4L37A

Sp2-sp3 - a complex of two storage proteins from bombyx mori hemolymph
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
674
structure length
674
Chain Sequence
b'FKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPHYTPDKAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Silkworm storage protein
publication title Crystallographic identification of an unexpected protein complex in silkworm haemolymph.
pubmed doi rcsb
molecule tags Protein binding
total genus 233
structure length 674
sequence length 674
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00372 Hemocyanin_M Hemocyanin, copper containing domain
A PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
A PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 4l37A02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 4l37A03
2ZMXA 3AWYA 3NTMA 3AWVA 3AWSA 1NOLA 3AX0A 1WX4A 2ZMZA 3AWTA 2ZWEA 3HHSB 2AHLA 4J6VA 2Y9XA 1BT1A 5CE9A 2ZMYA 1BUGA 1WX5A 4Z0ZA 4HD6A 4OUAB 1HCYA 4L37A 3WJMB 1BT3A 4Z10A 2ZWDA 3NM8A 3QJOA 5I3AA 4P6SA 4J3PA 5I38A 4OUAA 3W6QA 4D87A 4HD7A 1LNLA 4J6UA 3W6WA 3NQ0A 4HD4A 1WXCA 3HHSA 1JS8A 4P6TA 4J3RA 4YZWA 3NQ5A 1OXYA 5I3BA 1BT2A 1LLAA 3NPYA 1WX2A 3WKYA 3NQ1A 2ZWFA 3WJMA 2Y9WA 3AWWA 4Z0YA 4J3QA 4L37B 2ZWGA 2AHKA 3AWUA 3AWXA 1HC1A 1LL1A 3GWJA 4J6TA 4P6RA 2P3XA 3AWZA
chains in the Genus database with same CATH superfamily
3L5HA 4H0LC 3F04A 1UH2A 3QP3A 3KJ4B 3GB7B 4IDLA 4MZ2A 1WK0A 4XAKD 4OM0L 3MRNB 4GRWF 2VABA 3NEEA 4RZKA 5L6YL 1RK1A 5HYSB 5FR3A 3UPRB 3WN5B 1CLZL 3L4WA 4X80L 1FPTL 1SVBA 3HRZC 1UD8A 4NPKA 4ZJ9A 5F9WC 4HMCA 3NMEA 2R69A 4QHMB 4RMRA 5DZJA 3V5HA 1XGTA 3BAEH 4N9OB 4ZS7L 3CBKB 3US0A 3CZUB 3DSFL 3KDMB 4N28A 5C0IA 5I1GL 3HG5A 3QQ4B 1R24A 3W0WB 1BMGA 1BX2B 1VZHA 1BM3H 2X4SB 5IR1B 4JDTH 2R0ZH 2XRAL 4KJWD 4XN5A 3H55A 1JGIA 3US1A 1R3KA 4GG8A 4XZUA 4W4NA 1TJIH 4B96A 1ZA3A 1OTTD 2H1XA 5E2TH 5A40E 3OKKA 4MMZA 1YEEL 4GRWE 2OXGA 4EI6B 4M93C 2YEQA 3P11H 3KPSB 4JRXD 2MOVA 2K1MA 5T33L 4L8CB 4K71B 3S48A 3LN4B 5HTSA 4ZFGL 12E8H 4HOMA 1HSBB 2HPTA 3AB0C 1JK9A 1GGIL 3BVWA 3W57A 2QPEB 2W0LA 3D39B 1IJNA 3EBHA 2Y1AA 3TT1H 5F6HJ 1C7TA 3D3VA 5CP3H 1FLTX 4P3DA 5IT2L 2ISDA 4UT6H 1WZKA 3FO1B 4EQ2A 1U3HC 4LLUB 4PRHD 4ES8A 2P5WB 3OG4B 2DLIA 4LB8A 4KUZH 2R1WA 1AR1C 1IC0A 1KGUA 1TO4A 5I1IL 1U6AH 3U2SA 4Z77B 1NDGB 1L5GA 1IZJA 3DROA 1FFOB 1Q0YH 4LP5A 5L2KA 3MRFA 3L13A 1GIGH 1EDYA 1ZKAA 3LNEA 3RIFF 3RYMA 1BVNT 5CWSB 4NIKB 3S9DB 5EMYA 3B7YA 4E9SA 1ASQA 1B6UA 1RPUA 3ESMA 4PJEA 3MMEA 1IBGH 4X4YB 3MRHB 3OL2A 4G8GB 2ZSWB 3FN9A 4JM0A 3WFBH 4BH7A 1IC7L 2DLTA 1RI8A 4KHTH 2C3VB 4POYA 1NSNH 4MGXA 4FQHB 2FWSA 2EIKB 2HX7A 4LDLB 3P73A 5D7JD 5KJRL 2E76C 3GNMH 1MIML 2WB1A 3FMGL 1B0WA 5L4IA 4LMQI 4WW2F 3RLSA 2EYTA 3UJTL 2FB4L 1QFPA 3CFUA 3CQPA 2Y7QA 3EFFA 3NCJL 5IB5A 3PREA 2BP0A 4MQTB 3TA3A 3P9MB 2PO6C 2Y5TB 3MRDB 5FKPA 1OOAA 1QFWI 3EGSB 4AW4A 2IF7A 5HGBA 4LQFL 4PWKA 1I9JL 3NJKA 2HX9A 4CN4A 1P7KB 1PY4A 1QUNA 4BIKA 5IMMA 2AXGA 1DEEA 3ZSSA 3HZVA 1MFCL 2IFFH 1F6LL 2FEEI 1TQSA 4N6RB 4UV7L 4HC1A 8CGTA 2W5PA 1L7TH 4XHQA 1P5VA 1HKLL 3G5YB 4GRLA 4IMKA 5D6CA 1EHLL 4KO5A 3MRKB 3CHPA 1WICA 2F15A 2XFGB 3BKCH 1ZE3C 4I13B 1T7ZA 1XBDA 4PRIA 5I74B 5CSZB 4EI5B 1CFNB 3ZHLA 1B2YA 3SE4A 3CFDA 4X6DA 2V2WB 1RURL 2K7PA 3P0YL 5T3XD 4XN4A 3U48A 2NNXA 1HHGB 2J44A 3C60D 2A4ZA 4G8FA 4NCC2 3U9WA 2Z35B 2XIDA 4A1RA 2UYLB 1SOKA 4G5ZL 4HU2A 5KVGL 1TKWA 1UUNA 2JE8A 3K6FA 3OAUL 1CFTB 3HZKB 2AJSH 4FX5A 4ANUA 3C2AH 4POZD 4U6HB 4XVOA 5C09B 3VGDA 4MA3B 4LCYA 3NP3A 5CN3A 1IE4A 5KW9L 1E4KC 3D07A 2X40A 4GRMB 3EYFA 3G6JA 3FQNA 5H4ZA 5C0ND 3IYLW 1T89C 4NPYA 1PKQB 4OCSL 4AYFB 2CKBA 2A1WL 2XWTA 3I85A 4F7CA 1CVSC 3NJFA 4OGZA 3PWJA 3KPLB 3AMLA 2DRUA 4YAQA 4Z5RB 3MSPA 4R90H 3LQAC 5FYJE 1X6NA 3WHE1 2DIJA 2VXQA 1PLBA 1XR9A 4JM2D 5SX5H 4PRPE 3FSWA 3U83A 4QIRA 4H8VA 5C0DB 5HDBB 5D1XD 4ENZA 4NUPA 1E6OH 2VISB 4ZPTA 3T08A 4B9KC 2OZNA 5FV1L 3ZRSA 1IQWH 3LEXB 3V55A 4OZ4B 4Z7OF 4Y7OC 3MRBB 3SDDD 1JNLH 1D6EB 2GI7A 3PWVA 3NFNA 3KPNA 3HNTH 1R5IB 3EF7A 5I9QB 4JGNA 1F4YL 4HUXB 5IQMA 4AUYA 1CL7I 4B5EA 2B9AA 1UA6H 2NY5C 1LWHA 5HHVH 2VXSL 1ZRUA 3O2VH 4N5UA 1BQHB 3F7RA 3FJTA 1JIBA 4DTGH 1NCAL 1KWGA 2F2HA 2WPGA 2CR3A 3HG0A 4ODSH 3W81A 3N1PC 5ETUA 2E4TA 4ERSH 3PJLA 5I76B 3H2PA 5IW1B 3TV8A 2ZUUA 3GDCA 2W9EL 4V2CB 2AVGA 4RRPM 1J8HD 3VXRE 4QRQA 4FD0A 1XTMA 4DQOL 3QI9D 4KY1L 4Z7OE 3C8HA 1F86A 4A6YB 2L04A 1NGQH 4JKMA 4MJID 2A9NL 2X6MA 1DZBA 3B3IA 3OLDA 4I4WA 1A8ZA 1DBBH 3M7OA 4OY9A 4QAWA 5IHLB 2OXHB 1FSKB 5E1AA 4Y2LA 5G5DA 2COVD 2ZZUT 4AQOA 4HF5H 5CZKA 1QPKA 3E2HB 1E4XI 4TS6A 3VTTA 2P7TB 4DO5A 1NMCC 1B4LA 2D2CC 4KKLD 1KIPB 2OI9B 2WO4A 4OD1L 1M57B 1G0XA 1OP3H 4YFEA 4Q9QH 1THAA 4JRYE 3UTOA 2GEQA 1BDYA 3LEVH 3X13A 4ECNA 1QNIA 1P5UA 4DEUA 3BQUC 4U05A 2ZUVA 2KLSA 3BH8B 2R23A 5IFHL 1CICC 1YEFH 1NCOA 1OGAB 2EAEA 3U36B 1G9NL 1HZHL 4P9HC 1UWGL 1HQ4B 3ABGA 4H88L 5L8LB 4PRDA 2WSDA 2UZXA 3QIUB 1MHPH 2ZWLT 1BF2A 2KI6A 4FLSA 4PJGA 5A1AA 5C0AB 3DOHA 4AZUA 4P5RA 3L3HA 3SKNB 1YY9D 3EBGA 4DN3L 2WOYA 5C0GB 4Q58C 1C12B 3GHPA 2HRHA 5F9JB 1RUMH 3ISWA 1IBDA 2V2TA 4FQXD 5EU4A 4V2BA 4K55A 2ICWB 1HINL 5TH2A 3ORJA 3MYZA 3OMAB 4H8PA 3PL6D 2GW5A 3U7YL 4ZX4A 2DQJH 3WMSA 5IVXF 4KOCA 2X88A 5EEVA 4PCKA 1TQWA 2HKAA 4N22A 4RX4A 4A67A 5L88L 2DQHL 4QY8A 3CVBA 3G5WA 2AV7A 3RKPA 4GUQA 4GI9A 1TSHA 3LXCA 2DLGA 3QG7L 1A9BA 2QKIA 3MREB 6PCYA 1YEIL 4XRCA 3BMVA 2XIBA 1CUOA 1FBIL 4G82A 2Y24A 3SBQA 1WD8A 3MQIA 3N43B 5D2NC 4WO4D 3CUPA 3ARDA 3V0AC 3W9DA 5KSBA 2Z3FA 3H8NA 1BZDA 5EPMB 3L4VA 3P9LA 3EJUA 5M7QA 3GWJA 2VXUH 4PLJD 4GBXA 5TE4H 4JG0H 4PJEF 1G7PA 4JCMA 1O5PA 4GUCA 1E4JA 2HFEA 3DUSB 3P54A 2YAFA 4UIKL 2HYMA 4FYQA 4P2OD 1YEHH 5IVXE 3DPBB 4NUGH 5HYFA 3GSOB 3R0MA 1BEYL 3PAUA 1E40A 4Z7VB 4E5XB 1IX2A 4XBPA 1KNOB 2ZYHA 4IGBA 2ZUQC 1R5WB 2PYED 1BREA 4IRJB 1AE6L 1NTDA 3VFGH 1KFGA 5D70H 4P5KB 4AH2A 4DOHB 1KXHA 2C34A 3NDZE 1FYTD 1N8ZB 4XOCA 3Q1EA 2VM3A 2VM4A 3KS0J 4KO6A 4AYEC 1QMUA 2UY7B 1GHFH 2XWDA 3ALXA 4LCIH 1OWWA 1R17A 3RGVA 3UJJL 2JJTA 3T3MB 4POUB 4AIZB 4PJEE 1ZPUA 1BV8A 1J1OL 5KTEL 2I60L 3V6ZA 1A0QL 4JKPL 4ZO7A 2V2XA 2VR7A 3VFRB 2VN5A 3HA0A 3E6FA 3N0PB 2VDRL 3RHWK 4BFIA 4FHBD 3QPXL 5FOBA 2IO5A 3P3TA 3FT1A 3CHRA 4OBSA 4AKPA 3TWCH 2ZXAA 1HZLA 3LRSA 5DZNA 1JK8A 5F0JB 2D0FA 2J8UA 4NRZB 5C0FB 2ZX9A 1SJMA 4YSUA 1TTUA 2WXIA 3NYKA 1CFVL 2VDNB 4G71B 4NQEB 4ODUA 5LG1A 2ZKHH 4O9HH 1KJMA 2VSDA 1AP2B 3D48R 1XCQA 4ZW5A 2G2RB 2BOCB 3A4EA 4YHYC 1JTTA 1JV2B 2MJWA 3G6JF 4HHAA 4KQ4H 4S1SH 4U3SA 4A2MA 3QQ3B 4M62H 1KYOK 3FFCB 4KTYA 2HJKA 3SSGA 4APQC 4D9QE 4XP1H 1AO7E 2AW2A 4Z7WF 2P26A 3U9PL 4GMSL 4NO0D 1TZGL 2HG0A 1DSWA 4N24A 1Y0LB 5L8KB 1W6LA 1CBVH 2ITDA 1CF1A 2Q3ZA 2B3RA 4WFED 1SF3A 2QQKL 3M8OH 5DZOA 4X6DE 4HBQA 5EO1B 1VPOL 2O5XL 3OZ9H 3FPXA 3ROLA 2X6AA 5B4MD 2RB8A 3Q9PA 3N04A 4BXSV 1PG7X 4P46B 1TVDA 4YLCA 4MXQD 4KVPA 3LQAL 1JVOA 1CGXA 4P5TB 4NWTH 2IQAA 4K7PL 2CDFB 3G6JE 4G3YH 5KYUA 4OQTA 2X9ZA 3N0AA 4G1MB 2JFCA 3DRQB 2J5LC 3UYRL 5I16A 5I1DB 2ADFL 1MJUL 2PYFA 4XZ4A 1MY7A 1BHGA 4PRAA 4RFNC 4Z7WE 4J3OG 5GGTH 3U46B 1QP1A 4G6MH 3CFIC 3QFJB 1INQB 2UXGA 2FSEA 3G6DH 5JW3H 3LIZA 5KOMC 3ZL2A 1JPTL 3U4BH 1HDMA 3VXPA 4LT7A 4Y2DD 1G6RB 2LLNA 4UM9B 3NJNA 1KF9B 3QUZB 5BS0D 4XMPL 3W38A 4YHML 3AG4B 5CIPA 2NY5L 3UC2A 4M1GL 1NC4D 3MNWA 4XWGH 2EO1A 3F01A 4F7MA 2F53E 4M61A 2A74C 2BY3A 3HS9A 3F58L 3WFHA 5LBSH 3SOBH 4LOUD 4WK0B 4X0NA 2Z91A 1F1DA 4HIEA 4QTIH 1FH5L 1OT1A 3MJ9L 4BFGA 1BZ9B 3H9YA 4EJ1C 1NH6A 5ECJE 1D5MB 4R0LA 5M94B 1UENA 2YEZA 4YBHA 1IEBA 2E46A 2XXCB 1EXHA 4CILA 3GSWA 5TGBA 3FN0L 2BW5A 3NK3A 3JQOB 4Q8BA 3O0RH 4X7FC 4KROB 3LPPA 4LVEA 4NN5B 1I3GL 1W80A 5E08H 4Y9BA 5DD5H 3HZYA 3UG4A 2Y2WA 3IRPX 1QFWL 3BO8A 1SUJA 2O4EA 1XWVA 1PCXA 2MHAB 1SY6A 1NGZA 2RQEA 1MLCB 4MA8H 2EECA 5F6HI 2ZG3A 2VGLM 3MU3A 5FGRA 5C3TA 4BELD 2VDOL 2FEEL 5EO0A 5T1JA 2PXYC 1WAPA 2BVQB 4FXGC 3UX9B 3QEQB 1EZSA 4C8XA 3T4AC 4DPAX 2EEAA 1ZVSB 4UT7L 3FB8B 5F0MB 2NY2C 3MX0A 1G5AA 4YQXL 2A77L 1SZNA 4NUJA 5DJ6A 3CFQA 3CXDH 5AB9A 3X1NA 3DYOA 4JRFA 3SKMB 4QJ5B 3MV8D 3MBWB 3JVGA 4U1IA 1CDBA 4JQIA 4EIUA 5EOCL 3IMSA 4JDZB 3RG1C 3DJ9A 3QRGL 4EDXA 1QG3A 2BPBA 4G43B 3U79A 2DB8A 5LDUA 4NBZB 2QADD 3HZMB 5E2VL 3ZGHA 1X4YA 3FOMB 3IPEA 2VR8A 3FTWA 3VFVB 5HYJD 3ULUC 3C9NB 2R56L 1E4WL 4OH2A 1CI3M 1X5JA 1T5XB 2K6ZA 4P3CH 5ESVA 2AV1A 3DBXA 3PPSA 3FU5A 2OP4L 3C6LB 1OF0A 4HJJL 1ZLWH 3WFCL 1Y1UA 4LSDA 3SZ6A 3U6XS 2MKLC 2BIPA 1F13A 3OJDB 4L9LC 2FL5B 4YNYA 1LEGB 3ULAB 5IV2B 4PJIB 1PLCA 1E43A 3VFOA 2R7EB 2YSSB 4M5YH 2EEFA 2DLFH 2CXGA 1KPVA 3QZWG 2C1PB 1SLVA 3C5ZB 1OAKH 4XMVA 4OGQC 2M1KA 4L3CA 1T20B 3PGDA 1MFMA 1KMGA 1LWJA 3VCLB 4B97A 2HG5B 1FORH 4JFUA 4ZZFA 2P49B 4KX8A 3FH8A 3KYKH 1M1XA 2N7SA 1CT8A 4CADA 2AK1L 4LF3B 3HE7B 1A6TA 5INCB 1AGDA 1E5BA 2XNAB 4QTHB 2H2SC 3U4EB 4NT6A 3WIIL 1S78D 3LPOA 2YAEA 3MCYA 4JG1H 1T1YA 3SE3A 3V9CA 3VACA 5E9AA 4JY6B 5F2FA 2G9HB 4AX3A 4Z7AA 2GVYA 3CFBA 1ACYL 1UJ3C 3F7YB 4OLYL 3LB6D 1ZT1A 1BVLA 2G9KA 4NQTA 5BVPL 4P49A 3ZBMA 5JXAH 1CL7L 3DGDA 1MREL 1F58L 1T1ZA 4RGNE 3NEOA 1VFBB 2R29A 1MZYA 4LL4A 1KLFB 2Y2YA 3IJYA 1SMAA 2O5ZL 3LZOA 4X5LA 2V4LA 1MW3A 3QQNA 2VLRD 4TPRL 3SJVA 1ZJAA 5T5FA 1Q90A 2NY0C 3OSKA 5CGMA 1KCSL 4UQ3A 3N3EA 3H9HA 3ASOB 2DQUH 1IGFH 3O45A 4PRPB 3HHRB 5CILH 1TNMA 5ID0A 3LH2L 4ZO9A 3PABB 2Q7AA 4PJ8A 2YUVA 3MOQA 2J8UF 1AHKA 1QRNA 3RB7A 2E8YA 4PJ9C 4XMXA 5IB4B 1TTGA 1A7OL 3W9EA 1F1GA 5CBEA 3PP3H 1MFDL 1E4XL 4UIMB 2WBJD 1JUFA 2J6EL 1DQDH 4ZFOL 5GS1C 4GUPA 2NOYA 1TFPA 1F4AA 5C71A 3WNKA 5JMOC 3ZR5A 3FTGB 5KVEH 2YRZA 3I50L 3BISA 1TITA 1RZIB 4FZ8L 1XF5A 1D5IH 1SXZA 5FGCE 2X4NB 3CLEL 5LGJA 4TUOB 4Z0BL 3NZHL 3SGKC 4LLWA 2A73A 3CBRA 4TLKA 3SQOH 1NCUA 5J3HD 5IHUL 2VR5A 1GPOH 5FO2A 5I66A 2CUAA 1N5AA 4B9CA 4NQDB 2Y2TA 1NMAH 3SCMA 2J8UE 3FF7A 4QCIA 4LCWE 3RWJB 1XB6A 3SB3A 5GZOA 2ZOLB 4WY7H 3BUDA 1KTRL 1SHWA 4XC1H 1J0KA 4IOSA 1ZWIB 4DP0X 4Z7OB 4JDEA 1RZGA 2BVYA 4ISVA 1D2OA 4PSRA 1OD7A 2FJGB 1OCWL 3RUGA 5I6NA 2W65B 4I88A 2KT6A 3SDCD 1JI1A 2Q7YB 4XO4A 2FT8A 3UTTE 1WYJA 2QQQA 3QCVL 2DH3A 4PJHA 3NCMA 5F7AA 2OTPA 4LIQH 3GUFA 5C3IA 2VO8A 4WWID 4MMZC 2OTUA 1CU4L 5E5MA 2ZWEA 2XT1B 9CGTA 1KELL 2F58L 4JUSA 1BVKA 1MCPH 3QUYA 2X2YA 3QIWA 4IDJL 4TSAL 3HE6A 4UT9A 5DR5H 5I6KA 3LKNA 3CDGA 1ICTA 3MUGA 1G43A 2KLRA 1RD6A 5GS0D 4L37A 5DEGB 1YMHA 4YEFA 2FATH 1AD9B 2G2PA 4Y4KB 4Z76A 4MD0A 1T0MB 2R2BA 5BVJB 3N5AA 4RISH 1AHWA 3VGEA 1TJXA 5F88A 3FL7A 4PB9L 3SPVB 4D0CA 2IAMD 2C3WA 2K9FB 2VUKA 3GSNA 1S3KL 2VCOA 3HFMH 1KLUA 3BDXA 5KAQG 1LK3H 4H1LG 1F3DH 1B4TA 4P99A 4JFHE 1E67A 2X4QA 2P80A 2BVOA 4Q52A 3TBSA 2GTQA 3U7AA 1HZKA 3WLWD 3HS8A 4CMHB 3FONB 1A4AA 2DYPB 1OK0A 2HRPL 4X8JA 5EUOF 4Y2NA 3VI4B 2AQQA 2IDTA 1OGPA 3NPSB 5E9DE 1EZLA 3AWEA 3V0VB 2DIAA 2YQ2A 3EZJB 4LOFA 3VH8G 1VHPA 3AXLA 3IT8D 5ACMA 1DN0A 3Q6FB 4HS3B 4K7FB 2XXFA 3ZO9A 1Z6JT 4AV0A 1OARH 4UTAH 4HKBA 3EJJX 1ZVNA 2O93L 1N3NB 4Y5XA 2F9BT 3VXSD 2ZPKL 4XTRD 4I5BA 5GGVH 4A7QA 4ZMOA 5CINL 3TA3C 4HOXA 4GNKB 4ZBJA 1JZEA 1MHCB 3DV4B 4DKEH 1S7RB 4JN2A 1R5VA 2NXYD 3BAIA 1DLHB 5F1KC 1NIEA 4NLAA 1USZA 4Q7DA 4BEIA 5IVXB 5IMLB 4LPUA 4RQQA 5IVZA 4MJ6A 5CJBA 2P8PA 1J1PL 1CFMA 5LGHH 2FCBA 4LVNC 4G8IA 3QA3A 5EUOE 4HH9A 4RGMB 3TCLA 1FP5A 3O8XD 2Z0BA 4QGYA 2EH8L 3UADA 3ZSTA 1I8IA 3EJZC 4U1SA 4GRLC 3RX8A 4AVHA 1YZZA 2XY2A 2XZQL 4M9PA 4UQCA 3VXME 5TDPB 5JZ7D 1T03H 2WB7A 2BXZA 1W0YT 4U1MB 3SE4C 3BRFA 1RHHA 3UYPB 3ULUL 1LJMA 1G7LB 2X4OA 3IDJB 4DCQB 1LD9B 3AGVA 3E38A 3TNMA 2H5UA 2XWBB 1MJ8L 4PLKD 3BH9B 4KXCA 1Y18A 1MLBB 2WJ7A 2RCSH 3EYUL 2NX5B 2X1XR 4MNHB 3HBZA 3NSFA 3AREA 4LLVA 1KZYA 4QHPA 5F96L 5FYJL 2AMGA 5EO9A 4DUVA 5JORB 1HQRA 2QDVA 3QEHB 5TPWH 3REVB 5J9PB 3REWA 1RZ8B 3UGEA 1I3RA 2KERA 1RY7B 1AFVL 5GHWL 3GSVA 2VJ8A 1MRDH 3KPRA 1T5WB 3O4LD 4LASL 2YAHA 3O2DH 3LN5B 3EDKA 3Q8AA 4Z10A 5CKGA 4WIQA 4EKJA 3X12A 5IK3B 3U6RB 5DMGC 3T3PB 1ADQA 3FQRB 3NAAL 1OSZA 2EDBA 1A14H 1J0ZA 4LRNH 5EBGA 3B4NA 3S8WA 2OTWB 1B0RA 3RKDD 4WUKL 3HJEA 4FQQA 5KANG 3NZ8A 4H1LH 1Q94A 2EVIA 4FKHA 4M56A 3GRWL 2XBDA 5F9AC 3DX8A 4YBQC 2IPTH 4UQEA 1W15A 4R8WL 4XNAA 1AO7B 2P52A 5E00A 4RZCA 3A4AA 4ZXBA 1V7MH 5KVEE 2CNZA 3FBQA 1NUFA 5TE7H 5LVEA 5DMKA 1EFXD 1ZLSH 3HN3A 4K94H 4HPYL 1BM3L 1TEGA 1Z0NA 4N0FA 1TUPA 1S9WA 4JDTL 1JGVH 4AENA 4PGEB 3B6SA 2X7LB 1UH4A 2GSMB 4MJ4A 2SEBA 2BDNH 2MH4A 3AROA 3MROA 5D7JA 1KBBA 3GPEA 5CN2A 3F7VB 3TBVA 2WINB 1CGUA 4WKXA 3P11L 5B1JA 1U8QB 3CVHB 3QH3A 3PGFL 1AG6A 2ZF8A 4UB0H 4U3HA 3UBXG 1A3ZA 1KTDB 3HC3H 4M7ZB 1S7UA 2N1TE 3P0VL 4QRPB 12E8L 1BP3B 3DRTB 3EFOA 1NGXB 1SEQL 3NFPB 4GAYA 3BRGC 1O6TA 3SJVE 2NZIA 5B21A 4ZRGA 4LIQE 3ISRA 3TESA 5BRZA 3G08A 5DD1H 4QOKD 4GG6A 1BFTA 3IN2A 3ESOA 3TT1L 1KJVA 2A0LC 4NHCH 4UT6L 2VKWA 4AWJC 4Z7IA 1HIML 3VQ1C 5E7FA 1I3UA 2Y9RT 1MNUH 4BZYA 5DHYB 4AYBA 4Y19E 3LKQA 4OKVB 3G6AB 2VLJD 3ML8A 1U6AL 3L3OB 3S2CA 1QRNE 3JV6B 4JFOA 3UJIL 3TPUA 3WKPA 2F53B 2F5AH 3Q43A 3ILQC 1FIGH 2BZCA 4A63A 2IQ9L 5J7CC 1GIGL 2CXKA 1OLLA 4TULH 4KXAA 1BSIA 1P5UC 2J21A 2E8ZA 1NCJA 4LL9A 3FUDA 4V11A 1XEUA 2ZXCA 2R69L 3UBXA 2HLEB 4Q97A 5HVHC 1LILA 3OZKA 5D4HA 5EUKB 4QRAA 3RNQA 1F5WA 2HSIA 3EG9B 2WVSA 3FSZA 3WFBL 2BSTB 4X4ZA 1EZUA 4JCWA 1N7MH 4F92B 1INDH 4YXLL 1HH6A 4BK5A 4OIBA 2YS4A 1I85A 1SMOA 1QSFB 4M7LT 5BRPA 2YC1A 1ZHLA 2WK2A 1I8UA 2DBLH 4A38A 4HKXA 4NQCE 4F5CA 4CRPA 1Q72H 3CQQA 4M1CC 1OCCB 1Q9LA 4TQEL 2R0KH 1MI5E 4TOYH 1B4RA 3RNKA 1M71B 2DL9A 3NVQA 1VGEH 2B59A 3GPSA 2HKFH 3HFFA 4ZK8A 4NOFA 2QKIC 3JWDC 2UZIH 3S35H 1UCTA 4Y4HA 1UQSB 1OB0A 4FLOA 1FZKA 4OIFA 4H40A 2AJUL 1LNUB 1PEWA 3ARDC 4BJLA 5FFLA 1L7TL 3P40A 3SDDA 4RGNC 3ZTCC 1JV5B 3NA9H 5FPIA 4J3RA 3SDYH 3UZQA 4PI0A 4CVUA 1K6QH 5I3BA 4GBXC 1UVQA 4WGWB 2FX7L 3KYAA 3WS6A 5DUJA 4DZBA 4U6XA 1CGYA 4EKXA 3D50A 3HUJB 3EO9H 4KC3B 3K6SB 5FYLD 2V3DA 4P4KB 1KGCD 1YYMH 3UDWC 4DHLA 5IVNA 2AJSL 1DHKA 4X8GA 1NKRA 4NQSA 3PWLA 1Q9WB 3E8UH 1J8RA 3NH7H 1WG3A 2Y07H 3K4ZA 3MRLB 4X42A 4D9RE 5IESH 5EZLA 4IGBC 1KTLB 4PJ5D 5KYWB 1JGDB 3HLAA 3K0WA 4MRBA 4RFEA 2VRAA 2GC7C 5FCUL 2OPCA 2WJ5A 3EGDB 4P6RA 3GEWB 3JTTA 4NO5B 4WHYH 3IVKA 5H35A 5KAQF 1KTKE 1N67A 3SGDI 1HILA 4E9LA 5F7DB 1OT2A 3OAYH 1E5CA 1ZSHA 2DQIH 4R90L 1KPRB 5FA4B 3B9AA 4EOWH 5DSCB 3IDIA 2BSRB 4J3BA 5FM4A 4QWWD 3TJEH 1DVFD 2OCFD 3WAJA 4I7ZC 5MEPB 4A66A 1K4CB 2QR0B 4PJXB 5LNGA 1MCRA 1ZHBB 1U95B 3IGLA 5D7LB 3NTCH 2IOIA 4L1HA 1WC7B 1ASOA 1E6OL 4WJ5B 3UC0H 3ZUCA 1QAWA 2VLKD 5TQ2L 1BF5A 4HC1L 4HEPG 2XZCH 1MCWM 1YMMA 5DK2B 2WKGA 1OP5K 4U1HB 3QORD 1G84A 3QPKA 1NCDH 4K2UL 5A3IC 4IOIA 4QHUB 3MNMA 5T1DH 4FA7B 3PXLA 2OAAA 4Y16B 3W39B 3LMJH 2XG4A 3AG1B 1DQIA 4DTGL 5L4JA 4A2FA 5I1EH 4ODSL 3UFIA 2DQTL 5KYYA 1FNSH 1I7ZB 4L8DB 4HUCA 2P42B 2WNXA 4UNUA 3JBG7 4FLRA 3HMXH 3BIAX 3RL1B 4NWUH 4AV4A 4GOSA 4HW6A 3D25A 3G5VB 2DQDL 4FKEA 3TM6A 4DK6A 4N2AA 4IHOA 3CLWA 2JTDA 5DURB 1K9TA 1MG3C 1CD1B 1GS7A 3GMPB 4JFYB 2H9GA 4RMTA 3RTQB 4Y7MA 1R3HB 3Q8EA 2J2ZB 1KYDA 1DBBL 1ZANL 2CKBL 1BQUA 4PWHA 4WO4A 5FHBH 3L5WA 2HVKA 4HF5L 4NYLA 3LHAA 4YSEA 4U1KB 3BMWA 2FO4A 2OULB 4LSPH 1CMOA 2DMKA 3NQ5A 4TTDC 5E6IB 5CP7B 5DQDL 3WEMA 3LEVL 2ROXA 4E41D 1FI8C 4XMKH 2WLIA 1U33A 4P2OA 2H4EA 4LCWB 4K9EH 5HHNB 5EU3B 2F61A 1PAMA 4NB7A 5E8NB 4AG4H 4C47A 5GS2H 1WE5A 2NLJA 5AG9A 2R4RH 1NLDH 1TZIB 3HOGA 5EOQL 3OJVC 1MHPL 2VDMH 1RMFL 4MXVF 5ISZD 2PYEA 3D2UD 4JFDD 3D85B 3QJZA 4AIXA 3SDAA 3BDYL 3BAYA 1P7HL 5GGSA 3ARZA 5IB3A 4Y9CA 2XWZA 4KKCC 2Z9TA 1FYTA 1OM3L 1BIHA 4Q6IB 2B4CC 3S3PA 1G7JB 2DJ4A 3IDNB 4GO8A 5B3NA 1IC5L 2F08A 3IPBA 1CE1H 1PY9A 4AIEA 1WQVT 2X6VA 4IRSB 3ESNA 1ONQA 1QBBA 2YMXL 4BRVA 1IAKB 4R0LC 3O41B 4G9DB 5DZPA 1ZT7A 3VI3F 4K3JH 2A4CA 3ULSB 4Y8AA 4J3OC 1AGCB 2ZSVA 2B3IA 3K2IA 3CAFA 3DKHA 4MXWH 2N01B 3OLGA 5SV4A 4N25A 1QZ1A 1E27A 4MXVE 3VFPB 4ODTH 1B4JH 2MTAA 1DUYA 2OYLA 1N4XL 1DQKA 2ADJA 1P4IL 4W68A 3KW7A 2GJZA 5T1MA 3H3PL 4AGLA 5TE4L 2YWZA 1W72A 4XNYL 4AZ8A 3Q6GH 4GT0A 3Q2VA 4Y5YB 2WD0A 4TUJA 5BRZE 3FXIC 5AZUA 1YEHL 2DWYA 2IH8A 4NUGL 3WIFB 3KWWB 3LPWA 3LZFL 2I69A 5C6PB 2QBWA 1CGVA 3J07A 2E7LA 5SWSE 1BIIA 4NBXB 5IHZA 2W94A 3VI3E 3JVGC 2M26A 4AJWA 3EADA 1G1YA 2NMSA 3KM2A 1UM4L 4EDWL 2AJVH 3ROOA 2CALA 2VR6A 5E9DB 3RWFB 3VFGL 1X4ZA 1AZNA 1N6QH 4E68A 3V6FA 1OALA 1EAOA 1XAUA 5IJBC 5B8CB 4H8WH 5LCVH 4LCIL 3TBTA 3K6OA 1EO7A 5IW6B 4ZQKA 5CZRA 4JZNA 1HL8A 3FQ2A 4YZFF 4P2QB 3LTVA 2D7QA 1KT2A 2GJ6D 3FUJA 3CFCH 5DTFB 4RSVA 1T22B 3KXFA 4NENA 2AQRA 1O7DE 3NJXA 5D7IF 3E3QE 5HGAB 5IROD 3U7WH 5EUOB 3K2UH 4BQ8A 4F58L 3TWCL 3IWVA 4AV5A 4YH6A 2CO2A 1SM3H 3STZA 3G9VA 3E0GA 4HS8L 3BPOB 3K6DA 3WXWL 4MMXB 5A2JH 4ZUWA 3SO3C 4DH2A 4LAQL 3KEDA 5JR1H 1XGPA 2RMNA 3TO4D 3IF1A 2CHNA 1LEKA 1W91A 3HB3B 4V1DA 4KQ4L 4O2FB 4S1SL 3MV7D 4AM0A 2GHWB 4N0YH 4YZFE 4MQSB 4DN4H 1TCRA 2HP4A 4PBWD 4UZGA 1BXAA 3WG7B 1G7MA 4L4VE 3MJWA 4S1DC 5IF0A 2DM2A 4XCEB 3DETC 1Z5LA 5D7IE 4D8PA 5JIDA 1CBVL 3T71A 4N3TA 3W3BA 3JYBA 1PYWA 3ZE0F 4XCNB 3M8OL 1YNTF 4OCYL 2H32A 4LSUH 1IAIH 1NUDA 1FVEB 3A3YB 3OZ9L 4KGJA 4Q56A 4IBSA 5KSAA 3RVXC 3FU0A 1NFIB 4JFQB 5EBLB 4U1JB 4PY7A 4RMUA 3DYPA 3PHQA 1TTFA 2NTFA 3NSDA 3QFDA 1OHQA 4NKIH 5ECGA 5AUMB 3CCHB 5IJVA 3RVVC 4M5ZH 3ASWA 4KI5F 1C16A 4G3YL 4PJ8C 3CPLB 1U8KA 4S1QL 4ELMA 3RDJA 2NXZD 3OM3B 4Z8FH 1VRSA 4CBZA 1AKJB 5JYLA 3D9AH 1L0QA 5C9JA 2EINB 3AAZB 3M1BA 2XZAL 4WENB 5HXMA 4QRUA 2F5BH 3P77B 4KO9A 4G6ML 5KJ7E 2DQGH 1U8PB 2BVTA 3G6DL 4A55A 3MV8A 4Y2OB 4YE4H 3U4BL 3ZE0E 4N5EC 3GK8L 3S5LG 1JOIA 2VSKB 3RIFK 2AK4D 4UNIA 5EU6A 2EDRA 1MJJA 2VJ0A 4XWOD 4WDIA 2DBJA 4XXDA 3ARBD 2A6IA 3Q3GA 3FT3B 5HYJA 1F0LA 1N9PA 3AB0B 4KKQA 5DLLA 4GUOA 1UATA 4MJ5A 4HISA 1QX1A 4PJBF 3HHSA 2PABA 4DF9A 4GQ9H 2ZCZA 4P59L 1FL5B 2Y6TE 4KI5E 1M2VB 4HGMA 5GIRA 4QTIL 4P05A 3ZL1A 4G42B 2H0EA 3SCMC 4YDMA 1E3ZA 1M42A 1U92B 4H0GA 3O4OB 3QDGA 3WY3A 4X2UA 2H8PA 8PAZA 2GSIA 1FV1A 3ULVC 4P8QA 1AR1B 1JZ4A 2WHVA 1HESA 4OJAA 5AB2A 3ZLQC 4GW5B 1IT9H 3MLZH 4M3KB 4YHIA 5AQ0A 5AZEH 3O0RL 1ZSDB 2CHWA 3L3GA 1N6UA 4MVBC 2OQJA 2IAND 5DD5L 4BFKA 2NTSP 2QPSA 4PGCA 4Y19B 3WFDH 4JPKL 2P47B 5LGYA 2Q86A 2VAAB 4ANVA 4G7RB 3NCYP 4EPSA 1B88A 1SDDA 4MA8L 2CGYA 2I24N 1GS6X 3O3EB 5MEQA 4PHXA 1HYRC 3MDJA 1DL7H 3QUYC 4M02A 4U31A 4PJBE 3QIWC 4YXKH 3HE6C 5HHPA 4OZIA 5J1AB 1IGMH 4I0PB 3FT2B 1BVZA 2KL6A 4LDEB 3D8MA 2MEJB 1ZS8A 2Z31A 3OJ2C 3WNJA 5LXGL 1WZ1H 2QDWA 4YSSA 1CD8A 3V4VA 3ISYA 3VWKA 4Z18A 3DIFA 1T2QH 1BYOA 5FEBA 1BMWA 3MRCA 3VD3A 2O6FA 3LIZL 2AEPH 2UZYA 1GAFH 4BWTA 3L7EA 1N2RB 1HHHB 1JP5A 5DHMC 4M6AA 1AHWC 3VWJA 3O11B 3O3DA 4CSTA 1DP0A 1M7UA 5F97E 3SY0A 4XPGH 5B7EA 4PW3A 1ET7A 1HCZA 2WKLA 3ABMB 3GI8H 4XXCA 3ZR6A 2VLRA 4BFOA 2B4CL 2RBLA 4NQCB 1CI5A 2EIEA 2R1YA 4P3CL 4JN1L 2UY6B 5DJCB 1MVYA 2A6DB 3VXOB 1MI5B 5CM1A 2Y7LA 1A02N 3QQ9C 4Z0ZA 4OI8A 1T6BX 5I30L 2XQBH 1U41A 4K7PX 1I4FA 3BUYA 4YO0A 1E7UA 5B22A 3GQFA 4M48L 4FN0A 4M5YL 3DJRA 4YDVB 2CO1A 2YUWA 3PWPA 5IFJB 4OFYD 1OAKL 3PWUB 1F56A 5I1AB 4MMYA 1XSJA 2WBJA 4JHVA 1VEOA 5KANI 1JZ5A 1IGJB 1ZT4A 1FORL 4MBOA 2JCCB 3KYKL 3GBMH 5LNEA 1EEYA 2A83A 4X6CA 4IJ3C 4Y5XC 1UOVA 2PN5A 1SY6L 2WVVB 4N6QA 1DJWA 5IEHB 2I26N 1BMZA 4XN9A 2ESVD 5JQIB 3NQ0A 3IJSB 3U2JA 4FQ1H 3GS7A 2ZCKH 4NZTH 4B9JA 4LOEA 4PBXA 1CTMA 2P5PA 3IXAB 4HK0A 3IU4L 2YK1L 2FQGA 3OKOA 4F33A 1ZMYA 5A2FA 4N8UA 1GJWA 2VL5B 3V4VH 2ZF9A 5MHSE 2H2PD 1DE4B 4JO1H 1GGYA 3MJ7B 35C8L 4LDOB 4XPBH 4JQIL 4E0RB 3LS5H 1UKSA 1O7SA 3Q8CA 5AAWA 3QUMA 3PDGA 4IIZA 3ZZ1A 4ZAKD 2KC0A 4NHUB 4IIQB 4W1TA 5DRNA 3UBXI 4P23D 2W0FB 4I2XA 4KVNH 4KRPD 1HKFA 1XAKA 5C8JA 3DTXA 3FB7A 2EXYD 4NC2B 4XNXH 2ZXGA 3EJRA 5ANMA 1OTTC 2DQUL 1BG1A 4KUCF 1OGTA 2MPAH 4C83A 4BFJA 5I1HH 2HT2D 1XH2A 4BFFA 4QRFA 1QEWA 2TRYA 3CHOA 3T6ZA 2ILLA 3CDZB 3OVUB 3ES6B 3CZKA 1UZ8A 5CD3B 5AW4B 1FZMB 2PW1A 3I6LD 3VFUA 4YFLI 2AFNA 2LVCA 1Z9SA 1AR2A 3MFFA 5J13C 3QEUA 4NNXA 4W6WB 3VFTB 1DQDL 3N1QC 2NZ9D 3L3DA 4C56D 4G80A 1OF2B 3L4TA 1LYQA 3R19A 1NGWB 2Z0UA 3VGAC 4IBWA 1PBYA 2FUTA 4YVNA 4A7GF 2ZOKB 2YBRA 3B34A 8FABB 1ZTXH 3MGTA 1BPVA 5JOPE 1D5IL 2CDEA 2ZG2A 4NXSA 5BXFB 3KXFE 5K93A 5IIEB 2XFXA 5D2LF 1OE2A 2IAMA 4BH8A 4XNDA 3IDYC 4EZJA 2C7UA 1PGRB 3SQOL 4PD4K 3VD9A 3NPZB 2QZQA 5E8DH 1KCVL 2VW4A 1GPOL 1TPXB 1ZEAL 2XVGA 1NDMB 5MENA 3VH8B 1UXMA 1XF4A 4OAWA 4OFQA 1BZ7B 4WI7A 4WY7L 3L1GA 3EGXA 4HZAA 4XC1L 3F65A 4O2EB 3QPQD 2R29L 3AY4A 1C5BH 1NMCB 3BX7C 2BMKB 1O6SB 1X9LA 4A2EA 3NJVA 4OV5B 2Y7OA 1H8NA 1X5IA 1GSMA 1IKFH 3GSXA 3IMWA 2PP9A 4QRRB 4G83A 1FO0H 2MQ3A 5D7JC 3BQUB 5E8OA 1IO4C 4AEHH 4DGYH 2NQCA 4GSQA 1ILSA 3ZTNL 1CICB 3MACH 3FN3A 3DV6A 2HTLD 5J0BA 5D2LE 5EEYA 5DJ0B 1HHKA 4RESB 2QHLA 1MCPL 2H1LM 1NBVH 1KIUA 2RTTA 4KMTH 3A5VA 5DQ9A 2BNQB 3EDJA 3FRUA 4FNQA 2WZPA 3UTQA 3RY5A 1R3LA 4Y89A 1QR1A 5CEXB 2J5WA 3NDYE 4DEPC 4ZNEE 1NBZB 1FL6A 1WX2A 4LBEA 1YN6A 2HWZH 4XHJD 3F6LA 5FWRA 2ICEA 5AVUB 4AYID 1A4JB 1YEWA 3K81A 1U2YA 3VE0A 1MFVA 4K0OA 2VLME 2R0LH 3TZVD 3WD5H 3ARRA 1L7IH 5JIMA 2JKIS 4N2GA 5F3HB 3W2DH 3LRKA 3CSBA 3QRBA 1LK3L 4DUXA 3JTSB 2WGNB 5SX5K 3HC0B 3TFBA 5C0EB 3IGAB 1YEKH 1ND0A 4HIHA 2DQFA 1JNJA 4KDVA 2VWEC 4HKZA 1NBCA 5JYMA 3ULVL 2DYRB 1BG9A 1J0IA 4M6NH 1X5LA 2CIKA 1KB5B 4C4KO 5ALCH 1I85C 1DVTA 3W5MA 2B9BA 5HI5D 3DXAE 1OARL 2YPLD 5FM8A 2NQDA 4GY4A 1GGTA 1Y07A 2ZKWA 4MAYA 4OZFG 4A68A 4GIOA 3GMMB 4KRMB 1JF6A 3U9UB 3OQ3B 1MWAA 4LRIA 4G9FD 2XWJA 5GGVL 5HDQL 1EUUA 3MLUL 4QF1B 2ITCB 5G4NA 2BS8A 1A9VA 2Z7YA 5C0CE 3Q01A 5JPNC 5IMOB 1QPXA 3IWUA 4UT9L 4NUQA 2W9LA 4OD2A 1OTUD 4LEOA 3MJ6A 3TU6A 1S8DA 3U82B 4GSRA 2EACA 4B7IA 1NJ9B 3FO9B 2XXGA 4R9HA 3HAEG 4EXKA 3FHQA 1Z7JA 1XB3A 2CR0A 3CH1B 5CR1A 5EFIA 3TVMA 3V0WL 2ZX8A 1PX4A 3EOAB 3RWEA 3SDDC 4LLYB 5T3ZH 2IADA 5LUMA 1I9RL 5F1IB 1KZQA 4QO1A 1HXYB 1NUGA 4Y4FA 1SXSA 4QRSA 1Z9PA 3GXNA 1J1XH 4OF0A 4HS6B 2GITB 2F74B 3MLWH 2V9RA 1TVBB 3WS6C 1KBKA 1MCOH 4OZFA 4QT5B 4B60A 5IFAH 3BJ91 3DOSB 5D71H 4Z3EA 1VKXB 5DT1H 2I9TB 3VXNA 2H6PB 1UWFA 1I8MA 3RJDA 1AZVA 2RCSL 4MD4B 2Z8WC 1OP3K 1IILE 3ZL4L 4I3SH 1HHJA 3MI6A 3JWNG 3M17A 1VB9A 1A6AB 5TPWL 3MOAH 1UH3A 5DFWH 2XWCA 2BCKB 2CO7B 4Q9CA 3OXRA 2HLFD 1KXVA 1MRDL 3S8GB 3PQYD 3MV9E 1RZKC 4WWKA 3BGAA 5I6XB 4YR6B 5DJZB 4P06A 3N41F 4Y9FA 5AVQB 3VFMB 2Z34A 5E7BA 1NEPA 2EIZB 2JSFA 1XGRB 4PP2B 1KLGA 5EU5A 3WHXA 4BKLB 4NJ9H 5F7LB 4APQB 1QSED 2VZ3A 2DV6A 1MWAH 1KACB 3PDOA 4LRNL 1JSYA 1I7RB 3DVFA 4KKLC 1CG9A 1QSVA 4OZHA 3KPMA 4UNTA 2WTRA 2WZ0A 2XHNA 2ARJA 2EJ1A 2Y7SA 4I77H 1U3HD 3VDCA 2OKMA 4DKFH 5CKAA 3ZDZF 4L4VB 1LO3L 5D7IB 1V7ML 3HHMA 5DC0A 2MFNA 2A6JA 1J10A 1ZTXE 4JCLA 2VDKH 1S7WB 2OSLB 1KDJA 1JFQH 4K94L 5ICXB 2CO4A 1CFSA 1O0VA 4ZOCA 3ZKXB 2VZVA 1K8DB 3KLLA 1RUPL 4HJTA 4NP4H 3UTSB 1UZ6F 2BNRB 1FLRL 4G1EB 1YY9C 3NK4A 4L8BA 3QXWA 3NIFF 1XR8A 1HSAB 4OZFH 3MCG1 5GGVY 3TASA 1WBYB 3AX0A 4O00A 2FRGP 2X89A 3S96B 5LB1A 1IAII 2FZ3B 2HPOA 1PQZA 5GJTH 1XH3B 2WXHA 4UB0L 4B9PA 3QDJE 5CHNB 5CLZA 5AW1B 3UL4A 5FAAA 3N44F 3HC3L 4EE2A 2ZJSH 3GXTA 1MCNA 3V0FA 1NAMH 4ZX6A 5BQDA 3DVNA 3ZDZE 2QQNH 4H8QA 4I2XE 3NRPA 3HAEH 3O9WA 1KTCA 1A6PA 2J20A 4OZGA 2MCAA 3DPDA 3S2AA 1OAZH 3KGSA 4RDBA 4B7LA 4C4BA 2PO6D 1QATA 3QZNA 1B90A 1QLEH 5DRXA 2FYYB 4WO4C 4BFNA 2EXTA 1UZ6E 4WFFD 4FTVD 2ZXDA 4FXKA 2PKDA 3NIFE 1A1OB 3GLZA 3MBEA 5EIIA 1D5BA 2JIXB 4PLJC 4K15A 1FIGL 1K3ZA 4OUAA 1UGNA 3ML9A 2JK5B 2EE0A 2AXFB 1JBJA 4P2OC 3JWNH 1VACA 2VDMB 2F54A 4NXKA 2C9XA 3E80A 2MSPA 5B39G 4ODXB 3ZT7A 4MQXD 2YKLL 1FL3A 2TSBA 4ZFZB 1I82A 1N7ML 4PJ5A 3BXNA 3HN5A 1INDL 2R2EB 1KJ2H 2ADYA 3SDAC 4XPHH 5D96C 5K39A 5C07E 2D3VA 4CSSA 3SDXA 5CEYA 5IOPB 3T4AB 1TZOA 1J12A 4ETYA 4KBPA 4OCLC 4APXB 5H4YA 1YECH 4LSSL 1Q72L 1NC2A 4M7JH 5GRJL 5I1LB 3WJMA 4JPIB 4GXVL 3VRJA 4LHUA 4PJBB 2LV4A 2W60B 1DVFA 2AJ3A 2WXPA 4HHGA 4O2CB 4YHKL 5KYNA 1WTLA 3BGMB 2DI8A 1CFQB 2GY5A 1U36A 1AGFA 2X4TB 3RWDA 3QJUB 4CGUB 4L3ED 3ECQA 1JWUA 1ZJBA 2UZIL 4R96B 1CXEA 4FCHA 5I8KL 1Z3RA 3S35L 5JHMA 4GIAA 2QLVB 4S2SA 5B39A 2QV2A 4JGJA 4N2EA 3AU1B 4FKKA 4UZUA 4XCYA 1MXDA 3DURA 4LL1A 5T1LB 3TGXA 5IG7A 1N68A 4E9QA 5BV7C 1KCUH 2X44D 4GW4A 5GQBA 1SJXA 4KAQH 3NA9L 5CN1A 3SDYL 4AY0A 3DX4A 3EOBB 1N5YH 2ZG1A 2VTFA 1K6QL 3V6OA 1BVNP 2EO9A 1C5DB 4F37F 3TONA 2CHDA 1IM3B 5JHDA 3VXQA 1TMQA 2OSWA 3EO9L 1P4BH 2A6KB 3DDGA 1INEH 1BAFH 2Z4QB 1A5FH 1EJ8A 1AQKH 3ESPA 2E7LC 1OCZB 3E8UL 4I18A 2AAAA 2B1HH 3PHOB 4XNZC 15C8H 5T3ZE 2ZOTA 4JMXA 2PPAA 3KYOA 4N2IA 3BE1H 4OBRA 5KN5A 4J4PA 3NABL 1AI1H 1U8MB 2OS7A 5J12B 3ECBA 1PNDA 4RMSA 4GKNB 1A2YB 3ABZA 1UJ3B 2DM3A 3B56A 5DO8A 4AM0Q 4GO6B 2D31B 4LPTA 4R5TA 1QSZA 1J0HA 4EN3B 2DQIL 4P2RD 4EOWL 1EDHA 1FCCA 3LH8A 5EWIH 5T8IA 4QAMB 5AOZA 5A16B 1EEUA 1JZDC 3KPPB 3VQLA 4FADA 1K5NA 4D8OA 1M3IA 1I1AD 3NSJA 1V3JA 4OV6F 4M4RB 5E8EB 1QLFA 5PCYA 4E41A 1LO4H 4MRCA 1A1MA 4JBSA 4PLOB 3KHOA 2HVBA 3RFRA 5AOJA 3KJ6H 2B5IC 4RSYA 1CXLA 1JF1A 3NN8A 3F6JA 3AUWB 3NZSA 4HIPA 3GXPA 1U8HB 1U8CB 1MCBA 2Q76A 2UWEF 2XZCL 3VXTA 1I3VA 3EFDH 3D18B 3D5OF 3QNYA 3QAQA 4FEIA 1ESOA 2D7TH 4GSXA 1XFPA 2B20A 25C8H 1NCDL 4KPHL 3EJQA 5DK3A 4PJ9B 4CMMB 3E6HB 2VO5A 1F6AB 3H6AA 3LMJL 3C5JA 5FUZH 1FNGA 2E7MA 4JO2L 1A6ZB 1OIOA 5HHOD 4G6FB 4QYOB 1VF5C 2F8IA 2YPVH 5DJDA 1RIUL 5GS1B 4JHWH 4WWPA 4NKOB 1R3JB 4YXHL 1NDTA 3H0TB 1YPZF 5AWNL 4NWUL 1TTBA 1GOHA 2AZAA 4B53A 2FJUB 1AXSA 2NY1B 3BLPX 1J87A 4Z7QB 1RZKL 1U8NB 1UXSA 3QDMD 5DD3H 1FVCA 2FLBT 4H25B 5LN8A 4OTXH 4ICXA 5KSAC 2UWEE 1A4BA 2XXMB 4UINH 1I9IL 1UG9A 4G70B 5FHBL 4KWUA 5ERWA 3S4SG 1IEAB 1XGTB 1SHSA 4LSPL 1EXGA 4EN2A 1PZUB 3MV11 1XIWB 2ZCLH 3DWTA 1CLCA 1OWRM 3QIBA 5K9KA 1QVOB 3LHPH 4BM7A 3TJHC 3KZ8A 1P2CB 3K0YA 2RFXA 1ZLWK 2EDYA 4J1UA 4YDJB 1WX4A 5EU7C 3AWTA 1B9ZA 2PTVA 4K9EL 1YPZE 3IJEA 3U25A 3D12B 3VFSB 3KMDA 5F1SA 1FNEA 2Q3AA 2VZSA 1M6UA 3OKKB 2JQZA 4MMZB 4AG4L 1E30A 3KBHE 2R4RL 5I71B 2XN9A 3O6KH 3N50A 3EUUA 1QQDA 4HD5A 4NQED 4PTTB 5DDHB 3QNZA 4JLRB 4H5SA 5F1NA 4ZMXA 3MLVH 5B38G 3UO1L 1CGTA 2BVEA 1T1XA 3EH5B 2VQUA 2CLRA 3JWNE 1ET5A 3FT4A 1K3IA 3GIVA 5D2LB 3FUHA 3X11B 3EH1A 4QHKJ 2LLLA 5FYKU 3AJ7A 3QWRD 4YFDB 2FJHA 4EF3A 3M46A 4GLRH 5CBAB 1XSIA 3K4DA 4JO4L 4PR5B 4K3EH 4LPYA 4KXZI 4ZSOA 3T0EE 1USQA 3QRFM 1MPAL 1SJEA 2GJ6A 1T83C 4BSWA 5DEFB 5IM7A 2P5EB 3O6LH 1AJ7H 4HBCH 2OZ4A 5KSVA 5A7EA 1EO8H 4ONGL 4HD7A 3MNZA 1SYVA 3W37A 4ZFQA 5BZDB 2ZKXA 4N2CA 4O51A 2A5UA 2HT3D 4XN7A 3WEBA 4WNQA 3ALWA 1R19A 4F7PB 4LKXB 4MYPA 3AQZA 4DP9X 3B8YA 3TTSA 1XMWA 1HX0A 4HFWA 5J4MA 2NR6D 1OAQH 5B38A 1AZCA 4U1LA 1OXYA 2X5PA 2EE3A 5HJBA 4DVRL 4R7VA 1WITA 2GCYA 3Q6GL 2F1AA 4BSVA 4BGDA 3EYOA 1EHAA 5JIQA 3IFPA 3OHMB 3PIQB 3QAZC 3NQ1A 2Z31C 4HKJA 2V6HA 3VWKC 3S34L 2JJUA 1PSKH 4WKZB 1J9QA 1JNHB 1BD2E 2ZOUA 4L29A 5ICYA 3KM1A 1CB4A 2LU4A 3PP4L 2ATKB 4DK3A 2O61B 4ZDHB 2AJVL 3HG1D 3OKNB 1Y6KR 3PP3K 4HIJA 1W8OA 1R3IH 3TA3B 1KCLA 3FCUB 1A25A 2CD0A 1N6QL 5FKPB 2EP6A 3DXAB 4D3CL 3RAJL 3L3IA 5FK9A 4L1BA 4XXCC 1GS8A 2FX9H 1A9EA 1AH1A 1QASA 2VE6B 3K7UA 4JFFE 1IGYA 1JRHH 4Q4EA 3TP4A 4LVNB 1NIAA 1DEEB 3HZVB 3BWUC 3FNKA 4JFWA 2E27H 3CIQA 5HHME 5C0CB 5KVDH 2D3JA 3FQWB 2XYCA 3BZEB 1VDGA 1KC5H 5DUBB 5EULV 4AL8H 2IOOA 3NQIA 3KLHC 4K8RC 1ETJA 1G4MA 5LAPA 4F2EA 3RBSA 1JZGA 3VFNA 3H42H 4QTFA 3H9SD 3O3BA 3FU9A 3SKOB 3A6OA 2WBJC 3MPCA 4WI0B 2RHEA 3FDWA 1BXVA 1KYOJ 1UT2A 3DSNB 3K2KA 3OAWA 4YLQT 3QUKB 1Z5HA 3AACA 1KJ3H 2DWXA 1HNGA 1IJ9A 1ES0A 4O02H 2P44B 1AANA 1RZJH 5EV7A 2AJYL 4IBYA 2XBZA 3ARBA 2XTJE 3IJHB 1EFQA 2MTPA 1T6VN 4PIBA 4YDZA 3ENEA 4LVHC 2IBZY 5I5RA 1WBXA 1BXXA 2Q7NA 3NFSL 1ZA6B 5J3HC 1KV3A 4ABUA 1N0LA 4J8RA 4DP7X 2RA1A 1Q9OB 5K69A 4PWGA 3F3HA 3WIAA 1XCXA 3U0WH 5AAWC 1XR9B 2E3VA 5JHDE 2UVFA 4IBQA 3DECA 5I23A 1FFNA 5L0QB 4OJFH 4DIXA 3I02A 2WXFA 1G7IA 1E9OB 3C08L 3MOBL 1EHXA 5IQLA 4XP6H 4NSKB 5T1KB 1CXIA 3NBNA 1I8KB 1JPFA 3T0WA 1H0DA 4NIYE 4WI8A 3SD5A 2V0AA 3TT3H 3B2DC 2Z92A 5I73B 1M3JA 1SOQA 2ZOWA 4M5ZL 2P8LB 3HG4A 2HRGA 3AT9A 3WNPA 2EUVA 2WYTA 1MAJA 4Z8FL 4OFPA 4M8QB 3C5ZD 4N90E 1TIUA 3FSVA 1S9KC 1VCBC 3L2NA 4WI2A 2BHFA 4KKRA 1CGSH 5E99H 5GS0C 3MR9A 1SXBA 3RX5A 1QR4A 4U1NA 4N2LA 1DVQA 4Y1AE 2PXYD 3KE0A 3QHFH 3T6QC 3N41B 5ETUB 2O72A 4F7TA 3MUY1 2NY2D 4BQCA 1IAMA 2UVEA 2VSMB 2WTPA 2X4PA 1C08A 2YUZA 1ECYA 1QACA 3ZE1B 2IAMC 1A7NL 3N42F 4QRQB 4HAFA 1VAHA 3NESA 4HH8A 3UPCA 1EUTA 4GQ9L 1EMTH 2Y06H 3GLAA 1FH2A 1J5HA 3QDJB 3EHBB 2WP3T 5C0BA 2KYIA 1MDAA 3DMMB 1JPGA 4I4WB 1WFMA 1ZK5A 3V52L 1J5OH 4PV8B 3G5ZB 3D0VA 3ZXAC 3P1VA 3BEWA 4W4OC 4E42B 1BQLH 1WGVA 1O9WA 1FO0B 4MDIB 5EC2A 3AY4C 2PTUA 5KBLA 2BERA 3GF8A 4NKDA 3FCTA 4ZOEA 4HOZA 2QGCA 1K8IA 4WU5A 5FYJD 4UOQA 3S37H 5SX4H 3GLDA 3F2LA 3GBNL 4JY4A 2EXSA 2XJLA 1IGTA 4KQ3H 3U0PA 5HVHB 1MCWW 1ZTMA 4NQXA 5T3XH 4B27A 1NCCH 3RPKA 4ZX5A 3UIYA 2J7LA 4I3RL 4WUUD 4XNQB 2J4WL 4KNSA 2LVEA 3NJIA 1IGML 2ZICA 3KG5A 4LSTH 3BLBA 1FYHB 3DX9A 1JZ2A 2NXYC 2HMIC 3WL9A 1OAYH 3QJOA 43CAB 1WZ1L 2HLAB 2H2SD 4JR9L 4RLDA 5AYUH 3C5SA 4H26A 5C08E 1RXLA 4H0HB 3GSQB 1GR7A 4MA1C 1PPIA 5EU4B 2WQWA 3V4PA 4DP8X 5JW4Q 3R8BB 4R2GD 2ERJB 2ICEC 5C07B 4HWZA 4ZAKA 4XPGL 3FB5B 2WIMA 5JZ7C 4LAJH 1XGYH 1QLRA 5HVGB 4DKDC 3RFZB 3ARSA 1S9XB 4XMZA 3WE6B 3MLXL 4L2YA 1BOGB 1CZ8H 2DN7A 3Q44A 4CJ1A 2YGVA 3QJHB 3IM1A 1TU2B 5JO5B 1JS8A 4RRPG 4PLKC 5JXEA 1U8OB 1IB5A 2XQBL 2JKLA 3QUXB 4QXWA 4U0QB 3T2NL 1PZ2A 3COOA 3RWIB 1IM9A 4JFEE 3VXRD 1DFBH 4K9JA 4F3FA 5KBKA 4LCUB 1HYSC 3CSYB 1XL6A 1MAMH 4OLVH 2NY0D 4ONHA 1JG9A 2OL3H 3BUTA 3V0JA 3F12B 3ZGIA 3UP6A 1A21A 2NY4C 3P0GB 3RE0A 2ED8A 4W9EC 1D9KA 4GBXB 4U4BA 2IWFA 4XBGA 1ORQB 2YD2A 1X5YA 4X9HA 3PF2A 4C56A 3RWCB 5KVDE 4K3DH 4MAYC 3MJ8A 1V10A 3ETBF 3L9BA 5JLZB 4JRYD 4JX0A 4LRIC 1T7XA 3DHJA 2OV0A 4MB1A 4FQ1L 3DVGA 3RKDC 2ZCKL 4NZTL 4RRPA 1G6VK 3L3JB 5C0RL 3TBWA 4LNRA 3QBTB 5IB1A 1L6PA 2AEQL 4OLZL 4Q74A 5DI8A 1CFBA 5AYTA 2WLLA 4BUQA 2AQPA 3V4VL 1RP9A 4Z3GA 2X4RB 3Q2NA 3X3FH 5GGRB 4FERA 4JO1L 3TVMC 2VC2H 4N0CC 1XD1A 3T2OA 3LS5L 1EJOL 4ALAH 1BZQK 1YEGH 3V6ZB 3CFJB 4KZEL 2L0DA 2RGSA 2NY6D 6TAAA 5SWQB 5KSUA 1RU9L 2WUCH 4PP1D 4FNLL 1JZ3A 4JRXE 1YUHB 1U8JB 2ARJQ 4CDGC 4FXLA 5HYSG 2LT9A 1U58A 4XNXL 3UAAA 5I5IA 1G5GA 5FOBB 5DK0A 2QSQA 1RJYB 4FRWA 1E5ZA 2DZEA 3CJJA 1BF8A 4XVJL 4I1PA 4HWUA 4OVVA 5I1HL 5GJSH 2YD8A 2IDFA 4YL4A 1ETZB 4K8RL 3K3QA 4HIXH 4NNYB 2QGBA 1OY3B 1FAIH 1KXVC 3QZOA 4KJYB 5E1QA 3SYOA 3CN1A 2YSTA 3T0DA 4WWKC 2WLYA 1AS6A 2EDDA 3IS1X 4FFTA 4HHAB 3MXVH 2JXMA 3HI6H 1Q9KA 1RULH 3IDUA 4H7VA 2ZP9A 1VFUA 4J3UA 3ETSA 1ZTXL 3MRNA 2J1XA 3NA4A 1A3LH 2HJLB 5FOJA 5HYSA 4WV1B 3WN5A 2BW4A 3KLSA 3D3VD 2WVUA 4AK1A 3P4LA 5E8DL 4RMWA 1XGUB 1ZXKA 2I07B 2R0WH 2VDKB 4QHMA 2VDPH 3S98A 3ROLB 2IGTA 5GXBB 3C8KB 4LSRL 1L6ZA 5HGDB 1J5CA 4BQBA 3DARA 3KDMA 5L2KD 1L6XA 1RV6X 3U1PA 3QQ4A 4LLMB 1SLXA 4WTWA 4I85A 1UM5H 5D1ZB 3UAEA 2H6UA 3ARPA 1BX2A 2X4SA 5LHDA 4FI7A 1IGCL 1P0SE 4L0PB 4JS7A 3L8QA 3O6FD 5C7ZA 2WNWA 4M3JA 4CVXA 4E9WA 5CJQH 2Y5QA 4HWEH 3AQXA 4OGXH 1UOLA 1NZRA 4AEHL 4DGYL 4EI6A 3K71A 4PRAB 1NAMB 4M1DL 3KPSA 1SQMA 3P3SA 1PX8A 4L8CA 2FSEB 4PYGA 1MRCL 1CGWA 3HAEB 4PJ6A 3WN6A 3LN4A 4IMLA 4PJDA 4XVUD 2VL4A 3BT0A 1RPQA 4EUPG 2CJUL 4KMTL 4BV1A 3D39A 1YPZB 3O9WC 3CZJA 4GINA 4HAGA 3QCTH 2YGPA 1GC1C 1TCMA 3RBGA 1SN2A 5GS0L 3P3RA 3FB6B 3FO1A 4LLUA 5T3XE 4JM2F 5E0QA 3KPQB 2P5WA 2HWZL 4Z78B 3D06A 4ORGB 2H1PL 3OMNB 4AMKH 4WW1B 4ZMWA 4Z77A 4FXKC 1ITCA 1NDGA 1TG8A 4R4FH 3S6CA 1WEJH 2YEZB 3WIHH 3MBEC 1Q1JH 4FFZA 3SY6A 5E2UH 3OAYK 1MFNA 2C3HA 4H44C 4D9QD 1BVOA 3EJZD 5DU7A 1L0PA 2ZE0A 4OGAD 1JHLL 4GRLD 4NKMA 1OAUL 2WNGA 3CX5K 5CWSA 1RZFL 4Y5VA 1HCYA 1I1RA 2AKRB 4PRID 5GRWA 3X17A 1KJ2B 5AD0B 5BQ7B 1WCBB 4X4YA 3MRHA 4JZJC 4G8GA 2ZSWA 5AB0A 2XIIA 3INOA 4QJ4B 1UKTA 5FYKH 2C3VA 4QHKI 2G75B 3OWRA 4UDUB 4FQHA 4JAMB 4LU5H 2JV6A 4M6NL 3U1SH 3Q5OA 4ZUSB 2C9UA 3O0LA 4GLRI 5EO0B 4J3PA 4WSGA 3S0PA 3RZCB 4F2ME 2D4DA 2KZBA 3IFLH 1X7TA 2PCYA 1CN4A 3GMRB 4X50A 3JTBA 5DJ6B 4UAHA 3WEOA 3L17A 1SXAA 2GIYA 2VKXA 5D1XE 3K80A 2PMZA 3P9MA 3LKRB 4QWWC 3JT2A 5HHXL 1DVFC 3MRDA 1ZDSA 3EGSA 2D4FA 3TO2A 1BM7A 1J8SA 3T1FB 1N26A 4EZMA 4QGTA 5ID1B 5H2BB 4X5PA 4LP4A 1BD2B 4W9GC 3WELA 4J39A 5D1QE 4LOVA 4N6RA 4ZTPH 3T5WA 2VITB 1E42A 2AV1B 2VMJA 5IQOA 1TR7A 4AQAA 2YR3A 3ERXA 3G5YA 3JWOC 3KNBB 4EZKA 3MRKA 3RJQB 4JJ5B 5K9QG 1CDUA 3HNVH 4I9WD 1MFEH 2EZ0C 2GT9B 1CFNA 4YBQD 5CSZA 3VAEA 5AKSA 4EI5A 1BYNA 3V6OC 1Z5YD 1GH7A 2JKXA 2V2WA 3FT9A 3VFOB 2E9WA 4ELKB 4JFFB 2C7FA 1HHGA 1KPVB 3TF7C 5IFAL 3R0NA 2UYLA 2DQEH 5DT1L 2KUTA 4FABH 5C6TH 1CFTA 1J8HE 3HZKA 5DHVH 4U6HA 1Z32X 5C09A 2JB6B 4I3SL 2VUOA 4MA3A 4UOW1 1U8IB 3QJFB 4I18C 1A6UH 5IGXH 3STLB 1B2WH 3ET9F 4MJIE 4P5MB 3MOAL 2ZT9C 4GRMA 3QNXB 4OIIH 3TA4D 1JRHI 2CAKA 3H53A 4EUPH 1KN4H 4IKLA 4OJDH 3TF4A 3HI5L 3LNIA 5DGQA 4J4PC 4OW6A 4C4UA 4K73A 1PKQA 3K72B 4AYFA 5E51A 1UWXH 3AY2A 5EN2A 3CIAA 2OMWB 1ET8A 1EV2E 3CFBB 2X87A 2VMCA 3KPLA 1X9UA 3EO0B 2LOEA 1XH1A 4Z5RA 1BVLB 4FFVD 5FV2A 3WCYA 1KCBA 3AABA 4W9KC 5SWZE 1SLUA 1MWAL 2QVTA 1T1ZB 4Q0XH 5KG9B 1PU0A 1WA2X 1WA0X 1QBAA 2QEJA 1WFIA 2A0LD 2BIOA 1D7FA 1Q4NX 3BKML 2WWNA 5C0DA 4P0DA 2DD8L 1AMYA 1S9VB 4XP5H 1YDPB 4DKFL 4I89A 1H6UA 1GGBL 4W81A 3S36L 1F45A 3LEXA 4OGYL 3I9GH 4OZ4A 5KUMA 3MRBA 5D9SB 1D6EA 4L4TE 3ILQD 1P1VA 1TTCA 3GHBH 1JFQL 1R5IA 1EAPA 4HUXA 5F3BB 1DTUA 1CR9H 3UTZB 5ID0B 4Z3FA 4PJ8B 4NP4L 2KZWA 2CR6A 2BSSB 1BQHA 2EIJB 4O5LH 5KS9B 3BN9D 3NUKA 3S3JA 5ADPH 4WFGD 4JO8A 4GKOA 4AKOA 5I76A 4GUPB 1U21A 4PV9A 4TSCH 5IW1A 5E8PA 4N2DA 3SPJA 1JZJA 4ZW7A 1MOEA 3I2CH 4LK4A 4PRBB 2WM0A 1F1AA 2QQNL 1SFDA 4M1CD 5DLML 5FYJU 5DF0A 3L5XH 4A6YA 1M7IB 1UZGA 4NEHB 3X14B 5FB8B 4YEEA 5I1KH 4YZWA 2QFRA 2VW7A 1A47A 2OXHA 4RX4D 1QLEL 5B1KA 1XZ0B 4IKIA 2XACC 3H2WA 1Z9LA 5EORH 3ZTEA 2GI0A 2P7TA 3SCMB 4M4PA 3P2DA 4R5VA 1KIPA 3QS2A 4FMVA 5MEOB 1GTNA 5GSRA 3BT2H 3BKJH 2ROYA 4HFUH 4JDEB 1R75A 3ARDD 3MA7B 2C3GA 1F97A 1CXHA 4JY5H 4RGND 1TDQA 2JTYA 2QVMA 2CGRL 3BH8A 5D72H 2YLHA 4HWBH 5DA4A 5K1JA 4FDWA 4EQ3A 4LPCA 4KKZA 1BFSA 1HQ4A 5KEZA 4Q9RH 4WI6A 2OTUB 3IKCB 3QIUA 4WHDA 4QHLB 3SE8L 4AYMC 3GZKA 2Q8AL 5TFSL 1BVKB 3SKNA 3QUYB 2XWXA 3KBPA 5K1NA 4J3WA 5C0GA 1A6VH 1HHIB 1SYSB 2XI9A 3CDGB 4U6TA 2LLGA 4WRLA 5IBLD 2ICWA 3MUGB 5HY9A 1YECL 4IGBD 1BECA 3VA2C 3CLFL 4M7JL 1B9KA 4IJTA 3W0WE 5FYKE 1DQLL 3P4MB 6FABL 2JI2A 5SX4I 1DBJH 3AS2A 4U6YB 5B7FA 5DURD 4ZNCD 3MREA 2V33A 3RGVD 4WFHE 5KZCB 1F11B 4MD5B 3AVEA 3D0LB 1IFGA 2H45A 5ACLA 2J1YA 3DX0A 3GSNB 5KBDA 1GC1L 4TVPH 4PW4A 3MRJB 4F91B 4DP1X 5BUAA 2HB0A 5LN4A 3BDBA 2ADGA 3KPSE 1KCUL 1UOKA 3DGCR 1IGIH 2X4QB 2BH0A 3FOLB 5EPMA 2CLZB 3TBSB 4U7SA 4KAQL 5I3AA 1FAKT 1N5YL 2N1KA 2V9QA 3IRZA 5TDOA 2PP8A 3TO4C 3DUSA 5TJWK 3APCA 4G7SB 2PPCA 4AVJA 3GUTA 5C6WH 3CN4A 1S4IA 1P4BL 1INEL 3DPBA 2UX7A 1A5FL 2ZIDA 3GSOA 4HV8B 4TKWA 1AQKL 4WFEE 5HHOA 2CUIA 4JFEB 5H8DA 3O81A 4Z7VA 4E5XA 2P5WE 2HFGL 3E7JA 5LWYH 15C8L 4HKBB 4MZIA 5CUSH 1DDHB 1KNOA 3QJQB 2BZ7A 2Y1VA 1R5WA 1TJHL 2WCPA 3GM0A 4IJ3B 1DZ0A 4OLEA 4IRJA 4KH2A 1NEZA 4P5KA 4YWGH 3S4SB 3UTTD 4K23H 3PRZA 4YK4B 1N8ZA 3H6JA 1AI1L 2JKJA 3FW6A 4ZPVA 3MZGB 3ATFA 2VERA 3IE4A 2UY7A 2ZOOA 1SRDA 4W9LC 4RQQB 3U4AA 2P8PB 2YAOA 4AIZA 1S7SA 1B3JA 2ICWJ 4YGAB 1ZHKB 2X9WA 3D30A 3QA3B 2JJVA 5EWIL 4G8GE 1A6WH 1SN0A 4AEIL 1I8IB 2D0GA 4NERA 1ROCA 1ACCA 4U6VH 3ILEA 2DQCL 4ODVL 3VG0L 4OLWH 5HYQB 3TJPA 1GMIA 2NXZC 6PAZA 4LLQB 2VUYA 2C4XA 1RUAH 3BW9B 1LM8V 4HUVB 3KJ6L 5H37G 4Q14A 1E5AA 5BS0E 4LLAA 3WJJA 3TNMB 4TTDD 4O02B 4NRZA 3MXWH 4XH2B 5C0FA 3JWOL 4O58H 3VSUA 5JA8B 1JGEB 2BCMA 3GMNB 3SQRA 2Y1YA 2YD9A 4JRXB 4NQEA 3VJ6B 4GKSB 5E4EC 4FFYA 3WFZA 1AP2A 1OB1B 3RGBA 2P48B 4JFHD 2G2RA 2BOCA 1JV2A 3CFEB 3ARBC 5FUZL 3G5XB 1FIEA 3QQ3A 3RPIB 5G2NA 5J13B 2IG2L 4LFHG 4MAUL 1S5IL 4JHWL 1NOAA 2Z1PA 2ZMZA 3ATDA 4X7SL 5FGBC 2Q6WB 3QWRA 2YKKA 4Q6YA 3VSVA 1P7QD 1QNZH 2E9GA 2WIIB 1Y0LA 3KLAB 3N9GH 2Q1EA 3WEXB 4PRHB 1V3KA 1ZK9A 1YUKB 2OJEB 2PLTA 5EO1A 5H37A 1PD6A 1B0RB 4E9TA 5DD3L 5C70A 4W9JC 3FH5A 1YJDH 4ZQTA 3IDYB 2DLHA 4X9BA 1VIWA 1Q94B 1ZV5A 4UINL 4P46A 2CDGB 3A6BL 3LCYA 4WEBH 4JKLA 1T7YA 2FDBP 4P5TA 4J3OD 1A1NB 4RZCB 1WHOA 2NR6A 3Q2LA 2CDFA 4GS7B 2BY2A 2OMNA 4O4YH 1IVTA 3G3LA 4OLXH 1WBZB 5IMKB 2ZTBA 4TM9A 1DVUA 2OYPA 3DRQA 5FO8B 1PKQE 4KJQC 4UDTB 3TCXA 1IC1A 4J8QA 4WU7B 1NM4A 5F7BA 4JFZH 1HE7A 2D2OA 3B6SB 1GJIA 3MCKB 3PCYA 3U46A 4GAGL 1UA3A 2SEBB 5FUCE 2DI7A 1TEFA 5DD0H 5INDB 2E74C 2CRYA 4N2BA 4BRJA 5MI0C 1F4WL 1X9QA 1JWSB 1TYEB 4AK2A 4K4KA 3VXMD 1DSFH 3WNMA 1G6RA 2YMTA 3UXFA 4UM9A 4JANB 3BOVA 3QUZA 2ENSA 1PL3A 2ZWKA 4GAJH 1QFUH 4CGTA 5IUSA 2GC4C 4YBLB 1T5KA 3MLRH 5DHEA 3UERA 1J9CT 1UYWH 1GOGA 4XI5C 3G08B 5I0XA 1OPGH 3WAKA 4WCYH 5F89A 1BZ9A 3ARWA 5J1SC 4DEPB 2PNDA 1YYLH 4FG4A 4BE5A 3LXBA 2VDQL 3LKQB 3LVTA 3RVTD 3O6LL 1N64L 1AJ7L 2PWGA 4HBCL 1P9MA 1QEXA 4TLTA 1AD0A 1J8KA 2AHKA 2AANA 3VQ2C 2BC4B 2VDLB 3FCBA 1KBGH 2CBTA 3RVUC 1G9HA 4EBQL 2DWTA 4XT1C 2XYBA 3VRIB 1BZ8A 3NACL 2LFGA 1MRFH 3C60B 3M1CA 2MHAA 1FGVH 1MLCA 4F8PA 3B37A 2W07B 5CCKH 5E23A 4F80A 2DJMA 2BFVH 3IBOA 1AC0A 4HP5A 1A64A 2BVQA 1E8WA 3AWSA 3TNNB 4ANWA 4TVPE 1BXUA 1RVFH 1CD0A 4XAWL 2OJZH 3EXJA 2NUTB 4NC1C 3SKMA 4J12A 4CBPA 3MBWA 5F0LB 4G7YL 4GP4B 2Z4TA 4JDZA 1DQJB 2H2PC 3OGOE 4X7DC 4G43A 2XLLA 3IJ8A 2PPEA 4JL2A 5DD6B 1LMIA 1ORSA 3BGFB 3GEFA 1R3IL 1LVEA 3D52A 3HZMA 1ULVA 3FOMA 3CZFB 1HOCB 4JM2B 2ICES 4ZAKC 5JPNB 1G9MC 1VADB 2X3CA 3C9NA 4P23C 4F2MB 2Q8BL 4N0UB 2FX9L 2ZAIA 1T5XA 4RWHA 1OGAE 5CSGA 4KGLA 3B3BA 1JRHL 5TD4A 2KKQA 1YNLH 4TNGA 3LRMA 5I18H 2DYSB 2ENQA 1KG0B 3C6LA 5D1XB 2P43B 2OL3B 5JXEC 3CSTA 2E27L 2K78A 5KVDL 3N43F 5KVFL 3HR5B 2BWIA 2FL5A 1LEGA 4PJIA 4AL8L 5IHWA 2XV6B 3ARYA 1PG7H 3SJVD 3SDDB 2R7EA 2YSSA 3Q8FA 5C0AE 4ATTA 2WZAA 3FU7B 4GW1B 2C1PA 1XMEB 3H7LA 4H20H 4CC0A 1X44A 1EVTC 4AXWB 3I75B 2OZ4L 3C5ZA 2KDGA 3SQBB 3OR7B 3VCLA 3EYQC 4U6XB 4CU7A 2HG5A 4YDKH 2D8KA 5DS8B 1Y1DA 4FG6D 4E2OA 3FK3A 1CLOH 1QRND 2K45A 2Y22A 3FQXA 4LF3A 4S1RH 5LNDA 2JCWA 4NQSB 4QTHA 2PW2B 1JS4A 2XNAA 4YUEH 3U4EA 5JTWA 4WW2A 1KJ3L 5LQBL 2LE9A 4DVBB 3S3CB 4HUKB 1OAXH 3F7YA 3ARGB 1J8HB 1BCIA 2VC2B 1DQVA 3WTYA 3BRDA 3QI9B 3RL2B 1UEMA 5MP6H 2XU9A 4HEME 4MJIB 5HDRA 4MWFB 1TZHB 2FGZA 4N2MA 1CQYA 3BD5A 1MUJB 3U0WL 2DKUA 1VFAB 1NFDF 2CA3A 3QZLA 4M6ML 5EF2A 3IDXH 1NCWL 2K3HA 3H1ZA 4Z7UF 4WTZA 4ZTOH 1KEGH 4PCYA 5GZOD 4JKKA 2EVGA 5CD5D 4HULB 4UTBA 3BPNC 3ULVD 4XP6L 1XD0A 1HU8A 3BUIA 3O6MH 4PRPA 4CJ0A 3TT3L 1ZLVK 1UB6B 2HTLC 3PABA 1ETB1 1GCFA 3VYPA 3IGUA 4HD9A 3GXDA 4DOHE 3GTVA 4QD2E 4WEEA 4D7PA 3FQYA 1EGJH 4KZCA 4ZD3H 2B7DT 2E4FA 4FGMA 4UIMA 4IOIB 3ECWA 3L08A 5DRZA 5E99L 4G6AD 1NFDE 4XP4H 3TN0D 1RFDH 3HE6D 4FQXB 1IQDB 2XG5A 3WNIA 3RZWA 4IBTA 3FTGA 3QHFL 4OF6A 2ZMYA 1RZIA 3F64A 3PL6B 4Z7UE 5KBMA 3ZTDC 4ZS6C 4F9LA 3DO7B 4N8VB 2VDPB 4TUOA 1JDCA 1KIQB 5EHFA 1XQ4A 3WN5C 4UAOB 1R6VA 2QLYA 1UFUA 1SXCA 3IETB 5CEZL 2DTSA 3VU2A 2XN1A 5IW3A 2VZOA 3DHUA 3CMOL 4D9RD 2J71A 4GMTH 3RX7A 4FEMA 1S2EA 3RWJA 1H9DA 4G6JH 2CM6A 1S5HB 2ZOLA 1M05B 4X5WB 3IK2A 3VXRA 2HVKB 3A4FA 1BQLL 1BFVH 1ZWIA 1WS7A 4WWNA 2FJGA 4MA7H 3QQ9D 5FWQA 2W65A 3DX1A 5DEZA 1HL9A 3VXSE 2Q7YA 1QTSA 1U8LB 1CF8H 4DGIL 4NDMB 3S37L 3FFCE 3TYGH 1S7XB 5BOJA 1LEIB 3U30B 3L6FB 4KQ3L 2WLIB 3SYCA 1VGKB 2D7NA 1DLFH 4RIRB 4P2OB 4UTBH 1NCBL 3LNFA 1UKQA 5E1IA 1JXDA 3HG3A 1NCCL 4K5OA 4PW9A 1FFTB 2XZZA 4K71C 5JPMA 4Y9EA 2EDOA 2FAUA 1AXTH 5FYLH 1NGPH 4LSTL 3NPYA 1TLMA 2JJSA 2PYEB 4KK9D 5K9QI 4UT6A 1QUPA 1OAYL 1L9TA 4IKKA 2N7AA 5GGSB 4YHLL 5IB3B 5DEGA 1EANA 5IHHA 2VT0A 2O26U 1QD0A 5I0VA 2ZX7A 4RMQA 4PWEA 1AD9A 4N1CA 1MF2L 4Y4KA 4XCFH 4F37K 2NNFA 1T0MA 4FNSA 5L9DH 5KVMC 4N9GA 4WAFA 3OB0H 3WUWB 1ONQB 1XZWA 1H3TA 2E47A 1NMBL 3SPVA 1IKNA 5E6SB 2JI1A 3HS0B 2G4GA 4ZUUB 5ABDE 1L0XA 3FCSB 1G9NC 1QO3B 1ZT7B 2VNCA 1FJ1B 5D8JH 3ZZSA 1CZ8L 4XVSH 5CZVH 3TFKC 3AWZA 2XTLA 3V5DB 3QFJE 2NT1A 3SHSA 3TBYB 4Y5VC 1NGYB 2ZUSA 2ZKMX 5K5YA 2DYPA 1E28B 2FECI 1MIEH 2OJ1A 2FHFA 3AWYA 3NTMA 2LAGB 3IFNH 3MGOA 4HGWB 5BV7B 2YD0A 4KRNA 1T7VA 2NY7L 1Y6NR 5T1MB 1HNFA 5AG8A 5L8JB 2HLFC 4QR7A 3V0VA 1DYZA 1YNKH 4P04A 2X70B 1W72B 2H3NB 3Q6FA 4HS3A 4K7FA 3RVWD 3ARED 4JVPA 4IS6B 4TUJB 3TXAA 2J12B 5DYFA 4PJAF 2IC2A 4IEFB 4P2AA 3KPRD 4EVNA 1KGWA 4XNZB 4OCRH 2K9UA 1MHCA 1E5UI 2WXQA 3DV4A 2AQ2A 3OC8A 5DZ9A 1S7RA 2LU7A 4NO0B 4RFOH 1DLHA 4WF7A 5IVXA 5IMLA 1TXKA 2YEVB 3GS4A 3NCWA 4YSTA 5BO1H 4MDRA 4AGNA 4L8SA 1IAOB 3NJJA 4NN6C 2PR4H 1KYUA 3BFOA 1MKFA 4GEIA 3L9YA 5IEKB 2VXVH 4IQHA 3X3FL 1NUNB 3TBTB 1BJ1H 1GVIA 1VZIA 3V4PL 4FG2A 3V5KB 1OLZA 1YEGL 2AAVA 2FGWH 1Z66A 3GMLB 2E56A 5TDPA 4KU1A 3OKMB 4EI5C 3QEQE 1KT2B 3MRIB 4U1MA 3O6FA 2WUCL 4WQOA 1O6VA 4PJAE 4PJIF 4X6EB 5DHVB 1G9ML 4ZXBD 3IDJA 1G7LA 4DCQA 1LD9A 4NENB 1AGBA 2WUBH 3V7AG 2XWBA 5DA0B 1PZBA 4HJGA 3BH9A 3ZHDA 1MLBA 2C9VA 3AM8A 3HW7A 1OE1A 4WEMB 4EUPB 2B5IB 2NX5A 1ZV9A 2VMFA 4MNHA 4OFDA 5FDYA 1H6FA 3STZB 5GJSL 4JFSA 5JORA 3QEHA 4QOKE 3REVA 4NP9A 4M8VA 4YL9A 5CCHE 5J9PA 1AMXA 3BWSA 1MG2C 2FE0A 2ICWI 4Y2DB 4OFKA 4M7KL 3AGWA 4RDQG 1EAJA 1ZVHA 2ZWFA 5BS0B 3LN5A 2VLJE 4ENEC 5CGBA 4PD4J 3CK0L 1NC4B 3HTLX 5IY5B 1IRAY 3IAPA 3HI6L 1LP9F 1BBDL 5FUCC 3KWVA 3KAAA 5IK3A 3L81A 3U6RA 5L4MA 4J3VA 3FQRA 4PJIE 3N40F 5JNYB 3SKJH 3U1QA 1K4DB 4XNUH 5CGTA 5IF0B 4AQ8A 1W8EA 5BRZD 4D8PB 2OTWA 2ORBH 5CZXD 2APFA 1BQSA 5AVYB 5AW5B 4YSQA 1LDPH 1DO6A 3FF8A 4FQJH 5JW4N 4XCCL 5SWSD 2R0WL 3GO1H 1AO7A 4HG4K 2IGLA 3WNOA 1NQBA 2EYRB 1OSYA 2ZUXA 2QSVA 5I0YA 5SV3A 4Z3IA 5JOFB 1UM5L 3B2VH 4MQXC 4U2ZA 3GJFB 1ZAGA 4PJFF 2WWMD 4TV3A 4PGEA 3WKMH 3WUZA 3WGVB 2X7LA 4MLSA 1LP9E 1OZTG 4HCGA 4XVTH 1LXMA 2WXJA 5CJQL 4H8HA 2A9ML 4JUTA 4HWEL 4GH7B 2W59A 3RWHB 4D94A 3BJLA 3F7VA 4OGXL 2WINA 4M3HA 3GIZL 3M1BB 1J48A 4J6IA 3IDGB 2NW2B 3SD2A 1KOAA 3MKGA 4YSOA 3GHEH 1JERA 3IJ7A 4HK3J 4IU2B 1MELA 3MV8B 5AVWB 1KTDA 4UUJB 2MCPH 3NFPA 1NGXA 3QHZH 5E6UB 4Z7WA 32C2A 3TWYA 1MJJB 4DPBX