4L37A

Sp2-sp3 - a complex of two storage proteins from bombyx mori hemolymph
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
674
structure length
674
Chain Sequence
FKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPHYTPDKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic identification of an unexpected protein complex in silkworm haemolymph.
pubmed doi rcsb
molecule tags Protein binding
molecule keywords Silkworm storage protein
total genus 233
structure length 674
sequence length 674
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00372 Hemocyanin_M Hemocyanin, copper containing domain
A PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
A PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 4l37A02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 4l37A03
1LLAA 3AX0A 1BT3A 1LL1A 2Y9XA 2Y9WA 3AWZA 3HHSB 2ZMZA 3QJOA 1LNLA 3AWXA 4OUAB 2ZWEA 3NTMA 4P6SA 4Z0ZA 3AWVA 2AHLA 1JS8A 3GWJA 1WX4A 4J3RA 4OUAA 4J3PA 4Z0YA 4D87A 3NQ5A 3NQ1A 3AWUA 5I38A 4HD6A 2ZWFA 1BT2A 4YZWA 4HD7A 4HD4A 4P6RA 3W6WA 5I3AA 1WXCA 1HCYA 3NPYA 1WX2A 2AHKA 2ZWDA 1HC1A 3NM8A 4P6TA 4Z10A 3HHSA 3AWYA 3WJMA 3WKYA 2P3XA 3AWTA 1BT1A 3AWSA 4J6VA 4J6TA 4L37B 4L37A 5I3BA 3W6QA 5CE9A 1OXYA 3WJMB 2ZMXA 3AWWA 4J3QA 1WX5A 1NOLA 4J6UA 1BUGA 3NQ0A 2ZWGA 2ZMYA
chains in the Genus database with same CATH superfamily
5B8CA 4LLUA 3DYMA 2OL3L 3GSOB 2NYKA 1KWKA 3HPLA 3MI6A 1AHMA 2XVGA 4N2FA 3LNDA 4NPKA 1DJXA 2QQKH 1HNGA 2DRUA 43C9B 5KYWB 1NPNA 2QVMA 2UZYA 4OGAD 2CXKA 1U8OB 1U8KA 1OD7A 1IGCL 1T7VA 4WDIB 3DVNB 3Q3GB 4L0ZA 4B9IA 4MYWB 3HZVB 4ZUVA 5T3ZD 1DBBL 1KCRH 3TEUA 3ZHNA 4PH8A 1P7KA 3BZFA 5BQ7A 1OB1A 2DQGL 2YPVA 2J21A 2XKSA 1GC1H 4U6TA 5LBGA 4GQ9L 2IXQA 1KBVA 4OIIH 2HMID 3QEHA 1R3HB 2E0PA 2WQAA 4XOAA 4F9LA 5D7LD 2F8OA 3KL0A 4JLRA 3ZHFA 1O6SB 2AK4D 3G6AB 4IMLB 4PJCA 4AQ1A 5C6WH 3KPRA 5HHNB 4HZLB 1NPJA 5IW6A 5C2UB 1JV5A 4WI8A 3S3DB 5J6HA 3LAFA 4KI5D 2R69H 2VJ0A 2X9WA 4KI1A 4R0LB 3SKNB 4J6TA 1CE6A 1UOVA 3T3MF 3V4UL 2J6WA 2O30A 2BY3A 2Z7UA 3U4BH 3ZKSD 3KH4A 4BFBD 3AGWA 2Z35A 4LVHB 1YYCA 2OQJA 1HWGB 5I24A 1ID2A 2HVKB 3GXIA 4JKKA 5C2BH 5T3ZE 3K8MA 1HEZB 4NUQA 3FRUA 4ENZA 2GC4C 3VFRA 1S9XB 2KH2B 3MKGA 5M95B 1U6AL 3T0VA 2JNZA 1HC1A 2JCWA 4PB9H 1KJ2H 2D03H 4O9HL 1AHWB 5IVZA 3GIVA 4CBPA 1EAJA 1I4FA 2GUOB 2YGPA 4WSJA 3GMOA 5K1VA 4WF7A 3REWA 3VFNB 1W0WB 4F33A 1AGDB 2FAUA 1GHFL 2ED8A 3KYKL 1LO2H 1AZNA 4LHQB 4P5MB 1EGJH 5EO1A 5CZXD 3ZKNC 4F57L 1ZGLM 2DQJH 1PJ9A 1HEZA 4A6YH 2AJYL 1VZIA 4PJHE 3OMIB 4OFYA 3X14B 1DVUA 1IAKA 3M6DA 4OI8A 1KYDA 2HJLA 4K3GA 4MD4A 1IAII 5BMFH 5E2WL 4P2RA 4ZPTA 5IVZB 4KK5C 1O0VA 3FULA 4PG9A 2X3AA 3PWUA 1YEJH 4N2EA 5I6KA 5E4AA 3VXSD 4XPAL 5FECB 3U48A 3Q8FA 1D7BA 2I7OA 5DK2A 1C16A 2H32H 1EMTL 1GS6X 1VFUA 3SDAA 4KTGA 2J71A 2EE0A 4NNYA 1JV2B 4H44C 4LCCC 5GZND 1KCWA 3W0WD 3T3ME 2PW2A 4NQEE 4ZAKA 3TBSA 1UVQB 4JG0H 4X7EC 1G7MB 3MUGA 1IAIM 4QJ4B 1M9SA 3UO1L 1RIHL 2HB0A 4OJAA 4EN3C 3D2UD 2CBPA 3SYOA 1SFDA 2QVIA 1P4BL 1E7VA 1NFDF 2FIRT 3MHZA 4HH8A 2AXFA 5HDLA 4DK5A 4RAHA 4WU7A 1Q0YL 4YSEA 3DVNA 3Q3GA 2ZSVA 2LT9A 4EI5D 2ARJB 3V4VL 3HFFA 5L2JB 3RFRA 4M48L 4Z7WE 4UTBA 1E30A 5FO9A 3I75B 3MBWA 1CDHA 3Q6GL 1A7RL 5EORH 3R8QA 5I15L 1ILSA 3MCKA 4MA3A 4P2CG 3RVXD 3UC2A 2B39A 3WMQA 7CGTA 2P8PA 1OPOA 2FJGA 3L1OL 1KGIA 6PAZA 3TWCH 5I8KH 4KMQA 5C0DA 1MFAL 5C0BE 1OO2A 3LXCA 1U42A 1RZJH 2R1WB 4RZCB 1RJYA 4GQQA 1WCQA 1V27A 2ZOKB 4KUZL 3OMAB 1C9SA 2RGSA 1I9RH 3BSZH 5CLXA 3D3VA 4MZIA 5FK9A 3ZZSA 1FA4A 2CCVA 5CSGA 5EUOE 5HHPA 1G9NH 3QWQB 2XPGA 3VJ6B 3HRZA 1KIPB 3HC3H 2VT0A 1VLXA 4OGZA 3VVVA 3VGGA 3F7LA 2Y72A 4Y1AA 2IWFA 2I25N 5PCYA 3FO1B 1AD9A 5E1QA 4HKJB 2O6FA 3MREA 4JG1H 5ADPL 2XRAH 3CDFA 3RVWC 3KMDA 2BNQD 4ZW3A 1XGZA 2YMOA 1Y07A 1G7HB 4Y16B 1HS6A 4RX4A 4RZCA 2EDDA 4MXQC 2BOCB 1P4IH 2P5WE 3UG5A 3BXNB 3PIQB 4UT9A 1E6OL 1U21A 5C0AA 4KKZA 3SDDD 3SQBA 1UA6L 4YIQA 4EAEA 3HR6A 3TYGH 3VJ6A 4F58H 4E36A 4ADGA 2XYCA 3DGCR 5E8NB 4KZEL 3SGKC 4JJ5A 3BUIA 1MXGA 1DQQA 2J12B 2H3NA 3L5HA 5F9JB 2LU3A 4LLYB 2I27N 5ICXB 4WO4B 5C6PB 4OCXH 2N59A 2WCPA 4FNQA 3NCFB 5FUOH 1CIUA 5DDHA 5G2NA 2HX9A 3B37A 3NJNA 4NUJA 4X5WA 5AYUH 5I0ZA 2EVIA 4R2GC 1EZLA 2K9UA 1FIEA 3QCVL 2F8XC 1F13A 4G9FB 2CLRA 4JX0A 1TSRA 1QSFE 4H88H 2WUCL 3ARGC 1IAMA 3KLQA 1AJ7L 1IEBB 2FIKA 2HT4C 4R8WL 4AQEB 5TFSL 4WWID 4DNLA 1V7NL 3CAFA 4ZFOL 3KBPA 1MHCA 4GW5B 4R7VA 4XC1L 5IMOA 2G60H 1HX0A 3DUHA 3L8QA 1D5ZB 4XCCH 1H6EA 4IS6A 1F58H 2FJSA 2JJSA 3HG0A 3RI5K 2ZCZA 3W39B 3KWTA 5A16A 3ZE0B 2R8SL 3WLBA 3BN3B 4ZT1A 3CFJA 5SX5K 4RBPH 1C1EH 5JHLL 3SBQA 3D39B 2IEPA 1M7IB 2V7NA 3EOBB 3T08A 1J0HA 4QRUB 2CK2A 4LL9A 2C9VA 3U46A 2DH3A 3F64A 4E9XA 3GKWL 3LZRA 2N0KA 2GSGA 3P30L 4JCLA 4JFEA 5KYUB 5IQOA 4OB5L 3KR3L 3QC5X 2NZIA 3PJNA 1MKFA 1TZIA 4XVJL 3UTTE 4XT1C 2P44B 1AXIB 1NFDE 3GS0A 3QEGH 4X6CE 4CNIB 3EF4A 3Q05A 2YD0A 3KWXA 4N8CL 4H2CA 1J9RA 1UXWB 2AMGA 5I75C 4D9QD 1RV6X 5A3IC 3MLYH 4O2EB 1Q9WA 2ZPKH 1BM3L 3D8MA 3HS0B 4XC3H 3BT0A 5L4IA 5B1JC 2VQ4A 5HGBA 5AB2A 1OGTA 2W65B 3RE0A 3C5ZD 4X9YA 3EJQA 1OCZB 1ACYL 1ACXA 4KAQH 2YGOA 1Q4NX 1ROWA 2FGWL 2VW7A 3BAIA 4QRTB 2E6PA 2PCFB 3RA7H 3UFIA 1IC5H 3M86A 1XEDA 2X38A 2YLHA 4M5ZL 1OT1A 4NBZB 1BOGB 5GZNC 1MQ8A 2EYTB 4HBCL 4N9OB 1IL1B 1A6PA 5F0PB 1NLBH 1YYML 4UZUA 1N3NB 1XDTT 3P2BA 2H2SC 4U7MA 2ZMYA 1BOYA 2VR3A 5TDOB 2I60L 4Q9QL 2EE2A 4CC4C 3CFDA 3FT0A 3G7TA 4EKXA 2A99A 1JD7A 2ATAA 1RUKL 3B83A 3QJQB 1RIUL 4G59C 4G8EB 5FM8A 4MNHB 4OLYL 3WNLA 3NG5A 4JDVB 2EXYC 4I0KA 5JXED 4CA4A 1IBFA 1T6BX 2EXWC 1S8DA 2ALWA 4NKOB 2UXVA 4J6IA 1ZXKA 1FZOB 3CC5A 1WFMA 4W9HC 3CSPA 3AGVA 3QJTB 2VDNB 4EF3A 4X5WB 2YIHA 3UJJH 1XEUA 4Y2DA 2C34A 4HEPA 1XHHA 1KCSL 4A6YB 1A7QH 1KC5L 3NAAL 2AITA 4AQAB 4XXDA 4P46A 2DI9A 3GBLA 4M9PA 5I6LA 1UYWH 5ESQA 4KK9C 3V8CA 3WLWD 4PRAA 1CD9B 2FX8H 4KK5D 2WBJD 4WAFA 4UT9L 3CVHB 3IF1B 3IFNL 4TQHA 3M17B 4MD5A 4Y19B 3FCSA 4LQ1A 5IEKB 1W80A 2H32B 5GS0D 2UZIH 3ARDB 4I5BB 5HGHA 2YK1L 3UZVA 4LDCA 4QRFA 5SWZD 4IQHA 4TUKH 2E7MA 2WLMA 2VLJE 1PG7L 1I1FB 5J1SC 3FCBA 4U1GC 2O61B 2IV8A 4FRWA 3H3PL 4MNQB 5DGQA 5I0XA 1BJ8A 3I85A 3FQRB 2ZSWA 3LV3A 4FQJL 1K4DA 3S3BB 4EUPG 5KS9F 5K59F 5FGBA 1K3ZA 1NSNL 3O9WD 1Z9OA 1NFIA 5L7XH 3NQ5A 5TE4H 4HJTA 1NCCL 3CK0H 2OMZB 1ORQB 2HSIA 3A22A 3QWNA 3U9UA 5E56A 2VDKH 2VSKB 4O5LL 5TDPA 4GI8A 2DKSA 3SY0A 1ADWA 4L8BA 2VLKE 2V8LA 1SY6H 4RGMC 3F7VB 3C6LC 1WZAA 3OKDA 3WIFB 4FNPA 2CKBB 3LKSA 1JFQH 4HCRA 2QGDA 3SYQA 3F8UB 3S35L 2WM0A 5D1ZC 5EIIG 3B1UA 1YEKL 4ABVA 2ZWEA 3UG3A 1A2YA 1UWEH 4ODHL 4RGOL 2VN5A 1MG2C 5JA9A 3G6JF 1NFIB 5LBSL 4NWUL 4JQXA 4P9HL 1ZEAH 4KY1L 1EBAA 3FT4A 4PRBA 1CFQB 3GRWL 2I7SA 3QZWA 1SJEB 1KULA 5FB8A 4MB1A 1OZTG 1MWAL 5D70L 3SOBL 4L9LC 5KSUB 1YNLL 1A66A 1A0QH 4ONFL 3QJSB 2Y1YA 3BFQG 4JANB 3SE9H 3M1BA 1SEQL 5CNHA 2NW2A 3PL6A 5D7JC 5D2LA 3NPSC 4ZRGA 5DRZB 2A77L 3PHAA 4MRCA 4AIEA 4IOSA 4X9FA 1A1MA 4NQTA 4FTVD 5B1KA 3EOAA 1F1GA 3J8F7 5BRZE 2AERT 4JN2B 1PGRB 1Q0YH 3GRGA 2C9XA 5I38A 5ISZB 1KG0B 3FTGB 4QRPA 1WVZA 3FOMB 5KJRH 4HFUH 4FXLA 4G7YL 1E43A 5KSVB 1MI5D 4J23A 1ET8A 4WW1B 1IM3B 4XCNA 4UTBL 3UP1A 2VN6A 4NNPL 4TNFA 3ESMA 3KPLB 1JV5B 1HNFA 4X6FB 3SO3B 5J6HB 3DUUA 3GUTB 4RMBA 3X3GH 3TT3L 4X6DA 4ZUWA 3QEQB 4OSUL 4H0HB 2OMXA 1BD2D 4ZMOA 1XGRB 1PQZB 1WWWX 5IHZB 4LIQL 1K6QH 3QCUH 2GJ6D 1I85C 3QRGL 1XGTA 2R7EB 3KPTA 3O8XC 2ISDA 1BSIA 2ZX6A 4ENED 4KUZH 3QJHB 4MJIB 5HYFA 1G7PA 2JI3A 5C08E 2B1HL 3K6OA 4U7SA 3H4HA 5T8IA 4R0LC 5K39B 5JOPD 5KVDH 4PGZA 1SJHB 4QMEA 4WEBH 3BHBB 4JR9H 1YUHB 4LLMB 2OK0L 4XP4L 4MJ5B 1JVKA 5CKAA 5J12C 1U8HB 1P84J 2E27H 3TCXA 4JFXB 5JPNA 1X7QA 5JOEA 2XTSA 1MI5E 4JFUA 4OFDA 5EUKB 5I6NA 2H2PD 4BZ1A 3LSOA 6PCYA 2CD0A 5D7HA 1XCXA 2B77A 1DN2A 3CVDA 5DTFA 4U3SA 1AP2A 4EDXB 2BIQA 4PI2A 4EI5C 4R97C 1BPLB 2AJSH 2FDBP 1Q9OA 1A6ZB 1JNNH 1QEWB 1UCBH 5IT2H 3QH3B 3NJVA 5GHWL 3WTSA 25C8L 4U6HA 3UBXG 3V0VB 5CD3B 4E42A 4F1ZA 1X4YA 2GJ6E 3BHBA 3WNNA 3G6DL 2FWUA 3KWWA 4L4TE 3PGFL 3L3IB 2HJLB 4JMNA 4YMPA 2FSDA 3SKMB 1PLCA 4KJWD 3I6GA 4P2RB 1AGFA 3C9NA 1QFUL 4AGQA 4ELMF 3VXRA 3U4AA 4S1QH 3CFBA 4U6YB 5AVUB 5AYQA 1KB5L 4EDXA 1LE9B 4XAKD 5BO1L 3CFKA 4FNLH 1WFOA 1FLRH 3E0GA 3PP4H 4F15C 4S1DC 4EZLA 4NNYB 2ZXEB 5HXMA 5EU6D 1ZDQA 1WAAE 2CZNA 1ZLVH 2NUPA 3NM8A 3BP7B 4ZG1A 1U93B 3MJ6A 3EF7A 5KG9B 1W15A 5E1AB 1KGJA 2OR9H 5DMGD 4NQDD 4ZYKB 4GXVH 4FG6D 4LPTA 5J1TC 3LZFH 4I13B 2DN7A 3QIUD 1V5JA 5DA4A 2X2IA 1AS7A 1II4E 5E99H 4DN4L 1OZUA 4XZUA 3TN0A 1JNLL 2F5AL 2OL3B 3RYMA 2WLLA 2Y6SC 1A6UH 1JI2A 1SHSA 3LEYL 4AM0Q 5EOQH 1B4JL 2EIKB 3EAKA 4N8VG 2FQGA 5ESVB 4CDGC 2QR0A 2VH5H 3RWCA 4ZXBC 4PS4H 4W4OA 4DZBA 4U05A 4GW4A 4IU2A 3G5XB 4K23L 5AKVA 3A6BL 3ZSTA 5B8CB 1RMFL 3LQAL 4HIPA 4WW1A 1S6NA 2VXUH 4XO4A 4G1MA 2CGZA 4DSYA 2UZYB 3ZRSA 4A37A 4OZ4A 4X0KB 3MZTA 3BQUB 2WBJA 1HFUA 3FQWB 1DDTA 2ZPKL 4LSRH 3CZLA 3DROB 1PQZA 5IHZA 3WTWA 4X6BB 1L5GB 4APQD 2DQHL 4U1LB 2G2RA 4NO3A 2UV3A 5IBLD 3QEHB 4G7RB 3BWAB 4XRCB 1T2QH 2VE6A 4XNAA 1TKWB 3I84A 4G82A 5D55A 2ADFL 5MEQB 1TF4A 3KWVA 1XMWA 3EJJX 4LAQL 2ENPA 2R56H 3D12B 3P73B 5ITFB 4R0LA 1MFDH 4EUPA 3O6FA 3UAJC 4KITB 4KNUA 4DO6A 4PJ5B 4PWKA 5L8JB 2IG2L 1BPVA 5CR8A 5CEZE 1RZIA 4RH4A 3OPZL 4ZDHA 2CK0H 4OJDH 3ZE1F 2K4AA 1DQIA 4CC0A 5MEQA 2EDHA 2DWTA 3BYYA 3MLSH 5I1JL 2P4AB 3AT8A 2MWCA 3FH7A 4PMEA 3VWJA 4B95C 3GSWA 4JGMA 4W9DC 5AQ0A 4P2AA 2EACA 4MSWB 2LVEA 3RG1C 5AZ2L 1LMIA 4QRRB 5HDWA 5HHXL 4OM0L 1F1DA 1MNUH 2VDMH 4B9ZA 3MOBL 4YNYB 4P5TD 1MUJB 3QHFL 3VFNA 4NT6A 1YPZB 1J9QA 4X5RA 1WZKA 3SPVA 3DUSB 4AMKH 5E5UB 4G6AC 4TPRL 5GRJH 3TCLB 4F9PA 2AKRB 3QORD 5K9OB 5JHBA 3CXHK 2AK1L 3AG1B 2C9AA 2G3ZA 4W9GC 2W91A 4FMVA 3FN0L 3ROLA 3LX9A 4LVOB 2GK0A 1Z5HA 3UEZA 2XWDA 1JI1A 1O9VA 1LEIB 1NC2B 1ZWIA 3L4CA 4HXAH 3D5OF 5T3XL 2V9QA 5I1DA 1XVSA 6CGTA 2ZOTA 3L4WA 1UUSA 1UKSA 3MLVL 1FI8C 2CBOA 3P0YH 1DFBH 2ZWDA 3DXAB 5EBLA 2AKRA 3OJVC 5K9OA 3PWUB 3VTMA 2R4RL 4IEFB 5DJ0A 2EXYD 1QG3A 4YDKL 2RTTA 3CK0L 4XE0A 4B96A 3T8XB 4M00A 3FRPB 2Y6TE 4PAZA 1SRDA 3ZYIA 4CSSA 5FYJH 4ZO6A 5DD1L 4M62H 4UV7L 1JD9A 3DBSA 5FEBA 1I3GL 1KLFA 3ZMEA 3ZE0F 4I48B 3T65A 3Q1SL 4MNQE 3D0VB 4OLVL 2WBJC 2NNXA 3UTPD 1CD8A 3OB0K 3QISA 1HESA 3EJYC 4RGND 3UGEA 2IAMB 3AU1A 1AG0A 3FQ4A 5BRQA 4JQIL 1DLFL 3QNXA 2LAGB 3T4AA 1SDAB 4OZFH 2NY1C 2FNBA 1RCYA 3C2AH 3WEXB 4CVWA 3N85H 4ONFH 4KNQA 3DARA 3ELQA 1IZKA 2XXFA 5HHOA 5GGSY 5F96H 2AHLA 3DTXA 4FLHA 5EIQA 4QTIH 2DEXX 3FQTA 1AQMA 4NAMA 2J2ZB 1X9LA 4OV5B 1EEQA 4M9OA 1WZ1H 1PNDA 2P9RA 4NKDB 5E6YA 3K6SA 2IBZY 3O2VL 3JTBA 1MQKL 2EICA 2IAMA 3IPEA 2P5EA 3WAJA 3B4NA 2CIKA 3QDGE 4KHTL 4DP4X 3VRLE 5F7AA 4CVXA 5KZCB 2WO2B 3HC2A 3H3BC 3MRHB 4LCWE 5LQBH 4ZTOH 2WC7A 1PY0A 3PFQA 4DP5X 1XGUA 4H8WC 4XR8C 5D6DA 3U6RA 4L3FA 4E9WA 3KYAA 1DN0B 2ZCHH 5I0YA 5ESQB 4M8VA 3ULVE 1PG7X 2XJLA 4IRZA 2CDFA 2OXHB 2ZKHH 4NC1E 5A2FA 4XVOA 1P7KB 4J3VA 2Y3NA 5I75B 2ADYA 2CR3A 4ZMQA 4QXVA 4NS0A 1WX5A 3D0LA 5IK3A 2H3NB 3KM1A 3C09C 2WLHA 3FFOA 1A5FH 2OW7A 4PRNB 5JQ6L 3ILEA 3T2NL 1TNMA 1XCTB 2BM3A 3BAYA 3JZ7A 5SX4I 4B7IA 2A4ZA 4WTZA 2OSXA 4N85A 3H6JA 5TQ2H 2Z8WC 3VYPA 4Y4KC 2B5IC 2R83A 1A65A 2C3XA 3L3HA 2EIMB 1HYSC 4M1DH 1I4FB 2GUOA 4BSWA 2Z34A 1FNEB 5EU5A 2BHFA 4IS6B 1T5XA 1WE5A 2P48B 3SODB 5TDPB 5E8OA 3P9WB 5ITBH 4D3CL 1OAYL 2YAOA 4TNWK 2XV6B 3VFRB 2B3IA 3OZLA 2GJJA 5E7FA 3MRCB 5MENA 3KPSE 2FD6H 1ETJA 5DFAA 3P54A 4HBQA 2Y06L 4PS8A 2BIOA 2R1XB 3QPQD 3TJHC 5EWIH 1H5BC 2GC7C 4GSQA 4PVLA 2E59A 4FABL 4PJ7B 3V0AC 1UM5L 4HGKC 4FZ8L 3MRQB 1BQLH 1I7RA 1RU9L 2OSYA 2XQ0A 5DRXB 5J11C 3CXHJ 1M7IA 4P5TC 2VDPL 1FLRL 3PP4L 5GPRA 5KSAB 5E7BA 4RNRA 1NGYB 4HJIA 1JUFB 1Q72L 1U8JB 3EHBD 2YD5A 4MJ6B 4K0OA 1LQBC 3VFTA 3VWKD 3F6IA 4YSCA 4QRQB 1ACCA 1N18A 3UTSD 1TZIB 2BIMA 3VXUD 5MENB 1SN5A 2QQKL 3V2AR 2WN3A 4O4YH 1C5BH 1TUPA 2Y9RT 1KEGH 1U8MA 3UTOA 1HKFA 2OXGA 2UUDH 3TBCA 3P2DA 5CCGE 3KPPA 1A3RH 1QW8A 4ZXBB 1R0AL 2WWKO 2VTFA 2XY2A 4IIQB 4U33A 1A4JA 5E8DH 4BWWA 3US1A 5EOQL 3G04B 4KQ3H 4A2GA 4UOW1 3HUJE 3WS3B 5IJVB 1A6TB 3FB5A 5CJOH 4KKLD 3GTVA 4PS4L 4E5XB 3LD8B 3F65A 4ZAKB 4K3JL 5DVLA 3RNKA 1DUYB 5BRPA 2IAND 4MB5A 3LQAH 2Q7YA 4WK4B 3TU6A 3L5WA 4PBDA 5IBUB 3QAZC 1EUTA 4GQZA 3RPKA 2CU9A 4MA7H 4GKZB 2OMXB 3ECUA 4PGCB 2C7UB 1XGUB 5HGAA 3CPLB 3FQYA 3EJPA 4QAWA 3ZDYE 5JOPE 3JV0A 2Y7NA 4HC1L 2AJUH 3B1TA 1F3JB 2DMCA 3BP4A 3PWPB 1JZ7A 1N5YL 2VL5A 1ZOXA 4UINL 4G11A 5EU6B 5IOKA 3IDIA 2GHZA 2WVVB 4NBXB 2DY2A 5I6XB 3TBWB 3MA9H 3WL9B 3DGGB 4JN1L 4XGZA 4HJUA 1ZHBA 3MBXH 5E0FA 1P5UB 4LBAA 3T2PA 2OJZL 3EDJA 4JDVA 2EYRB 3NCXA 5DMGC 4MAYB 4E9YA 3O4OB 3GSRA 4LAQH 1WK0A 4AJWA 3WDIA 5T3XE 4N2OA 5DTFB 3MUHL 1KTBA 4JQIA 3IJSA 3FU3A 5CINL 3HNTH 2VLMD 3ZDZE 4XNUL 4XO5A 5D1XD 3PNWA 5I5RA 3GD1C 2D31B 2APXA 4PD4K 3OPZH 3H9SD 2KPWA 3UGUA 5EU4B 2DYSB 4QGYA 5JMOC 4PJDA 5DXWA 1R9FA 4PJ9C 1R3JB 3MOAL 4HIXH 1UD6A 3MODH 2R4SH 3FO1A 1RQ5A 1SHWA 2HKHL 3TT1L 1OM9A 5E8NA 4WHCA 2EVJA 2XIIA 1FRGH 2MCPH 4B3EA 3WGUB 1QFPA 3NRFA 4H8WH 3HHMA 4V11A 3HNVH 3PUCA 2ZUQB 1XX9C 4Z7NF 2JSFA 3WG7B 2P1YA 1AE6H 5HYIA 1T5WA 3PNWB 2YKLH 4P23D 2VDML 3S35X 3RDJA 4HPOH 1U92A 2PLTA 2OM5A 5C1MB 2BY2A 1J05A 4GAGL 3BP5B 1P1VA 1UB6B 3GM8A 2YN5A 4H20H 3CFQA 3WJLC 1AGEA 2WQXA 1INQA 4PJFB 3BIKB 4K94C 3EYQD 4ISVB 3IMUA 4PJIB 1KBBA 1PZ3A 2FYYB 2ITDB 4LDOB 1X44A 4JO1L 1EDHA 1E8YA 4LSVH 5DUPH 3RZCA 2DIBA 5I5IA 3QI9B 2VO5A 5KEZA 2EYSB 4R90H 4JM2F 3GJEA 4J3OG 4JFFE 2YD7A 5ADOH 1B0RB 1U4EA 2F8IA 3MN8A 1RLBA 5EF0A 2EQDA 3SBRA 3V0IA 1CYGA 1MRDL 2KT6A 5BXFA 3SD5A 5EUOA 4PJ9B 5CN3A 5KYUA 4U7KA 4BQBA 4YDIH 1D3CA 5EPMB 2P46B 5FWRA 3DMMA 3L13A 3AB0C 2GIYA 4PJIA 2Q76B 2ENSA 2IOIA 4JZJB 4WWKC 5D1ZI 2BHYA 1ZT1B 3EJYD 3VG9C 4HD9A 3QXWA 3UC0L 3E3QE 3PHQA 5EN2B 2IGLA 2ITEA 4AGMA 5FM5M 5BW7C 3P4OA 5IQMA 4DQOH 1RJLA 5BUAA 5LAXA 2BNRA 2XV3A 4OLVH 4HKBB 1N2RB 4P9ML 2PXYA 2X7LA 5H37H 3RIAK 1RK0A 3I3BA 4JN2A 1MVFA 1UWYA 4ZUSB 3QIWC 4Z7WA 1XF1A 3EJZC 3NEXA 4JM4L 1A25A 2J25A 5IESH 3OC8A 3AUWB 3T8MA 4CC1A 4D0BA 3QNZA 4C4KO 5C09B 4EN3D 4HUVB 3V4PL 2QJDA 3BUYA 4NO2B 2H6OA 1CTNA 4NWTH 4LU5L 1MIMH 1FO0B 2NTFB 3GUTA 2HFFA 3PWVA 3HN3A 3ZHKA 4XX1E 4EN2A 4OZIF 3MV9A 1B9KA 1EZSA 1L0PA 1PLGH 3G5VB 5CSZB 4Z76A 2WXMA 4PWEA 5CHNA 3STBA 1NPUA 2ESVD 2OZ4A 1XTMA 4JPKL 3CX5J 3FTSA 4XMWA 5LCVL 5C9JB 1MW1A 3APNA 4HXBH 4MSWA 1MSPA 1KT2A 2AV7B 1DE4B 3R1GL 5DC0A 5HDBE 5HGGS 3LSOB 2AS5M 1D5XB 4XTRC 2GTZB 4RSYA 4Z3EA 1FO0A 3SDYL 2XZQH 3K71B 3WKML 5C0BB 1OKEA 3IGAA 1W6WA 2NNAA 3BAJA 5FWQA 3UTSA 5G5DA 1CLZL 4U1HB 1KTCA 1V3JA 3GMRA 1BQHG 4YXKH 5CN1A 5I17A 5TH2A 5HP5A 2W59A 2CR0A 3LMJH 4IRJD 1L0QA 4JFHD 3QNYA 4JFEE 4OAWB 1LO4L 4JCMA 4ABUA 4JHVA 4Y8AA 3C5SB 2ED7A 2ZICA 1AZBA 4U6XA 4JPIA 1TZHA 1RULL 4P4KA 4WUKL 3W57A 5F44A 3LDBB 3L3JA 3ZTDC 4C57C 2DKUA 4NKIL 3WFBL 3QIBC 4HWZA 1NGPH 1OAUH 3AWVA 2CJSA 2X09A 4G43B 1T1WB 1R5IA 2OMYB 5GGVH 4MDRA 3KPOA 4XAWL 3CMOH 5B38A 2BSTA 2DW5A 4OZGA 2ADJA 1N5AA 1JGUH 4RIRB 2HFEA 4HC1A 4DP0X 4Z7AA 4XNZB 4QXTB 3GSOA 3RPIA 3BEWA 1F4WL 1W0YT 5KUMA 1W16A 4CJ0A 3RFZA 2Z64C 2Q10A 1XD1A 2NR6A 3PWLA 3PPSA 4I77L 3O3BA 3A5VA 3UX9B 4BFJA 5L6YL 5DEJA 1HL5A 5HJDA 5HI4C 1SJMA 3F6JA 5IROD 1KXTA 3ECVA 4Y16C 3ZL4H 2Y2YA 4I3RL 2GYSA 2G0KA 1S5IH 3OZ9H 4IBUA 4Q97A 1BM7A 2RIKA 1ASPA 2CQVA 2HJFB 1M9WA 3BD5A 3O3EB 4QXGL 3OC5A 4OGQC 3VRIA 1KTLB 4YHOH 2W88A 5D2LF 3VXPA 2J73A 3LH8A 3QDJB 4EIGB 2YJQA 3G6JB 3H4FA 3BQUA 1F02I 4IU3B 3T4YB 3B43A 3F7VA 1G7QA 4GEJA 1YYMH 1VRSA 4L48A 4NGHH 3M7OA 1FVDB 4GRWH 4L4TA 3WKQA 4Z8FH 2BO0A 1VFAB 3VGDA 4WJ5B 2G4GA 4PR5B 4GAYA 5EUOF 4FZEL 2DQDH 1GY2A 1HDMB 3BKML 3FQNA 1XF5A 3NPSB 3AC0A 4ZMZA 3KLKA 1CE6B 3NGBC 5J6GB 3KYNA 2R69A 3MXVH 3ATFA 4XRCA 1DBJH 2KZ1B 4X6DE 1JXDA 4B27A 2EKJA 3CBRA 4WGWB 3FB7B 2WB1A 5L2KE 3X13A 3VRIB 1ODUA 4CUCA 1RKRA 2R0WL 5B39B 3KE0A 3TJHD 5HYSB 5B7FA 5C0JA 3PU7A 4YHKH 1FPTH 5I18L 3OXSB 1V54B 2N0MA 3EFDL 3VB8A 2KQNA 3ARFD 1FYTB 1HN1A 2X0VA 1XGYH 4PGEA 2OP4H 1F00I 4PJ5A 3QARA 1C7SA 1WICA 2X87A 4LPWA 3WNKA 4ELME 1KB9J 1MJJB 4K3EH 4G83A 3DTDA 3MFFB 2ZX5A 1JK9B 1R3HA 5J56B 4M7ZB 5AG9A 3OLDA 1KFAH 1TVDA 5BS0A 1QTSA 4NERA 3VSVA 4UILL 3O81A 2R27A 1CGSH 4TUOA 3C75A 1JVOA 1OGPA 3EOTH 3CPUA 1IBHA 3BH9B 4B0MB 2NR6C 4I9XA 3UACA 4TSAH 1KTDA 4LSPL 5B1BB 5IQ9A 5C08D 4LCWA 1R6VA 4B5EA 2Y9WA 2ZUSA 5DJYA 4XN8A 3LEXB 4LEEA 4BSVB 2JJSC 5D7IE 3CN1A 1FIGH 1QP1A 3ROOB 4JVUA 4HK0A 4UV4H 5FGSA 1C16B 1O5DT 2X4PB 1LO0L 2WPGA 2XI9A 4DP8X 3NQIA 1LK3H 1JGLH 4FFYL 4P04A 4P2OD 4N5ED 2IFFL 3VGEA 1LM8V 4I0PC 4LCIH 5DQ9A 1IKOP 2BSSA 4D9RD 3TF4A 2UWEF 1ETZA 4G8GB 3LZOA 3KGSA 2DQIH 3D50A 4PTTB 1LDSA 4LRNH 2CWRA 1I7RB 5J13C 1BHGA 3NIDE 3KLAB 4XXWC 3WIAA 2QQNL 3QJOA 3QUKB 3B5TA 1BGXH 2J6EL 5ALBL 3D07A 4FQXA 3VYOA 4FQPA 3V4LA 1AGDA 4AYSA 5GIRB 3AM8A 4G6ML 4R5VA 1OARL 1JZ8A 4OCMC 3VWKA 4NZRH 3L3GA 2C3VB 3EDKA 1TQBC 4QRSA 2J1XA 4K71C 4S1RH 5F7MC 1LXMA 3VXSA 2WTRA 2VABB 1AYRA 5KVEH 1KBGL 3BRFA 3LVTA 3QI9C 4G8GA 3CZGA 3FRPA 4FXKC 5FHAH 2BW5A 1A9BB 1FVDA 4L4TB 4U2ZA 3RBGA 3DOIA 3KEHA 4H25B 2FBJL 1Q90A 4L4TD 3DJTA 5ELIA 4PY7B 4FMFA 5FA4B 3C5ZA 3KPRD 3GPSA 4NRYB 1JPTL 3ZZ1A 3INUL 3FT3B 3OSKA 2G5RA 1TJIL 3KM2A 5KBDA 2BSDA 2B16A 1PY4A 1N0XL 2B7DT 3OPUA 4KQ0A 3H0TA 3FQ1A 4LASH 4PTUA 4XMXA 2ZP8A 4F7TB 1INDL 4FQ2L 1YY8B 4GQPH 3K4DA 1SXCA 2X89A 4NM8L 5CP7A 3S5LB 2AVGA 2NZ9D 1Z6JT 3MR9A 4JAMA 2WHVA 4S0SD 5DZ9A 5HD8C 2EKSA 1U8OA 1C5CL 2X0WA 4DEWA 5FUZL 2E3VA 3FPYA 1TITA 3W9EA 5KJ4A 4IHOA 2X4TA 4UIKL 5D7SH 4PGDB 4PV9A 3WE1A 3SCMA 4HS8L 4X4YA 3E6HB 3VG0H 4L8SC 5JW4Q 1FVCB 3RHWK 2UWEE 5I1LA 3HRPA 5EOCJ 4YHPB 5E8PA 2IPTH 3CVIL 3OKNA 4N2NA 3UYRL 4JEGB 3MRHA 3C60C 4AGOA 2KQMA 2YD8A 1Y7VA 1AY1L 3DURA 1BECA 3L7FA 2NY0D 2WLIB 4L1DA 1DVQA 1I3VA 5D2NC 3TVMD 4N2HA 3VXRD 5JXAL 4TUOB 3QZOA 4J3WA 2F53E 5HYJA 1XB8A 4F7PA 1QAWA 4FFZL 3HE7D 5HI5C 1PU0A 3U6RB 2VKXA 4AL8H 1FNGA 2FYVA 2OMUB 4BUHA 4XMPL 3KJ6L 4HEME 3PXHA 2ZUXA 5FOJA 3Q6FB 3DHUA 3PLYA 2A73A 4F33B 2IANB 3CUPA 2L04A 4FYQA 1NBYA 4ZAKD 3HHSA 4PJ6A 5F3BA 1OE2A 3L16A 2CLVA 3P73A 5ITFA 5KTEH 3D09A 3X1EA 1JPST 1QACA 1R24B 4ZO9A 1FORH 1RZ7L 1ZVHA 1T0NA 4KI5F 4MD0B 4FA7B 4QJ5B 4WFGE 2Z4QB 2VMFA 3I9GL 5GZOC 3ECQA 3B9EA 1MELA 4FQ1H 1QSEA 1CL7L 2AV1A 3IBOA 4IRSC 4HZ1A 4JHBA 5IJDC 3THMH 2WWMD 2JWYA 1JVLA 3MRMA 2WVTA 3FMGL 4A7QA 4FQXB 2AANA 5IWLC 3H7LA 1KELL 3QA3A 4YH6A 4RWHA 4OCYL 2YBRA 5ILTH 3SE8H 1PKQA 4QO1A 1IJ9A 3VXMA 5EU5B 5FA3B 2GJ6A 3A3YB 4G8IA 4YHNA 1HEJC 1EHXA 1XCQA 4U31A 4XN5A 2V9UA 4EZJA 3A24A 1NGXB 1QABA 3DV4B 2BVUA 1FDLH 5AAMC 2X3CA 1EJ6A 5C0EA 1AHKA 1D5BA 1E4XI 1T2XA 3OBAA 1OSPH 2H8PB 2WLKA 4NT6B 4JG9A 1DUZA 4QR7A 1HK6A 3A6OA 3TL5A 4DP9X 4LDLB 4X9IA 4P5SA 5CJQL 5DQJB 5I8EA 3WXWL 1JTTA 5BXFB 2VWEE 3MV8B 2OTPA 4ZX4A 2V17L 1FF5A 4MWFB 5D72L 1B2WH 5IHLB 3O6ML 4RISH 3AQXA 1JYVA 1JN6B 3BLBA 4HJJL 1USQA 5JA8B 2ODHA 3B2UC 5HDQL 3MJ7A 3GO1L 1QR4A 4M03A 3GHPA 3I02A 4XX1G 4AEEA 1IQWL 1IL1A 2B4CC 3HBGA 3NA9H 4Y9GA 1QR1A 3SDCC 4K9JA 4DP2X 1JPFB 1I8KB 4DVBA 5IMLA 4XH2B 1PZ5B 2VR9A 3QP3A 3NCYP 4APXB 1E2ZA 4KXDA 1R46A 4PGDA 4PV9B 3E9TA 3MBWB 3MGOA 1W72A 2Q6WB 5F88A 2NZ1A 5E6SB 4JFOB 4GKOA 3DX9B 3RTQB 1KFGA 2A9NH 1DUYA 4XCEB 3RU8L 3KPNA 2Z3FA 4OF8A 5KOVC 5KW9L 3MROA 5C3LD 2BXYA 1BYNA 1HL8A 3RGBA 5F1SA 1PSKL 5AUMB 1QOKA 3FSOA 4LVEA 2WK2A 1WT5A 1KIUB 2O5XL 1RVFH 3FFCE 5EU6A 4JPWL 1RURH 3QIWB 3KLDA 5CGTA 2O5YH 1J5HA 3WY2A 2HZHA 4GKNB 3MNZB 2YQ2A 4BFOA 3K6FA 4HIQA 5ALCL 3L5JA 1VPOL 2F54A 3P0VL 1IB5A 2CK0L 1JPEA 4XP6L 1CE1H 1ML0A 5DD6B 4ZUTA 3EYFB 3KGTA 1LWHA 3IPBA 1FL6B 3BD3A 4KJYB 4WIQA 1JZ6A 3QNXB 3ZKQD 4M4RA 5DSCA 1S7QA 5HY9A 5CLYA 3RX5A 2UY6B 1MH5B 5J06A 3SYAA 2HXAA 2AXGA 2NQDA 1G1OA 2Q2LA 2XTJD 2GTZA 3UZVB 4IJ3B 2ID5A 4JKLA 3PWJB 3HN8A 5E1IA 1TTCA 4OUUA 1E9PA 1LE5B 5ISZE 1S9VA 3VGBA 4PRDB 1QO3A 2IDTA 3R7RA 3CQPA 3L1GA 4B9PA 4KO6A 5D7LE 3TYFA 4PWJA 1XB6A 4KH2A 4NO5B 2QTVA 3ARDC 4JREC 5KYNA 2H47C 2Q3XA 3NCJH 5DJ8A 1GMEA 4N0CC 4WKZB 1KJMB 2W1NA 1W91A 2PO6C 2DQEH 5LBVA 2VZ1A 1UUNA 1RIHH 4IOIA 3MV9E 4FXKA 1ULVA 2X5PA 4G8IB 3D3VE 3SOTA 2DICA 1Y1DA 3EO1B 2R0ZL 3ZIMA 2BNUA 1DN0A 5A6MA 1NFDB 3BPOC 2YPLB 2QLYA 1XCTA 4PD4J 4H5SB 1YNKL 2FWLB 2DZEA 3VRLF 5DJ6A 3IKCB 1VKXB 4OGAC 1M56B 4XXDB 3ZQWA 4B41A 3C8KA 3FS9A 1U41A 4FQIH 5A1AA 2X4NB 4BINA 3CZKA 3DX8A 3MNMA 1WAEA 3ECBB 2Z1PA 3ARBA 3G5WA 2LU4A 3V9EA 3HG1D 3U9WA 3RY6A 3MMEB 5LO7A 2V37A 3KXFE 5D1QA 2NY6D 3MJ7B 3IJEB 2UZPA 5BRZD 4LP5A 1HQ4B 4UV7H 4OZHA 4MCZA 3MV8E 1KCBA 1N6QL 5EEVA 4PJ5E 4MMZC 3ULVC 4TSCH 3RWEA 3R19A 4YSSA 1X6LA 2XKUA 3JQOB 3D18A 3UJIL 1S7TA 2D0GA 3VX0A 1G9NL 2YSSA 1FNHA 4KRLB 3CLFL 1EDQA 3MLXH 3MVSA 4ZO8A 3LN4A 2DQTH 3VH8A 3A4FA 5JLZA 3ALPA 3F5WA 1QUNA 3IN2A 5AW0B 4I3SL 2WWNA 5BOPA 3ARUA 1CDIA 4P2OA 4YWGH 1TJHL 4Y4HC 3V5HA 1W8OA 1B0IA 4TVUA 1C12A 3GTTA 3LXUX 5E6UB 4AYFA 3U4EA 2A9CA 5E9DE 4WU5B 4KJQC 3RWEB 1MEXH 1LO3H 3ECWA 2XYBA 4G8GD 4HISA 3CFDB 2K45A 3H2QA 2IADB 5DO8A 1A7BA 2JELL 5F9AC 4PV8A 4XPGL 3CDGB 1EO7A 3HC4L 2ZSVB 4YPGA 5ABDE 4OCNC 2VYRE 1WH0A 4M93B 2R1YA 4EQ2A 3VSTA 2WIMA 1E9OA 1IBZA 4H8UA 1FFNA 2IJ0C 4LXFA 5TF1H 5IM7B 5JIDA 2BVPA 3BWUF 2HCZX 3DRTA 2MFNA 4S0HA 4NXKA 1UD4A 4M3JA 2APFA 1OQXA 3MRNA 1KJ3L 5F8RC 4F2MB 4KXAA 5IBTL 1DANU 3W11C 3IAGC 2XY1A 3TH2T 1NCOA 4UB0L 2ZKHL 2N7BA 4MAYC 1T0PB 2VMEA 2ZXAA 3FU8A 4YHZH 3WS3A 4ZOCA 5IJVA 3DO7A 3MNWA 2DYPA 3TXAA 1XF3A 1AQKL 4NDMB 1TZGL 1CK0L 4HS3A 2EC9T 4I2XB 2H32A 2WZ5A 2X4QB 4R96A 3QGVA 3B56A 3CPLA 2XG4A 2JB5H 2RACA 4ZODA 5ERWB 3COOA 4G6FD 4IRSA 2P3YA 5EA0L 1WIOA 3BESR 1JWUA 3CFEB 1U8LB 5F7HA 4AENB 1GAFH 4R4FL 2DD8L 3ABLB 4ICXA 1OE1A 2F54E 1QSVA 3ZYJA 2RA1A 1S9KC 1F8TH 2Y69B 3CIQA 1ZHBB 4YBLB 3SE6A 1UC6A 1BJMA 2WSKA 3DGDA 3EFOA 2EDKA 5CM1A 1N6UA 4QLWA 3BJ91 5I16B 5EDXA 4JKWA 4EKJA 3DPBB 4HWBH 3IRPX 1TZHB 3ES6A 4D3CH 5AYTA 1QLEL 4N8VA 4NC0B 5AL8A 4R7NA 1NCBL 2AF2A 5ERWA 1U8CB 1H5BA 1KYAA 3S8FB 4ELMB 3OSVA 2ZX9A 3NEOA 2VR6A 3RB5A 3KPQB 4ZTPH 4G80A 1OHQA 2NDGA 2G75A 5GJTH 2L4OA 3EBHA 3FO0H 1AYOA 1CT8A 3B9DA 4G8FB 1YEIH 2BC4B 1JP5A 2TRYA 2A6JA 1PEWA 4OGXH 4E42B 4LARL 4JDEB 5TGBA 5D1XE 1R4XA 4AI7A 1SJEA 3VH8B 3N3EA 5JLZB 1QBLL 3I9PA 1VESA 5KSAC 1QKZH 1DQLL 1HINL 1F4XH 5D7IA 2KUTA 3AQZA 5ES4B 1X6NA 1G9MC 3KWUA 2PYEE 3ZE1E 4JPQA 2OAAA 5E00B 1NJ9A 4BH7A 2W81C 1DEEA 4F20A 2WYHA 5ID0B 4L3CB 3RJDA 3IVKA 5INDB 2D3NA 1J7VR 1PX8A 3EOBA 5ICYB 1VCBC 3O4LE 4IIZA 4L5FL 4IRZL 5I1GL 4QLRA 3BPNC 5CJQH 1J0ZA 4YUEH 4ZMYA 3N40P 4OD3H 3SDDC 2J8UA 3O9WC 1AMYA 1G7IA 2X6AA 1P1ZA 5CJOL 2YAFA 1DJGA 4I1NB 4P4RA 3FUIA 5GRWA 3WJJC 1OAKH 4Z1PA 3IDNA 2YD4A 2E46A 3RWIA 4UIMA 2HWZH 3ARPA 5GGUA 1MAML 1YJDL 5ECGA 2WO4A 2WXLA 1KCRL 1N19A 4R5TA 3W9EB 3RDTC 5IVNA 5DMIH 3C6LD 1R5WB 3V0HA 4YL4A 4OIIL 2ZIDA 5EIVA 3OB0H 1UH3A 4MQXD 4B9YA 1B0RA 2C26A 3S4SB 3EYUH 3HN5A 4N6QA 4HJSA 1HDMA 4NC2B 5KSVA 3PF2A 1G7IB 1GOHA 4KTDH 3DO7B 2PPFA 4HUUA 2A6IB 1G7PB 2W0LA 3BGFC 1NICA 1AXTL 4HQQH 2Q76A 3SPCA 4FGMA 5BCAA 5KZCD 3P3YA 3EKCA 3FT9A 1QPPA 3SJVE 5IVXB 4ODTH 1BOGA 3DO3A 3NJJA 2XG4B 1IM9D 3T0EE 2ZKWA 3LH2H 3W82A 3GSWB 4JQXC 3D25A 1IAOA 2QHRH 3DIDA 3JV4A 3UERA 4Z10A 1RJLB 2EILB 4J3TA 4YPJA 1WAAA 1F2QA 3ZVVA 3DYPA 3AS1A 2HFFB 3PWVB 5B7EA 3B6SA 3IJHB 1FL5B 4Q4EA 2DMBA 3VQLA 4BUGA 4XB8A 4XOEA 3P02A 4M61A 4DWHA 4AYGA 1T89A 1BVLB 2E7LC 3HBQA 3TJEL 1BQRA 1H3TA 1BVNP 2F58L 2BCKB 2F18A 3I6KB 3LKNA 2A5UA 2M8XA 4Y5YA 3T6VA 3U0WH 4TQIA 2O1AA 1BZ9B 2XHNA 2CA3A 4FEIA 3VFWB 1TJGL 2PNDA 1Z9PA 1AGFB 3P40A 2O6CA 4ES8A 3FFCB 2FEDD 4Y89A 2WY3B 4FTVB 2ZE0A 2DI7A 2YKLL 1UXMA 5DFWH 4EN3B 3K6IA 1R3LB 3CSYB 5ACMA 2YRZA 2XXCB 1FL5A 1OF0A 1KJVA 1MCSA 2F5BH 1YN6A 3WEBA 4L9LA 3KWWB 3TURA 4YSOA 3IB4A 2Z31C 3RY4A 2JK5A 1UA7A 5I8OL 1E4XH 2XBTA 4RQQB 3PWNB 2EDWA 2P80A 1IZJA 2YA2A 4KROC 3SE9L 3WIIL 3TV3H 1E3ZA 2HRLA 3E1ZA 1NOAA 4KFZC 4YGVA 3RVVC 5FGRA 1IEHA 2Q1EA 5IJKC 4L9DA 3L95A 4Q8BA 3C12A 3HCVA 1KB9K 3RRQA 1CLVA 4FN0A 4HFWB 3UYPA 3JV5A 5DUPL 1CVRA 3S8GB 1XR8A 1H3WM 2HVBA 4YX2L 3V0JA 1WGVA 2AABL 4RRPG 1ZA3A 4GNKB 3R0MA 1BCIA 1D6VL 4QIRA 3MPCA 5I1EH 1AANA 1FZMA 3MRKB 3EGSA 1TEGA 3OGCA 4KKLC 4OLZL 3ARBC 3O6LH 3NIGE 4HUXB 5F7KC 5B21A 3IMBA 3QPKA 5FF6A 3ZBMA 1ZTXE 4O58H 3FU7A 4PS3A 4OI7A 4JFHE 3MO1B 3PV6B 4NHUB 4NN6C 4Z0XA 4KXZH 3ZO9A 1NC2A 2K6WA 4BHUA 1CF1A 3LZLA 1U95B 4X0KA 3TBVB 4HCGA 3GK8L 4JZJC 3L9EA 2ICEB 4O51B 4OT1L 4RMWA 2R23B 3BVVA 1HEHC 4J12A 1Z9SA 3W3BA 1KF9B 5K33A 1QFWI 3FFCD 4XCEA 1ZJBA 4XPHL 1T5KA 4PI0A 2XX0A 5CCKL 2BOLA 4W9KC 2R39A 5MI0C 4ODXA 3HKZA 3F7YB 4M56A 3QULA 1P9MC 1CFQA 4MS8C 2YAQA 4X83A 2PTUA 3ZRCC 2WBJB 1G0YR 1UZ6F 1KPVA 5IHHA 3VQMA 5EMYA 4K8RL 5EIIA 5E2JA 3QC6X 2I5YL 5D2LB 3FUKA 3HJ0A 4ZFGH 4GRLC 3B2VL 2CJUL 1NCGA 4PY8I 2P5PA 4NIKB 2CDFB 2NY2C 4WTZG 2VLRA 3D4YA 3HR5B 2JELH 4RMRA 5ECJE 3IDYB 2B2XH 4MNGE 4LSSH 4JRXA 4PRHD 4G5ZL 4P4KC 3BYTA 4OUOA 1GS8A 1E8ZA 1L9RA 2D3VA 3WEOA 5D7KE 4OUUB 5IB4B 1WV7T 1IVLA 4OIFA 1I9IL 1NL0H 2GBUA 4LQFL 2D4DA 5C0ND 1E6OH 4P3DA 1S3RA 3IFOA 4Y5YC 3ZTCC 5BS0E 2WLIA 1KJ3H 4CKVX 2YAPA 4XNXH 2VLKA 3ULUD 3QIWD 2A9MH 1DQVA 3GXMA 3ESPA 4KUCD 1NBCA 4QHNB 2PCPA 1Q1JH 3CUPB 4RETB 1UWGH 1D9KD 3BQUD 3L7EA 4MBRA 2B4CL 2YC1A 1EERB 1UWFA 3NIDF 1XXDC 2R2HB 5GGQL 4Z7NE 2KMWA 1RI8A 2N01B 2EVHA 3MFFA 1MJ7L 3U9PH 3OAYK 1DFXA 4IGBC 2W38A 3GBNH 1QA9A 2XN9A 5C0GB 4KOCA 1S7UB 4OLUL 4G9FA 1H0DA 4ZS6D 3PS6A 3ARGA 3NOIA 4N2GA 3V4PB 1IKFH 4WVRA 2VRKA 3HMWL 4R7XA 2ITCA 4MMYB 4TTDC 2BLFA 3AAZA 4XAWH 4XE5B 2BDNL 4AE0A 4CSTA 1JF5A 2F74B 3A6BH 5DURD 4JHAH 4PG2A 4OUAB 4LOUC 5BVPL 4F7EB 3OMNB 2GUYA 3HE6A 3RURA 4N2IA 2A6KA 2LU7A 5AW3B 5D7LA 4BA8A 1SXZA 2VDQH 2WXHA 5C07A 5CFAA 2FTAA 1VB9A 3Q2LA 4K55A 3BE1H 4LO9A 5DHYB 2GCYB 4QRUA 1Q0EA 1U30A 3SKMA 1XCQB 4TKWA 1ZK9A 4U1IB 1AO7A 1T04B 5A6IA 3DXAA 3W11D 3IDJB 3KNBB 2MKWA 1WLHA 4PRPB 2B0SL 1G4MA 3FTWA 4LFHG 2MHAA 2P49B 3ARFC 5K1NA 4NP9A 4O2CB 2F8VA 4JHZA 4BGLA 4QRRE 5SWSE 3BVWA 2VZ3A 2FX9H 4I1PA 5LXGL 5ANMB 5JW3H 3AWEA 3MCLH 3MRCA 3SY6A 4UQDA 4M6ML 5DS2A 1EVUA 2O26U 1EK3A 2WN2A 3UROR 4ETYA 1H3PH 3APDA 1IGML 2OCCB 4IBWA 3KNBA 3LRGA 3M1OA 1I7UA 4PWGA 1Y1UA 1DBJL 3U0PB 3KYKH 3VXUA 4F9PC 1BVOA 1ZANH 1QSEE 1U58B 2VNCA 4R4ND 1KB5B 4HOXA 4L5FH 1PMYA 1UKQA 5CN2A 8FABA 1NLBL 4BWTA 3AWGA 4OIAA 2Z65C 4L1TA 3X1NA 2ZXCA 1I7TB 1JYXA 4JO5A 2X9YA 3QB7C 4KXCA 1QFWH 3X1BA 1CFSA 1Y18B 5DC2A 1AQHA 1WA2X 2PN5A 1JGDA 1QI4A 1OP4A 2ICWJ 2IWKA 1IBYA 5C8JB 3KLLA 1I7UB 2KL6A 4QHKJ 4KX9A 1ADQL 1TDQA 3C6SB 3CN2A 5C0DB 5DD6A 5HVHB 4S2SA 3D2TA 5LWYH 3ILDA 3P77A 4XBPB 2YGVA 1V05A 3PAUA 4L1SA 3UTQB 2VR5A 2DM4A 2V5SA 4NUGH 5E70A 2BJMH 1WBXB 3MCKB 4MA3B 2VIRA 4PWHA 3OHXA 2WXNA 3BAXA 2RHEA 4XBGB 3D2UA 3PQYB 4E2OA 3CBKB 4L4VA 1I7ZB 3UAJD 5AOMA 3HI5H 3LY6A 1FFOA 3BUQA 2ZAGA 1FSKB 2VDRB 1ECZA 1LEGB 2IDFA 3O11A 4HF5H 2CPUA 1DJSA 4R3SB 2VL5B 3S2CA 4Q9CA 3SEPA 4BA0A 3QG6A 5D4HA 1OOAA 3Q6GH 2WVVA 4LPCA 1A4KB 5AVSB 3SPIA 2R0LL 5I1LB 1IX2A 1DEDA 1NIFA 4KO7A 4RCAA 4Z7OB 1F1AA 4Z7VE 3OKNB 4YZFE 5LHDA 2IGFH 3EYSL 3ABGA 1PG7H 3VI3A 2PR4L 3R7QA 1F6AA 3S96B 2CA4A 3TWCL 2DQUH 4LOFA 4WO4D 3BDXA 4Z95H 4JRYD 4WI3A 5DJ2B 2HN7A 3VFPA 4ZFOA 3K8KA 2M2DA 4JFZL 1BD2B 1MCFA 4LPVA 1CLYL 5HYSG 1BQHB 3JYCA 4YDZA 2B20A 3QSKB 2JTDA 3G9AB 4ZPTB 3A4DA 5F3HA 4G8FA 4LP4A 1XMEB 4XPBH 5AFAA 2W8CA 3P3UA 4TUUA 4L8SB 3ISWA 4R4BB 1ORQA 1A7PH 1YYLL 2A73B 4FLRA 4MCMA 1K8DB 1KNOB 1V55B 3BEVA 2HVKA 2JKSA 1R3JA 1M7DA 3N42F 3Q5YA 4PW9A 4L18A 5TF0A 1ZMYA 2GK2A 5DHXB 1WBYB 3GXPA 4HIHA 3ULSA 1YEKH 3BUPA 2FL5A 2P3XA 5T5FA 2CHXA 1TQBB 4TYUA 1NA8A 5EZLA 4HVBA 3DVGB 3WGVB 1J88A 1ANUA 1DVFB 3S88H 1XH1A 3SBPA 4G6KH 1QHOA 3S36H 5C0RH 3KS0H 3MYJA 4I88A 3WO4C 4NJAH 3VH8G 5BRZA 4BXSV 2FJHB 4JBSA 2ZWNA 5DO2D 3SGDH 2BS8A 2VQ1B 1M7DB 2E47A 3SBWA 1QWUA 4JFPA 2CDEB 5GS3A 2IFGA 1JK8A 4EDWH 1SXNA 1G9NC 4FQLH 2DJ4A 3RUGF 3QIUA 1HT6A 2MMXA 2BP8B 3DV4A 1SVZA 2ZOLB 1TJMA 5JDJA 1FVEA 3FO2A 3GDBA 3SN6N 2KBGA 3ULVL 2HFGH 3BDYL 3CHXA 3CZFB 1OAXL 3L1OH 3MV7A 3TO2B 5IWLA 1GVIA 3WN5A 2ZCLH 2CO6A 1MFAH 2D7NA 2PKDA 5JHLA 4APXA 4PJ8B 2GKIA 3LQMA 5EV7A 4DKAA 1E4WL 1WX4A 3QXTA 5EC2A 4X4ZA 4PYGA 4WZ9A 5EPMA 4ORGB 1JRHH 2X88A 1JDDA 1VA9A 3U7WH 1E9QB 2H41A 2W0FB 2A1WH 1J11A 4MNQD 1FFNB 3EO9L 3BLPX 3FN3A 3HG3A 3QUYB 3N91A 4N8PA 1LEGA 4IK7A 3UCQA 1DTUA 3L6FB 1FYTD 3D87B 1UADC 3SQRA 5C71A 5GGRB 3QCTH 1LILA 2FJUB 3H7BA 4GUPB 3ZQ9A 1NGWA 5DS8B 3BO8B 2B2XL 4CC4A 3BAKA 1YVLA 1GJIA 5KBPA 1KGXA 4DAGH 4PUBL 2FWOB 1XH0A 4X99A 3PJLA 5ABAA 1WFTA 4D7BA 2JLLA 2BVOB 2Y06H 1CXFA 3QWRA 3P11L 2UY6A 1A7OH 3WO4B 1E2WA 2GAZA 2NTFA 4GT0A 4W93A 4ZMVA 1A3LL 1XIWD 3QDGD 4JM2B 3RHWF 5HPMB 1IC5L 2D7TH 5GRXG 5HYJD 1Z2KA 4FDWA 4L3ED 4ZPVB 1U8PB 2NY4C 4TNVK 2P28B 1MF2L 3NP3A 2MTPA 5IQLA 1XSIA 1MRCL 4GW1A 4S1QL 4GT7A 3MLZH 5I16A 1P84K 1C5BL 2YQ3A 1KEML 2F53B 2ZT9C 3DBXB 3GLAA 4BEIA 5IZ7A 4BBWA 3JTSB 3ES6B 1P6WA 4KZDL 2FNWA 1B88A 1D5XA 1HIML 4MXQD 2ZJSH 4XCCL 3PWLB 3L17A 2OL3H 2APBA 1R5VA 4I4WB 3B9KB 4JPSA 4A2DA 3IAPA 4FX5A 1TLKA 5E5MA 4AOFA 4O02L 3JWDL 3WXWH 2D2OA 4YIQB 2L0DA 1VKXA 1NAKH 4FQXD 4KKNA 4YEFA 3F83A 4PG2C 4U3XA 3VI3E 1MCJA 1VERA 2VQ1A 5F1IB 3CHQA 1EZUA 1QFOA 2Y36L 4NFDA 4OTXL 4KWUA 3X3FH 5HDQH 3ZHDA 2VXTH 2PWEA 3LKPA 1IAIL 4K2UL 4XVJH 2AJXL 3RZCB 3PQYD 5E2TL 2ZKMX 3MMEA 5LG6A 1WCBA 3DX2A 4KPHL 2ICEA 4O51A 5CILL 4A38A 4MDIA 3KCPA 4RFOH 1HHKB 2NDFA 5A2IH 1CL7I 3PDDA 2DLTA 4QHMB 3CFCL 5DJDA 4UU9B 4DKTA 1EO8H 2NSQA 4LVNB 4PJ9A 2PCFA 3U2JA 3DJZA 1X4ZA 5CJ8A 4AH2A 5JIIA 1T03H 2XWRA 1ORSA 1ERNA 1RD6A 2VJ8A 3FQ2A 5FO7A 5GGUB 3MV8D 2Z7WA 3WJMA 1NDMA 5FCSH 1LK2A 2J8UB 4BCXA 1ACZA 4PJDF 3JT2A 3LHPL 2WQSA 3F00A 2XZAH 4JPWH 1JZFA 4Z7UF 4XVTL 3HS0C 4M7LL 5I82A 2H0JA 1BP3B 2HVJA 4FQCH 5TDNA 2ED6A 2VZVA 2UWEA 2YPKB 1ZV9A 3VXNA 1BX2B 4FNRA 5KVFE 4G8EA 5IUSA 1HYSD 2F15A 2AEPL 2B1AL 4NN7B 3C6LA 3VYNA 4LLQB 3RGVA 3V7AE 1Z5YD 1NBZB 4TVPL 5F70A 4N0YL 4U0RC 2F7PA 1OGSA 2R1YB 3HA0A 5EZOL 3UXFA 4U6VL 3GMMA 2V2XB 2BVOA 1M71B 5D2NB 1KT2B 1XCWA 3OXRB 1WD9A 1A47A 4YDJB 2FECL 2CCLA 2NY6C 4YLCA 3ULUF 1JTPA 1Q8MA 3GRBA 3H54A 1R1CA 3LOWA 4ZDHB 2YPKA 4KKRA 2WLYA 2I24N 3J2PA 5A3ID 4LSUL 4WEMB 5B3JE 1SEBA 2AEQH 2ZYIA 2HPOA 5HDBF 3V8OA 3N04A 4PRAB 3QRFM 4FJYA 5KBMA 4H20L 5BMFL 3PDOA 2CHWA 3KVDD 3MACH 2CPCA 3M88A 4M61B 1JPSH 4M5TA 1B3JA 1DR9A 5KAQG 5EBMA 3JWOL 2C1OB 4J3QA 3NZ8B 4NIYE 4Q14A 3QFDA 4NAJA 4HLZG 5D7JB 3ZMNA 4BIKA 5I23A 4L8DA 2PYFB 1IQDB 4AMKL 2EH8L 2WINA 4XP1L 3ML8A 1HXKA 5DEZA 3UL4A 1GZQA 4IRSB 2FR4B 3L5IA 4XP9H 2Q7NA 5J7CC 5KJRL 2NY0B 5EFIA 2PPAA 4FHJA 4Q0XL 2WD0A 2Z4TA 3C5SA 1MI5B 5LGJA 1E3XA 4D8PA 3ZZQA 1MLCB 2VUOA 1HH9A 2CDGA 4JRLA 4QNPF 4TSBH 5AVVB 4PGJA 3CCHA 3VXMD 3NZ8A 3CH8A 2GCYA 4K9EL 2VZTA 5B4MD 1XR8B 3NH7L 3ZPDA 1NCHA 4PLKD 2JXMA 4AIZB 4BCYA 5IMMB 3G9VA 1YECH 4AKPA 1NEPA 1SXBA 3B9VA 1DHKA 1J1PL 3NMEA 4FFVC 3TIEB 2BSTB 3UJIH 4NM4H 4ZD3L 2SEBA 1DCEA 4HUXA 4FI6A 3GNML 4GRWF 4W6YB 3S35H 2ENQA 4M62L 4HUWA 2HLFC 4F91B 1G94A 3HEIB 2FJFA 1A3QA 1BFOB 3L3IA 5T1LD 1I8AA 3WOVA 1RPKA 1JZGA 5TGBB 2X6MA 1N10A 4GG8B 1AZVA 5G4OA 3TA4D 1WEJH 4RGMB 1DVFC 2Y9XA 4N25A 3WS6A 4ISVA 2FZ3B 3BWZA 1RHHB 1EJ8A 3DOSB 5EU3A 2BP0B 3QHZL 4Z7VA 2OTWB 2YZ8A 5SWZE 3ZMRA 5LXVA 25C8H 3P4LA 3S88L 4KOBA 5J6GA 3OMZA 2DLFH 3S7GA 3RNQA 4AGNA 3E6HA 1NDGA 2BIIA 2DIEA 4H0GA 5GS0L 2AK4E 2PO6B 4CRPA 1HI6B 4P2RE 2FHCA 1IGJB 3V0DA 3MJ8A 5MHSE 5FUCE 2ROYA 1HHGB 3SY0B 2BERA 3VXSB 3O9WB 1YLBB 4N26A 4TLKA 1XFPA 2GABA 5KYWA 4J8QA 1VFOA 4OZGE 5LNGA 2EDNA 4LNRA 4N90E 3WKMH 4OFVA 4D0CB 1U8QA 1RSFA 2ZX7A 1H3VA 3KYMB 4LK4A 4NQEA 1N26A 1OTUD 5L0QC 5KN5B 4OCWL 1JHTB 3UTQA 3BVUA 1LO4H 1ICTA 1SM3L 2IXQB 4FMKA 2VQUA 3ARDD 3AG3B 1BZ7B 1MLBB 4U3CA 5DQDL 1E50A 1CFNA 2CIIB 2BNRB 2JCCE 4WENB 4CSZA 5IHBA 1CD1A 1DCLA 2R2CA 5K39A 1LNUB 3HI1A 5E99L 4DN4H 3O4LD 3O2WH 4GMSL 2NSXA 2K78A 2ZWGA 3O3AA 1FFOB 1ID5I 4UM9D 2F5AH 3L2MA 3LIZA 4Y4HD 3MCG1 4WEUD 3EUUA 2DTML 1T2JA 4XVUC 3GGWB 2WVUA 5AAWC 4DT2A 1MCQA 3LN5A 1XF2B 1KBKA 1K8IA 4WWKA 2X4TB 4GMTH 1OK8A 3EH1A 4X98B 5IHUH 5ABZA 1MJJA 4JJHA 5DJYB 4PJHA 5I5JA 3WJJA 2Z92B 3BIAX 1C1EL 2A6IA 2I9TA 1U3HB 1TU2B 4WWKD 4DGVH 2J1ZA 4WTXA 2QQLL 1CICD 1SLVA 3VSQA 2FECI 4XB3A 4Y7OC 3QG7L 3TTYA 2BSSB 3PHOB 5KS9E 3D7PA 1BZEA 3G6DH 4WQOA 4F92B 5DS1A 4GP4B 3N43B 3PABB 3QEGL 4Z7IA 1OTSC 3LS5H 1KN2L 5SWSA 5JPNC 2DJMA 3ROOA 3WFCL 3W0WE 3CGTA 3ILPB 5DFTA 2PP8A 1KCVL 3QUML 4NQUA 4KGJA 5CP3H 1VGKB 3MLRL 1BM3H 3KG5A 5A7EA 3FHEA 3NT0A 1IM9A 3VFVA 1NBYB 1X9QA 3DTUB 2WTOA 4HG4J 4HUKB 1YC7A 2WQWA 3VWKB 3E80A 4Q6IC 4MD4B 4GUOA 2J6EA 3TBSB 1RZ8A 1RU9H 4HP5A 1JL8A 4U6XB 3U7AA 2AW2A 4U2YA 5C7ZA 5D7LB 1AS6A 5I1KH 3P9MA 2YLKA 3P3RA 2LTQC 4J39A 2B59B 4JFED 4PJEA 3HCVB 5LB1A 1AP2B 1A7NL 1Z9NA 2AV1B 5I8CA 2BP0A 4B50A 2NSMA 2XVBA 3SCMD 5KVFL 4XH2A 1FFRA 2YSTA 1LJMA 1U3HD 1F4YL 5ACZA 1DQML 3ZJAA 2FBRA 4AY0A 3AROA 5L2JA 3CLEL 4AQOA 1A6UL 3LEYH 5CBEB 5I1IH 1MZZA 3OAYH 3QUZA 3MRKA 3NJXA 1TENA 4OD1H 4CILA 1SBSH 4FKKA 2UYLA 3W39A 3X3FL 3KL3A 2F7RA 3FONB 5LG1A 4OQTA 1K72A 1R34A 3ZDXB 1U8MB 4K7FA 3RPIB 5D93B 1CTOA 1BFSA 1O9WA 4OIBA 1MREL 4FXTA 2D3JA 4DESA 5JIQA 1HAUA 1FBIH 3L3KA 1KZQA 1FFPA 2P52A 3GXTA 3T3PF 4TUJB 5IJBC 4ZMPA 1CGYA 3VNYA 4IHOB 4M43L 1UEMA 1V3MA 2GTWA 4HCRH 3SYPA 3OLIA 3NJGA 4E5XA 5IGXH 5AALA 3VI4B 3BKCL 4FYTA 1UEYA 1PBYA 1DZBA 1S5HB 3KVQA 3QIUC 2DQHH 3SO5A 5T33L 4YR6A 3DKHA 2FJGB 2P24A 4MQTB 4Q7DA 1WP6A 1YPZE 1CFSB 1KTKE 1Y18A 1NGZB 4X7SL 2VDNL 2NUTA 2F6AA 3H42L 3MYZA 3NFSL 4KRPB 4Y1AB 2KZKA 1XGPA 2BK8A 4OFYD 2G5BA 3WTUA 4WK0B 4YDLB 2EIBA 1XSOA 4X9GA 1GR7A 1ZLDA 1YEEL 3AXHA 4E9SA 3VXQB 4V1DD 4FQXC 1CXIA 5GGTH 4QOKA 1MCHA 1NCJA 3DGGA 1N8ZA 2Q5BA 2AK4A 1U36A 4FXGA 4G3YH 3GSNA 4S2SB 2MNJB 4YR6B 4HAFA 3VAEA 2P7TA 2HRPL 3RGVC 4X6EA 4OBSA 4Z7OF 1BVZA 3KPRB 5HVGB 3LNEA 3ZE0E 2HMIC 1J1XL 1DO6A 1HL4A 2DAVA 2J4WL 1DQQB 4CADB 3CZUB 3LRHA 4N0FA 4YFLI 5FYJU 5LNEA 1KXQE 1PNCA 3OVUB 3OKLA 5JUEH 5I1CH 5DMKA 1MDTA 4MLIA 3TC9A 4BSJA 1A4KA 4UQEA 4HYTB 5AVTB 4YDNA 4TM9A 2VO8A 1YMMA 2PPDA 4NO0B 4S1DD 1BFTA 2MJWA 3HAEG 1D2OA 4O02A 5F7DB 3HR5A 4WUUA 3FB8A 1HSBA 4ONHB 3AQDA 7TAAA 3WUWB 5C6TL 2KI6A 1BREA 5J12B 2VKWA 3BW9A 1KDJA 4N1CA 1S9XA 1Z3GL 5F96L 3EFFA 1JK9A 4H8QA 1ZLUH 4MAUL 4ESKA 2K3TA 5CZVL 4YLBA 3LRKA 4MXVF 2NMSA 1SPDA 1TQTA 2KDGA 1DJYA 4KMTL 2Y7LA 5F97E 5H35A 1ZKAA 1E9PB 4CDHA 1LE5A 2VISB 3T9WA 4X5XA 1J8KA 4L8SA 4FYRA 1IC4L 1IEBA 4QRPE 4M5YL 5GSVB 4H26A 5AOJA 3ETBF 2ZXWB 3WUWG 4ONHA 5T1DL 2DM7A 1TTAA 4F7CA 1AKJB 5I9QC 1Z66A 3V55A 3V4VH 1YNTB 1WBYA 2ZNXA 5CBEA 1YEHL 3NSFA 4P2QB 3UBFA 1A02N 4LKXA 1JN6A 1ZLUK 2VCOA 5L9DL 2XNAA 3BEVB 1CICC 1CFBA 3FQXA 3GF8A 3MTRA 3MV7E 4RX4D 5M7QA 4R90L 2H9GB 5A2CA 4PJIE 1HOCA 3QORA 1SZNA 2DDQH 2OA9A 5D9SB 3U0TB 1YMHA 3FB6B 3GK8H 3AWUA 1BVNT 2NRDA 4Y7MA 3SDAD 1BMZA 1OSZA 1EIBA 1FFTB 2YAMA 3NIDB 1SHMA 4UZGA 2ITCB 4MMYA 1A14H 3TESA 3DSNA 3HPJA 4JVWA 4ZBJA 4AEIH 5IFAL 5IUCA 1H15A 5HVWA 5D5MB 3RP1A 4F8TA 1I1CA 1OF2A 2PW1A 3ARBB 1LGVA 3IJ8A 4DGUA 5FFOA 3ZU8A 3QCUL 2ZMZA 4G1EB 3TVMA 4XP5L 5C0CE 4I18A 1W72L 3WTVA 15C8L 4R9HA 2PW2B 1JPFA 4PJCE 4DVBB 2G5BB 2G9KA 3GI8L 4JO3L 1GZPB 2GEQA 1QZ1A 1UT1A 3U2IA 3QQ4A 4RFEA 4C56A 3WN5B 2BWDA 5J57B 2A4CA 2WZ6A 5IMKA 1GGTA 3FBQA 4H25A 5IROA 1NFAA 2H6PA 5D1XB 2PXYB 4QRRD 2J44A 3CZFA 3IS0X 4AZ8B 5A2KH 2OX5B 4X8JA 4KK6D 4IEFA 1OCOB 5DFVD 5DJ0B 2P5EB 1NBZA 1CZ8H 3MRIB 2X2JA 1T66C 4WKXA 6FABL 4XHJC 5KSUA 1OLLA 4D0BB 3SYCA 4PTUB 4RFNB 4F7TA 2Q3ZA 4L1LA 4Z77A 4KZEH 1KBPA 1N12A 1T3FB 3L3DB 2YPLE 1SBBA 2XWJB 3BWUC 3O2DH 1MJUH 4XNQA 4HOWA 3V79C 5IHWA 1OTTC 1REIA 4WHTB 4U0RB 3ZKMC 3MV9B 5T1LA 1A4JB 2HLFD 4HS6A 5C07D 3EH5B 4KJYA 1U8KB 5DYOB 2F1BA 8CGTA 4GI6A 4Y2OB 2VDLL 2WNWA 3LKQB 3WIHL 5DJAA 1E5BA 1BXXA 3CFUA 3T77B 1YSOA 2HLAB 4IGBA 3MREB 2HH0H 3UTPE 3ZTNH 5LKNA 2EUWA 3CXDH 2X6BA 3LQAC 4ZMTA 1T4KA 1U0QA 3CMGA 5F9DC 1H8SA 4GRWE 4PRNA 2WXRA 4QY8A 4HJ0D 2WQVA 2M26A 4X6DB 4ZUWB 1WFNA 4IRJA 1KY6A 3UTSB 1BZDA 2BNUB 1XGRA 5I1HL 4JFYB 3WEMA 4N3UA 3QWOB 3MQIA 2B9AA 4KK8C 5JW4M 1OANA 1RJZB 5HGDB 3Q13A 3QDMD 4K3JH 1RUAL 3QS2A 4BELD 5KSBF 3CQQA 2DL2A 3FCSB 1FZJA 2W94A 4GRLA 3FU5A 1YCSA 2NY5H 3PUUA 2OW6A 5HD8D 4L4VB 1FN4A 1KIQA 3VM7A 2X4OA 2OULB 1B4JH 1O6TA 1A6VH 5I76B 5L7XL 5CSBA 5D7IB 5D9SA 1UACL 4KKCD 3TO4D 1OAYH 2YMXH 3RDTB 3HZMB 3NPYA 3PWPD 1FYHB 4K23H 4UOQA 4IIQC 2FX8L 4HMEA 1K3IA 2DF3A 2D7QA 2NCMA 1I1AD 2UY7A 2CMRH 4RAVA 1SXAA 5DRXA 1CLOH 1WHOA 2IDUA 5F0LB 4XPTL 5F1IA 3FCTB 4FEMA 3TO4A 2WB7A 2VMCA 3DDGA 4UT6L 1ZLSL 3FCUB 4NQDB 5FB8B 4ZS6C 5ID1B 3WHE0 3C60D 5L6YH 3LNGA 5ESAA 4NZTH 5DUML 4FJZA 1J0IA 1FE8H 3K2KA 4I3RH 5MHSD 1O7DC 4E41A 4JY6A 4RWYH 4K3DL 1T5WB 3QPXH 5EZLB 3WBDA 5LLIC 1E40A 3GSXA 1VPOH 2H6PB 5D1XA 5MEND 3GMQB 4ZXBA 2PO6A 2VDKL 5GRZA 3VXOA 4X8JB 4AG4L 3MJ8B 1SY6L 1RIUH 4HETA 3VNZA 1BG1A 5FM5O 1EV2E 1XL6A 2RB8A 2WBWB 2RAMA 1L9SA 3RZWA 3V5HB 4LAJH 1VDGA 4Z77B 3ZDXE 1J1OH 1OY3B 1DJZA 3NJLA 3GI9L 4Q52A 4A2FA 3FK3A 1W0VA 5MERB 5GISL 3HZ3A 4ZUUA 4H7VA 3TCTA 4ZSOE 4YPGB 3ILQC 4H1LA 1IKNC 2AJUL 3NSJA 5FLUA 5IFJB 2FE0A 4OZHE 4JRXE 1A1NA 3VXNB 1Q9KA 3W2DL 1WBZA 4U0QB 1Z32X 3S3PA 3GSQA 1J5OH 4X80L 3MOBH 3I75A 3H9ZA 3LKOB 1RPUA 1G9MH 1X5ZA 3C2SA 4HV8A 3HJEA 5K93A 2XSKA 3GGWA 1I8LA 3EG9A 3EGDA 1MOEA 1MHPL 1EHNA 2ERJC 3T0BA 3LB6D 1HZLA 5FYLL 1UD5A 4JG0L 3N2JA 3U36A 4DCQB 3DYOA 2Z35B 5AVXB 2NT1A 3FTYA 4IIQA 2XG5B 1U8NA 3MNWB 2VXSL 3K7UA 4OF0A 4NO3B 1Z1WA 3WFEL 2Z91B 4NNPH 1CYXA 3TEXA 5E2VL 1ZE3C 2ZONA 4XPFH 3J07A 5IFHL 4TQEL 5E1HB 4KRNA 3KD4A 4ZUTB 3UPRA 2DB8A 1CICA 4NP4H 1FC2D 1OAZH 2XQYG 4JB9H 4RQQA 4XBMA 3RJQB 1KIQB 4JPVL 4KX7A 2EDFA 5LAPA 2NCEA 4MX7A 2EINB 1ONQA 4Y2DB 4HT1H 5MEPB 5DJCB 5DVMA 4AYID 2EVFA 5C0IA 4MA8H 4Y5XB 1D7DA 1NMBL 3ATEA 3X17A 3MLWL 1WS8A 2B1HH 4X8GA 4D9RE 5J4MA 3TZVC 1TCRA 4P3WA 1B6UA 1GIGL 2N7SA 3VO0A 3V0FA 4BK8A 5TE7L 2IDSA 1JWMA 4DZ8A 2RCSH 4XMKH 1QO3B 2CG9X 4FNTA 5CLZA 1FZKA 4LLDB 4AEFA 1QI3A 4G42B 4HPYL 5EFIB 5EO1B 3U6XS 4AW4A 4J4PC 3QW9A 3SKJL 1U8PA 1BAWA 4LRNL 2G9HA 4ZQKB 2K0RA 4BKSC 1E90A 2Q86A 3KBHE 3OV6A 2AVFA 4UQIM 3BZEB 1JE6A 4N4YB 4UQ9A 1QNZL 2AJVL 1SEQH 1U3ZA 2HUHA 1ZV2A 4MB4A 1J5CA 3MUY1 4FFYA 4MQSB 3D69B 5ADPH 4XCYA 5FS5A 9PCYA 3HC4H 4C58B 4ZMAT 3IFPB 3MV9D 2QR0B 1OM3L 3T0EB 4J2XA 1M3JA 2BZ7A 3MX0B 4PJ9D 3MC0A 4Q56A 3GXFA 2XQBL 2C3HA 5IVXE 3SJVB 2WZPA 4MZ3A 3S9DB 5KVGE 4JKPL 3RIFK 3IU4H 2ZOUA 2HJKA 4MBOA 3KBEA 3ZL1A 5I30H 5I6XC 4FNLL 2DWSA 3EJTA 3D9AH 2XX1A 3IJEA 5F9OL 1KXHA 1RFDL 3B9KA 3GPEA 3PYCA 5IW1A 3CFJB 1CF8L 1JFHA 3X3GL 3APMA 1RUQH 2IVFC 3O3BB 3SQOH 1CDYA 4OKVB 3WLWC 2OMTA 4EBQL 3GZOA 3BC9A 5JQIB 1ZT7B 1JF1B 3ESVF 3H9HB 1XIWC 4NQSB 4L05A 3SZKC 5DJDB 4LBEA 4YO0B 5D71H 4BFIA 2IO5A 5INCA 1RULH 1WHPA 2ORBL 4PJ5D 4OZIB 2NY4D 3UTTA 4WNQB 1NAML 3D05A 4LNRB 3LKRB 1WCBB 2EP6A 5L8LB 4KXZI 2LV4A 3BMWA 1W72H 1GTFA 3VWJC 4F5CA 3EGXA 3ET9F 5EULV 3PL6B 2PP9A 2IQ9H 5J5EA 4QOKD 5FOBB 4GSDH 3IWVA 3VXRE 4BQCA 1RZIB 2VW4A 5K9KA 5DO2C 1RUPL 3OKKB 4YHLL 1M4KA 4YC2C 4YO0A 1MFEH 5INCB 1HE7A 4QAMB 1OEZW 3WAKA 2BNQA 3WE6B 3FUDA 3L4UA 3VD4A 1E27A 1OB1B 3TBTB 4D9LL 3I6LD 3SDAC 3I50H 1T21B 3APCA 4M7KL 4HKZB 2MIZA 5AEAA 4Y16A 4Z3HA 3A47A 5LCVH 4WJ5A 3GSVB 2WYTA 1SJVA 2IBGA 5F7BA 4ZS7H 3GS7A 4JMXA 2ZP9A 4LKCB 3N0PB 4FAAB 3U1SL 1Y6MR 4BKTC 2CE6A 1BBJA 4EN3A 1NMCC 1TPXB 2WCGA 3K6SB 1K8IB 2HKFH 2P8MA 2FSEB 3O3UN 3OQ3B 1PX3A 5EZIH 2LLGA 3F7QA 5DK0B 1HINH 4QOKE 3Q06A 3NEEA 1AGBB 5EU7C 1PZCA 1OGAE 1M71A 5D2NA 3WTYA 4NUJB 3UEQA 2GK0B 1TZAA 5D4IA 3D39E 5DLLA 1G6RL 3AWFA 1ETB1 2C1OA 4UYPA 2Y1ZA 5AW9B 2E7LA 3WY4A 5DWUL 4OCYH 2MRYA 1T1YB 3HUJA 2H2PC 3QA3B 2ZG1A 5H4YA 3KYOA 3B3IB 3E1F1 1UXLA 1VACB 4M02A 5CGYD 3HVNA 1OAKL 5EOTA 5DFVC 4AWJC 4AVJA 1KEGL 5AB0A 3VRJA 4BD4A 4XHQA 3BPLB 3QR1A 4A67A 2P26A 1MAMH 4HDIA 5L88L 2CM6A 2NXYD 3IPFA 4WUUE 3BOVA 3WELA 3ZT7A 1A6VL 3SPJA 1WTLA 3ARGB 1L9NA 2VAJA 4EIBA 1EJFA 1XR9A 3BCFA 1X3DA 3UCRA 1SLUA 4I0PA 3ETSA 4QDGA 1QVOB 4Q89A 3O2DA 3D39D 3NJIA 2ZSWB 3LV3B 1CLOL 4IJ3C 4NQSA 3KDPB 4OUAA 2X4PA 3K91A 4L29B 3IFLL 2F68X 4UT6H 1ZLSH 4FG6C 4NNXA 1GYAA 3ILQD 2XIDA 3QJXA 1B9ZA 4V33A 4L3AA 4UM9A 3SDCA 4KRPD 2FJFB 4G6FB 4WV1C 5TTRA 4Q9RH 3MA7B 4M3KB 4PTTA 1FG2B 4WCYH 1M42A 3B8SA 4KK8D 5EU6E 2ROXA 1IILE 1GGCL 5ESVA 2K7PA 2YFOA 3FL7A 3VB9A 1ET7A 1QSFA 5E00A 4TOYH 4ILDA 2DQDL 1HXMB 1I9JL 2AP2A 1A2YB 3GXDA 1KYOK 4JM2C 4NRYA 4ANXA 1GCFA 2G2NA 2B1AH 4OCRH 5ICUA 5A43C 2ARJA 3MV01 5CINH 3WEXA 4BDVA 1RZJL 1B0GA 4N6RA 3ERXA 2PR9A 2MQ3A 4QRQA 1IGTB 1PD6A 4XNYL 1TJGH 1WITA 3WDHA 5IROC 1ZDSA 4PFEA 2ICWB 1T7WA 3LPPA 4L0PB 5CP7B 3D06A 2F7OA 4WHTA 1WC7B 5DUJA 5FAAA 1PDKB 1QFWM 5FW6A 2AXWA 3MODL 4JQIH 2YN3A 4OI9A 1EFQA 4J2QA 4EXKA 2OMVB 4FE9A 2DPKA 3CVHL 3KDMB 2EDTA 1JHLL 2ED9A 4TNWF 5CU5A 5ISZD 3KZ8A 4G72B 3SCMB 1YUKB 2JQZA 3UAEA 3TFKD 5I1AB 2OQJB 2DEWX 1GH7A 1J9TA 2HG5B 1UWEL 4QYOA 1A1OA 2WKLA 3SHSA 1HILA 5EO0B 3IDXL 5IQ7L 3VFMB 2VLJB 1DDHB 1SXSA 4ZQTA 5DD0H 4J4PD 4JQVC 4M1CD 1YNLH 3L1EA 2ZG2A 1BD2A 1ES0A 5AZEH 5JQHC 4UZSA 1BQKA 5K5YA 3CHRA 3CLWA 4N68A 2I9LA 1TT6A 1IAOB 1M3IA 2JQMA 3UPAA 2AMUA 2ODIA 2A2QT 1XGTB 2R7EA 2BMKB 2E76C 3ARED 4MASA 3BKYL 4N2BA 1OP3K 3B9KD 2A6DA 1SVBA 2WVSA 3F7PC 2HX8A 1EQWA 1C5CH 5C08A 1G6RA 4UM8A 2CJTA 2WUCH 3LPFA 3E7JA 4Y1SA 5BVJA 3F05A 5DGRA 4BK5C 1QW9A 4HK3J 1CI5A 3B9AA 2HT2C 3ZYOA 1JGLL 4Z7QF 2V6HA 3II2A 5KYYA 1MUJA 1MIEH 1E4JA 2R51A 4LCIL 4Y9BA 5C0AE 3VI3F 5EBWA 4AX3A 5IOPA 3KXFD 4FI8A 4U1MB 3JWNG 2UX7A 4Y4HB 1MFMA 1DVZA 1RZKC 3EW3B 4YC2B 4P6SA 5D8JL 4AK1A 4F7EA 1Z5LB 1P9MA 2VSMB 3IE4A 4UYQA 5H2BB 1KYUA 3HE6B 1MCOL 4MZ2A 3CSBA 4N0UA 4O2CA 3NFPA 2BY0A 4ORZC 3PXLA 4UUJB 5CUSH 1R3KB 4K9EC 4L8BB 1FAIH 4JZOA 1S9YB 2DS4A 3T0AA 4GAJL 4PJXF 1MAKA 2VN7A 2DLHA 1RZFH 2BXZA 3MGTB