4L37A

Sp2-sp3 - a complex of two storage proteins from bombyx mori hemolymph
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
674
structure length
674
Chain Sequence
FKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPHYTPDKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic identification of an unexpected protein complex in silkworm haemolymph.
pubmed doi rcsb
molecule tags Protein binding
molecule keywords Silkworm storage protein
total genus 233
structure length 674
sequence length 674
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00372 Hemocyanin_M Hemocyanin, copper containing domain
A PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
A PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 4l37A02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 4l37A03
3AWWA 3NQ5A 5I3AA 2ZWFA 3NPYA 3W6WA 2Y9XA 4L37A 3HHSB 4HD6A 1BT2A 3WJMA 4OUAB 4P6SA 4J3PA 3AWTA 3W6QA 4P6TA 1OXYA 1BT3A 3AX0A 3HHSA 5I38A 4Z0ZA 1BT1A 3WJMB 3AWYA 4J6VA 1WX4A 4J3QA 4Z10A 4D87A 2AHLA 4HD7A 2ZMZA 3NTMA 3AWZA 3GWJA 3QJOA 3NM8A 4YZWA 2ZWEA 3NQ0A 4Z0YA 1JS8A 4J3RA 2P3XA 1WX2A 1WXCA 3WKYA 3AWSA 1LNLA 2ZWDA 1HC1A 4HD4A 4J6TA 4P6RA 2AHKA 1HCYA 2ZMYA 5I3BA 5CE9A 2ZMXA 1LLAA 3AWVA 3NQ1A 2ZWGA 3AWUA 1NOLA 1WX5A 2Y9WA 4J6UA 4OUAA 3AWXA 1LL1A 1BUGA 4L37B
chains in the Genus database with same CATH superfamily
2WVVA 3G6JF 2BS9A 1ROCA 3RWHA 2PPAA 3WDIA 3VFPB 4DK6A 1BT3A 2WN3A 4PJDF 3ZMRA 4J6VA 4QWWD 2V8MA 4M1CC 4Q58C 5J12B 1INEH 3BJ91 4HXAL 3FQUB 5GS2D 2VT0A 3VJ6B 4JL1A 1I1CA 3D87B 5JOPD 1R0AL 3DX7B 4M1DL 2Z35A 3PHSA 4RESB 3ILQD 4KZEL 1KJ2A 2X2HA 3CG8A 3AQDA 2CR3A 2NSQA 1AZRA 3M8OH 1JNHA 1HCFX 5DVMA 3V0VA 3ETSA 5HYSA 4QRQA 5HPMB 2FJGB 3B7SA 1RU9H 1YUKB 4OF7A 3GMPB 4PWJA 4P48A 1V5JA 2GJZB 4WKZB 5IHUL 4QMEA 4EI6B 3OKNB 4W9IC 3H6JA 2R8SH 2WSKA 1WWBX 4I1NB 5D70H 3QRFM 1WXCA 4WTZG 4XNBA 1ECZA 1DVFD 4XI5D 3LEYH 5FCSH 4ZD3H 5D1QC 2VABB 2VMFA 3VD7A 3WE6A 5DC2A 4L4VA 4K3EH 4XZUB 3JTBA 3KD4A 5CR8A 2YGNA 4M8VA 1RUQL 5DJCA 2R0LH 1WP6A 1L5GA 4PGBA 2V7HB 5EHFA 4TLUA 2P5EE 4KQ4L 4N5ED 2WBXA 3RKPA 1MWAL 3X14A 2FYVA 1ZE3C 3O6MH 5ESAA 4MCYB 2NCEA 3BWUC 3RU8L 3U82B 3F6IA 2ZWKA 4IQHA 3LZPA 5E6IA 4XB3A 1X6NA 4U1LA 2NUPB 4OUUA 4OZHE 2BVEA 1BMWA 2VDLB 1GYCA 1RVFH 1PSKH 1S7UA 3LQAC 4QHNA 2BOBA 3BT0A 3RFZC 4KRNA 4UQDA 1E90A 4OIAA 3FHQA 2XA3A 5I8KL 2EEAA 3M6DA 2CJ3A 3MV7A 2NSXA 4L0ZA 4UOZA 1BYPA 2MRYA 4BFJA 1UZ8B 2BIOA 2CU9A 3AM8C 2JK5B 4Z7QE 1KEGH 5IESH 2PCPA 3LKNA 3D51A 3BUQA 1NQBA 2YGPA 1I8MA 3SGKC 1S9WA 2R39A 3HZYB 1ZRUA 2Y1YA 1A4JB 3V5KB 4KO7A 1X9RA 3KPNA 3OKDA 4PS8A 2XBDA 3O2VL 2Q10A 3MNMA 3AM8A 5FO8A 3D18A 3QR1A 2VDOL 3VXUB 4AVKA 4OQTA 4Y4FA 1BV8A 1PNDA 2IANA 2VZUA 1JGLH 3Q06A 2VR8A 3WIHA 1X5JA 1AACA 1OW0A 3QIBC 5GHWH 3UP1A 1JJUA 1THCA 2DIAA 4PCKA 4QXUL 2FK9A 2Z7UA 4PJAB 1ZWIB 3ZL4H 3M1BB 4ZD3L 3C5XA 4N20A 5E00B 35C8L 4U6HA 5LXGH 3B2UC 5I6MA 1M05A 1TZOA 2Z8WC 4PJ5B 1TQUA 1MVYA 2Y5EA 2H2SC 1RP9A 3MLWL 4L1TA 4XBMA 3LN4A 2GBUA 2VQ4A 3BKYL 3BYTA 4JDVB 2J43A 3G6AA 2JKLA 3OQRA 4MDIB 3RPIA 4WHYG 1DBML 1Q9LB 1DZ0A 1X5AA 2OTWA 4RRPG 2FCBA 2WLIB 3W57A 1TZIB 2YPVH 4IOIA 3JVGC 3KHQA 2IQAA 3B8SA 4JANA 4WI3A 4HH8A 3UJIH 2BIIA 1E28A 3GPSA 1SLVA 4J2QA 1YEIL 5IV2A 2H9GA 4W6YB 3DGGA 3EYSL 4Y2DA 4L4VD 1RVFL 1J0KA 2Q20A 3GXFA 1BX2A 1TZGL 4X8CA 4YE4L 3KNBA 2E0PA 5BZDA 2J44A 2MNJB 2RHEA 1EFXD 1V3LA 2ORBH 3CMGA 3MGAA 5F7YC 1FVEB 4HMDA 2Y7NA 1U95A 1MHEA 2MCG1 4OF5A 5AB0A 1G84A 4MDJA 2W91A 3X1EA 1VHPA 3TA3A 5FYJD 3SCMB 4E41D 4MX7A 2X28A 2H41A 4F93B 3UC2A 2O30A 4F7KA 1KIRA 3IDXL 5B3NA 2N56A 3L3GB 1SUJA 3IF1B 4CVWA 2VC2H 2E7HA 4OV5B 1Q9WA 4JPIB 3H3PL 4XX1E 2EECA 3T6VA 2J5LC 4P23C 4AY0A 3FRUB 2HN7A 3V79C 3KWTA 5D7SH 1AQKL 4FXKA 4HJTA 1UCBL 5K5YA 3H9SB 4FA6A 1ZVNA 3EJZD 1JTOA 3BD4A 1S5HA 1YMME 2UXVA 4HS6B 5AKSA 3KWVA 5FFOA 3WXVL 4LSUH 2VJXA 2VISB 5E8EB 1SGKA 3FTYA 4MNQB 4ZOAA 4YUEH 4N2DA 3GKWH 4CC0A 2FZ3A 4KOBA 3D3VE 5KS9F 2WXGA 4YLBA 1V05A 4AUJA 4AUYA 4LBAA 4XCNA 1KC5H 4ZTPL 3TBWA 3KPRD 2IAMC 1YEFH 1T04A 1OGAB 4KPHH 2E3VA 1PX8A 4FNLL 3D0VB 4LFHG 3HI6L 4DUVA 4D0CB 1GTFA 3DJRA 3V0FA 2E7MA 2VW7A 2EICA 2XWDA 5K59F 5BV7L 3MGOB 1ICTA 3SCMC 2Y36H 5LCVA 3CXFA 1NWOA 4F7EB 3ZDZF 3QSKB 4H26B 4ZS6C 4FQXB 4QGYA 4OZIB 3ZN6A 3HC2A 2V2XA 5JHAA 4XPHH 2NY7L 3DHPA 4N8VB 1WX4A 1X5LA 4WFEE 3TO4B 3ATDA 3FRPA 1P4UA 1S7SB 3QIWB 3WY2A 5FOBB 2EVGA 3C2AH 4CU6A 5JPMC 4XE0A 1VIWA 1TYRA 3GRWH 2KMWA 3J27A 5I74C 3P30H 1JZ4A 4IJ3C 1JHTA 1T4KA 3HRPA 4MA8H 2V17L 4FTDA 2PCYA 3MV9D 4HGMA 2IOMA 2VSDA 4XNXH 5J13C 4XPGH 4FQJL 1U3HA 1HHHA 3MNDA 4PGCA 4HCRA 1UADC 3OSVA 3I6GB 1CJYA 4BFNA 1WAAA 2QKIC 3FQXB 2H6PA 1G5AA 2HRPH 3LH2L 2ZAHA 4K7PY 5L2KE 3PUCA 1QBBA 4G3YL 3HB3D 5DHMC 3LB6D 5EUOA 1F11A 1UEYA 3FW6A 3D0VA 2VXQH 4KHXL 3MPCA 3QG6B 5C6WH 4ONGL 1AYRA 1QMUA 4YHZL 3U0PB 1F1DA 4K55A 1T04B 2FJFA 5L8KB 4CKVX 3SDAA 3QCVH 4HF5L 2B1HL 3CVIL 4WV1A 1QSFE 3B1UA 4P99A 1UA7A 3C6LD 3QWNA 5BMFH 5KVEE 3SDDC 2FZ3B 1E9PA 4HOZA 3HE7C 5HVWA 3BRDA 1HZHH 4KJQD 1TTAA 1KY7A 1TETH 2W07A 1QPKA 3GHPA 4QO1B 4KO6A 3EUDA 3V5HB 3GSUB 1FO0H 4FJ6A 3DGDA 1JPEA 4HUXB 1A7QL 3KEHA 1CO1A 4M62H 4NUJB 3A4FA 5KZCD 1WFUA 2ZP0T 4MJ6B 5HDBE 4EN3D 1JS8A 4J3OG 4R7NA 1OAKL 5IQNA 5L9DH 1NJ9A 4OV5A 4G43A 1B0IA 2UZYB 4MWFA 1Z7JA 2CBPA 1KIRB 1DFBH 2DLTA 1ZTXL 1JERA 5EU3B 4ACTA 4XC1L 4X4ME 1JHKH 3JV4B 3VQ2C 4OJYA 1E8YA 1JNNL 1TFHA 4AZ8A 4M7LL 5T3ZE 3QUXB 4Z7NF 4QJ3B 1G9HA 3CXDH 1ZS8A 4IEFA 4HGWA 1WV7T 3K1KC 2JQMA 3DXAD 1MXGA 3DDFA 3P30L 3GSVB 2OI9C 4JFTA 4JUSA 2W5PA 3QDJD 3ZUCA 4BQBA 1BX2B 4NOBA 1BGXL 4FFZL 4IKIA 4PJ8C 4UT6L 4AIXA 5LLIC 2JXMB 5EO0B 3BLKA 1EZVY 4KK6D 5TDPB 4K8RH 3QO0B 1QZNA 5IV2B 1BJMA 2D4FA 4FQJH 2OMTA 5C08A 2ADGA 2FB4L 3H3KA 4E0RA 1RUKL 5GRUH 4JY5H 1EERB 4IOIB 1CF1A 3EO9L 5HY9B 4ZX6A 2AQTA 1WZ1L 3ULVF 1OOAA 5H94A 1NCOA 4DKAA 4C83B 1PYWA 4MNQD 4YDJA 3CLEL 1OPGH 1WCBA 2FX7H 3QDAA 4B27A 1JSYA 5LNGA 2DOCA 3TONA 3IEAA 4A2MA 1NKRA 5AYUL 4HWEL 5E00A 2QZQA 1T2JA 3BWAB 5EIIG 4Q9CA 2D3JA 2M2DA 4BFOA 4HJJL 5BRZE 4PJAA 1AS6A 3F6LA 2NTSP 3FN0L 3GI9H 4Z7VB 2KZKA 3SDXF 2XWJB 1GTNA 3V6OA 1BAFL 3QRGL 3NCEB 4G8FB 2IALA 3AG1B 1QAWA 2X4NA 4TULH 5I3AA 1Z0MA 4B9JA 3TF4A 3BUYA 4XMKH 5KVGE 3NOIA 2JKSA 2XIBA 4P5RA 4KZDH 4OSUL 2AEQH 3PWLA 1D2OA 4HBCL 4HQQH 3QIUC 3MXVH 5CO1A 3F62A 4CVZA 4BXSV 5CEXA 1F4YH 4G42A 2IDCA 4WWKD 4FLRA 5CEZD 3SIKA 3IDUA 3U7AA 4IHOA 1AH1A 4MJ5A 2KBGA 1FVCA 1LEIA 2PCPB 3QI9A 5JMRA 3GJFK 1MWAA 4EXPX 4KKRA 4OM0L 3BMWA 1DQQB 1WFTA 4FYQA 2P9RA 5HP5A 4BRVA 3MRCA 3HZKA 1P69B 2GITA 3OAUH 5I6XB 4XBGA 2DQEH 4PP1D 3H2QA 3RX5A 4A2FA 1HT6A 3GQFA 5KYWA 2AZAA 3S36L 7FABH 2MHAA 3V6ZB 3FSWA 4YHNB 4JL2A 5T3XD 3KDMA 5IB5A 5GGRA 5DHEA 2NY6D 3FCUB 3K4ZA 3FU9A 1QR4A 4P3CL 4KKQA 1IVLA 3K6IA 3E6HB 4OZIF 3IB4A 4PGBB 1KB5H 3V8OA 1SXZA 4JKMA 3QIUB 1P6WA 3L4WA 3TU6A 3VFRA 4UQ3A 4KJPC 5KUKA 1VEPA 4APXA 4TTGA 3GZQA 4HIXL 2PWFA 3ABKB 3VX1A 3FPYA 4WSKA 1BZ7A 1JZ7A 2IDUA 5EBMB 5BOPA 1BF5A 4YL9A 3OSKA 5D2LB 2Y1VA 5EIVA 5F7EH 1BF8A 5KBKA 4ZW8A 4IBZA 1JZDC 4WI6A 4MJ4A 5DZAA 5LCVL 1IAKB 1KBGL 3T4YB 3DSNA 3LNHA 2VYRE 3ET9F 3WEAA 2IGFL 2COQA 4WSGA 1PG7L 2AXGB 1KTJA 2VQTA 3U36B 5IQLA 1IGML 4WUUE 3VXPA 3TVMD 3GJEA 3A5VA 2GKIA 5EEUA 3DX7A 1WLHA 2DMGA 1RZGB 1TDQA 3WJJA 4WIQA 2P5WB 4W81A 4CGTA 2CK0L 1WG3A 2L0DA 3CN3A 3FQUA 1NCIA 4ODHL 1NFKA 5AAMA 1H9VA 5IK3B 3O6FC 2W9EH 5T8IA 2A9MH 3QI9C 4PLOB 2N59A 1Y0LA 3RVVC 4Z7OB 3OAUL 1UCTA 4I9XA 1P53A 3Q2VA 4QRRA 3VI4F 2ROXA 4UBDD 1Z9OA 5PAZA 1EO8L 4AGPA 1TCRB 5M94B 1WFNA 2EIJB 3QB7C 3OHMB 3B9KC 4WUKH 1YJDL 4GQZA 4UYQA 3VG0H 1SEBB 2FEDD 5IFJA 3FZUC 1BEYL 2WPGA 3L3DB 1OALA 3M86A 1P4IL 5JW3L 3FCSB 8FABB 5F1NA 3RZCC 3ZKSD 1RJLB 2X40A 4XAKE 4ODTH 4R4NC 3HG5A 1YN7A 4Z7IA 5LAXB 1A9VA 2DQJH 3ZDYE 1A25A 5IB4A 2CUAA 1WHOA 1OGSA 2CR0A 3VXTA 4LQFL 4MAUL 4RGMC 2V5TA 4APQB 1SRDA 4AQ1A 5AKVA 4FS0A 3QA3B 3RPBA 4PRID 3J2PA 5D1XD 5E8NA 2CO4A 4A6YA 4BSWA 4PLKC 3MREB 3AX0A 2OCJA 3AUWB 1U4EA 4K5LA 2PYED 2VLRB 2YUWA 4KK6C 4LOEA 2IGLA 2WTRB 3BPCB 4FKKA 3H42L 2ZG2A 4C59B 4X4YB 4JX0A 3ES6B 3EUUA 4GYBA 5D2NB 5JNYA 3QDME 5DLLA 3FQNB 2G5UA 4W9EC 3TJPA 5K39A 1MCFA 4LRNL 5CEYA 3TNMB 1Z9PA 4L3EB 2FGWL 3HRZC 3IMSA 3OWRA 1ZT1B 4UQ2A 4YPJA 1PG7H 3D48R 3MA7A 4HIPA 3T77A 1VFBA 2JJSC 2NY0D 4AEIH 4ELMB 4PHXA 3L9RA 2YMOA 3L4ZA 5KJ7E 2XTJE 3MCKA 3HG3A 4DOHE 1WBYA 1WWAX 5DJZA 4H25B 2RQ8A 4KITB 5E1HB 2WQ8A 3CSTA 1PY4A 2C9QA 4LGSB 4U3CA 1Q0YL 1AZZC 4HSQA 4NWUL 1IAIH 2BVPB 3MLWH 2OMVB 2A4CA 5D7LB 4N87A 5IMMA 1LDPL 5IOPA 2JLLA 5CZKA 3MOBH 5D1XE 2P47B 3DTXB 4YSEA 2DLHA 5DMIH 4PN6A 5TQ2H 3MI6A 1MJJA 1L9RA 1TLMA 2JNZA 4I4WA 5IEHB 5D7JC 3GBEA 4UV4L 2Y7QA 4QJ4B 4MSWB 1JGEB 2CO6B 4A7GA 4JHUA 1JZJA 1Z6JT 2R1XA 4GAYB 1XF3A 3BPNC 4NZUH 1YNLH 4Y2OA 1PAZA 1FSKB 3FT1A 5B39B 4IYKA 2RH0A 4QYAA 4YE4H 4UTBL 2JKRM 2DTML 2G2PA 2Z1KA 3IMUA 5LBGA 3WY3A 4LQFH 2VDNB 3F5WA 4MAUH 5HI5D 5JQIB 5MHSE 1WYJA 3ULVL 3ECWA 3C5ZC 4IDJH 5IIEA 1HINL 3CFIC 2E46A 3DO7A 1S9VB 1ZD6A 4GAYA 4PP1C 4NI6A 3P2BA 3U46A 1FFOB 5CN3A 5H37A 3AY4C 2K6YA 3FU0A 2Y07L 4PJAF 4WK4B 1OTTD 4OCRH 4PVBA 2JJVA 5TF1L 1QLEH 3IDJB 1WDAA 2J8UF 5IOPB 1LILA 2CDGB 4BM7A 3SYOA 1JK9A 5DHYB 1NBZB 1S7WA 1A7RL 2BSBA 4NQQA 2A1WL 5L88L 2AXFB 1IGJA 2P48B 2D4DA 1IIKA 3F7YB 1U3YA 3GKWL 3FU7B 1SDDA 4EIBA 1YPZE 2PR4L 4F8PA 4JFUA 4V2CB 4N86A 3W11D 1QTYT 5C0GB 1NCCH 2W38A 4Z7AA 2CNYA 1HZKA 2WUBH 3BX7C 4UINL 2WLZA 3UTPD 1RFDL 5IMKA 3MOBL 3QJZA 3BT2L 5BVPL 3G04A 3B9VA 4LDLB 3VVWA 4AYEC 1KENH 3I9IA 4O4YL 3BPCA 5FYJL 4GO8A 3UO8B 5K9JH 2XZCH 4Q52A 2WLLB 2ADYA 4LFHD 3NQ1A 2W8CA 3HNTL 3MREA 4AG4L 1OWWA 2XWTB 3P77A 4X98B 1KYOJ 2FD6L 2VZOA 1CGUA 3BUTA 3QA3A 4JG1L 2NY6B 4DKFH 4AKOA 2WBKA 3GZPA 3RL2A 2DL2A 1NKGA 3O41A 1I3UA 3QJQB 1USQA 3MRKA 2X2JA 1DYZA 3IETA 4MA8L 4KO5A 4XVSL 3N3EA 2BSTA 5HVFB 4JFFB 2Q7AA 5IQ9B 3LNEA 3FCSA 3PGCA 4UBDC 4N1CA 3S5YA 2GAZA 3GUFA 3J7HA 3ZTDC 1OTUC 3RL1B 5C09E 3AXLA 3CK0L 4PRHE 4NO3A 3EZJB 1QLEL 3IDNA 1W0WA 3DO3A 4XWGH 4GXVL 4AQEA 5IK3A 2DL9A 1AE6L 3P02A 1NBVL 4NUQA 4Y5XB 5DU7A 3UTTE 3UO1H 4ZYKA 4P5TD 5CCKH 4GMSH 1YQVL 3DURB 4PV8A 4XPFL 3P0VH 4KZ0A 5IR1A 5EORH 2X1OA 2F08A 4BZ2H 5DHDA 5AUMA 1DBKH 2Y2YA 1NMCB 4PJ7A 3VXPB 2EVFA 3DX8A 3FB7B 2PR4H 5HDLA 2DZEA 2EH8H 2RFXB 4UMGA 5SWSD 4JFOB 3ZHDA 3FAXA 5AVSB 1FO0L 1FFQA 4MVBC 2UV3A 3UTQB 1F6AA 3T4YA 3IFPB 2NXZD 4YFDB 3GLEA 5J3HC 4KDTA 5I0XA 1NINA 5I24A 1IAKA 2VZVA 3UTPE 1RFDH 2YEVB 1P7QA 3TP4A 4NM8L 3ASOB 4DP0X 3T3ME 1R3HA 1YEDB 3LKSB 2IC2A 1NCTA 5ICXB 2HLAB 1RZIA 1R3LB 1W72A 2NY1D 2XZCL 3VD2A 1BZ7B 2OP4H 4HV8B 3QGVA 5AOJA 2NY0C 1IM9B 1AQ8A 3V9EA 3LAFA 3C9NB 5GRWA 2PW2B 4OD2A 1WRFA 4KMQA 4UQ3B 4DP5X 2J56A 3QIUA 4IRJC 1OB1A 4K8RD 4L48A 4Q56A 1WWWX 5K9OA 3NIDE 5F71A 4JJ5B 3G5ZA 1T21A 4JHAH 1TSRA 1YVLA 4M1GL 4LP4A 4Z10A 1UKSA 2UXGA 4HWNA 4JO3H 4XHJC 4XVUD 3EJYD 1BA9A 5IGXH 5DGQA 3X1BA 3TO4C 3DXAE 2FB4H 3QJHB 3CZKA 4W6WB 4Y4FC 4DPAX 4F7PA 5MERA 1RUKH 2QFPA 1Y1UA 5GRUL 4E9RA 3MMEA 2D9QB 1BBJA 1FNEA 3FONA 5KYYB 2ZX5A 3T8MA 2OMZA 4C56D 3TV3L 2HVBA 1KCBA 5D72L 4LF3A 4BUHA 5EB9A 2K4WA 1VF5C 2YK1H 2JI2A 2W0KA 3NSJA 4XWGL 5IHHA 3SPCA 5T33L 1N6QH 4AL8L 1VRSA 1NBVH 3HRZB 3NCYP 4L8CB 5FO2A 1D9KC 2B39A 3VD1A 3GIZH 2BWIA 1OGTA 1ML0A 3PDOB 2QL1A 4OGZA 3IRPX 4G8AC 4JFXA 4MJ5B 1KELL 3DO4A 3P4OA 2EH8L 5JPNB 4G42B 1BZOA 1K72A 4MA7H 3SDCB 4CVZB 3T0EC 4PJCF 3VSUA 2I9TA 2C3HA 1RZFH 4OLUH 3V0WH 2YAFA 3LEXA 3LRKA 3BIAX 1AD9B 2D73A 3MRJA 1T1YB 2FWSA 5CSGA 4YXLH 4Z76B 4ODWA 1IC7H 1P0SE 1QSFD 5LBSA 3ZGIA 4DVRH 1EXUA 2L7JA 4QOKD 3K72A 4Z76A 1L7IH 2JKNA 4MNGA 1TZHA 1T1YA 1F6LL 2BVUA 2XWJA 3KE0A 3IJ8A 2XTJD 2NW2B 2L3BA 5DEFB 6FABL 3O4OC 4ZT1A 3LV3B 2BSED 1C08B 5F6IB 3CDGA 1PG7X 3VMPA 2GCYB 2F8VA 3QQXA 4NDMB 5I1GH 3E1F1 2F54B 2Y5TB 2AV7B 2QADB 4EXKA 4YDJB 4YLQT 1IL1B 2DB8A 4CDHA 3BVUA 4GXUM 1GKEA 3DV6B 3UTOA 4HPOH 2YEQA 2WXHA 3K4AA 3UXFA 3KPPB 4Z7WF 4N8PA 5JPNC 2OMTB 5C08B 2WTPA 3HKFA 3GBNH 3NQIA 1U42A 2J72A 3GXIA 1LVEA 1MJ7L 2B59A 2QVMA 4ZMWA 2ID5A 4DGIL 1JGDB 2JCCA 1VERA 2JQAA 2XFGB 3ELAT 4W6XB 3G9AB 3HNSH 4KK9C 4TUOB 3US1A 2YEZA 2QTEA 1M53A 2K3HA 3QJHA 5MERB 3T2OA 1JGIA 2A2QT 3QUXA 2X9YA 3DUSB 3ECBB 4XAKD 1GC1H 4AZ8B 5KWYC 1MUJB 3KXFB 5I16A 2YZ8A 5K9OB 5AKRA 2XVKA 3NDYE 1WVZA 1JRHH 2IADB 3KPLA 3OLEA 4PCTA 4YFLI 1SYSA 4NKMA 2E76C 5PCYA 1YMHB 1G7IB 3TIEA 3D3VD 3SYAA 2X12A 4Z7WE 3WEXB 4A7UA 1CYWA 2EE9A 2VDPL 4FYRA 4DETA 1PLAA 2F18A 3I2CL 3NH7H 4HUXA 5E4OA 5TK2A 5FYLD 5G4MA 3R0MA 3CQFA 4R0LA 4YHKH 2F9BT 2W07B 2E47A 4Z7VF 1QNZH 4F8QA 4YR6B 4PLJD 3Q7JA 4HD9A 4YDZA 5TFSH 1LMIA 1F6AB 3FOLB 3UBXG 4ODXA 1O6SA 1ZJAA 1C1EH 4GW1B 4NC1C 2ZX6A 3SDAB 5C0AA 2RFXA 3VSVA 4BZ1H 4PJ7B 4WJ5A 2H2PC 3MJGX 5I1GL 1J1OL 2J1ZA 3C6LB 4MVBD 5IR1B 5EUOB 1A1MA 1TSHA 4P2QD 4YDVA 4PV8B 1UVQA 1IBGL 2H6PB 4JZJB 1D7FA 3UG5A 4FMKA 3BLBA 3O11A 4R3SA 4PMFA 2YKKA 1BXUA 1FIGH 3WAJA 2ESVD 3RWDA 2DWSA 2EINB 3BEWB 2FVNA 3ZKXB 2FLRT 2AQSA 2BS71 3QPXH 4JN2B 3GBNL 3LDBB 4JM4L 3IDNB 7PCYA 3JVGA 4HLEA 4ZFZA 2Y7LA 4OCXL 4XMWA 4RNRA 1L9TA 1WZKA 4NBYB 4LLWB 5GGVL 5INCB 4OZGB 4HHAA 4L3FA 1G4RA 4BA0A 4FADA 4LDCA 4X2UA 2CO1A 4XT1C 5SX4I 1CD0A 3MSPA 3L3IA 4JM2A 5AZEH 4N8VA 1OZUA 5DT1H 1CL7I 3QZWG 2Y69B 3OLIA 2V2XB 4K94L 3EZ8A 2X1WL 5KVGH 3H3BC 1AP2B 4LIQH 3H55A 3O3BA 4X9YA 3I9PA 1BQSA 3TCLB 3FQYA 4D0DA 4HC1A 1H9DA 4I7ZC 4FEMA 1IEBA 3A6CL 3NJHA 3K46A 2N0MA 4IBUA 3VWKC 3LS5H 5B3JE 1CXHA 5IWLA 2K7PA 3ETTA 1AG0A 1O75A 3QFJA 1NC2D 4IU2B 4JFED 1I3RA 5HDQH 1IO4C 1ZLWH 2YWZA 4AEIL 4NLHA 5AOZA 1J0HA 2ITEA 4FFYH 4IHBA 3BVTA 2XN2A 3VGGA 3TBSA 3WN5A 2WXQA 1OPOA 5DLMH 3SGKA 1MHPH 4O2CA 1MNUL 5CEZE 1SDAB 5J1AA 1J1PH 5DC4B 1HIML 1ZKAA 1A02N 3ZBMA 3LZQA 4HULB 1XVSA 1SXBA 2W60B 2XPGB 4H8WH 4AX3A 2VCOA 3PIQA 1ES0A 3UMTA 2NZ1A 1OWRM 2H1PL 1FNGB 3MTRA 2AXFA 4PJIF 4RMUA 3PDGA 1TU2B 2LU5A 4PAZA 2BHUA 5F7AA 1T0MA 4K7PL 1TTGA 2R7EB 3QDHA 5C3TA 1AO7D 1E4WH 3B2UD 3SQBB 3UZVB 1H15A 2ROYA 2UZIH 3IDJA 4L23A 5E5RB 3UABA 1MHEB 2GJ6B 1PW3A 3N40P 2F1EA 4DSYA 3MRHB 1NOFA 1EAQA 3D85D 3MV01 4P2QA 3WLWC 4PP2A 3ARGB 4F58H 1A0QL 2Y6TE 4HXBL 2R2HB 3WHE0 3MRRA 4Y2DB 3DGGB 5AW6B 1RAMA 3GSWB 2AXWA 2IVFC 4NQEA 1UWXH 2WJ7A 3HZVB 4OFPA 2XXMB 1E9OB 5HGAA 4M93C 2DM4A 3DX1A 3HFFA 2X4QA 1AXIB 1BD2E 4R5TA 1AIZA 1C16A 3RPIB 1AGBA 3G6AB 1SVBA 1BREA 4JDVA 3N43B 4WWNA 5A2IH 3U9UB 2Q3ZA 5JLZA 2IH1A 1TJHL 4BSJA 1SOKA 1TCMA 2VN5A 3T0EB 5T3ZD 1JWMB 5CD3B 4A38A 4BHUI 3GBLA 1WIUA 4JFZH 4AENB 1QSZA 5D7LA 2CWRA 2PF6A 2DQDH 3BQVA 2XIDA 1I7TB 1MHPL 5KSBF 4J3VA 4PREB 1J1PL 5ADPL 1LYQA 3II3A 1UWEH 1D5ZB 4MD4B 5BJTB 1HAUA 4RAVA 2J6EH 4H25A 4G80A 1N0LA 5IVXB 4LLQA 3D3VA 4L3ED 1NMBH 5D7IA 5LBSH 5B8CA 1O6VA 1PZ2A 5DSCA 2ZSWA 2P49B 1FGVL 3EJQA 1KENL 2GVYA 4XNYL 5HHOB 3KL0A 3EOBB 1A2YB 4XMXA 2DQHH 5CEYB 2R9HC 3F7PC 2R0WL 3HNTH 3VYNA 3FQNA 3LKNB 1MAJA 1UWGH 4AG4H 3OZ9L 4PY7A 3QYCA 1CDHA 3HVDA 4X4YA 3OL2A 1D6VH 4U49A 5EV7A 1UD5A 1M57B 2DBLL 4G7RB 5I6PA 4Z0XA 2WO3B 3N5AA 4AYGA 4JFSA 4LOFA 1WBZB 5IESL 4X83A 5DMKB 4NQDD 3FHAA 4HJIA 4A6YB 4BSWB 1CD8A 3VSTA 4ENEC 3KGSA 5D6DA 4K73A 3VXSE 3LPGA 2C9PA 4KO9A 3ASNB 1PIFA 1HL5A 3KCPB 2QSQA 3O2DA 4ZMZA 4NNPH 4PW3A 3IU3A 4NQCE 4KUCF 4JFQB 5DJDB 4LEEA 4F8TA 2ZF9A 3LIZL 2A3TA 5JQ6H 4ES9A 8FABA 2V7HA 4DF9A 2IV8A 3L3DA 1G94A 1MG2C 2JE8A 2OXGA 4OM1H 5IFJB 2AEPH 3IAQA 2EEFA 2MFNA 2C9RA 3VFUB 1YQVH 4LCIH 2MNUA 3NSXA 4UT6A 4ZSOA 3RX9A 3ARFC 3QW9A 1EUUA 5GJSL 1I85C 1TQVA 2CQVA 4WI8A 5BW7A 1MI5D 5E5LA 4O51A 2DQDL 5GRVK 4GS7C 2G60H 2PO6D 2VDNH 2BH0A 3OQ3B 1JV5A 4EI6A 4DQOH 4HD4A 3S96B 3FO2A 2ICCA 2GJZA 5KYNA 4NFBA 1QYGH 2FJGA 1E5UI 1X4YA 5IVNA 4JHBA 4PYGA 3UGUA 1JNHB 1IBFA 2YPLA 4P2AA 3Q8BA 3NAAH 6PCYA 5H37G 3KPRE 4EJ1C 3EH5B 4MNGE 4XNYH 1N18A 3MNZA 4NENA 1OY3B 1ZPUA 3DSNB 5EUOF 1MJ8H 4L8SA 2BHYA 4HU8A 4YBLC 4DH2A 5CZVH 4ZFFB 5B1JA 2AQPA 4I77H 4UNTA 1JPSL 1OT1A 2AK4E 2ORBL 4PJEE 5JHDE 1D6VL 4J8RB 4D8OA 5I0YA 5JIQA 5BNXD 3G08B 3U7YH 3H7BA 5L2KA 3RZWA 5T1LD 5HHQB 3BAYA 3U6RA 4YDKL 3DK0A 2H47C 4Q74A 4M1GH 1MVUB 1VGKA 3O6LL 3PPSA 3TA4D 4JY6B 1KF9B 1I7ZB 3CLFH 4OUAB 4RMTA 1DANT 3D06A 3B3BA 2FQGA 3FQ1A 1WIOA 1MF2H 1QW9A 3DHUA 3MV9B 3TEZA 2ZCZA 3MRQA 1M1XB 4Y89A 1BLNB 4E41E 5D7SL 4UIKL 4F2EA 4Y5YA 2WUCL 1IQWL 5AWNL 3C5SB 5GGRB 3ESOA 3IK2A 1QX1A 4F2FA 3CVHH 2VW6A 2K0RA 3GIZL 4UDTB 4HLZH 4X9FA 1RPQA 3NIFF 1XX9C 4N0YH 2GITB 3MRMA 2PETA 4Y1SA 4Q9RH 4Z0XB 3OG6B 2Q76A 1OGPA 2VDNL 4FNLH 3WDJA 4Y19B 2Q86A 4DQOL 4EUPA 2W81C 1RZFL 3OC5A 4OLUL 2XWRA 4PY7B 1JN6B 4WHCA 4YWGL 3DROA 2Y36L 3ZDXB 1FVCB 5D71L 1MCDA 1LEIB 4B9PA 1K8DA 1T5XA 4F8LA 1XIWC 4Q97A 2KPNA 15C8H 5KN5B 1XGRB 3OJ2C 4HPHA 4FRWA 5DSCB 2VO5A 3UBXA 1CDYA 4UOJA 2BVQB 1Z9NA 2WZPD 2YD7A 1JPTH 4J3TA 1YEKH 1IBYA 1RY7B 5EZIL 5FYKU 1GGUA 4IKJA 4XTRC 3V4VH 1AD0B 4N0UE 2UUDH 1T66C 1NIFA 2A4EA 2CGRH 3BUYB 3GRWL 4RAVB 1D5ZA 5EU6B 4D2NA 5SWZE 5LGKA 3IS0X 2XU9A 2AMGA 4RGNE 4WI9A 2IPKB 1R17A 3VRIB 3B2XA 4YDKH 2DD8H 4XPGL 4HG4K 1KCSL 5CD3A 1IKNC 1WGOA 2CHWA 4UUJB 4OGYL 1UEMA 3QQ9C 4MDRA 4PBVC 5HD8D 1FFNA 4MJ2A 3LH2H 3WJMB 1L3WA 3ZE1F 1KBBA 3DTDA 2IAAC 4LLAA 4WFGD 1D3CA 2VXQL 4I87A 3D85A 5MP6H 1AGBB 2COVD 1EFXB 4C83A 1C16B 1BQLL 4N9GA 3MFFA 3CHQA 4D8PB 4TL4A 3SD2A 5BMFL 4X6EB 3SBWC 2ZCLH 4HJ1A 3O4LB 2FIKB 2DWTA 3GSWA 4Y5YC 4IIZA 2Y22A 1FFTB 2R2HA 5JXEA 4F3FA 3LYRA 5JOFB 3IXTB 1N5AA 1RUML 3KBPA 3BWUF 1ZS8B 4N2LA 4XH2A 3UPAA 1GIGL 3RX7A 3UJJL 3CV5A 3L2LA 2PP9A 4XVJL 4E9QA 2HJKA 2P5ED 2QGEA 3GSQB 5E5MA 2Z8RA 3TYGL 3ARYA 5AOKA 1XMWA 3WI9A 4RGNC 2DQTL 2X4UB 1NJ9B 2VITA 4JJOA 1SJHB 1V3KA 4R7NB 5E8PB 4AXWA 4X6DB 1JNNH 2Z34A 3QUYD 2YPLD 3NIDF 5GSRB 4PV1C 2EEXA 3VFMA 5FECA 4NUJA 5GZNC 4Z3FA 2CGRL 3QEUB 4NKQB 4JRYE 2JJSA 5FKPB 1IZJA 4H88H 1WWCA 3QAZC 5J1AB 1EVUA 1TVHB 2ICEC 5FW8A 1U8MA 2D3LA 1X9QA 3KWWB 5D8JL 1JXJA 2OYMA 4K15A 4BZ1L 2G2RA 4GRLB 4I3RH 1O7SA 5F70A 2DD8L 4Y1TA 2YQBA 2B9AA 1BSIA 1MAKA 1CE1H 1JDAA 1T0NB 5C0CE 4Q7DA 3RB7A 5C7ZA 4JZNB 4G8IB 5IW1A 5B38B 4MHHG 3U0PA 2D7TH 3MOAL 3GHEL 1PS3A 2IMMA 3A47A 2W0FA 2Z31C 5E9NA 5ICUA 1F11B 3VRJB 4I5BA 3RVVD 2ZWFA 1CZ8H 4R2GC 2E7LC 1ZT4B 5FC9A 4OCMC 4GG8B 2OYLA 2HTKD 4MMYA 2F7RA 2HVJA 4PGCB 3V0HA 4LVOB 4WI0B 3FBKA 1QI5A 1U3HB 2ZCLL 2EYSB 4M1DH 3VFNB 3LZNA 4ORZC 4GT0A 2VLKD 5DXWA 1RUPL 4GRWE 5DJ0A 3O8XC 5ANHA 5LJYH 1ZMYA 3CVDA 4JG5A 2WKLA 3EDKA 1PLCA 1GGTA 4RFNB 4HHAB 4LLWA 5INCA 4UU9A 4Y4HB 3UG4A 2PMZA 2VXVL 3KL5A 1GRWA 3FMGH 4U3XA 4ZFZB 2BRRL 2C5DC 2OM5A 4O9HH 3PL6A 3SE9H 3TO4A 2QTVA 5BZWA 4FLHA 4Y1AB 3ZL2A 3N55A 1ULVA 3BEWA 2LU3A 3WNMA 4NZDA 1QTPA 3IJ9A 2EIMB 2WQXA 2F53E 4S0TD 1PEZA 4D9QE 1UXWB 3P3RA 1KCRH 4MQ7B 1A1MB 1PY0A 1FVDB 3QUMA 2F5BH 3C6LA 3PLYA 2F0CA 5IROC 1NEZA 4XWOD 2NQDA 1CFTB 1D5MB 4ZUWA 2YWYA 3U2JA 3TBWB 3CJJA 2NUTB 1NUNB 4ODXB 1V55B 3FOLA 5DQDL 1CT8B 2XVLA 4U0RC 5AD0B 4V1DD 4K71C 2WJ5A 3MBEC 2B5IB 4KHTL 4D7PA 3WD5H 2YPKA 2QPSA 3SDAD 1KGCE 2NDFA 3OC8A 5F7KC 4HUCA 1IKFL 5KJ4A 5I28A 3C8HA 5AAWC 1D9KA 4LSTL 4X99B 5IUSA 1OM9A 2OSLB 1UJ3B 2ZUQC 3P54A 1PEWA 4YHIA 3BQUB 4HWZB 4JRXE 1G7IA 4NFCA 2OW7A 4R90L 2X9XA 4YVUA 3QQ3B 5TJWK 4XN9A 1SNRA 4JO2L 1IM3D 4V1DB 2PPFA 1QFWI 4F8OA 5D7JD 5FGCE 5DK2A 4F58L 3MLRH 5GZOA 3E8UH 1MUJA 3A4DA 4WZ9A 5DD5H 1RUPH 2CXKA 2R83A 1U95B 3GWJA 3C6SB 3MCLL 4P5TB 2UWEF 4GEJA 4HWBA 4P2CG 3G5XA 4Q0XL 5HD8C 2B77A 2XN9A 5GSVA 5CILL 4B53A 3KCWA 4JRLA 4Z7WA 3F7VA 3WG7B 1JGLL 1BD2A 3ILPA 1L9OA 1E9QB 2G4GA 2IQAB 4JANB 4JB9L 1HU8A 5LHDA 4PJIB 5C97A 4QXUH 4OJCA 3GI8L 4IS6B 2OTWB 1TMQA 4WWPA 2ADJB 3W0WD 3L1FA 2VDLH 1FYTA 5IHZA 4XN4A 2HJLB 2A9ML 1A7NH 4PJ5A 2WINB 3IGUA 4UZSA 2YGVA 1BFOB 2BP0A 1DBMH 5D93B 2W92A 3TJHC 4PRDB 4E5XB 3HI5L 3K2KA 4LSQH 1VGEH 4XP9L 4FNQA 5GRVL 4OFYD 5KTEH 1NMBL 3OAWA 4JR9H 5IVOA 4RISL 3MJ8A 1EHAA 1EXUB 1HXKA 2JJTA 1OTSD 1UOVA 4GQ9H 1GZPB 3PCYA 3W11C 1ZK9A 4ADJA 4NO5A 3QEGH 1AY1L 5DDHB 2QBWA 3HC4H 1DBBH 4I9WD 1XD1A 3VX0A 3KPNB 4JJHA 3FTGB 3IJSB 3V5KA 2PWEA 3CH8A 3MRNA 5CHNA 3UTSB 3G6DL 1UXMA 3ZTCC 3QDGB 3RDTD 4JFXB 2OL3B 5E99H 4A67A 5CSBA 2X9WA 4LSPL 1UZ8A 2X1PA 2GFBA 3CFMA 4IBTA 4JM2D 3SKMA 4XVTH 2AKRB 4BELD 3H3PH 4DWHA 2F53D 4EN2A 4AMKH 2BK8A 4PW4A 5CILH 1ESOA 3JTSB 2CPUA 5AVZB 3T6QC 5EO1A 4JO1H 1S7UB 4AJWA 1PX3A 3ZVVA 1JZGA 2E27H 1G1YA 3ZL1A 1TPXC 3L4VA 3MMEB 4KJWC 3HG2A 4ORGA 4JB9H 4JFPB 4PJ6A 2EZ0D 1EAOA 4LE8A 4XOAA 2X4RB 4JCWA 2WANA 1CD9B 1Q0YH 4LVNC 2BIQA 4G8GB 2FWLB 2CDFB 3QEQB 4L5FE 4WFFD 1DHKA 4Z7UB 2MNWA 1JXGA 2L04A 1F1GA 1J8HB 5C8JB 5C6TL 5I5MA 1GW0A 3B9EA 4KVPA 3TO2B 4L4VB 4XZUA 4NJAL 3SYQA 4PRAA 3T2QA 1IE4A 2PW2A 4OD2B 2XV0A 3L5XL 2BSDA 1FPTH 1JWSA 1KJMB 1WAAF 4XMLH 1YO4A 4QHLA 2EYTA 1E8WA 1R3LA 4R4FH 2Z4QA 3TZVC 3SODB 5HBBA 5DEGB 5EF0A 3HTLX 1T6BX 5B1CA 1R3HB 2I26N 3WIFB 4KI5D 4AM0B 4L4JA 1XH2A 3MRGA 1MJ8L 1FO0A 2APFA 3ZQXA 5HPMA 3C09C 5D1ZI 3WNOA 4RMBA 4A7QA 4ZMLA 4HZ1A 2YXVA 3TFKD 2AHLA 5K9KB 1YAZA 2HTLD 3TWCL 1IBZA 3ULVH 4OLYL 2IXQB 5ETUB 2CUMA 3HOGA 5E99L 2Z35B 3U4AA 1RK7A 3HG1A 3BAXA 4FXTA 4OFDA 4TVPH 4NM4L 3GLZA 3O8XB 5HHOD 4LCWD 1M6UA 4OCRL 1WZLA 3S5LA 2ZXBA 4Y5XA 1BZQK 2OZ4H 2X5PA 3NPZB 4HCGA 3T6WA 1I8AA 3MOQA 4ICWA 4Z3IA 4QRBA 4P4RA 4FKHA 4KHXH 1H6UA 7CGTA 3WIHH 2D7OA 5DZJA 3KLQA 4NO3B 3PWJB 4FCHA 2I5YH 5KSUA 1NAKL 3RL1A 4B50A 4OD1H 4ZAKA 2IH8A 5SWQA 1Z66A 4XVUC 1G87A 4LSSH 2QMJA 4HJUA 3FQWA 2YAHA 3O4OB 4B7IA 1J5DA 1DJYA 2IAMB 3POCA 3OR6B 4G7QB 5HHXL 2OQJA 4L1HA 5FUOL 4PVNA 3B3IA 3IETB 1FZJB 1WIPA 4QRTB 2W95A 3IU4H 4LAJH 1MEXH 4GRMB 4R8WH 3VXOA 1JMXA 2WUBL 4FI6A 2OX5A 2X6AA 4NJAH 2O6DA 4P9HL 1JHLL 5T1MB 4NNYA 1RL1A 4A2HA 4LHUA 1W0VB 5FYJH 4I18B 2ED7A 2WLLA 2ZCHH 1KBVA 3WJLC 1A4KB 3EGDB 1RIVH 1H5BA 3PQYB 5KANI 1ZTXH 1Z5HA 2XYBA 3LN5B 1LTXA 3RVWC 2E4TA 1KIQA 2Y6SC 3MACH 5H37H 1KXVC 3N42F 1MCJA 3LKRA 4F2ME 3V4VL 3O2WH 4JMXA 5B7EA 4NT6B 4S1QH 5TDNA 3TPUB 3ZSSA 2EDFA 5I18L 1FRGL 2AXJA 2ZWYA 1E5AA 3QZNA 1CI5A 1URZA 4MZ2A 2ZOTA 4RSVA 1CXEA 1WA2X 12E8L 4K3HA 5K1JA 4OB5L 1QUNB 1QSVA 2VUKA 1IGJB 1X7TA 3MLUH 4WU7A 1XBDA 4KZCA 5K93A 1MKFA 4E9TA 5A16A 1NBZA 3SE4C 1R6VA 1HC1A 3TL5A 2JKXA 5DHYA 3BP5A 2FWOA 3VQLA 2CDGA 1E2VA 2FX7L 4PD4J 4ZXBA 4YEEA 4MXWL 4LESA 2P8MB 4AITA 3E9TA 4AEHL 3FO9B 1FFOA 4U1MA 1TVDA 5JORA 3PGFL 5IUCA 1VEOA 3BH8B 3ZOAA 1K85A 2Z0BA 1QSEE 3NQ0A 1HKLL 2PP7A 3S37X 5FUOH 3SJVB 4AQAA 2W9DL 2FGZA 3B9KA 4CKQA 1YNKL 3U30B 2HG5B 2MEJB 3JYBA 4HLZG 1C12B 1GH7A 1FN4B 4TVPE 4AWJC 4ZUUA 4JZOA 2GHWB 4FG6C 4EEEA 1D7CA 4EIUA 4P9HH 5FYKD 1MCRA 5B39A 4HQQL 4R4BA 5FAAA 2IO5A 2PWGA 2CIIB 5A6IA 2J88H 2VXUL 3MXWL 4GAGH 3RIKA 2YMXL 3C8KB 4P59H 4V33A 4W4NA 1YEJL 1BVNP 4MXVE 5F0PB 1IAIM 2DQTH 2QKSA 4HHWA 3P4MA 4WEUD 3QUGA 4NPYB 4XRCA 2V2TB 1PZBA 5DS8B 3VD9A 3CD4A 3O81A 1OAUH 3CLWA 4L18A 3T0BA 2V33A 2VL5A 1SBBA 2O5ZL 4ZUSB 4LHUG 2X05A 1W8OA 3L7EA 2OMVA 2BVPA 1S78D 4HJSA 4DJMA 1K4CA 2VDQB 5D8JH 1W72L 2YLKA 3L2MA 1NL0L 1ZA3B 4TN9A 1X9LA 2D03H 3L1OL 1TVBA 2E6JA 5EDXA 12E8H 1JYNA 2Z92B 4IU3A 2HCZX 4KUZH 1J9CT 1G7HA 2HUHA 1LEGB 4FLSA 5I30H 3CPLB 5FO9A 3TV3H 3VUAA 1YMMA 1FZOB 1S6NA 2LU4A 4LLVB 4LPVA 3S34L 3TA3D 1JVLA 3G7TA 4U1HB 5JNYB 4NWTL 5T33H 3IDIA 5D2NA 3UZEA 3ZLQC 4LO9A 4AEHH 3ZK0A 3ILDA 3P2TA 3IE9A 4P4KC 4QDGA 1CL7L 4JRYA 3EG9A 3WKNA 5SWZA 3T2PA 4BDVA 2GK0B 1B6UA 4L37A 3D52A 1B3IA 3PGFH 4Y16C 4AGMA 5BS0E 1Z1WA 4WWOA 3VFVA 1WSST 4BGLA 3Q2NA 4E9LA 1SY6A 3FU5A 1B4JL 2YUVA 1QQDA 2HRHA 3DIFA 2C1OB 2K9UA 2NQCA 4P57B 5FGRA 3EHBB 5IB4B 3JWNE 4JREB 2OMUA 2FLBT 5KVDL 1OSYA 4YXLL 5LG6A 3HB3B 5CFHA 1WUZA 1YECL 1PTZA 3WUWG 2YMXH 5C09A 4P59L 3HAEB 1R4XA 3BFWA 1Q94B 4PTUA 3A6BH 2QGDA 1J8SA 4YC2C 3IFOA 1OAUL 3OKKB 3JWNC 3FU8A 2ZXDA 1I9IL 3VB9A 5ESVB 1A9BB 1I1AB 1NC4D 5KUMA 2NNRA 1Z5LB 3MHZA 3RWEB 4Z3GA 2JQZA 3HW7A 3WXWL 4K2UH 2EABA 1A7BA 4JDEB 5CMAA 1MCOL 3BE1H 1DSYA 3OXSB 2YS4A 5GIRB 5HYIA 5KYUA 4M3HA 5I73C 2HKHL 4X5XB 1VADA 4LKXA 3KPTA 3BZEA 3GJEB 3NEOA 3VTTA 3ZDZE 1F4XH 1T7ZA 3QRLA 4A04A 4POYA 2ZX8A 1QLRA 3KLAA 4JFYB 3I9GL 4OI9A 4XGZB 4P2OB 1P4LA 1RHFA 3D7PA 5I30L 4H8VA 1G1OA 1JZ2A 4WNQA 3O3AB 3MTXA 1OF2B 4KVNL 2DQJL 2AV1B 2DLFL 4N0CD 1CGWA 4KK5D 5IWLC 1MFEL 4HKBA 2OSXA 2PTVA 1YNTA 4H2CA 3LS4L 3T3PB 3WMPA 5TH2A 2R2EB 2RD0A 4HOWA 3DBXB 4JFEA 2WSPA 4MA1B 3IDYC 1T80A 5D2LA 5DHVA 5TQ0L 3U4EB 5E0QA 3UPCA 4IJTA 2I60H 1NANH 4PJEA 4QRUB 4Y2LA 1A7PH 5KBDA 3WOVA 3PS6A 2WXLA 4ONHA 3B2VH 3CVCA 3KPSD 3MODL 4YE0A 3UIYA 2ZWNA 3NZSA 4M7JL 5J13B 4BUQA 3U6XS 3ARWA 1D7DA 2CRYA 3VFRB 4DGWC 4XB7A 4P2YA 2CO3A 2XWXA 3E2HC 3NESA 3CSPA 4GPVA 4XPBL 3BZ4A 1DEEA 5L0QB 4W9KC 5JYMA 1H8OA 3ZE1E 3QK0A 1ZA6B 1OOWA 4BFIB 4ZX3A 1MDTA 2Z93B 4JRYD 3ABGA 4M03A 3W39B 43CAB 5K9QI 1VZHA 5E6UB 1AQHA 1L7TH 1YECH 5T3XH 3HC0B 1DJIA 2YA2A 3FUEA 4CSTA 4WEEA 3UAJD 4BKTC 4MAZA 1OT2A 1HQRB 3IGAB 3TZVB 3ZYZA 1OQOA 3ARVA 5D1QE 2R51A 3AROA 1I9IH 2WM0A 5ICZA 2QQQA 3RPKA 2VAAA 3PP3K 5A2LH 3KVPA 3WNLA 1H6TA 3NIGF 3DRQA 3VMNA 4KJPD 1FNAA 3WO4B 1MWAB 4IOFD 2VLKB 1IGFH 3GS0A 1KGJA 5D5MF 3DRQB 5DMIL 5FYKL 5TQ2L 1E27A 2DI7A 2DS4A 1VGEL 2ZJSL 3HE6D 4HKJA 2XN1A 4XP9H 3S97C 5KTEL 1K3ZA 2XG5B 2IFGA 3AS3A 2YQ2A 2CCWA 3MKGA 5AVYB 1URLA 2E6QA 3QNYA 1EWHA 4JM4H 4FXGC 5BVJA 3II1A 4PMEA 4ZQKA 4X7EC 1M9WA 5KSBE 5D1XA 5JOEA 1HQ4B 3S35L 2XNAB 5EA0H 1KJ2L 2UY6A 5BQ7A 5KSAD 5DI8B 1EHNA 3QPQD 3QJSB 2A9BA 2IALB 43CAA 4AYFA 4J3RA 3N43F 1KJVB 4G11A 1A7PL 2H0PA 4BKSC 4Z7VA 2YXWA 2DQGL 2WXNA 5AG8A 4OCWH 4OGXL 1K5NA 5DRNA 2HT3D 5KS9B 1KIPA 4M7JH 4DN3L 1R1CA 1S9YA 1IT9L 3ZE0E 1E5BA 1F3JB 3UBGA 1DQDL 3OAYH 1UJTA 4AMKL 1AQDB 2BNUB 2BWDA 1EBPA 4HC1H 4GW5B 1WCBB 5C9JB 2YQ3A 4IK7A 4Y9EA 5D1ZD 3NSYA 4JLRB 1A6PA 4QRRD 4D87A 3PYCA 2VXTL 4BH7B 1A7RH 3VTMA 5L7XH 5D6CA 1I9RL 3TM6A 5DA0B 3U30C 3B9KD 3BD5A 3EFDH 1YNTB 3JWDC 3MRLB 3P73A 4NC1E 4CUCA 2H6OA 4BWTA 1UH4A 3HBPA 4Z7QF 3O3AA 4PG2A 1BDYA 3SD5A 2JXMA 4WCYL 3THMH 3TEYA 4RQQB 4WV1C 4NQDA 1MNUH 5ID0A 4GAFB 1QTSA 3QNXB 1KBKA 5F88A 2WXKA 2VZTA 2HFTA 3LVTA 3JXAA 4UINH 1DDTA 1MWOA 3D05A 1CLZL 4PG9B 4QRPA 4X5XA 1IEAB 5IG7A 4FFWC 5AVVB 3L5XH 4UZGA 4GBXB 4Q2ZB 3N9GH 4R7VA 4LVNB 1GGIL 4I3GA 5EU3A 4K7PH 4I0PA 1CG9B 5LG1A 3ZSTA 3JZ7A 1MFDH 4TL5A 2WOYA 1II4E 1H0DB 1KGUA 4FLOA 4R4FL 4XO3A 5FS5A 1Q9KB 5GJTL 3ULUD 5DRWB 4LSRL 4FFZA 3WUWA 4HH9B 4DK3A 3IFOB 4MJ6A 2EKSB 4YO0A 2C7FA 2EIKB 3LOWA 2ZD0A 4PTUB 3HNVL 4OZ4A 1XF2B 4P2QE 2QKIA 1A6ZB 4QXTB 5I6LA 2O4EA 4I13B 4XO9A 3EOYG 1S2EA 1FIEA 2ZCKH 3GSUA 1DUZB 1NAMB 3CZNA 4XVSH 2FATH 3CQQA 1J0YA 4QHMA 2NNXA 4HS3A 1A3ZA 4F27A 3SKUD 2HLFC 1E9PB 4WFHE 3KS0J 2DF3A 5CU9A 2EDXA 2QLYA 3JWDL 1GHFH 3DIFB 3PU7A 2LQRA 3CZFB 3LTVA 3V4LA 5FF6B 2FJFB 3NSFA 4Q9QL 2VMDA 4BFEA 4FNSA 1CFNA 4F33B 3ABZA 3D33A 4B41A 4L37B 3ARBC 1N70A 5LAPA 5JIKA 3MLYL 3QIBB 4PWKA 1PVHA 5TPWL 1X5XA 4OD1L 4F9LA 4ANWA 2NLJA 5EEWA 4LL9A 5HGDA 5ALBL 4LLVA 5F6IC 3CFEA 5F44A 1AO7A 5HHXH 4D9LL 1W8NA 2GC7C 3VI3E 5FCUH 4DPBX 4KX9A 1LEGA 4UDUA 5I1EH 4L0YA 3CHXA 1N8OE 1MEXL 4CA4A 5EFIA 3V7AG 4U2ZA 4HP5A 2HG0A 2XX0A 5EUKB 3FRPB 4G9DB 1SJMA 4TRPH 1HE7A 1MI5E 1SY6H 4YPGB 2WBWB 4WDIB 2BSSB 2YAPA 2WAHA 1AGDA 1KCKA 1XGUA 4JM0A 4PR5B 3QC6X 3QJUB 1JGVL 2JKJA 4MAYC 3V8CA 3Q2WA 3UAJC 1UXLA 3P4MB 1EDHA 5E1QA 1UC6A 3HNVH 2F2HA 3N1PC 2CDEA 2VWEE 3D39E 4L8BA 1OLZA 1NC2A 4TPRL 4WI2A 2HPTA 5E2UH 4B9KC 4BZ2A 4ZG1A 4XCNB 1XIWD 1FL6A 3QUHA 2JCWA 1BJ8A 4MHHI 2CJUL 4MNQA 4OD3H 4JZOB 3FUIA 5E2WH 4GKNA 1V8HA 2LLGA 4Y16B 2VISA 2NZ9C 3FL7A 3L4UA 5E8EA 2BFVH 1U92A 3MV7D 4WRLA 1DTUA 3RA7H 1JZ6A 1J0ZA 4RX4A 1ND0A 1T5KA 1SBSL 2B0SL 3MZGB 4FG0A 3SJVA 1H3WM 3LIZH 1DVFC 4FXKB 3W5NA 3S8FB 1SLUA 1JF6A 1KTDA 1L0YA 2EH7H 1GY2A 1OANA 1XAUA 2PTUA 2P1YA 3FO9A 2WZ0A 4JPIA 1QRND 4XBEL 3SGEI 4U1JA 1NMCC 1ZVHA 1M71B 1T1WA 2NMSA 3QEHB 4RMVA 3KEDA 4JFDD 4J3PA 1DBJL 1PDKB 1CLOH 2FWOB 4WHTB 4LEXL 4MDJB 2AJ3B 2X6CA 1EZLA 2XPYA 3AU0A 4Q89A 1XXFC 2XWCA 3MJ9L 4S1SH 3VM7A 5BUGA 5EEVA 4OQ1A 2ZX7A 1MFCL 3D2UB 1QR1B 1QEWA 1WS8A 2ITCB 1A6UL 3BH9B 4G6JL 4HD5A 1CIDA 4JPKL 4LIQE 4OCNC 3GMMA 5TGBA 3SE6A 3WEBA 4KXZI 2Z91A 1QBAA 4XP1H 1UB5A 3QIWD 3D50A 3L45A 3T71A 3MBXH 2H9GB 4IKNA 4UTAH 2ZAIA 4NT6A 5TDNB 2J88L 1E28B 2VXUH 3ZTEA 3FNKA 2FDBP 4ETQB 3FC8A 3V6OC 3REWA 3ZDXF 3GSOB 3WNIA 1KIQB 1JPSH 1EAJA 3QZWA 1U8JA 1E7VA 3E80A 5AYTA 1YY9D 1PKQE 4M8QB 1H5BB 3EGDA 3PQYA 4X8GA 1S4IA 2H32A 3ISWA 2Y7SA 1VCBC 2GBVA 3EYOB 1XH0A 1SEQL 1W72H 3T08A 2Z7ZA 3S35X 2EACA 2XUWA 5C0IA 2OJ1A 2JH2A 2NR6D 3UEQA 1RV6X 5DFAA 5E2WL 3AS1A 1I8KA 1MF2L 4Z0BL 4HJGA 1Y07A 1D5IH 2WB7A 3B3IB 3IMTA 3S3CB 5JA9A 3LNGA 5IMOA 4OZFB 2J1YA 2IEPA 3OR6A 3UYPB 2CK2A 3BRFA 3ULUC 1E8ZA 1Q4NX 1BQ5A 1FFPA 1T0PB 2WV3A 3I85A 3PE9A 4G9FB 5MI0B 2QPFA 4ERSL 1ETZB 3LZOA 3ZQWA 3HLAA 3KYAA 1G9MC 1JXDA 4NAMA 3V0IA 1T89A 3PWJA 4ZFOB 4XMZA 4PCYA 1R3JA 3U79A 1DN2A 2WLYA 5SWSE 4KMTL 3OMIB 1UYWH 1PZCA 1WISA 4AYDC 4KFZC 4XN7A 5F9OH 2BIPA 4S1SL 2YARA 1T6VN 1CLVA 3OD3A 2F74B 1G9ML 1WT5C 2QQNH 4N3TA 5I8OL 3GHBL 2B3RA 4E2OA 1YEHL 3TYFA 2BOBB 4NAQA 1JTPA 3SGDI 1OGAE 1COBA 1EA9C 5F0MB 4LARL 3ARXA 2MOGA 5DVOA 1QNZL 1NEUA 3FS9A 1MELA 4B9FA 3P4NB 5I1AA 3ESPA 1HCZA 4WJKB 4PW9A 4GLRH 3RX8A 2H0JA 2Z4QB 1NFAA 2ITDA 1RJYA 2VZ1A 4NUGL 4NZFA 4TNEA 4P5KA 4UB0H 3MUY1 4A39A 4R7XA 4FFTA 3ZTNH 1MCOH 3H2WA 4MQXC 2P52A 2HKHH 1PLGH 4ADIA 3TO2A 3QUYA 3SDDA 4N6QA 3HC3L 3UZVA 1RJYB 1HEJC 3QEQA 1OP5H 4H1LA 4GQRA 5AL8A 1I7UB 4U0RB 1ECYA 1BQLH 3EFFA 4LPCA 3CFCL 5B39G 3SDXB 1A3RH 3GMPA 4YQXL 2ICES 4XP5L 4OCXH 5FDYA 4Z8FH 3V0VB 3GSXB 4X0KA 4XMUA 4XMVA 3SKJH 2R29L 4JDTL 3O3DB 3EOTL 4NCDA 4X7DC 5IBUB 2OPCA 1DSFH 4LCYA 4MBRA 1KXQA 4P2RE 4X7TA 4PIRF 2YQGA 1RLWA 2V5RA 5DD0H 5JHBA 1BP3B 2W59A 2Y7MA 4KMTH 4X5QA 4MYPA 5D7JB 4LIQL 2CKBA 3HHMA 1ET7A 3K6FA 3QHFL 1GIGH 3CDFA 1LL1A 3BPNB 2JKTM 3C60B 4NUMA 4N8CH 1U8PA 2NZ9D 3TEWA 1R75A 1KPRB 1YEGL 3HR6A 2Z9TA 4Z18A 4TKWA 3MRNB 4KAQL 3BP4B 2A6JB 2WZAA 3UFIA 3IJSA 1LJMA 1U0QA 2X6VA 2EXYC 2VLLA 4K3DL 3G6JA 3RWJA 3VU1A 4E42A 3IGFA 1QFUL 4FQLH 4OJDH 5FW6A 3F7LA 5FHBL 1KACB 1KOAA 2WIIB 4Z7NE 1AQMA 3PWPB 4PRPD 4X4KA 2X2UA 4H88L 1PD6A 1ZHBB 4MMXC 4U6YA 5JXAL 3MJ8B 1L9SA 1G7MA 1SQ2N 4X80H 4E9XA 1EEUA 3EJJX 2A5UA 5CZRA 3ZTNL 2ENPA 1B0GA 2ETWA 5LDUA 4MAYB 3G3LA 1M42A 2ZJSH 3GJFH 2NX5E 1QATA 3I6LD 2OMXA 2Y7OA 3LDBC 2HJLA 1RK1B 3HC3H 3MRFB 8PAZA 3OKEB 2D7TL 2A6IA 2E59A 4UAOC 4A6YL 2X3BA 5EU4B 1WE5A 1U8JB 1J9QA 4KJQC 3KXFE 4APQC 3RNKA 4BV1A 1A3RL 3PJLA 1LE9B 4ETQA 1OP9A 2ZUQB 4G5ZL 2HAZA 1QFWH 3DUUA 1PX4A 4Z7UF 5D7LD 2KLRA 3NPYA 2R1WB 4JDTH 4OLWH 1DSFL 3R18A 4QXGL 1XF1A 2F68X 3MRIB 4PJ5D 4Q6IB 4AQ8A 1PAMA 1T7WA 5F9JB 5CJQH 4F9PC 2AJYL 1MCNA 2NDGA 1DQJA 2ZT9C 3TOPA 1I7RB 5JHLA 4Z0YA 2WWOA 3A67L 4NEHB 1FORH 4KBPA 4P5TA 2BFGA 4XXWC 4FZEL 5DFVD 3RJQB 5E24E 2VXVH 2IBZY 5E9DB 5BS0A 1RZPA 3SE9L 5J1TC 1XGYH 4OIBA 3V4PB 1TQCC 3H53A 3OAZH 3ISRA 1M71A 4KAQH 4YNYA 4K3EL 2J4WL 3ZHLA 3Q9QA 4G70B 1RIHL 5DRZA 2DMKA 1D5XA 3CCHB 4U3HA 2F5BL 5KOVC 1XHHA 4QOKE 2V9TA 5E6ZA 2FT7A 3GF8A 3GSRA 2PYEE 4DVBA 4WCYH 2F53A 3MGTA 3PHQA 1BIIB 1MCQA 2A74A 4L4TB 4YAQA 1BAGA 3CFDA 3EW3B 4TM9A 4PRIE 4D9RD 1ITBB 1IM3A 4JY4B 3ARPA 4M4RB 1DVQA 3UACA 4QRAA 4Y4KD 4X4XA 4UQ9A 4BFGA 2YBGA 1ZXQA 2YGQA 1KV3A 1VCAA 2AJSH 1GGIH 1FGVH 4CC1A 2FSEA 4MS6A 2P80A 2A9NH 1CGSL 3OBAA 1GJUA 2V0AA 5IEKA 4MQ7A 3MYJA 4QT5B 2DI8A 4MS8D 3PAVA 2D2CC 3OXRB 4YXKL 3G9VA 1PZSA 5DJAB 3C5JA 3EYFB 4BSVB 3MLVL 4FN0A 1MZZA 2BSSA 3CZEA 3QXWA 1XGPB 2JJTC 4QGTA 1I8LA 2ZUSA 5AZUA 3H54A 2MH4A 5HYJA 3U2SA 4G9DA 3KDPB 1OD9A 1QHOA 3KLDA 4FZ8H 4K9EL 4NRYB 5EUKA 1RP8A 4UQEA 4XPAL 2VWEC 2VDOH 4NNPL 1GVIA 3BZDA 3OKMB 2O6CA 4PJGF 4WGKA 1ZEAL 5GGQL 2C3VB 4NN7B 3NSCA 4V11A 5C0CA 5KSVA 4UDUB 3NZHH 4XNQA 5IJVB 4WUUD 5JW4Q 1GYWA 1MIMH 4KTDL 1WFJA 2E74C 3T4AB 3ZMEA 5HGDB 3EYUL 2HVJB 1KPUA 4DP9X 3IJHA 2V3EA 5JHDA 4AYMC 4LCVA 4DT2A 4LCIL 2PWDA 1MSPA 2IFFL 4PJBB 4HU2A 3ESUF 2VDLL 1UZ6F 4GNKB 4QLWA 1RMFL 4QRSA 4PWIA 1OE3A 3V52H 4KRPC 1MFNA 3BQUD 4WUUB 1QLFB 2IWEA 5E2TH 5JDSB 1NCDL 4PRPA 2BMKA 3CSFA 4AIEA 2D3NA 2GC4C 4QHMB 3N1QC 5EO9A 3SDYL 1CB4A 2ZUXA 3NAAL 1E0OB 1YJDC 5FM5M 1TVHA 5DK3A 3Q8EA 3O0RL 3IT8D 4PD4K 3OKMA 1QLEB 2UWEA 3KJ4C 1XF2A 1KBPA 1KCUH 5DJYB 2E9BA 3VFMB 4WTZA 3S8WA 4NRYA 2AJZA 5CZVL 2BC4B 5GSRA 2XX1A 3HC4L 5E8PA 3QH3B 5JYLA 3DX0A 3IRCA 5DJXB 3N44B 1AZNA 2X4UA 2OSWA 5C2BL 4Q4IA 1ZE3H 3DGCR 3D25A 3ZKND 1E50A 1CYGA 5DJAA 3PJNA 1UOKA 3QNFA 4PRHD 1FL3A 4GBXD 3CN0A 5CBAB 1P2CB 1CVSC 2X4SB 3LPWA 2EDMA 3O6LH 4NO0A 5HHNB 4GKZB 1YG9A 1IEAA 4KKLC 4Q14A 4PG9A 4QRPB 4EI5C 4OZGF 1SOSA 1AQKH 4UIMA 2WGXA 4C4UA 2FSEB 3QNXA 4NQDB 2BIMA 4MD5B 4F3FB 5J6SA 2CR6A 1GAFL 4LP8A 3EXLA 2DY2A 2GY5A 2I7OA 3C08L 5AWNH 3WGUB 3D0AA 4C4KT 1IM3B 4M48H 3P73B 3ROLA 2IWGA 3DX3A 1XF5B 4X5WB 4F20A 5D6CB 4ZTPH 2OJZH 2VOTA 1BQHG 3N91A 3F84A 5KANG 1P5UC 4UM9B 4AV5A 3N85L 3V0AC 3R7QA 2Y23A 2EC9U 2WWMD 3MLSH 2R9HD 1RERA 2NY0B 1D5XB 4NQUA 4LEXH 1JMZA 3NSDA 3FTUA 2XSKA 1RHHB 1WBXB 2GUOA 2PO6B 3CSYB 4YZFF 5BRZD 2NNCA 5F97E 5ACMA 5DFVC 3MJ9A 2WXFA 3KYMB 1FAIH 2VDMB 4ZAKC 2YOCA 4X6CF 2YA1A 3SDYH 4C58B 2R0KL 1OP3K 4KKAD 5DJ8B 2VRQA 2APSA 2ATPB 3B43A 3B9AA 5GS0C 2UY6B 2F8XC 1E4HA 3AVEA 1GA2A 1JPTL 5AVQB 5B8CC 2V17H 1OCWL 5C9KA 3F04A 5GGTA 3FFOA 5F9JA 3UBXB 1PD0A 1RKRA 3FQ4A 3SDCD 1TTFA 2XRAL 1OSZB 1T83A 1Q1PA 2AF2A 1SXAA 4ZODA 2ISDA 4FQCH 5KN5A 2DJMA 4RIRA 1K8DB 1T5XB 2ZONA 3J8F7 1E27B 2WBJB 3OPZL 3DROB 4JQIA 3IDGA 5L4MA 2F19H 4Y19A 4PJDB 4EUPB 1AGEB 5EU4A 1IGYB 3ZKQD 2GTWB 2Q76B 4LDOB 4NYLA 3S3SA 3WL9B 2OZ4L 1DP0A 4OV6F 5ABDE 4ZO7A 2DIJA 3QCVL 1BHGA 1DFXA 4YX2H 4UNUA 1BUGA 2YAMA 5MP6L 1F58H 3VFGH 1RXLA 1GAFH 4LL4A 2QMKA 2VMCA 4QUOA 5J12C 3RY5A 3AWTA 5FA3B 1Y18B 4AQ8C 2HSIA 1TETL 4BD4A 4LU5L 4ZRGA 2TRYA 2XTLA 1G7MB 1J5HA 5F3BA 3HE6A 3HFMH 3C5SA 4P46C 4TSCL 5F7FA 2H1LM 4U6YB 5CINL 4ONOA 5F8RC 4XXWA 3PWPA 2WIIA 3HN8A 1DUYA 3KYOB 4JZJC 1N0XL 1SF3A 1XB3A 4DCQA 4LPYA 4L05A 3H7LA 4DW2H 3G6JB 3IMWA 1OAJA 3KH3A 2DI9A 2DWDB 1K6QL 4O5LL 4YSUA 2J2ZB 5L9DL 2AQNA 1A5FH 4ABUA 3WLBB 4I48A 3LXUX 1OE2A 2PYFA 4F1ZA 3EHBD 1XMEB 5B21A 4XC1H 3LEVL 4PJEB 5KSAB 2R0KH 4JKWA 2WQUA 4Y16D 5MEPB 3C60A 2RGSA 1ACCA 3REVB 1OCOB 5HI5C 2O5NA 1D2PA 2V5MA 1BPLB 3M7FB 2CKBB 4HKBB 1MREL 5ANMA 4YSAA 5A3ID 1HTYA 3QXUA 1GGCL 4AJVA 1S8DA 1XTMA 4L8SB 1AR1D 4HSCX 2ZWDA 4ZMPA 1ZDSA 3GKZA 1CD1A 3IVKB 5CJBA 3VTAA 4J3SA 1G7JA 4X7TB 1TPXB 5BRPA 3B2PA 5I18H 5FWQA 1OE1A 4OLXH 3MV9E 3ZHKA 1HWHB 4JY5L 2EXTA 2X89D 4MXVF 5GGRY 2QQLL 3TCXA 2DDQH 4N0RA 4RWYL 3SDXA 1XTLA 3WSQH 4ZNCD 3AWEA 5INDA 4PJ5E 3CC5A 3CLEH 3VQ1C 5CMAB 2RQEA 3MV8B 2FHCA 5E23A 1P1ZA 3R4DA 3SDDB 3OLDA 1CICB 5AZ2L 2KZBA 3ZRSA 3TH4T 1LNLA 4PJCE 5CP7B 3BKJH 5EWIL 2BS8A 1XIWA 4PJGA 4YSDA 1ZDQA 2NY3D 2TSBA 3AQYA 4JFHE 4KZEH 4LCUB 1BXVA 2ITDB 2OAAA 2H2SD 3HFML 3IMBA 2FH6A 3WEOA 3DBSA 1SJVA 3RQ3A 3ZKNC 2HXAA 2J55A 4XMKL 1WEJL 5I1AB 1VB9A 1Q9OB 1GC1C 4RDQF 1YC7A 2MJWA 1UWFA 4X4MA 4JFQA 1ZY9A 4N5UA 4J23A 3V6FA 1EK3A 3KPSB 3QFJD 1JZ5A 2JB5L 2NY4D 3QS2A 1DLHA 4XXDB 2WZ6A 3F00A 1EZUA 1AOZA 3DK2A 2QADD 2K45A 4I2XB 1MQKL 1EPFA 3MXWH 4GAGL 5GRXG 4Z1PA 2RA1A 4FQIL 4RFOL 4GRWH 1AZUA 1IKNA 1DCEA 1YQ2A 3PY9A 2G5BB 43C9A 3IDIB 1MREH 3NCCB 3EGSB 1PFOA 1SN5A 3BFOA 4U1HA 4R5XA 1GGCH 3LPOA 1YY8B 1YMMB 3DRTB 3DJTA 4R96A 4Q4EA 1B6DA 1S7TB 4KRMB 3CTTA 1KCVH 2XFXA 3EOBA 3FT2B 1IBHA 3U0TB 2VRAA 1C8PA 5CLXA 3CHOA 3HLAB 1ZV5A 4KH9A 3FFCD 1ETZA 2PWHA 3ARED 3GM8A 5DMJB 4ZFQA 3NDZE 3TN0D 2IV9A 3HPLA 2R23B 1TVBB 2X41A 5DC9B 5I15L 4WO4A 5IVXA 4N90E 3WNKA 5GZOD 3B7UX 4FDWA 4QHKI 4K71B 4OZFA 1MDAA 3WD5L 3GEFA 2YPVA 3CIQA 1F3DJ 4MRCA 5DJ6B 4X6CB 5J11C 1UHVA 5IVZA 4DO5A 4KV5F 1NLBH 1U9KA 3N6YA 1AS8A 3BKJL 4YHML 1JWMA 2CBMA 3RY6C 4BE6A 5C3LD 2B8OT 5JZ7C 1UD8A 3LZFL 5EULV 1XFPA 2ZOKA 1XT5A 4ZTOL 1J5IA 4G5ZH 2X0WA 4WVRA 4ZS7H 3SDCC 5F1SA 3U9UA 2E75C 2LLNA 3QFGA 4QXGH 4JEGB 5CS7A 3QZWB 1PF3A 5DD5L 5DZPA 5CJQL 2E9GA 5L8LB 5HI3D 3AMLA 1B88A 2JSFA 1FN4A 3CH1B 3QJFB 3A67H 5JHLH 1LO3H 4AKPA 2HG5A 2X1QA 1MFBH 3B9KB 3X3GL 2OL3L 2AJVH 4K9EC 4NNXB 5KVDH 4P3DB 4HWBH 1UB5B 2XKNA 2QJDA 4L3AA 3QPQC 2Z91B 4J6TA 1O7DC 3NTCH 5ENWA 2Z1PA 3D2UA 1YEEL 3MCG1 3A23A 2B2XH 1QR1A 4KNQA 1EV2E 35C8H 5SX5H 5I19L 5LXGL 4G6FD 1OGAD 3MLZL 5FDWB 2HT3C 4I1PA 3F7KA 1WH0A 3GGWB 3HE7D 1G1CA 4JK0D 2YC1A 2BOCA 4PJ9A 4L5FH 2N7AA 2BDNH 4QF1B 2LLLA 4K2UL 4R2GD 3HCVA 3DOSA 4YGVB 3U9WA 5GS1C 3I50L 2VQ1A 1CU4H 3CPUA 2EUWA 4WU7B 4JW3A 4X5RA 1C8QA 2RAMA 5I3BA 4NNXA 5MEOB 2XZAH 3IJEA 1WAAE 1ND0B 1LP9F 3NACH 2CPCA 5D9SB 5JIMA 3F8UB 2RMNA 3K80A 3CH1A 3QJFA 4L1BA 5JW4M 1QG3A 2VUYA 2YD0A 3V4UL 2VM4A 5C7XL 4L29B 4BYHA 4GY4A 3QEGL 5CGBA 5TE4H 3LZFH 4Y9BA 4EI0A 4MJIB 1NFIB 4FFWD 4IOSA 1I3RB 1UJ3C 1JXKA 4HIQA 4G7YL 4L8BB 1PCXA 4JPVH 5KOMC 1I9JL 3QFJB 3WJJC 3UGXA 4I18A 1W0VA 1W16A 5DFTA 2ICEA 4LSPH 4BZYA 3AT8A 3PGDB 3QHTC 4K9EH 4J6UA 1HL9A 4H1LH 4D0DB 4P2OC 4LRNH 4UI2A 1LO0H 4X6CA 4WDIA 4QRTA 4OTXL 4YPGA 4NJ9H 5AVWB 2OL3H 4NO2A 3ILEA 1UH2A 1OLLA 1QPPA 2OZNA 3NRPA 1L6XA 2XG4B 1BMZA 4OZGA 5EFIB 4PS3A 5DUPL 2HVKA 1Q8MA 4RNRB 2EDQA 4H1LG 1KC5L 4D0BA 2R4RL 3JZYA 4PRIA 2ZXWB 4EUPG 4OAWA 3ALPA 4PJ8D 4R96B 5CE9A 3CFEB 4PJEF 1SMOA 2GTZA 3EGSA 4Y5VC 3FB5B 3IS1X 2G5BA 4BFFA 1IC4H 4OLEA 5ECGA 2DM7A 1YNTF 5C71A 4H0LC 4NRXB 4HKZA 3OB0H 4DKEH 1IBBA 1X3DA 4YDVB 3L6FA 1FPTL 4XMLL 2Z31A 4AGQA 1OCZB 4F33A 4XPHL 2DH2A 4PBXA 4WKXA 4KK9D 5AVUB 5FF6A 1LHZA 5I76B 3IKCB 4GW1A 4XP6H 3LX9A 3KPSA 1BOYA 4PJ8B 1G9NL 3ARUA 4P4KB 1E4JA 1R3KA 3AMKA 3QDGD 3RDTB 2ESVA 3X1NA 5EOCH 3ELQA 2VLMD 3DX9A 3TF7C 3DYPA 2XQYK 3GUTB 4YVNA 2XN0A 4IRJB 1E4XI 2DKSA 3LQZB 3MV7E 1DVXA 1A6ZA 4LCUA 1FNSL 1XSKA 5EF2A 1FGNH 2AEOA 5J56B 1XIWB 1DO6A 3A4EA 4PJGB 1KWKA 3PABA 1T0OA 1QO3B 3PJSA 5I26A 4PRAB 4DESA 4PJFA 2BM3A 2KKQA 3S2CA 4NKMB 1A1OA 5AOMA 1L9MA 2IADA 4IMKC 1CG9A 5E1AA 4CVUA 2ZUWA 3RHWF 2CDFA 1M6OA 2UWEE 4L2LA 1MCKA 3CC5B 3WIHL 1RUAL 2Q5BA 3ECBA 4UAHA 1DQLL 3EF4A 1J12A 5IG7B 2Y2TA 3COOA 1HZHL 1XCQA 2AQRA 2WCSA 2QLVB 4HLJA 2QSVA 3B83A 4OCLC 3AITA 3CBJB 4ORGB 1TTCA 2GSIA 3ARDB 1F97A 4YSTA 1JWUA 3PWNA 4WENB 4RQQA 2P28B 3D8MA 4MYWB 2ZE0A 3IE4A 2A0LC 1G6RB 2R2BA 3UYRL 4PUBH 4R9HA 5ANMB 2VE6A 5MENB 1KPVA 2X88A 3MRLA 4O58H 2VLJE 2AKRA 2OFQA 2D31B 3D12B 1OAKH 3FRPG 3DV6A 3HR5A 4KDWA 5J4MA 4XC3H 3JWNG 3ARTA 2GBAA 5A1AA 4MLIA 2F54A 5BPPA 3O9WD 1BM3H 3QDGA 4I8DA 3HMXL 4PJHE 1F3JA 2OXHB 3JYCA 1C08A 4RAHA 4AH2B 2WNGA 2DWDA 1KIPB 1X5GA 3DPDA 4I0PC 5L0QC 1DVFA 2AGJH 2D7QA 4NO5B 4CBPA 1EJ8A 1B2WH 3JWNH 1Z3GH 4IRZH 1DUYB 3GZKA 1HCYA 1D6EA 2KC0A 4RWHA 4AYFB 1HWGB 4HOMA 3AB0C 4PJ9D 3CXHK 4MLSA 3B7RL 4UTAA 3EO0A 2AABH 2ZKMX 3W2DH 4FQCL 1NGWA 4HJEA 2FRGP 2IF7A 3QI9D 4R84A 4TLSA 5A7EA 1FNSH 3IWUA 3MRJB 2N3JA 4TSBH 4CSSA 3OJMB 4FQXC 1R5IA 2XT1B 3LIZA 3LSOB 5HSFA 2BJMH 2ZWSA 4AC2A 1X6LA 2WINA 4H7VA 4Z7OE 4OVVA 5FYJE 1XBRA 3LNFA 4NYLB 1BJ1H 2WP3O 3L5WA 3WL9A 1L9PA 3RFRA 4PJDA 3PDOA 1AIFB 1F58L 2ADJA 2ZMYA 1OGTB 5FYKE 3MLYH 3GMRB 2J57A 4ZDHA 1F02I 1SVCP 3ULUE 3NJVA 3RWCA 1BAWA 4Z7UE 4YDIH 1FZMA 4AT6A 4BZ2L 3HRZA 5HXMA 2VAAB 3HBZA 1BD2B 2X2IA 4L4VE 5ALBH 3QQ4B 4TULL 5CINH 1KYUA 2A7BA 3IYLW 4Y8DC 4J39A 5D1XC 1HQRA 3IGAA 4QRPD 4WI4A 5FCUL 4GMTL 2R1YB 3CAFA 3QQDB 1XV8A 3HG0A 3L48A 3NEXA 3SO5A 5I1EL 2L8AA 3UYRH 1FNEB 4PUBL 3CU7A 4KXZH 1U3HC 1X9UA 4DW2L 4N85A 4WGWB 1BPVA 2FEDC 1OHQA 1NUGA 4NZRH 4I18C 3QHZH 4F92B 1J10A 4U1KA 2NYYD 1P4BH 3CUPA 1XZWA 3BGFB 3ECUA 4TVUA 1ZA6A 4BFIA 1GYAA 2VLRE 1T21B 4FXGB 4JJ5A 1DEEB 3QCUL 3HMXH 1HNFA 4EKXA 4JAMA 3QQ3A 5D2NE 3RRQA 4FTVB 2IDFA 3BQUA 4HWZA 1FUNA 5DD6B 3JSSA 2PCFB 3FT4B 3DYOA 4JPQA 4BK5A 2DLEA 4EIZC 2YOAA 4QRUA 3FTXA 3S36H 2NSMA 4JO3L 4UM9A 5DHVB 3TEUA 3ULSA 3ZY7A 3DBXA 4JFEB 4X9IA 5DVNA 1ZSHA 2YPKB 1WT5A 4UM9D 3MU3A 2Q8BH 1OF2A 5LXVA 2CJUH 4J4PA 3VA2C 3WSQL 2LGNA 4F91B 4WNQB 3UTQA 1H6FA 3US0A 3W1ZA 2NY5C 1MRCL 3KLAB 4JFYA 5LGJB 1Z9SA 5AG9A 1QFOA 2FHBA 4RZCA 4UOW0 3A0OA 1NEZB 3F64A 1OCRB 2D2OA 3CX5J 3UOAB 5KVFH 3QUMB 5GIRA 4KRPB 3OXSA 4DAGH 2FSDA 5EIQA 3DURA 1LO2L 2P8LB 5B22A 1JXFA 1ZK5A 4JCLA 2Q3XA 3D25B 4HMCA 1Z5LA 1TF4A 2CLVA 3BAEH 3RWEA 1A9BA 1I1AA 3SOBH 1FCCA 1W0WB 2ODHA 5DO8A 3OKYA 4GB9A 3S8GB 3QDJB 4E41A 1PKQA 5C0EB 1MLCA 3U1SH 4M1CD 2BC4A 1MLBB 3HZ3A 3GSNH 1BT2A 3PNRB 3AXLB 4PJCA 1NCHA 1MFCH 4AVHA 3RUGB 1KYDA 3GMOA 5JIPA 5D7EA 3ZX1A 1TR7A 5DWUL 5H35A 4XP1L 2XY2A 4PI2A 2EVIA 2QVTA 5DZ9A 5B1KA 5JDSA 4YDMA 3Q2CA 1C9SA 1HH9A 5H4YA 1QLFA 1HSBA 3D4YA 3RL2B 3B8YA 4PGJA 2G0KA 4LQ1A 1ZT4A 3EADA 3KR3L 3Q6GL 3ZYOA 1XB8A 4FP8L 1KFGA 4FF9A 2XWTA 3C87A 1NGQH 4KKNA 4C55A 2B15A 3AREA 3ARBB 3TN0A 2GK0A 1U6AL 3EG9B 4G8IA 2NOYA 3H85A 4FQHB 2GIMA 4ANVA 5I15H 3Q1SH 3L4CA 2G3NA 1TIUA 1TZ8A 3MROB 2WKOA 4Z0BH 4F5CA 4DGIH 5IJVA 1RZ7H 2BZ7A 5HDBF 5KW9H 4K23H 2C3VA 2XQBH 2EKJA 5ABAA 3VU2A 4PH8A 1KTKE 3WNNA 3W38A 4KVNH 3U0WL 3F7YA 2DYPB 5DUML 2YIHA 1TMCB 4YHMH 3WTYA 1LO2H 1ZT7B 4KI5F 4CRPA 4LLMB 4M5TA 5IMLA 3VNYA 3L7EB 2C3XA 2DM2A 1SLWA 1PZ5A 1MCSA 5I8CB 3B2VL 1SHMA 2YD6A 3D1MC 4Y7MA 1S7VB 1U8IA 4QLRA 5FHAH 5FK9B 4CU7A 5AB1A 3U2IA 5HDWA 3UG3A 4XH2B 4APQD 3IPBA 4OZFH 5J9PA 3WS6A 3IXTA 1ZANL 2WY3B 1QWNA 3AT0A 1QBML 2RACA 3APDA 1G7QA 4JY4A 1GS8A 3OGCB 4X6EA 5DURB 2O5XH 3P0YL 4D8PA 1IGIL 2A9AA 4AQAB 3ZDXE 4CMMA 5F96L 3GSRB 2DBJA 1AXTL 2VN3A 4FP8H 4Y2OB 4ANXA 4XNDA 2DKMA 4JKPL 1VZIA 2FECL 2MOVA 5I17B 4L5FL 1BM7A 2O6FA 1JGEA 3QIBD 5CJOH 2JCCF 4M6NL 5DRZB 1IBGH 4I4WB 3SE3C 1MJJB 1ZTMA 5EZLA 4PJFF 1ET5A 4P4KD 4YNYB 2FH8A 3I50H 3O45B 5C3IA 3UYOD 2FX8H 3JQOB 2WWNA 1XO8A 5IMMB 3RVTC 3OMNB 4YDLC 4MB5A 4P5TC 4TSAL 2FEEL 5EZOH 2NY1C 3VXRB 1I7RA 1QUNA 4PVMA 2YRBA 1WBYB 3IGKA 3AU1B 1F3RB 4AL8C 3L9RB 3DHJA 2BVQA 1UUNA 4NCC2 4W70A 1VFBB 3EOTH 4UQ2B 2C9UA 5C0AD 3ERXA 5AW5B 2PKDA 4K8RC 4LVHC 4G7YH 1ZLUK 4L9LB