4L37A

Sp2-sp3 - a complex of two storage proteins from bombyx mori hemolymph
Total Genus 233
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
233
sequence length
674
structure length
674
Chain Sequence
FKTTPVDAAFVEKQKKILSLFYNVNEISYEAEYYKVAQDFNIEASKDCYTNMKAYENFMMMYKVGFLPKNLEFSIFYEKMREEAIALFKLFYYAKDFECFYKTACYARVYMNQGMFLYAYYIAIIQRSDTASFVLPAPYEAYPQYFVNMEVKNKMDYVKMMDGCLDEKICYNYGIIKENEQFVMYANYSNSLTYPNNEDRIAYLTEDVGLNAYYYYFHSHLPFWWNSGKYGAFKERRGEIYFFFYQQLLARYYMERLTNGLGKIPEFSWYSPLRTGYLPPFNSFYYPFAQRSNDYELHTEKNYEEIRFLDIYEKTFFQYLQQGHFKAFDKKIDLHSSKAVNFVGNYWQTNADLFEEDFLQFYQRSYEVNARRVLGAAPKPFNQYTFIPSALDFYQTSARDPAFYQLYKRIVQYIIEFKQYQVPYTQEALHFVGLKISDVKVDKMVTFFDHFDFDAFNTVYFSKEELKSSPHGYKVRQPRLNHKPFTVTIDIKSDVATNAVVKMFLGPKYDENGFPFSLEDNWMNFYELDWFVQKVNPGQSQITRSSTDFAFFKEDSLPMAEIYKLLDQGKIPTDMFNSSDTMPSRLMLPKGTYDGFPFQLFVFVYPYEPTPKESEPFKAVVPDNKPFGYPFDRPVLPQYFKQPNMFFKKVLVYHEGELFPYLFNIPHYTPDKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Silkworm storage protein
publication title Crystallographic identification of an unexpected protein complex in silkworm haemolymph.
pubmed doi rcsb
molecule tags Protein binding
total genus 233
structure length 674
sequence length 674
ec nomenclature
pdb deposition date 2013-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00372 Hemocyanin_M Hemocyanin, copper containing domain
A PF03722 Hemocyanin_N Hemocyanin, all-alpha domain
A PF03723 Hemocyanin_C Hemocyanin, ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 4l37A02
2.60.40.1520 Mainly Beta Sandwich Immunoglobulin-like Hemocyanin, C-terminal domain 4l37A03
3AX0A 4J3QA 4P6TA 3NM8A 4Z10A 3WKYA 5CE9A 3AWTA 4J3PA 4HD7A 3AWVA 4Z0YA 3AWZA 1BT3A 1LNLA 4J6UA 1LL1A 5I3BA 1HC1A 2P3XA 4J6VA 3AWWA 1HCYA 4OUAB 2Y9WA 2ZWEA 3HHSA 2Y9XA 2ZMXA 1WX5A 1NOLA 2AHKA 2ZWFA 4Z0ZA 4J6TA 4L37B 1BUGA 3WJMB 3NQ1A 1LLAA 3GWJA 3NQ0A 3NPYA 2ZMZA 4HD6A 4D87A 1BT1A 2ZWDA 2AHLA 4P6RA 1OXYA 2ZMYA 3AWXA 1WX4A 3AWYA 2ZWGA 3NTMA 4OUAA 3W6WA 4J3RA 4YZWA 1JS8A 3HHSB 3NQ5A 4HD4A 1WX2A 3AWUA 4L37A 3WJMA 1BT2A 5I3AA 3W6QA 1WXCA 3AWSA 3QJOA 4P6SA 5I38A
chains in the Genus database with same CATH superfamily
2EDHA 3WTVA 1I7ZA 2R2HB 1FSKC 1I7TB 2P7TB 2X09A 3O2DA 4N1CA 4D9QE 4Z77A 1JXFA 2X88A 5LHDA 4ECNA 4W6YB 4Z7UA 3SPVB 1J9TA 1I8AA 3WUWG 3NA4A 5F0JB 4FI6A 1BPLB 1NANI 4Z3TA 5B4MC 4WO0A 2EINB 2XJKA 3RTQB 4GG8B 1C5CH 3TXAA 3HNVL 2WIIB 2JB6B 5C0CE 2PXYB 1NOFA 3FTYA 3HCVA 4PRID 5TJWK 4B9ZA 4EKXA 2G60L 4PJCA 5J8OA 1IAKB 2YPVH 4OIFA 5D6CA 2BSBA 4Y5YC 1HWGB 3QUZD 5D70H 5EZJB 3SE4C 2AITA 5IQMA 1G0DA 2GJ6B 2JIXA 3BUDA 3F83A 5DVOA 2QVTA 1RP9A 1A6ZA 5CLXA 3ZZ1A 1TYRA 4FQXB 3H4FA 5GGTL 2DQUL 3FPYA 2ENPA 1UEYA 3SGDI 2XN9E 2ZAIA 2JFCA 5H2BA 5CMAB 4F33B 5J11B 4O9HH 5EUOB 4P9HH 1RI8A 2VH5H 1A7RL 5GRUL 5E6IB 4JPSA 1ADWA 4LKXB 3DHMA 4ZTOH 4LVHC 1AKJB 1OPOA 3DA0A 3FFCE 4D9QD 4PH8A 2DEXX 3L3KB 3QEQE 2O5YL 3H6JA 4ONFH 4NZDA 1E4XL 5D8JL 4PEEA 1SPDA 4OCWL 3QAZC 5LNDA 3FO1B 3JVGC 3QRBA 1PFCA 5FYKH 3LIUA 1T1XA 3F7YA 3FSVA 3MACL 4LL1A 3RNKA 3T1FB 5CGMA 4WJ5A 1A4BA 2H0JA 1FVEB 5LCVA 3OKDB 4AE0A 5KYXA 3IGKA 2WBJC 3CSYB 3UTSA 4LSRL 1MAKA 5CD3A 3S5YA 2ZX6A 4O2FB 1SYVB 4RGNE 3V7MA 4DF9A 4CN1A 3NN8B 3UZQB 2HJLA 4X6FB 3BZ4B 1K4DB 5KTEL 5C1MB 4CN4A 4ETYA 4XO9A 3SN6N 4JUSA 4XT1C 4MB4A 3BH4A 1GC1L 3VH8A 2XN9D 2YZ8A 4PJ8D 4Y4FD 4QTHA 3I3EA 2IPTL 3KJ4B 5I0VA 4X7TB 1VPOH 3GDBA 4YDVA 3QDAA 5FDWB 4ELDA 5JPMC 3H9YA 3Q06A 1MRCH 2WN2A 4ALAH 5BV7B 1DVFA 5FKPA 3RWHA 1NFAA 2UWEA 3D87B 3QEQD 5I1CL 3WNMA 4A6YL 3QJOA 4G43A 1MCFA 5HGDB 2Y36H 3FT2B 2HLEB 2VUYA 4L3CB 1NCGA 2AAAA 3MUHL 1X5MA 2H9GB 4MNQA 1U0QA 3CLFL 3G04B 3GMMB 4GKNA 2NY2D 3MV7D 3Q2LA 4LEOB 4MZIA 5BOZG 3VTTA 4EDWL 5GSVA 1KLFA 2NR6A 3AB0C 2EO1A 2ZNWA 3QWQB 3T0AA 3A0OA 4OZGA 1H3PL 4UAHA 4GKSA 2VDLL 2XX1A 4WV1C 5C0DA 1KTJA 3FN9A 1A5FL 4XRCB 1ZTMA 2W92A 4M6AA 5CLTA 2FNWA 4TNWF 4PJGA 4UBDD 1NUNB 4LP4A 4NQUA 3C5JA 4PP1C 1CE6B 2ZWEA 1AGDA 2ZONA 3HNVH 4XGZA 1VRSA 2G60H 4P2YA 3WD5L 2F58L 5K39B 1X9QA 2HFFB 5AW8B 1RL1A 1GHFL 4OU3A 1CDUA 1BUGA 3L5IA 4FQJL 3NIFE 4DK5A 4PB9L 4FX5A 2YPLA 3B8YA 4U6YB 2F8IA 5GGTH 2DQUH 1SBSL 4Y88A 3DETD 4P2OC 1A6WL 2WXJA 3NK3A 4LCWB 2NW2A 4M03A 3CE1A 3HCVB 4MA8L 1WWBX 1EGJA 1WE5A 2RCSL 5GRUH 4EZMA 1A7RH 3QDGA 2QKSA 3OGCB 1UJ3B 2MH4A 5BUAA 5DK3A 2WN3A 4HBQA 2PYFA 2H8PB 4YQXL 4WO4C 3KXFB 1WSST 5AW6B 1J8HE 2JI1A 1NFDF 2O5YH 2F1EA 1T5KA 1E4XH 2QVMA 5D8JH 4KROB 4OCWH 2YWZA 4PHZA 4ZMYA 2CPUA 1RHHA 2A38A 3TZVA 1MCOL 3MDJA 3DPDA 3BP4B 3MACH 1DO5A 1YAIA 4KBPA 4Q9CA 4WTXA 5EN2A 2YBRB 2EXYD 3QQ9D 3IMVA 1UENA 4EN3B 1Z9NA 2EIMB 4N5ED 5GS1C 4BDVB 4LSRH 4ZFGL 3OKOB 2BXZA 5D5MF 3SKUD 4PLNC 4JS7A 1OTUD 4ZUWA 2A6KA 1Q9WB 5CJQL 1IAOA 2H5UA 4HIXL 4XB7A 5IG7B 5KTEH 4I3GA 1R3LA 2CJ3A 3MU3A 3QJHA 4K3JH 4MMXC 5ERWB 2X9XA 2WOYA 4E9YA 1KBWA 4R5TA 4PG2C 1GC1H 2WQ8A 1S9YB 2FYYA 5LLIC 4U7SA 2IPTH 3EW3B 1DQJA 3VFOB 1U8QB 4JFWA 2A9CA 4V1DB 1FLRL 4G80A 4FFVD 4PJ5A 3D48R 1P5VB 1RURL 3AG4B 4LSTL 3MNVA 3WENA 2ICES 4BFIA 5I1CH 4OKVA 4QXGL 4A6YH 4UTCA 2DH2A 1T89A 2AKRA 1O5DT 2G2NA 5LDUA 1WBXA 1QG3A 5ANMB 4DNLA 3CLFH 3CU7A 3MR9A 4YBQC 1HI6A 1GGIL 1SBBA 3O8XD 1LEKB 1FI8C 3VFMA 2G3XA 3DJTA 4PWJA 3DGGA 4UM8A 4EDWH 3AWGA 4OFYA 4YBLB 4DERA 3TN0C 2UWEB 1H3PH 2BW4A 2IGTA 4TNFA 5G4OA 2Y07L 5KBDA 3U9WA 2VDLH 4G7VL 2IMMA 4UQAA 1C16A 2HUHA 3FYEB 1A5FH 4P46A 4CVXA 2WP3O 4ZSOB 2E27L 4RFEB 4EIBA 3V0FA 2MOVA 3M7FB 1JFQL 3VXME 3QNXB 4LRIA 3T0XA 4AYSA 5IUSA 3O9WD 2FCBA 3BZFA 3WD5H 2F58H 3CDCA 3U0TA 2H45A 5IR1B 4LASL 1GHFH 3V0VA 5I5MA 3GI9L 3LN4B 2MWCA 4FQJH 3QVAA 4GI9A 4PB9H 2OP4L 3D85D 3FCSA 3H2QA 4LGSB 5IFHL 2JB5L 1DSWA 1SXCA 5GS2H 1SBSH 1MJJA 4R2GB 2DJSA 1A6WH 1HH6B 3N41F 3ZK0A 3S4SA 4Q97A 5CCGE 1XVSA 3RWGB 4MA8H 5DVNA 4WTZA 1T0NA 2RCSH 3BXNB 4WU7B 1QEWA 3R7RA 4UNIA 4K55A 1TZOA 4PJHE 3FULA 4MJ4A 2HH0L 3OKNB 1LE9B 1XCXA 2PYEA 2YPLB 4MRCA 4YSRA 5ACMA 5CD5C 5F6HI 5JUEL 1MCRA 1XF1A 4CADB 2EYTB 2MOQA 2GT9B 1JZ8A 1XH1A 2K70A 5I2IA 3KGSA 1MCOH 1TZIB 3WLBA 3OJDA 4QGYA 3WELA 2O6PA 4MVBD 4APQA 3NJLA 3LPWA 3TU6A 4DUVA 3VXMD 5IB5A 4UT9A 4YDZA 3ASWA 3POCA 3RVTC 5I8OL 5IHWA 3FFDA 1QRNB 3GJFA 1IGYA 4LO9A 5JIDA 4ZFGH 1NBCA 2FEDD 5MEOA 3PAVA 1CG9A 5CJQH 4HIXH 5BV7L 2JQZA 2SODB 4F91B 2FLBT 3CV5A 5FW7A 1KG0A 1PX8A 2VRAA 2WXGA 1WHOA 3QS2A 2ITDA 1MLCA 1VIWA 1HHKB 3REWB 1BJ8A 4QO1A 1CGTA 1HOCB 4XCFH 3LN5A 4YLCA 3ARYA 5B21A 3F7VB 4CJ1A 1FLRH 4JY5L 2FWOB 2H3XC 3S8FB 4PJDE 5F9OL 4ZXBA 1RURH 5K69A 4LSTH 1AY1L 2RBLA 4FQIL 3I02A 3R19A 4QXGH 3QNYA 2EDEA 1KJ3L 4AZ8A 1BFOB 2R4SL 4QLRA 5EO9A 3M17B 4NO2A 2YUWA 1AVAA 2OMYA 1T7WA 3OC8A 4XO3A 2X2JA 5J13B 1YEEL 5JHBA 3U6XS 1W16A 2XA8L 2XZAL 2ED9A 5JIHA 5ID0B 4FQ1L 4NC1C 3C5SB 4RAVA 4NUPA 2VLKE 2OBGA 5KJRL 2YBGA 3CSPA 5E0QA 2I9TA 3PWPE 5FGCE 3WCYA 2FJHB 2Y07H 4R97B 4D0BB 4UMSA 4G7VH 4RA3A 2AKRB 5E2UL 2JCCF 1XCWA 4NI6A 3QJFB 2B1AL 1T22A 2YUVA 3N06B 4X8JB 5JXEC 3VGDA 2AVFA 4EI5D 1ZA6B 2E27H 3R7QA 1GW0A 5BJTA 2BERA 4UM8B 1NFDB 1JFQH 1VJSA 5T3XL 3TH2T 4HKXA 5C0JA 2WNGA 3VB9A 2EE9A 2GJZB 2NY0D 3FNKA 5I66B 4K2UH 4QNPF 1OF2A 4OJDH 4EDXA 4YK4B 3ABKB 4L05A 4MCYB 1E4HA 4JB9L 5I0XA 3GI9H 1OP4A 2BH0A 2GK2A 3L7EB 3MV9A 4XOCA 1LD9A 1XIWD 1A3ZA 1MELA 2OP4H 4YSTA 5IFHH 2JB5H 3GXNA 1IEBB 5D5MB 1EDQA 1COBA 1S7TB 3MBED 2IAMB 1K2DA 4NKOA 3P4OA 3KGUA 4HEMA 3ZL2A 1REIA 2VLKD 3HZYA 2C9QA 1KTDB 2JLPA 2MSPA 2HH0H 5D96C 4J8RA 4DPRA 4R96B 3HZKA 3PWPD 2FWUA 1JERA 3CZJA 3FU5A 5SWZA 4HGWB 4WENB 5JUEH 3S35L 5T1MA 4JANB 5KVDL 2KMWA 3NIGF 5DMGC 3WJJA 1JK8B 3GJEA 2VDQB 4ZPVA 4ODXA 3AZUA 1MCQA 4O2CA 1G1KA 2DQIL 3HRZA 3IDYB 3SKMA 4HCFA 1NANH 2YD1A 3AW5A 1KLGB 4WNJA 3ZKQD 5I8OH 3IJHA 2A6DB 2EADA 2AEQL 4X6CF 5D55A 3FCBA 5E03A 3CN2A 5C0RL 2A6IB 3PNRB 4XNZC 1PLAA 3V5KA 3DMMB 4HJUA 1E4KC 1OZUA 3TP4A 1IARB 4Y2DD 5BV7H 1YEKL 1T1ZA 1T2QL 2AXJA 4LCCC 4XMLL 5D1XA 1U3HC 3H53A 4NZRL 2WQWA 1XF5A 3RIFF 4AYGA 3MJ8B 2C7UA 4H1LG 1XD0A 4BZ1A 4N68A 2I60L 3EDFA 1MREL 3FOLA 3MRNB 3ZU8A 4JY5H 3ZE1E 4XOAA 3OZ9L 1AQ8A 5F9OH 5CWSB 1AY1H 1FNEB 2Z8SA 4FQIH 2FWLB 4DGUA 4RSYA 2A83A 4C55A 2ZF8A 1KJ3H 4U1GC 2R4SH 3CC5A 3HZMB 4AH2B 3ZMRA 4P8QA 3V5HA 2DBJA 2CMRH 4MXVE 2MNWA 4CRPA 4KVNL 5EDXA 1YEEH 2GSGB 2XA8H 2MOGA 5JLZA 3RWDB 3ZKMC 4FQ1H 2AK4E 3V4VA 2HVJB 4HUXA 5KJRH 5DHXB 1JGUL 5F7LB 2P9RA 2DQDL 4HEPG 3KLQA 5E2UH 5JW3L 1OHZA 3ULSA 3NOIA 1BVNT 1WA1X 2YOAA 1CT8B 2B1AH 3KM1A 3VXUA 3GKZA 1JNHB 4KKAD 4BFKA 4ZDHB 2H0PA 3FN3A 4N0YL 3SDAC 2XIBA 3FBQA 1ED3B 3IFPA 3UYPB 3ROLB 1JZ7A 5T3XH 5HVHB 5EBGA 1OB1B 5T8IA 2XFXA 1OTUC 4LHJB 1KCRL 4LCVA 5F88A 5IP4A 2CU9A 3BIAX 3JV0A 1XF3A 3OPUA 3QRGL 1IBHA 3TT1L 4L4TB 2ISDA 4JB9H 1UCTA 3CD4A 1T22B 1BPVA 1HH9B 4E41D 4IKLA 2VMJA 4L0YA 3BDYL 2MPVA 3DUSA 4FFVC 4HSCX 5AAMA 3DKHA 1U91A 5C07B 3T2LA 3SGJC 3BGMA 3UTQB 4L0PB 3X13B 1I4FA 4ESKA 1RZJC 3ARDC 3EJRA 2RHEA 2OMUA 5E8DL 2AK4D 1SN5A 4QXUL 3DX4A 1XAUA 3O6FC 2P44B 4GS7C 3ZKNC 2Q8BL 2AQRA 3L4YA 2H2PC 3VFVA 3S35H 2Y7MA 2YARA 5JZ7D 3B8SA 5I15L 2I7OA 4FQHB 3EYVB 1JPSL 4N8PA 5DDHA 2E47A 5ALCL 3TPKA 1JDAA 1EEYA 5C0GA 4BK5C 2PN5A 4YHIA 1L6PA 5L8LB 2DQIH 4GEIA 2A9DA 3BD3A 3QXAA 3LMJL 3ELAT 4HX1B 4YSPA 3VFRB 2V2WB 2AEQH 2C9XA 5EC2B 1ZE3C 1V27A 3AWSA 2V3EA 4LPVA 5C0RH 4NPYA 1W8NA 1JYNA 1G87A 1KPRA 4HV8B 3SZ6A 4DKEL 3LH9A 3ZGHA 5BZDB 2GIMA 3PNWA 5F7WC 5L4JA 1KJ2B 4BSWB 4NUJA 2GHWB 2OR8A 3AC0A 1YEKH 5D2LF 5IB2A 1O75A 1T2QH 4XMLH 1SHMA 4NZRH 1IC1A 4AQ8C 3GBML 2HMIC 2JCCB 4XVJL 5CCKL 5CILL 2CIIA 4J1UA 4L29B 4LOUD 2I60H 3WFDL 1XGUB 4NHUA 4UTBL 4Q9QL 1MREH 3NJHA 1FSKB 2BPBA 1O7VA 5F71A 5E99L 1NCNA 3OZ9H 1AYOA 2WLHA 4GXUN 3PWNB 4IRJA 5BRZD 5C09E 3V5KB 2J5WA 3WU1A 1A4CA 3LNEA 2DIJA 5ESAB 1JWUA 4I5BB 3ZMNA 1GY2A 5B7MA 5CP3H 3IFOA 3TF7C 1UB5B 3DVNA 2ZOKB 1D9KA 2WLLA 2JTYA 1FFNB 3H7BA 5ESVB 3BAIA 4PJFF 2VDNB 1WCBA 4N2KA 5E2WL 3S8WA 5AVYB 5LBSL 4KVNH 1MJ7L 5IBLC 3QZPA 5MERA 4IKNA 2J1WA 1UKSA 4LDEB 2JVUA 4C56E 4Z95L 1JRHI 4LVOC 1JGUH 1TO4A 2WD0A 3P9WB 3ECQA 2P80D 4N3UA 2DQDH 3S3DB 5DS8A 5MEQA 4MNGE 4WUUE 5JW3H 4M5ZL 4Y5XC 3IVKA 1A6UL 3FTZA 1W72B 4AM0B 2X40A 4JLRB 1KZYA 6FABL 1IKOP 3ZO9A 1P1ZA 4A39A 1EXHA 1ZLDA 4PJ9D 4N0YH 2BIQA 2ENYA 3LQZB 1FWXA 3GBDA 4FQPA 4M7LT 4W9KC 1ZAGA 4G8IB 3UIYA 1VEOA 1KCRH 1XF4A 3NIGB 4TVPD 1YMHB 2EH8H 4PJIF 5AWNL 2W0LA 3PHOA 3QRGH 3TT1H 5C09D 4LPWA 1U8OB 1MUJB 5ALBL 3X14B 1SFHA 4U7MA 1I9IL 3C09B 4BH7B 4Z7OF 5C9JA 4V2BA 3N55A 1EHAA 3BDYH 3FUEA 2DQJL 3NMEA 2HPOA 5DURB 2WVUA 4BKLB 2D4DA 2VDQL 3O6KL 4X5WA 3CH1A 2JXMB 4PJBA 1ZT7B 5DJ8A 5E8DH 4C56D 2WBJB 3QFDA 2HN7B 4QXUH 3NUKA 2LLNA 1I3VA 2ROXA 1UTDA 3PDOA 4P4KA 3U4EA 4NN7C 2XYCA 2CALA 3CFKA 3QUXD 2Q8BH 1JGEB 4WUUD 4A2GA 4F9LA 3KLHC 1BYPA 4NZ8A 4N25A 3WFCH 2GUOA 5I15H 4XOBA 1JPSH 4PJXA 5EZPA 5HD8D 1TEFA 4U2ZA 5ALCH 1TVHA 3ARBC 4AJYV 1UB6A 1WFUA 3LMJH 3VRLF 4BFRA 5JPMB 3QZWG 1OM3L 3LKNA 1F4HA 2XFGB 4TTGA 5HJ3A 3NSJA 3GF8A 4XPAL 1MI5A 5D7LE 2Y2WA 4DKEH 5LUMA 1JZGA 2QTVA 3EH3B 1PZ5A 5K59E 2C9PA 5FK9B 2EXSA 2EEFA 4YDMA 2K8QA 4OD2A 1FL5A 1QABA 3PGCB 3K6IA 3GBMH 4U3SA 4XVJH 3N0PB 3MYJA 3DV4A 5CILH 3WFDH 5CCKH 3AB0B 4UTBH 4Q9QH 4NWUL 1MHPL 5E99H 1B4RA 4JDTL 1ADQL 2DWDB 3A6BL 4NQEB 3MUGA 3WYRA 4WV1B 5DJDB 1YEIL 1W6WA 1BFVL 1L7TL 2Y9WA 1U8HA 1J5HA 3RPIB 2NRDA 2YD2A 3QUGA 2YQBA 2ED6A 5E2WH 1CGWA 1Q9KB 1M2OA 5LBSH 1PJ9A 1MJ7H 2KZ1B 3REVB 3ESVF 2Y7NA 5FM8A 1HZHL 5IMMB 5JMRA 3FUNA 3IPEA 4GSXA 3U9UB 1G7PB 4Z95H 3V8CA 5FECB 1FVDA 4N0CD 4PI0A 2YGOA 5EU5B 1EFXB 4BD4A 1R19A 1VGKB 4M5ZH 5D7LD 1A6UH 4NB7A 4F15B 5MENA 3X2QB 2QMJA 3RX9A 4P2OB 6FABH 3R4RA 2GJPA 5J6HA 2WWMD 3D07A 2TSAA 3UAJD 4F24A 1NBYA 3OTTA 2ZUWA 4YHPA 3S35X 4DP5X 3Q2NA 5BVJA 1T4WA 2F54A 2XPZA 4MYPA 5AWNH 5TDOA 1RIUL 2BDNH 4DPAX 3AU1A 1TFHA 4GAYA 3A22A 4WO4B 4ZS6D 2C7FA 3IVKB 3DTUB 3UJTL 1F1AA 1JV5B 1QTYT 3JV5A 3OLDA 5ALBH 3T8XA 2PCFA 2B59B 1GZPA 4HUUA 5IMKA 1ERNA 4I48A 3NA9L 2IDQA 5IMLB 1MVYA 3KYNB 2DQJH 4KJWC 4QYOA 3W11D 1GGTA 2VDQH 3O6KH 5FUCC 3QUYD 2ZYHA 4DN4L 4JN2A 1GKOA 4AQAA 4ETQB 4WWID 1QBAA 5D2LB 3WO3B 1AZRA 4X7CC 5GISL 4PGCB 1H5BA 2OMZA 1HHIA 3KYAA 1EO8L 3G9AB 1MWAB 1TFPA 3ARWA 5FW8A 1M71B 2FGWL 1NPNA 2VT0A 3Q6GL 1VFUA 1ET7A 3M8OL 3VG9C 1E9PA 1KJ2L 3UPAA 1TQCC 4TL4A 3OSVA 2JI3A 2WZ0A 3BT0A 5I1IL 1OM3H 1ZPLA 4PJFB 1KBPA 4KAQL 3SE8L 1ORSB 5HHOB 3QWNA 2X6UA 4ABVA 4KKAC 3MV8B 4H8VA 5J6GB 4XPAH 2VQ1B 5GZNA 1LXMA 4U1SA 4N0RA 3DSFL 3VRIB 5FYLL 4AYBA 1IM9D 4AQ1C 2FQEA 2GY7B 2CRIA 2Q86B 5C0CA 2P52A 4XH2B 3BD4A 3K81A 1ZGLP 2VDNL 1B2YA 1ACYL 1U42A 3BAYA 3L3IA 3IDNB 4NWUH 3TN0B 1MHPH 5HI5C 4JDTH 4GRLA 1ADQH 3A6BH 3HHSA 3V6FB 3EYOB 1NDMB 1YEIH 1YNTA 4AIZB 1BFVH 5G4MA 1L7TH 5IGXL 1TJXA 4HKJA 3WUWB 4HHGA 4PLKC 5C86A 2XN9A 1XT5A 3DYMA 4PJIB 1FNGA 3EYQD 2X4NB 4MDJB 1FNSL 2PCXA 2ZKXA 1W72L 4LF3B 4Q89A 3LNIA 4TQPA 1HZHH 1F6AB 1P4IL 3FFCA 3P73A 3LRSA 4EUPA 5ANHA 3SO3C 2KC0A 3GSOB 4PR5A 3WNJA 4HULB 1V3LA 4LLQB 4Z7WE 5AYQA 1ILSA 3PPSA 4PD4K 2ZP9A 3GXMA 3LKQA 1MCJA 5F8QC 3WDIA 2XBDA 4ZYKA 5IG7A 1VKXB 2CBPA 2X89A 3ESNA 1FH5L 4KO5A 1UUSA 1SN2A 4ABWA 1AHKA 1TZHB 4BA0A 3HPJA 3MKGA 5HP5A 4N8CL 3V0JA 2PTTB 1RIUH 3JTTB 1TR7A 4LCIL 4JCLA 2GCYA 4P57B 4ONHA 4XAWL 3MRHB 3FQUA 3UJTH 1H19A 1FFQA 3NIFF 2NXYD 3NA9H 4LOUC 2VZ1A 2Y25A 3OR7A 5E1AB 4ELKA 4S2SB 5J0BA 3BUQA 4DN4H 2OSLA 5E4EC 1TSHA 5GISH 2H2SD 4NQDE 4XMZA 3CFJA 2QSCL 4DGIL 1EO8H 1JRHL 4ZNEE 3O3UN 3RBSA 3EGXB 5I8EB 1T5XB 2FGWH 1B90A 3BWSA 3BO8B 5E5UB 2WSDA 4PRIB 4E42B 1HTYA 3M8OH 4PBWD 1KJ2H 4PMFA 4QRRE 3U1PA 3V7AG 3QUZB 1HAWA 7CGTA 1U21A 3BISA 5EV7A 1EVUA 2HRGA 4MNHA 2Y2YA 2BMKA 5I1IH 3EJYD 4KAQH 3L5WA 4WI9A 1NC2B 5G5DA 5J4MA 1TCMA 4P59L 2NZIA 3B9VA 1JPTH 4HHAA 5FFOA 4F7TB 3DSFH 4H13C 3V6ZA 5FYLH 1NGYA 4BZ2L 4N0UA 4LLYB 2VC2L 2Z4QA 1N18A 1HCYA 3B7TA 4AGOA 5EBMB 3G7TA 1ODUA 3MRQA 4J4PA 2EEDA 1A4JB 2BNQE 4QRPE 2VDNH 2VDKB 1ACYH 5DFVD 4FXLA 4OT1L 1IIIA 2ZCKL 3CZSA 3H9HB 2I9LB 4NQDD 2KPNA 4BXSV 4HZLB 5JOPE 2BW5A 5DJ6A 5IGXH 1D5XA 1DDHA 5D72L 3I2CL 4HAFA 1JVOA 3LY6A 5EU6E 1FNSH 1WIOA 1EJFA 3EYFA 1W72H 3WN5C 4QHLB 1ZS2A 1GS7A 4IIQC 3QQXA 4BH8B 3CXHJ 4BFOA 1P4IH 4ACTA 2LU5A 2EDKA 4MD5B 1CDIA 1J8HA 5E6ZA 3L9EA 1AOZA 2CIKA 5DGRA 1J12A 1FLTX 1PQZA 3P0VL 4OZFA 5CZVL 4PJ8B 1YEGL 2EDFA 4Y4FB 3BPLC 3E3QC 1LNUA 2IAAC 3HB3C 1OTSD 3LQMA 3HNSL 3O8XA 3AFLA 3DGDA 1KGCE 2Z92A 1GCFA 1FH5H 3EGSB 5DQJA 1BBJA 2Q3ZA 4OJFL 4L18A 3EZJB 4HJGA 1GKEA 2LT9A 3QEQB 4QRPD 4NM8L 4N8CH 5BRQA 3WV0A 3BP7A 1QAWA 5D96B 1NMCB 2ZSVA 4LCIH 4ELMF 5ICZB 2IH3A 4U3CA 4XAWH 4KMQA 2GI7A 4E9TA 1WC7B 3ULUE 5JOPD 35C8L 3US0A 2VLLA 3MV7B 2LFGA 2AJ3A 3T65A 2R1XA 1YDPA 1R4XA 2FBJL 2HZHA 3ETTA 4J8QA 4H88L 4CAGA 2XWBB 4WTWA 1MWAL 2MEJB 4XOEA 5EU6D 4O51B 2OTUB 1MJUL 4PWHA 3X3FL 5GRXG 3O9WA 1XEUA 4P46C 3FTWA 3LOWA 1YEWA 1YUHA 4J3OG 3S37L 4UAOC 3D85A 2YOCA 3U7AA 4XNZB 1S9XA 2GTZA 1X7QB 2QSCH 3ME0B 4M4RB 4DGIH 1JGVL 3QJQB 1JRHH 2EYSA 1JMXA 3P4LA 1LEGA 3MKKA 3FJTA 3HKZA 1B0RB 4U1HA 3RWJA 2AXFA 3APMA 2GUYA 4M43L 4DIXA 4Y4KA 2XICA 1KGCD 2FBRA 3MRKA 3D51A 4N0CC 4UT7L 5AVWB 4AV4A 3G9VA 1VFAA 5DD6B 3RWFB 2ADIA 1YC8A 2ZUQB 4E5XB 4P59H 3VFSA 3A47A 4GSRA 1BZ7B 1AQDA 3ULUD 2H3NA 2QSQA 1ZXQA 3HC0A 4BZ2H 3MX0B 4X4KA 2C3VB 5I76A 1Q72L 4JRYE 5JYMA 5DFAA 2CKNA 3DBXB 1FL3A 1HYSC 1YEJL 1WD9A 4ZS6C 2UZIL 3X12B 2GTWA 4G42B 3WEOA 2I24N 1ZKAA 4OT1H 2ZCKH 3HE6C 3U46B 5HGGS 4AENB 1B4LA 2DQ6A 2BWDA 1KIPB 4CBZA 1Q0XL 2VITB 2AXGB 5D72H 3W11C 3I2CH 4X99A 4JY4B 3OKKA 1IEAA 3AXLA 4LSDA 5LB1A 3DRTB 3PV7A 4OD1H 5KBNC 3BT2L 1G9HA 3QZLA 4PJHA 3TO4D 4E9LA 4IOSD 4YJZL 1KCBA 4WHDA 3NIFB 4R7NA 2VQTA 5A3ID 2ZXCA 4NJAL 2ZX7A 5D7JD 1NUGA 4Z0XB 1NEZB 3EDJA 4FZEL 3P0VH 5CZVH 4N90E 2X4SA 2F7PA 3QI9A 1YEGH 4XVTL 3CWGA 5K1VA 1OSPL 3IEAA 4LLUB 2G5BB 2Q76A 3P9LB 4OF8A 1KJVA 3EYFB 4YMPA 4ZXBC 3HNSH 5HHQB 5DJYA 4HWUA 4XBPB 1FZOB 3TNMA 9CGTA 4G7RB 1FP5A 1QZNA 4OJFH 4NM8H 5AVRB 4NRZA 2QBWA 1JHTA 3O6FB 5E2VL 4CDHA 2ADJA 2CO6B 3FT4B 1BMZA 4XNQB 4KUCD 1KB3A 5I3AA 1BQ5A 1G0YR 2WZPA 4EI5A 35C8H 2MIZA 2FBJH 3NPZB 2DEWX 3DX9B 5AQ0A 4F1SA 1E9OB 4H88H 5IW3A 3SEPA 1MWAH 2AJSL 2JJTA 1P69B 2O6CA 5KUMA 1MJUH 3B6SA 5HHNB 3MGTB 4KKCD 5KG9A 4EPSA 2KKQA 5K9QG 2ROYA 2IH8A 4PJDA 1CICC 1LK3L 1KWGA 3BVTA 5DWUL 5FX3A 3BW9A 4W68A 1C7SA 2EDYA 2P28B 3CFTA 3EYQC 1M9SA 1BAFL 4N90D 1JGVH 4LKCA 2X4UB 5DJ2B 2GAZA 2XWRA 5HDWA 1KT2A 3K4DA 4HD7A 3RFRA 3O4LB 3GRGA 4X6BA 4NZJA 4M43H 2OV0A 2VLKA 2EXWD 3GSWA 4UT7H 3MUJA 4HPOL 3PWPA 4WI3A 5FM5O 3KH3A 2AANA 2D3JA 4Y1SA 3D85B 3NFNA 4AKPA 1R34A 1WAPA 1MDTA 2XWTA 1NBZB 4WEBL 4XR8C 5GJTH 1PKOA 3GMOA 3QFJE 1DLFL 2EDTA 3WEXB 4HHWA 2JQAA 4LGPB 1ZWIA 1GYWA 1ZHKA 1RV6X 4OQTL 5HSFA 4F37F 5F44A 2RALA 1Q72H 4WEMB 2VNCA 3A6OA 3S2CA 1YEJH 4JFPB 4WW2A 2X2UA 4D3CL 2UZIH 4ZUVB 5TF0A 1BIHA 5EULV 2MCMA 2Y1VA 1BV8A 4WAFA 3HRZC 3KH4A 3VE0B 4Y2DA 3KYMB 1PGRB 1UCBL 3L8QA 3PIQB 4Y5XB 4YLBA 5DC0A 2FZ3B 1Q0XH 5IEKA 1RZGA 2LFEA 1WHPA 3S9DB 5AOMA 3PXHA 2XTLA 3VXMB 2QGBA 1ACXA 4U6HB 4ELMB 3FUJA 3RVUD 5T5NG 3BT2H 3VQ2C 4MXVF 5EOTB 2H2SC 4FXGA 2R27A 3ARVA 2R2CA 1EAQA 1N0LA 4NJAH 2FSEB 2WZ6A 1UWXK 1T83C 3FB8B 4FZEH 4ZJ9A 2NT1A 1KGJA 2C1OB 1PD1A 4LVEA 5ES4B 2O61A 3QFJD 4XVTH 1AGBA 2XPGB 1U93B 1OSPH 3AQZA 3IN0A 3OWRA 2P5WE 3PQYE 1OARL 2NNCA 3EOYG 4OBSA 2ALWA 2ZOLB 3T0BA 3CG8A 1UXSB 5E9DE 2WBKA 3MRCB 3EO9L 4U3XA 4KTDL 1B6DA 3OJ2C 3VSTA 3DURA 4QCIA 2XIDA 1JZIA 2W5PA 3O41B 1U95B 3G3LA 1OF0A 5E2VH 5CLZA 1XB8A 3L3JA 3MTXA 4MQ7A 1J88A 4NN7B 3FUKA 4XWOD 5HYEA 2ZYRA 3D0AA 3STBA 1N6QL 5ADPL 4F7CB 4GKOA 4WWKD 5HYQB 3CN4A 4FRWA 2AJSH 3ARBB 5INCB 1QPXA 3TCLA 4DWHA 1RJLB 2PNDA 4OLEA 2J2ZB 4TUKL 3X1GA 4IRZA 1BQSA 1KEML 5FM5M 4R4BA 5IW1B 4LDLB 4HDIA 2D7PA 1LK3H 2Y3NA 1FHGA 3A24A 2E3VA 3O3BB 4J3OC 2MKWA 2HJFA 4MKMA 3B3IB 3FQYA 5JHDB 1BAFH 2DIBA 2J72A 3BVVA 1TTRA 3B9KD 2BP0B 4BWUA 3KPSE 4LLVB 4PW9A 4PTUB 2P5WD 3PQYD 4QWWD 5I3BA 1S7UB 4XXWA 3W0WB 2NY0B 4HISA 4YHLL 1SDDA 1D5BB 1FZKB 5F7DB 4DCQB 1ILUA 5E9DD 3VXSE 4ZUSA 1LE5A 4M29A 4Q6IC 2OULB 4NXSA 4H1LB 4HPOH 1LMKA 1E4JA 1G6RB 1XIWB 1BQHA 3HS9A 3IM1A 5DZLA 1SNRA 3QRLA 1I75A 2CRMA 5EU3B 3UPCA 2VJ0A 3LZRA 4WEBH 4ODTL 2UY7B 4JVWA 1DLFH 1I8IB 2DWTA 3MBEB 2AJXL 2VIRA 2OMWA 4OQTH 1DJIA 2VLKB 3P3TA 5JTWA 3ZE2E 2RMNA 3IDIA 5FGCB 2DMCA 3B83A 3C2AL 4UWQB 1UD2A 4D3CH 4PRPA 5CHNA 5C8JB 3S34L 2D7TL 1S9WB 3G5YB 2YRBA 4FNUA 3T9WA 4DP8X 2HVKB 1UCBH 2EH7L 3CXHK 4G6AD 4LLMA 4HUVA 1HXKA 3L4VA 3RILA 2ZF9A 3CVHA 1U8LA 4AGNA 3H42L 3K71A 2J21A 1WZAA 4MD4A 4TQIA 1HQRA 2ARWA 4A63A 4W6WB 5BS0D 4B53A 4J6RL 2A7BA 4OV6F 3I3BA 3KNBA 1RZJL 1AR1C 3GIVA 4R7LA 2DL2A 2OTWA 1I82A 2E75C 2XKUA 5BZWA 2FUTA 4YOKA 2QQLL 5KVGE 1OARH 3G6JE 4DAGL 1UKQA 2HG0A 3LIZA 2XTJE 4FXKC 1QA9B 3PYCA 1KMGA 2MCAA 3S37X 3I9IA 2X2YA 5PCYA 2QPEB 3EO9H 4F7MA 4KTDH 1TQVA 3V55A 4Y9EA 1MG3C 1CTMA 2P80A 3FT0A 3KPMB 1I1AD 1E50A 2BVOB 4OUUA 5F0MB 3SBPA 5K9KB 1BJMA 2YA2A 2NYYD 1JYVA 4JPIA 3HLAB 5B7EA 1EUTA 3B1UA 2W07B 4PJ9A 1BBDL 4F2FA 5ADPH 1N6QH 1HEJC 1R5VB 4CSZA 3VG9B 1HDMB 1NFKA 1AIFB 1G7LB 3AG2B 4JGJA 1TQCB 1HEZB 2EACA 2ENQA 3T0EE 5CSBA 2J6EL 4FYQA 4TUKH 5HYJA 1KEMH 2HTKD 3UCRA 4E36A 4FZ8L 2IPUK 5DK2B 3JWNG 2EKJA 3E8VA 3H9SA 5EBWB 2DQFA 1FZJA 3CX2A 3KHOA 1WQVT 3A21A 3JV4A 5FS5A 3VXOB 4AT6A 4E0RB 3KBHE 1V3KA 3TO4C 4AQ1B 4YHLH 1CD0A 1H8SA 3GSNA 2AW2A 3OQ3B 2WXPA 3QCVL 3QHFL 1I8MA 3LKPA 3HC4L 2XTJD 4HT1L 3I9AA 5F3HB 5A3IC 4Q9RH 4QPEA 3QB7C 1QMUA 3U25A 4P5KB 4U1KA 3AMKA 4ZFOB 4C56A 5KAQG 2NY4C 5F3FA 3OBAA 4HUWA 4E41B 1LO5B 2R69L 3KVDD 4ODSL 1HXYA 1HL8A 1M6UA 4PJAE 1A7NH 4MNGA 4WUUA 1NOAA 2DJ4A 1BGXL 2XACC 2YEVB 3MOBL 1AGEA 4ODTH 3QS3A 4GMTL 2CAKA 4ZMOA 3VD0A 2AJXH 2GSIA 5KYYA 3MUUA 5KVEL 3W82A 2P48B 3ARED 3R06B 2AK4B 4FJ6A 4HC1L 4YFDB 5DVKA 5SX5H 4WI0A 5JW4R 3IDUA 3AADB 1CPUA 3FQTB 2ZXGA 1EEZB 3C2AH 3GC3A 2AJUL 3T0ED 3QPQC 1HILA 3B2DC 3SYQA 4PGDB 1A9VA 1ZLEA 2PABA 3FONA 4NFCA 1E5YA 4ORGB 3S34H 1ETZA 1VADA 4JBSA 2D7TH 2VUOA 1HE8A 3IPBA 1N5AB 1TENA 2BFGA 3C5ZD 1BP3B 3SO3B 3UZEC 3V4UL 5BMFL 3MA7B 2EH7H 4BWWA 1E0OB 5AAWA 3EHBD 3H42H 5E5MA 2CBQA 2ZOUA 5H4YA 4M48L 4BCZA 1MZYA 4A67A 5C0EB 2Y2TA 3MJWA 4F8LA 3WG7B 2Z7ZA 1ES0A 4AVJA 4JHAL 4DQAA 2VRKA 1DSFL 2HTLD 5GXBB 2X6CA 1QLRA 1OGAA 4Z8FL 4J6RH 1VSCA 2OZ4A 1NAML 1YN7B 3O4OC 4FHKA 4YGVB 3IU3B 1RZJH 1KJMA 4GFTB 4P3DA 2VE6A 2V9TA 3EOBA 3HJ0A 4IQHA 3WEMA 2UXTA 4J7RA 2GITB 2QQLH 5B39B 5FFLA 2VQ4A 2F15A 3DX6A 1NEUA 3BPCB 4DAGH 5KBKA 1A6AB 2OYLA 3ZIYA 4MAYC 3NCFB 3SGKA 5BRZB 2E9WA 4IDJL 3FTXA 2Z31D 2E5EA 1T6BX 4XXDB 1T66D 4YFEA 3L3HA 5I1GL 2X3AA 5E4EB 3UEZA 4G9DB 5D7LA 4HCRL 5BUGA 1J10A 5C08E 1ZE3H 5T1JA 1LYQA 1BBDH 3MREB 1G94A 3AG3B 1V3JA 3PWVB 4MYWB 4OZFG 3EOAB 4NRXB 4K71C 4EIGB 3AWZA 3IXTB 5E8EB 3RIKA 1BVKB 2J6EH 3V0WL 4LSQH 3T4YA 1Q1JL 3ZHDA 1BOYA 2D7OA 3OKMA 5EIQA 4FAAB 5IJKA 1KXTA 3QZWB 4FZ8H 5F93C 1FNFA 4FG6C 5I0YA 2B5IB 4JPIB 5DEFB 3BKYL 5ESQB 1I7UA 2UXFA 1G6RL 4ATWA 1TEYA 3GB7B 2XVBA 4IBYA 5H37H 3L5JA 3C6LD 1A6TB 4CKQA 5HHME 2O1AA 2IQAB 3FTUA 3QCVH 3QHFH 4GIPD 1AD0A 1CXKA 3HC4H 3QUYA 4HT1H 3ES6B 4L37B 4K9JA 4LEEA 3S0PA 5IT2L 4XMXA 3CZFA 1IAII 3U6RA 1QBLL 5C09B 1PNDA 1TQUA 2V9UA 2YMOA 3VI4E 1E30A 3IDJA 3RWIB 2WVTA 2R69H 4ODSH 1RPQA 4KKZA 1MIML 3GUTB 1H3XA 2UVEA 1BAGA 3SOTA 4AOFA 3MOBH 1D7BA 5KYWA 4GMTH 1J7VR 1V5JA 3GT6A 1QFUL 3KDPB 4OGYL 2VDRB 1XMEB 2YAHA 5KVEH 5H94A 1RIVL 2P8MA 4A04A 2MKLC 1AO7A 3HG2A 5KYNA 4C56B 1H5BC 4X83A 4HC1H 4QR7A 3WN5B 4M8VA 4NFDA 4IIQB 1DLHB 3PREA 2AJUH 1QNZL 3MLTA 3QUXB 3VVWA 2DLEA 2V5SA 3IMWA 5DC2A 2ZTBA 2GJRA 3FAXA 5KW9L 3GS0A 3V4UH 1CGUA 1TYEB 4WWKC 5BMFH 4ZMXA 3M86A 4K7FA 1ZA3A 1IM9A 3QNZA 5B38A 3HB3B 3UC2A 3M1CA 4I1NB 4FFYA 3X3GH 4TYUA 5HHMD 4Q9BA 3W81A 3QT2A 4M48H 1DVTA 3C6SA 4RDBA 5B8CC 3F3HA 5DZNA 2IOIA 4I0PD 4F80A 4JHAH 1DSFH 3RZCD 2HKAA 4Z8FH 2YEZA 4RBPH 1NTDA 1NAMH 1DHKA 1IC7L 1MLBB 4U1MB 2W94A 4EVNB 3C8DA 4BK8A 4IBSA 3NABL 1XQ4A 1JCKA 4N2CA 5D1ZA 4X9IA 4OZIE 1W0YT 1JWMB 1QACA 2ZXEB 3O0RL 1QSEE 1SJVA 3TIDB 3W6QA 1I1YA 5ILTL 1M3JA 5BZXA 4S1QL 4MJIE 1M2VA 3UBFA 4JFFA 5J12C 1UM4L 1QLRB 3EG9B 2YQ2A 4IDJH 4KX8A 1GMIA 5E9AA 3RTLA 1MJ8L 4XI5D 5C3TA 3H55A 3VCLB 5I1GH 1AOHA 3QULA 4XNYL 4UAOB 4MSWB 1S7XA 5EO0A 1A4KB 3KPLB 4YHNA 3BQUC 4M1DL 4R8WL 1W80A 5ACLA 4KWUA 4KK9D 2CLRB 4IBQA 2P5EA 1A65A 5A16A 3CBKB 4RIRA 3V0WH 4LLDA 1Q1JH 3KWWA 1TIUA 4ILDA 3WJLA 1NKGA 1QSFA 5DU7A 4ZO7A 4C4KT 4RQQB 1CBJA 4ZFOL 5D9SA 3WIIL 4H1LH 3EH1A 1G7HB 3BKYH 3LHAA 1C1EH 4IHOB 3JWNC 1G6RH 1E9QB 3WHE1 2E7MA 3T4AC 3PG2A 1U4EA 3BUYA 3R0NA 1QSED 4B3VA 2IANA 1T3FA 2F8VA 3NCMA 5E94A 3G5ZB 4A2LA 2XVLA 1ULVA 3ELQA 1GZQA 1QX1A 4MJID 5F3BB 3V5DB 1ZS8B 3B7UX 5IT2H 3OKMB 1QBLH 4IEFB 4P3WA 4C47A 2YXVA 4YEFA 1FFOB 1PPIA 1MIMH 2Q0ZX 3HE6B 4QRUA 3VXQB 4AZUA 4Z7WA 3WS3A 4Z5RB 3MUZ1 1KYFA 2WXKA 5DEZA 5ENWA 2P24B 1FDLL 1QFUH 4OGYH 1RIVH 2XYBA 3FUIA 4O02B 4GW1A 4M02A 1I3RB 2QJDA 4RVBA 1QNZH 5BQ7A 1GH7A 2GEEA 1HHJB 1TJIH 3IKKA 4HFWA 4APXA 1DJGA 3A5VA 3ZTEA 2WQAA 3BP5A 4OV5B 1A2YB 2VMCA 2EEAA 1BFTA 1NFIB 4Y19E 3DOIA 4NO3B 3GMPA 3K0YA 1S78C 2WINA 2KZBA 4F58L 3HI5L 3VX1A 3AU0A 4P99A 1RUKL 2X5PA 1UZ8B 2BO0A 4BKSC 3KPRD 3U36B 5LG1A 2ED7A 2JJSA 3KJ6L 3SQBA 3TBSA 4YX2H 1JBJA 2FRGP 3QCTH 1IM9B 3NABH 1DN0B 4J4PC 4ZNEA 1P2CA 3ZVVA 5JPNB 3CZEA 4DQOL 3LKOB 6PAZA 3O0RH 4JFEE 1MHCB 5EZLB 3CSBA 5ILTH 2QLVB 3V4PA 1JIBA 2YC1B 2CNYA 2YRPA 4FQ2L 3IE9A 4LQ1A 1F0LA 1QR4A 4S1QH 2DYSB 3AQYA 5GS3A 5CE9A 5F7MC 1UM4H 1YPZF 4AJ0A 3ARFC 1OK0A 2RQEA 3EH2A 1U8PB 1MJ8H 1URLA 3LRLA 1CICB 5DYOA 2QR0A 1IILE 1ND0A 1X3DA 3BH9A 4XNYH 4JQXC 1FH2A 3BLPX 3MA9L 4OJAA 4W4OA 4BQ6A 5IHZB 2E7DA 3RGVC 1TQSA 1QQDB 2X6AA 4PRBB 4H2AA 4NHCL 5B1BB 3ZY7A 1M2VB 4M1DH 5LQBL 3ULUF 1AFVL 4R8WH 3FU3A 2BNQA 2OQJB 2K3TA 4QRPA 2CJSA 3D18B 4XP6L 2EVFA 2BRQA 1A1MA 1CO1A 1UT2A 2VZVA 4TVPL 3ZPDA 4NRYA 2HKFL 1DQQB 4ODUA 4YWGL 4ZFQA 2OMTB 4H5SA 3BUBA 3NP4A 4N0FB 3WIIH 4RX4A 3OC5A 4YR6A 4HU8A 5DSCB 3H1ZA 4JFED 1CFVL 3R4DA 4HS3A 4D87A 2VDRL 2YO3A 1XWVA 3UH8A 3VMOA 4IS6A 4M3HA 5LBVA 2R2BB 2VLJE 4JAMB 1XGQA 2DL9A 2LE9A 3IMSA 1KXVA 1T4KB 3PWJB 1J9CT 5CP7B 1Z2KA 2EVIA 4PJEE 1FN4A 3TA3D 1FDLH 3GSRA 5A2CA 1NKRA 1T66C 3VWJC 3B5HA 2ZUYA 4M00A 5BRPA 1R3JA 2R1YB 4LMQE 3UTTE 1LEIB 4Z7WB 2YSSB 1S7SA 3QJUB 4LU5L 1P7KB 4KX9A 3N1QC 3D33A 4FNQA 4KC3B 1TQWA 3ULVE 5FYJU 1BQHG 1OAUL 4YO0A 3PWLB 5HJGA 2OYPA 1MW2A 1QUNB 1EDHA 3GZKA 3ISRA 4TMPA 4F58H 3F12A 2ZWKA 3HI5H 4ANUA 2ZE0A 3A4DA 4W9DC 1ZHLB 1M1SA 4NC2B 5FO9A 1LWRA 1RUKH 1Z9SB 3MODL 1YN6A 3D25A 4G59C 4ODWB 5D93B 3HI1A 2J1YA 3TJPA 3G08B 4PY7A 3BGAA 3KJ6H 4PJ6A 1DJWA 5T1KD 1FO0B 3C6LC 1IAIL 2ZXDA 1BCIA 2DQEL 3ATAA 2IH1B 1G9MC 4D8PA 1PD6A 1NGQL 4DQOH 1NDGB 5T5NF 4A7UA 4PVBA 4ZG1A 5FYKE 1F56A 2JH2A 1DE4B 4FQ2H 4L4JA 3VI3E 4MA7H 3B4NA 4IOSA 4H25B 4HALA 4WSKA 4PVMA 3ARRA 4Z76A 5FUOL 4P2AA 3WNOA 4Z0YA 5BVPL 4NQDB 3G5VA 3SKNB 4MMZB 2X7LB 5D7JA 2V3FA 3QARA 3Q5YA 3LPOA 3H3KA 3MA9H 4U7KA 5J1TC 3DX7A 2Q3XA 2VUKA 3L16A 3T09A 4DW2L 2XHNA 3ULVD 1KC5L 3BH8A 4NHCH 4JRYA 1R3IL 2EE6A 5LQBH 1AFVH 4GRWF 2WTRB 2X12A 4FEMA 4XP6H 1INEH 3LQAC 5GJSL 3IMUA 3L1EA 4Q6IB 4J6TA 2ESVE 4TVPH 1WT5C 2HKFH 4YWGH 4G11A 1HINL 4TLUA 2Y7QB 4JM2A 4ZD3L 2F74A 2YWYA 3B2UC 4P5SA 5DEGA 3VD5A 2BY2A 3QEGL 4LBEA 1CFVH 1VACA 5AOLA 2WQUA 4G8FB 4QRPB 5FYKD 3O3DB 3OLIA 4FEIA 3AT9A 4R9HA 2VDRH 2J20A 1Y6NR 2BHUA 3L2MA 3MLPA 4Y2OB 2OFQA 1E6JL 1WCQA 3TOPA 4XN8A 2LTQC 1RK0A 2JJTC 2ZD0A 4YR6B 1S5IL 2W0FB 2QPUA 4B27A 1UWGL 3CZNA 1Q94B 4FS0A 2NX5E 3WIFA 1A64A 1IQWL 5JORB 5EU6B 3AGVA 1GGCL 3DJRA 2NUPB 4ZFZA 1SJEB 4HS3B 1OLLA 3FH5A 1O7DC 4IRSC 2B0SL 4F9PC 2ZP8A 5AZ2L 4MASA 3QJVB 1MNNA 1IM3D 4DHLA 1AC0A 3NJFA 3MLZH 1TVBA 3OMZA 2V8MA 3HG3A 2ESVD 4MWFB 2VZSA 1UYWL 2G3NA 4N9OB 1XTMA 4JKMA 5FCSH 4LU5H 4KZ0A 1WX2A 4PU2A 1AR1B 3NCWA 1YPZB 3WL9B 1OAUH 5JR1L 4KO9A 4RMQA 2KLRA 2A74A 4PGBB 1TETL 4YSAA 4FXKB 3ZMEA 2ARJQ 3VGEA 2IGLA 1J48A 8FABB 2YXWA 2F7OA 3K2UL 4ZO9A 5FV1L 2OJEA 3MODH 2FB4L 2AVGA 4TTDD 5T1LA 1IBYA 1NCDL 1BD2D 1FNHA 1HIML 1J1PL 4WI8A 3F6IA 4MD0A 1IAIH 3RL1A 2DQEH 2UXVA 2LQRA 4N4YB 5JDJA 5TE7L 1YMMD 1NGQH 3RY4A 3MHZA 4RLDA 4JQIA 2APWA 3WKML 5H8DA 2ZKHL 3BEWA 2HWZL 1AP2B 1Z32X 2BNRE 2FSDA 3KD4A 3Q8EA 4ZFFA 1UWFA 3CHQA 5FUOH 3LEVL 1AZZC 5BVPH 2HJKA 3GXTA 3PABB 3BSZL 4PSRA 5KSBF 1QO3A 3SYAA 1ZLVK 1WBYB 5A40E 2BVQA 3QFJA 2Y1YA 1HNYA 1YG9A 3D08A 3KPQB 4ZODA 4DW2H 4FXGC 2HT2D 1C5DB 1KC5H 4L9LC 3IF1B 4MZRA 1KIUA 4XE0A 5C7XL 3TO4B 3DGCR 1R3IH 2QQNL 5J57B 4JUTA 8PAZA 4IU2A 2EDNA 4RDQG 1IGFL 4H26A 5GJSH 5D1QE 1XF2A 4WFFE 3HVDA 4NSKA 4TUJA 4L3EE 4GO9A 1JTTA 4NO5B 2CH8A 3WS6A 5I8CB 2PPDA 4W9HC 3RWEB 1CU4L 3K1KC 3RUGA 4ZD3H 3PGDB 5GGUA 3HG1A 1DCLA 2E6PA 1AG0A 3QEGH 4GO6B 4G1MB 5DUJA 3D4ZA 4HKZA 4X5QA 1ZPUA 5HI4C 3N6YA 2RD0A 2BNRD 2MQGA 4Z18A 2D03L 1X9UA 2R59A 3WIHA 4O02H 4HOXA 3N40F 1E6JH 3FU9A 3LH2L 3MO1B 3CZGA 3MRGB 1S5IH 4X7SL 4ZNCD 1UWGH 3VFNA 4D94A 3B9KA 1XSOA 2WXIA 2DKSA 3OX8A 1IQWH 1T7XA 3BP6A 5K9OA 4F8PA 3BAWA 1GGCH 3PQYA 1EK3A 1WEJL 2FQGA 1MCWW 4R7DB 1U8CB 2ARJA 3KVPA 1D5ZA 2F19L 2VR7A 4JFTA 43CAA 3HUJE 3D52A 5IHBA 3HFFA 2B0SH 1S9KC 4NQCD 3ATDA 2W0KA 3MCKB 5AZ2H 4W1TA 3S6CA 4GMSH 5D1QD 2CKBA 4WFFD 4L3ED 4X5RA 1MEXL 3B34A 3MLYL 3TFKC 1UYWH 4BSVA 3AWEA 3O4OB 4XXWC 3WIFB 4NN5C 1BZQK 1G1OA 2EZ0D 5FO7A 4NIYE 2Z0BA 1FZMB 2CLZB 1FO0L 4ZT1A 5JR1H 2PCYA 2VAAB 1MQ8A 1D6EB 1GR7A 1IGTA 1TETH 2FIKB 2HA1A 2MNUA 3FO9B 4HIIA 2R39A 4MAYB 1KNOB 2XQYK 3NM8A 1RU9L 3K2UH 3V8OA 1SMAA 2FB4H 1E28A 4HJ0D 1NCDH 1NCUA 2PCPA 3DXAE 4F1ZA 1HIMH 1R3KA 4GRWB 1GW6A 1J1PH 4IDLA 4M8RA 5J1SC 4KU1A 4PTTB 2X4QA 1G43A 4GLRI 1TT6A 3KPSA 5TE7H 2VSMB 4KVCL 2CO2A 1L5GA 3AITA 3TWCL 5FHBL 4P2QA 2HG5B 3FHQA 1DVSA 4NNYB 3U9PL 3WKMH 1AXSA 2ZKHH 3TL5A 1E5CA 3VXSA 2JK5B 2HWZH 5B38G 2AFNA 4K71B 3RVXC 1TYJA 3J2PA 2J56A 3VA6A 4DZ8A 5ADOL 1WFNA 2CLVB 3L5XL 3U2IA 3LEVH 5IIEA 1UJTA 1WIPA 2G9HB 2WP3T 4I85A 5I6KA 3BSZH 1JWSA 4PLJC 3CDGB 3H0TA 5I1LA 2AEWA 5JHLA 3WJMB 4ENED 4JFHE 1K5NB 1WWAX 1G7IB 3FSWA 4Y4HD 3L3OC 1UXMA 2C26A 3JTBA 1ICTA 5C7XH 4ZUTA 2OAAA 2W59A 2QQNH 3EUDA 2OXHA 2AQPA 1IGFH 3KCPA 1ZLWK 2LLGA 1OTTD 1XAKA 2E8YA 3LV3B 1M7IA 1UQSA 3RGHA 1P4BL 1K72A 3SPCA 2XVGA 3WFBL 1IJ9A 1RKRA 3D39E 3T3PE 2GC4C 1CU4H 2RACA 3DXAD 5A2FA 3J7HA 3WE6A 4DOHB 3RE0A 4NKDA 3OB8A 2V3DA 3FB5B 2CA3A 4KHXL 2EE0A 4LHUA 1M53A 4IU2B 2XDHA 1Q8MA 4KZEL 3IBOA 1KELL 2FT6A 4V33A 3X11B 2QZQA 2H32A 1U8MB 3RVWC 3PY9A 5BXFA 2ITEA 2D03H 4RETB 5FHAL 2DI7A 4B41A 1OK8A 2XBZA 4A1RA 3IETA 3NCXA 3LH2H 1HQ4B 4OI9A 4OAWA 1MCDA 1JYXA 4WWKB 4KTEL 2GEQA 4PJAF 4X0KA 1WEJH 3G6JA 2GJ6E 3O11A 4QRFA 4HP5A 4Y16C 4ANXA 4L1TA 4PP2A 2F19H 2WXRA 1HHHA 5AAPA 3J07A 3SQOL 4Z78B 4ZUUA 3LEXB 5B8CB 5F6HJ 3HE7D 4JJ5A 5CGTA 3PU7A 4BYHA 4EE2A 4RNRB 1MEXH 3MLYH 4PV1C 3VYPA 3EO1A 4URKA 3D39D 3HMXL 1VENA 1N7ML 1JCVA 2YA1A 2P5WB 3IE4A 4IOIA 1FYHB 4OCXL 3ULUL 1INQB 4PYGA 4HUMB 3CDZA 4F8OA 4EZLA 1FO0H 5HYSA 5E6RB 1OANA 5E9DB 4Z10A 3AREA 1UH4A 1KCUL 3FBKA 3GSXB 3ZTJH 2J8OA 1KBBA 5KSBB 1I1FB 2OYKA 3ZLQC 5J12B 1O7SA 3TTYA 5JQHC 1RU9H 1T20A 2V4LA 3NFSL 5J9PA 4FTDA 1FIGL 1XR9B 4XNAA 5DI8A 5KS9F 2DLGA 3GHEL 1LNLA 1UD8A 2PXYD 2QV4A 3U1QA 3BJ91 4ZAKA 2VL5A 1RUPL 1UA7A 4HWBA 3LPGA 4KVCH 5GRJL 2X4OA 3BQUB 4D0CB 5EH1A 2GJ6D 5FHBH 3SBWC 3WN6A 1CS6A 4CU6A 3DI2B 2Q6WA 3U9PH 1K4CB 2CUHA 1SN0A 4FQXD 4POZD 4K5MA 2MPAL 1P5UA 3QUKA 3CHRA 4TNVK 5ADOH 3RNQA 4W6XB 4ZX3A 5GS0C 5AAWC 1DEEA 1W0WA 3NSYA 1CFTA 1IBZA 3QIBD 4UQ2B 5DJAB 1PYWB 1QASA 1RVFL 4QTIL 5E6ID 2A6JB 1SYSB 3MLUL 3RKDC 3T4AB 4AKQA 4PGJA 3ABMB 2I25N 5CU5A 4A2EA 1Y0LA 1CURA 5BS0B 2PP8A 1TTFA 2EIZA 5AZEL 3Q44A 3K8LA 3VSUA 2Z31A 4OGXH 1JZ5A 1U8NA 3SDCD 4NDMB 1P4BH 2VO8A 4JEGB 3WFBH 3DUUA 3JUZA 2YPKB 3HS0B 2X4TB 2WAQA 3PWUB 2H1XA 4JFUA 2NUTA 3AWXA 4U1IA 4CL7A 3U0PA 4PRNB 2C4FT 2WQSA 1KZQA 2FJGA 2VZUA 2PP9A 3O3EA 4KHXH 4O00A 4NXKA 2J5LC 2UY6B 3T6ZA 3OXRB 1KB5B 2VTFA 1KELH 2WGXA 4Q2ZA 3SDDD 1I1AB 5LO7A 3UP6A 3CFDA 3SCMC 2OXGA 4JRFA 2G75A 4M6ML 5FHAH 3PF2A 1WWCA 1MFNA 3FT3A 3HR5A 3K1DA 1TU2B 3FL7A 2WLIA 4DK6A 1O6TA 1GZHC 4M8QA 3VYNA 4KTEH 4R4NC 4X6EB 2ZUVA 4QUOA 5M94B 1N6VA 5DTFA 2JELL 2QFPA 4S0HA 3ZT7A 3V9CA 4KK6D 2ZG1A 2V7NA 3SQOH 2YD3A 4H2CA 5T3XE 1NGZA 2E9IA 1TKWB 5D6DA 3V0GA 3NQIA 4BA8A 4M1CC 4DP1X 1BAWA 1JNNL 1MFUA 1W8OA 4O2EA 5I6NA 1BMGA 2BOBB 3HMXH 3DVGB 1N7MH 2VWEC 4OIIL 2G5UA 5C08A 5DHVB 2J1XA 2VISA 4OCXH 4C57C 3ULUH 2BVPA 5EEWA 4R3SB 4J3PA 3DC0A 5F0LB 3DO4A 1JE6A 3RHWF 1ONQA 4CILA 4KK5D 4XCNB 5CEYA 1FL6A 3BIBX 2F6AA 3NQKA 4KRPD 3NFSH 3ARFB 1OWWA 2DLTA 3FF8A 3HIZA 4HAKA 2HLAA 1C12A 4NKMA 4XPFL 3X1BA 1FIGH 2DYPD 1T5WB 1FUNA 3EKCA 5M7QA 3EFOA 1EEUA 3T3MF 5EA0L 1ZTXE 4JREC 3GHEH 4KV5E 1IKFL 4PHXA 3RGVB 1KPUB 1RUPH 5GRJH 4HLZG 5I1JL 5KVDE 2Q7YA 4G82A 4RRPG 4LCUA 3T0EB 1K6QL 1N3NA 4PQXA 4NQXA 3S3JA 3RZCA 1TUPA 3FOMA 2MPAH 1JXDA 4PRDB 3VI4A 4FLSA 5T3XD 1OVZA 3C5ZB 3QXDA 3L9RB 4OJEH 1N2RB 1QLEB 2A4EA 2N7BA 2EABA 2EDQA 5E95B 5ISZE 1RVFH 3TEUA 4QTIH 4RZCB 5IVZB 1KTRL 1C08A 4PRAA 5K9JL 3MLUH 3TPUB 1S7VB 1UOLA 1RLWA 5CGYD 3ZDXF 5HDQL 2WLYA 2ZWZA 4UCFA 1TZGL 4S10A 7FABL 3DPBA 1T0OA 4Y9BA 5AZEH 1P5UB 2XI9A 4KROD 3C08L 3VTAA 2ZMYA 1N4XL 5D1ZC 4PJAB 2FJFB 1I8KA 4DZBB 4NKQB 4LOFA 5I19L 4F7EA 2Y7LA 1TJMA 1JF6A 3ECBB 1IAIM 4BQ9A 1WTLA 2QFRA 5F7EL 3T77A 2W1NA 3T0DA 4UQ3A 1QFOA 4EN3D 2VMDA 3WE1A 1MHHB 3EF4A 4NENA 1U8JB 4L9DA 1R24B 4IJ3C 2Z31B 3GRWA 3DYOA 1PZAA 3VWJB 4AQOA 1ODAA 4HJ0C 1RIHL 4WKZA 1Q0YL 1Q9LB 4WVRA 1CXLA 5KSVA 1G9NC 2NNRA 4JG5A 1SHXA 4H8PA 2WO2B 4M6MH 3HKFA 4EQ3A 2C1PA 5I74C 1JAEA 3MLXL 2EUVA 1S7QB 3FRPA 5IESL 1U30A 3ZQ9A 5ISZD 4OZIA 1X7SA 2F18A 2WYHA 3WLWC 1BZ9A 1QSEA 4CGUB 2FHFA 5CF3A 4X8GA 5JW5B 3U2JA 1DUZB 3WJLC 2JELH 1BWWA 1DVXA 1HU8A 3UEQA 5LKNA 2Z93A 2BNUB 5KS9B 3WDJA 4QMEA 4JZJA 2R29A 4IU3A 2G75B 5D7HA 2CE6A 2J1ZA 3F85A 4CJ0A 4J3QA 2EVGA 4AY0A 3VGHA 3KPOB 1WFTA 1JNNH 3MGOA 2Y6SC 1IAMA 1G7QA 3C6LB 4Y4HC 3U7YL 2HVBA 4OIIH 3V4LA 4XZUB 1FVCB 1GXEA 1U8KA 4GRWH 1OM9A 2G3ZA 5I23A 2KLTA 2BSSB 5GGRA 2V7NB 1OTTC 3JTSA 1AHWC 1SRDA 2OYMA 4YXLL 3ALXA 3EGDB 4YS4A 3F7RA 4RAUB 3ZOAA 4AGQA 4XPFH 4NQSB 1KCSL 3SKOA 4K8RC 1BECA 4Z3GA 4JPWL 3RIAF 3KL3A 5EA0H 1Y6KR 3S96B 3U2SA 3UPRA 3KL0A 1IKFH 1QRNE 2DM4A 2DAVA 1XD1A 5ABDE 3RURA 5I1JH 4X6DF 1B6UA 4UT6A 1K6QH 1TXKA 4FFZA 2VGLM 3WIAA 2ICEA 5CCHE 2V2XA 4NKMB 3MRJA 3LCYA 1RZIB 1VGEL 4PV9A 4R2GD 3ARXA 1B88A 3N44F 2UUDK 1USQA 2AEIT 2XKNB 2GK0A 3D50A 1HSAA 1RHFA 1YAZA 4GYBA 2UYLB 2Z7WA 1P9MA 3BMWA 2VM9A 5G2NA 5INDB 2EKSA 2FBOJ 5HHMB 2CM6A 2FVNA 5K9JH 1PIGA 5DD5L 5HDQH 3UDWC 1NKOA 1FNLA 2HFTA 1GOFA 5EPMB 1TZGH 4I0PB 7FABH 5IKCA 1Z9OA 2KH2B 2ATPA 2EC9T 3RZCB 3WFHA 4ABUA 4ISVB 3VU1A 3C08H 3W1ZA 1N4XH 1JZ4A 1KBVA 4XP1L 2X44D 1T03L 3QCUL 3NAAH 2OX5A 4TNWK 1KB5L 2FE0A 3C6EA 2LTQB 3OXSB 4P5RA 4K5PA 4I77L 5F7EH 1PL3A 4Y19A 2E7LC 3MRPB 1QRND 3QQ4A 3MV01 3WKNA 1YHPA 2WKOA 3UZVA 1DBAL 2IV9A 1UATA 3T8VA 1XSIA 4GLRH 4IRSB 2K7PA 3GEWB 4OGZA 1RIHH 4W4OC 1Q0YH 2Z91A 3DROB 3PV6B 5I1HL 2DM3A 1CD1B 2O5NA 3VU2A 1SJMA 2EICA 1RMFL 2ZCHL 3MOAL 2OK0L 3ASOB 1IVLA 1NFDE 3MLXH 4ZMTA 4OZHE 5FA4A 5IESH 4HK0A 4J27A 5F72S 3VD9A 2BSRA 4L5FL 4JFEA 1MVUB 4B9YA 5JA9A 5JOFA 4POZC 3RDTA 5KVGL 1SHWA 3UJJL 2QDWA 3T3MB 1JK9A 3M07A 2BIMA 3OKLA 4DKTA 5BOJA 2CQVA 3QIBC 1M7XA 2VLRB 3SJVD 1T1WB 1KTKE 3F58L 3N5AA 1LWJA 3OSKA 1AS7A 2ICWA 4QRSA 4Z7IA 2ITCA 2Q1EA 3QEUA 3L17A 3VYOA 4PREB 4IBWA 3U7YH 1MW1A 15C8L 4JFDB 4PUBL 3TA3A 4S1DC 3VGFA 2Y5QA 3TONA 4MJIB 2FH6A 3Q3GB 1KPVA 1WAAF 2CGZA 3L3DB 1P4LB 4XNDA 1P6FA 2H6PB 3AQDA 3QO1A 2I69A 4HGKC 2YN5A 4YXLH 1W0VB 3HZ3A 3MRMA 2WWNA 3Q9QA 4IOFD 4ADIA 4YVUA 1KCSH 2GFBA 2XG4A 2MCG1 1QOKA 2GQHA 4OZ4A 3CCHB 5CJOL 1QLEL 4JGMA 4W70A 1JYWA 2BCKB 4L9LB 1RSFA 2Y72A 3JWNH 3ZT5A 2JQMA 1HNGA 4KTGA 1BX2A 3FZUD 4PJ7F 2VSKB 1BOGB 5DJXA 4F2ME 1VGEH 2BZ7A 2P42B 3EJCA 5CS7A 1YEDA 4AEFA 2AS5M 3TM6A 5J89A 3WHXA 5T1KA 1M05A 3BVNA 4Q6YA 2VLJA 4V11A 3RY6A 2W9EL 2IAMD 1JF1B 3QRFM 3TLRA 2AZAA 3MJ7B 4IKKA 5JIIA 4PJEA 3U6XA 1FRGL 3MMEA 1RK1A 5E9NA 5C3IA 1E5AA 2YKKA 2H47C 3X1EA 4WZ9A 1JD7A 4N8VA 5DD5H 5HGHB 4OI7A 2X10A 5GSRB 5EUKB 2WQRA 3KPRB 1D2PA 4TQ8A 1WYJA 1Q9OA 4J3BA 1S9VA 1QHPA 2IO5A 3MBXH 5IM7B 2ICWI 2NTFB 5AVXB 2CK2A 5EEXA 1XGRA 2NY3D 2WK2A 3QIWD 5E1GA 2X6VA 1XGTA 4XP1H 3UTTA 3P1VA 1T03H 3QCUH 2YPVA 1KB5H 3FN0L 1BG1A 2ZKYA 4AK1A 6CGTA 1EPFA 5IW6B 4YZWA 4I77H 4UUJB 2ZXWB 4JRXE 2NLJB 2RR3A 4RDQF 3RWCA 3FB6A 2PUQT 4UDTB 4P49A 3VFPB 1DBAH 1ZEAL 3KWXA 1WBZB 2F53A 5E7FA 3DMMD 4G9FB 5IFJB 5DRXA 2AQNA 5BZZA 4GUPB 5I1HH 1ML0A 1T1YA 1QVOA 1RJYB 2GVYA 3ARSA 1N10A 3L95B 4M7LL 5LGKA 4J28A 1RMFH 4QF1A 2ZCHH 3MOAH 4YLQT 2OK0H 3MFGB 2RTTA 4KNQA 3K80A 4KO7A 4NN5B 1MFDL 2DH3A 2V9RA 4XX1G 5CO1A 2E8ZA 4XTRD 3GMLB 4L5FH 4JZNB 4FTVE 2YAFA 1FV1B 1WICA 4L4TE 2QHLA 2W65B 1X5LA 4YPGB 5LAXB 5BPPA 1G9ML 5DHVH 3UJJH 3VI3A 5KVGH 2Z7UA 4MDIA 3IKCB 2IWGA 2HFGL 2LAAA 4CW1B 3JV6B 3K4AA 5EZIL 1DQDL 4MMYA 1RUML 2HSIA 3CPLB 3VJ6B 1YJDC 4LHUG 1UACL 5MHSE 3KDMB 3ATFA 3IDGA 3F58H 4JY6B 4X6DB 3NJVA 1H15A 3ATEA 2QV2A 5C07E 1FCGA 3NRQA 5AOIA 2FEEI 1MQKL 15C8H 4FQQA 3RI5F 4PUBH 5DHYB 4JRXD 1R6VA 5AD0B 5IREA 4ACPA 1XCTB 3N44B 3OKLB 4NN6C 3GLZA 4HMCA 4LMQI 2A73B 3MNZB 1MVFA 2Y7OA 4LNRA 2HFEB 2XWZA 2ICWB 1O6SA 2A9AA 1I7RA 1OCZB 3LQAL 1LLAA 2QKIA 3FTGA 3NTCL 1HS6A 4TN9A 4L8CA 3TYGL 2MQCA 1G4MA 5CJOH 3SPJA 1P6WA 5C0BB 3MV11 1QLEH 3GSVB 4J3XA 2ZWNA 1GGUA 1DFBL 4FTVD 5EIIB 3HBZA 2UV3A 4BQ8A 1NCBL 5MEPA 3L3OB 2BSED 1BVOA 1GPOL 1KB9J 1ZANL 3TBWB 3V6BR 2IPUG 4JPQA 2COQA 4DEWA 2ERJC 5HYSG 5DZAA 1OXYA 1IZKA 5MHSD 5AW2B 3AGWA 1DBKL 2A74C 2JCCE 4OW6A 2W9EH 5HGBB 2NX5A 2NOYA 5I0DA 1EAJA 1LQBC 2ZG2A 3S2AA 1FRGH 3ZL4L 2Y6TE 4U05A 3P4MB 1P4UA 5AYUL 5F1OB 1DUYB 3NJGA 4X98B 2AQTA 3STZA 3OG4B 4JO2L 2VKXA 1F4YL 2YGPA 4J3UA 4QHKI 5FB8A 4JX0A 4X4XB 1AR2A 2LAGB 4J3RA 4Y89A 2IADA 1XZ0A 1J0KA 1DVYA 1NCTA 1I85A 3QZMA 3FN0H 4R0LB 1TITA 1QFPA 3MXVL 3BQVA 1L9QA 4W9GC 4PS8A 2QVIA 4HH9B 4XB8A 2FL5B 4WCYL 5D7KE 3HPLA 3IDMB 4N8VB 5GRYA 5E23A 4YAQA 3D69A 2A3TA 3WEAA 5GGTA 4W4NA 5KANI 4UILL 4Y16B 3QO0A 1J0JA 1ZEAH 2VSDA 4HSAC 1MF2L 1IBFA 3BCDA 1ZIBA 1NCJA 4PI2A 1LP9F 1ZT4A 3C60A 4DKDC 1JSYA 4M7LH 4N26A 2J73A 4TSAL 3OAZH 4XHJC 3LKSA 9PCYA 1P7QD 3IGLA 1MFDH 5C0IA 3P30L 1X5XA 1NJ9A 4E9VA 3VFWA 2PP7A 3NIGE 4U1LA 4JHWL 4HSQA 5CBEB 3QORC 2Y23A 3DYPA 3WS6C 3VXPA 5AG9A 1G9MH 3VD3A 3QIUA 3L1OL 5DWPA 3CVBA 3ILPB 4P07A 3ROOA 5TQ0L 1T1YB 1H3VA 2HFGH 1K8DA 3FT1A 2B3IA 1JZEA 3G6AA 1DQDH 2DWXA 3GNML 1RUMH 3QNFA 4X6CE 5EZIH 5B4MD 5TF1L 5TGBA 1UACH 1VZHA 5CSZB 3QUMB 2PR4L 5L88L 4XP9H 1OE1A 3RFZA 5DMIL 1NGXB 4YIQA 1DQVA 2W95A 4PJ7B 2E6QA 4YSDA 4M56A 1MQKH 5D7KD 4H40A 3ZJAA 3B9AA 4MDIB 3MVSA 4ZOAA 4ZW6A 3ZKXC 4N85A 3I6GA 5KSAD 4M6NL 1ZSDB 3IRPX 5EC1A 2EO9A 4N6RB 1OT1A 3LQAH 2J8UF 3NTCH 3RIFK 4P5TA 3BWAA 3TYGH 2N1KA 5L2KB 4A6YA 5EHFA 4I18B 2YMXL 4ZX5A 1E8XA 3MRRB 4ANKA 1DFBH 3FYIB 4LOVA 2FO4B 1NCBH 3GXFA 1IM3B 2OMVA 2WLMA 1UT9A 2NW3B 1GPOH 1ZANH 2YAPA 3AABA 3FU7A 4J3WA 4LLWB 4RMRA 4P4RB 2ESVB 3TV3L 2X2IA 4YDJA 4U1NB 1CGSL 2X42A 3ZDYF 3OHMB 3DIFB 1JPST 1RZ8B 1XCQB 3LS4L 2WNXA 1DBKH 3I6KA 4L8BA 1MCNA 4Z7VE 3NCCB 4PAZA 2K9FB 4JHUA 1M7DB 5SWQA 3VA2C 2H7WA 2IJ0C 3ZL4H 4Z0BL 2WBJD 4FDWA 5IQNA 5B1JC 2I07A 4KDTC 3JXAA 1D5MA 4NQEE 4XN1A 5SWSB 5GZOA 5AYUH 3HUJA 3NPSB 1PU0A 2J5LB 1P7BA 4W9IC 1BD2B 1CFQA 3NJNA 4JO2H 2KS0A 1F4YH 3VRJB 3SCMB 4LL9A 1E8WA 4ZPTA 5IVXF 3CSTA 4BE6A 2HT4C 4HMEA 5GHWL 2XQYA 1YMMB 3MXVH 3ZDWA 3P9MA 3CFNA 3QDMA 4HW6A 4WCYH 5DRZB 4JZOB 3EXJA 1E6OL 1OSZB 1A7BA 5J1AA 1JPFA 2H26A 3MRFA 4IOFC 4JVUA 4UILH 1MF2H 5KSUB 2B14A 5ACZA 2V0AA 4G70B 3RVVC 5ITFA 3ASNB 4IGBD 3EDDA 5DJCA 4F8TA 4IHBA 1RP8A 3ILQC 3DXAA 4TSAH 1PW3A 1OGTB 4WU5A 2IPKA 3ZRSA 3TVMA 2AC0A 1BM3L 3P30H 1GVIA 2O6EA 1R5IA 3APFA 4JHWH 2Q10A 4NQED 3CFIC 5EU4A 4H8UA 4NM4L 3L1OH 3TIEA 1DFXA 4EEEA 1YQ2A 3E6HA 3UACA 5TQ0H 1MWOA 4MJ5A 3GNMH 3TH3T 5TF1H 3D0VB 3UTZB 3TA4D 3D6GA 2PR4H 1A9BB 5L88H 1PDKA 4PP1D 2KQNA 5DMIH 4FNLL 4JREB 2ID5A 3V9FA 4QJ3B 5D2LE 3C2SA 3ESUF 2X9ZA 2BNRB 2X1WL 3QIWC 1AJ7L 1UVQB 1I8LC 1UURA 4KJYA 4M6NH 3OB0H 4YUEL 1F90L 3UL4A 4KY1L 3F84A 3OLEA 3V6OC 2TAAA 1MH5B 1NIEA 1ZHNB 2WXFA 3ALWA 3D39A 2EE2A 3WTSA 2B4CC 4JDVB 4OCSL 1Z9MA 2VW4A 4P6RA 2R2HA 4KUZL 5CLYA 1I7TA 1J5DA 2P7TA 3NESA 2YMXH 2NYKA 1MCSA 3UGUA 1FGNL 4NQCB 3SPVA 1UHVA 4PM1A 5HHOE 2IVFC 5D1QB 5A2KH 3MV8E 4L3EB 4RISL 2C8NA 1Z5YD 3TV3H 5EC1B 1D3CA 3KBPA 4DP2X 3L4ZA 1CGSH 2NXZD 3RTQA 2H0FA 5CEXB 4GG8A 2Y5TB 4QXTB 1JN6B 3LS4H 2WIIA 2JB6A 2PXYA 1VHPA 1IL1B 1MFAL 5HHPB 1IAKA 4HIPA 3TYFB 4F3FB 3DRQB 1LP9B 4F7MB 5EZJA 3SE9L 2GJ6A 4NUGL 4OCYH 3HG0A 1C9SA 3WY3A 3QWRD 2FEEL 4FQXA 1EAPA 1BW8A 2X70B 1GSKA 4N2BA 3V0EA 4Z3HA 4ZAKC 4RMTA 5CMAA 4D9RE 3D8MA 4C58B 3FQWB 4F33A 5EUOA 4XN4A 1LK2B 3CIQA 5GHWH 5IBUG 5E6IA 1KN4H 1PKQB 2MNJB 5E70A 1GA2A 3QXVA 4Z7OE 1MCCA 1AKJA 1P1VA 1F6FB 3LSOB 3L3KA 4WHYG 2ZZUT 1E6OH 3PHSA 5HHOD 1CL7I 3QG6B 1ZK9A 2BIOA 2CXKA 3MV8D 3FO1A 1HXMB 5HBBA 1YC7A 3K6NA 1IGIL 5H35B 4XB3A 5FA3B 3T1FA 3K72B 1MG2C 4AWJC 4G8GB 5L4IA 1Z0NA 1HVXA 1XR8B 3N43B 4GINA 2VDMB 1FVEA 4Y4HB 3OKDA 2WY3B 3FRUB 3P0YL 3QFGA 5AALA 3CSYA 1BM3H 3QUML 1WISA 4O2FA 1SYVA 4HIJB 4M61B 4B6ZA 4S1SL 2K4AA 3NN8A 4KJPC 1OT2A 5EO1B 3UZQA 4DVBB 4X6FA 1SY6L 3BZ4A 3LB6C 3DECA 1K4DA 3QWOB 2J8UB 4MXQD 2MQ0A 4NM4H 3SDDA 3ZBMA 4BHUI 1AHWB 5ITFB 3TEXA 1OE2A 5TTRA 4OCMC 3VRLE 1QHOA 2Q2EB 2PETA 4N5UA 4A7GA 8CGTA 1UWYA 1WG3A 4X7TA 3QQ3B 2EUXA 5FDWA 1DBBH 4FNLH 1ETB1 1UH3A 4R5VA 5GS0L 3WMQA 4JNXA 4Y9FA 1NAKL 4Y2NA 3TTSA 2NZ9C 2PWFA 1MXDA 5D7SL 5HGDA 2AGJL 5IFAL 2XG5B 1AJ7H 3FT2A 1G6VK 4L3CA 2Y22A 2P1YA 4YUEH 2H9GA 1F90H 2V5TA 2HCZX 4HPYL 4KY1H 4LGRB 2FR4B 3G04A 3GMMA 1U92B 3Q13A 4PRIE 4D7PA 4A38A 4ZMAT 2V6HA 4LEOA 2WUCL 3AUVA 1KB9K 4OCSH 4HZAA 1ZV5A 4KUZH 1SVZA 4EQ2A 4QTFA 2BRRL 1DBMH 1FGNH 2K6ZA 1XBDA 2VO5A 3O2WL 5IVXB 1TQBC 1YY8B 3HE7B 5CD5D 1QSZA 4XRCA 1HJCA 4KX7A 1E90A 4RISH 4IK7A 4WY7L 4M7ZB 5F1SA 4FFTA 1F58L 3MLWL 3HHMA 1KXQE 3T6QC 2DIAA 4DP6X 1CE6A 3IAPA 4JL1A 4XPHL 1MFAH 5J6SA 4WUKH 25C8H 4NC1E 1R0AL 2WVSA 5K39A 2HFFA 3RVTD 1OAQL 2EDLA 1FYTB 3SE9H 4NUGH 2GKIA 4J23A 5FKAB 3KPNB 2DWEB 4NQQA 4QD2E 4JFXB 4U6YA 4X5XB 4LCWA 2WXMA 1NCHA 2EILB 4E9QA 3MFFB 3UO8B 3CFEB 3CN1A 5DD1L 3DDFA 3OGCA 4GW5B 1UJ3A 3AM8C 4N22A 1HAUA 2H8PA 2EUWA 4IKIA 4ZX4A 3ULVH 3GSUB 4AW4A 5KSAC 3KXFA 2AV1B 2FX8L 2OJZL 3ZRFC 1EAPB 1NC2D 1RULL 3S3CB 5I16B 3FO0L 4MJHA 4R26L 4IBUA 1XH2A 3NEXA 1EXUB 4YHML 3TEWA 3ZYIA 3QIBB 3RQ3A 3BP4A 2O6FA 3E9TA 1IGIH 3H2PA 5EU7C 5IJCC 2R7EA 3UYOD 2YBRA 4EN3A 3M1BB 3P0YH 5IV2B 4BDVA 1YRKA 3NZUA 3QUMH 1QPKA 3OKOA 1C8QA 4S1SH 1VZGA 1J5CA 2CUMA 2Y9XA 1XHHA 1KTLB 1Q9WA 1SY6H 2V17L 1MZZA 3V0AC 1OV8A 5ERWA 3SDCB 1M9WA 5KJ4A 2DQGL 4NCC2 3MV7E 4DGWC 3DNKA 3IB4A 4TUUA 4L0ZA 5JXED 1S9YA 3GMNB 4A2DA 3MPCA 5F1IB 3L08A 5IQ7L 4N2OA 4NT6B 3VFOA 2YD8A 1U8QA 4UQCA 5ISZA 4V1DA 1U6AL 4FA7B 5GS0H 1P5VA 2BY0A 3GBEA 1PTZA 1NAKH 2ZWDA 3SDDB 4UIMB 3BRGC 5D7SH 4W81A 2AGJH 4YSUA 5IFAH 3PRZA 3AT0A 5ANMA 5KBPA 4YL4A 4ZZFA 4HPYH 1V7NL 1R3HB 3C12A 3IN2A 2WUCH 1FE8L 1LEKA 2R0LL 1CFNB 2AXHA 4P3CL 3SGEH 5FFGA 2C4XA 2CM5A 2Y06H 2WW8A 3GTTA 4JZJC 5KBLA 5CP3A 2BRRH 3KWUA 3O2WH 4HOZA 3S36L 1OCRB 4IGBC 3QSKB 5CR8A 5AB0A 2BSDA 1CF8L 2WLJA 2XQ0A 4WY7H 4P05A 4ZSOA 3VWKC 1BF5A 1GRWA 1F58H 3MLWH 5DMGD 4RFEA 4R90L 4ZOCA 2BSCA 5E4IA 4GNKB 2MMXA 5I18L 3QNXA 3HLKA 1G9NL 1EERB 4XPHH 3UJIL 4MCZB 1R0AH 3CQQA 1OAQH 5IR1A 5B3JF 1HHGA 1WK0A 4XC3L 4DPBX 3LN4A 2BOCB 5HXMA 1SOQA 4KRPB 4PS4L 5ICYB 1KY7A 4BKTC 4KNUA 4POYA 2DYPB 4JRLA 3HAEB 3NG5A 5KOMC 1HH6A 5PAZA 3FQXA 2FLRT 4G8EB 3RWGA 1U3HD 3Q0HA 3BXNA 3F62A 4WU7A 1EO7A 2P47B 5DD1H 3IJYB 5I75C 1ITBB 1J05B 1IIKA 5LGJB 4Q8BA 2CO7B 2ICEC 4TRPL 4MQXC 3OKNA 2GC7C 5SX5K 2VDML 4HJIA 3RB5A 1LE9A 5F1NB 2EC8A 2FX8H 2OJZH 2EDMA 1TTUA 4JQVA 5E08L 1RULH 4X5PA 3FO0H 3N40P 1F3JB 1F97A 3AAZB 4QHUB 4CADA 2EYTA 1KF9B 2GT9A 3Q5TA 4YHMH 1TZIA 4F27A 4FYTA 2Q2LA 2BFVL 2EP6A 1CFSB 2WM0A 3L1GA 1B4TA 4FYSA 3IMBA 4BRJA 1FG2B 1O0VA 1DEDA 1QRNA 3ZKMD 4LRNL 4K8RL 2CR6A 4MA1C 4OZHF 5ICUA 3BDXA 1SVBA 5DZOA 2V17H 2NXZC 4NN6B 5AL8A 3W5NA 1JGLL 3HZVB 2DQGH 4K9EC 1CI5A 4A55A 2E4FA 2R7EB 5D4IA 3RU8L 1HHKA 3REWA 5IQ7H 1FFPB 1HOCA 1NC4D 2HLFC 3SDAD 1PS3A 3WNIA 3F7VA 3GXUB 2M2DA 1U6AH 2FWOA 1DJYA 1CD9B 1KYAA 3RA7L 2DQCL 4YDIL 3ABGA 5DFTA 1DZ0A 4XP5L 2XRAL 5AW3B 1BFOA 2JMRA 4NJ9L 3IBEA 1WS7A 3RAJL 1RZQA 1T0MB 3M17A 4FN0A 4CNIB 3K6SB 1YCSA 3SB3A 1CL7L