1H6FA

Human tbx3, a transcription factor responsible for ulnar-mammary syndrome, bound to a palindromic dna site
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
184
structure length
184
Chain Sequence
DPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFAKGFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-BOX TRANSCRIPTION FACTOR TBX3
publication title Structure of the DNA-Bound T-Box Domain of Human Tbx3, a Transcription Factor Responsible for Ulnar- Mammary Syndrome
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription factor
total genus 41
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00907 T-box T-box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.820 Mainly Beta Sandwich Immunoglobulin-like Transcription factor, T-box 1h6fA00
5FLVA 4A04A 5T1JA 4S0HA 1XBRA 2X6UA 1H6FA 5BQDA 2X6VA
chains in the Genus database with same CATH superfamily
1SJHB 4PW4A 3NPSC 3CFEB 1T0NA 2FH6A 1JNLL 1URIA 4G8GA 2H6PA 2NXZC 5D1XE 5EOTA 1QTSA 1JV5A 4GSXA 1KGXA 4QHPA 5TFSL 2VJ0A 1S7XB 5FDWA 3TT1L 3EIFA 1XGUA 2N7BA 3SHSA 1TKWA 4U1SB 3HC2A 4HDIA 1CLCA 4Z76B 4EN3C 2H1XA 3EOBB 2GEQA 1H3GA 1KPVB 4NNYB 2EDFA 3IWUA 4PJFE 1AOHA 3DV4A 3QA3A 5C0CB 3BC9A 2E86A 3KVDD 4FMKA 3STZA 2XTJE 1CLOL 1WCBA 4KKBC 3ESVF 4LLYA 2K8MA 4XN5A 5K9KA 1A64A 4JFQB 1PNDA 1U8NA 1ZT4A 4HIHA 5KN5B 1ECZA 3F7QA 1I8IB 3F7YA 3W3BA 4N1EA 4P0DA 5DJ6B 5AAMA 4ORZC 2WBWB 4WY7H 5K93A 1IC4H 5EOCH 4H8WC 3KWWB 4N2IA 1G9MC 4H44C 2CA3A 1QVOB 1DSYA 1OGAE 1JP5A 1QZ1A 1TJHL 2FGWH 3L3HB 4Q52A 4XWOD 3VQMA 4YHYB 3H9HA 4OLXH 3BUIA 3HZYA 4UQBA 4RMWA 4QWWC 2N7SA 4EIGB 2PW2A 5GGUA 4QXGH 5L4IA 2WLLA 2AZUA 5DSCB 4C47A 3VUAA 1I7TA 1IRAY 1TIUA 2NY4B 3M45A 2ZF8A 1R9FA 4XNQA 3P0YH 1JK8A 3V5HB 2J25A 4LLDB 4F24A 3S0PA 4U1MA 5C09E 1CR9L 3PABB 4KXCA 4PGDB 2FYYA 4HS6B 4QTHA 5KJ7E 4Y2OB 2MPAL 2XRAL 4LIQH 1T6VN 4LCCB 4XMZA 1MFMA 1ZVNA 4LSUH 4L5FH 2YD6A 5HHNB 2UZIH 1U8OA 2XNAA 2Z1KA 3OAYH 4MQTB 4QT5A 4EN3A 1KJMA 3L2NA 5EG6C 3RVUC 3RTLA 1LE5A 2VISA 4JFOA 3EYFA 2HJLB 3NAAH 3LN4B 2LAAA 1W72H 5CZVL 1A7RL 4MNQB 5GRUH 4BD4A 4JM0A 2PXYC 3CDGA 4M6NH 4PD4K 3ARPA 3SDAB 4ZYKB 4U6YB 3JV4A 3IDJA 1BXXA 4E5XA 1QD0A 3VFVB 1N0XL 2J2ZB 4OLWH 1F02I 1UWFA 4OF7A 4TQPA 3AC0A 3CVCA 2G9KA 1IGIL 3HS8A 1A0QL 3FTZA 3C8HA 1IC1A 3BWAB 2ZUSA 3X11B 2YK1L 4JKKA 1XCWA 2KZBA 4XMWA 5LGYA 1BAGA 1R46A 4PJ7F 1ZCRA 2I7SA 12E8L 5HHPB 2Y7NA 2OZ4L 1YJDH 3DX6A 4AH2A 3TGXA 4AYEC 5JIIA 3MCYA 1ZOXA 4L4TB 1J5DA 1JPTL 1NGXB 4BBWA 2WXNA 3MCG1 2YBRA 1YQVL 1H6TA 1E5BA 1Z9OA 3P77B 3N85H 5CEXB 3DUUA 5FUCC 1UA7A 3EDJA 3B6SB 3OKOB 3U9PH 1A7QL 2PABA 2DL2A 1TCMA 3MR9B 1JDAA 1VPOL 1XMEB 1QASA 2K45A 1J5OH 1CFBA 1ONQA 4ILDA 5FECB 1P5UB 2ZUQB 1OAXH 3L6FB 4QRTA 4N0RA 4XO8A 4R6UA 4N1CA 4X80L 3ZHLA 5FR3A 1GR7A 1PEZA 4M00A 4P48A 1MW1A 1DVZA 4YXLL 3CZLA 4XZUB 3CN3A 3MRHB 2PXYA 1L9OA 4FQJH 1Y0LA 4EVNA 2KKQA 4JEGB 2GSIA 5DC9B 4N0YL 1EFXB 3CLFH 5FYKD 5HHOD 5FM4A 3BKYL 3BUYA 3QIBD 1UC6A 2CUHA 2VERA 1E4XH 1LEGB 5BV7L 2X4QA 4ZSOE 1F5WA 3IDGB 3T3MF 4BZ2A 1I85C 4NX0A 1IQDB 4AGOA 4HAFA 1J1PL 1X9RA 1YG9A 4ZTPH 1R3KB 4LLVB 3WKQA 1NEZA 3VCLB 4PRIA 5CINL 4X6FA 5T3XD 4F1ZA 3N9GL 4LEOA 3DBSA 3C6SA 3B9KD 1DQMH 1AZZC 1DQDL 1E67A 2MQ0A 3R7QA 5DURD 3O3UN 3ARGB 3CXFA 4R7NB 2WIMA 1G7IB 5L8KB 1M2VB 5KYWB 4Y5YC 3MCLL 4AGQA 3HC3L 4KKLC 3F6LA 1T7VA 1FL5A 3NCYS 4XPGL 1ZLDA 1KXVA 3HI5H 1RZFL 1TO4A 1J1OH 3WJJC 3VU1A 2CE6A 2JCCA 3B5GA 3HHMA 4WWKD 1BGXH 4NM8L 1G9NL 4OZGB 1NCBL 3GT6A 3LNEA 4GRWB 2K4WA 4PCKA 3RE0A 2YPKB 2AXFB 5AVXB 1ZTXL 4H2CA 4I18C 1FFNA 1NC4B 1XGRA 3FMGL 4YC2B 5K9QI 3PWLA 3C5XA 2NR6A 1DBJH 2UYLA 1T1WB 4WFED 3Q6GL 1R4XA 2R51A 4NAQA 3AQXA 3BDYL 4FQXC 2ADJB 3MFGB 4XVTL 1CQYA 4IW4C 2QADB 3ZIMA 1U41A 1ZV9A 3MZTA 4KNTA 3THML 5KSAB 4NQEB 1OWWA 3QFDB 4YAQA 3LQAC 1UUNA 2ZOUA 4UQ3B 1I85A 4Y2DC 1OTUD 3BP7B 2FYVA 1ROCA 2IH8A 3WO3B 2XWJA 1UZGA 2I9TA 1BEXA 4YDVB 3MFFA 4ZG1A 4Q89A 3O3EB 1P84K 3WIIH 3ZL4H 3BVUA 2CHZA 1NKGA 5I9QB 4DKFH 2YA0A 1XR8B 3D05A 3SE9L 3UBHA 1KIRB 1ZA3A 4OGAC 3VFGH 3QR0A 4Z7WB 4Y5YA 5E1GA 1SEBA 3ML8A 4KVNL 1RHHA 2IPTL 5HI4D 3QDHA 1ASPA 2QMJA 3ESUF 4GW4B 3OF6D 1F3JB 5LAXB 3ZDZB 5BRPA 3ZYIA 4F80A 2A73B 2IVFC 2WK2A 2YOAA 4HUVA 2QQKH 2VZTA 4HWZB 3MLXL 2WNGA 3L3JA 2R2BB 1M6UA 1PF3A 1QO3A 2JE8A 3QCTL 4L2LA 4L37A 1E27B 2XV2A 4WJG3 3EYQC 3UAJD 3PWPB 3I6KB 4UU9B 4OLZL 1TVHB 4ALAL 1R24B 4I18A 3WUWB 2E74C 2EC9T 2WO3B 3TCLA 1Q0XL 2R1XA 1C5CH 2VDNH 3TF7C 3HNTL 5E51A 4FQLL 1KJ2L 2NY5L 4FQXA 2GC4C 4JM2A 3RPKA 1THAA 3EFDH 1JMZA 2E9JA 2EXWC 2XWZA 2Y2WA 1EZSA 2NY0B 3E2HC 1BDYA 5IVZA 2AJUH 2PW1B 4WO4B 5IW1A 1AI1L 1LO4L 1MCNA 2AV7B 2UWEA 4DQAA 2ZAIA 4Y2DA 5BZZA 4IU2B 5CUSH 4J27A 2Q8AH 1AO7B 4PJAB 2EDOA 5F1IA 5EULV 2AQPA 1MFCL 5J57B 1MI5D 4EZMA 3N6YA 5HI3D 4UQ2B 3L4YA 5F3HB 4ENZA 2LABA 2A9MH 3K91A 2R1YB 2ITDA 4NKOA 4W1TA 4B9KC 4BFIA 2CBQA 1U6AH 4M61B 4QXTB 5DS8B 3TNNB 4WHYG 3S98A 4MMZC 2JIXD 2Q86B 2O5NA 3NJJA 4L1TA 3ES6B 1M71A 1V7NL 1J5CA 2FO4A 4N3UA 3QXVA 1TNMA 2R1WB 4WQOA 4D9LH 1HEHC 1O7DE 2AJXL 5D7KE 3ZTDC 5L4JA 2YIHA 3APMA 1R5WB 1FG2A 5FCUL 5JXAL 1K4CA 4XRCB 3LQZA 2OL3L 1QZNA 3MUHL 1UM6L 4GSQA 5E4EC 3NQIA 4KXZH 1LEKA 5KS9A 1CGYA 1NFDF 4PJHA 4PV8A 3ETBF 1LNUA 4LE8A 4XN8A 4YNYA 2FJFB 4NXKA 1NPUA 1NL0L 5ISZE 4TL5A 4K5LA 3LZFL 1NCWL 3NRQA 4PJCB 4Q9QH 4MDIB 4MDJA 4TULH 4L8DB 1E40A 5HDQH 1MCJA 3B2DC 2OMYA 3DYPA 4L4TD 1BZ9B 4AV0A 2E7DA 1N12A 2OAAA 5IV2A 2LLLA 1A6VH 3RWGA 5ICZA 4CADB 3LPPA 4G80B 4HGMA 4GSDL 4RZCA 2B59B 1HL8A 3EDEA 3ILPA 3DYOA 5C0GB 2YPLD 5C0BB 4DP4X 4JQVA 1TSRA 4AK1A 1CVSC 1H3WM 2VSCA 4W9KC 3VYPA 3T8MA 4ICXA 1W16A 2HFGL 3VFOB 2RMNA 1BZDA 4MMZA 1OCCB 3DX1A 5EEYA 3IDNB 2FX7H 5DD0L 1LWJA 3K74B 4AIZA 3TEYA 2NQ3A 5HVGB 4JFZL 4NS0A 3EHBB 4FLRA 5LXGH 5LDSA 2Q87A 3TFBA 3D4GA 4HSCX 1KY6A 3CVHH 4XPHH 1KNOA 1L7TH 4FMFA 4P59H 3ATAA 2VKXA 4OTXL 5I6XB 2HRGA 1I8LC 4JDZB 4K5MA 3ZHFA 3IEAA 4M6MH 4QJ5B 4AJYV 1NC2B 4RFNB 4X98B 1Q9WA 3ILQC 1NPJA 4U1KB 5HBBA 1NAMA 4FA8A 1VFOA 4OZIB 1CBVH 4P05A 5DEGB 5BQDA 3NCWA 1U8KB 3KYKH 4HOMA 4MJIB 3KDMA 2J4WH 2Y25A 2BS71 1EAPB 2HH0L 5DJ0A 3T2NH 4F8NA 2UUDK 1P6WA 4LCWE 3N1FC 3UJJL 4OJDH 4YDJB 3U1QA 4GMSH 2CGYA 4P4KC 1S7TA 3HN3A 4PVMA 4N8CL 4POZD 2ZICA 4QOKB 4CMMB 4GINA 1A6ZA 3S4SA 4OF3A 5F6HI 1HCFX 1BZOA 3ARGD 1SEQL 3DNKA 5G2NA 1PG7W 3FFDB 4ZW8A 4LBEB 4BH7B 1HQ4B 3LN9A 1I7RA 3N40F 8FABA 2F5AL 1DQJA 1L4IA 5I8EB 4RGNB 2HRHA 3QIWD 4Y2LA 2X10A 4K15A 5I18H 4YWGL 4ZRGA 2AGJH 4WI9A 5MENB 1RURH 1K9TA 1XDTT 4JE4B 1TTRA 4GKNB 2Y4SA 4UYPA 4HGWB 4KMQA 1T4KB 2DLGA 4WNQB 1A1OB 1WUZA 2JNZA 1I8LA 3HMXH 4M3KB 3G6JB 1G5GA 1FC2D 2XZCH 3KGTA 4OGYH 3VRLF 3VWKB 1WC7A 2XJLA 4GW1A 5MP6L 3FQNB 3RZCD 4NQXB 2R56L 4LARL 2Z35B 3RIKA 2QADD 2P48B 1HZHH 4XAKE 4C56B 2YQBA 4DQOL 3OD3A 1V5JA 3VXSE 3ARUA 5LN8A 1E4KC 4W9DC 4LHQB 3GSNB 4GI6A 4LMQE 4QYOA 2H47C 3DSNB 1JHTB 3EFFB 2PP9A 2VQUA 3L1GA 1E50A 1QBBA 2VLKA 4ACPA 2X9ZA 5IBUG 1BCIA 1XXFC 1J8HB 2PPDA 3P4NB 2WIIA 2VRKA 3E3QE 2VZVA 5EF0A 5L0QB 3RTQC 1MXDA 4HG4J 2K6WA 3MRBB 4PVBA 2HJKA 1AIFA 3KD4A 4ZO9A 4L8SC 2WB7A 2VL4A 3UGEA 2IFGA 3B2MA 1CLYL 1X44A 4PJXB 4XBGA 2G2NA 4YVUA 4C55A 2B9BA 1ZKAA 4XHQA 5T5FH 3MROA 3K7UA 3M17A 1OAJA 1KTLB 1XIWA 1ZPLA 2EIEA 2CCLA 4PJ7A 4AWJC 2NUPB 5DQJB 5A7EA 2N1KA 1MFDL 3PWPD 4K9JA 1MWOA 5JYMA 4RISL 1O5DT 1RQ5A 4ODTH 5D1XB 3MKKA 1ZT7A 2WXQA 3R18A 2VR4A 3AG3B 1AD0B 1KCRL 3UO1L 3WY1A 1HVXA 3GM8A 1G1OA 4X8XA 3Q06A 3CLEL 4FQ1L 2R8SH 4FABH 4P04A 1DQLL 1ZE3H 4HU8A 1A6TB 1KSRA 4PEEA 1B3IA 2D7TL 3MC0A 2FO8A 4PJFB 5DJ2A 5KSUA 3ZHNA 4GQPH 4WO4D 4YUEL 1TZOA 4UT9A 4DTGL 1W0WB 4FD0A 5C0IB 2G0LA 5D70H 2EYRA 5DQDL 3GMMB 4XVJL 3D3VA 4MJ6B 4QO1A 2YD7A 3J27A 3FT2A 5B7MA 4DN3H 4E0RB 5EU6E 1A4KB 2IAMC 3S35H 2HCZX 4Z8FL 1GY1A 2V2TB 1T5XB 2IPKA 2GFBA 3DI2B 4NO3B 4DGYL 2BCKB 1OGAB 1H3PH 2RD0A 4JW3A 3OLGA 2YSSB 2B1AH 5E2TH 1GYUA 3DROB 3QORC 4NQVB 5F2FA 3SBQA 3KBEA 4CNIB 2J1KA 1KWKA 4P5MB 1TLMA 1C12B 4U2ZA 2G5UA 2ZIDA 2X4PB 3QGVA 4PWEA 3E1F1 1HAWA 2GBUA 3TV8A 2APWA 1SQMA 2DQHH 4HZLB 4M8RA 4JRXD 1USZA 4MA3B 3QUGA 5F6IC 5AZ2L 3BKJH 3MGAA 4DEWA 5C0FA 3MTRA 1KELH 3QNFA 4GP5B 3PJNA 1RZKL 1BJ1J 2KLTA 3L3IB 4GRLD 4M93C 5C09B 5GSRB 5EZJB 4QUOA 1N6QL 3LZLA 2CO2A 4W9HC 3WJMB 4MA1C 1EAJA 5BRZE 2C9AA 1CI5A 4LSSL 5E8OA 3GO1L 4MD0B 4W9LC 2IALB 2YD8A 4LDOB 3FTGA 4J6RH 1AGFB 4QRFA 3GXDA 2KYIA 5I1EL 2VDQL 2P44B 5LB1A 4I4WB 1T1YB 2WZPD 2Z31D 1TJGL 1GGYA 5E03A 2H2PD 5JQ6H 1YPZE 2JB5L 5E6YA 5IQMA 5C0RL 1MJJB 4FQQB 2V2XB 3V6FB 4IHOA 1F8TL 4HKJB 15C8L 2NZ9C 3K2KA 3E6FB 1XT5A 2V5TA 3KCPA 2CGRH 3C12A 3FQRB 4OQTL 2D03L 1PSKH 5L8JB 5DLMH 2BERA 4TM9A 1D7FA 5FO7B 2Y1ZA 3JV5A 2VXVL 1RK0A 4U31A 1GOHA 4U05A 3JYBA 4CRPA 2EE3A 3RGHA 1WICA 3EHBD 3QJHB 1SHWA 4NUQA 4ZX6A 4AW7A 5DS2A 1Q0YL 4EXPX 3MNWA 4JFEA 3ESNA 3ARXA 4AQOA 2JXMA 3U6RB 3VG0L 4CN6A 1P84J 3SPGA 1NC2D 1VERA 2UY6B 4U6VL 1JRHL 1AR1B 3RX9A 4PLNC 4DIXA 3HS0A 3NFPB 4G5ZH 4NPYB 4F7EA 2R2CA 3NT0A 4MJID 4UB0H 3BP5A 4WV1C 4AITA 1BG9A 3UTSE 1FUNA 3Q5TA 4BSWA 3II2A 4NP4H 4QF1B 1JIBA 3D2UA 2ZKMX 3LKNB 5E2VH 4N2FA 3TBYA 4IBZA 1TUPA 1RD6A 2BIQA 1RULH 2CO6A 4ODWB 5INDA 1NGYB 5HGDB 1BBJA 5IMLB 1DLHA 5AWNH 2DM2A 2EIDA 1HIMH 4HALA 2BMKA 2WLHA 4Y5VC 1NICA 4DAGL 4NKIL 1RH8A 2HMID 5FO8B 3LD8C 1FVCB 1Q1PA 3GKWH 4NSKB 4GAFB 4ETYA 2W5PA 3BN9D 3U4BL 4BFEA 2N59A 4IGBB 2EEDA 4ZSOB 2AVGA 4RGND 4JAMA 3O81A 2OMZA 4K7FA 2GY7B 3BRFA 1DL7L 2DQDH 4DZBB 2J88L 3MJ9H 2GUOB 3FU0A 1W8OA 4ACTA 2CBTA 4OUUA 3GLZA 3W9DB 2OULB 4DVBA 4HF5H 3VSUA 3PNWA 5F7UA 1OZTG 3D4ZA 1E4HA 3RY4A 1CFQB 4Q74A 4LFHG 3VWKD 2QHLA 1BVKA 1VEOA 4PRIE 3BRDA 5F1NA 4U0RC 4PIRF 5I26A 2YR3A 3JT0A 4PRHD 3EUDA 3CIQA 4LESA 1JFQL 1JNLH 3AGVA 4M4RA 2WTRB 4C56D 1BBDL 2IANE 5FUCE 1ZPUA 1QFPA 1KOAA 5IB5A 3AUVA 3TT1H 2O6EA 1KV3A 3APNA 2IGTA 3FXIC 2LE9A 1BQKA 4P5TC 2XXFA 1CU4L 2Y7QA 3QPKA 4QMEA 1XCQB 5CCHE 3EKCA 3H56A 4UOQA 2WXLA 3I2CL 1KYDA 4LSVL 3WDJA 4CJ1A 4OLYH 3VD2A 3W1ZA 1QFWI 2JLPA 3D9AL 1AMXA 4PJIF 3G3LA 1N6VA 2XQBH 1VFUA 1UTDA 1NFDA 1CLOH 4HIPA 4PREB 4UYQA 2BWDA 3DDFA 1IJ9A 2Q3AA 2I9LA 3IRCA 3M86A 1BXVA 3I3EA 2GT9B 4GAGH 1OOAA 1CD1A 3NCXA 1BSIA 3KPOB 3LPGA 2DYRB 2XKNA 5JHLA 4MZRA 5K59F 3WFHA 4TLTA 5LGJB 5FX3A 1EMTL 3VXQA 4JKNA 5F9WB 2K0RA 1JPST 3GRBA 4U4IA 5C3TA 5C0DA 2MKWA 4M7KL 3BWSA 2ARJQ 1M05A 3TF4A 1EEZA 1MLBA 1ZHNA 4QI3A 2XBZA 2DMHA 4OVVA 1AHWB 4N86A 3FOLA 1GTNA 2L4OA 4NKMA 1OAZL 1TTCA 4XCEA 1G7MB 4YGVB 5JIKA 1A4JA 5ILTH 3RFRA 3O9WD 1DBKH 3ARBB 4OZ4B 2VAAB 3TM6A 2FSEB 3DHJA 4P2QD 1CR9H 4HIJA 2P5WE 2DWEA 2XIBA 3AS0A 5HDOA 1IVLA 5C08E 2MPAH 2XRAH 1ZD6A 1AFVL 5FKPB 3EH2A 5FS5A 2CLZB 2AXJA 3HOGA 5MI0B 4Y1AE 5SX4H 5EMYA 1JWMA 4P5TA 4JFXB 4H8VA 1G4MA 5EC2A 5IHUH 2V7HB 3GBEA 4IKIA 5DMYA 2OMVB 3ZT5A 2ZUVA 3A0OA 4A7SA 3GSVA 5CCJA 5E4IA 2AITA 3NIGF 1IGML 3EOAA 5FUOL 1QSFE 3NCFB 2OQJA 4S2SB 4MLSA 4OB5L 3W5MA 4OD3H 1HSBB 2X38A 4X9YA 5JA9A 1IILE 1OGAD 4KJYA 4ZS6C 3KPSD 5L8LB 1IM9D 2IEPA 5A43C 1DJYA 3UDWC 3ULUE 3RHWF 1S7WB 3FCBA 3K71B 4QHMB 2BZ7A 5FA4B 1IGIH 1A0QH 1HHIB 5J56B 4ERSL 4IMKC 2VL5A 1NDMA 4P23A 1JZHA 4V1DD 5FM5O 3O4OC 1SLWA 3QUYC 5D6CA 5FEBA 4NWTL 2CK0H 2UWEE 3K0YA 5HDLA 12E8H 3A6BL 4HWBL 2OZ4H 5GJTL 4YDLC 4YLCA 3GDCA 2YD9A 3T0DA 1MCSA 3N50A 3LZOA 5F7YC 5E8NA 3CJJA 4EDXA 1WH0A 3CZKA 2R4RL 1WFOA 4DK6A 1EJFA 1SOQA 2P8LA 3P4MB 4KRPB 2VO8A 1PLCA 3HNVH 1MG2C 1E28B 4PJ9B 1CXIA 2X42A 1PZCA 3GSRA 2AKRA 4TVPE 1Z9SB 4WSJA 1VPOH 4ZFQA 1HNFA 5H37H 4O02A 1TQCC 3ZE1E 2OJ1A 1JGUL 1PZBA 3I02A 4X80H 1M7UA 2CR0A 3QQ3B 4AUUA 2OTWA 1WBYB 3T09A 4TRPL 2NUTA 4YXLH 2W8CA 3BVVA 1TFPA 2QSQA 3APDA 5KS9E 3JZYA 5I1JL 1EHXA 4PJHE 5B3NA 5ISZB 5CBAA 3S2CA 4N0YH 1X7QB 1J0YA 5JPMB 1XEDA 4JGUA 3UDWA 4Y4FC 3IDYB 4MMXA 4UTBL 4JMNA 3BKYH 1CFTA 2HN7B 2DIEA 5AYQA 4P2OD 5BV7H 5GZOD 1QPKA 3OG4B 4QAWA 4LSPL 4QLWA 4OI9A 3R1GL 4IMKA 5GS2D 1DQIA 5DJDA 1I8MA 3QUYA 5F1OB 1J1PH 1E9PA 2CRYA 1AR1D 2O1AA 3NYKA 4FYRA 2GB2A 4NQSB 1MCBA 1N8ZB 5CINH 4C4KO 1BZEA 4XNBA 3GMNA 5IGXL 4QTIL 2SEBA 1DQDH 4UTAL 1OF2B 1AZVA 3HB3B 5D4IA 4HJGA 3RDTC 3AXLA 2DIAA 1OALA 2J1WA 4M7LT 4NGHL 2ARJA 2DTMH 3MCLH 4AMXA 2BX5A 1M6OA 3LZNA 4CAGA 4LOVA 5T5NG 2X40A 5IHHA 3BWUF 5INCA 4XPGH 4OJYA 1ZS8A 1RZFH 2GJPA 4MD5B 1CL7I 1TZIB 4ZTOL 4KZEL 5IM7A 4NM8H 1INDL 4O9HL 2EVJA 1BQSA 1NCBH 1E5UI 5I23A 1S9YB 4RFOL 2Q6WA 3WV0A 1FO0H 4IGBD 2IO5A 3MU3A 1FGNH 2F53A 2GVYA 3CFQA 3SPHA 3P3UA 5T3ZL 4F8TA 3ZDXE 2X53A 2CM6A 1NUGA 5ALBH 3PDOA 2ZSVB 5D7LA 1G4RA 3MRJB 4HA1A 4LCWB 4Y4HB 4HWUA 1JZ7A 4EI5C 4Y4FA 4XVTH 1E8ZA 4XVUC 2FLMA 2YD3A 5FUZL 5EBMB 3SGDH 3F84A 5IB4A 4ZMNA 4PRPE 4WK2B 3T4AC 2LU3A 4L1HA 5DJZA 1HINL 4P07A 3SPIA 3BFOA 1CDUA 3O2DL 4WI5A 4N5UA 4F8PA 4Z7NF 2ICWB 4LP8A 5ESQB 3SY0A 4GG8B 5J3HD 3K81A 1P7QB 4HIQA 1SHSA 2KZKA 4YBQD 2ENPA 5AVVB 1GVIA 1UWYA 3KLSA 1MF2L 1T0MB 2X3CA 4TTDC 4WUUD 3BKMH 5A6MA 2WXJA 2XV3A 5EU5B 4PP1C 3WEOA 1JPEA 3TBSA 2F58L 2WP3T 3NZUA 1EDHA 4X42A 3F05A 3RDTA 3SE9H 2LFGA 1K4DB 2XFGB 1GYAA 3VB8A 2QQNL 4G8EA 4J3UA 4KVNH 4N5ED 3UG4A 3GMOB 4FHKA 4I3SL 4U3XA 3SGJC 2A1WL 3ESPA 3G7TA 3IMWA 4U1JA 5IBTL 3TFKC 3G5XB 3EO0A 2DQEL 1TMQA 1XZWA 1JUFA 3LJ3A 4PR5B 2QPEB 3MLXH 2BNQA 4OFPA 3QCTH 4KGJA 1S9VA 3D0VA 3V4VL 4WUKL 3C60C 5CZKA 3QUML 4OLZH 3ULVH 4KV5E 3L95B 3KPQA 3DURA 1HK6A 5DF0A 1Q0XH 3VXSB 1CD9B 1MIML 4MXVE 5FOJA 2I7OA 3RWDB 2BVQA 2J8HA 3K5SA 3EXJA 1PG7L 3HNTH 5M94B 1KJ2H 1YEEH 1C16B 1G7PA 4PLKC 4UQDA 2NY5H 3GJFB 4N9GA 5F7MC 4EI5A 1I75A 5EU3A 4TNFA 2ZKHH 2IGFL 3T4AA 4HU2A 2X05A 1MZZA 4K94H 1VFBB 3T65B 1NFKA 1A6AB 3GTTA 2HX7A 4BFFA 1LO4H 3P2BA 3Q3GB 3FUJA 3A67L 3VFRB 1SY6L 5E00B 2P49B 4OCMC 4PJ5A 2HP4A 1JV2A 2CDEA 1IU1A 1MFCH 5CILH 3BAEH 1PEWA 2G5BA 3GXPA 1BF2A 1CICA 5I6LA 4JFYB 3D69A 5I6NA 4O2EA 2OXHB 3NCJH 2BFGA 3MV11 1FZOA 3BLBA 4HUXB 1FFPB 1N4XL 2ITFA 1IBDA 3ZKQD 5ABDE 1NMBL 5ID0B 3CMOL 2PTUA 3K2UH 4PJ7E 4L48A 1QLFB 1CDGA 1UT9A 4AJ0A 4F9LA 5CCKH 4JO1L 2B1HL 2A83B 3VGBA 2H6PB 1UM6H 1QAWA 1X4ZA 1CS6A 1JV5B 2TSAA 2ZWNA 3I74A 3O2VL 1QEXA 5EOTB 1CVRA 2D8KA 5FDWB 1PY4A 1XGUB 3OV6A 4G8AC 9CGTA 1PZ2A 3VD9A 2KC0A 2BHUA 4HDIB 1YAIA 4O4YL 3LNIA 2BHZA 4E9WA 1JHLL 1BEYL 3TH3T 1NL0H 5AOLA 4OF6A 3QDJA 3LZFH 1NCWH 3N41B 5DRNA 3DV4B 3QA3B 3QG6A 3STZB 4XNZB 4Z3JA 3KGSA 4LLYB 5E6ID 5HTSA 4GSUA 4CGUB 3LEYH 4AVHA 1U2HA 1ET7A 3BAIA 1BECA 1ZT4B 3HEIB 4HIHB 4OAWA 3SE4C 3SJVA 1IGTA 4NN7B 4GSDH 3F7YB 2I5YL 5D9SA 4GXUM 4H40A 3EH4B 3ZOAA 5C9JA 2MNUA 3NP4A 4QHNB 1WEJL 4KKRA 4WU5A 5D7KD 5IHWA 4KRPD 1VIWA 1DBAH 1PGRB 2F7RA 3H9HB 3IRZA 1MRDL 2V8MA 3HZYB 5IG7A 4G7VL 1BFTA 3S5ZA 5HYJA 2AQTA 2PW2B 4JFZH 4S1RL 5GGUB 3VJ6A 1QSEA 2R23A 4YFLI 2WLLB 2WW8A 1IC7L 5LO7A 1I7TB 1EH9A 5DHVA 4D9RD 4XNQB 1JK8B 5BRZB 3U30C 4OTXH 2NNFA 3A47A 1GGUA 4U1MB 3TBTA 4GO8A 3TT3H 2NXZB 4APQC 3NJMA 3TOPA 2FYYB 4QTHB 1IARB 2WSPA 4LKCA 3BD4A 5CD5D 2X88A 2V4LA 1IQWL 4TSCL 1ZDSA 2C9RA 5AG9A 2IXQA 1U8OB 2XNAB 4J39A 3V7AE 4QT5B 4EN3B 1NBQA 3CLWA 5J8OA 4OCSL 5JQIB 2CZNA 4LMQI 2VISB 5BRQA 4JFOB 1Y18A 1YPZB 4KQ3L 4OIAA 3EYFB 2EDNA 2HH0H 4J8RA 1RVFH 1TJXA 2XG4A 3CDGB 1CUOA 3UJJH 3JV4B 3IDJB 1JNJA 3KXFE 4FDWA 4N25A 2WKGA 4N8CH 3VA6A 4X99A 5TDPA 4E5XB 4J2XA 5BXFA 3B7YA 4UILH 1A14L 5AOKA 3SE4A 5LN4A 3HB3D 4KXBA 1ZHLA 3QXUA 1SEQH 4PLJD 1WZKA 1OAYL 2D0HA 2VABA 3VTMA 4DETA 3P3YA 5EUOF 1KYFA 3V0AC 3DUHA 1UM5L 1CJYA 2MEJB 4OF8A 1MEXL 3FUIA 3KWTA 2YSTA 2WINA 4OIIH 3O4LA 3KPRD 4G6JL 2PNDA 2W59A 5LG1A 3V5KA 1DZ0A 2OX5A 3DX6B 2VH5L 3Q1EA 4YWGH 4AH2B 1ODAA 2WVSA 3F62A 3NSDA 3LV3A 4UDTA 2CJUL 2YBRB 1E5YA 4E9VA 5D8JL 1CDIA 3LEXB 3T6WA 3DUUB 2AJSH 1N67A 3QQ9D 4KXAA 4OJAA 1N19A 2N01B 3NSYA 4XN2A 5A16A 1UQSA 1C1EL 4APQA 3V8CA 3MV7A 1WFMA 3T6QC 3UTSB 4F3FA 4ZZFA 1PFOA 4QRPD 5D7IA 2H4EA 1MCQA 2F8OA 4Y4HD 4MZ2A 4N90E 1ONQB 4E41A 3FQWB 2J3SA 4QRTB 3US1A 2WVVA 4G59C 3EDDA 4U6XB 3DOSA 2YGNA 4PJGE 2JVUA 3CC1A 3NUKA 3KDPB 3RVWC 5HYIA 4A38A 3X2QB 5D72L 2PXYB 3WKNA 2Z8WC 1FQ9C 1HXYA 1Y0LB 4TS6A 3RY6C 3VXPA 4EVNB 5KVEL 2GSIB 1H8NA 4HFUL 4UM8A 4UOZA 5F9JA 1FNSH 4PY7A 4LVEA 1FZKA 4G3YL 1MUJA 1H3XA 4ZX5A 3W5NA 2D7NA 2FQGA 2VR7A 3BUYB 2WGNB 3B83A 3WS3A 5I5MA 5JPNB 4TOYH 2X4QB 3KVPA 2AI0L 4TUKL 1CLYH 4FQPA 3BIKA 1ED3B 3J2PA 5ESAA 3EADA 1KTCA 4PWFA 4DFHA 2XQYK 4LPWA 1AG6A 1NEZB 2PN5A 1XBRA 3SEPA 3F12A 1IBZA 4PRIB 2WCSA 4XN4A 1S46A 4LEOB 3C6SB 2NY7L 3S36X 2QQLL 3Q2WA 4GP8B 1KEGH 4Z7UF 5CWSA 2FECL 3EJZD 2P5EA 4ZFOL 3GXMA 3ASOB 2Y7MA 3SD5A 5E9AA 4KI1A 2EO1A 3L1FA 1KCRH 3UO1H 7FABH 1FL5B 5EN2A 2WXGA 1IUZA 4ZXBC 1XTLA 3DBXA 3BZEA 4FQ1H 2IFFH 4PB0H 1DQLH 2J6EL 3BWUC 5EDSA 2EC9U 3X13B 1KBKA 1RZJH 4MS6A 4UM9A 4NC0B 2D7TH 3AT0A 4ZUVA 1R5IA 1S5IL 4YUEH 4DTGH 3V9EA 5EC1B 5EV7A 1WFJA 1NMAH 2X7LA 3F83A 1A6UL 5AB0A 5DQDH 4YHZH 1FFNB 1XGRB 3RY6A 4XVJH 3PS6A 3PWLB 4IIZA 3UAAA 1TVBA 2UYLB 4NCDA 2JTDA 1LDSA 1PLAA 4ANVA 4UCFA 4XXWC 1OGPA 3VVWA 3CXHJ 1XH2A 5IJCC 1DSFL 3B8SA 1OE3A 5C8JA 2ATPA 1N5AA 4YAQB 2BRRL 5KVFL 5KYXA 5AW1B 2W9DL 2K3TA 3QPQD 1ORQA 4NNXA 4GUPA 3ZTJH 5H94B 2VE6A 3UPRA 4RWHA 2XWJB 1N10A 4JANB 2I9TB 3B5HA 3MFFB 4HJSA 4U1LB 4G8GD 1BZ8A 4KOCA 3L81A 4UV4L 5F97E 4K3GA 4K7PL 5GZNC 2P5WB 1DE4A 3ZRSA 1ZA3B 1N6QH 1UWXK 4Y5YB 3BVWA 3WN5C 1SEBB 3MBWA 2OS7A 1AXIB 1RHHB 4Y1AB 1AP2B 2G4GA 4ZXBA 5D96B 2YN3A 5EZLA 3BUBA 4L9DA 3GO1H 4D9QD 2HTLD 3BSGA 1X5KA 3LCYA 4HUVB 3ZK0A 1S7RA 1ZHBA 2DLFL 4KK9C 2MRYA 3LXAA 2P45B 3L3JB 4L37B 5BQ7B 5I1EH 3H2WA 4HUUA 2H3KA 2PETA 2ZKYA 1EIBA 5KSVA 2B4CL 3SDYL 4XCNA 4I18B 2JB5H 1RP8A 5IT2L 4V2CB 3TCLB 2X4OB 5C0RH 2R1XB 1CGWA 3KWXA 3FCUB 1F8TH 1U8CA 3T4YA 5C2BL 1RAMA 2VSKB 3FB7B 4FQXB 2EUWA 4OQTH 4XXWA 5T33H 2WWOA 4JM2B 2D03H 5K5YA 5I1CH 2BZCA 1PU0A 2WKLA 5DYFA 3BH4A 1RK7A 2VXVH 5ALCH 2CH8A 5FGSA 3IETA 1INQA 1IEBA 4X4ME 3HKFA 2CHWA 1EEYA 2UWEB 1CG9A 1SYVA 3NP3A 4PV9A 1MDAA 1CK0L 1ROWA 1MWAL 1XB3A 1Q0YH 5E2WH 4Z7OF 5DVMA 1FN4B 1MG3C 4F57L 5CEZL 2NXZD 2PTVA 4HH9A 4AEHH 5DWUH 4A04A 4UINL 2JKSA 1AQKL 4YR6A 3CN2A 3FKUS 4OQ1A 2ITDB 4NKOB 1L9SA 1JRHH 4BFIB 4NHUA 1T83C 2E7MA 4KOBA 3WN5A 4N8VG 5E5UB 5I76A 2YZ8A 1M71B 1V3KA 2C7FA 4EN3D 2OXGA 3BGFC 2EEBA 5EPMB 4CW1A 4I48A 3P1VA 5IFHH 3QFGA 4BCXA 1XGZA 4WFHE 3CDYA 5GISL 4LEXL 4XX1G 1FG2B 2ITCA 1GGTA 2AK1L 5KJRL 4KKBD 1UGKA 1R0AL 4ZZKA 1NUNB 1TYRA 1LEKB 5KS9B 3VSVA 4JFHD 4IBYA 3QHFL 2FZ3B 4PJHB 4PV8B 3MRNA 1LNUB 2ZYIA 4N8PA 4JRYA 4YNYB 2I26N 4P3WA 3ULAB 4RIRA 5EU7E 1E9QA 5LNGA 4PRDA 3U7YH 3OKEB 3U4BH 1UZ6F 1JI1A 4WKZB 3E2HB 3C8KB 3HMWL 4NFDA 2XVGA 1FNGB 4QWWD 5DD3L 2OMYB 1YRKA 5JXEC 1BVNP 1HHJB 5IQLA 4AEIH 5CLZA 5KVDE 3FB8A 5I6MA 1WBZA 4P99A 3POHA 5IV2B 5FYJE 4RMSA 5ICZB 4WVRA 2OSWA 2LHAA 3RUGE 3HC0A 4RZCB 2WUCL 5JHDA 4ELDA 5EEZA 4OCXH 3ILPB 1V10A 3HRZA 1NSNL 1TG8A 5AL8A 5DU7A 1DTUA 2FX9L 4KI5E 5I1IL 1YMMA 2CKNA 1SF3A 4TN9A 5A6IA 1W8EA 2W95A 4MMZB 4QXWA 5C92A 1JFQH 3BVXA 1WITA 4AIZB 5L7XL 3RVUD 5C97A 4WF7A 4XMKL 1BBDH 1JNHA 3WXVH 3C87A 5SWZE 3TH2T 4ZUSA 4KAQH 1LGVA 4UDUA 1OT4A 2PXYD 1X5FA 1TQSA 1HZKA 1F97A 1QFHA 5E4EB 2XV6B 4HEMA 1O6TA 4JGMA 3I2CH 4LSVH 1Q9WB 2ZP9A 3BZ4A 4AY0A 3GSOA 3FHQA 1NAMB 1DHKA 2YEQA 2VDMB 3ZDXB 1ZHKA 2EUVA 4G6MH 2DEWX 1QLRA 3QEQA 4FXLA 5LCVA 5LQBL 2Y0SA 1YEKL 2DOCA 2J43A 3SPJA 4QHKI 1V7ML 2UXVA 3KDMB 4PRPB 4HUCA 2HAZA 3A4AA 3B7UX 2BP0A 4PCTA 5D7LE 3SKMA 1JZ2A 3FK3A 1XF2A 3GBLA 5T1LD 2E46A 3CBJB 4NQDD 1CFMA 1X5IA 5JXEA 1S7TB 1EMTH 2ZWLT 3B2VL 4NIYE 5C07A 1GAFL 2R0KL 3NCYP 1A6ZB 3S4SB 4O5LL 5HYSG 1VFMA 4UQCA 5LBSL 1M7IA 1KXTA 1S7QA 3BD5A 3GRWA 2DQTH 3W11C 3C5ZC 2OMUA 5DD6A 4AUJA 8FABB 5J1AA 4O2CA 1DQJB 2ZCLL 1EZVY 1FIEA 2BVPA 1QWUA 1QKZL 3UERA 1J0KA 4JO4H 3VB9A 2EDTA 1C08A 5I1LA 4G8IA 2AVFA 2ENJA 2RJMA 1MJUH 3TXAA 5DJXA 3A6OA 4GEIA 3FQTA 1ETJA 4DZ8B 5CP7A 1WAAF 1HHGA 1WC7B 4GW1B 2VERN 4L29B 2AEOA 2X0VA 4M56A 3RLSA 4I87A 3WTXA 5FUOH 3AGWA 5ANHA 1RJYA 2V2WA 1NGWA 4GKSA 2BPBA 4OB5H 2WJ5A 1F00I 4ODUA 3VDAA 1MAJA 1A1MA 4J3BA 4XOEA 5DJ8B 4LRNL 5FKAA 5MHSD 4NEHB 4A2MA 4RVBA 2WLKA 4U1IB 2FK9A 1XXDC 4F9PC 2R29L 1T03L 2VLKB 3DOIA 1I1CA 3IXAA 2PCFA 2WIIB 4YXKL 1ACXA 1ZLUK 5TDOA 5KVGL 5HYFA 2HJKB 1AIFB 4NWTH 4V11A 5HGGS 4UBDC 4D0BB 3A6BH 1E4JA 1YNTF 2ALAA 4FJ6A 3C5ZA 4KKLD 4ZFZB 3TN0A 2Z4TA 1PBYA 1XR9A 4XBGB 2BFVL 4G7RB 5D2LA 5EUOA 5EWIH 2R4RH 4LKXA 2AHIA 4NO5B 3MROB 3M17B 1XIWB 1FH2A 3FO2B 1RIVL 4PJ7B 5AB1A 4JCWA 2GQHA 1LYQA 5F7BA 2XA8L 2DMCA 4UQ9A 4K0OA 1ZT7B 4LT7A 5A3IC 2BW5A 3DX2A 3TURA 3EGXA 3QHZL 2WOBA 2BVOA 1ADQH 4JFDE 1JGUH 1H15A 4YQXL 3BJLA 5CKAA 1LEIA 4HLZG 4RDQG 2JKXA 2RR3A 4FQXD 4TRPH 1YEFL 4ZQKB 3QO1A 1XF5A 2PMZA 4TSAL 4RNRA 5I1JH 5EFIA 1BZQK 2JI3A 1OARL 5ESVA 5DJ2B 5KSUB 4OR1A 4JBSA 4LHUG 3G5ZA 4Y2DD 5J13C 1OWRM 4UTBH 2EYRB 4B5ZA 2WVUA 5HHXL 3OWEA 4F9PA 4FXKC 2HFEB 3D3VB 4QO1B 3QDJE 4QY8A 1HOCA 3PXHA 3FT2B 3R1GH 2LU5A 1DJGA 2Q7NA 3LS4L 4X7TB 1Y1DA 4WTZG 4G9FA 4XI5C 4B0MM 5LWYH 3UGUA 2IPKB 4OGAD 2GFBB 3U2SA 3OKNA 1NOAA 4H13C 4DGWC 1DCEA 3JWOC 4N2EA 3VE0A 5TE7L 3QFJA 3BT0A 1HYSC 2XU9A 5JIHA 1N18A 4QTIH 3UP1A 4DGIL 5IGXH 2QGCA 4M29A 2PWEA 4JFSA 3VD7A 4F8LA 1COBA 4HS3B 4RETB 3NSCA 4NGHH 1GCYA 3QZPA 1CZ8L 2Y07H 1Q4NX 3X1BA 3KPTA 2LV4A 4MNHB 5C0FB 3EYQD 1BAFL 1DYZA 3KBHE 5E5LA 3IDXL 5TH2B 1F13A 5AVUB 4KZEH 3TVMC 3GZOA 4O9HH 1X5YA 4R3SA 4Z7UA 4G6KL 1M1SA 2EE9A 4PGZA 1NIDA 2PP7A 4DKDC 1DVXA 4O58L 1I9JL 2BOCA 2EXWD 3FTGB 1HH9A 5IK3A 5T3ZH 4S0SD 3E1ZA 1NFIA 4Z3IA 5EIQA 2QEJA 3V5DB 4FE9A 2WBKA 1J8RA 1TTGA 2APXA 3UH8A 3KXFB 1JPFA 4G43A 3D0AA 4D94A 4FXKA 5FUZH 4OCNC 5PCYA 3FU7A 1CXEA 1SXAA 5GXBB 1KTKE 2VUOA 4IHOB 4MLIA 1HINH 4QD2E 5J7CC 1J10A 1JPGB 4X6CA 2WN2A 1HESA 3O2DH 3PUUA 3WIHA 4J5VA 1ASOA 3KCPB 4HWNA 1KJVA 3L2LA 4K9EL 3WFDH 5DVPA 4IOFC 2FHBA 1SFHA 3V0GA 1GCFA 3RWIA 1LP9E 1MF2H 1RK0B 2V0AA 3NCEB 4WENB 1KACB 4X4ZA 5E6RB 4ZFGL 4NQQA 4YHML 3WDHA 3E8VA 5FB8A 1RZ7L 4OM1H 1T5KA 4JFEB 3MLSH 2JXMB 1WTGT 4NJAL 2BY2A 1DN2A 2HT3C 3N04A 4D7PA 3HKZA 3NGBC 4JZOA 4I3SH 5HGAA 2A1WH 2YD1A 5GIRB 5TQ0L 1T5WA 4Z5RA 3C09C 5IBTH 3HS0B 4PU2A 4DN4H 3TVMA 4F7EB 3O3DA 1OIOA 4QIRA 3F7KA 4MA1B 4UI2A 3UCRA 1VCAA 4DP1X 3BP5B 2HUHA 4JG9A 2WOYA 5E9DD 1KIUA 3V4VH 2QVKA 3MV7E 4WUKH 4L0PB 4N85A 4BSWB 5D7IE 1GYWA 4PJGB 4KDTC 4YE4L 3D2UB 4IU3B 1MIMH 2CKBH 3TBYB 4DK3A 4KY1L 4UQEA 1PG7H 4S1SL 3EYSL 3P4LA 4FQ2L 2CO6B 4FX5A 3UROR 5INDB 1HXMA 1SDYA 1GPOL 2DJMA 4WFGD 1T4WA 3KBPA 5KSBF 1BBJB 4TXVB 1J8KA 1DLHB 4X50A 1GJWA 2IGFH 2XY2A 1X5JA 4LSTH 2UXGA 1HWGB 3ZY7A 7TAAA 1UB5A 4HJJL 2OMNA 5F9OL 3RJOA 4PTUA 2ARWA 4DVRL 3MRKB 3W56A 3DPBA 3A67H 3IJ8A 1D6EA 4XHJC 1H0DA 2F19L 2ZD0A 3G04A 4JAMB 5AYUL 3QIUC 2OMZB 2BCMA 4K7FB 1MCRA 1ADWA 3GHPA 5E8PA 3WAJA 3OTTA 3W9EB 4DVBB 3BQUC 2NY2C 1U8PA 2W1NA 1PAZA 1UWXH 1X5GA 3AY2A 3VAEA 3F7VA 5IY5B 1UACL 5I5JA 4MMYA 1BVKB 2J5WA 1QUPA 3ILQD 2D31A 1NMBH 2FVNA 2VXSL 5F1NB 3CMOH 2FEEI 4MX7A 3SKUD 2XZQL 3L7FA 3ZMRA 4IIQA 2WQXA 1J1XH 3DWTA 1FC1A 4JO1H 2WTPA 2P5EE 1IM3A 4M4RB 3TTSA 3M1BA 1GZQA 4F27A 5J6HA 2BVYA 1WTLA 2AV1A 2GITA 2A6JB 2Q7YA 2ED7A 1N5YL 4LCIL 2A9CA 5DS1A 4EDWL 2AJ3A 3E38A 4KDTA 2YAOA 5D55A 3MA7A 2Y7QB 1DN0B 2VLKD 2C3VA 1OGSA 2ADFL 4KTDL 4P4KD 4IK7A 2NLJA 3FSVA 3D85D 4XVSH 2W65A 5FYLH 3APFA 2NX5E 3BYYA 2OJZL 1SJMA 4NC1C 1H8OA 3CG8A 3LSOA 25C8L 43CAA 3T3PE 3LD8B 4A7GF 1UD3A 5DXWA 2I9LB 5CN1A 5GS0L 4RZKA 1FLTX 5DJCB 4I85A 1CD1B 1BD2A 1KGWA 3WFZA 2FHCA 1RUPH 3D07A 1P2CA 2WYHA 2I5YH 2YPVL 3GZQA 3QIUA 3WFHB 4HC1L 2E4FA 1SBSL 3RJQB 2GBTA 3VXQB 2XTSA 2ZT9C 1BM7A 2L3BA 5IFJA 3BDXA 2RQEA 1MRDH 1M05B 3BQUA 1ET5A 1EEZB 1MLBB 5FO2A 4DEPB 3A23A 1OPOA 4U4BA 1RUML 1FORH 2VLJA 3FOLB 4NKMB 4PV1C 4S1RH 4L8CA 3QZOA 1A4CA 1IC7H 1A4JB 2AABL 2B5IC 2OM5A 3FAWA 3M7OA 3UTPD 1CD0A 1K6QL 5D2NC 5MERA 3QJUB 5JHBA 4HIJB 2DWEB 5FYJU 2P28B 3L1EA 1MCCA 4N1HB 3LYRA 4D3CL 1XBDA 5AVZB 3WFCH 1I8KA 1RZGA 1JWMB 1IQWH 2PTTA 4P5TB 2XWXA 4TSCH 2AK4E 3SGKC 5EC2B 3D3VD 4RCAA 1RZIB 4W9IC 2XXGA 4OCSH 4H0GA 2JK5A 1UOLA 4KQ3H 3QDMA 3DA0A 3GSVB 3RTQD 3AB0B 2HWZH 4HXAL 3EOAB 4L3FA 5HJDA 1PLBA 3SDXF 1JZ4A 2FBOJ 2OQJB 5HI5C 1IZKA 1UD2A 2XWBA 4LPXA 4KJYB 5LXVA 1LILA 2IG2H 4Z7QE 1A14H 1ODUA 2P24A 5K1JA 3QC6X 3VRIA 5BV7C 4AIEA 3RX5A 1HN1A 4WI7A 4HKBB 2GK0A 2BINA 1NDMB 1YNKL 2VL5B 4P23B 4AUYA 1JWUA 1FNHA 1NCDH 4M5ZH 3SCMC 6CGTA 5D6CB 1A5FL 4ZO6A 1FJ1B 1QRNE 1U3YA 5I74C 1Q9OB 2VH5H 5DD1H 4X5PA 1BOGA 1ET8A 5E8NB 3DVGB 3BW9A 4PPTA 2NQCA 4GAYB 4EDXB 2FEJA 3DVNA 3H7LA 3WKML 4YSPA 3REVA 2P8LB 5E08H 3BAXA 5DK2A 3UZQA 5CS7A 3GSRB 2AKRB 4XBEL 4LF3A 3PL6C 1G9NC 1MCOL 3GS4A 2Z0BA 2HFFA 4WW2F 3MLZL 5JLZA 4ZMTA 4O02B 5SV4A 3IM1A 2BHFA 3I02B 4OCLC 3FSAA 4Z3TA 1NIBA 4MAUL 2OTWB 4HETA 4RBPK 1MCPH 1Z6JT 2NUTB 3OZKA 2WQUA 2IAMD 2XT1B 1OT2A 2WLIA 3BEWA 3T2QA 1WAAA 4BK8A 5IEHA 2KLRA 1A2YA 5HHOA 3D0LA 3PJLA 4KRMB 4OD1L 4QPEA 5DEJA 1WA1X 4Q97A 5KVEH 3GSNL 2VDKB 3HZMB 4BCZA 5CBAB 1VDGA 5JO5A 3EBGA 1WQVT 3QORD 1PKQA 2V7NA 4MMXB 1QWHA 1SUHA 2CHDA 3FJTA 3ZE0E 3WMPA 4JFED 3AROA 5HYQA 1KPRA 1QW8A 35C8H 1NCCH 2P8MA 3BSZH 2AI0H 1LJMA 5CIPH 4G7YL 3RWFA 3EDKA 5I71C 3SCMA 1I8MB 3QUYB 1E9PB 1S5HA 1F3DH 2DQIL 2GCYA 5J11B 1KB5H 4FZEL 3GMNB 3IWVA 3RVVC 2HKHL 2HRLA 2SEBB 3EJRA 4YHIA 4HJGB 1YNTA 3AXLB 1S9XA 1AZBA 2CUIA 3ABLB 3B9AA 4E9XA 1HEJC 2VXQL 3OC8A 2ARJB 3D2UD 1M6OB 4NJ9L 3D2TA 5IHZB 1INEL 1L9QA 3KE0A 5INCB 1FRGL 5F9DC 4F58L 4WW1A 5HVWA 5ITBH 1ZS8B 4XCFL 4RSYA 1LK2A 4KROB 4L0YA 4NZRL 3PL6A 5IMKA 3VFUA 5IM7B 1BQHG 4EIUA 2NZ9D 3U0TA 1HL4A 2Q6WB 1ZVHA 3COOA 4ALAC 4BGLA 3JZ7A 4HEME 5IREA 5DZ9A 2D4DA 3SPVA 1KXQE 2XX1A 1B4RA 3W2DH 2E8YA 3CX2A 3PHOB 3T77A 3QJSB 2NY5C 3QEQE 3KWVA 1CF8L 4Y4KC 3PDOB 4PW3A 1OPGL 5D7LB 4Y4FB 1JTPA 2K6ZA 3VM5A 1V54B 2C9QA 1SHXA 4CA4A 3RYMA 2KQMA 4AZUA 5IB4B 4PRBB 4NERA 3IYLW 5KVFH 5CEYB 3IFOA 3LNGA 4ZMPA 4X4KA 1G0DA 3EG9A 1I9EA 5C07E 4OJEH 4K3EH 5ICUA 1UFGA 1G7JA 1NDGA 1M57B 3H54A 1HAUA 4JPIB 3EUUA 1HSAB 4LGRB 1O6SA 5ANMA 4UV4H 2BIPA 3C2AH 1OP4A 2Y23A 4GG6F 2DRUA 5CZXC 5C7XH 3OF6A 1E8XA 4G8EB 2VC2H 2H7WA 3AAZA 5IVXF 4JJHA 2DLEA 3A24A 4RMTA 1RZPA 4Y19A 4RAUA 4NXSA 32C2A 2FWSA 2RIKA 2DLFH 1JUFB 3UZEC 1JGVL 4FFZA 2BNQB 4BH8A 1S9VB 5F72S 2G5RA 3FFOA 4N8VA 1EUUA 4U1HA 2ZUTA 1SJEB 4W6WB 2MKLC 1BIIA 5IT2H 3DURB 3DECA 2DLHA 1ZGLP 2XQYG 3D39D 4N68A 1CGSL 1AXTH 1QFWL 1IBHA 4Y4KA 1ZLSL 4ATTA 4XNDA 1G7PB 4NKDA 2IPUK 1C8QA 2I32A 4N9GB 1D3CA 3MLYH 3WEAA 3O2WL 5EU3B 1U9KA 3P30L 1XZ0A 3VI4E 4G9DA 1XCTA 3BFQG 3MBEC 4YK4C 2L04A 2Q1EA 5BS0E 1MI5A 4PGBA 2N0MA 4YL4A 1FPTL 1CK0H 1DZBA 1MWAH 2DWXA 3FN3A 4JJ5B 4PJ5B 3MUJA 4G6AC 5HGBA 4WIQA 2CDEB 4W4OC 1OTTC 1LLAA 4KMLB 3ARFB 5FYKH 4F57H 3TWCH 2G5BB 2JIXA 3CQPA 1A9BA 1UYWL 1KN2L 2FWUA 3II1A 1AQKH 4UINH 1CICB 3MODH 1U2YA 3PGDB 3G6DL 1HJBC 4MSWA 3D69B 4O2EB 2BDNL 3RIFK 1PLGL 3MNDA 1FZOB 2Y06L 3QPXH 4P5TD 4OCRL 1JSYA 4Q0XL 4B9IA 5D2LE 1IEHA 3GTVA 5EUOE 3VXOB 3SPCA 3NJGA 5FFGA 4Z95L 1IAII 4BHUA 5T3XH 4JFDB 3MACL 4RFEA 4LEXH 2OL3A 5AW5B 3RBGA 4FG6C 2OP4L 1JVLA 4JUTA 3UZEA 1ILSA 5IQNA 2AK1H 4XT1C 4MGXA 2E9WA 4HOZA 2A9NL 3KEHA 4A6YA 1SXNA 1QEWA 1ZV2A 2Z9TA 2FATL 2J8OA 1MCEA 4AMKL 3ARQA 4YPGB 5K9OA 3WEXA 3H4FA 4X9BA 4YPJA 3QDJB 4M8UA 4JY4B 3GHEL 4WO0A 1TJMA 3B9VA 5DRNB 4Y9FA 3QG6B 1BQRA 3HMWH 2YGVA 3JUYA 5DD3H 3OC5A 5IJBC 5E8EA 1A1NA 2WXRA 4WTQA 2YQ3A 1OAUL 4OAWB 4BXSV 2YEZA 4LB8A 4M1GH 3WE1A 1Y6KR 2WUCH 1HWWA 1XB8A 4OH2A 5C9JB 1KYOK 4G9FE 1NSNH 4L8BA 2HVKA 3S48A 2FX9H 1L9TA 5I1IH 1R5VA 3V9CA 3SBRA 3QFJE 4YLQT 3DX7A 3I6LE 5IG7B 3MRRA 4BWWA 5D93C 3OXRA 5HYSA 3Q8FA 1X5LA 2R23B 3VJ6B 3WFBL 1RI8A 1FAIL 2JKLA 2WQWA 3KYNA 1MIEL 5IWLC 4MB3A 4XC1H 1WBXA 3BUTA 4FNLL 4EN2A 2VZSA 2AQSA 4PRNA 3OLEA 3TBTB 3EH1A 3N1GC 2WKOF 5DC2A 4ZS6D 5DI8A 4KTGA 2AJVL 2C1OA 4LKCB 4N6RA 3TBWA 3MA9L 4M9PA 4ONHB 3ZN6A 1SXSA 1V3JA 2UX6A 2B14A 3VX1A 2IXQB 4FADA 2DQ6A 5LQBH 1FIGL 1WRFA 1XH3A 1NJ9A 1V7MH 2XXCB 3D4YA 1BVNT 2A9DA 4J8RB 3IFNL 4I1NB 3QUYD 3ECWA 2WAHA 4B9YA 4UAOC 4X6DE 2XG4B 3QP3A 3V7MA 3CZEA 3QNZA 5AAWC 1C8PA 3B2VH 2ICEA 4X99B 5TDPB 5M95B 4N9OB 2J7LA 1FZMA 2R0KH 5BXFB 2GHWB 1LP9B 2YKKA 3K46A 1IKNC 2BC4A 4A7GA 1ZHLB 4X6CE 1O5PA 1SMOA 5C0EA 2VABB 3FHEA 1UXMA 3WGVB 4QRSA 1CIDA 3M88A 4XODA 5IBUB 2ZCLH 3V4UL 1D2OA 2CMRL 2WINB 2A74A 3FT4A 4NP9A 4N0FA 4QKTA 4KKPA 1QKZH 4NBYB 4R26H 5DQ9A 3V5KB 2OX5B 3MV8E 4FULA 3G5YA 4R5XA 2X87A 2BLFA 1YEHH 2VNCA 2PO6C 4G11A 2A99A 2VWEE 2Z3FA 3LV3B 4TLSA 4UDTB 3FONA 3HE7C 4NM4H 5IWLA 1UZ8A 4MWFA 1KLGA 1PCSA 5F0PB 3MX0A 1NLBL 3U30B 2F53D 5A16B 1UQSB 4APQB 1JI2A 3MV7B 4F3FB 1CL7L 1ACCA 5DT1H 3Q9PA 5D7IB 3DO7A 1OE2A 3RWEA 1JBJA 2KT6A 1OD7A 1I9RL 2X3BA 3OLIA 4Y4FD 3UJTH 4JY6A 2R2EA 1RLBA 2YFOA 5J0BA 3BPCA 2GBAA 1OSZA 3DOSB 1ID5I 5FW8A 3D50A 3FCSA 4LRNH 1YYMH 2E7CA 3U25A 4KMTL 1PX4A 1KB9K 4WW2C 4FKEA 1HDMA 2P42B 4UOJA 1WJ3A 3L4UA 1TO5A 4KKQA 3ZT7A 4D0CA 1HXYB 2R29H 3VXPB 1I8UA 5AAWA 4LP5A 2CRIA 5I5IA 3SDXA 4UM8B 1RMFH 4HUMB 5F9JB 4YXKH 2AJZA 4HCGA 4PY7B 4NFCA 5KVGH 1FZKB 2FT6A 4UIKH 1IKNA 4RMRA 3RDTD 3EJTA 3MTXA 5EUKA 5I15L 4LHUA 3BISA 1TYEB 4AQ8C 1KWGA 4KDVA 3EGDB 2YMTA 3VVVA 1NIAA 5EO0B 3KG5A 4R7VA 4X5WA 4U49A 3BIKB 5ESAB 2BFVH 4EBQL 5IROC 2I25N 2NW2A 3W0WE 1EXUA 3F12B 2HX8A 2PO6A 4WTZA 2BNQD 1RZKC 4KQ4L 4H5SA 3VWJC 1UOVA 4JKMA 2P5EB 2W0LA 3PUCA 4HWEH 2JJUA 3OJ2C 2ZG2A 5HVHB 1PZ5A 3BPNC 1U91A 5LGHL 2R2HA 3FU5A 1J0IA 4NRYA 5CXPA 5EN2B 5K1VA 1P53A 2NRDA 3OAUL 2Y5EA 4JQXC 4PVLA 5AEAA 3DBXB 4EI5D 3BZEB 1YEFH 4F2MA 5A2BA 1QI4A 4XVUD 3R8QA 4TSAH 2ZZUT 1ETB1 2WUBL 4QGTA 4UM9B 1OARH 4ZUVB 1R5IB 2XWEA 2X2YA 2Y7LA 4PBWD 2NX5B 4TLKA 2CDFB 4DP8X 4F7PA 4F92B 4GIAA 2K70A 2X7LB 3T3PB 3VQLA 3I75B 4PJ5D 3UBGA 4PGEA 5HHXH 1ERNA 4JN1L 4TTDD 1TVBB 4Q9BA 1A3QA 4FEMA 1TFHA 1KULA 3PWNA 4PP1D 3CXDL 3LMJL 4R96A 2H0FA 1HH6A 3KHOA 4PJBE 3LS4H 4XNUL 3P9MA 3F7LA 4XP6L 4X4XA 5GGVH 4F37K 4MS8C 3OAWA 3ECQA 4PY8J 1YNLL 3CTTA 1BD2E 4RRPM 4LPYA 2YAMA 1N5AB 3DGGA 3QWQB 3TBVA 2W60A 5TE7H 1Q9LA 4JRXA 2AERT 5E70A 1ORQB 2J1ZA 4NNXB 5IMMA 4GUPB 4FOMA 2ZYRA 2VE6B 5IROA 3UPRB 3HR5B 4ORGA 3FUKA 4AQZA 3RL2B 1E7UA 4P46C 3TFKD 1X9LA 3MUGA 3LRSA 1CZ8H 3QAZB 3GF8A 1ZS2A 3HN5A 3MLRL 4U6TA 1BAFH 3OAZK 3UGXA 2OI9C 3C60D 1DE4B 1FDLH 4MJ5A 3ZBMA 5L6YL 3B2UC 4MHHG 4WI0A 4ZODA 5SWQB 2DMKA 4UMSA 1VZIA 4G6KH 2Q20A 1A4AA 2YLHA 1SM3L 4HMEA 3CC5A 1PMYA 3PV7A 4JQXA 4PLKD 1OW0C 3MNVA 3HZVA 2Z8RA 3SOBL 3PGFL 2H41A 1I9JH 3H3BC 3MRCA 4GRWH 5CLTA 4BE5A 5ACLA 1S7RB 1ZHBB 5AZUA 1CBJA 2BIHA 2EVHA 1EX0A 3WNMA 3GFUA 1NBCA 1D9KB 4H1LG 2YAPA 4HUUB 4PJEE 3IPFA 3OR6A 5CGBA 4IHBA 4X0KA 5EOCL 2GEEA 3SJVD 3RWHA 5C0AD 2JJVA 2FGWL 3KL3A 4F33B 1UASA 3OR7A 2H1LM 2Z6FA 4CILA 2BWQA 4OLXL 5CBEA 4PS7A 4JDTH 1F90H 3T4YB 3V4PA 1FA4A 4CVZA 4K9EH 3AU1A 1WFTA 2Y7OA 4X8GA 3SO5A 1KTRL 1OK0A 4NLAA 3ARDB 3IETB 1INQB 3P0YL 1IEBB 5HYJD 3KPNA 4JO3L 2QELA 2FNWA 1EEYB 4ZFGH 1CG9B 1QRNB 1SYVB 1QSED 5HD8C 4YHMH 4PV9B 3LXCA 3OPZH 5IFAH 4UQIM 1WWAX 4XP9L 3N0PB 4KK5C 4P46A 2YA1A 4ZFFA 4NJAH 4NQTA 2F7OA 3R0MA 1DQQA 4HH9B 4LSUL 5JYLA 3S37L 2UZIL 3TP4A 3U79A 3S9DB 1UB6B 2ZXEB 5TQ0H 4FNTA 3BEVA 3NAAL 4MD4A 4JZJC 3WN5B 1W72L 1P1VA 2NNAA 4JHVA 5GRUL 3VXTA 2C9PA 4GG6A 3WG7B 2OXGB 1B90A 1ZIBA 2AEPL 1JK9A 2LLGA 2P47B 4Y7OC 5FCSH 4CW1B 5JOFA 1GYVA 1OW0A 1I1AC 4PWGA 4QXUL 3V6ZA 3HC4L 2OKMA 4DWHA 1U4FA 4YE4H 1UD4A 1XF1A 1RY7B 3MJ8A 2ITCB 3K6SA 4KY1H 3BAJA 3CSBA 4S1SH 4YJZL 3LPFA 4J3VA 1JDDA 1R47A 1GPOH 2K7PA 4A39A 4F2FA 2R0LH 4R97B 3LY6A 5E8DL 3VFPA 1MCLA 1J9RA 1TF4A 1Z0NA 4JRYB 4MA8H 1FNAA 2CRMA 4JREC 4WI8A 4HJJH 1E9QB 5DHMC 4XN1A 5F9OH 3FB5A 3LDBC 1ZRUA 1YJDL 2BXYA 4PRDB 3D51A 5HHOE 4DVRH 3RB7A 1PKQE 3O4LD 3BVTA 5I8OH 4BFGA 1NAKH 3FB8B 1JYVA 1YUHA 3WBDA 3UFIA 3CPLB 1YZZA 1J88A 3HC0B 5T3XE 5JHDB 4N2CA 3PP3H 4QR7A 4APQD 3KPMA 3HRZB 3MV7D 4PRHA 3OHXC 5IB2B 1J5OL 4OFVA 3IE9A 1TU2A 3KL0A 1F6FB 2VXSH 1VAHA 2NY3C 5AQ0A 1RJCA 2O61A 1GY2A 3H42H 3IFLH 4JZJA 4OLVH 4E41D 3NESA 1SGKA 4WU7A 1KXHA 4FQJL 3ECBA 4H88L 1CGTA 4JJOA 1JNHB 3BGFB 3DXAA 2GUYA 4ZUSB 3SKJL 1I1AA 2KDGA 4UDUB 1N5YH 2WO2B 1R33A 4NLHA 5D4JA 1UCTA 5AOIA 1NCTA 2E8ZA 3CLFL 3HCVA 1N3NA 3KS0J 3MPCA 2O5ZH 3T0WA 1VLXA 4EMZA 3BZ4B 3GSOB 2YN5A 3BGMA 3QUKA 2A4ZA 1J48A 3CHQA 1ZHKB 3LZRA 1PZ3A 3BPLB 2C1PA 1QLRB 3QEQB 2OJZH 1MFBH 1ZTXE 2FB4L 1ASQA 3N1MC 4M5YL 5MEPA 4WFEE 25C8H 4ZTPL 3GMPA 1M56B 4P49A 3V0IA 3WMQA 5GS0H 1QACA 1URZA 2IBGA 4H8QA 2X9XA 1KBGL 1R19A 3CZFA 1DQML 3GEWB 2BP0B 2YPVH 1XF2B 4A2FA 4HC1H 4LLQA 1D5MA 3GXFA 3JTBA 1SBSH 2OLDA 5BQ7A 3IMBA 4I1PA 3WIAA 3NJKA 5C07B 4DPCX 3V9FA 1M9SA 4I0PC 4MXWL 5D5MF 1JHKH 4AQEA 2IH9A 1KDIA 2EXTA 5IOPB 1ECYA 2JH2A 4LVHC 3HI5L 1JL8A 1GMIA 1KXTB 1M7IB 1S7QB 2DI8A 3VFMA 1NOLA 3OHXA 4J1UB 3LHPL 1RUMH 2X89A 2OMUB 1EO7A 5DD6B 1BGXL 2AABH 1NMCC 1IBYA 2F0CA 4O2CB 4R4BA 5J1AB 2JTYA 5SWSD 3UEQA 1QFWM 1Q9KA 2BVPB 1EHKB 1K6QH 2Z7ZA 5B3SB 2WBJC 1VF5C 1GL4B 2JKIS 2PUQT 2WY3B 3RURA 1C08B 4D3CH 5I1LB 2CUMA 5ID1A 3VMPA 1OV8A 4W9FC 3RVWD 2FRGP 2WGXA 5DJXB 4Y19E 4FI8A 1M1XA 3JBG7 5CP7B 2BSBA 1CF1A 5BZDA 1HHGB 1IE4A 1WP6A 2CIKA 3TEUA 2VB5A 2XCMC 2XICA 4JM4L 1E6OL 4HXAH 1BOYA 2WKOA 3EJUA 3KPSA 4ZX3A 1IM9A 1RJYB 3CHRA 4HKZA 4KK6C 2L7EA 4MRCA 1NGWB 4DUXA 2E6QA 1CDHA 1WAPA 1TR7A 1A1MB 3HE6B 5FK9A 5EIIG 5DJYA 3INOA 5CSBA 1WAEA 1WF5A 3Q0HA 5ELIA 4GLRI 5BS0B 4H20H 3KLAA 5I8CA 2ICCA 4DKFL 3LIUA 3NZ8A 3IXAB 4KKZA 2PCFB 3HPJA 4JLRA 4XNXH 1RZ8B 5TDOB 2X44D 4I88A 4HWBA 1A5FH 2A4EA 1MI5E 1M42A 3V52L 3D87B 3CVIH 3G5VA 3Q1SL 3C5ZB 4I3GA 2NY6C 3TN0B 1XR9B 1VGEL 2APBA 4FXTA 2FD6L 2H5UA 2QQKL 2Z4QA 5F88A 4ZXBD 5D2LB 5EUOB 3C6LB 2H1PL 2XG5A 3FB6A 1YEDB 2XV0A 4LKXB 2WBJA 3P4OA 1I3GL 3WKMH 1OD9A 3QC5X 3SYPA 2VDNL 1V05A 4XBEH 3L3OC 3W82A 5JIQA 3LIZH 4U1GC 1HS6A 3EGXB 3MLZH 1A6PA 2YLKA 5DMKA 3EFDL 4JK0D 2BVOB 1QBLH 3VRJA 1H15B 5CLWA 2JF1A 2X28A 1LEIB 1ICTA 4MAUH 3RL1B 3UYPA 3QCUL 3QO1B 3X17A 3ZE2F 4G7QB 4K8RL 5CUSL 4RNRB 2Q8AL 5EFIB 4EZJA 2F8IA 5ESVB 4KTEL 3GSNH 5HJBA 4UTBA 4M1CC 3G5ZB 1VHPA 3LHAA 1BQHA 4GAAA 5DC0A 3C9NA 1KB9J 3CVBA 4YS4A 2QMKA 3D09A 4LCVA 1NM9A 1XGTA 1FZJA 1HOCB 2CLVA 2VYRE 3MKGA 2Y69B 1U6AL 1U42A 5AAPA 2NCMA 1BFOA 4G7YH 2GPZA 3GIVB 1KFAL 5GZND 2NPLX 4G9FB 1VKXA 1B9KA 1NOFA 2X6MA 4PYGA 4D9LL 1FVEA 3LKSA 3OKNB 4NHCL 4BIKA 1MXGA 2YPLE 4BZ2L 5KEZA 4GQZA 2IQ9L 3VE0B 2JB6B 3DX4A 2X4SA 3L5WA 4UTAA 4WI6A 3QFJB 4FZEH 4M8VA 4J8QA 5EHFA 4GH7B 2HKHH 1TTAA 3DX8A 4LFHD 1JD9A 3PPEA 2VXQH 3TYGL 4UNIA 2ZOKA 3JWNH 4NJ9H 2UX7A 2X6BA 4KK9D 3VH8G 1EV2E 3OAYK 4F58H 3KBFA 4U1NA 3L3OA 4X7SL 3HW7A 3QRFM 4NZRH 3SE8H 5LG6A 2ZCKH 3ARWA 1E9OB 3TNMA 4BEIA 4Q9QL 3FS9A 4JRYD 4R3SB 5HDQL 3MREA 2EXSA 4X7CC 1OSEA 2KZWA 1ZGLB 4DP9X 4A7VA 1L9PA 5EN3A 1S4IA 3U7AA 1DJSA 1A6VL 3AADB 1HH9B 2E7BA 4JMXA 5IK3B 3RBSA 5DEFB 3WHXA 3UCQA 1NFIB 2ERJC 4LQ1A 1CF8H 4HX1A 3PQYA 1OPGH 2RHEA 3ERXA 5J13B 1T21A 3KGUA 1PCXA 2KHAA 4X9GA 4G43B 1JPFB 3REWA 4A2GA 3FO0H 4HEPG 5JHDD 3FU7B 2MPVA 2H9GA 3FSOA 4MKTA 4WUUA 4X6CB 3CDZA 1MVUB 1YA5A 2O72A 2XQYA 3ZGIA 1KJVB 2ED9A 2V6HA 1KGYE 1YMMD 3VGEA 3ARSA 4PJDA 2CHNA 1QLEB 4ABUA 5BCAA 5I17A 5LXGL 5E56A 4AVKA 3HLAA 1IX2A 3RWIB 1FP5A 3AREC 2VQ1A 3AM8C 2I24N 5ID0A 3CSGA 3R19A 3LRKA 4Z1PA 3WTWA 5FB8B 4NYLA 2VDPB 5HYEA 5DZOA 4CSPA 4OZGE 1KGUA 2KBGA 4M9OA 4ZS7H 1CBVL 1PJWA 1QR4A 4JZOB 4XWGL 4HUNB 4NOFA 3AT9A 1T5WB 3MJWA 4YBLC 1FH5L 2XPZA 3CZUB 1GHFH 2E4TA 5IP4A 4HUWA 3O3DB 1XSKA 4WDIB 3FQUA 1N68A 3QUMA 4AXWA 1OK8A 3RWJA 4K23H 5B3JF 3EJCA 3GXUB 3TO4C 3HG0A 1U3HC 1CGSH 5JXED 5D7JC 1QFWH 1ZLSH 2A9BA 3O3AA 1HXMB 4M6AA 5L2KA 2DF3A 3O2WH 5CLYA 3P30H 3L45A 3CFDA 3ULUL 2P7TA 4FFYH 2J73A 1UB5B 4ODXA 5D7EA 5DMIH 1SY6A 2G2RA 1T2JA 4PTUB 1FPTH 1R17A 1D7DA 3DPBB 3WMSA 1D6EB 1H0DB 3G04B 4R4FL 3TX4A 1VENA 1NCAH 2GW5A 3AREA 3HBQA 3HMXL 4XBPA 2E7LA 3G6DH 2LOEA 4OGYL 5E8PB 2XZCL 3OAZH 2VM4A 2Y1AA 1PLGH 1AVAA 1FG9C 1H3UA 3FZUC 4Q0XH 1U8PB 3F7VB 5I16A 5BO1L 4MMYB 1SVCP 1S78C 4BM7A 3QXAA 1HZHL 3NJHA 4N20A 4LSRL 2D31B 3WY2A 4MX7B 4TVPL 2XN9A 3MACH 3OVUB 3L7FB 2D7OA 4NI3A 4IIQB 5CFHA 1GZQB 5J6HB 1BWMA 4FTVD 1S3RA 1ZWIA 2AV1B 5GGRA 3RFZC 3D18A 1PZUB 2GITB 4XOBA 3H2QA 2Q7YB 3ZKXC 3E0GA 2VLME 4HK0A 6FABL 2AJ3B 5AW4B 4B6ZA 3TO4A 2JFCA 3NJXA 3PV6B 2C3VB 2I60H 1U3HA 4F2ME 3NJIA 2NLJB 4E9TA 3R06A 5E6IA 1R3HA 4KTYA 2K1MA 1XHHA 2W65B 1B3JA 4YGAB 3BI9X 1EO5A 3WHE0 3NVQA 4XCYA 1J5IA 3EBAA 4X5LA 4PJBB 3LSOB 43CAB 1YEGL 2WCGA 2GTWA 3LS5H 3W11D 4MQXC 3GMRA 3C5ZD 4XGZB 3V0FA 4BRJA 4Z3FA 1OAUH 1BD2B 3MRMA 2Y5TA 1GTFA 1T2QL 4DFIA 4UZGA 2V37A 3QIUB 5ABAA 1A6WL 4XP1H 4ODTL 4AYFB 1T7ZA 2XVLA 3PREA 3EW3B 2LAGB 4DKEH 5IFJB 4PSPA 1FNEA 3BQUB 4JRXE 3UEZA 1HCVA 2Q3ZA 2K4AA 4FL4C 4OBSA 2R8SL 4CVXA 3FN9A 3NK3A 4UMGA 2VLJB 2XFXA 4L8CB 2QDVA 2X70B 1AS7A 4HIEB 3WL9A 4N6QA 3T1FB 4IRZL 2WXMA 2ZPKL 1G7QA 1RZQA 4LLMA 5MERB 3U2JA 1DUZA 4OGXL 3RFZA 1EAQA 3QR2A 4WWOA 1I8KB 4PJCE 3TCTA 1LO5A 3BCDA 1EGJL 3IAQA 3MA9H 1RZGB 3QJXA 2PTTB 4KQ0A 3AABA 2XBTA 1EZVX 4PJEB 2VMDA 3U1SL 3S35L 3ME0B 3CX5K 2JK5B 4XXDA 1JGLH 3HI1A 4HPOH 5E2TL 4Z78A 4G9FD 5TJWK 4EKXA 1MVFA 3MI6A 4R7LA 4UBDD 4QHLA 3ZMNA 3DJTA 3M1CA 3F04A 2XVKA 1G5AA 5HJ3B 2WYTA 3K5RA 4HIIA 5EO9B 3QFJD 1KCKA 5AUMA 4GOSA 2Y36H 3KR3L 1A7BA 3BKJL 3PDDA 2PP8A 3QI9C 1CDJA 3ZKSD 2GK0B 1WYJA 1OHQA 2CR6A 2QTVA 3IJHA 4IBWA 4PW9A 1PIFA 3ASNB 1JWUB 1DEDA 2EKSA 2X4NA 4RRPG 2ENQA 4IRJC 3WNIA 5A3ID 1S7UA 3LPWA 3AXHA 3SKOB 5DUPH 2VZ3A 1I3VA 1BOGB 3TA3C 2B5IB 1VESA 4QRPA 2D3NA 3BW9B 1BVOA 1UH2A 1NLBH 1N2RA 3L9RA 4NO2B 1AOZA 1SBBA 3DVNB 4MJIE 4P5KA 5JQ6L 3ZHKA 4PHXA 3REVB 4YSCA 4JRFA 1CL7H 5D1QC 3UZQB 5DVOA 4LF3B 1I9RH 2VLRA 1W0VA 2VZ1A 2ZJSH 4QAMB 5I82A 3UOAB 3NIDE 2CGRL 1HI6A 5GGTH 5JLZB 1PSKL 1IGJB 5DLML 2EDYA 1XSIA 3DX3A 4QNPE 3AXIA 1PQZA 3NA9L 3H9SA 3IPEA 4E68A 2WLIB 3BEWB 4X83A 1M7DA 2X4UA 4MVBC 4XI5D 5IEHB 3OQ3B 1A2YB 2Z91A 5HHOB 4HAGA 3DGDA 1EBAA 5DO2C 4ZW7A 1HYSD 2GJRA 1EO8L 2IDCA 4J12A 1PKQB 1VFAA 1NWPA 2GABA 2V7NB 4RGNE 5A2IH 4BZ1A 1K3ZA 5I1GH 5I15H 2DWDA 3MHZA 3QI9A 3GS7A 2CO1A 3AQZA 4R4NC 5PAZA 3Q6FB 2P8MB 4WEMB 4G5ZL 4HW6A 4K3JL 3RWFB 2DQJL 1TYJA 3SCMB 1DDHB 1RV6X 2FBJH 2H0EA 3Q01A 3B9KB 4IRJA 4Y1TA 5I74B 3DIVA 2OV0A 5DURB 3TVMD 3IN0A 4ONFH 3SDCC 3TA3A 1I3UA 3N2JA 5F93C 1FFTB 4LL4A 4ZFOA 2QLYA 5E2VL 3S36H 3L4CA 4PRHE 5AW9B 4JGNA 1DVUA 4F2EA 1S9XB 1XH1A 2WWNA 1RULL 4G6FB 3N3EA 5LGHH 1Y6NR 4IKNA 1RJZA 2YO3A 3ABGA 5AWNL 5D1QA 3IJYA 1HIML 4WW1B 3CFMA 3RJDA 2J6EA 3OAUH 2D7MA 1LK2B 4L9LC 5IMKB 1A47A 3DXAE 3VFUB 1CFNA 5B4MC 3RU8H 3HI6H 2P3YA 2WUBH 2W80C 3BZFA 3RPBA 3G9AB 1NGPL 2P8PA 3A6CH 3PG2A 4HKXA 2EDRA 4KK8C 2B4CC 1XSJA 3U0TB 5IW6A 3L5JA 4YZFE 4YSOA 1OLLA 2Z92B 2DQDL 1NLDL 3FUNA 4IOFD 2IDUA 5GJSL 2PWHA 3CZSA 3SPVB 5CM1A 2RFXA 3ALWA 3AFLA 4DH2A 2HG0A 4YSSA 5I8KL 3WY3A 3CXDH 1RUQL 3GUTA 3GKZA 4DW2L 4XP6H 4XNUH 5GRZA 4HCIA 5EOCJ 1DUYA 2WNKA 3E6HB 4H1LA 1KTBA 1SNRA 2PWGA 3H8NA 1UKQA 1AQHA 4AM0Q 2HT3D 3IFOB 3JWNE 1T89A 1PZAA 5I71B 2R7EA 4PGJA 1IKOP 3UTZA 4Z7WF 1R34A 4N0UE 4F5CE 2BSRB 4MDRA 2SODB 4OFDA 5DRZA 1KT2A 1G7JB 4OM0L 1NDGB 1Y6MR 3Q8AA 1IM3D 3PNRB 3SDCA 4A63A 4X6EB 1BVLB 3SD2A 1O6SB 3BP4A 5E94A 5AKSA 3MLRH 4DPBX 3RG1C 4KJPC 2VGLM 2L7JA 4P2QE 5L6YH 2WZAA 1AQMA 4B9JA 4OLYL 1K5NA 3AAZB 3MUY1 2QT6A 3EXLA 1RKRA 2FEEL 2XQBL 3I3DA 1SM3H 3JSSA 5JZ7C 4L9LA 4Y19B 4GAGL 3RRQA 3PGFH 3SOBH 3WLWC 4AZ8A 2TRHA 2ZWSA 3L2MA 2X6VA 4X2UA 3BVNA 1JGDA 2D3JA 2NXYC 1CE1H 5CJXC 1SFDA 2QPSA 3GI8H 3AU0A 3HZKB 4N8VB 4U1HB 1BD2D 1CFVH 3DC0A 4XHJD 2H3NA 3TEWA 1AKPA 3WO4C 1BIIB 3QIUD 2ZNWA 3KPSE 5IEKA 4R2GC 3GNMH 5EOQL 3U0PA 3BLKA 4PJAF 4K7PY 4NKDB 5DHXB 4WJKB 5F3FA 3CFIC 2P4AB 1JN6A 1XZ0B 3L4WA 3BQUD 2NY2D 4IDLA 5ILTL 4I2XA 1XCTB 1OTSC 4JPVH 3FCGA 1DBKL 4V1DE 4JO3H 1MI5B 4PGBB 2VLJD 1QOKA 2GJ6A 2H32A 2WTOA 3NIFF 3PWJA 3JTTA 4CL7A 5HGBB 3UACA 4PJ8C 4XP9H 2COQA 3TC9A 3IKKA 1B0WA 4FA6A 2XETA 1LO2L 3S96A 2X3AA 1SN0A 4NKQB 2GK2A 2JIXB 3S37H 1A9BB 4YFEA 5DHVB 1Z3RA 5IHUL 3HZ3A 1GZPA 4Y5XC 2X2UA 4P3CL 4EUPG 3JWDH 3GSWA 2J56A 3ZIYA 2XSKA 2O6CA 5JHAA 2EIJB 4OD3L 2AEPH 1S9KC 4LGPB 3QDMD 2APFA 3EGSA 5AKTA 4QXUH 5E5MA 4RFEB 2OMWA 2OL3B 3HC4H 1DSWA 5I19L 4G5AA 4NCC2 3QZBA 1X5AA 4AYBA 4QRRA 5CJXA 2YD5A 4A6YB 4EXKA 4KZDH 1QEWB 2E27H 4N2BA 5E8DH 4OZHA 3KJ4B 1PY0A 1L3NA 2FH8A 1WGOA 2CK0L 2QKIC 1CIUA 3WEXB 5K9OB 4PSRA 1K8DA 2YXVA 3K8LA 1OCOB 1TITA 2N1TE 4DP6X 5IVNA 3RIFF 2FIKA 2IF7A 3TEXA 5JUEH 4YK4B 1U8JA 3J07A 5E8EB 1A1NB 4WKXA 3ULSA 3PHQA 2YPLB 4N26A 4PJ8A 1T80A 3HNVL 4JZNB 2R59A 5FAAA 1X5HA 4XN7A 2WNWA 4YHYC 4M43L 1D7CA 1XD1A 4UT6A 1TDQA 4L8BB 4Y2NA 1EFQA 1E42A 4FRWA 4Y5XA 1BLIA 1JGIA 5BW7C 2XIIA 1R5VB 3ELAT 5IB3A 3NFNA 3FRUA 4AC2A 3DX7B 1TTUA 2XA3A 1UXLA 2NY4C 3CFEA 3OXRB 4H88H 3BSHA 4TTGA 4JN2B 3QDGD 5I28A 2WXFA 4OZIF 3KYNB 3TLRA 5TF1L 3SKJH 2ZUUA 3HAEG 1U33A 3AMKA 1BFSA 5HI5D 1S7XA 3WSQL 2EDJA 4BFOA 3AT8A 1XMWA 3OMZA 3V55A 1JWSB 1UJTA 5DI8B 3GBNH 3VGHA 2HKFL 4N2MA 1PJ9A 2C1OB 3HHSA 3K2MC 4N6RB 3TBWB 4HCRL 2DJUA 1KPVA 1AZRA 4M5YH 2FB4H 1FNLA 4ZMXA 5ES4B 3MAWA 2ESVA 2QKIA 3H4HA 4WSGA 1XH3B 3SDAC 1EANA 5JMOC 1A21A 1NJ9B 5T1LA 2LU4A 5L4MA 2MNJB 3EO9L 4NQDA 1DP0A 1KBGH 3SCMD 2HLFC 2ZXWB 2DZEA 2WB1A 1IAKA 3QNZB 3H7BA 5CD3A 3HVDA 2ICEB 2YRPA 3CHPA 1QUNA 4Y1SA 4N2DA 2DTML 1FZMB 4MXWH 5LBSA 3V6OC 2ATAA 1V27A 2BC4B 2A6DA 1QVOA 4WUUE 3VQ1C 5C0EB 1MN4A 5ICYA 1NDTA 2ZX8A 5EIIA 4G6FD 3QIWB 4PJDE 3G9VA 4X4YA 3LHPH 4BUGA 3S5YA 4QRSB 5BW7A 1REIA 3VI3A 2ZXCA 1T1XB 3PL6D 2IH3A 2A74B 2HZHA 3FYEB 3G6JF 3NJVA 1FO0L 4N0FB 5D93B 4FERA 5DQ9B 1FV1B 3G5YB 3UJIL 3V5HA 1FGNL 4LLDA 4FLSA 4F93B 3PABA 4I8DA 4PGDA 3WIFA 3FONB 4BHUI 4D8OA 2JJTC 1UZ8B 4JG5A 3QRBA 4MWFB 4QCIB 1KLGB 5ALBL 3RZCB 3MX0B 2BSEA 1SDDA 1F2QA 4FXGC 1NEPA 1T0PB 4Z77B 4BFKA 1P5UC 2ZUQC 3DO7B 1U8LA 4OT1H 4JM4H 1E6OH 2DM4A 1DBBL 3P0VL