4L37A

Sp2-sp3 - a complex of two storage proteins from bombyx mori hemolymph
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
674
structure length
674
Chain Sequence
FKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPHYTPDKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Silkworm storage protein
publication title Crystallographic identification of an unexpected protein complex in silkworm haemolymph.
pubmed doi rcsb
total genus 233
structure length 674
sequence length 674
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00372 Hemocyanin_M Hemocyanin, copper containing domain
A PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
A PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 4l37A02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 4l37A03
4J6UA 4Z0ZA 3QJOA 2AHKA 1WXCA 3AWZA 3NTMA 3AWWA 5I3BA 1LNLA 1HC1A 4J6VA 4HD4A 2ZWGA 3AWUA 3AWTA 3AWVA 3NM8A 3WJMA 4D87A 5I38A 4L37B 2AHLA 4OUAB 2ZWEA 4YZWA 3W6QA 1WX4A 3HHSB 1LLAA 4P6RA 2ZWDA 3AX0A 4J3RA 5CE9A 1LL1A 3NQ0A 3AWSA 4J6TA 1BT3A 4P6SA 2P3XA 3AWXA 1NOLA 4HD6A 4J3PA 3GWJA 1BUGA 2Y9WA 3WJMB 2Y9XA 1OXYA 3AWYA 3WKYA 3HHSA 2ZMYA 5I3AA 1BT2A 3NPYA 1WX2A 3NQ1A 4J3QA 2ZWFA 3NQ5A 1HCYA 4L37A 4OUAA 4Z0YA 1BT1A 3W6WA 2ZMZA 2ZMXA 1JS8A 4P6TA 4HD7A 4Z10A 1WX5A
chains in the Genus database with same CATH superfamily
4JUTA 1T5XB 3U9PH 1TJGH 5EN2B 3ZE0B 3LQAL 3L3DB 5D9SB 4I3SH 1WS8A 4F15B 3LB6D 3IGFA 5CEZE 2E6JA 2DQUH 3KJ4B 2VDML 1M7DA 2ZWLT 5GISL 4LAQH 5DD6B 4B27A 4ZFOA 4DESA 4N68A 3NMEA 3NQIA 3H7BA 3ZUNC 3ARDA 3STLA 5DYOA 1DEEB 4XTRC 3TOPA 3DJRA 5HGHB 2YJLA 4YO0A 3UZEA 4AIEA 2CMRL 2ZUWA 3D0VB 2EUXA 3VG0H 2CO6B 4L4TB 1XH3B 3MUJA 1CLZH 4CN6A 1ZJBA 2NNFA 1BQKA 3PPEA 4LPYA 3BFOA 5D5MB 3X13B 3WL9A 3F12B 3ABLB 4DVBB 1PZAA 2ENJA 3OX8A 1CL7H 1PYWB 4OQTA 5JO5A 4QJ5B 1P4IL 1WBXB 4AH2B 1J9CT 2A9AA 2IANB 5D1XE 3WUWB 2ZCKH 4NRXA 1E8ZA 3Q8BA 5CZVL 1KB5A 1L4IA 2ZKYA 2FJHA 3UO1H 5CLTA 4AZ8A 4NC1C 3BRFA 4JB9H 2AQ2A 4HU8A 1MCWM 3GMOA 1N5YH 4Y16A 1WWBX 3ARED 5GGUA 1RUML 3FOLA 3P0VL 4KKRA 4YDJB 2ZX5A 3RY6C 1UEMA 1PLCA 3W57A 2E27L 2JLPA 2NX5B 1YEFH 1IQWL 1B88A 1KGIA 1LTXA 1SXBA 3BEVB 4HF5H 2DWDB 2CNYA 3AWXA 4XP4H 2L4OA 1HHGA 2F1BA 3JTSB 4PWGA 1E7UA 4XBPA 5IQMA 3S4SA 1CL7I 3BUPA 3BP4A 3OHXA 3SKJH 2HX7A 5DC2A 4C58B 3PAVA 3TESA 5LJYH 5FW8A 1OXYA 4AMKL 3ZW3A 5IHZA 1QKZH 5E7FA 1S46A 4KTYA 1IC7L 3VXRD 3KBHE 3U7WL 3O3BA 4OFIA 1ZAGA 25C8L 4JJHA 5AVVB 3BKCH 4HXAH 5KBNC 2CIIA 3D18B 2KDYA 4PJEB 3GBML 3RUGA 2ZWKA 4F57L 4J7RA 2FWUA 4EZMA 1X7QA 4UT9L 4HWBL 2AEOA 4RMRA 3KPPB 4S0SD 4XOCA 1ORQB 2VRQA 1KC5H 1KELL 1OTTC 4G6FB 5ECJE 1H6TA 5DMYA 4MXWH 5DTFB 1BX2B 1NAMB 1ETA1 3QJSB 1AYRA 3O11B 4IRSB 2CDEA 3ZTDC 5HVFB 2QHLA 4WTWA 3AXIA 3Q5TA 3ZDYB 5I75C 3VFPA 1T7ZA 5SV3A 3JT2A 4GKZB 4XCNA 1GR7A 1MF2L 3F83A 2FEEL 1F4WH 4JZOB 4NQXB 5K9KB 3HHRB 3IFPB 2VH5H 3VXQA 3WE6B 2AJSL 3C5ZD 4HUXA 1RJYB 2WN2A 4KRPC 1IAOA 2XWEA 4Z77B 5IG7A 2VN7A 4LCWB 2XETA 3HBGA 1KCWA 1EFQA 3IYLW 3L5XL 1KULA 2DQFB 1WFJA 3PY9A 1CZ8L 2PO6B 2ZUSA 4UCFA 2V2WB 2WQAA 5HJ3B 5T5FA 1NL0H 4IRJC 1JI1A 2AQRA 4ABVA 4FADA 2YJQA 4IRZH 1R5VA 4S2SA 3HNTL 1X5GA 4K7PL 1J5DA 1UHVA 3IJSB 3EFOB 5C9JB 3U7AA 1CGYA 5IB3B 3EO9L 3QDMD 1A3ZA 2CK0H 4GXUM 4YNYB 1DBML 5E4EB 4PV8B 1G7HB 4MYPA 2F08A 4IK7A 5ESQA 4O4YL 5DJ0A 3ULVE 4MCZA 1GZHC 3G08A 1KN4L 1QLEB 5DUPH 1ZT7A 4YGVB 5FB8A 3CN1A 4I1NB 2E7LC 2PCFA 1QFPA 3IPFA 5ETUA 4PJGA 4EN2A 1GRWA 1KJ3L 4HJJL 1GYVA 4PRIB 1P4UA 5GJTH 4FQLL 4X5QA 3G5ZB 5I73B 3QK0A 4RLDA 3ET9F 2ZKMX 5EIIG 2XXFA 1BM7A 3SKMB 5D72L 4B97A 1JDAA 4X4YB 4JVUA 1KCRL 1ZHBB 3UBGA 3L3OC 2DQEL 1KCKA 2UX6A 1DJHA 4H8WC 4XHJC 4CVUA 5F3BA 3ROLB 3KS0J 1KJ2B 1WAPA 4YEEA 1XF4A 2YGOA 4LASL 2OSYA 2A0LD 2B1HL 4ISVB 1GGCH 5FYKL 3RL2A 2ROYA 3D4GA 3C08L 2X70A 5EN3A 2A83A 2WXMA 2DPKA 2EINB 4AYDC 5B8CC 2F53D 1SN2A 1A9EB 4MDIB 3VD7A 2N4IA 3AXLA 2G9KA 3PDDA 3US0A 3C6LA 1R0AL 1I3GH 4G43B 3UJJL 3HZMB 3PFUA 5J12C 5BCAA 5BXFA 1AKJA 4HFUH 1M3IA 2A9MH 2HTLC 4P2OD 4D7PA 4FQQB 2ZKHL 3L9YA 3M7FB 2OMUA 4MA3A 2ATKA 2NRDA 1DQDL 3WN5A 3HG5A 4N9GA 2YGPA 1YN6A 3LKSB 3GMQA 1QUNA 5GGSA 3QNZB 1XB8A 2OJZH 2HUEA 3PV6B 5I28A 5J13C 3DRTA 3E3QE 3BT0A 4BZ1L 5D93B 1GGTA 4PGZA 2DY2A 2XQYA 4I77L 1JVKA 1JGVH 5DRXB 4PB9H 4JG5A 1B0IA 1GL4B 1L9PA 1NWPA 1WXCA 4QI3A 2PPAA 2F54D 4EXKA 2P49B 3O0RL 4JKPH 1OWRM 5KVEH 5DGQA 1NC4B 3N6YA 4MAYC 1CGUA 4E5XG 1YJDH 2EO9A 3NIFE 4I2XB 4WTZG 4WQOA 4YOKA 5AD0A 4R90H 5EBMB 4LSRH 2MTAA 5JHDD 5HHME 3K81A 4FEIA 4FABH 1I75A 3EOAB 4KGJA 2AV7A 3GBEA 3BLPX 3NA9L 4ILDA 3WDHA 4A2DA 1UM5L 4KKLC 5GGTA 1GHFH 5T1DH 4Y2LA 3REVB 3ILPB 4G8FA 4GUPA 3SDXB 5E8EB 4L1HA 5L6YH 1PDKB 1U41A 3RWFA 1QI3A 4QTFA 3D09A 2W0FB 5GRXG 4Y4KB 2AABL 3ARBC 2X3CA 3O6MH 5DC9B 2AQSA 3QHTC 4MFHA 1S5IH 5IBUG 2J55A 4ZMXA 1KWKA 3AX0A 3OAYK 5T1MB 2PYFB 1EAQA 2MOGA 2WCSA 4ZOBA 1A1NB 1XGTA 5E4IA 4F24A 1E65A 2BIPA 1FV1B 2ZOLA 4OGYH 5BOPA 4GG6F 3D5OF 4KDVA 5I15H 3VXOB 2FO8A 3GMNA 3UAAA 2CO7B 2V5SA 3PF2A 2B59B 1NIEA 4JBSA 5ABZA 3RILA 1YEHL 1M56B 1NFDB 2W9DH 4JM2B 1DE4B 1LMKA 4PG9B 3MV7D 4J3PA 1UH3A 2OI9C 1LDPH 4BH7A 5FA4B 3F8UB 4JFFA 3KJ6H 1O5PA 1T1YA 5C0RL 4ZT1A 4GQRA 4JFUA 5IM7B 3ARFD 2O5XH 1VGEL 3PL6D 4NFBA 1QUPA 3FNKA 1D5ZB 1KCUH 3QC5X 3RWDB 4QLRA 2HT3D 3SGKA 1D6EB 4JFZH 2AK4E 3HLKA 5JDSA 1S3KL 2QDWA 4M7ZC 3MV01 4OUUA 5IB1B 2C3GA 1JPST 4NM8H 4J1UA 3C75A 5C0EB 2QT6A 2NY0C 5KWYC 1Q9LA 4WDIA 4MD5B 5MHSD 4NHUB 1I1FB 2VZ3A 2BMKB 2BRRL 2DQJH 1I8KB 1QEWA 2NUTA 2DLIA 5IOKA 2KS0A 3B9DA 4R4FH 2NCEA 5C0BE 2G30A 1K8IA 4PTTB 3HMWH 3L1GA 2Z31A 2ORBH 1OCWL 4M7LT 2VM9A 4YSCA 4DGVH 1Z9MA 1J87A 4WV1B 3NJHA 4KDTA 2D7PA 5GRJH 3Q2NA 3HJ0A 4F7EA 1H6FA 3RNQA 4LCIH 4WK0B 2ZAGA 1JPTH 4PBXA 4PRHB 2X10A 2B9BA 3G6JB 1ZK5A 4LLDA 4V1DA 1FN4B 2A6JB 5FOBB 3H4HA 4J8QA 1HE8A 2BOBB 5JMOC 2B7DT 1JGEA 3KAAA 2YN5A 4XVOA 3NRPA 4N2NA 4HKXB 4ZNCD 2OLDA 1SLUA 2OR8A 2WO4A 2LLLA 3WTYA 3SPVA 2EDWA 4HIJB 2AJYL 4RSVA 1E9PA 3L3GB 4DK5A 4E9YA 4MJIA 4ZFQA 5MEPB 3QJHB 3ARUA 1ZLUH 3ZBMA 5JA8B 2Q2LA 3QIBA 2HLFC 4PLOB 3GSQA 3SE9L 3FN0H 3RZCA 1AGBB 3BO8A 3DX9A 4JQIH 3NEEA 4OAWA 3GSVA 2C4FT 1I53A 5DHDA 4IKNA 4A6YL 4L4VE 3VD4A 3MLSL 3VFUB 4PLJD 1TIUA 5I0DA 5IJVA 3CFDA 3GHBL 2CCVA 3HC3L 3X12B 2Y7OA 4LCCA 1NCAL 4KTEL 3HAEH 3LIZH 2EUZA 1KYOK 5JORA 3MLZH 2P8PB 5HTSA 4HLZH 2P5ED 1WUNT 1A4JB 4ONFH 4P2QA 2E47A 3EDDA 4IK6A 4DKEH 3BUBA 4D9LH 5BVPL 1A7OH 1EZVY 2ZP9A 3UFIA 4F8LA 2BNRE 2B1AL 2Y6SC 4YPGA 2ZXEB 3LD8B 3TEWA 2YKLL 4PJDB 3DMMC 3MGOA 3GNML 5FYJD 2RH0A 3K91A 4K5NA 4NP9A 4CC1A 4RFNB 5IMMA 1J8HD 4DPCX 1T04A 1KPRA 3QQDB 1MRCL 3NP4A 1ROCA 2R2BA 5C0JB 3TM6A 1WCBA 4WFGE 3EH1A 1JOIA 2WO2B 1MHPL 4R0LA 5EWIH 1G7IA 5I1CL 1N68A 2GAZB 2IG2H 2IDUA 4FG6D 1WTLA 1MAML 1PZBA 1ZA6A 4HPHA 3O4LA 2TAAA 2FYVA 3IJ9A 4ODBD 2NY3C 2QKSA 3O0LA 3SCMB 3HVNA 4TVSa 4X6FB 5ICYB 1U3HA 1TPXC 5B1JA 5ALBL 4BCZA 2J4WL 3EO0A 1VEPA 2VDLL 5CJBA 1XF1A 4OCWH 1NAML 2IH1B 1HXMB 5E2TH 4D94A 2VL5A 3GRWA 1FSKB 1DLHB 1MCPL 5CN1A 1LMIA 4XGZA 4H8WH 1OP5K 2EECA 4W9LC 5BQDA 3GZPA 3X2QB 2NYYD 3HVDA 1KN2H 4WWNA 1WBZB 1PZ3A 1G0DA 3B9KC 3Q8AA 5EC1B 4UOW0 2GHZA 1K4CB 1LNLA 3K7UA 4OCRH 3PWJB 5I1EL 2OCFD 2YA2A 5IB5B 1U8QA 2OW6A 1T83C 3L13A 2OTWB 3SDDD 1SQ2N 4M8QB 4G2AA 4LNRB 1QYGH 2JIXD 1IAKB 3SY6A 4IS6B 5JIIA 5CIPH 3BPCA 4M1GH 1KPUA 4POZD 4KKAD 4FLOA 2VDNH 4YDLB 1UD8A 3E80A 1WA1X 4AE1A 4Q7DA 5I16A 2EE6A 2DYPB 5KN5A 1BMZA 5IVXF 4IMLB 1MCKA 1VKXB 3MFFB 4P23C 3D39A 1JJUA 5BS0B 4NNYA 4XXWC 3HI6L 5ADOL 1QPPA 3QH3B 4J27A 3P4MB 2V7NB 3QDHA 3ZMEA 4E42B 4P99A 5I8EA 3KLHD 4CC4C 5C0AA 4PMFA 4F7TA 1ZHKA 3SJVA 2A38A 8CGTA 5KVGL 3B5TA 3RVWC 1QLEL 3ARTA 1HWGB 4WJ5A 4PJEF 4MX7B 2FR4A 4LPXA 1H8OA 2G2RB 3F7PC 4OJEH 4U6YB 3WNNA 1LQSR 3ABZA 3CVIH 1KGYE 3ZO9A 3NJGA 3GFUA 2QMKA 3HW7A 2MCAA 1VZHA 4BXSV 4LDLB 5I30L 4ZXBB 1J5OL 1NDGB 4YXKH 1WYJA 4X7DC 1VCAA 3GSOA 2VSDA 3KYAA 4OIAA 3X3GH 3CFTA 4GO9A 4EF3A 5INDA 4X5XA 2GEEA 3VQ2C 2EKSB 3ZDYF 1KJ2L 3PGCA 2ITCA 3TASA 2V5YA 1WT5A 1PZCA 4J8RA 1A1OA 3WHE0 4LXFA 3ZT5A 1W8EA 4UIMA 4IKLA 1JHTA 3BAJA 4TUJA 3JBG7 4LDOB 3IJEA 5E8NA 4ZAKD 3SDAD 5AOLA 4EI5C 1F2XK 5I1LA 5E51A 1U92B 3I6LD 2P9RA 1SY6A 2EUWA 3CNKA 1ZWIA 3KMDA 5T33L 3B2PA 1J0IA 4FQXD 1SXCA 3FUHA 1IT9L 2NY2C 4PJ8A 5E4AA 1GKOA 4C47A 4DQOH 5FF6A 4R8WH 3SGDH 3OHMB 3QAZB 3W0WE 5J1TC 1F8TL 3HCVA 2X4OB 4PVNA 1DJZA 4P6TA 1BZ7A 2OMZA 3A3YB 4OLXL 1FGVL 5LGHH 3QE5A 1TFHA 1UXWA 4P46A 1XMWA 2Q76A 4Y5XB 1YC8A 3I85A 3DGCR 3JV4B 2BFVH 4JZJB 2AJXH 3WTWA 4WY7L 5D8JH 2VDQL 2N0MA 4HGWA 2NUPA 3VRLE 2OQJA 1U8OB 1RZGA 4G1MB 4JO2H 2WQSA 1A14L 3FQNA 1AC6A 4XOEA 1UJ3A 3PWVB 3BT2H 3KPQA 5C09B 1BD2D 2V2XB 1JPSL 3EZJB 4XO5A 4LHUG 2G0KA 3MRRB 2UWEF 3SGDI 5KZCB 2X5PA 1NMCC 3ORJA 4WKZB 4F7PA 5ISZE 3WDJA 1HJCA 2JKRM 1J0JA 4I88A 2BPBA 4XO8A 3P40A 5IMKA 5DHEA 5C08B 3NSJA 4Q0XH 5E5MA 4MS6A 5ESAA 1EO8H 1UB6A 2NW3B 3AAZA 5D1QD 2O5YL 4TKWA 4P05A 3E9TA 1YEEL 1E9OA 4JDVB 3HZVB 4WTZA 1YRKA 2VDOH 5DMJB 4XODA 1W16A 1MCLA 1S8DB 2R1YB 4G6JL 4TUOB 2AEWA 1KIRB 2OMVB 1YEIL 2HJFA 3THMH 4K7FA 3UZVB 4NFCA 1OKEA 2BOLA 2OK0H 3NQKA 4Q9BA 1WHOA 2E7CA 1YEJH 3IFNL 2HB0A 1MRFL 5DHVA 1NLBH 1R19A 1T1WA 1M7DB 4G1EA 4QRPE 2Q6WB 4ZFOB 3WFDH 1NFKA 4JPIA 3DURA 3B2UC 4EIBA 3INOA 1F42A 4UV7L 5B7EA 1CLOH 3KPRD 3ARDB 3STLB 5DYOB 3FUJA 3V5HA 3HG2A 3GWJA 2PCXA 2XSKA 4TVPL 5JW4N 4Z7WA 4YO0B 5JHAA 1NA8A 2NCMA 3C2SA 3OKLA 1BFOA 4NQEE 5F21B 1SHXA 5K9QI 3JWNE 1PZ5B 3MO1A 2V2TA 3RDJA 1IAMA 3RGVC 4Z0BL 4ZMZA 4D9RE 1L0PA 4NOBA 2YSSA 3L4UA 3WL9B 1G9NC 5FUOH 3A6BH 4FJ6A 4KAQL 1CFQA 3CU1A 3DUUA 4NZRL 5DSCA 4MRCA 4TLSA 5DCCA 3S2AA 4D3CL 5KSAA 4LSVL 1QBLL 4QT5A 5DFWH 4E9LA 4NRXB 1K72A 2Z0UA 3FT1A 1KB5B 1N3NA 4AZ8B 5FHAH 4PJHA 4HUUA 3GMOB 4Y16B 2FWOA 3K4ZA 1XCWA 5GGUB 3FOLB 4YDNA 3UADA 2H8PB 4CMHC 4JMNA 4KHXL 1XGYH 1DTUA 2GJ6E 2ZE0A 2JI3A 1JNLL 1FGNL 1BVNP 1GC1C 1HHGB 1MREH 4XBPB 3FUFA 3S4SB 4OCSL 4GW4B 4G59C 3KXFD 4LRIC 4U6XA 3OHXB 3AY4A 3SDXF 3ZXAC 1AO7E 5D7LE 5FUZL 4XOAA 5DQ9A 5IHZB 3K72A 3FO0H 3KWXA 1DBKH 1LK2A 2EACA 3TCTA 1SVZA 3RDTC 1SBSL 2ZWGA 2W07A 1KENH 2Z35A 3H42L 2ZYHA 4QWWD 3O3BB 2E76C 1HI6B 2CIIB 4QRQA 3S97C 2N7AA 4JKNA 3RUGB 5HVHC 1LP9A 1OLZA 1X7QB 2ZT9C 2DWYA 4RMBA 4QRRD 3QWQB 1YVLA 2OTPA 2O5NA 3KNBA 4FLSA 1YECH 2OR9H 2VKXA 4C4UA 3WLBA 4LEBA 1BFSA 4ZFGH 2RIKA 32C2A 1GKEA 3TP4A 4TLUA 2BDNH 2CDEB 4F7CA 1WISA 5DR5H 5FIEA 4PV9A 2MPAL 4B41A 3VFPB 1YPZE 4DO4A 5JUEH 3EJYC 1BVKB 4ES8A 4R26L 3NA4A 4KFMA 4ZZKA 1L9MA 4Q52A 4PY8J 3VXQB 2XWRA 1T5WB 5FYKD 1TQCB 3VD2A 4HUXB 4PJ7A 3GBDA 3VFGH 1IAOB 4QTIH 3AWGA 1MVYA 5IG7B 5TF1L 5I9QC 4M4RA 3H2PA 1EGJL 2YK1H 3RTQC 3A24A 2WTPA 4OGAD 3QIUC 2JQAA 3ZT7A 1DQLH 2EYRB 4Q8BA 1DJSA 1OAKL 4MD4A 1R5VB 4RDQF 4S2SB 2DS4A 1QRND 1M3JA 4FN0A 1DLFH 5HI4D 4G11A 1S9YA 3D2TA 3G9AB 3HE7B 5BZZA 4M1CD 3OR7B 5TPWH 3GZKA 4A2FA 1JZ5A 2WVSA 4DP2X 1D9KA 1EUUA 3I9IA 4HEMA 1N0XL 5F1IA 4CBPA 5HPOA 4J2XA 3BP7A 3T5WA 4ANKA 5ESQB 4M03A 5I1IL 5D4IA 1E8XA 4G7VH 3CSPA 1RUPH 5DJ0B 5C3IA 3CHQA 4MCZB 4KPHH 2FUTA 3G08B 3KLSA 4PB0H 2Y7QB 1ZT7B 3BQUA 5FB8B 1I7RA 2PLTA 3I6SA 2BVEA 3INUH 2PCFB 2AXFA 3VWJD 3G6JF 4PJGB 1F5WA 2W65B 4LCVA 4DWHA 4GIPD 5ELIA 4A04A 4AL8L 4S0HA 2ZMXA 4ZOCA 3X11A 1YEGL 1C5DA 5AAMC 2R0ZL 3JZ7A 4B7IA 4NT6B 3BW9B 3MXWL 4UI2A 2NSXA 5CGMA 3NTCL 1IJNA 1SJEA 2YMXL 1QO3B 3EYQD 2D9QB 5GZOD 5F3BB 3JQOB 1S9VA 2DMGA 3CIAA 3HLAA 3CSFA 3RL2B 4S1QL 4XZ4A 2C1PA 2X70B 2A83B 4NKMA 4U3HA 1ZHNA 3BPOC 1HC1A 2JB5L 4L1LA 2AVGA 3QJQB 5D7HA 4KY1L 3KPSD 2Y06H 1IGCH 1T1XA 3MOAH 4I18A 3VTTA 2DWTA 3GMMA 1H3TA 4RBPK 3EFFB 4PWIA 2RD0A 4JY5H 5GGVL 3AXLB 2BRQA 3I3BA 4JW3A 1U91A 4WFFE 3C6LB 3VX1A 2OL3A 3OXSA 4H8UA 1E5BA 1DCLA 1NCUA 5BXFB 3NEOA 1I7TA 2DMHA 4DVRL 4MA3B 3NVQA 2ZWEA 2ATKB 3LZRA 4PJ9B 2XTJC 1KXVA 3DX6A 1CTNA 4OZ4A 4N9GB 3WN5B 5K59E 1YN6B 4AT6A 5ILTH 4BUGA 3P3SA 3U1SH 1QUNB 4GAGL 5C0DA 5GGSB 2YD1A 4AQEB 1HNFA 4NHCH 3DRTB 2WHVA 3H9SD 4Z7UF 2EZ0C 2QR0A 3RU8H 4NO5A 4OSUH 3BYTA 3JUZA 2IBBA 1LVEA 3TVMB 4TXVB 4DP7X 4PJDF 4HLEA 2X28A 1JF1A 2XN9E 5FX3A 4Q97A 5DEGA 1OK0A 3VXUA 1H19A 2OMWB 4PMEA 5AW9B 5IVZA 4CGTA 5IY5B 5FYLH 3LEXA 1MCWW 1QG3A 5AKSA 3PP4H 5FFOA 1MAKA 1A3RL 1V7MH 4JPSA 4RZCA 5DEZA 2HSIA 2LLGA 4ALAC 4QGYA 3BYYA 1KJMA 2YPVH 4PVBA 5AL0A 2HMIC 1CQYA 3MLWL 2CR3A 3LJ3A 2FJSA 2K3HA 1GTNA 1NKOA 4M9PA 2E75C 3UDWC 4AUJA 3WFEL 4PJXB 3IFOB 3GUFA 4N87A 3QFJA 5F70A 5HGAA 4KC3B 5EU7C 3I2CL 3ULUF 2AV7B 1U93A 1BAWA 1QBAA 2YFOA 3HHSA 2ZMYA 3DHMA 3FTZA 5T3ZH 2VXSH 1AGDA 3UYRL 5JIDA 4F9PC 4G8FB 4MSWA 5JHLL 3RWFB 3CU7A 4D0CA 3NK4A 4DETA 1UKQA 4OCLC 2XA8H 4NQQA 3VTMA 3LEVL 3O2VH 1O7DC 4GS7C 2Y5QA 4G3YL 4UAOB 3T65A 4P3CH 4POYA 1XGTB 1EXHA 3SOTA 3BVTA 3MCKB 1JD7A 3H85A 2ZOLB 5IB4A 4GSQA 4OJAA 3RVUC 5IQ7H 3GMNB 4AMXA 5JOPD 4UOZA 4B0MB 4QHNA 4P4KD 5I0YA 2R1WB 5FDYA 3WIAA 5L4IA 1BV8A 2X4QA 1GW0A 4NIYE 1K5WA 5CM1A 5SWQB 3F7RA 4Y89A 2FBRA 5IIEA 3FDWA 2KYIA 1BXAA 2OTUA 4QXTA 1WPCA 2ALAA 3MYJA 5DK2A 4Q9RL 3K1KC 1XEUA 3T2LA 3Q2VA 4BH7B 4JFFB 1T1YB 4BFJA 1NCNA 5DD1H 1AGCA 3VQLA 3EKCA 1FE8L 4N85A 1PBYA 2XTLA 3AWTA 1XCTB 4R7VA 3DVGB 2OPCA 4PS7A 4UT6H 1PFOA 4IKIA 4YHOH 5JDSB 4PS3A 3HZKA 4OUUB 1M7XA 2G9HA 4CL7A 1G9NH 4J1UB 3ZDZE 2IH3A 2YQ2A 3QR2A 5BMFH 4ICXA 3EYOA 1Q9LB 4OZHF 3FTVA 4WDIB 4S1RH 4BKSC 2H6UA 2R29H 4X7SL 2DL2A 4YDVA 1QEWB 2WLHA 4PJFA 2NUTB 5JPNA 1CD0A 4M3HA 1AXTL 2CHXA 1QA9B 3FT4B 4UOJA 2X0UA 4JRXD 1K8IB 1TETH 4K3DH 2NX5D 2RTTA 2EIKB 1VEMA 2Z31B 4IRZA 3RJQB 1IGIL 3NACH 3MV8B 1WFIA 5B7MA 2VIRB 4BWWA 3KPMA 1CC3A 4O2CA 2A1WH 2Y7MA 4F7EB 5I8KH 3VXMB 3PGFH 4N6RA 3RNQB 5IT2H 1E2VA 4WRLA 1AAJA 4XNUH 4LLDB 4V1DB 5HYSA 1NAKH 4P2RD 5IGXL 5BZXA 3P2DA 3TU6A 2XWDA 5FWQA 4ZFOL 5IW3A 4MB3A 2UZXB 3AC0A 5DDHB 3BSZH 4L5FE 3Q01A 5BRZB 2G2PA 5L0QB 3FUIA 4Z76A 3BSGA 4XNMA 2A9DA 2ATPB 5E99H 1JXFA 1E9PB 3APMA 4MJIB 2N56A 3T1FA 4G6FD 4NLAA 3UO8B 1INEH 1R3HA 2FJGA 3GSQB 1FIGH 2GK0A 2RQEA 3BO8B 2OCJA 3DX9B 5EUOF 3MCG1 1F18A 5H35A 5J5EA 4CILA 5JLZA 4IRSD 3DUSA 3GSVB 2EP6A 2GBUA 3WELA 4B9GA 1E5ZA 3AS3A 1R47A 3F04A 5JXEC 1DUYB 1UXLA 4OQTL 1MJ8H 4RFEA 1BT1A 1HZHH 2WWNA 4FFYH 1UG9A 1OAJA 3OJDA 3HNVH 4GO6B 4JL2A 1J88A 5IJVB 2DLHA 3CFDB 4UZUA 3AMLA 2C9PA 4X98A 1KB5L 2EXWC 4G83A 1QBBA 2V33A 4LCWD 5E9DA 4GXVL 4LCCB 4I0CC 1ZV2A 4KI5E 3MRLA 4F58H 5JORB 3HC4L 3Q43A 1N8ZA 3H2QA 4YUEL 2WYTA 3IMSA 4P2QB 1SXZA 1RD6A 4P3WA 4FZEH 3BVNA 3VX0A 4AQAA 4H20H 3TGXA 4DK3A 5IJKC 3MRMA 3RB5A 2JSFA 1WHPA 3BWSA 3EBGA 1G1CA 5FPIA 1BQLL 3MGOB 3B3BA 1IC5H 4OZGB 2I5YH 2P80A 4A55A 1T04B 1KPRB 3DK0A 5KSBE 1M2VA 1X5JA 1UZ6F 1NBQA 1WCBB 2ZCHL 4GMSL 4DH2A 1QQDA 4E41E 2JVUA 4FQ1L 5E03A 4KVCH 1PQZA 1JN6A 1NCWH 3ZTEA 4R0LB 4OLUH 1G7IB 3QS3A 4JHZA 1MIEL 1NCBH 1XIWA 4DERA 1L9OA 5LUMA 1ZA6B 3FN9A 3O4LB 1DYZA 2WP3T 4XC3H 4PRID 2ZXWB 1U3HB 4YHMH 5MERA 5B3SB 2UYLB 3K5RA 3EO0B 2W60A 3CZGA 3N40F 4RMWA 1DVZA 4OBSA 5K9JH 2VL5B 2CJUL 4FAAB 3AWSA 2Y69B 3CXDH 2ZNXA 3UPRA 1HH6A 4XGZB 5T1LA 3QUXC 4BFNA 5I18H 1NCOA 1MPAH 2E59A 3N43B 2DQTL 2DV6A 5I5JA 2HFGH 4J23A 2Z7ZA 4NI3A 5GHWL 4TL4A 1RVFH 5K9QG 1BREA 1UKTA 3DXAA 4X6DB 3TH3T 1U8QB 3TZVC 1RP9A 4S10A 2YAPA 3HC0A 4K3JH 3UABA 3ENEA 4KZDH 3FS9A 5EB9A 5T5FL 1A7RL 3BPCB 3NCFB 1KPUB 1B2WH 2GPZA 1MJ7L 4NBXB 3U0PA 5I74C 4KJYA 5D70H 5BOZG 5KN5B 2N7BA 3CSYA 1RUAL 4XC1L 4UOQA 5CJQH 3KM2A 3U79A 4C55A 4NNYB 2X88A 3HN8A 2DLFL 1NLDL 3K74B 2CD0A 4KUCD 4IBLT 2ZSWA 3AUVA 4TULL 2NQCA 2XA3A 4JUSA 4OFPA 5C0AB 1ZHKB 1WQVT 3SJVB 3U7YH 4OM0H 2GBTA 3GTVA 4S1SL 5AG8A 4WJ5B 5TK2A 1ES0A 2J8HA 3BOVA 4H0GA 4KO5A 2FR4B 2DKSA 5HDBE 3ZN6A 1KACB 1ZLDA 4MKTA 1OSZB 2ENQA 3CZJA 1U8MA 6FABL 4Z3IA 1N4XL 2H1PL 4ALAH 1INQA 3AT9A 2DD8H 4KHTH 4GAAA 4K07A 3GSOB 4X7TA 1BP3B 1UD3A 4FG2A 3MBEC 4L1SA 1JF6A 3H9ZA 1PZSA 2AS5M 4HD9A 5F9WC 3PGCB 4HWEL 2ITCB 3D9AH 1NGXA 4AV4A 5E08L 4N0RA 4J8RB 1A1OB 3TPUA 2EDYA 4OGXL 1E0OB 4KK9C 4FNLL 1F6FB 2B5IB 2OJ1A 4EDWL 4HIXL 4LP8A 4UIMB 2X7LA 1OAQH 1ZIAA 1AHMA 1JHTB 4Q2ZA 4BJLA 5L2KA 4TUJB 3EO1A 3IWUA 2WQXA 1EO5A 3RY6A 1RHHA 2AMUA 2PCPA 3L6FB 4OY9A 3EF7A 2C9SA 2ZCLH 4Y4KD 4LVHB 1D5IH 3UC2A 2YHGA 4KOCA 2VM4A 4PJ8B 1Z1WA 1XL6A 5FF6B 1HVXA 5TE6H 3VG9B 2DQHH 2G3MA 3ILQD 1A6PA 1XL4A 3HCVB 3ES6A 1BZ7B 2UZIL 4NN5B 3HKFA 1UXWB 4P46B 4X42A 3SBQA 2Q76B 5AW7B 4TVPD 4XNAA 3MRFB 4L9LC 2PYEA 3I02A 2WBJA 4JM2D 4HGWB 4R2GB 4XPAH 5CINH 1FNGB 2W1NA 1HYRC 4WI3A 2ISDA 2OQJB 1ET7A 1RZGB 3DBSA 2A6IA 1O6TA 4HISA 3OD3A 1UJ3B 4NQCA 3RP1A 3KPQB 1HWWA 4OLEA 2J6EH 2JKJA 3MAWA 1NCDL 3TA3C 4GSDH 4RGNC 5EC2A 3M6DA 4YXLL 2W59A 2Y24A 4HSQA 4KH9A 4F7PB 1IEAA 5IHUH 1SF3A 3U1PA 1A5FL 4HFWA 2O93L 5FCUH 4BD4A 1D5RA 2VZ1A 2YARA 3ZE1B 2H3NA 5IMKB 4JQIA 1B0RB 2XFGB 4LPCA 2VDKH 1BJ8A 1C7SA 3DRQA 4B9YA 5E5MB 3ULAB 5ESAB 3NPYA 3AAZB 1LK3H 1I1YA 4Y4FC 4KROB 4G6MH 1D6VH 3HRZC 1DFBH 2EH8H 3D52A 1E9OB 1NCTA 3IWVA 4JFQA 4UB0H 3QPQC 5EEZA 5CKAA 5GGTL 1TQWA 2TSBA 4N2OA 3HAEA 3LIZA 5EU3A 2VXUL 1OVZA 4HUWA 1ZLVK 1ZVYA 2HJFB 1KB9J 4TPRH 2FB4L 5DUJA 4IRJA 3WN6A 3UAJD 4V33A 2PXYB 3CHPA 2WN3A 4HMEA 3NSFA 3EYVA 5C0CA 1CU4H 1T1WB 4G1EB 1AOHA 2K8QA 3WD5L 4GRMA 4JPIB 1SZNA 4F27A 2BM3A 1BYPA 3DURB 3FUMA 4J6UA 3MJGX 4K7PX 3VGAC 3Q05A 4PRHD 4PGCA 4DAGL 5KS9A 3QEQE 3LPPA 1GYWA 1YG9A 4K55A 4NAMA 3AQXA 3V5HB 5KYWA 2CBTA 5FGSA 1LILA 3VW3L 4Z7WB 2J1KA 5AYTA 2GSIB 5E56A 4M61A 3ZVVA 3OKLB 1BFOB 1GZHA 2DM2A 4J6VA 1CN4A 2EDXA 4XRCA 3HI1B 1KV7A 2IDCA 3MO1B 2E7LA 3U0WL 1CIUA 3EOYG 3QZLA 2AXWA 3CN2A 2WXFA 2YSSB 2K70A 1NFIA 3HNSL 5DMKA 1CJYA 3DUUB 1KYDA 3EJZC 5I1HL 1A02N 5DSCB 1H9DA 1O9ZA 1YNTA 3A6OA 2FX9H 1Z9OA 1IBFA 2UXFA 4PI2A 3MA7B 3WTTA 3D48R 4XNXL 3UJIL 5F9OL 1TU2A 3CFIC 4L48A 1DQMH 1CFVH 3L3OA 4F8OA 3TBWA 4OZFH 4PJHB 4HUUB 4PJXF 2XXMB 2FWOB 5E5LA 1NMAH 5ENWA 5EU6E 5GGQL 2VO8A 1AE6L 1AD0A 5TQ0H 4IDLA 3UERA 2AP2A 4TQ8A 1UWEH 2J43A 1YEKL 4K2UL 4LKXA 4P5TC 1J11A 3Q1SH 4M5SA 5ID0B 1SMAA 4K9EL 4L8DA 2KZKA 2CPCA 1GGIH 5J6HA 1R6VA 3APCA 1K85A 3UH8A 2E46A 1AOZA 1X9RA 2CRMA 4FHBD 4X5LA 5EZIH 1XTMA 5B8CA 1FFTB 3PXJA 4WI2A 4PJCF 3ESMA 4HU2A 3RX9A 3TT1L 2VC2H 4C56D 5CIPA 5D4QA 4OFKA 2WVVA 4JGJA 5GS0C 4XPFL 3K72B 1XQ4A 4KJWC 1YAIA 1WWWX 1JHLH 1IM3A 1E4WH 2Z35B 4G82A 5DMGD 4K23H 1SJXA 5E8OA 2C7UA 4JFPA 4YR6A 1HHJA 4QRQB 2X40A 3KLAA 1ETZA 2J7LA 1G9MC 1S6NA 1J5HA 2NY7H 2BSTA 3D2UA 3RWCA 1LP9B 4I13B 4BFOA 1NEPA 1PNDA 4WFHD 4EIUA 4RGMB 4QHKJ 2BJML 3L4WA 4GAJL 2ZG3A 1JSYA 1U8JA 3KNBB 4PJ5A 1R3LA 1TJHL 4YVUA 1KTKE 5KOVC 1BYNA 3D12B 1PY0A 3WLBB 3T8VA 3US1A 2UUDH 5CU9A 1DBBH 32C2B 2X0VA 4F7CB 3L2NA 5A6MA 5AKVA 3SCMD 1M1XB 4PV9B 5EOQL 5B4MD 5B38G 4U1MB 1ZD6A 3N1FC 4MBOA 4XPHL 4U49A 5F0LB 2NR6C 2DTMH 3GSWA 4MAYA 4PJ7B 15C8H 4QXGH 4FQHA 4ENEC 3WSQL 3ZZ1A 2NY6B 4NZUH 3VWKC 3F7KA 3VMNA 2CO3A 3QWRD 4IBWA 2JKNA 4MD4B 1DJYA 5A40E 1VENA 1F45A 4ANWA 3QORB 1S9YB 4G9DA 1F3JA 3II3A 1O6SA 1YYCA 3GEWB 4HS8L 2MKLC 4JDZA 1TZGH 1D9KB 1OPGL 1RIVH 3ARBA 5F1IB 3RPBA 5FKAA 2HKHL 3BP7B 3U6XA 5EIQA 2DYPD 4ZW8A 1O7VA 2N01B 2ZKXA 3BQUB 3O6KL 5BS0D 5J57B 1I7RB 3LQZA 3CH1B 3T0EC 3LPOA 2VXQA 2AXFB 5D2LE 2BSED 1VPOH 2D7MA 1N7ML 4OFQA 2BVOA 3RFRA 2BH0A 4QHUA 3F6JA 3FB7A 3X11B 1RULH 3FPYA 3FYIB 4ABQA 3KE0A 4TYUA 3E6FA 3LMJL 5D6DC 3FRPA 3V52L 1NOFA 1GPOH 1OOWA 1SJEB 3I9AA 1KDIA 4KJQC 4U1GB 2FNBA 1BOYA 2MNWA 1S9VB 4ZXBD 4PJAF 3QQXA 1Z0MA 2P4AB 3WTSA 2ETWA 3GRWL 1UGKA 2D3JA 2C1PB 2VMFA 4L3EE 3U6XS 1WZ1L 1TEFA 1EZLA 4F2MA 1TLKA 5H8DA 4FXGB 4OJYA 2WLZA 2YQGA 1T1XB 3DSFH 4I18B 4YBLB 2PO6C 3MNDA 1G1OA 4FXTA 4PQXA 4BKTC 5HXMA 1UM4H 1V10A 3T0BA 4BGDA 2BNQA 3P4NA 2OL3B 3T4AC 1QLFB 2DMBA 1BT2A 3O8XA 3HB3B 1I7TB 3HG4A 2Y1AA 3O3AA 4XPTL 4Z9KB 4AGOA 1I1CA 5F6IB 5FGRA 4OZ4B 4OZIA 3DX6B 1DBAH 1SNRA 4AT6B 5GZNC 5C0DB 4C56E 2H41A 1VGKB 3OKKA 2X53A 1J0HA 3OPZL 3PS6A 4XMWA 3NCBB 1QD0A 1CURA 2QMJA 1UA6L 2RALA 4WU7A 1JD9A 1WUZA 3L3HA 2IQ9H 1JF1B 3NZ8B 2P42B 1BOGA 4JPKH 4L05A 4OZGF 5DEGB 3VXUB 4BKLA 1OM9A 3NDYE 2VLRD 1U8IB 3LEXB 4OM1H 2CBMA 3FMGH 3IDYB 5CFAA 5EOTA 3OLGA 2IDFA 4RZCB 3IMRA 4Z7IA 3EG9A 5I6NA 3B9VA 4NJ9H 3TNNA 4WWOA 2GEQA 1KJMB 4AY0A 4WJKB 1IGJA 1N64L 3E0GA 4PRAA 5DUML 1AS7A 4NZTL 2BHFA 5FHBH 3SN6N 4PCSA 4Y1AA 4AXWB 5C09D 3AU1A 1OF2A 2IF7A 3AT0A 2CO2A 1AD9A 4U3CA 1CR9H 5KZCD 4O9HL 4QDGA 1FL5A 4N2DA 5HGAB 1YYML 4FTDA 3BPNB 3QULB 2QSCH 1U93B 3C60C 2FHCA 2JQZA 2XPYA 4XNZB 3NRQA 5C08D 3IS1X 3P9LA 2VMDA 3B7RL 1MFCH 2ZOTA 3I74A 4MSWB 4J4PD 1N8OE 1RP8A 3KL3A 5HGDB 4D0CB 3BAYA 2D2OA 5C0CE 2Y7LA 2E9GA 4KU1A 4WNQA 1GJWA 1P69B 1XT5A 3AG4B 1Q9KB 5HI3D 3UGUA 5L7XH 4EZJA 3K6NA 4X6DF 3T65B 1EHXA 1L9SA 4XWGL 4HMDA 1YMME 1URLA 4YHPA 4ZJ9A 4Z78A 5KANI 2HLEB 4MJ6A 3L5HA 5IB4B 3PWPA 5TFSH 1XH1A 1L3WA 1SY6L 4QHNB 2BY0A 2J1ZA 3OGOE 4Y4HC 3APFA 3OKEA 3FRUB 1HKLH 1QBML 2X4QB 4M8UA 4R7LA 2QL1A 3RZWA 5INCA 2C3XA 4P5SA 2YO3A 1WAAF 3ARDD 3FT0A 4Z18A 5ALCH 2OTUB 4I48A 4QXTB 4PU2A 2H6OA 4YVNA 3MYJB 5F88A 5DK2B 3DX0A 1H3PH 1S7UA 3NJLA 5J11C 2AJUL 4QOKA 4FNRA 5KBDA 3V6OC 3K4AA 5SWSA 1IC4L 1IM9B 4JO5A 2M8XA 1AR1C 2IGFH 4J3XA 3WTVA 1RPUA 4RWYH 1X5AA 2GI0A 4ZI8A 3HZKB 1RAMA 3GINA 3NCXA 3FQ4A 2HLAA 4XP6L 4AYID 2IH3B 3OL2A 3N3EA 4ZUVA 3J2PA 4JO1L 3PQYA 4HKZB 4F9LC 5IVOA 4HXBL 5LWYL 4UNUA 1CFSA 1QI5A 1S5HB 4YDVB 2MFNA 2V9TA 1E4KC 5JPNB 1QTPA 5HHOA 12E8L 4Y16D 3U36A 1B4JH 3FB8A 4G70B 4N2BA 1T4KA 4QNPF 3QNYA 4PR5B 1NCGA 4RH4A 5T3XH 3B9KA 4RFOH 4ZPTB 1EVTC 3QNFA 1PG7H 3W6WA 1H3XA 3B7TA 4XN4A 4PRNA 4M6ML 4GP4B 3KPMB 4R7DA 2A6DA 4O2CB 4RCAA 5DU7A 1T83A 5HDWA 5I23A 5CXPA 3ZQWA 4OIIL 5A2BA 4B95C 3HHMA 1UT2A 1G1KA 1KT2A 2FJUB 3LVEA 4J3SA 3BJ91 5ESVB 5GS0H 4NQDA 4B9JA 3IT8D 4UU9A 1JPEA 5D2NC 2ZOKA 5I76A 2LQRA 3P0YH 2PKDA 4K8RH 1P4BL 2PTVA 1QFWL 5D1XB 1IBGH 1CICA 3F7YA 1PFCA 1LQBC 3FU7A 5E1GA 4KQ4L 4P23A 4BK4A 1G9MH 1UVQA 4QXUL 1CXHA 4XXWA 3Q1EA 3MI6A 3LN5A 1JGIA 2J5WA 3OKNA 4XNMB 4N5ED 3EJJX 4J3OG 2TRYA 4CC4A 3LB6C 4NN6B 3T1FB 3K5SA 3W37A 3IDIA 1R3HB 4PD4K 3NCWA 3I3EA 2GK0B 5HP5A 1YZZA 2W38A 4NGHH 5H35B 5JLZB 2WYHA 3DUSB 5CLWA 3EYSH 1BPVA 1M2OA 3UX9B 2ATAA 4S1DD 4RFEB 2VZOA 2FL5A 5SX5H 1KBBA 2B39A 3OJDB 1Q1PA 3W6QA 4QF1B 2JFCA 4X98B 2VM3A 5C07E 3ZE1F 5E9DB 1LLAA 3U2IA 4JFSA 2NY4D 4KV5F 5E23A 2ZX9A 1G7LB 1E6JH 3MRLB 1TR7A 2Q20A 4GUQA 2AI0H 1N8ZB 3LQMA 1SDDA 1LNUA 5LLIC 3S9DB 3BVNB 3HE6C 2VLKE 2D31A 2WLLA 1KTDB 2JK5B 1P6AB 2B3RA 1OP3H 3VH8G 2HFEA 1CFBA 4XMKL 3MRMB 5D7EA 4KRMB 5CU5A 3UEZA 2P3XA 2FGZA 2IWKA 2OXGA 2IAAC 1TENA 2H47C 4JM4H 2EIDA 3HBPA 3SEPA 4Z3FA 3HS0C 1U8KA 1M2VB 1JK9A 2FLMA 1NC2A 1I4FB 4PS4H 3V5DA 1QQDB 1MAJA 1PQZB 1JN6B 3QG7L 1YQVL 1EDQA 4F92B 3FZUD 1XGQA 1P84J 3QUMH 1XIWB 1X5HA 5AVTB 2VDPL 4YMPA 5K39A 4KMTL 1EO7A 2ZWZA 3B2VH 3DPBB 3A6CL 4ZX3A 2W9LA 1HSBA 1TZHA 2YPVA 2W60B 4GRLA 1T03L 4ETYA 4WO0A 3L81A 4TTDD 1T3FA 1TZIA 4L0ZA 4NKDA 4X9FA 1V3LA 1FC2D 2WSDA 2SODB 3AXHA 3PHQB 5HHNA 1HH6B 2CR6A 2XZAL 3EW3B 3FSVA 5T1LB 2EVFA 5L88H 3GTNA 2JF1A 3IKKA 1YEDA 4E2OA 3DXAB 2WSPA 5CN3A 3RURA 4EZLA 3HUJA 1DDTA 3FN3A 1B4LA 2XWXA 4Q4EA 3HR5A 2UY6A 4CJ1A 3HC0B 4HGMA 1I85C 3E8UH 4I1PA 3L5WA 1FPTL 1T22A 3V6OE 5AVUB 3U0PB 3C6LD 2H2PD 4KJYB 1C16A 4WEUD 5TE4H 3ZQ9A 3GJFB 4G9FE 1AKJD 4ODUB 1OV8A 3U4EA 2E7MA 3SDYL 4N20A 3S8FB 1AY1H 1KCBA 2OYMA 3IE9A 4UQEA 3K0YA 3BZ4A 2Z91B 1IBHA 5HHXL 1PIFA 1BGXL 4WHCA 1U6AH 3FTYA 1U8LB 1BZ9A 2C9VA 3EGDA 5MEQA 1CDGA 3HJEA 4DSYA 3RNKA 1QWNA 2NOYA 2X9XA 4R3SA 4XAKD 1ES0B 4LL9A 4AYGA 1UWFA 2DBLH 1VFMA 4H1LH 5E0QA 5TQ2L 3UBXI 1UADC 4X7EC 1IGTA 3SB3A 4RSYA 4AK1A 4ZD3H 3NIDB 4LVOC 3H9HA 1ICTA 2GIXA 1INQB 3ULUC 4H2AA 2Y1VA 4XVJL 5C2UB 2Z9TA 3C9NA 3UIZA 3DX2A 3QIWC 3TEXA 3VXSA 4ODTL 3RGVA 4G8GE 3U4KA 2EDHA 4X7TB 2WUCL 1J1PL 1XTLA 1WG3A 2F5AL 4NM4H 3KM1A 2ZXQA 4HAGA 5D2NE 3QUZC 4ZMYA 1LGVA 5JW4R 2H4EA 3ETTA 2IWFA 3MBWA 3WEXA 3TPUB 4RRPA 2R29A 3S5YA 5AKTA 3X1BA 4H88L 4HVBA 4H0HB 2X7LB 1GZPA 3S3PA 1UH2A 3KPOA 3QARA 4Q2ZB 1CXIA 1M05B 3EO1B 5L2KB 4LEEA 1RHHB 2PCPB 1OEZW 1KTRL 3IJ8A 4BSVA 4U33A 2LU5A 3NZHL 2OL3L 4OLWL 4U3SA 2A6KA 4I9WD 5GS3A 1EEYB 3KHOA 2ITFA 1ZDQA 3T77A 3U9PL 3KYMB 2K6WA 4LRIA 1TJGL 1FJ1B 4FS0A 4I3SL 2KC0A 2VR5A 4H7VA 2V3FA 2YUZA 4MQXC 1Q0XH 2PYEB 2XWBA 3I02B 4LAQL 4LLMB 2DQDH 4LKCA 4Y19B 1WA0X 3BDBA 5KVFE 3WIFA 2D4FA 5DJ8A 5BQ7B 5D96C 3BSZA 2A6IB 1RZ8B 2HP4A 2NY5C 4YBQD 4NQCB 1K2DA 4JFFD 1OAYH 4K5OA 5G4NA 3M1CA 2Y3NA 5EC2B 3BN3B 3MN8A 3Q5YA 3AWZA 3VG0L 4AEIH 1IEAB 4HFWB 1I8MA 1CLZL 4MASA 2XT1B 3NPSC 1PIGA 3D30A 1JVLA 4U1KB 1UOLA 2DQMA 2JCCA 5CP3H 1CL7L 5DEFA 5I75B 1I1YB 3RI5K 3NM8A 4BGLA 4FFYA 2D73A 4JFQB 2ZCKL 4PJBA 4HIEA 4AYFA 4W9KC 1ZTXE 4KRPB 3UO1L 2W80C 3S3DB 2AJZA 3K6FA 2MEJB 4JB9L 3CMOH 4LESA 3IXTA 1CB4A 2WSKA 3OAUH 2X6UA 3HAEB 1WRFA 5EU3B 1N5YL 4Z95H 5GSVA 2RQ8A 4HUWB 4MRBA 3RTQA 5ID1A 2FRGP 3D4YA 4GUOA 4IRJB 1YEFL 2Z31D 5ITBH 4WSGA 2YS4A 5HYJA 4HF5L 2WJ7A 3VFMA 4BWUA 4U1NA 3EYVB 4G6AD 1P6FA 4NQSA 4XP4L 3VXRE 4GRMB 4C4BA 1PZ2A 5IQNA 3SKJL 4CKQA 4PGCB 1JXDA 2X4SA 5KS9B 5HY9A 4V1DD 1QKZL 1HSAA 1U2HA 4LIQH 5DVLA 5HYEA 3BZEB 4BELD 2BIQA 3BWUF 5KYWB 1BT3A 4QO1A 1EVUA 1B9KA 4M61B 4N0FA 3BKCL 4HXAL 3RVVD 1CUOA 2ZX7A 2BY1A 1FH5H 3BI9X 1XF5B 2YN3A 1ACZA 3SOBH 4V2BA 2ROXA 3UROR 4ATTA 3QT2A 5C1MB 2HX8A 1Q90A 2JI1A 1VSCA 1NFIB 4K4KA 2XHNA 4MJID 4HC1H 1KC5L 2BSRA 2JH2A 5DMKB 3QIBD 2A74C 4MXWL 1SYSA 5BZWB 1PLAA 5A3IC 3O3DB 4ODHH 3U46B 1HH9A 1R3KA 1YNTB 4MA7H 5AAMA 3RVTC 1B0WA 5KBPA 4Z7OE 3RZCD 3GXIA 1Z9NA 1AGEB 1TU2B 1O6VA 1HTYA 4X6EA 3T71A 3L3OB 4X9GA 3WKNA 4QLWA 2CM6A 4M02A 3TBWB 1SFDA 3CWGA 4JDEA 5ENWB 4CN1A 3B6SB 4GBXA 1AD0B 1F4WL 3NFSH 2VH5L 1MJUH 4LKXB 5HPMA 2YKKA 4A66A 3MNMA 3FCSB 4I0PC 4L8DB 3O9WC 5E2UH 3T3PE 2XQBH 5EPMA 2ZUTA 5J6HB 3MRJA 4XN9A 1BQHA 4ACTA 3QDME 5BO1H 3KGUA 4P2QD 4XE0A 1NL0L 4Y9FA 1M7IA 5CIPB 4IRZL 4L2YA 2WVVB 1L3NA 3ISRA 1E42A 5BO0D 5GXBB 2VDNB 5TDNB 5DVPA 1IM3B 2XY2A 3K4DA 3T3ME 5J12B 1RK0A 3H9YA 3X1GA 1JRHH 2VZVA 8PAZA 3QRGH 2C7UB 4YR6B 5FYLE 1HHJB 1PLGH 3GT6A 1QR4A 2CK0L 1ETZB 5D7JA 1JV5B 3VCLA 1NGQH 1XZ0A 3D2UB 2BSTB 4Z7NE 3RWCB 1JFQH 3CFBA 3O6LH 1IGMH 1CD1A 1IJ9A 1UXMA 4LBAA 5J13B 1IE5A 2E9IA 5FUCC 1T2QH 1X44A 2J5LC 2YAMA 4YSOA 5DUPL 5HDRA 1QR1A 1U8JB 4PJ5B 1R3LB 2LHAA 1TMQA 1MQKH 4OF3A 1G6RH 2BCKB 4CU8A 3PE9A 4APQC 2LOEA 4WZ9A 3O4LD 5H37H 1BPLB 4KZEH 5GJTL 4Z7VA 1U3HD 2X6AA 2A9NH 1JRHI 2BNRB 1A2YA 4N86A 1DSFH 5FR3A 4WHYH 3GSWB 4MAYB 1ITCA 1DL7H 2HFFA 2CLRA 4FQHB 3UDWA 4C57C 4DEUA 3JV0A 2F53E 2XLLA 2ZKWA 4R96A 1MCEA 3U4AA 4DNLA 4QRTA 2QVTA 4K5LA 4OF7A 1GGCL 1OE3A 3VI4A 4DN3H 5DD0H 3GMRA 1HOCA 2KLRA 4Q56A 5FOJA 1DBJH 4G9DB 1G5GA 1F3JB 1O6SB 5CWSA 1YYLH 2H2SC 4JDZB 3VE0B 1F3RB 1T7XA 4BFFA 3SODB 3ARBB 2DW5A 1HFUA 5HD8C 3C09C 3M07A 5IHLB 3SYQA 4HFUL 2A9ML 1J0YA 1JMXA 1F58H 3GIZH 3D39D 4GKNA 4FGMA 2MQGA 3SD5A 3ZDXE 4UILH 5DFVC 3WENA 5MEOA 4N8UA 2EDBA 4MJHA 2OJZL 1AMYA 3VFOA 2F54E 3CFKA 5C0AD 1MCSA 1OQOA 2BVOB 4J12A 3B2XA 1ILUA 3SJVD 2A3TA 4QHUB 1CBVH 6PCYA 3W81A 3BC9A 3T6XA 3FB7B 5HYFA 1JGVL 1DEDA 2OI9B 3ZKMC 3S35H 3ZTNH 3E6FB 3HRPA 2CPUA 4PB9L 3ELAT 3FRPB 2Z93A 4PP2A 5JHDE 1JPGA 2J6EA 3MLRH 2EC8A 4CSZA 1KCVH 1TTFA 2L3BA 3GSXA 4JKPL 4TNWK 5KVEL 1F1DA 3GTTA 3ULUH 4UQIM 1YJDL 1KFAH 1TQCC 2IGTA 2UZPA 4M7ZB 4JRLA 1VHPA 4R90L 4F2MB 4LSRL 4HG4J 2BSBA 2YPLA 3NJNA 4FABL 1D7DA 2DYRB 1TVHB 3WNJA 2P5WA 3I9PA 3IAQA 2PP7A 2C3HA 2BNQB 2I60L 1GHFL 3P4NB 5T1DL 1KEMH 1NCJA 4HD4A 4H0IA 2H26A 5L6YL 3J27A 3O3AB 4YSDA 3HE7C 5FLVA 3BKMH 5GRUH 2FYYA 3O6ML 1HU8A 1SLWA 5LBVA 2BY3A 1S5IL 2ENSA 1HOEA 4JCWA 4FFTA 3OKKB 4PJ8D 1JZEA 3MV7E 3UOAB 5FECA 2XI9A 1TXKA 4OGYL 4WU7B 5KJ4A 4JVPA 5I15L 2BC4A 2Z7YA 3L3HB 4ZUTA 2Y6TE 2OFQA 1FNLA 4P46D 4OGZA 5LCVH 4BKLB 2HA1A 4BUHA 2VJ8A 2W9DL 5EZPA 2D0HA 3VYNA 3D3VA 3IFLH 4Z6AT 3VI3E 1IGJB 2DH2A 3OZKA 4NJAH 4UM9A 1LDPL 3ZT6A 4Y1AB 2J73A 2NY5H 3TYFA 3AU1B 3CV5A 1OF2B 3KJ6L 1XBRA 4XO3A 2V9QA 1JS4A 2R9HC 5LGJA 3NT0A 2O5XL 4KQ0A 1FL5B 3RFZC 1FZJA 1VZGA 2QPEB 1EBAA 2HRLA 1KCUL 5IF0A 5MHSE 3C5JB 2BZ7A 4HHGA 4JFZL 4JQXC 1IX2A 3A22A 3AUWB 3ECWA 3P9LB 4NM8L 1CGTA 1HXYA 4Z23A 3VD3A 4OZFA 4TQPA 3ZL1A 4QAMB 1PNCA 2E9WA 2J8UE 5JXEA 3CDZA 1KLFA 3V95A 5AWNH 3FH8A 2R0KH 4G5AA 5E6UB 2DQJL 1S2EA 4WNQB 3GM0A 2ERJC 3NESA 3VFTA 3ULVF 4R4FL 1FHGA 1BSIA 3DI2B 4Z78B 4YHPB 3P9MA 1U3NA 4MJ6B 3HMWL 3PWPB 2ORBL 2N7SA 1QTYT 4A1RA 1PZDA 3AQYA 4YXHH 5FAAA 1E5YA 4DGVL 4DP0X 1I82A 1YHPA 5IJKA 3OKEB 5GRJL 5GS1C 3VSVA 4R4NC 5DJXA 1Q1JL 2FQGA 4LCIL 1CGXA 1JPTL 2AZAA 3DMMB 5INCB 4YDKH 2Y5TA 2NSMA 2B0SH 5C86A 5IW1A 3PJSA 3E1ZA 3K6OA 4I48B 4U1IA 3ATDA 3BN9D 1S7UB 1J9QA 1SVCP 1D5MB 4P3DA 2V9UA 3QDGA 4QOKB 3RPKA 3U6RA 1T7WA 5SWSB 4DQAA 4ONOA 4NPYA 1WCQA 2CDGB 5F3HA 5FKPA 3CGTA 5JPMB 5IW6A 1X5IA 3BIAX 2HLAB 4WLCA 3CLEH 2BSDA 4ZDHA 4ZUVB 4E9XA 1TPXB 5KSAD 4B53A 3PQYB 3FN0L 3NK3A 4JQIL 4N2AA 2YBRB 3IDMB 3ROOA 3FCTA 4WEMB 1J05A 5HHOB 5KBLA 4MAZA 2P5EE 3U36B 1N6QH 3QG6A 3QUXA 3FB8B 4HIIA 1T4KB 4O02B 1ONQA 2WXOA 5E1IA 1AG6A 3QNYB 2VWEE 3B9KB 1JVOA 5E24E 3DOSA 2VZUA 4PRNB 2EVHA 3LIZL 1D7BA 3F5WA 3MLZL 4LQ1A 4P8QA 4R7DB 3TZVA 3UTQA 1O0VA 3KGSA 4UANA 1R75A 2HJKB 5FYJE 4ONFL 2HTKD 1ZOXA 5DJDA 1TCMA 2XG4A 4D9LL 4DKEL 1U3JA 5IK3B 1A7OL 1J8HE 1KT2B 3ZHLA 2RFXB 3EOBA 1MXDA 1TVDA 1A7NH 4LLYA 4UU9B 2KLTA 2JB6A 3N44F 4H1LG 3RIFK 5I76B 4UQ2A 1AZCA 3LYRA 3F7YB 4P23B 4GI8A 3TBYA 1R5WA 5G5DA 1UVQB 5CBAA 3CSBA 3LN5B 3OKNB 3WEMA 3PJNA 4AQZA 4M29A 5I1AA 1EZSA 2EE3A 2ZPKH 3B8SA 1JAEA 5AUMA 5AW6B 3LNEA 3IDIB 5EWIL 4F3FA 1DVSA 4N9OB 2IG2L 2QVIA 2X87A 4FULA 3Q13A 3PWUA 2EVGA 3QHZH 1BFVH 1S4IA 1UQSB 5IEHA 3S8GB 5G4MA 4H13C 1KXHA 4NFDA 1PCSA 2C9QA 4CADA 4KXDA 3VI4E 4EQ3A 2FL5B 1I8LC 4OCWL 5AW1B 3L2LA 3IETA 5E2TL 4R6UA 3MJ7A 4RWHA 1EJ6A 9CGTA 3PNRB 4NERA 3MBEA 1X5LA 4H8WL 5KYUA 1KN2L 3MUGA 1LNUB 4FP8H 4XI5D 6PAZA 1AYOA 2D31B 2I07A 2WLLB 4OCRL 4OFYA 4AVIA 2HFEB 3GYRA 4L18A 1SHWA 1SOQA 2OXGB 1ZPUA 1WO2A 1QYGL 2IOIA 2R2HA 2YXFA 1I9EA 5T1KB 2ZOOA 4GG6A 4EI5B 5EZOH 2VR6A 4M1GL 1D9KD 5F9DC 3MLXH 5KW9H 2C8NA 2VDNL 1JXGA 1YPZB 4KITB 2Q3ZA 1U8KB 3CJJA 1JK9B 3NIGB 2NY2B 1NC2B 2NXYC 2MQCA 4FYRA 5DC4B 5DMIH 5E2JA 1EK3A 1NBZA 3BQUD 3KYOA 4WF7A 3BRDA 2VRAA 2WKGA 1XGQB 2C3VA 3QXUA 2BS9A 5HI5D 4L9LA 1I9RH 3I3DA 3KBFA 4TUKH 5I2IA 2DWEA 5FGCB 4IOFC 5M94B 1FIEA 5DJ6A 1ZANL 5C0IA 5I38A 4ZTEA 1HSBB 1P0SE 1TZHB 2ADGA 2VERN 3CN4A 1J1XH 3IGKA 3B2DC 4HX1A 1XD1A 3S3BB 2IPUK 1KWGA 1U21A 3JVGC 4PJIA 1F11B 1TZIB 2DM3A 3CVIL 4NKDB 4OLVH 3V7AE 5HHNB 2P5WE 1XR9B 3EJTA 3TA3A 1NMCB 1N6VA 5EUKA 3SZ6A 3UIYA 4FA6A 4P6RA 3FBKA 3ZIYA 1XFPA 1YEDB 3CFUA 5F1SA 4YXKL 3CXHJ 3SBWC 4D0BA 4EUPH 4G7QB 3MLYH 2FDBP 2LAAA 1B2YA 3HUJB 3U0TA 3X3GL 3B83A 2J3SA 3O6FC 1A7QH 3U30C 2UY6B 3B1TA 1BQRA 3QUYC 2ED8A 3L5WB 2XZZA 3I6LE 1EJOH 4ICWA 4LHJB 4Y4FA 3TONA 3SYCA 3HRZA 4XP5L 1OALA 3KYNA 5DZ9A 3D85A 1C16B 4UQDA 5M7QA 3PRZA 4LL1A 5CEYA 3CZFA 3HB3D 3T8MA 2BWIA 4GI9A 2Z0BA 5IHBA 4KO6A 2Y23A 1LO4L 1OM3H 5JNYB 5IEKA 3UG5A 4E0RA 3S88H 2LU7A 2X3AA 3BZ4B 3QP3A 1UD4A 3AU0A 4FYSA 4KX9A 4P49A 1JZHA 4BSJA 3MROA 3V7MA 4FEMA 4DQOL 5TJWK 4R8WL 1BZ9B 3UMTA 5AW4B 5MEQB 1HQ4A 3EGDB 3ZKNC 1OGAA 1S7TA 2B14A 4NLHA 3T04D 3RNKB 1F3DH 3NSXA 2L8AA 5HGGS 5LGHL 4AC4A 2VXQL 4R3SB 1BD2E 3VXUD 1VAHA 2DOCA 2BFVL 1BCIA 3QUKA 1E43A 4LARH 5D8JL 4BXVA 3CVHB 1BG9A 1MCBA 4GH7B 4OB5H 1T0PB 3WLWC 1RZKC 4JO2L 4NRZA 3J8F7 3KW7A 1M71A 3NGBC 1I8UA 1QP1A 4WK2B 3BT2L 5D7SH 4F5CA 3VXSB 3RGVB 3PWLA 1SRDA 3PP3K 1MHEA 5D1QE 4Z10A 4XX1E 2D8KA 3QFJD 3CLFH 4W68A 3VWJC 5F7FA 1T66D 4N8VG 3VMPA 3AG1B 4GP8B 3MBWB 5CGYD 3QQ9C 2F1AA 3F84A 4OKDA 5IROC 2IFFH 3TO4C 4Q0XL 1GZPB 1EO8L 2EICA 3ERXA 3KPOB 1UWXK 3LN4A 2PNDA 2IV9A 2LT9A 4P5MA 4CMHB 5A16A 3EJSA 4W1TA 1FNFA 4HQQH 2GG1A 2LE9A 3OAZH 2WUBH 4P5TA 4BSVB 2HN7B 4IBZA 1BEYH 4UT7H 2VDOL 1YCSA 5GZOC 4JR9H 4UMSA 4XWOD 4U3SB 2A6KB 4IU3A 2X1PA 5AB1A 4A2GA 3GDCA 3HZ3A 3THML 1EEQA 4W9EC 3T77B 1TNMA 3DDGA 3KPRE 3TC9A 4V2CB 3WAJA 1FO0H 2OK0L 2FNWA 2KHAA 3CPLA 4JY6A 4E9QA 3LN9A 1YEJL 2FH8A 1NLBL 1EEUA 2ICCA 2XWBB 1RUQH 5AVWB 1A3LH 2EJ1A 3RDTB 3WFDL 4LKCB 1JWUA 5B1BB 2WXLA 3MMEA 3WIFB 1JHKH 1CLOL 3LRKA 2VR7A 2VZTA 4I0KA 4HCRH 4W4NA 3RKDD 5HVHB 3EDKA 3C87A 3F58H 1K2DB 3GI8H 2UXTA 4KKBC 1BBJA 4YE0A 2GK2A 1I8MB 4L4TA 2F5BH 3QWOB 5D7IE 3V6FB 2BP0A 1ADQH 3VGBA 2K9UA 1CFTA 2JCCB 1XGRA 1KB9K 2XQYK 5FUOL 2DWXA 3A6BL 2KT6A 3EZ8A 3F12A 3S98A 3U9WA 2WINB 2AEPH 3FHEA 1CDYA 4UQCA 4GXUN 1MW1A 3AWYA 2BSSB 2ODHA 2NR6A 4ONHA 4HEPG 4HIEB 1S9KC 4I3RH 3ZGHA 3FJTA 2IANA 5FHAL 2B5IC 1TTAA 3OV6A 4B9ZA 3ZRCC 3VWKA 5I9QB 4MS8C 1G4MA 3KXFE 3RTQB 1AIZA 1S9XB 1JNNH 3QIUB 2NPLX 4L2LA 1XGYL 4YDJA 1ODUA 1CI3M 1QSEA 2QLYA 2L7QA 4Z7QE 3VFMB 4FQ2H 2ZX8A 1FAIH 5D71H 4NQSB 1IGFH 3BEVA 1MREL 2QSTA 3CZUB 2APBA 3MU3A 2WIMA 5E7BA 4CGUB 1ZS8A 5IVXA 1L5GA 2W0LA 4ES9A 2X4SB 3D4CA 5DWPA 5AKRA 3FO0L 1DBKL 1HSAB 4P5KA 1IC1A 1OHZA 1QSVA 4XXCC 3OGCA 4U1SB 3WIIH 4EBQH 4DP9X 3EDJA 3L5IA 4N90D 1KENL 4QRRE 3TBVA 5CF3A 4QO1B 4JFDA 4MXQC 4N0FB 5J1AA 3L2MA 1J8KA 3S6CA 1E3FA 3T8XB 4TSCH 5HDQH 2R56H 3T0EA 2FJFB 2WM0A 3QXDA 1BQ5A 2EEDA 3QUMA 4YQXH 2XZQH 5TK4A 1AIFA 1CE6A 1SHSA 4LOUD 2DTSA 4P4KC 2BSRB 1TTCA 2ZCZA 4ZNEE 4URKA 1A8JH 3KPPA 1Q72H 2AXHA 1SYSB 4L1BA 5FYKE 4L1TA 1YECL 2OR9L 3GXTA 3KH4A 1HH9B 1R3KB 5DUBA 1U58A 1UJTA 4ZFGL 3IJ7A 2QFRA 2BDNL 5D6DA 1XGPB 4X6EB 2ZICA 4KH2A 5DR5L 1T0OA 3Q0HA 3O11A 5JUEL 3GBNH 3SQOH 3RAJH 1NSNH 2NNXA 4JCLA 2E5EA 5HPMB 1QRNE 1JUFA 5K69A 4JZOA 2B2XH 2FD6H 4KKCC 4QTIL 4XNBA 3VFGL 5E9DD 3CC5A 5EPMB 3K1DA 3W39A 3MRJB 2FSEA 3FSZA 4Z77A 3BPOB 1BQHB 4NPJA 2YK1L 4KK8C 1BA9A 1VIWA 3ARRA 2K0RA 1DQLL 4Y8DC 2PO6A 3SQBA 5HJ3A 3QCTH 4HHAB 4XCFH 2FHBA 2YEZA 3UBXA 1ZGLP 2E86A 2G4EA 2PXYC 1DLFL 2AV1A 3PLYA 4Q6KA 3T4AA 3VRLF 1ZTXL 3O2DH 1QSFA 4HPOH 4PI0A 5TPWL 1LHZA 3H8NA 2FQDA 3IJSA 1KTCA 4BQ6A 5C9JA 2X89A 3C6SA 3VCLB 3DECA 2P80D 2YGVA 2XTJB 4Z3GA 1XZ0B 5GZNA 2YQBA 3LPWA 2YAFA 1L9NA 1CD1B 4PV8A 1RUPL 1JWMB 4KPHL 4PB0L 1QR1B 4KJPD 2X9YA 4MYWB 3RHWK 5AALA 2X4UA 2HPOA 2BVTA 4W93A 3INUL 1FVDA 2J88H 3MRPA 1XIWD 4H1LA 2TSAA 1LE5B 2NY1C 4QYOB 4NUJA 2FEEI 4TQEH 4JRYA 4APXA 1V8HA 3IPBA 1W15A 4ZG1A 2UWEA 4Z7VB 4W9DC 4TSBH 1N67A 3TV3L 2XIDA 4KNSA 3Q9QA 2RCSH 5ACLA 2XJLA 2HFFB 3R18A 1HYSD 4DUVA 1WFUA 3OZLA 1UCTA 5FK9A 5T1LD 1IBZA 4GRWE 3KPSE 4R96B 2ZNWA 3VNZA 1D7CA 5EO9A 4QRTB 1B0GA 3SBRA 1BYOA 2F8VA 4FC3E 3C60A 4JKWA 1FLRH 1FG9C 2AEIT 3DXAD 3P1VA 5KVDH 3GMRB 1TYJA 2F19H 4NNPH 4X80H 2X1QA 1IGCL 3MOAL 2B8OT 35C8H 4N0UE 4QIRA 5AVYB 4M5TA 4JY5L 1ZRUA 1BXVA 4TNVF 3GPSA 1GVIA 4X6CE 1F6AA 2XV3A 4GS7B 3H9SE 3JWDC 1HQRA 4LASH 3TYGH 1T0MA 2D0GA 1WK0A 2ZOUA 2O4EA 3GJEA 4XH2A 4LSQH 2BX5A 2QDVA 4PLKC 4GKNB 1MLCA 5LGKA 1FWXA 1R33A 2H45A 5ILTL 3U1SL 5MEOB 4KXBA 2ICEC 4NHCL 2E4FA 3VFOB 3QCUH 3CFKB 3RU8L 3QNZA 4OSUL 3CDGB 4M9OA 2EIJB 4PWJA 3CC1A 4FKHA 1NGPH 3RWGB 3N50A 4XTRD 1AQKH 1FH2A 1HCVA 5FYLL 3PP4L 2Z93B 3QDJA 2GW5A 4PP2B 1JPGB 1V7ML 4JFOB 3LNGA 1MDAA 2EADA 3GSXB 4UOW1 1EHAA 4D0DA 4MHHI 2YPVL 4A7GF 1RZKH 3HFMH 1GCFA 3KLKA 3N5AA 2JJWA 1Y7VA 1NC4A 1AANA 2VDKB 1UXSA 1KIUB 4X4ME 5CP3A 1XHHA 2EYSA 3V8CA 2YPLB 4OCYH 1NQBA 5EBMA 2HVKB 3PIQA 4OD3H 3IMBA 4F9LA 4AEFA 4FOMA 5T3ZL 1F0LA 2VXSL 4HOMA 1H8LA 1OHQA 3M7OA 1E4KA 5I0WA 5L2KD 1MIMH 2H26B 2P8MA 2GTWA 3ZE0E 2FVNA 3MX0B 4FFWC 3SDXA 1YO4A 3TX4A 3OXRA 1JGUH 5HDBB 5JOPE 2XA8L 1IGYA 1IKNC 3DYMA 2FYYB 5A7EA 3O2VL 1PG7W 5AZEH 1CFNA 4P9MH 4TNEA 3TBBA 2YRBA 4FG0A 3PDGA 3P2BA 1CVSC 1RURH 4P3CL 2JJTC 2XU9A 3OQ3B 5GGRA 5FECB 2RGSA 5E1HB 4LPVA 2PYFA 4F8PA 4PAZA 4N28A 1GJUA 2BC4B 5IQ7L 4ZUTB 3UEQA 5FXCH 1A6UH 2QVMA 2G3ZA 2CO7A 1GZQA 1YPZF 2PYED 2WBJD 1ACCA 2XQ0A 4LSTH 3MA9H 1NINA 4N4YB 3OF6A 3AS2A 4IBTA 4JN1L 5D5ME 4NQCD 3M1BA 3QA3A 3TYFB 1NZRA 4J6RH 2WNWA 5DD1L 4XE5B 5FA4A 1SQMA 2YR3A 4HC1A 3MRGA 2HUHA 3WHE1 1OTTD 1FZJB 2IANE 5TE7H 4WCYH 4YHOL 2WGXA 3TJEH 1E6OH 2X2UA 2X9ZA 1OAXH 3RWDA 4AENA 2AKRB 4MZ3A 1HXYB 1G9NL 3V79C 1TZOA 4OZFB 1YSOA 5BMFL 3CDZB 1KLFB 2WY3B 4GO8A 4RMSA 2NX5E 5LAXA 3T6VA 1U8HA 1ASPA 4S1RL 2LLNA 4S11A 3DSNB 2R29L 2VN6A 2WOBA 4YBLC 4KRPD 5KYXA 3DO7A 2ESVA 1ZCRA 5CUSH 2BMKA 2BCMA 3F7VA 4K7PY 2CA3A 2Q0ZX 3AROA 2E9BA 3UPCA 3IAGC 1BJ1H 1MCFA 5I71C 3P9MB 3D08A 4KTGA 2A77H 4MNQA 1TETL 4HS3B 4K3DL 2VC2B 4IRJD 1BQSA 1FORH 3HE6A 3MRNA 3NACL 3OSKA 4PM1A 3MCYA 4F1ZA 4MVBD 5C0CD 3BWUC 3E1F1 2QPFA 3L4ZA 5DJXB 1A9VA 2A1WL 5I8KL 2G5BB 2PW1A 3PGFL 4NAQA 5IT2L 4PJEE 2YEVB 2I25N 2Y5TB 4F80A 4HETA 3CFCH 3PJSB 4U1IB 4B7LA 3G6JA 3N91A 4EDXA 2A6JA 4JL1A 4MCYB 4P3DB 3QDGB 4N25A 3U6RB 2BOBA 3TT3H 4PLNC 3TH2T 2ALWA 4XCCH 3ZRFC 4X5WA 4ZYKA 4HSCX 3BSZL 4NPYB 1WZAA 4DF9A 2CHWA 4HKXA 1G6RA 4JJ5A 5F3HB 5FKPB 2W95A 3ZDYE 5E99L 1ZK9A 5H37A 3WS3A 1QNIA 4HIJA 4DOHB 3S3CB 1INEL 3QJHA 1FIGL 1NUFA 1ED3A 4N5UA 1AZNA 1GA2A 5IFJB 1O75A 4M8RA 4LCWE 3AWFA 1E3XA 3RBSA 5AOZA 5KJ7E 3ROOB 3FCTB 4PY7A 4L1DA 3W11C 3ABMB 1MJ8L 1TQTA 4XHJD 3QG6B 4HIIB 5IESH 1HZHL 5LN8A 4FFYL 1ONQB 5K59F 2FIKB 3HNVL 2WB1A 4EOWH 3HI5H 4E9RA 4MQ7A 3DOSB 2DKMA 4OUOA 4HCGA 3SGEI 4BK5C 2ZWFA 4GMTH 3QWNA 4AJYV 3X12A 3F5WB 4F58L 1L0YA 5CBEA 3UTQB 1CWVA 1OAUH 3L3KA 1I85A 4H40A 1GAFH 4GOSA 3V10A 5FEBA 2XG4B 3N85H 4FZEL 5IBTH 3RY5A 5HJGA 4MNGE 3MSPA 2X2JA 4X9IA 2XDHA 4FTVA 4W9JC 5I74B 1Z9SB 1IM3D 3O45A 3UTPD 5IWLC 4Z7UA 4UQ2B 4AIXA 3NCEB 3S5LG 2HTLD 4GNKB 4NO3A 1IC5L 5FS5A 2I5YL 4PJDA 5DVNA 4AYSA 3D2UD 1IAIL 5G5DB 3EUDA 3TBYB 4H2CA 5CBAB 2Q10A 1F41A 2V5RA 4PRIE 3FXIC 3QQDA 5AQ0A 2AK1H 1YAZA 4KVCL 5AUMB 1NCWL 1OZTG 2B1AH 4U6VH 4OLUL 4PJ5D 4F3FB 3K71A 3BVXA 4HA1A 1NCBL 3PWUB 2GBVA 1I7ZA 4PW3A 4WW2C 1D5BB 4XC3L 2HWZH 3UBFA 1COBA 5IEHB 1AFVH 3V4PH 4GT0A 4CADB 4YHML 2VNCA 4G7YH 4LNVA 1MRCH 3ZYOA 3MV9B 2OP4H 4IU2B 4ESKA 4X6FA 3IETB 4MAYD 5K9JL 1ZMYA 2XG5B 1R5IA 3MJ7B 3QIWA 1GGBH 3CXDL 1D3CA 1EHNA 1SBBA 4QHMA 5I18L 3MBEB 1DLHA 4M3KB 1QFUH 1ZS2A 1MPAL 2UXGA 3AM8C 1TEGA 5KYUB 1ZGLM 2WO3B 2HFGL 3QUZA 3MUGB 4G6KH 5F9WB 5FWRA 4Q9CA 1RVFL 5BPPA 1G0YR 2CJTA 2I07B 3O3EA 4RVBA 3W9EA 2IALB 4KKLD 4AI7A 4CU7A 5E70A 1HZKA 1I9JH 3PWJA 1I1AC 4RAHA 4K3JL 4KZDL 2R2HB 3CZNA 1P84K 4QRBA 3AB0C 4GG6B 4LNRA 5EF3A 3QRFM 3TWYA 1B2WL 2WLNA 3MKGA 3ARBD 4IS6A 1RIUH 1W72H 4JAMA 5D70L 2K4AA 3JWDH 1Q9OB 2H9GA 5EEWA 3MGAA 1W9XA 2IC2A 4JPWH 4BK8A 5CJQL 1NBZB 5D1XC 1U30A 3KYOB 1T0NA 4X5PA 5CSGA 5LCVA 4AKOA 4B6ZA 1UM6H 5F7YC 4ZUWA 3ZSSA 2C3VB 3CBJB 3ZDZF 1JPFB 4L9LB 3DJSA 3PDOA 2DWEB 5DJ6B 5C0IB 2NW2A 3U7YL 2ADGB 2AW2A 1LEKB 2W5PA 4I2XE 2F8OA 2VLJA 5ERWA 2B15A 1ASOA 2YA0A 3BESR 4PJIB 5CLZA 4Y1TA 5L2JB 2GSMB 3TA3B 1OK8A 1WWAX 3CQQA 4U1HA 4RGNB 3UTZA 3VFVA 1M1SA 3OZ9H 4ALAL 4WSJA 5EUKB 4DK6A 4IDJH 4X5RA 4OZHA 2B08A 1KIPA 1J1OH 2RAMA 2DD8L 3ETBF 4AL8C 5KVGH 3GXPA 2BFGA 4JVWA 1F00I 3SPIA 3BMWA 3U0TB 5LN4A 3WFCH 1WE5A 2XWJA 1U8NB 2NY0D 2YSTA 3STBA 3D9AL 3FOMA 4Y4FB 1WX5A 4MQTB 4M7JH 3HRZB 1SLXA 2BNQD 2A99A 3FPXA 1OAQL 3D85B 3KYNB 5E4OA 2F7IA 5I19H 3WJJC 1L7IH 5CEYB 3O8XD 1CXLA 3H54A 1KBGH 1LO3H 2XN1A 3JZYA 2ZCLL 2QGBA 4E0RB 1DN2A 3VDBA 5E1AA 4PCKA 1D5IL 2BHZA 4TVPE 4ETQA 5KAQG 1NFDE 1U92A 5CJOH 3MROB 2DIEA 3P4OA 5DQDH 1XXFC 2IDSA 3PWNA 5TE6L 3MRQA 2R0WH 5LQBH 1HQ4B 1P4LB 2DQHL 1OGAB 1PD1A 1S7TB 2NTFA 3S37X 2D7TH 3QDAA 3VGAB 2F7QA 2KERA 4NCDA 2XBZA 1S7XA 3QUKB 1ACXA 4XPAL 2K4WA 2VR8A 2CALA 4AQ1C 3ME0A 1LO0H 2ITDA 1MFUA 4KFZC 1YUHA 4FL4C 1M71B 1X5ZA 3CTTA 4Y1AD 4ZSOA 5EUOA 1W91A 4KI5F 5DT1H 5C7XH 1G4RA 3PWLB 4DGYL 2J6EL 1MHEB 4NKIH 2VOTA 4GSDL 5F6HI 2XKUA 3OJ2C 3UG4A 3VXTA 2WC7A 3V0EA 2A74A 2HLFD 5IHUL 1CGSH 2VDQH 1QRKA 5FCUL 4AQ8C 1QAWA 2BOCA 2WCPA 1A4KA 2JWYA 2VDKL 2YGNA 3LXCA 4U7KA 2VL4A 3NABH 4J3OF 1AHWC 2IIJA 3ULVC 3LN4B 1L6ZA 4P5MB 1SUHA 5A16B 2F0CA 1ZPLA 4G6ML 4EN3C 4JFYA 4X8CA 1D6VL 1DFBL 2EH8L 2FUQA 5KSBF 4UB0L 1GMIA 2D0FA 3FQUA 4I0PA 4I3GA 5LVEA 1FF5A 3O9WA 3FU5A 3HZVA 5ITFA 2WYIA 4IU3B 4KK6C 2NZIA 1AQHA 4PRHE 2R1YA 4TUOA 1IVTA 3T2QA 3PWPD 4B9KC 3G6JE 1KIRA 2JTYA 2NYZA 2C9UA 1KGXA 4IM8A 4DZ8B 3CPLB 4JY6B 2G3XA 2ICWI 3MZGB 4J3VA 1T2JA 2Y6SD 1CU4L 4M7LH 2B3IA 2WGNB 4JLRA 1FG2B 1YC7A 1JWUB 4BQBA 3MMEB 4EIGB 2Q6WA 3FT9A 4F93B 5LG1A 2GCYA 1HEZA 4ELME 2PP9A 5JDJA 1TSHA 4AX3A 4UDTA 4QOKD 1MW2A 1BBJB 1IARB 5SWSD 1NGZA 3MTRA 4TN9A 3RB7A 2QQQA 5FA3A 5I66A 1F86A 3QJXA 1FNAA 1XH2A 2BP0B 4AIOA 1PZ5A 3IE4A 2AZUA 2AJVL 1CFTB 4APQA 3DK2A 1JXJA 1XGRB 2NY3D 3VGFA 3M86A 1OAZH 4XN5A 4OTXH 5IR1A 3FFCA 1GW6A 3PQYD 4JANB 5DHVH 1CI5A 2CCLA 2FX9L 4ONHB 3VGEA 2XVKA 4YAQA 3KVDD 1EUTA 8FABA 1DQML 1CFVL 2PUQT 3E3QC 5HHOD 3ARGC 1BVLA 2KDGA 4X7CC 4OI8A 3COOA 3VWKB 1NMAL 2QPUA 5AOIA 5TQ0L 2Q8BH 3CCHA 5CNHA 2NDFA 4GQ9H 4DEPC 1RH8A 1UWEL 2ARWA 4MHHG 3CQFA 5TDPB 3CIQA 2H8PA 3Q1SL 3B9KD 1Z0NA 1QSEB 1GGIL 1ORSA 4BDVA 1UH4A 5EZIL 2DEWX 3WKMH 5ACMA 2QV4A 3CK0H 3S37H 1S9WA 2VC2L 2AAAA 1ZS8B 2J44A 4LEXH 1L5GB 3W56A 4ZX4A 5IVXB 3OJMB 4GW4A 4NQDD 5HDBF 4P5KB 4IHOA 4WFHE 3OGCB 3B7UX 1JHLL 1T5KA 2P1YA 2ZXDA 1E4WL 1OTUC 2R39A 2ZXCA 3OWRA 3TBVB 4JFDB 4K23L 5I0XA 5CE9A 1NGWB 1CICD 2CRIA 1SDAB 5J1AB 2W0PA 4P23D 5DZNA 4DGWC 2NY7L 1HI6A 3L7FA 1TSRA 1MW3A 4U2YA 4YWGH 2OYKA 3T0EB 4YS4A 3QXDB 3A4FA 2WXHA 3QUMB 4ANUA 4OV5A 3IDGA 1AIFB 1CE6B 4HWUA 5E2WH 2EXYC 1JBJA 1AQMA 5EEYA 3RVWD 3P3RA 3ESUF 4ZS6C 4ODSL 5DUBB 5EZJB 1CF1A 3PCYA 1HS6A 5SWZA 1U58B 3JV6A 5FFGA 3OVUB 4PRBB 3MR9B 2EIZA 3UP6A 2DQCH 3CZEA 3VA6A 1A6AA 1AS8A 1F4HA 2PF6A 3H56A 1NEZA 4NUGH 2G5RA 1BVKA 2DTML 4K0OA 4WWID 3CD4A 4A7TA 1JUFB 15C8L 4EUPA 4QXGL 2OXHB 5D7KD 4PBDA 5CEZH 1PGRB 1T5WA 4U7MA 2Z8RA 3CC5B 5CCKH 5E9NA 3W39B 4NZUL 2FSEB 3NCMA 3TIEA 2P26A 3UTSB 2XXCB 3T0AA 3SQBB 3C2AH 4KZCA 4MDJA 4YFDB 1MVFA 5EF0A 4BQ8A 3UBXB 2YEZB 2EYRA 3BUIA 2AV1B 3T4AB 1PKOA 3NCYS 4LP4A 1GY1A 4HJEA 1QSFB 1F97A 5L8JB 5BS0E 1H8NA 2X6MA 3HE7A 2XIBA 3POHA 1CXFA 3OR7A