL 1U58A 4P4KA 5IKCB 1WFMA 1IM9A 5HDQH 3FQYA 5A2IH 1JGUL 1S7XB 1X7QB 3CZJA 1BVNT 4EJ1C 1NCGA 2BO0A 1XCTA 3PDDA 4XBEH 2NX5B 4OF3A 3SPIA 1WFTA 3P73A 4OUOA 3TIDB 3US9A 4Z7NE 2Y23A 2IH3A 3DXAB 2VM4A 3L3HA 1FV1B 4G8GE 1YEKH 5F7NC 3QZWB 3KL0A 3T71A 4O02B 3WTXA 1OT1A 2VZOA 2AJ3B 3K6OA 4L4TE 2UZPA 4UIKH 3T3PB 4H88H 4RQQA 2BZDA 2D7MA 5AVRB 5C09A 4RETB 2C1OA 1KB5H 3NJMA 4Y7OC 3OG6B 4BFIA 3OKDB 2X2UA 4NN6C 1KGCE 3GMRB 1T7VA 1TJHH 4G1EB 1C12B 3L9EA 4XB3A 4OCYL 3CLEH 3QAQA 2ADFH 1M6UA 1T1ZA 4YGVA 3C12A 2X4NB 1ZLVK 2Y2WA 2IOIA 2WO4A 3MNVB 4OF6A 1UM6H 1FG9C 3ISRA 4GKSB 5ID1B 1A7PL 4Y4HB 4Y4KA 4FQLL 5DTFB 1WT5A 3L4WA 3KLAB 1BQHA 1RIHH 1HQRB 5E8OB 5IW6B 4M02A 3NSYA 4NENA 3S98A 2D31A 4K94L 4N0YH 3MCYA 2R1YB 1JYNA 1JRHH 1WZKA 2CLRB 3EO9H 4K71B 1YECH 4UANA 3ARBD 4PJ9C 1XH2A 2QR0A 3CN0A 1E43A 4JHAH 3WYRA 2W5PA 4ZNEA 3W39A 5DHEA 5CEZE 5BS0E 4QF1A 2VLJA 2ZSVB 3N0AA 4H0IA 4B41A 2QQQA 1HSBA 4FG6D 4PY7B 3VFOB 1II4E 2Y7QB 2AJUH 3CVIH 1CQKA 1DCLA 3GIVB 4NERA 3VXUE 3ULVC 5E5UB 1OB1B 2HCZX 4PR5B 5DJ0B 5B21A 3F7YB 5F9WB 5E2TH 5E70A 2N7SA 1ZPUA 3B34A 4F8OA 2QLYA 3CG8A 1MCPL 1YEGL 5FUOH 5HYJA 2J5LB 3C6LD 3OKOA 3HAEH 2R7EA 1NCCH 3NFNA 2H47C 1C1EH 2EYSA 3UAJA 2VN7A 2VDPH 5EEVA 2FQDA 1WYJA 1JGVL 4LLUA 5A16B 1VFMA 3MKGA 3L3JB 4MMZA 4XT1C 2FYYA 3PABA 2A4ZA 4WUUE 1EFXA 1JMZA 1QI3A 3RZCB 5HDBE 1ACCA 1AR2A 1WFJA 1K4CA 1AE6H 1UZ8A 2Y1AA 3EH3B 4XP6H 2MTAA 2MNJB 5EEYA 1UT9A 2IDTA 3QNYA 1IC5H 4LPWA 2A7BA 4ZQKA 3QJHA 2DN7A 5C3IA 4IK6A 4QHNB 4PJDF 3WHE0 4JM2F 2E8ZA 3LKPB 4EBQH 1JZDC 5KAQF 2OMXA 3BHBA 4E0RA 1ETJA 3UZEC 4XGZB 2GSMB 4F2EA 4OLUL 2BW4A 2ZUWA 4HIXL 1BXAA 2R29L 4W9CC 2CU9A 3S4SG 1Q9OA 1E42A 3PGCA 5I6XB 3N41B 4RA3A 1EVTC 4ODXB 1KPRB 1N8ZB 1LMKA 3UZQA 2B9BA 5ICXA 4LSVH 1I7UA 4PJDA 4R2GC 5AVYB 3ECBA 1KTLB 4JM2A 3ZE0B 5LLIC 1RU9H 4XI5D 4Y5VC 1SJHB 1NCJA 5E2VL 1X5ZA 2Y0SA 3MODH 4NP9A 5IWLA 4IOIB 1AZVA 3CLFH 2Y9RT 1F3JB 1HNFA 2PF6A 1GGYA 3CH1B 2VKXA 1L9MA 2GITA 5CZRA 4DPCX 2ROYA 5B3SB 5IGXH 3L3IA 2YJLA 5CJ8A 3SDDB 3ARSA 4ZDHA 3P4OB 1W80A 1LHZA 1FCGA 3SO5A 3GM0A 4M8QB 5F7YC 1GHFL 5FYKD 2HMID 5JHDA 4OKVA 3VD1A 2IWEA 2C9XA 1O7DC 2MEJB 1J1OH 1XGYH 4A7QA 2WXFA 3GRWL 1H8SA 4I13B 5BW7C 2Y07L 4GINA 5C0BE 3WIAA 2VH5H 1E6JH 3MSPA 2EABA 1EEZA 1XF3B 2UZIH 4YX2L 5JHLL 4ODSH 1AYRA 2VLME 3GLDA 2R0ZH 4KK9C 4TVPD 5EZLA 3RHWF 5HYQA 3HE6C 4LASH 3ABZA 5BVJA 1W9XA 4RAUA 4M3JA 4Z18A 1ZA6A 4ZJ9A 3Q7JA 2VR7A 1U6AH 4M4PA 2A6DA 5CLTA 2X4SB 4LNRB 2OCJA 3BD4A 4RX4D 1L9NA 4AVJA 1SZNA 3O3AB 3NJIA 3WBDA 3EYFB 1SXCA 3HN8A 4FNSA 3EGDA 3IFOA 4Y8DC 1B2WH 3HTLX 3LQAH 1G4RA 2NY5C 3LS5L 4HHGA 4KXCA 3QUYD 2BXYA 3FFCA 4Q9CA 4NXSA 1RULH 4P8QA 4R0LB 3R4RA 4P2RB 1O6TA 3KJ6H 3LJ3A 5HDLA 5GJSH 4MAYB 5DEFA 3PPSA 3FCBA 1FLRL 4RIRA 4KKZA 3LZFL 4BE5A 3IJYB 4L1BA 3W9DB 4EF3A 4X5LA 1YMHA 2ZF8A 4HJIA 3NZHL 4FQ1H 2JB6A 5JHMA 1GPOH 4OUUB 4JANB 1TTUA 1RHHB 1EUTA 2D0GA 2JJSC 3IRCA 4WI0A 3ZRCC 4NFCA 1WEJL 2OYPA 1K8IB 3FT9A 4ATTA 4JB9H 5H4ZA 4FI8A 4G7QB 4FFTA 4J3SA 4PIRF 1OAQH 1UEYA 2H45A 3BQUB 4YHYB 1KB5B 1KLFB 2HKFH 3C87A 5BV7C 5LBVA 2XKSA 4HLEA 3IPFA 2J6WA 4EO5A 1FI8C 5D5MB 3KPRA 4I1RA 1XHHA 2J72A 3FQNB 3QJTB 4KV5E 2ZKMX 1A6AB 3BEWB 3EFOB 3GMPA 3WJLC 4AOFA 5IFAL 1RIVH 2FH6A 2GHZA 3C5ZA 1F4WL 1USQA 4GS7B 5BRZB 2R4RL 4I48A 4Y19E 2VW6A 4JG9A 1OQOA 4M93C 4PGCA 1S78D 1UZ6E 2EDRA 4AENB 3ZDZE 1A65A 4XPAH 2K7PA 2YPLB 5D70H 7PAZA 3FQXA 1LQBC 4XAKE 4XP4H 3TZVD 1DDHB 1GC1C 4PRPE 1MCEA 3CZSA 3EOAA 1M57B 5ILTH 1N64H 2GTZB 3U6RB 3U9UA 5T3ZE 3NCXA 4BIKA 2W9DL 4G82A 3KE0A 1M7DB 1I3UA 2GJ6A 3QEQE 4NC0B 4NO2B 3MACH 4QRPB 3W0WB 2X2YA 4LCVA 1V8HA 3NCJL 4GBXB 4S1DC 1W2KT 1A64A 4NHUA 3GB7B 4DEWA 2JK5A 2FVNA 3GRBA 1B0WA 3O6LL 4K3JL 4JJHA 5MENA 2XNAB 2CO7B 1AI1H 1YEEH 4YDNA 4OFKA 2V17L 4JHUA 1YEFL 1T7ZA 4P46D 4OF8A 3ELAT 1QATA 1C7SA 3MRLB 1VERA 3C75A 1AHWA 2AZUA 3MRGA 4CN1A 5T3XH 1QSEE 4HUUB 1IAII 2P5EB 5H4YA 2FAUA 5I9QC 3O8XA 2XXFA 3BUDA 3RLSA 4Z7UB 4LPUA 1YQ2A 1CFNB 2IQAB 4CVXA 2F5BH 3DGGA 4F8QA 2P43B 5KUMA 1RXLA 2NDGA 1F2QA 1U58B 4P4KB 4MGXA 1IM9B 2ZX9A 2X4PA 2NNRA 4PJ7F 3GXNA 1P4IL 3J07A 4HMDA 4RGOH 4JNXA 3WELA 3VFPB 2EDJA 1U93A 2O5NA 1XCTB 2ILLA 3L5IA 4R5XA 5IFJA 1GH7A 4IMKC 1WISA 1BECA 2ZWSA 3P73B 2CR3A 5DK0B 4EN3C 3CK0L 4RAVA 3D69A 4G8IA 3L3HB 3L5WA 4N1HB 4A55A 2J43A 3HCVA 3NCBB 4G6FB 2E9BA 2CJUL 1QFWL 1GYUA 1A3QA 4RQQB 4M7ZB 5C09B 1GOHA 4WU5A 3OPUA 1SVBA 4DVRL 1CLZH 1XSIA 2WHVA 2FJSA 3QUKA 4JPWH 4YDKL 5EHFA 3RB5A 4AL8H 1IGFL 1T5XB 4PJ7A 4AYEC 3CXHK 4CL7A 3JVGC 4G8GA 4HHWA 3V0WH 3GIZL 1T1ZB 4YGVB 4R90H 1HAWA 2DIBA 2A77H 4R4NC 3FMGH 4XCNA 4NNYA 4J23A 4Y8AA 5D2NE 1LO4L 4QEGA 4QHKI 1XQ4A 1BQHB 2XQYG 3MRJA 3HFFA 2OL3A 4QXVA 4X5QA 4NENB 4FFWD 5HI5D 2OI9B 3FU3A 4KMQA 4DPBX 3VWKD 4YDIL 4XBMA 2WUBH 5H35A 3CSBA 3F7QA 3APMA 1YEIH 2YN5A 1MIEH 3ZKND 3W39B 1OAXH 2VLJB 1OP9A 4GRLC 1NCTA 4MASA 1JGUH 1I85A 1HSBB 2G3XA 3L7FA 4KRPC 4CC1A 1XR8A 5C6PB 2E6PA 2A5UA 3RGVA 5I8KL 4KZCA 4W9GC 3RWJA 5I26A 4Z8FL 1WVZA 2R29A 4LGSB 5BS0A 3NJJA 3SGJA 1N5YL 4OCWL 2Z0BA 3T65A 2XN9D 5ACZA 4N9OB 5HYJB 3NIFE 3OKOB 4BCZA 1DVSA 2R7EB 2CJSA 1OAYL 3NFNB 3VI4F 1F6AA 1RZKL 2EYSB 3NJFA 3PDOA 3NJLA 2R0LL 1GYAA 4OI8A 4OCYH 4LLUB 1E7VA 3V5DA 3IGUA 2X4OA 2FYYB 3NP3A 3PABB 3F6IA 2E6JA 1RZIA 1B4JL 1EFXB 1KJ3L 2PCFA 1A7PH 2AQTA 1K4CB 1UZ8B 4FQLH 3TM6A 3DLQR 1QD0A 4NQEA 2DQDL 2SEBA 2Z65C 3PXJA 3QNYB 4QT5B 1TZHA 2YPVL 1H3WM 4TUJA 2SODB 4E41A 3VI4A 4BQCA 3QJHB 4I2XE 1D6VL 3PAYA 4ZPVA 5IQNA 4E9XA 2PO6D 2YJQA 4GIAA 3RWDA 1WLHA 2EE3A 5HVFB 2ZAIA 3GDCA 1RUKL 4NN7C 2OMXB 3BHBB 1J9SA 1VJSA 2EEXA 4OVVA 4E0RB 4RMUA 4GMTH 4KK8D 5IK3B 5I71B 4EVNA 1U4FA 1SMOA 5D9SB 2NY1B 5H2BA 1Q9OB 3A22A 5ANME 3PGCB 2DQEL 1O9VA 3GYRA 1FNEA 1AC6A 5JIDA 4QRRA 4HUMB 2Z31A 1NDTA 4ZX4A 1WTGT 3UZQB 2BZCA 2DRUA 1MCPH 1YEGH 3KJ4C 5ICXB 2KKQA 1BVZA 1I7UB 4PJDB 3ECBB 3BOVA 3PWNB 4JM2B 3JYBA 3UTQA 3OGCB 1QQDA 5DHDA 1A14L 1IKOP 3I02A 3MRHA 5F7LB 4HG4J 4KX7A 4MJID 1MCLA 5L2KA 3UG4A 2DQCL 1JGVH 3TBVA 2X41A 3G08A 3DSFL 4OZGF 5CM1A 4J5VA 3TWCL 2WLKA 4QDGA 4ZFOL 5EEWA 1AIFA 2GITB 3ARGA 4NUPA 3L3IB 3TJHD 1FO0L 4L2YA 1KXTA 4E9SA 1MF2H 3QJZA 5DVMA 4ZMQA 1NBYA 1I75A 3H2WA 3KR3L 2AJZB 3CH8A 4JHVA 5FM5O 5JHDB 4NUJA 4OKVB 1ZLSL 3S0PA 2AFNA 4PU2A 4LHUD 4BKSC 4GQZA 3QJOA 4OZGA 4I3GA 3QUXA 2FWOB 2LAGB 3JV6A 4HSAC 1EK3A 3BN9D 2A6KA 2OR8A 4MJJA 4PJ5E 2YD5A 5TE7L 1EEZB 2R29H 1FIGH 2D3LA 4WI5A 5EZLB 3MFFA 1BW8A 5HYQB 1FFQA 4DWHA 1JWMA 1JHTA 5BVJB 1KWGA 3D87B 5ESAA 1O0VA 1F42A 4N5UA 4U2YA 1W8OA 5CJQL 1ZA6B 3NZUA 1WD9A 4N2FA 1HESA 1BVNP 1FG2A 1FFPA 4B9IA 3IJ7A 5E6ID 5CJBA 2H1XA 1AY1L 5D1XE 2F5AL 4BA0A 5E2VH 5FA4A 3QUZC 4GG6E 3EGDB 3IFOB 2QVIA 4Y1AB 1E2WA 2N59A 1JERA 5JXED 4KBPA 3M1OA 4WV1A 2BY1A 2OXHA 4YSDA 1V3KA 1GA2A 1DVUA 3NCCB 2EZ0D 5DGQA 2FD6L 2DYRB 2Y1YA 4KO5A 5DEFB 1NQBA 2WZPD 2E86A 4A7UA 1GHFH 3ZDWA 4RIRB 2Y5EA 1YJDH 4A2DA 4MQXD 3F5WA 1TQBC 2BS9A 3DX8A 3GJEB 3ARQA 2KH2B 3GRWH 2Y07H 3PHAA 2HLEB 3ZL4L 4WI0B 1UKSA 4RNRA 5MERB 3SGDH 3SKJL 2GK2A 2UWEF 4GSDL 1GZPA 4UUJA 2HMIC 3WE6A 1RK1A 4YX2H 2BPBA 5JHLH 5FW8A 4U1NB 4JKPL 1I1AA 4NT6A 4KI5F 1IFHL 4DUXA 3GLZA 1UXSA 3AREA 3S36L 2CNYA 2UY7A 2B0SL 3GXFA 5AAWA 1BAGA 1OGAE 2BSBA 1KTBA 4NOBA 3N1GC 4GP4B 2BP0A 4JFWA 5LG1A 4DZBB 2WD0A 1OOWA 3KPRB 3H9YA 2HJFA 5DMJB 1Z32X 2A6IA 2EO1A 2UWEA 3LS5H 2XFGB 5DDHA 1GW0A 3MX0A 4J3OH 1G1KA 1NTDA 4X4MA 3C5ZB 5DC4B 1TFPA 4I48B 4MZ2A 1PKOA 1TJIL 2K45A 1ECZA 5JUEL 4H8WC 4PGCB 3SPCA 3AWGA 3QQXA 4JKNA 4QXWA 3RVVD 1ORQA 2YMTA 1FLRH 3IDUA 1IBDA 3FQXB 3LZFH 4Z7IA 4YLQT 1UADC 2YKLL 4J3BA 3RPBA 5BUPA 1OW0A 2OAAA 4RMRA 1QW9A 3JT2A 3EOAB 3NZHH 3U9UB 3M7OA 3GNML 2XY1A 2DM7A 4HX1A 3VXSA 1WEJH 2GJ6B 1JFQL 1U8QA 1DBBL 4MMYA 4RZCA 5DRWA 4Y9CA 3TN0C 4U6XA 4EUPG 4WW2C 3A0OA 3AG4B 1RP9A 5I74C 4ABUA 1RZ8A 4PRPA 4UDTB 3AS1A 1ETA1 2YZ8A 1FSKC 5MENB 2DB8A 5FGSA 3LN4B 3NEEA 4AVHA 2UVFA 3G5XA 3EH4B 3FTUA 3HKZA 2X5PA 2FLBT 1UD6A 2F7RA 3F8UB 4I3RL 4J7RA 3J7HA 3MJ9L 1DEEB 1AHWB 4ONGL 4BZYA 1HWHB 3MRGB 4K3EL 5IFAH 3UTOA 1P6WA 1PY9A 1NGXA 4DFHA 3NIDE 1F4WH 3GXDA 3O8XB 3U36A 2F19L 2R4RH 3WS6C 2CBPA 3LRHA 2A6JB 4CVXB 3DGGB 1CDIA 4XTRD 1A6ZA 4TKWA 1ZDQA 3IMSA 2VERN 4DK5A 4KWUA 4ZFFA 2X4PB 2OMZA 4WFHD 1H5BA 3QFJE 5IFJB 4CILA 1KPUA 2A4EA 4PJIE 4HZLA 4KXBA 3BPOC 4F8PA 5F1IB 1X9UA 3LRMA 4GW4A 2W9DH 4RAVB 4G8IB 1N68A 3L5WB 3DNKA 2NY4D 5AEAA 2ICWI 4YBLB 4H0HB 1MY7A 4HBQA 2X42A 2UVEA 3N42F 3UTTE 2HX9A 3X2QB 3NCJH 1E5AA 3TZVC 5T5FL 1EAOA 4WU5B 4XB7A 4X7FC 3QUKB 1GIGH 4RA0C 5EB9A 4PJ7B 2V5YA 4NXKA 2OJEA 3O6LH 1SM3L 4G8GB 4K3JH 3HHRB 5F8QC 4MXQC 1VPOL 2LR4A 2APXA 3QDMD 4JVPA 2V17H 1OARL 1YEFH 2F2HA 5ADPL 2K3TA 1HDMA 4XCNB 4IJ3C 2X2HA 4NNYB 4JPIA 5FO8A 2FECI 3D0VA 4RDQF 4J39A 5ICYA 4NZTL 4KVNL 1BQUA 1U95B 4RLDA 1YHPA 2GHWB 5AB2A 4PB9L 4AX3A 1F0LA 4NKMA 5H35B 4H26A 4P46C 4APQC 5BUAA 2YPVA 4KJPD 1HC1A 2GJRA 2DAVA 5D6CA 4ZS6D 5ESVA 5JQ6L 3IDXH 4OFPA 1P4IH 3L7FB 4PP1D 1H3UA 1TR7A 1T5WB 5AQ0A 1XR8B 5FV1L 3Q8BA 2E9JA 5CJOL 1W15A 4X5PA 2VUYA 3HNTL 4KAQL 3RGVB 2ZF9A 1DUZB 2X9YA 1W0WA 3CK0H 5D1ZD 3RWJB 4JREC 2WXRA 3VD9A 3N0PB 1F18A 2WWMC 3IDIA 5BS0B 3VFSA 4FKHA 2CJUH 3ECVA 1JCVA 1QFWH 3T65B 4X2UA 5ACZB 1JV2A 4DVRH 1DN2A 1K2DA 1XB3A 3UCRA 4JQVA 5D93B 4D94A 4YDKH 1F6AB 5FYKU 3QI9D 4BZ1L 1IGFH 5KOVC 2M8XA 4K15A 2I7SA 1J8KA 2E46A 2XDHA 5TQ0L 5JW3L 3GIZH 3V5DB 2ED7A 3VE0A 5AKSA 2X4OB 1NFIA 4YPGB 5BZWA 5GGRA 4YSQA 1RZIB 3K6IA 4OJCA 3MUGA 2XJLA 3NIGF 1LO4H 3UJJL 3X11A 4UOW1 2DMKA 3B6SA 4DESA 4NQEB 3Q2VA 2SEBB 1Q0EA 2E9GA 1TZHB 3KGRA 4TUJB 4Z3HA 1J9QA 2HTKD 1FO0A 2L7UA 4U1GC 3VI4B 1MFCL 4QTHA 3JZ7A 3SCMD 4E41B 4YDIH 3CHRA 1N8OE 2OP4L 1EHNA 4WHYG 4ZPVB 4AYID 3RWDB 1JYWA 4JFYA 4NKDA 1OSEA 5F9DC 1RURL 3P4LA 3GPEA 3Q43A 3IJ8A 5KVFL 3DI3B 4KRLB 1R6VA 4OJDH 1MNNA 4FFWC 4FTVE 2VAAA 5HI5C 2F15A 2WVSA 4EVNB 2RQ8A 2IPKB 2EO9A 4XO4A 5H2BB 4BBWA 1HINL 5I8KH 2KZ1B 1FNEB 1KULA 3QDJD 4Z8FH 4H8VA 4QRRB 3C60A 3T0AA 2Z31B 4ZUTA 1N5YH 1AZNA 2RMNA 4XP5L 5FUCC 3UTQB 2DLIA 4TNFA 5DD0L 7PCYA 1QQDB 3TVMD 1RZKH 4KKPA 2XWTA 3I02B 2R0LH 1SOQA 2GCYA 5L2KB 4Z3JA 4RX4A 2P5WD 3LKRA 3G08B 4TVSa 1WPCA 5C07D 4JVUA 4V1DA 1R46A 3HR6A 1UWYA 1B4JH 2BIQA 3LD8B 5LGJB 1KJ3H 4O4YH 4C56D 3DRQA 4MQ7A 1BVLA 3QUYA 2CRZA 2DQDH 4PRNB 1KXTB 3O3BA 2IH1A 4U1LA 1AKPA 2YPVH 1DQML 1NBYB 1TCMA 4PIBA 4X8XA 2E76C 4JO2H 3L9RA 4JHBA 4N0CD 2QJDA 4NUJB 1D6VH 1KFAL 2WXHA 2PR9A 3M6DA 4UOZA 3T6QC 1IKNC 4CJ0A 1BQ5A 2QPSA 2P4AB 3MRRA 4OGAD 2H6PA 4OZGB 4UNVA 1LEIB 3QUXB 1RUKH 4IIQC 5TQ2H 3JV6B 5E1GA 5LCVL 2A6KB 1RPKA 4M48L 3P54A 1KJ2A 3UP6A 1E3FA 4HZAA 3MFFB 2DQEH 4AM0A 1AG6A 4XPBL 3K6SB 1JHTB 1Z9NA 3D48R 5EDSA 5ESAB 3C5XA 5HY9A 2J20A 2V37A 4AYBA 3TS8A 1NL0L 2AERT 4EIUA 4LKXB 1FFPB 5J4MA 2VLRE 5F6HI 3KLSA 1YCSA 3UCQA 1A14H 2YEVB 5T8IA 2I9TA 1GXEA 2KLSA 3LTVA 4FMVA 4HWBL 3TCLA 3BISA 3OLEA 2DQCH 2JJTC 2V7NB 5IG7A 4ZPTA 1NMCC 3F64A 1BQKA 2UXFA 2PTUA 3DSFH 4FQIL 4JFDE 3L54A 4WV1B 2OXHB 2R23B 2YD8A 4MD4A 3QIWA 1FO0H 4OIIH 3FFOA 3BVWA 1DVXA 1ZE3C 5D1XA 1OWRM 4L1TA 2X09A 4LEXL 1R3HA 5FECA 3OX8A 2IANE 3DROA 4Y7MA 4LCYA 3A24A 3KR3H 4I9WD 2RA1A 4URKA 5FM4A 3I75A 1S7SA 1XVSA 4HJUA 4JE4B 5GQBA 4BWUA 1ZLSH 3F5WB 3IKKA 1FIEA 1QSVA 2GB2A 3ZTNL 3DX8B 3SDCA 3TJHC 4GXVL 3ZJAA 3BWUC 3T6WA 1XAKA 4RNRB 4ZO8A 4HIPA 4KJQD 4PJXF 3GDBA 2AEPL 1SLWA 4UUJB 2I9LA 5TE7H 3DUUA 3AT0A 1OCZB 1RK1B 4LEEA 4CNIA 5C3LD 4WFEE 3Q48A 2P24A 1I1AB 4MD5A 4ZX5A 1GCYA 3E2HB 4I0PC 4ZBJA 1BP3B 5C0ND 1UXSB 5CJQH 1ZLEA 2ICCA 2UY7B 2BZ7A 3BUQA 1EBAA 3UO1L 2QFPA 5J12C 4ABWA 2EH8L 1TZAA 2BP0B 3I3DA 4FG0A 1AY1H 4G1MA 5IEHA 2F5AH 1OE3A 1S9KC 4KK5D 1XAUA 2PTVA 1IKFL 1FWXA 3LAFA 5DDHB 3MJ9A 1PNCA 1UH4A 5E56A 5AOIA 4AVKA 5I28A 3BJ91 4RMVA 2FEEI 3SYPA 5E6IC 2NR6D 1NBZA 2FD6H 2JCCE 1NDGA 5DGRA 3O45B 3T3MF 1SYVA 3CLWA 3SJVD 1QRKA 5JXEC 5E5LA 1T89A 5FGRA 5HPMA 1WWAX 2W9EL 3KYMB 4APXA 2NUPA 3SBPA 2V3EA 4F33A 2DQUL 3O3UN 4NCC1 4Y19B 2EZ0C 3ARYA 4N2HA 1KYUA 2Z8WC 1WE5A 3P4NA 5AVWB 3SE9L 3ZDZB 2C9AA 4HX1B 3SKJH 3VXSB 2ZIDA 4U31A 4B53A 1AAJA 1U8QB 4MMYB 5LDUA 4RZCB 5DRWB 4GSDH 4U6XB 4XVJL 3QK0A 1QPXA 2ALWA 4LFHG 2PPEA 5GGUB 4JKPH 4PRPB 4WNSA 2P47B 1MRDL 4U3HA 1IFHH 3T0EA 4KFMA 4G9FA 4NC1E 3S36H 5T5FA 2B0SH 5K59E 3B2MA 3CNKA 2FT6A 2B1HL 1X5JA 3G5XB 2LV4A 3L8QA 3LVTA 1SXSA 4AIOA 4NRYA 1RK7A 4M5SA 4F7TA 2OMVA 2BLFA 3PWPA 3SDXF 2VIRA 3U79A 1NGXB 5TE6L 5K9JL 5LNDA 1HKLL 3U36B 3L5XL 4MS8D 2VZUA 3NJNA 1TJIH 5EIIG 3I6SA 1J7VR 1J8HE 1V3JA 3NFSL 3SE4A 1PX4A 1M1XB 3VWKA 1HCZA 4ZFFB 3QP3A 1P6FA 1P4BH 1A21A 2OMZB 2QGEA 1J0JA 3S7GA 4C47A 1ET5A 2YKLH 2E7LC 4AQ8A 1FHGA 3NGBC 4HZLB 4GMSH 4Q0XL 5EOCJ 4WHDA 3MZTA 2YARA 3SDXA 3UL4A 4GW4B 3GNMH 4IOSD 5JXAL 4IDLA 1JGLL 1DBBH 2DEWX 5GZOA 3HZYA 4BFGA 3QZPA 2KZBA 4P2YA 4KX9A 4P5MA 3HRZB 1VADB 4KKQA 4Y2DC 2WLNA 4HOXA 4PJEE 1EXGA 2OJEB 1ET7A 5DD5L 4CAGA 1OP4A 4WNQB 3SIKA 1LEKA 4BZ1A 3WNPA 1NEPA 2X2JA 5EU6A 3UTTA 1RK0A 3VVWA 4HFUH 3DOIA 1D5MB 1J86A 1HDMB 5IQ9A 3MJ9H 3ZL1A 2WXNA 4Z9KB 5FO8B 2WVVA 4I87A 3W9EA 4ONGH 1XF2A 2EYRA 1CF1A 1DE4A 3D0VB 3N42B 3QIBC 4K3EH 5LAXB 3TH4T 3N91A 5ICYB 5F93C 4F9LC 4HEPG 3HZKA 4S11A 5EZOL 1Q90A 2F19H 4WSKA 5CO1A 3MV8A 4NKMB 4H26B 1KXQE 4MVBD 3OMNB 4Z7VE 1L9TA 1FGNL 3BD3A 5TH2A 1RSYA 2YXMA 4D9RD 4POUB 4JKWA 3GO1L 5ESVB 5CIPH 3KWTA 2YXVA 1QYGH 1BXXA 4AC2A 1HKFA 2QHLA 2YAMA 2APVA 1EDYA 3FRPA 3OAYH 1E4WL 3H3KA 1W0WB 4XTRC 1R3KA 4J4PD 3RUGE 2EVJA 3H0TA 3IDIB 4LLWA 4AQ1A 3CJJA 3HNVL 5T5FH 1K2DB 5KWYC 3HI6L 2BNRD 2X4UA 2XG5A 1IQWL 1NIDA 3WDIA 2BRRL 1HCFX 1SM3H 4QJ5B 2C7FA 2ZCZA 1QWNA 2G0KA 2GVYA 3LNFA 1VPOH 1ZPLA 2B1OA 3VMOA 1P2CA 2X87A 1OARH 1NFIB 3D39D 3CFBB 1EV2E 5L4MA 5ADPH 5GGRB 3NIFB 4MA1B 3EJZD 4N2CA 4PH8A 3MUGB 5CN3A 4JM4L 1TYJA 3X11B 4Q14A 2X6BA 3B6SB 4UB0L 4ZFOB 3ASNB 1O5PA 3NACH 4LOEA 4KVNH 5HHME 4AW7A 2QPEB 3FHEA 4NJAL 4PBWD 2IBZY 5FPIA 4PB9H 1FO0B 2ZKYA 3DRTB 4JPQA 4WTQA 4QTHB 5DS2A 5CCJA 3HUJE 1MVUA 2BNUB 4R7LA 4HMEA 4GAFB 4JFYB 4NKDB 1G5GA 5JQ6H 1CGXA 3X1NA 3LS4L 1N0XL 4S10A 4DP8X 5LQBL 5IV2A 5CJOH 3BWSA 4K5MA 3GBML 3NIGB 4KAQH 3HNTH 3LZLA 4ICXA 4F8LA 4I2XB 1BWWA 1Y1UA 4ADGA 5LCVA 4KJPC 4WAFA 1UB6A 3QULA 1K85A 3BP5A 1YVLA 4K4KA 2XY2A 3C60B 4NM4H 4NQQA 4KPHL 4ZUTB 5AOJA 4PS3A 1DL7L 4PP1C 1CBVL 4TLTA 2QKIA 3T4AA 1DDTA 2A9CA 2WBJD 4BZ1H 2XWTB 1YNKL 5IB3A 5TQ0H 2EXWC 3ATBA 2GCYB 5FFOA 5JW3H 4IMLA 3CVBA 9PCYA 3LKRB 4HWBA 4V1DB 5I24A 5IVXF 2WN3A 3E3QE 2J73A 1A7OL 4PV9B 2YOAA 3DRQB 3ERXA 3UJJH 1B4RA 1BVLB 2ADGB 2X6MA 1URZA 4BDVA 3PXHA 3O3BB 2IH1B 3CN2A 4U1LB 3VQMA 1RJZB 4BA8A 5DEGA 1MFCH 2IBBA 5E4AA 1WITA 4E2OA 2OP4H 1JF6A 3OAYK 1OLLA 3LN5A 5DJAA 2EDTA 5F44A 4WEMB 2OTPA 4R7NA 4UQBA 2WZ6A 3VXPA 2H6PB 4N0FB 1RURH 4YDMA 4TOYH 5HBBA 5KVFH 1MCQA 3HPLB 3O0LA 5HDRA 3MJ7A 2EIDA 3AITA 3SCMC 4K5PA 1XWVA 1Q8MA 3LMJL 1HINH 3PYCA 4UZGA 1EXUA 4AM0B 4KKBD 3EO0B 1G9NL 2IWFA 4FYRA 4P5TA 3V2AR 1IAKA 1OO2A 1SFHA 1X5LA 5DJYB 3RVTD 4IRJD 4J3WA 3RIKA 4I1PA 2BNQA 4XP5H 3HOGA 4PJ5B 4LT7A 4YZFF 4H1LA 4IRZH 4HETA 5DD0H 4Z76A 2BHUA 2EXSA 2N1TE 2I9TB 4JRYD 3LPOA 5T1LD 1R24A 1V10A 3TCLB 1X3DA 1LP9F 2QLVB 5IG7B 4ZPTB 5IJCC 1DQJA 3S4SA 4HAGA 4TNWF 4N8VG 3TVMC 3QIWB 2NPLX 3L7EA 5D1XB 2QSVA 3S5LA 5HI4C 2NY3B 5KJRH 5FECB 1R3HB 5AZUA 3OX8B 3L9BA 3DROB 1DQMH 1GTFA 5AWNL 2GBTA 1I8AA 4LCYB 3OC5A 5FK9A 2FB4L 3I75B 1S7SB 1TVDA 1KFAH 1PD0A 3I9GL 4IQHA 5L6YL 4I89A 2WWKT 5LKNA 4HC1L 3SDCB 1J8SA 1LP9A 1I7ZA 4Q52A 3D0LB 4L1HA 3HHMA 3U2SA 2K6WA 2BHZA 5LCVH 2VGLM 2HZHA 1FRGL 2I9LB 1OPGL 2XFXA 1Q4NX 3DUUB 4CNIB 4XH2A 2P24B 1ID5I 3O0RL 4XPBH 3RTLA 4MD5B 5E00A 3X3FH 3ULVL 5F9OL 4OGAC 3TBSA 1NIAA 3GSNL 3NRFA 1NL0H 5SWZD 1PZCA 1MHEA 1S9YA 2DTML 3VH8G 2IF7A 3OM3B 4U1SA 3VXRA 3SY0A 4P3CL 4G1MB 3TO2A 2X05A 4JPSA 4HWBH 5CD5D 2GSIA 4WI2A 3SGDI 2W88A 4FQIH 4M8UA 2XZQL 2FEJA 1E2VA 4F7MA 4XPGL 5E8NB 1FUNA 1F45A 3FT1A 1CI5A 5EG6C 2F1AA 5L2JA 1NDGB 1S3KL 2AQ1A 1SYVB 4LEXH 1QRNE 2NNXA 1KT2B 2XWRA 4XO3A 2F7OA 4JUTA 3V0VB 4WI7A 5EZJA 3VXME 3N6YA 4Y88A 5HPMB 2NY2C 1O7DE 2OSLB 5B1BB 3DVNA 4APXB 2NUPB 1QVOA 1AR1B 2KHAA 4F33B 4MRCA 4JFHD 2DL2A 3CDGA 5CIPB 2OTWA 4GXVH 4L5FL 3QG7L 2FLRT 4LSTL 5CS7A 4JGMA 5FGBC 2DIEA 2AEPH 4XBPB 5KUKA 4KFZC 1S9VA 3CDZA 3ZYZA 3V8CA 1XCWA 5CUSL 3T3MB 4XNZB 2WXKA 4MWFA 3S3BB 3VDBA 3EDDA 3T0EB 4G9FB 4W93A 3VYPA 4KJQC 3UO1H 5JA8B 5KYWA 1FVDA 2EH8H 4HP5A 4YDJA 5GS3A 3SKNA 3SPGA 3TU6A 1MZYA 2J21A 2TAAA 3MN8A 4N20A 4NRYB 3B83A 2G9HA 4Z7WE 4YSEA 1RVFL 4DZ8A 4X9FA 4F7TB 4M7LL 2OMVB 1IKFH 3PWPB 1TQVA 1NMAL 2VIRB 4XODA 2ZXQA 5ECJE 4AT6A 1P0SE 4J12A 3QJSB 4FQXB 3GZKA 1XF5A 3O2WL 5I6NA 4OZIE 3O4LE 1UXWA 1YMMD 2J55A 3WY2A 3MRBB 5GSRA 2DM2A 2P80D 3EDEA 3BUYA 5T1KB 4CSPA 2W9EH 4N87A 3LKNA 4BWWA 5KVDE 2DQUH 2Z35A 4XPHL 5I1CH 3SDXB 4PREA 4XOCA 4ZX6A 1IAOB 1K4DA 6TAAA 3SE9H 4ZMLA 1H19A 3PAVA 3K8MA 3ES6A 4XVJH 1ZDSA 2CO1A 4P5MB 3MLZH 4FHJA 4LNVA 5D1ZA 3RWGB 3JUZA 2K78A 1XF4A 5KVGE 5E2UL 1MRDH 3PS6A 5DD3L 5AYUL 3K5SA 4QNPE 1OTTC 3ESUF 1R5IA 1U3ZA 2XHNA 1AOZA 2B1HH 1LEKB 5IHZA 3JSSA 5EU6B 5A2JH 4YOKA 4KGLA 4N6RA 3UTTB 4KKCD 4KITB 1CJYA 1OTSD 1UOVA 2A9DA 3G5WA 1MCHA 4TSCL 4TUUA 1ZIBA 3BH8B 5IQ9B 1KGJA 4LPVA 2WVVB 4FFVD 3TASA 2EYRB 1P7QA 2XXMB 4S0HA 3O6FC 2B8OT 4IBVA 3VNZA 1PBYA 5TE6H 3HZKB 4CU7A 2VL5B 5K9JH 1HKLH 3D50A 3L5XH 3MV8B 1AO7A 4NQCA 4L23A 1EEQA 3KG5A 4QYAA 3CFDA 4K8RL 3RKDD 3T0WA 3C5JA 5TH2B 3NFSH 1F1GA 4XVOA 1TNMA 3P77A 5J5EA 2DTSA 1INDL 2H0PA 4A2LA 4LOUC 2C3VA 3DX9A 2OFQA 2OXGB 2MOGA 3FRPB 4Q0XH 4MS8C 1LD9A 4FNTA 4NP4L 4TVUA 4C83A 4EKXA 4JFEA 5JIHA 1SF3A 1R3KB 2JI1A 3H0TB 3KPSD 2A3TA 1FN4B 3MCKA 2J7LA 4LLWB 4DAGL 4AQ1B 1OL0A 1KB9K 4GY4A 4HG4K 5EN3A 2YD1A 3O81A 5DU7A 4DGYH 3GK8L 1INQB 3L13A 4H40A 1TTCA 3RFRA 1DVYA 2X4UB 4QAWA 4XXCA 2HX7A 2NYZA 1BVOA 3TCTA 3HG3A 3NOIA 5CEYA 2BP3A 5IMMA 2CRIA 4JG1L 5KVGL 4XNYH 2BS8A 1NPUA 1UJ3C 4XCEB 4PCSA 2YWZA 1ZTMA 3L3OC 2NLJA 3VA2C 5BV7L 3B1TA 3JWNC 3ZVVA 4A38A 4PSPA 5C07A 4P2AA 4D3CL 2GAZA 4Y16D 3CHPA 1WG3A 3FBQA 1IEHA 5AAMC 5EZOH 1QFWI 2XVKA 3ZQWA 5GRXG 1MI5A 3SYOA 5KSBE 5EF1A 3GI9L 4ZAKA 4G3YL 1UVQA 1FQ9C 1FGNH 4XNXL 4TTDC 3GO1H 2ZXDA 4G6AD 5AUMA 3HKFA 1QNIA 2WYTA 4LCWD 2QMJA 4FD0A 5IV2B 4XWOD 3AXIA 3LCYA 3CVHL 3SBWC 3LIUA 1DVFA 4P57A 1E4WH 1PIFA 2E8YA 4BFEA 3LV3A 2Q1EA 1G7LA 3BP5B 2XQYA 3PUCA 1GC1L 3H9HA 3IJHA 5BVPH 1TIUA 1E4JA 3HNVH 3DMMA 4B3VA 1MJJA 2QKIB 2N7AA 2FO4B 3GS7A 4U05A 3T4AB 2EEDA 5ISZE 4F7EA 1Q9KA 3HI6H 1TJXA 4LPYA 5IB3B 2BRRH 4OY9A 3WEAA 4J4PC 2CWRA 4IMLB 3U7WH 5ICUA 3NA4A 2VZSA 1ND0A 3INUL 5HXMA 2Z91A 5FS5A 2HJLA 4JM4H 1U92A 4UB0H 3UC2A 4YFDB 3V6ZA 5BRPA 4OJEH 4YMPA 4NJAH 3T5WA 2IDQA 5DEGB 4X6BA 5JR1L 4FTDA 5HHOE 5IT2L 4NSKA 4RMTA 3EJZC 3TBYA 1AZRA 5DJAB 4B60A 2QVTA 1KYAA 3PQYE 1MSPA 4L4VE 3VXTA 4L9DA 5D7EA 2QSCL 3ZKXC 2WWKO 4UTCA 4X8JA 3U7AA 3LS4H 4HC1A 1SHSA 4LKCA 3MJ7B 2N7BA 2EO7A 4WGKA 1I1YA 1ZKAA 3GBMH 2NY7L 4PJ9A 4JUSA 5F0MB 1CLVA 3HR5A 4KPHH 4P5TB 4K3HA 1IAKB 1DL7H 4FRWA 5CZXD 5GGSA 2A4CA 5C7ZA 1CBVH 2BNQB 3FF8A 5GZNC 4LVHC 3NJVA 4WO4D 5GXBB 4Z76B 1P69B 3GSNA 4HK3J 1UXMA 1YN7A 5MI0B 1P4LA 1YNLL 2APFA 3VI3E 4YSUA 1R24B 1IUZA 2HH0L 1WBZA 3LRGA 2C3WA 1I7RA 3S4SB 3QC6X 4MBOA 2WBJC 4D0BA 1A4KA 3K80A 1A1MA 5HD8D 4WF7A 2XWXA 4KHTL 3L7EB 2VXVL 1AOHA 5FK9B 1GS7A 2CQVA 4AQOA 3NN8A 4POZD 3VB9A 4P5KA 3K8KA 3VXNA 1I7ZB 2FBJL 2P8PA 3TPKA 4B9JA 5D7JD 4HU2A 1CGYA 2IMNA 3PWUA 2ZG3A 2ZKHL 3U2SB 1CI3M 2ARJA 2MQ0A 5AVTB 4U1IA 2BOCB 2XFXB 4PCYA 2CK0L 4LSSL 4E9QA 3LMJH 4H0LC 1JXDA 4XH2B 4WWID 4RWHA 4DK3A 5E00B 1G9NH 2OMUA 1RUML 3TBSB 3BYTA 1FL5A 3UZEA 5LNGA 1F86A 1CD1A 3BE1L 1S9YB 1MHEB 1XBRA 5L8LB 5EUOA 3VXRB 4IGBD 1BPVA 5C0IA 1QFOA 3LPPA 3OSVA 1MOEA 3BSHA 1UWEL 5J6SA 1L9OA 1R34A 1TO4A 3ZIMA 3STLA 5IZ7A 4IRJC 2FX7L 4LSDA 2AS5M 4KKLD 4F7MB 3RPIA 3VWJC 2K4WA 4DIXA 4CGUB 1NC4A 1WZLA 5L2JB 3VDCA 3IK2A 4Y1SA 4HOWA 3LQMA 3CXFA 5AWNH 5EZJB 4Z5RA 4XPFL 2FB4H 2B4CC 2ZXEB 3I9GH 3DVNB 2NW2A 5A2BA 5L6YH 2YUZA 1QVOB 4HC1H 3CDGB 5JLZA 4C4KT 1BF2A 2OTWB 2JCCB 1Q72L 4WK2B 1YEDA 2P8LA 2AITA 1FRGH 2O26U 1OPGH 2RACA 3CDZB 1Z3GL 1M7IA 2J8UF 4A37A 5CWSA 5BW7A 1DTUA 3O0RH 4NBXB 4P59L 4MWFB 3ULVH 5F9OH 5FX3A 3GSNH 2JTDA 3L16A 3GMQA 2DTMH 1HJCA 1FVDB 5FUZL 2MIZA 4YDJB 3SKNB 4P3CH 4RFOL 2ALAA 2G9HB 3HE6A 3WFEH 4DZ8B 2F58L 5I1GL 3LDBC 3EKCA 4XNDA 1OP5H 1BV8A 2GJPA 3X3GH 1H9VA 4IBUA 4AT6B 1CGUA 4XPGH 1ZRUA 2WLYA 1XF5B 3BAEL 3CC5A 4FJZA 1P5VB 3AXLA 4FG2A 1S3KH 4YK4C 2CSPA 3ZYJA 5GSRB 4UOQA 4YE4L 3G5VA 2XQYK 3BUYB 4TF4A 5F7HA 3Q5TA 2R51A 4AZ8A 3LKNB 3MV9D 5IFHL 2EIEA 1AZZC 2Z35B 2EXYC 1U8IA 5GHWL 4PREB 4L5FH 1K4DB 2I24N 3QG7H 1J8HB 4LSTH 5FYKE 3BXNA 4XXDA 4XXWC 1ICTA 3ES6B 5EORL 5BOZG 2DYPD 3ML8A 3WEOA 3H2QA 3LNHA 1U3HC 2QQLH 3FTSA 5G4NA 5CUSH 1XF4B 4HF5L 1NFDF 2QVMA 3K74B 5B7FA 3B3BA 2NY0D 1R5IB 2P52A 1TJGL 4ZFZA 1YEHL 5IHZB 1S9WA 3AMLA 4OQTL 1FZMA 3IBEA 4TVPE 1Q38A 1NLBL 4GFTB 1RVFH 2JCWA 2FT8A 4L3EE 4IKIA 4L3AA 1ERNA 1EEYA 4M7LH 4W6WB 4LF3A 4XNUL 5G4OA 3D39A 5IJVA 1P7QB 4ELKA 4EUPA 2YSSB 4QCIA 1KTDA 1NMAH 1S8DA 1NFDA 1RAMA 4XHJD 5DRXA 3S35X 1AO7B 3O2WH 4NQCB 3KCPA 5GGTL 2WNXA 5HDWA 5B7EA 3C5JB 3DETD 2WNKA 5F9AC 1T83A 1NIEA 3H85A 4XCYA 5LBSL 3WJLA 3P77B 1RZQA 1B0RB 2MHAA 2C3VB 1Y6MR 2HG5A 3DOHA 2E4FA 3DX9B 5H8DA 3WTVA 1LD9B 3VD7A 2WCGA 1IE4A 4KRNA 4Z7VB 3FRUA 1IAIM 1B2YA 2XBDA 2CALA 1AS6A 5DJ6A 2C3HA 3MCKB 4F8TA 1IGCL 1ILSA 1JVLA 1BZEA 1QLRA 2Q0ZX 3GGWA 5E2UH 1OP5K 4ACPA 4YFLI 3LEYL 5DD3H 5AYUH 4ETYA 1KGIA 5CEYB 2AV7A 3RUGB 1TO5A 5IMMB 3PAUA 3TWYA 2IBGA 3PHOB 3FFDA 3EJQA 1FNSL 5IJKA 2NLJB 4TSCH 3TJEL 4LOVA 1AGCA 5TF1L 4TVPL 2GAZB 3MJ8A 4LVNC 2B5IB 3T8XA 4L9LC 3ZE1E 2BOBA 1MI5B 2AMUA 4K8RH 1L6ZA 1XEUA 4ZAKB 1UVQB 3ALXA 5FYLD 2AEQL 5AUMB 2ZNWA 4N22A 3MUY1 2XX1A 3IPBA 3BUPA 2DJMA 1INDH 3F7VA 5HHMB 3NSJA 4XX5A 4AUUA 4UU9A 1RUQL 2EYTB 1DVFB 4NP4H 4P57B 3RWCA 3HUJB 3SOTA 1F3DH 2VM9A 3LV3B 4ZD3L 4RZKA 1XL4A 3MRQA 2CXKA 3H9HB 4NCDA 3IJHB 4DAGH 3LPGA 4IMKA 1UEMA 3SDAD 8PAZA 2PUQT 4Y4FC 3GK8H 4EN3A 1KCVL 1Q9KB 3JWNG 4F7EB 2DLHA 4XVTL 2Z93A 2X9XA 4PW4A 4XC3L 1U91B 2HFGL 4JG1H 2ODHA 5KVGH 2PLTA 1HEZA 1N67A 3AG1B 5T1LA 4EUPH 5BV7H 2Z91B 5CFAA 2HJLB 5ISZA 1VA9A 2HT4D 3JVGA 4TN9A 1U92B 1LE5B 1U8OB 3EAKA 1HQ4B 2DMHA 3V6ZB 4D3CH 2WBWB 4PJXE 4JO1L 1U21A 5DHVA 1ZS8A 1FFTB 2QZQA 2NZ1A 4HUNB 1MG3C 3DJTA 3DBSA 3GI9H 2MH4A 4G3YH 1XXFC 4P49A 3TBYB 1S7VB 4XNXH