3I85A

The crystal structure of human emmprin n-terminal domain 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
79
Chain Sequence
AGTVFTTVEDLGSKILLTCSLDDTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cervical EMMPRIN
publication title Structure of the EMMPRIN N-terminal domain 1: Dimerization via beta-strand swapping.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 79
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i85A00
5FB8B 4JFXB 4M5ZH 1OB1A 1EO7A 1DDHA 1F97A 1MPAH 4UDTA 1U8KA 1BLNA 1N2RA 3BIBX 2X7LA 1WLHA 3HMWL 4MQXD 5F7YC 3BXNA 4LCCB 2Y6SD 1JGUH 1W72H 2EE6A 4LVHC 4OQTH 5DURB 3IJSB 2YD5A 3O3BB 4G6KH 1L4IA 1RUAH 2DQTL 4Y4HD 5GRJH 3KLHD 1QNZH 3X3GL 1TVHB 1LD9A 3GMMA 2P5EE 1LO3L 4MA8L 1Q0YH 1XGRA 1YDPB 2QHRH 1AQKH 2Z4QA 3OXRB 3PGCA 4C56E 5IHUH 3BZ4B 1QFWM 1EAJA 2GJZA 3IXAA 5GRUH 3EOAA 3HZKB 4XMPH 4Z7VE 5LXGL 3A0OA 5D2LE 1IE5A 4GG6A 2VXQL 3KYOB 4YDKL 5IBUB 1FZJA 2EE9A 5FUOH 4PV9B 2J2ZA 3EDJA 4UUJB 2A74A 4CADA 4G8GA 4HJGB 2P48B 2WUBH 4CJ1A 4P59L 3TA3B 4Y1AB 3TZVD 1J0IA 1TVDA 1HCFX 3L3HA 4G6ML 1FNFA 4WNQB 1C7TA 1MJUH 4QOKB 1FL6B 2CGRH 1JN6A 5J1AB 5J4MA 4HCRL 4XPGL 2MQ3A 4XP1H 3S8WA 3T4YB 3HI5L 2BY0A 3HZVA 1C5DB 1T0NA 1H8OA 2BVOA 5D1ZB 1FNGB 2ITCA 1KIPB 3QIUB 4ZFFA 3VFRB 5DS8B 1B3JA 3LN5B 2IPKA 1PDKA 1ZS8B 4DEPB 3ARYA 1PG7L 2OQJB 4OCWH 2WIIA 2F54B 4R0LB 5I1HH 3U2SB 5EZIH 4JZOA 1JWMB 1BVZA 1OAKH 1QLFB 4PJDE 1YPZA 5CKGA 5IMMA 1S9VA 1S7UA 1MQKH 1F58H 3OQ3B 5J57B 4P4KC 1T2QH 3VXSD 4CU8A 2ADIA 4FQXA 4J8RA 4M4PA 5GZND 3DETD 1X6LA 1QRND 5JXAH 4JFED 5DQJB 4PJGA 1D7FA 4HKJB 4CMHC 3MREA 3HAEG 5DRWA 2IG2L 3QIBD 4OCRH 1KPUA 1YYML 2VITA 4X6EB 5KSVA 1Q9KA 5D5ME 1UVQB 2XXCB 1N5AA 1QHOA 4H1LG 4P9HC 4KHXH 3HS0B 3WD5L 5IMLA 3FB6A 2AK4A 2E7BA 4UIMA 4XWOD 4Y4HA 4HWEH 5BV7L 4IOIB 5ANMB 5I1IH 1MELA 4HC1A 3PL6B 4G43A 3QUYC 5I0DA 2J8UB 4Q7DA 1VGKA 2B0SH 2BNQD 5ENWB 3HC4L 1VFAB 3WKMH 4BSVA 5D8JL 3SBWA 3WXWL 3ULSB 3IFLH 2CIIB 2R4SH 4Q58C 1JNNL 5EDXA 1UM4L 1HIML 2JLLA 2AEWA 4GMSL 3B2UD 2XTJC 3HI1B 2D9CA 5CJXC 2C1PB 2YEZA 4YC2B 5FK9A 5B3JE 6FABH 4JQXA 5KG9B 1NGXB 4P2QD 3X12B 2YWYA 5JHDA 1CI5A 3BHBA 3TZVA 4E5XB 4HJJH 1HILB 3F5WB 4TVSa 4ETQB 3DGCR 3I6LE 1XF4A 4PRHE 3VMNA 1S9XA 1PFCA 4LAJH 2AXFB 1BOGB 3MRLB 3S37H 3NFPB 5ACZB 3V0WL 1P6AB 3FO1A 5EFIA 2APWA 1U9KA 2OL3B 1Q8MA 2H6PB 3GJFH 5B21A 2BZDA 5ACLA 3M17A 4YHYB 4NNPL 4I0KA 4EI6A 3O2WL 4G8IA 3U46B 4P5TB 2ZPKL 1QR1B 3B3IA 3G5VB 1ZLSH 4J1UA 4CN6A 1KCVL 4U7SA 4F7CB 1S7XA 4YPGB 3BUTA 2AV1A 1KNOB 1WGOA 5GS1A 2BC4A 3GSRB 5CSZB 1CFNB 3U48A 4AMKL 1OD7A 1WSST 3VXSA 4Z7WE 4JR9L 5AZ2H 5E2VL 1QRNA 1JYVA 3KPSB 2YA0A 4GMTH 1MRDH 4JFEA 5IFJB 2HTKD 4QY8B 1I75A 3D69A 3QEQE 3DSFH 3O3UN 4NKMB 1E4WL 3WE6A 3D25A 3QIBA 4WWKB 5IEHB 1PD6A 1T89A 5BRZA 1I8MA 4PFEA 1KXQE 3MZTA 4NJAL 3ROLA 4ONFH 4NKQB 5H35B 1IAMA 5DJCA 4OCXH 3DMMD 2L4OA 5DJAA 3QULA 3W11D 3H3PH 1J05B 5C0BE 4WTZA 3PNWB 3QCTL 3CZFB 2OJZL 4I3GA 4Q9BA 3D39B 1AFVL 1M7XA 1YZZA 4FXKA 3IFOA 4JG1L 5EBMB 4F80A 4Q0XH 3RWEB 5HYSB 3S9DB 2BNQA 3RVXC 5JW4Q 4OIIH 1FQ9C 3AS1A 5DJ0A 3VFOA 2F53E 4MA3B 4G5ZH 3NCJH 3RNQA 1XR9A 4OF7A 1BGXL 4OLVH 1CDYA 4M6NH 2DWEA 3QPQD 3STZA 5JHLL 1YEHL 4WEUD 2VMFA 4JRWA 2OCFD 3KPLA 3LKQB 1NLDL 3R0NA 4L1HA 1I85A 4JM2F 3ZZ1A 4KQ3L 4X9BA 4P2QA 3TPKA 4L3CB 4DN3L 1PEZA 2FYYB 3U36A 5JLZA 1GSMA 5JDSB 1BBDL 3VXME 2DLHA 5HHVH 4U0QB 1ZGLP 5KJRH 4C57C 4ZFOL 3IRPX 5F3BB 4P3CH 1Q9OB 2I9TB 4MYWB 1KACB 3B6SA 1WAAF 3NBNA 2JELL 3VJ6A 1KLUB 4PJAB 2IH1A 3C08H 4JGUA 5TDPB 4CNIA 5ADOH 3V5HB 5GS2H 4NZTL 3CZJA 1NC2D 1AGEA 2I60H 3T3MF 3DX8B 3P9MB 4ZOAA 3PWLA 3U6RA 1FL5A 4V1DE 3O6FC 3OAYK 4HAFA 5BVJA 2EXWC 3T1FA 1H3VA 2F8VA 1CLYH 4QXTA 1RVFH 3CMGA 4U0RC 3KJ6L 4GG8A 1X5KA 3QDAA 4XVSL 2BK8A 2D7OA 5ESAA 5E8OB 3BQUC 1NGQL 2W92A 5IEKB 4XI5C 1GIGL 4IRSB 5I1CH 5JOEA 1KCSL 1U58B 5C8JB 5JQ6H 2PCPB 4ZUUA 1WTLA 3O3DB 2VO5A 4PJFA 2F5BH 3EBAA 1YY8A 1HQ4B 4CKVX 1F3JA 4DGYH 2N1KA 5A16B 1JNHB 2DQCH 1W72A 1HHJB 2W0PA 4OQTA 5DA0B 2YS4A 4BYHA 1Q94A 4JO4H 4QWWC 4KZEL 3OGCB 4M48H 1NEZG 1BQHA 5AD0A 1RK0B 4ZMAT 2ENSA 2CR3A 4F33A 4X7EC 4TUJA 4HS8L 1G9EA 4RFEA 2VXSL 5GZOC 3DVIA 4DQOL 3DMMA 1K6QH 3TCXA 1JWUA 4ORGA 4P4KD 5I17B 5LGJA 4DN4L 2ORBH 3C6SB 2JB6B 4P3DB 3VXTB 4HIHA 4GRLD 2AJYL 4K3GA 3NIGF 4H88H 1QA9B 3VFWB 4UNVA 4PGBA 3JTSB 1FFNA 1OPGH 3B9DA 1D5IL 3DBXB 4FNLL 4YDIL 3T2OA 5D6CB 2IF7A 1ND0B 2GT9A 3KS0J 1RK1B 4JLRB 4LF3B 5IK3A 3VFTA 3V7MA 2R2CA 4ZPTA 4QXUL 4BSWB 3ARVA 2X42A 4YHOL 2VAAB 3H9YA 3UTPD 2BNRD 4M3JA 4M8QA 5F72S 4Y5VB 3DOSA 5J13B 5EU7C 4PJXA 4DW2L 1FAKT 5FO9B 4JO1H 3JSSA 4XHJC 3OKOA 5E9DD 1IMHC 5FV2A 2WUCH 3GNMH 4NQSB 4UV7H 3BDXA 4OF8A 5M94B 1NCAL 4CAGA 1T6VN 4Z8FH 3HN3A 4KV5F 5DSCA 5HYEA 4WU5B 4PTUA 5K33A 1J1OH 2VZSA 4MB3A 4CL7A 1C16B 2V7HB 1MCQA 4DKEH 4HXAL 4XCCL 2FZ3A 4X0KA 1KTLB 4JCLA 1IAII 5JW5B 2JJWA 3KYMA 1QEWA 4NJ9L 4POYA 4HS3B 1JE6A 1KC5L 5DVOA 3MUGB 2WANA 5TQ0L 1CGSH 3ZKMC 1VFUA 4QRUA 4JJ5A 1UH4A 4NO5B 1SVCP 2JK5B 5IHZA 4G6AC 3WHXB 3ZT5A 4JHWL 4QHKI 1T1XA 3TBYA 1SBBA 3CNKA 1U93A 1GH7A 1JFQH 3RIFF 2ESVD 4AM0A 1KENH 3K4AA 4PGDB 4RAUB 3L3OB 1PY4A 3TBSA 1PLGH 1ZHLB 3KDMB 5C1MB 5M7QA 5MENB 3UCRA 3BT2L 3P0VH 4B7LA 1F13A 3ZLQC 1B0GB 4MCZB 3VRJA 1JPSH 5HHXL 5E7FA 1NBZA 4Y2OA 3SDYH 4FP8H 3R0MA 4M61A 1ZT1B 1N0XL 4ODBD 4RNRA 1OW0A 1BBJA 1N0LA 2NY2D 3UJIH 5KTEH 2DQGL 3ZT6A 1RU9L 4EXKA 4UZGA 5IGXH 2R2EA 1CK0H 4P4KA 1MI5E 4KKCC 5JMRA 5EN2B 4GS7B 4M62H 5HGBB 2X4SB 4GRLA 3UO1L 2Z0BA 4JZNB 1LEGA 1W0VB 2AJZB 2A6IB 2Q8AL 4QHKJ 5D96C 1NCCH 1CICC 1ED3A 1I7RA 3UTQB 3L9RB 1ES0A 2VDNL 2UY6A 4H20H 5C0GA 1D5XB 4PJIB 1LVEA 4PRBB 4QHMA 5CJ8A 5I73B 3V6FA 1HWHB 1I9IL 4R4ND 2W60B 3I75B 5I9QB 3I85A 2G75B 3MJGX 5EO0B 3SDXF 1MCSA 3LRSA 5LWYL 2IFFH 3RVXD 4JM2B 4QHUB 5KZCD 4RBPK 4LFHD 2Z91B 3QEHA 2EIZA 5KSAD 3RIFK 3GI9L 1FAIH 4PJEA 4L3AA 5GS2D 1RHFA 2PN5A 3MRMA 5GIRB 5BMFH 1I7ZB 5LQBL 4BQBA 4GAGL 3GJFA 2I07A 5F7EH 1T66C 3QZWB 5C0AB 4P49A 3ARBC 3CX2A 5I1GH 1FZOB 3A6CL 1A3LH 3HC0A 5E5MB 5GS0L 1U3HC 2DQJH 3R8QA 4NO3B 3BD3A 1CR9L 4GKZA 3ULUE 1QSFE 3BKYH 2ZOKB 1EH9A 1ZT4A 1VEMA 1RUQH 3JTTB 2ESVA 3GM0A 4G6FB 3D9AH 1P4BL 5BCAA 2CD0A 4N90D 3U0WH 3SCMC 3H3BC 4OZFH 2APFA 3CAFA 3HB3C 1HXYA 5FGBC 2FATH 4YHML 5HHOE 5FIEA 4XTRC 1XGYL 1EVUA 1U3ZA 1VSCA 3KLAB 1P53A 1J5OH 4P2OB 3GB7A 3OX8A 5DK0B 4X6FB 1PKQB 3BQUD 5D4QA 2YD3A 4X6BA 1RZIA 5CEYB 1C5CH 3B8SA 4KRNA 2M26A 2X89D 2ZOLB 3D1MC 3IDNA 4N0UA 2QTEA 2YBRA 3K7UA 4M7ZB 3MGAA 4KMLB 3UP1A 3EFFA 4QWWD 5D2NE 5D1QB 3EO0B 2WWKT 5CCKH 4QF1B 4OI8A 1CIUA 1NEUA 2F19H 1CG9A 4P5KB 4DUWA 4LK4A 1OSZB 3PGDA 1IEAA 4RMQA 2LE9A 5GZOD 4FMKA 3BRGC 1OOAA 3TGXA 1FRGH 3UDWC 3DYPA 1DLHA 3MCLL 1CBVL 1EDQA 3SN6N 3P2TA 2Q76A 3O45A 4Y4KB 3S37X 1S5HA 1QTYT 1S7QA 4WUUE 5F1SA 3TA3C 3DO7A 2LAAA 4RRPA 3H9SE 1CFTA 2Z31D 4XCEB 5KSAA 2CK0L 2Y7QB 3WDJA 2GUOA 4MS8C 4ZUSA 5A3ID 1QFUH 1WBXB 3UTTE 3ZE1E 3I3BA 3MBXH 4PGEA 4Z76A 4XNZB 3E3QE 2HTLC 5D1ZC 43CAA 1Y6KR 3CXDL 2APVA 3QIUC 1PSKL 1L6XA 4K3JH 1FC2D 4LSRH 5J7CC 4NM4L 3DURB 4PBVC 4ZO7A 5D7LE 3C2AL 3ISWA 4PJBB 2NYYD 1TXKA 1TJGH 4R0LC 2D0HA 3BP5A 4XHJD 1JF5A 1SJXA 2IBZX 2ATPA 1WBZB 5B38A 3FCTA 2GTWB 3NA9H 3UZVB 1FFRA 2F74B 1DQQA 2CRYA 1G6VK 3CCHA 5E94A 2F9BT 3T0VA 3ZHDA 3PWPD 5EG6C 2JB5L 3JWOH 4XNYH 1ZLVK 5F89A 3MBED 4XWGH 4OZIA 5HJ3A 2NX5D 1KXTB 3S96B 3O41A 3GMNA 4NUGH 4BFGA 2IH3B 3UJTH 4EQ3A 3ZKMD 1Q1JH 2WLYA 4O2FA 3ECBA 2FH8A 5HDQH 2QQNH 1HZHL 3BQUA 3GK8H 3PWUB 4NO0D 2X89A 5IMOA 1TDQA 2ZKHH 4U3HA 3GBNL 5EORH 3PL6C 4O2EB 3ARQA 3N0PB 1V3MA 4YDLB 2BERA 1B6UA 4YNYA 1WCBA 3P4OA 4MNHB 4S1SL 3QQ4A 4ZG1A 1U41A 4JRYE 2DQIL 1G6RL 3T0EB 3MV9D 5EA0L 5SWZE 2RIKA 2GFBB 4OFVA 3V8OA 1S9YA 4HXBH 2YPKA 4MJIB 2A6KB 3WIFB 3ARUA 4OF6A 5GRYA 1R3HA 4GSDH 4YC2C 3FFCD 4CMMA 2EEDA 3FN0H 5L9DL 4KKCD 2XZQH 4JFPB 1FNAA 1JVKA 1DBJH 5EZLA 5TDNA 2Z31A 2VTFA 2MHAA 5HYQA 3FRPA 3QFDA 5DD3H 4OF3A 5CWSB 1CE6A 1CICD 1R5WB 2KKQA 3GHBL 4N0RA 4NC2B 5EUOA 5CGMA 1KCLA 4RIRB 3HRZA 4RGNB 5ETUB 3MGTA 5JOFA 1U6AL 5F6IB 2NTSP 1NFDA 5CHNB 4GG6E 2B7DT 3DV6B 2H32B 5HI4D 1MAMH 2XY1A 1UWEL 3O4LD 4YR6B 3RJQB 4Z7VF 3VXPB 1HKFA 1HHGA 4RMRA 4F58H 5T3ZL 1ZHBB 4X4XB 4YHYC 5D2LF 3AB0C 1AI1H 1I8LC 2Z35A 3QPXL 4JO3L 4P5TC 4D9QD 2HVKB 5GGSY 3MLZL 4JKKA 4NQEB 1MAKA 4HDIA 1Y6MR 2R39A 3IJYB 2V9TA 4JVUA 5FYKL 1K4CA 3RGVC 1SY6H 3PWPA 1N7MH 3W9DB 1T66D 4KUZH 4HSQA 2AEPH 4MJ2A 4Z95H 1KG0B 2WM0A 1QLEL 3MBEA 5IOPB 2NX5A 1MHPH 2AQ1A 3FONB 4PREA 2CKBH 5ADPL 2O5ZL 7FABH 1DL7H 4WWKC 5FM4A 4UNTA 2OL3H 2V17L 4YFLI 2C5DC 2BFVL 5IVXA 4PB0H 5MHSD 4AEFA 3WFCL 3BMWA 3WIIL 5DHVB 2FX7H 4Y19D 4NO0A 3CVHB 4X5XA 1YPZE 2D7TL 4L9LB 5BS0B 1NAMB 2UVEA 1A9BA 5ALCH 2DMBA 5IFAL 3SCMD 3ARWA 4PJDF 3ESVF 5DYOA 3U7AA 3EO1A 5DMIL 4Z77B 5JIHA 4DTGL 4HPYH 4K9EL 3OAUL 1R24B 2IQ9H 5FDWB 3RAJL 4XTRD 1I3GL 4UTAL 3RWFA 2XV6B 3MV9A 2YK1L 1DQTA 3SY0A 4KAQH 1I8IB 1A7RH 4RSVA 4WI8A 3OMZA 4JDZB 3BKJL 5J6GB 3FFCA 4LNRA 2YMXH 2DQHL 3DXAD 4HUMB 2FIKB 3NOIA 2XWTB 2AK4E 3QXUA 5HXMA 4QRQA 4LHUD 5D5MF 5E24E 5T1DL 1NGWA 4ODWB 3VG9C 1CICA 1DQML 1PYWA 3KPNB 4PGJA 1XFPA 2E9JA 1TZIA 3C6LD 1T1YA 4LSDA 1JHKH 3VCLA 5F88B 3S35L 3T65B 2CXKA 2D4FA 5D72L 3QISA 4HZAA 5DD6A 4P2RB 1ONQB 3DUSA 2GKIA 5EZOL 3L6FB 1KIRA 1KJ3H 2YPVH 5D70H 2RFXA 5DR5H 1YEEL 1IM3A 1BVLB 1CLOH 5DGQA 1FZKA 3ZKSD 5JHDE 2Z93B 1F3DH 4I3SL 4YUEH 2B8OT 5IR1A 1MFBH 3GI8L 5B3JF 3MR9B 4XZUB 2FJFA 5E8NA 3BW9A 2EZ0D 5E6ID 3WEXB 1N5YL 4IRSC 1AO7B 5FKPA 3NIFE 4OZFA 3GO1L 4H8WH 4TRPH 4UT9H 4WW2A 3HCVA 3TCLA 3QA3B 1YMMB 3OKYA 3QIUD 2VR5A 3JZ7A 1ACYL 4OCSL 3GMLB 4BA8A 1YNTA 1TJIH 2DLFH 1B90A 4JFOA 1PX3A 1EERB 4OLUH 2WQ8A 4KQ4H 5SX4I 4JPKL 1JGDB 2OTUB 2CRMA 4WEBH 4Y19A 4HF5H 4XNMB 3JWDL 3ARXA 4JN1H 3P40A 1F8TH 2E8ZA 5HGDA 1MJ7L 1INDL 2VQUA 3LKPB 5CJOH 4XGZB 3TVMD 3SCMA 4XBGA 3VXSE 3BP4A 5FGBA 4GUPB 5F3HA 4QXGL 4NNYA 4Z7WF 4GQ9H 3OR6A 3O8XB 1PAMA 1YQ2A 3KPPA 4LGRB 5BRZE 4O51B 1U8MB 4JANB 2QQLH 1DFBH 2BHYA 1EA9C 3IJSA 2AJSL 5GGRB 4XP5L 4F57H 4Y5VC 2J6EL 3DXAA 1MCOH 3EOBB 1R3LB 1TVHA 4WW1A 3I02B 4LHUA 2ICEB 4ZQKB 4UU9B 1AKJD 3S7GA 1IFHL 1YDPA 3N85L 5GRJL 1UB6B 3N1GC 3MODH 1YEKH 3BZ4A 4HUNB 3C6LA 1UXWA 2EDKA 5EO1B 5L7XH 3HZKA 1FFOB 2YPLE 1ZANH 2EXYC 5C08B 3UDWA 1L0QA 4PBXA 2JIXB 1BIIB 4XMKL 1UG9A 1GYAA 1KN4H 3P9WB 5T1KB 5DC9B 3BESR 4PJHB 1JNLL 3C60D 1CFVH 3F7PC 3OKLA 3QQNA 1QBLL 1BQSA 1BZ9B 5B4MD 1J0KA 3Q1SH 4YHLL 5JPNA 5E6IA 1XGPA 4UIKL 3QXDB 1B2WH 5ID0A 4HUUB 1RUMH 4FQJH 2D0FA 3NAAH 2FEEL 1FVEA 1C5DA 4M9PA 1GOFA 4N9OB 1HOCB 3QIUA 2PYFA 1LEKB 1E6OH 1DQLH 1ZS8A 4HKZA 3C09B 1S7SA 3LKOB 1Q72H 1OSPL 2SEBB 2F54A 1UC6A 3UPAA 4KU1A 1NAKH 3U2SA 1IKNC 4QRRD 3CDFA 5SWQB 3OKMB 1JWMA 3KYNA 5CINH 5J1SC 4UTBL 1NANI 2NW3B 3RGVD 1HI6B 3ARFB 4JDTL 5I76B 3EUUA 4MB4A 1AGDA 1EEQA 2OM5A 3ARSA 1YECH 1AC6A 3IETA 3NIDE 4GS7C 4R4FH 3TVMA 3UZEA 1AQDA 1YA5A 4PJFE 4RISL 1PBYA 4OZHB 3ILPB 2Z8SA 5DEGB 2AEQH 2ICWA 1KTDB 1T2XA 1X5LA 4LCWD 2O26U 4Z0BL 3I2CH 4N0CC 4PJDB 1XCTB 1R3JB 4XP6L 1T1ZA 2P43B 2G60H 3IU3B 1T21B 3JV0A 4K7FB 2CH8A 3MRBB 3X13A 2NY1B 1UVQA 5I73C 3DVFA 3TV3L 3BGMB 2DD8L 3E6HB 4WV1A 1U8JB 2A6DB 5I9QC 3P11H 5ANMA 4HMEA 5SX5H 4FABL 3PL6A 4IMKC 4OUUB 3V6ZB 2P8PA 3GGWB 3UPRB 1CL7L 2QR0A 1PQZB 1JGLH 1UYWL 2Q86A 1NCTA 5CEZE 3K2MC 4PRDA 1I9RH 1G7PB 1N6QL 1U0QA 5DRZB 2VKWA 5C09B 2KPNA 5HTSA 5CEXB 4EVNA 3G04B 4U05A 2X4NB 1NMBL 2IPTL 4I5BB 2PR4L 2X4UA 3MROB 4O9HH 5KVDL 1WFOA 3MRCB 2FB4H 1BHGA 2X1WL 2ZUTA 2XA8L 4LMQI 4FQ2L 4Z7UB 3X12A 5BJTA 1JV5A 4FZEL 4F7MB 4PJXE 3QUML 1F4HA 3MOAH 4JKPH 3INUL 4KZDH 2R0WL 1C12B 4IS6A 3MJ7A 2W0FB 4AZ8A 1JIBA 1YEGL 3GSNB 4HPOL 4N5ED 5CP3H 3JV6B 3QNYB 1MHCB 1BOGA 1DVFB 3MRLA 4LLVA 1BMGA 4PJ5B 4DK3A 3NFPA 4KKNA 1DBAH 1YEFL 1V3LA 3BJLA 2CKBA 2V2WB 1B0RB 1NL0H 3P30H 3VH8B 1NPUA 3LHPL 2OL3A 35C8L 4OM1H 4L8DB 1U8NB 4GXVH 2JJVA 3M8OH 4MAYD 4PRHB 2DI8A 1OM3H 1I8LA 4JO2L 4EIZC 4P2OC 3GSWB 4QRRA 3V2AR 1GHFH 1LEIA 4F7CA 4YPGA 1MCPH 3RGVA 2X4PA 2DBLL 4HFUH 4X80L 5F96L 5CSZA 4EBQL 2K7PA 2YZ8A 2BXYA 1YC7A 1S7VA 1BD2D 3RWHB 4F37F 2FO4A 3BD4A 5D7IB 3L95B 4FQIL 3VXNA 3QDMD 4MAUH 4HT1H 4M7ZC 12E8L 1DLFH 4NKMA 2HWZH 2DM2A 4LCWA 5IEHA 5D1QC 2KZWA 3MUY1 4ORZC 3IFPA 1NH6A 5GGTH 3HR5A 4TSCL 4E41D 3PHQB 2HFGL 2UZYB 2PYED 3QG7L 2IBGA 2QV2A 4X83A 3SOBH 5CGYD 3PNWA 1G9NL 1QBMH 3PHOB 3RUGE 4M6ML 5J89A 4IDJL 2AEIT 4LHQB 3QEQB 15C8L 4KI5C 5EBMA 3UYRL 3MACL 3PP4L 3BWAA 2VJXA 5TF1L 4MA7H 1ZHNB 1QSED 3VD9A 4XNZC 4MDJA 3VWJD 1WZLA 3CC5B 3LKQA 3DVNB 1T20A 1FE8H 2YD8A 3NCJL 4TPRH 5IVZB 3KPRD 4XPBL 1QQDB 1UQSA 4LCIL 4ZPVA 1DEEA 3SGJC 4KPHL 3UBXA 4M7JH 2ID5A 1WEJL 5JDSA 1A7NH 1X4ZA 3PWVB 5F3BA 4S1QL 2I9TA 5FAAA 1X44A 2BOBB 3I84A 2VE6B 4HIXH 4DWHA 3CLEH 2IQAB 3QI9B 4PJAA 3CVIH 3QHFH 1I7TA 4LSSL 3V5HA 2NY4B 4NZDA 4JZJB 3OGOE 5JW3L 2WBJB 3MXWH 1AGCA 2DM3A 4LKXA 4XMLH 3EO9L 2Y06L 3VFPB 2XTJE 4UOJA 3B2VH 5IB1B 4MAYA 3TYGL 3FQNB 3I9GH 5EB9A 2DYPB 3BX7C 3VXUB 1D3CA 1C5BH 5I66B 4OGYH 2XRAH 5J8OA 5E8OA 1P2CA 2FH6A 4PGZA 1AD9B 4ODVL 3S98A 2HT3D 3U0TA 4DOHB 1FC1A 5I18H 2VZOA 4YWGL 1NJ9B 4OIAA 3U30C 3L3DB 1CFSA 3QHZH 1RVFL 3O3DA 1LO4H 3ULUF 2FECL 3VXRD 4KC3B 1HQ4A 2EYTA 5FM8A 1BD2A 1RZKL 3Q6FA 5GGVH 5MEND 4RAVB 4NFDA 5A16A 4YDLC 2V2TA 4U6HB 1A7OH 4OFYD 3FFDB 3A6BH 3F7QA 3BVNB 4O5LL 3HZMA 3FO9B 4Q9RL 4A6YB 3T0EC 1CS6A 4HD9A 1Y18B 5F8RC 2WBWB 4KTDH 3ELAT 4HH9A 1X5HA 4E41A 1TETL 3F8UB 1A6WH 1E4KC 2PYEA 4ZO9A 2P1YA 3G5YB 1T5WA 1H8SA 2YZ1A 5ISZD 2VDOH 5I17A 3LEVH 4UNUA 3NFSH 2A9MH 2PF6A 4S0TD 3VFWA 2E5EA 3DBXA 2MTPA 2YRLA 3D3VD 4EKXA 4Y4FD 5D6CA 2X4TA 5IFHL 3AAZB 4N0UE 4JLRA 4PRPB 4F15B 4YIQA 4K2UL 4LARH 1FPTL 1JYNA 5IF0A 2Y1VA 1ETZB 5LVEA 1QSEA 2FCBA 4ZYKB 4RGNC 3VWJA 5HGHB 5IT2H 5F6IC 2EDDA 3WO4B 3MA9L 1UEMA 4HFWA 3KPRA 3LQAC 3BN9C 1M71B 1IGFH 4KVCL 3QWOB 5HI5C 5HHPA 4M9OA 4LLAA 2EEAA 1RJLA 2MFNA 3RL2B 3PV6A 1D6VL 3NFNA 1OQOA 3AMLA 3G5ZA 4WU5A 1KFAH 1JZ4A 4PUBH 1NMAH 3RZCD 5L2JA 1GC1C 1C16A 3J7HA 5HVFB 5J6HB 4IMLB 4JREB 3LMJL 1QBBA 3OZ9L 5ITFB 4BKLB 1RJZB 3P9LB 4RX4D 3ZE1F 3SDAD 3HPJB 3RDTD 1GVIA 1KBGL 2HMID 3MRIB 3MLSL 2QSQA 3V5KB 5FXCH 3LKSA 4LQFL 4F8QA 4NO5A 3BUYA 1QVOB 4TSAH 3MJ8A 3WHXA 2C3XA 2LTQC 4YFEA 2VL5A 1EO8H 1SJVA 4FTVB 2XT1B 4L9LC 4G6FD 2H8PB 3VGHA 1E4XH 1H3GA 2AV7A 4PG2C 1OTUD 2HLFC 3RWGB 3VXRA 3FT3B 1KB5L 3L3OA 3KYKL 4NN6B 2HVJB 4JPVH 5MENA 4XPAH 1SJEB 4N90E 1AHWB 1GC1H 2YD2A 3I6KA 3PG2A 4OFYA 3L5WB 4QCIB 1B0GA 4XPTH 1FNSL 3WHE1 1ROWA 4AT6A 3GKWH 3V4VL 5IQ9A 1IKNA 2CJUL 5K9KB 3TN0D 4BK5A 1SYSB 1U8QA 3VXOB 3O9WD 2LFGA 1DBBL 4IRJB 3DO3A 2OI9C 5ISZA 3U4AA 5GXBB 3BEVA 1X5ZA 1CYGA 4W4NA 2X4SA 3KNBB 1JYXA 2VDMH 4KROB 2NY0B 2JJUA 3D3VA 3L5XH 5DK2B 1XIWB 3QEUA 2CR6A 5HPMB 3UTQA 1MUJB 4M62L 4KUCF 4MLIA 4GRMB 1AJ7L 1D5XA 4RMWA 1IC4L 2XI9A 4PJIA 1NSNL 1MHEB 4EZMA 2FJGA 2R23B 3T4AA 2GTZA 2ZCLH 3DX9B 1OARL 3W2DH 4LLUB 5DHYA 5FYJH 1HQRA 5DXWA 3TFKC 5F7LB 2QADD 1I1YA 2NXZB 4KI5D 4XNXL 1A7QH 5CP3A 3W5NA 4U6YA 4QHUA 2HRPL 2R2HB 4JFYA 4Z7NE 1OAYL 3TLRA 3IU4L 4KVNL 2DJ4A 1N64L 2OTWB 1P6FA 4MD0B 3FO0L 4OCNC 4OJFL 1FDLH 2EDXA 3U4BH 3AGVA 2F5AH 3QNZB 3NCYP 4UAOB 3HE6B 3RZCA 1UM6H 5EUOE 1MEXH 3QZWA 4X98B 4F7EA 1BJ8A 3AS0A 1YJDC 3Q5TA 1G84A 5BXFA 3I3EA 4PRAA 4LSUH 5GHWL 5E5MA 2FL5B 4V2CB 4RX4A 1HSAA 3SDAA 3RDTA 4NUJB 1U8IB 1MAJA 5EU7E 3ULUL 1INEH 4GG6F 1P1ZB 4XC3H 3EOTH 3VD7A 4KMTL 2FX9H 1NCDL 2NZIA 2A83B 1GGCH 4LIQH 4U1IB 5GISH 1KYOK 2DTML 1I8KB 3SKOA 3OB8A 2V2XB 2ZSWB 3QDGE 4UILL 4FQPA 4YFLF 2IBZY 3PWPE 5D7JC 3LKNB 4GW4A 1WWAX 5EU4B 2DKSA 5GGTA 4F7TA 3MC0A 2NY5L 3HZYB 4YAQB 1QSFB 2NX5E 4YE4L 2OR7A 1A0QL 1UGNA 4MD5B 3MRFA 3O8XC 4LU5L 5DK0A 1PKQA 3TN0A 5GGVY 4KY1L 2FATL 4KJWD 4NQCD 1C1EL 2AJUL 5E8PB 3O9WA 3BPNB 3WO3B 4XCFH 4Z5RB 1XF3A 1ZA3B 4NRYB 5E95B 2ZOLA 2MKWA 3KJ4C 1AXTH 5DLMH 5HHOB 1B4JL 3ILQC 4NGHH 1UXSA 3T2NH 4P99A 4YXLL 1LO5B 1JHLH 1YPZF 3MRKB 4PJCE 3S36H 1KJ2L 4PP2A 3VGGA 1UWGL 3EO0A 4EQ2A 3RI5K 3VRIB 5L0QB 1A7PL 4UV4H 1F90H 1C08B 3ESUF 1T5XB 2FBJL 5BVPH 2R0KL 1ZOXA 1SM3L 3OKNA 3FFCE 4MXVE 2YN5A 5CP7B 5EUKB 3FMGH 4JRXB 5CKAA 5INCB 5C6WH 1DQDL 1QR4A 3HKFA 3RKDC 4WENB 3RIAF 3TBWA 2Y7QA 1KGCE 4C4KT 2ZUSA 3WL9B 3MRJB 3IVKB 4F9LA 4LDEB 3UC0L 3WFHA 4C58B 2VDQL 3GSQB 2HKHH 3NPSB 4ZUWB 5IIEB 1BM3H 2Q6WB 3REVB 3BN9D 3C09C 2D03L 5DI8B 1PZ5B 1TCMA 5L2KB 2OSLA 5DFVD 1M6OA 1OTTC 4XCNA 3STBA 3S88L 1REIA 4AK1A 5FGRA 3LY6A 3QNXB 5T3XL 1MWAB 2ZNXA 3QDJB 1RI8A 1XH3B 4QRPB 4PP1C 3MV7D 3O3AB 1FO0L 4LPUA 3WXVH 4XNQB 3ARFC 3RQ3A 4XBEL 3ZYOA 4HX1B 1CGTA 4G8FB 3E8UH 4R90H 5HYJD 3GSUA 3QCVL 3NIFF 3VI4E 1F4WH 4G6JH 1ZSDB 1N4XL 4IOFC 5ICZB 1WIPA 1P7QB 4TULH 2J3SA 4UBDD 5I8KH 3H0TB 2R2BB 4I2XA 2ED7A 3PWNA 4NQCA 2YXFA 3PWUA 1T1WA 3FB8B 3KPQB 5EU6D 4ENED 5KVFH 3L7FB 1OP5H 3AFLA 2NNAA 5FOBB 1HH6B 5BS0D 4D9RE 1HXMA 5T1MA 3HC3H 5IBLC 4ESKA 4ZFGH 2Z92B 5DMYA 1FBIH 5I15H 2IANE 2JJTC 3WS3B 4NIKB 2Y36H 4DVBB 1UZ8B 3PIQA 1RHHB 5EO9B 4FXGB 5JO5B 2EICA 1I1FB 4DVRH 3N50A 3RVUC 4L8CB 2AJVH 1INQB 4PLOB 3QWRD 5FYJD 4L8BA 2GFBA 2QKIB 3QJFA 2A6KA 3WIFA 3L7EB 3SE8L 3QFJB 5DUBB 1JK8B 4CW1A 3HMWH 3TO4B 5FO7B 4S2SA 5EU3A 4G9FB 1MIML 5B8CB 1BF2A 1DUZA 2JCCA 1DDHB 4UDTB 1BLNB 1T7VA 4RFOL 3QUXB 3VI3E 3DTXA 3MZGB 2DQTH 2GAZA 3BXNB 4MDIA 1AH1A 2XZQL 3IFNL 3X3GH 1LO3H 4RIRA 1DVFC 3WLBA 4MA8H 1CFQA 5JORA 5AYUL 2YWZA 4ONGL 2UUDK 4FQ1L 1OGTA 1LD9B 4YR6A 3GMMB 3VXPA 4X4XA 2KH2B 5LXGH 2VXQH 1XGRB 4XVUC 2HVKA 4Q9QL 3JUYA 5ILTL 3PGCB 2B4CL 1MAML 4LOUD 2GJZB 5HI3C 5I8CA 2BMKA 4KK8C 3EOAB 1AO7D 4QOKE 4P59H 3MV7A 1FZJB 4ZOCA 5LGKA 2A74B 5F7WC 4G8GB 2DTSA 2PW1B 3SKUD 5HYJA 2V5MA 2VDRL 4Q97A 3NABL 4HCRH 4XPGH 1J8HD 3ZDZE 1SY6L 1J0HA 3HI5H 4RWHA 3GMQA 4ZAKD 1KEGL 2A38A 4TYUA 4Z95L 3RWIA 4X6CA 1JN6B 2F54E 5C7XL 5EU6A 1WQVT 3L5HA 2I25N 5SV4A 3HZVB 1PG7H 4EUPH 1T0NB 1K9TA 2BVOB 4L9LA 2J7LA 5BS0A 2NW2A 3GIZL 1PG7W 4J3OC 4ZFFB 4IDLA 5BV7C 5JMOC 2IPKB 1A22B 5D7JD 2ICES 1UFUA 1YNKL 5FHAL 2WIIB 3FQWB 5K59E 5I30L 1F11A 3NIDF 3LD8B 3S4SA 4JFQB 4M7KL 4OD1L 1AIFA 4PJFF 1BQLL 3QWRA 2YUXA 1IGJA 3JVGA 4U1HA 3MLTA 1U8OB 4J7RA 1I8IA 1S9VB 5E6ZA 5IMMB 1S7UB 4JDZA 4Z9KB 2IG2H 1MCIA 4FQXB 1YYMH 4NKDB 4J8RB 3WNPA 5L6YL 2AK1L 2Y9RT 3ILQD 4QO1A 5ANME 5FM5O 4PJGB 3TF7C 1GGTA 2J8UE 3MREB 4MGXA 3EJZD 3WD5H 1JZ6A 3TNNA 5BV7H 1KPUB 1X7QB 3KPOA 3LS4L 4YHPB 3IXTB 4GOSA 1IC7L 2ICWI 1KYOJ 3VWKD 1R5IB 2VITB 3QI9C 5KSVB 1Q9KB 1N5AB 3HC4H 1FJ1A 1UJ3A 2NY4C 4JZJC 1JBJA 4GRWB 5IMLB 3FB6B 1ONQA 5D8JH 3WXWH 4J4PD 5T1KD 1BVLA 1VGKB 1JNNH 1UM4H 1HIMH 1QBAA 2VL4A 4GMSH 2EKSB 2YOCA 3TBTA 1NGPL 2VWEC 5DJ6A 2MMXA 3RKDD 1A6VL 4WUKL 3T04D 5FYJU 1A21A 1AO7A 4LVEA 4URTB 4TTGA 4PJXF 4OTXL 4AEIL 3LSOA 1MCWM 3TJEL 3PXJA 1L0YA 4LSTL 4UT9L 4H8WL 1J8HA 3BHBB 3TZVB 3CUPA 2FLBT 3BPOB 3GMLA 5DEZA 3V0WH 1IQWL 1JF6A 1MNUL 4ZAKA 4AEEA 4K8RL 3EDEA 2HKFL 5H94A 1XF4B 3H7BB 1S9XB 2X70A 1FORL 3LRGA 4NNPH 4FFYL 3WUWG 3O2WH 4PJ8B 2ZPKH 1MCNA 3FO1B 3LKPA 5EFIB 3ZMRA 4OI9A 4XGZA 2P8LB 5D7JA 1KCVH 2IADA 3M17B 1O5DT 4MJ6A 1RUPL 3T8XB 2LU4A 4EI6B 4L4JA 4AYFA 4G8IB 3KPSE 3DUHA 4AMKH 1KUMA 4JR9H 4J1UB 5E5RB 5E2VH 4JJHA 4YHNA 4YHKL 3B4NA 1U8MA 1S7XB 4O51A 4OIBA 5JIIA 2AV1B 3WV0A 3VXQB 4TVPE 5C6PB 2BC4B 1E4WH 5B22A 3V52L 3WO4C 5C70A 3VXSB 3UJJL 4NJAH 3WYRA 1Z9OA 1QRNB 4J3VA 4JFEB 4ZQKA 5EC2A 3SDCD 3D39E 3D69B 2P45B 1E27B 1RUKL 3D25B 3QIBB 3WE6B 3QT2A 1I8MB 2E7CA 1UB6A 1VENA 3QBTB 2OJZH 3QCTH 4WIQA 3RUGF 2H3NB 3PUCA 1AFVH 3ULVL 3ROLB 2MSPA 4JG1H 5IHBA 3Q0HA 5ICYA 2D9QB 5DJCB 4NBYB 4JFZL 5DJAB 3QULB 3TT3H 5IBUG 4JREC 1H3TA 4LEOA 1HHIA 4J4PA 5T1KA 4FXKB 4LPWA 3IFOB 3GBML 2BNQB 3GMPA 5JHLH 1YEHH 1BWWA 3F6IA 4GW5A 1NLDH 4TNWK 5DJ0B 5E2WL 4KQ3H 3RNQB 1XR9B 2OR9L 3MJ9L 5A1AA 4DN3H 3STZB 1NUNB 1BBDH 2GI7A 2KBGA 3KPLB 4PJAE 2DI7A 5TGBB 1RJCA 4CDGC 1L9NA 4IEFB 3Q1SL 4HMDA 4NN6C 4P2QB 2YA2A 5EC1A 2RB8A 2UWEB 2EEBA 5E99L 3L1OL 1RUML 1AHWC 3LKOA 4ODUA 3K1KC 5JLZB 1NLBL 1DE4A 4P48A 4KXZI 4NZTH 3UBXI 4YJZL 1E6OL 1E6JL 5KSUA 1J88A 1TLKA 1BEYL 4KK8D 5HYIA 4CNIB 4PJ7A 4RA3A 4IRJC 1FIGH 5E2UL 1SEBA 5E5UB 3ARFA 3V4PL 3KJ6H 1AGEB 4XVSH 3G08B 1NGQH 1VPOL 4GAFB 4X7SL 3PWLB 4KROC 1FL5B 1GIGH 4OZHA 5BVJB 4X8XA 1KCSH 3LV3A 3ILPA 3T1FB 1BD2E 1XIWC 5FYLL 1HHKA 4QXTB 1KTDA 2ZJSL 5E56A 4GG8B 1LGVA 4LGSB 5DO2C 3KLSA 5ESAB 3IU3A 1T21A 1RIVL 3CDCA 3L5JA 5DJXB 3VDAA 5ITBL 3GIVA 4ZUUB 4KJPC 4KZEH 1HYSC 2MPAL 1IC5H 2PYEE 1YY8B 2XWJB 4BM7A 4QHLA 4JFDD 3QO1A 3IF1B 5F1NA 1WIUA 4HS8H 2NXZC 2VXSH 2AKRB 3GGWA 5CEZL 3UPRA 3SDCA 5DT1L 1PQZA 4DQOH 1W72B 2JJTA 4WHYH 3CH1A 1BQHB 5AD0B 4KHTH 4F33B 5C09A 1DR9A 4K55A 4DN4H 4I9WE 5CEXA 1VA9A 2AJYH 4RFEB 4B53A 4FNLH 4YZFE 1JGLL 1D5IH 4UAOC 1VKXB 3HE6C 4YDIH 1D9KD 1EUTA 3MROA 1YEDB 3DMMB 3MV8B 1AE6L 4WGWB 2MNUA 1EO5A 1JWUB 4ORGB 5LGJB 4JFFB 1IGTB 2WAHA 2ZCHL 4DAGL 4HIHB 4QXUH 4Z7UA 5IJVB 1TMCB 1A47A 1FFNB 1IAKA 1A8JH 3CMOL 1JZ5A 3K2UL 3NH7L 4NRXB 2GT9B 2HFTA 2HYMA 5IK3B 1PY9A 2W0FA 3VFTB 4E42B 1OAZL 4ZPTB 4OLYL 4JY6A 4DW2H 1RULL 4LVHB 1MHCA 1P69B 4HCRA 4L9DA 4JKPL 4S1DC 2NY4D 3W0WB 4M8QB 2V2WA 2EYSA 3K3QA 1B0RA 5IROC 4ZUTB 3B9VA 5JOPD 1RQ5A 4TNVF 1P4IL 4PJXB 3RBSA 1FVCB 4L8DA 3R1GL 1RZJL 2ARJA 3MRQA 5HHMD 2Y5EA 3OKOB 3BP6B 1YC8A 4HXAH 4YGVA 4XCCH 4JCMA 4NJ9H 4PTUB 4GXVL 1KC5H 3BI9X 3BPNC 4ODXB 5F7KC 4BZ1L 2R1XA 5TQ0H 4XX1E 3M07A 2CDFA 4D0CA 5B39A 1NC2B 1AGBA 2FZ3B 3V4UL 2Z8WC 4X0KB 5IV2A 1QEWB 1XGUA 3RWHA 4JHWH 3SPVB 3VXRE 5D7IA 3X17A 5KN5B 3RWDB 5MENE 3SE3C 3U7WL 3ZTJH 4ODHL 1ZXQA 4ZO6A 4JJ5B 2RJMA 3OAYH 2PXYC 1JHTA 2NCMA 5IHZB 5L0QC 3TIDA 2XKUA 3BT2H 3FQTA 1T1XB 3TBYB 1IGYA 4H26A 5C0EA 1CXLA 4WFGE 1AR2A 4TUOB 5KVGL 5HHXH 3O11A 2BRRL 4OLXL 4JFDA 3TBSB 3MLPA 1QOKA 4HGMA 4U1LA 1N0XH 1L6ZA 5HYSG 2DQGH 3VRJB 2VUYA 1RU9H 2CK2A 3D3VE 4NCDA 1I9EA 1OF2A 1YN6A 3MMEA 3UO1H 4OF5A 4TNVK 1B6DA 1BBJB 4MMZC 4LKCA 2GQHA 2E7LA 1D9KA 4PYGA 2FR4B 1Z2KA 2Q8AH 4PJIE 3DVNA 1T7ZA 3L3IA 1U91B 3OJ2C 4I13B 4P4KB 4P9HL 1MFAL 5IVZA 4GRLB 2VDNH 4XRCA 5TE6L 1QQDA 3KXFD 2X9WA 2DLIA 4OCMC 1I9IH 2YRZA 1ED3B 3PWVA 3ZKQD 4CMHB 1ZGLM 1EZVX 1ES0B 3RPIA 4FFZL 2GK0A 5C0GB 3F6LA 1A1OB 3PWJA 4QHMB 3KG5A 4OZGA 5LWYH 4X7FC 3V6FB 2BNRB 1YEJL 4JZJA 4Z7NF 3GI9H 1YNLL 3D0LA 2DRUA 1UCTA 2R0ZL 5DC0A 4HJ0C 5C0AE 5GGUA 4GBXD 5CZVL 4JPIA 3CVIL 4S11A 5LQBH 3C5ZD 5FM5M 4GAGH 5IB1A 5FHBL 5EUOF 2EC9U 2HJKB 3QEHB 4KGJA 5E9DB 3MXWL 4PJEB 1MJ8L 4K94C 2AXJA 3A6CH 5GS0H 1F2XK 1NJ9A 3WJJC 3GJFB 3I50L 4FTVD 3C5JB 5MP6H 3W81A 4KKBC 4OGYL 3C87A 4JDVA 3HC0B 1DTUA 2IALB 1GOHA 3RVVC 5I18L 3VD4A 4JAMB 1QUNA 4GKZB 4L4VD 1P4BH 2NY6D 4HGWA 3U7YL 3X14B 4NCC2 1Y18A 5GGVL 1J9CT 1ZT4B 3GFUA 5C0ND 1PKQE 2ESVB 4YHMH 1QRKA 3ET9F 1XGYH 4WI2A 1SYVA 2KUTA 3ALPA 4IRJD 5I1AB 5GRVL 4PJ9D 4PLNC 2BDNL 5B8CC 3NCMA 4GXUN 3SE9H 2WZPD 1GZQA 3QUXC 3BJ91 4PRPA 3QR2A 3BH8B 3PP3H 3GB7B 3OX8B 5ALBL 3MLYL 1JMXA 2XICA 1C7SA 4XAWL 1EMTL 2NY2B 4PJCF 2R56L 3RHWF 1DBKL 4RMUA 3VU2A 1HYSD 1OGAB 5EH1A 1L9MA 3B5GA 2AW2A 1GGBL 3KXFA 1M71A 3QWOA 3SGDH 5IQ7L 1EK3A 1JTPA 4N0UB 2NXZD 1NCWL 2YBRB 4H5SB 5IT2L 1AR1C 3MCLH 1CBVH 1R3IL 4KI5E 2M1KA 2UV3A 3HPLA 3WKNA 3RL2A 4ZFOA 1WISA 3KR3L 1CG9B 4MXVF 4BJLA 2X40A 1NQBA 1IEAB 2LAGB 1IRAY 4BH7A 1DLHB 3FOLA 3OBAA 4M93C 4IMLA 3O45B 2CK0H 3SKMA 1I4FA 1D6EB 3REWA 3U4EA 1S5HB 1CDHA 4GBXA 4Z6AT 4UB0L 3VGAC 2KDGA 3V7AE 3C5ZA 1CFTB 4KJYA 3HMXL 1NMAL 5K93A 1PJ9A 3MRIA 4Y5XA 5KSAB 3B5TA 4PJBE 4IIQA 3CXDH 3V5KA 3AU1A 1PSKH 2IPUK 4HKXB 2GUOB 1CF8L 4PLKC 4ZUSB 3LKRB 1QVOA 4NM4H 3C2AH 4RBPH 2B20A 2KZ1B 4FTVA 1I7UB 4PGEB 4Z76B 3MLVL 3D0VA 3V95A 4PIRF 2XFXA 3QQ9C 2C4FU 4RZCB 3BISA 4LQ1A 3MLWH 2Y72A 4L4VA 4MLSA 2JB5H 2ENYA 2ATPB 4JFHE 5B38B 3FCTB 5K9KA 3VI4F 1SYSA 3TC9A 1DQQB 1EBPA 3CCHB 3QG6B 4I2XE 5E94B 5FOJA 5C6TL 4NZUL 4IRJA 2Y07L 2HFFA 1T2JA 4PJ9A 3GKWL 5DHXB 1AD0B 3F65A 5F89B 1AXIB 4OZIB 1HZHH 4P57B 5T33H 3O41B 3GMNB 4P23C 2VOTA 5DK2A 1TCRA 2ZG2A 1BAFL 1UACL 5F9WB 3TT1L 4U0RB 3ZSSA 1MUJA 4O2FB 3LRHA 3ECBB 1MCWW 2Y6SC 2PXYD 2L7JA 3BQUB 1MHEA 3T0EE 2VXTL 4NWTL 4MD4A 4EDWH 3BP7A 1EEYB 4S1SH 1T6WA 5IMOB 4XCYA 4MJIE 2DQIH 2XQBL 1Z6JT 1CGXA 1G6RH 3FRUB 5EA0H 3T2QA 1VFMA 2O5YL 4YNYB 5FKAA 3IS1X 1WCBB 3P4OB 3RU8L 1JTOA 3QQ4B 2JCCE 2ILLA 2P46B 4DUVA 3SBWC 5L9DH 4YXKL 4WFFE 4MD0A 2YSSA 5D1XD 1MLCA 1NFIA 1S9YB 5AYQA 4MQSB 3HE6A 2AJ3A 4X98A 3VI3F 2X6MA 1R3HB 3QZWG 5D6DC 4RGNE 4JHBA 1FH5L 4JQXC 1R5VA 4CMMB 1O0VA 2VLKB 3GHBH 3MO1A 1N8ZA 3TZVC 5EZLB 3BPOC 1A14L 2Z31B 4NN7B 4NUJA 5DRXB 5TDNB 2MHAB 4CVZB 2Q7NA 5GS0D 5HYQB 3QFDB 3E2HB 1U6AH 3E0GA 3EYQD 1CE6B 1CCZA 4K7PX 1NCBL 1UWEH 5EUOB 3WFBH 4G7YL 4U1IA 5T3ZH 1I8KA 3KVQA 2V2XA 4F2MA 3RJDA 1AY1L 5JOFB 4PJ8C 3QPXH 3ABZA 4JO3H 1FG9C 3MV7E 1NFDB 2MJWA 5IROA 4G80B 1GGCL 4HJ0D 1HHGB 5DJZA 1LNUA 2ZUXA 4AG4L 1IQDB 3HZYA 4YAQA 5MERA 2Q7YA 4LSPL 4K9EC 5IBTL 1SEQL 4HDIB 1UB5B 1QLEH 5FECA 3F7VA 3ZDZF 4I48A 4GJTB 1E4XI 2ZUVA 3WS6A 3PWPB 5ADPH 2O5ZH 2EKJA 2E6QA 4R6UA 1ZA3A 3NCFB 4KKBD 5EIQA 2V17H 4NQTA 3MBEB 2BFVH 1T83A 4K23L 4XXCA 5BS0E 4U1NA 4R8WL 4GW1A 5CZXC 3EYUL 1TPXB 3WFCH 4X8JA 4PREB 1YUHB 3ZDYE 3WIIH 1S7TA 4MXWL 2D7TH 3QIBC 1ZLVH 1T89C 3SE3A 5ACMA 1AXTL 4Q2ZB 2PXYA 5IVXB 3THML 5F9JA 5IFAH 1MSPA 5BW7C 4DTGH 4X5XB 5FYJE 4K9EH 2AS5M 3OAUH 3RAJH 5K59F 4XWOC 3HAEH 1I3GH 4UTAH 3UX9B 1K8DA 3M1BA 3N9GL 4XAKD 4RWYL 4OD3L 3EZ8A 2YK1H 4HS6A 1WAAA 3EO1B 5EUKA 5E1HB 4H1LH 3SKNA 4WTWA 3BKJH 3HHRB 3QUXD 3RWFB 3MV9B 1FNHA 4MNQD 2V9QA 3SY0B 1OLLA 3WL9A 5D1XA 2O61A 4BQ9A 4MHHI 5T1DH 3VFSA 1UZ6E 1UH2A 3B2UC 2J8UF 1MH5B 3I3DA 5DD1L 2E8YA 3FFCB 4LNRB 1DQMH 4NFCA 1RZGA 4FQHA 3GSQA 4ZUWA 4P2RE 3V7AG 5CGTA 4J3XA 5IIEA 3VD3A 2G2RA 2FHBA 1DCLA 5SWSB 1RFDL 1UA6L 5D72H 2PTTA 1AR1D 5D96B 1CICB 4BZYA 1PYWB 2H41A 2OZ4L 5EZOH 1BM3L 1TZIB 3DX6A 1T1YB 2ICCA 4GLRH 3VCLB 1YEEH 1QFWL 2BXZA 4LPTA 3LIZH 3U0PA 3IDYB 5DD6B 1AO7E 4I3SH 1CVSC 4PRNB 3OXSA 3JWDC 3GI8H 3WLWC 4POZD 3O4LB 1UKSA 2RFXB 1YMME 4HHAA 4L5FL 1VACB 3DUUA 1N5YH 1IM3B 4XC1L 4CN1A 3BZFA 3GO1H 3WXVL 3BE1L 1CDCA 4ZS7L 5ICZA 1I1RA 4CGTA 5IR1B 3RP1A 1MFEL 1HWGB 4D9LL 5E8NB 1CDJA 4PLKD 1ACYH 4MNGB 1F4WL 5FKPB 2H45A 4OZFB 4G6JL 4OCSH 3L7FA 1R0AL 3WJJA 4WW2B 4D0DA 2E7MA 5FOBA 3TCLB 5I8KL 5C2BL 2EDHA 5E8EB 1ZKAA 4JPKH 3QQ9D 2Z92A 3AMKA 2HTKC 5F9DC 1YNTB 4M03A 3WS3A 5FEBA 4JFOB 2X1PA 4NT6B 3OF6D 3MRHA 1MJ7H 1INDH 2ZZUT 7CGTA 2X4RA 4L8CA 4FZ8L 5E8DL 1I3VA 2QKIA 3IDXL 3DMMC 4Y19B 4NM8L 4HUWA 4QXGH 2R29H 1JMZA 5HGDB 2WMPA 2VC2L 4G9FA 3T0DA 2EIBA 3O6MH 2VDPL 2H26A 3SCMB 3UTSD 4XBGB 3BP4B 5B8CA 1AXSB 5F3HB 2HFEB 4P23D 4NNYB 3O2DL 3ZTNL 5KSBB 3MUHL 2AJSH 3QUXA 4XP5H 5C0DA 4ZTPL 4YX2L 1CD1A 2J6EH 3OR6B 3OSKA 4MNQA 5KANG 3ZYZA 3KPPB 1I1AD 3QPQC 1MFCH 1D5BB 3TPUB 4KI1A 1KIQB 1IFHH 1N6UA 3N85H 3DXAB 5C08E 1QSZA 3DX7A 1WIOA 1T0PB 4LRIA 4WW1B 5A2LH 4LHUB 1EIBA 3BZDA 5T3ZD 2DQFB 1CTOA 2ITDB 1DANU 4PJHE 4XMKH 3C6LB 5K9QI 1UXWB 2E9WA 5GJSL 3RNKB 1NDMA 4LSVL 5EOCL 4UOW0 2BVQA 2XZZA 5FYKD 5E08H 3DNKA 3VGDA 1JNLH 4S10A 4YK4B 4ERSL 1QBLH 5ESVA 2PW1A 2Y23A 4YHLH 1CXFA 4CRPA 4UIKH 1X6NA 3OKLB 4PJAF 3EJYD 2W1NA 5T5NG 4W68A 3MLRL 3S3PA 5JPNB 1Z3GL 5E6IB 3SDDD 4HULB 1XGPB 1CU4L 4KKLD 4L3ED 5ID0B 1VADA 5E2TL 5CZKA 1FVEB 1A4JB 5E00A 1OSPH 3VD5A 4PJ8D 1LE9A 4N8PA 1DQJB 2PYFB 2VR4A 2W9LA 4HKZB 1S7SB 1U8LA 1F2QA 4UTBH 1LK3L 4OZHE 2QSCL 3FQWA 4HLZG 4JDTH 1KTKE 3NTCL 3FT4A 4JFQA 5F97E 2D31A 4MQ7A 4RISH 1G6RA 1OW0C 3ZHLA 3RA7L 3KYNB 4UT7L 1VCAA 1U8OA 3GRWL 5A2FA 4J6RH 4JGJA 4Z0BH 5C0RL 1AGDB 3IETB 5EBLA 4GRLC 4XP6H 3TVMB 4NKDA 1AQDB 4XPFH 3UTSA 4NN5B 5ESQB 4BH8A 4L4TD 4MVBD 2X9XA 1WK0A 3BN3B 5CZXD 4AENA 4P23A 2ICWB 4J12A 4Y16B 1QP1A 2DD8H 5FCSH 3TV3H 2NR6D 2IGFL 3KPTA 1X7QA 4YHPA 1T1ZB 3IXTA 4M4RA 1I1AA 1R5IA 4FABH 1XGTA 2NTFA 3X13B 1KCKA 5C09E 1CL7H 1UYWH 3C8DA 4WV1B 3ZDXE 3HNTL 2ERJB 1N6QH 1FHGA 4ZDHB 2OR8A 4J3UA 2HN7A 3OR7A 2P8PB 4YZFF 1NMBH 1IKFL 2IPTH 2QR0B 2OP4L 1AKJB 2P42B 2Q86B 1QO3A 5L8JB 1RZ7H 2PR4H 4TSBL 4Z7UE 5KVDH 1H9VA 2EH8L 2B1AL 4PRDB 2EKSA 1II4E 5EU5A 1FL3A 3FB7B 4ZNEA 2AERT 5ABDE 2XA8H 2YC1B 1U8HA 4EVNB 4FQ2H 1FYTD 1IZJA 1UT9A 4FZEH 4E0RB 4LNVA 4OFIA 2X4UB 2YD6A 3I6GA 3T77B 3QUMH 1KOAA 4ZD3H 3INUH 5D6DA 4PJ5E 2R0WH 1BFVL 1AP2A 1YEGH 2YXMA 5BJTB 1JV5B 4HPOH 4FXLA 4NWUL 1VERA 5FUZH 3C60B 1YEFH 1WFTA 4FS0A 4JN2A 4IS6B 5DDHA 5DK3A 3MJ7B 3H7BA 5I8OL 3SDDA 1HH9A 3HA0A 3H9HB 3LHPH 4L3EA 35C8H 4Z7QE 2DJSA 2VYRE 4ZSOA 3EDKA 4LLVB 4JO2H 4ALAL 4PJ8A 2CKBB 2HLAA 2UZIL 3WLWD 1MF2L 1UKTA 2ZSVA 3FTGA 4JG0L 2P8LA 3O2VL 2GJJA 4PR5B 3AB0B 3T8XA 3EYOA 4N0FB 2DBLH 4X80H 5F96H 4EBQH 5D7IE 1CT8A 5DQ9A 4QRRB 4P2CG 1QFPA 1KN2L 3QSKB 1LEIB 5FYKU 2NY2C 1FFQA 4TVPL 4FQIH 2X4OA 5EOCJ 3RGVB 3VXQA 12E8H 2X4PB 4OT1L 3F58L 3BAEL 3GHEL 4H1LA 3IDJA 1S7VB 4OAWA 1JGEB 4L4TA 2FO4B 1CXHA 4HK3N 4TSCH 2P5ED 4YHIB 3VXNB 2HFGH 2CXGA 3ARDC 3QG7H 1EHNA 3H9ZA 4LL9A 3PF2A 1E27A 4LCWB 1X5GA 1G9NH 3IFPB 4C56D 4M6MH 2XQYK 3BPCB 2H3NA 4IDJH 1ORSA 3HR5B 15C8H 2FD6L 3UTOA 5J11B 3UYRH 3MACH 1IAOA 2WIMA 3PP4H 4R4NC 4WO4C 1WICA 5BW7A 25C8L 4FFWC 1FSKB 2EC9T 3UMTA 3MV8D 3ME0A 1MQ8A 3GJEA 1IILE 4UINL 1HYRC 3HUJB 5DMJB 3ZHKA 3VMOA 4JFFD 3MRGA 5TF1H 4JB9L 4MXQC 5A40E 2CUIA 3BWAB 3TWCL 2BSRB 4PJIF 3TT3L 5KSAC 2VLRB 3DHMA 3QEGL 4CVXB 3FQRA 3MLUL 1HDMA 2LV4A 1FYTA 2DI9A 4XPBH 1JZ8A 4LCIH 3TYFA 4GO6B 4XHQA 1J0ZA 4PG9B 4KPHH 4MDJB 3P4MA 1J12A 1WEJH 1EPFA 1T20B 1TZHA 5TGBA 3W0WD 4BELD 2C3VA 4S1QH 5JW4R 1E4JA 1UQSB 4D3CL 4ZPVB 2UWEA 1F4XL 1DEEB 1RZKC 5JOPE 4NC1C 4B41A 3UBXB 2M8XA 5FA3A 2DL2A 4LSSH 5JW3H 5CSGA 3VG9B 1JWSA 2WQRA 3VXUE 3IKCA 3EO9H 5F7FA 2Y06H 5CIPB 3P0YL 3K8MA 4MCYA 1I7TB 3TYGH 5E1AA 3OV6A 4DOHE 4EJ1C 2AGJH 4HK0A 1CFBA 1AGCB 4LKXB 3VMPA 2FHFA 3G08A 1TZGL 1ZLWK 1NKRA 4EI5D 4ODVH 1BFSA 4LDOB 4NRZA 3ROOB 4YWGH 4MAYB 1A6UL 4XVTL 4ELKB 1FIGL 3A67L 4I18B 5F9WC 1YN7B 3KLDA 2B1HL 1P2CB 1RZKH 3U0TB 5F93C 5DJXA 1OD9A 2D7MA 1CFSB 4O5LH 3NVQA 3TH2T 1J86A 1NDGB 2XWJA 2GITB 4Q9RH 4W4OC 2EYTB 1BD2B 3IF1A 2J6EA 3Q6FB 3HFML 5FUCE 1D5MA 2AKRA 2V2TB 1KT2B 3QDMB 1TETH 3HZMB 1IC5L 3S35X 2X4QA 4XH2A 4PRPE 3CLFL 5I1KL 4HH9B 2A9NL 1T22A 4E41B 4Z7VA 3WSQL 2PYEB 1VKXA 3CD4A 1DBML 5D2LA 4QRTA 1YEDA 4ODTL 4HUVA 1T5WB 3MV8A 5IFHH 2A73B 4U6VL 4KHTL 4K2UH 3E1F1 1FPTH 4JFFA 1IGTA 3CPLA 2J12B 1G7LB 5IJVA 5SV3A 1MRCL 4NN7C 1GAFL 2Z31C 1A6PA 4APQB 4LAQL 5DA4A 1EEZB 2X4TB 4NRXA 3E2HC 2VDLL 4YIQB 3FKUS 3MA9H 4E42A 5A3IC 5IF0B 1QSEB 4KVCH 4JPWL 4GAYA 4B50A 3VWJB 5H37G 3LPWA 3QO0A 4DGIL 4O02L 4KI5F 4FHBD 3W0WA 3NA4A 4HFWB 1EZVY 4W6YB 3KPRB 4ZUTA 3SO3C 3LB6C 3VH8G 1QACA 1D6VH 2N7BA 5HHPB 2NYYC 1FVCA 3B8YA 4X4ME 2O93L 3Q5YA 4U31A 5E4EC 2IAMD 2OXGA 2XKSA 1RJLB 4WHDA 3BP6A 1ZGLA 2CRIA 1RJYA 3LMJH 3PV6B 2DIJA 2DQEL 4HIJB 3OZ9H 3NFNB 3G5ZB 1KBGH 1GZPA 4ODXA 5L2JB 3MYZA 2R69L 2APBA 3MLSH 4PJBF 1WITA 2Y5TB 1MFNA 4FTVE 1NC2A 1RZ8A 5JPMA 2R15A 3ZE0E 3MBEC 4LQFH 4YQXL 4EI5A 2R9HC 5JDJA 4M1DL 1TPXC 1A1MA 3SPVA 4MMXC 4GXUM 4HWUA 5KN5A 5DZLA 1A6AA 1S3KL 3RWDA 2XZAL 4O58L 2R8SL 4U1MB 1RZFL 3LKSB 1KB5H 3JV4B 1NEZA 3KYKH 3BUYB 3MJ8B 3ALXA 2VL5B 5D5MA 4NDMA 3LVEA 4TUOA 1FNSH 4Y0GA 2AV7B 4NSKA 5C0BD 1G9ML 3VXRB 4KJQD 4M8VA 4NYLA 3V4VH 2CJUH 3PP3K 3ZSTA 5LJYH 1YEIL 3WN5C 3I6KB 1M7IA 3F12B 1DBBH 1W0WB 4AT6B 3C8HA 5IQ9B 2F53D 1J11A 1KJVB 3ORJA 4FA8A 1BJMA 1U8QB 2VLME 1EXUB 4I0PD 4M7LT 2FR4A 3TBVA 5ISZB 1U91A 3LDBB 3BEVB 1OGAD 4CJ0A 1HK6A 1F45A 3PJSB 5JNYA 1AJ7H 1IC4H 3G6AB 1NSNH 3D3VB 1SMOA 3P77A 4Y4FB 4DFHA 3ARDD 3QEUB 3VXMD 3DLQR 1OARH 3ES6B 4L29B 3ULUC 3QUMA 2CDEA 2RHEA 1A1OA 3H3KA 4X5WA 4XNXH 2FJGB 4Q6YA 3T4AB 3IDYC 2GTZB 4WO4D 2F15A 2BNRA 1EJOL 4BZ2L 2HRPH 2JCCF 4FFWD 5HI4C 4JQIL 5DHYB 1OAYH 3IU4H 4KVNH 1HQRB 3TEUA 1N64H 1I1YB 5IP4A 4MXQD 3FO0H 2P5WB 1M7DB 4HAGA 4OJFH 4V1DD 1BIHA 4XBPA 1MRFL 4U6YB 2IAMA 3IDUA 2HJKA 4HQQL 5E9DA 4F8TA 4JFYB 2EDTA 1Z0MA 1A6TA 3ZO0A 5GHWH 1W8NA 3WIHL 4RDQG 4WW2C 3RZCB 2J88L 3C5JA 3FB5B 5TFSL 5KS9B 4F7EB 3ULUH 5HVHB 5BXFB 1WC7A 4PRAB 4KMTH 3T3PE 1NCDH 5I1EL 2IALA 1FP5A 1HSAB 3DRQA 3SDAB 3RDTB 2DTMH 2P24A 4Z0XA 1SBSL 5D9SA 3UTZB 4JAMA 5MP6L 1IL1B 4UILH 2IBBA 3X14A 3BSZL 2W9EL 1T0MA 2BY2A 3SKOB 4RGOL 2NY5H 4YE4H 5TE4L 5I1AA 1A0QH 4K3DL 5C0BA 5T5NF 5FF6A 4LU5H 1EJ6A 4GW4B 5F6HJ 2OK0L 4KY1H 5A2KH 1B9ZA 3UXFA 1C1EH 2AJUH 1JPGA 2XYCA 4F7TB 4HUXA 1S8DA 3O6KL 2HH0L 5HY9B 3BH8A 1LO0L 3MRFB 2F53A 5BZDB 3TN0B 2ZG3A 4JM4L 1B4JH 3WFEH 3B9KB 3GSVA 3SE9L 3WMSA 3O9WB 3ZDYF 4MQTB 4I0PA 4YXLH 3OB0H 2UZXB 5HVGB 1BZ7A 1KJ2H 4FMFA 1XF3B 1OGAA 3KAAA 1UWGH 1T3FA 1P5UA 1UADC 3UAJD 1FLTX 1MCCA 1A5FL 4P3WA 1UXSB 1A7PH 3VFVA 4H5SA 5TJWK 3BEWB 5JA9A 1JPTL 2CDGA 3ARDA 3QDHA 3VXMA 3AM8C 4PP2B 2FBJH 4JRXE 1F6AA 2R0KH 2C1OA 2WINA 3C6LC 4DGVL 1SM3H 2ZUQB 1XZ0B 1JGVL 4G42A 2OLDA 4MA1B 5E6YA 2V5SA 4WO4A 4YK4C 1DQDH 3NN8A 3L3GA 4X7DC 1D6EA 5HDBE 3CFJA 2QADB 3OKNB 2MWCA 1XF1A 5I74B 2VLKD 4V1DA 2BRQA 3R4DA 1FV1B 3RWCB 3UC0H 1UZ6F 2GSGB 4ZODA 3OKDB 4IM8A 3RTQB 3TBWB 5HDOA 2VDQH 4HKXA 5L2KE 2EZ0C 2XN9B 3JWOC 5E6IC 3LKRA 2VIRB 2D03H 3WFHB 3RY5A 1I7UA 3QDJE 1M05A 4QRPE 5GGQL 4QTIL 4K7PY 3S88H 2AXHA 3NMEA 3DIFA 4OZ4A 5T3XH 3LB6D 4RZCA 4OD2A 3UROR 1FO0H 4KTEL 3OTTA 2GSIB 1MHHB 2OSLB 1M6OB 4XCNB 4XBEH 1R3KA 4TQEL 4WWID 3CFEA 1K2DB 4N0YL 3RX7A 3QCVH 1GCFA 2VH5L 3AY4C 2JE8A 3ARGD 1N4XH 3MLWL 3QG6A 4N1CA 4QLRA 5DMKA 4LASL 2A1WL 3CFIC 1HN1A 1U42A 3TVMC 1AD0A 1MI5D 1N6VA 1ZE3C 4NN5C 3GSUB 4JVPA 4P57A 2R9HD 3HNSL 3WNOA 3AC0A 4Y16C 1G1CA 2FWOA 3MRNA 4HWZA 3CU1A 3ARED 3HE7B 4I2XB 2BHZA 3PWNB 4NQCB 5T33L 1T1WB 4XVJL 4K71C 3O4OB 5KW9L 3U30B 4WV1C 1EEYA 2ERJC 2NNAB 1KEML 3MUJA 4MJ5A 2EDQA 1HXMB 4W4OA 3FRUA 5T1MB 4YHZL 3QFJE 2XZCL 3LN4A 4XAKE 3WDIA 3BH9A 1EAPA 4G9FE 4P46B 4EDWL 4WFHD 1F6LL 3PIQB 5L88L 3SE8H 2J4WL 1G7IA 5JUEL 1MIMH 2WLZA 3OG4B 4L8BB 3QJFB 5K9JL 2BHUA 1CDGA 4RFOH 4CW1B 1TTFA 1U92B 4S2SB 4P9ML 1KLFA 5EU3B 4AY0A 2XNAA 4QEGA 3IFNH 2FO1A 2VLKA 1OT1A 1DUZB 3LQAL 4CVZA 2JCCB 5DRXA 5SWSD 3C60C 3EGSB 3WFDL 3DTXB 5AYUH 5B4MC 3FOMA 4K07A 1NBYB 2GAZB 4ONGH 3ULUD 4MDIB 4BFBD 1GPOL 2FDBP 4FQ1H 3BGFB 1TTGA 4DFIA 4R4BA 3WLBB 2P4AB 3WNKA 1NC4D 2Y25A 1CFQB 5HD8C 1MLBA 5JORB 4Q9QH 5I1DA 3DI3B 4PJHF 3QHTC 5ILTH 5DD5L 4XP9L 1OWRM 2B4CH 1OGTB 4G80A 1CVRA 3TJHD 3WFBL 4G8GE 1E28A 1RIUL 1QKZL 2PW2B 1IQDA 4UMGA 2LQRA 5IKCA 5ERWA 2NY3D 3MNWA 1BVKA 1KPVA 3MRDB 5JW4N 1UB5A 5I8CB 2BMKB 3OJMB 2VDRH 5LBSL 1GOGA 5LCVL 2BSTB 3NABH 2R4RL 3MV7B 4YEFA 4X9HA 1HSBA 1UJTA 1QLRA 2OS7A 2MQ0A 2J8OA 3T09A 5H2BB 3QAZB 5DZNA 5E70A 3CVHL 1G7QA 1KEGH 1XCQA 1MI5A 1NAML 3OWEA 4ODSL 4HEME 5HYJB 5C7XH 1J1XL 3LH2L 2CMRL 4WI4A 2VN7A 4PRIB 1YUHA 1KELL 5DD0L 5AEAA 1BF8A 1SJHA 5CMAA 3GMQB 4NPYA 4N8VB 3AREA 3GIZH 4J3SA 1LP9B 2A77L 3RWIB 3G6JB 4X6CB 4Q2ZA 1IGML 5J11C 3S3JA 2LTQB 4WHTA 5EU6B 1XR8A 1V5JA 3STLB 1FSKC 3RVTD 4OZHF 5INDA 2EO9A 2VLJD 1WV7T 1YNKH 5FHAH 1J0YA 2NW2B 1CGYA 5I30H 5F1OB 5FDYA 4O4YL 2E27L 4XNUL 4M7KH 4OD1H 4QRSA 1BQLH 4WUUD 3WN5A 5AG9A 3H9SD 1A6ZB 3FAXA 4PY8J 2V5YA 1F11B 2I27N 4PJGE 2LU3A 3S4SB 1AIFB 4U1HB 1IGJB 5L6YH 2AK1H 4NKOB 4LLWB 3MLTB 2EYRA 3IB4A 3UTTD 4RQQB 5I19L 1MH5A 3ZKXC 2OI9B 1G1YA 4HWBL 4YDVA 3LS4H 4GRWE 2P8MA 1A02N 1IC7H 2H2SC 3P4NA 4TTDC 4Y89A 4BQCA 5SWSA 4H8WC 4KRMB 3ZDXF 1ZHKA 3TNNB 1JRHL 2EDOA 1D5ZA 3KPOB 4K8RC 4WI3A 5GGSA 4N5EC 1S7WA 3F7YB 4ZNEE 2AXGA 3CXHK 4KRPD 5T3XD 3S34L 1NC4A 4Z7UF 1FJ1B 1UJ3B 1ZAGA 5DJYA 1NGPH 4PRNA 5FYKE 3N1MC 1JUFA 1A6VH 4WUKH 4M00A 1RIHL 1YJDL 2EDRA 4Q6IC 2MOVA 3B5HA 3O4LA 1OTSC 1VACA 2WWMC 2DAVA 1UCBL 4MAYC 3CFDA 3LIZL 1ZTXL 4I18C 3BKCH 1ZT7A 2UUDH 5IVOA 5HBBA 3TBTB 4OTXH 4AEIH 5DJ6B 3ZKNC 4ZUVB 3TJEH 1P7KA 5IMKA 2Q3AA 1QFOA 4LSTH 4MNGA 1HNFA 3EAKA 1T4KA 2APXA 4M43L 4R96B 1N3NA 1FNLA 2OMBA 3PHSA 1IQWH 1MNUH 4ZSOE 3LSOB 4K8RH 2OTPA 3HI6L 2HKFH 3OPZL 2ADFL 5E8EA 5CIPH 4Z7QF 1FORH 4KUCD 3U9PL 1CWVA 1J8HB 3CUPB 1SMAA 5DVNA 4FFYH 4ZAKB 1GRWA 4NT6A 4F9PA 1OCWL 3C5SA 5H94B 5D2NA 2X70B 4JRYD 3W39B 5SWZD 3ULVC 1RUPH 2VLJA 3H2WA 4TUKL 3DRTA 5CGYC 5D7IF 3ZL4L 1VGEL 3RWJA 4ELMB 5IW1A 2ZUYA 3QUZD 4DZBB 2ADGB 1TJHL 1EFQA 1U36A 4IRZL 5D7JB 2ARJQ 4WUUA 4APQC 4YHKH 2IADB 1NBQA 4MJ6B 1AXSA 1F02I 1XGQB 2I5YL 3H9SA 4BUGA 1F4YL 2HFEA 4Y16D 5KSBA 43C9B 2R29L 1QRNE 3V0AC 4H0IA 2NXYD 4JFEE 4NZRL 4G8EA 4P4RA 3V52H 3HR6A 4FQLL 3UJJH 3PV7A 2ZUUA 1ZV5A 3O6ML 3SGKA 4ACPA 5F7DA 2GCYB 4YHNB 3VWJC 1D5BA 3VGFA 3TPUA 3UTTA 3IS0X 4OV6F 3DVGB 1KIQA 1GGIL 2DQUL 1YQVL 4EDXA 3M45A 1RUKH 1WWBX 5GS3A 5J3HD 3KJ4B 2I9LA 1MFCL 3ULVH 1O7SA 2AJXL 5EC2B 3T0AA 5EPMA 4JFZH 1I9JL 4NOFA 2DQFA 5EOTB 1TNNA 3EHBD 2BNQE 2GEEA 2ITDA 3AM8A 3FO2A 5FA4A 5IVNA 3VWKB 2VSCA 3OJDA 3RNKA 1P9MC 3GBMH 2DIAA 5ICYB 4YLQT 5MEPA 5HVWA 1QPXA 1FO0A 5GSRA 5E2WH 4LEOB 1HHIB 2OR9H 3MJ9H 3GMPB 4P2QE 5E08L 4K3EL 4GW5B 2UWEE 1FLRL 4GLRI 1JCKA 2HT3C 5CD3A 5T5FL 1KPRA 1UENA 2HP4A 5E99H 3L1OH 2FX8L 3BRDA 4FFVC 1A4JA 3TIEA 1NLBH 5I2IB 5HD8D 2Z8RA 3EJJX 1DQJA 5IJKA 1J87A 5EC1B 4R7NA 1E6JH 4UT6L 1BEYH 5C0FA 2M2DA 4XB7A 4ODUB 4RDQF 1WTGT 4KDTC 4PGCA 5E2UH 1DE4B 1WBYA 3L5IA 3V4PH 3CSGA 1DP0A 2X05A 4JRYA 3LS5L 5KSUB 2YUVA 5SWZA 1VPOH 2Q20A 5EOQH 4X7SH 2N7AA 3GMOB 3EDDA 3VG0L 3AY4A 4Z18A 4PJ7B 5FYLH 2XY2A 3VFUA 3LCYA 1SEBB 5D71L 2W9DL 2ZJSH 5C0JB 3LDBC 3K74B 1EHLL 3NACL 3QUZA 3H42L 4LEXL 1MY7A 1RIVH 5ESQA 2AK4D 3LV3B 4Y4FC 4WVRA 3O3EA 4Y16A 4EIGB 1HHKB 5ITBH 1JF1A 2MPAH 1MIEL 3P73A 4J6RL 2QJDA 4PV8A 1MFDL 4PS4L 4CU7A 5DZOA 4XPFL 3SGEH 1BFOB 3KHQA 1P4LA 5CEZH 3FQUA 4U4BA 5DT1H 3GIVB 5ELIA 3IGAB 4LMQE 4KKAD 4QHLB 3QO1B 3MV8E 5F1NB 4ZDHA 2OJEB 2UY7A 2A2QT 3VA6A 4JFFE 4KDWA 3SDCB 1EGJL 1AKJA 3KGRA 2DLTA 4YDJA 1RZJC 4C54A 5JHDD 1AE6H 2VLRD 3CH1B 3PQYD 5IB5A 3FB7A 2YC1A 5LGHL 2ZCHH 4DAGH 1Q0XL 3D2UD 2ZCKL 3MA7A 3MRRA 5CILL 5IW6A 1OVZA 3GSNL 3RZCC 4E0RA 1RZ7L 3CMOH 1LO2L 3K2UH 3NH7H 5M95B 3T77A 3QIWD 5HVHC 2VSDA 5TE7L 5IHLB 3QXAA 1OAZH 3AS2A 4OLYH 4PYHA 3BO8A 3W0WE 4OF0A 3SDAC 2BJML 3RDTC 5CD5D 2YA1A 1IAKB 2H2SD 1RULH 2HMIC 1CD0A 4TTDD 5EIVA 3K4ZA 1QD0A 3C60A 4UQ2A 4BUHA 4ZD3L 1SY6A 5LAXA 1T03L 5I16A 4I3RL 4K8RD 1JNJA 4JY6B 2FSEA 2LABA 3H9HA 1P4IH 2VDKL 3R1GH 4F7PA 4G9DA 1LE5A 5FUZL 1RZJH 2VKXA 2OBGA 5GSVA 1H5BA 1CZ8L 1TVBA 1FG2A 1OTUC 3RY4A 2XTLA 4HZLB 1L7TL 2EYSB 4LLYB 2Q1EA 5BOZG 3DROA 4LLQA 3SE4A 1OTSD 2FEEI 2WWMD 4PR5A 2ARJB 4BFIB 5HHQA 5I75B 3MRQB 4BZ1H 4N0FA 4P5MB 4ZOEA 1A64A 5CUSL 3MOQA 4EUPB 3BZEB 3IJHA 4YGVB 3ZKND 3ZE0F 3V4UH 3TN0C 3FAWA 4BFEA 3VFMA 1WCQA 3B9KC 5BRZD 3O9WC 4CN4A 4OLEA 2R1XB 2OXHA 3AROA 3QCUL 2CDFB 3U7WH 4D0CB 5B39B 4ODHH 2FGZA 1Q38A 1AGBB 1Z0NA 5IV2B 4I77L 3GSXA 1JGEA 1XGUB 2EECA 4Y2DB 4YHIA 3U79A 3RL1B 1TIUA 5KVGH 2BRRH 1G7JA 1S5IL 2DF3A 4RFNC 4OLXH 1JHTB 3BPCA 4RA0C 2ZUQC 2H2PD 3CXHJ 3TIDB 3FQTB 1CXKA 4GFTB 5IG7A 1IGYB 4H26B 5C0EB 4MA1C 2VNCA 2YPLD 3ULVD 5HHNB 3O11B 3HUJA 4JFDB 2QADC 4WTZG 5BV7B 4U1LB 5I74C 2MCPL 3U9UB 2EDBA 1K8IA 4APQD 5CFHA 5C3LD 2DIBA 2HAZA 2BSRA 3RTQC 2VLRA 4WEMB 3GM8A 3PQYA 4CVXA 4P9HH 4D8PB 1MFAH 1OF2B 2YHGA 3LEYL 1YN6B 3D2UA 3MMEB 5TE6H 3ALWA 1CL7I 1X3DA 4F9LC 2G5BA 3DWTA 3QRGL 4LKCB 4NQDD 1D9KB 4PG9A 2A6JA 3QIWA 3Q3GB 1IJ9A 3L3IB 3UTPE 5HYFA 2BNRE 4XRCB 4FFZH 4MWFA 4NP4L 4L8SA 3AXLB 1ZMYA 4N9GA 3T1WA 1EX0A 4KK9D 1YEJH 1UWXK 1TFHA 1YNLH 3DJ9A 2R0ZH 5E9DE 3RPIB 2GK0B 1M1SA 5CZVH 4PJEE 3PWJB 5CIPA 1OLZA 4F37K 4OZGB 5FHBH 4WDIA 1RMFL 5F9OL 4AQ1B 3D0LB 1MCLA 1MJ8H 2MQCA 4Z7OE 2VABB 2ZWLT 5GGUB 4Q6IA 5DVLA 4UQ3A 3HTLX 4F3FA 4JPIB 5F1IB 2JF1A 5AWNL 1CGWA 3ROOA 3I50H 2KQMA 4ELKA 5HHMB 2AGJL 3KHOA 2YUWA 4I18A 2NLJA 1YN7A 4O2CA 3HE7C 2X5PA 3MTRA 5FYLD 2B2XL 3T3PF 1H3PL 4A6YL 2FIRT 4KJWC 4OB5L 3O4OC 4FFVD 5CLWA 4FQQB 1NDGA 2GITA 2ESVE 4JDVB 3U7YH 4EOWL 5D93B 3OHXA 2HJFA 2YKLH 4GH7B 1X5IA 3P4LA 5I1LA 4P46C 1KT2A 3QDMA 2ZUWA 5CEZD 4HEPG 1WUNT 4LRNL 9CGTA 4HGWB 5C0CB 2NMSA 5KBNC 1BQHG 1U8PB 2BDNH 1MY5A 3V0VA 3QUKA 2R0LL 2YPLA 5BZWA 3C8KA 1FGNL 1SYVB 2A73A 5JIKA 2BOCB 1IVLA 4UI2A 5JR1L 2NY7L 4GAJL 5ALBH 3MLYH 4I0CC 1G7LA 3D85D 4AIOA 1OGAE 4XAWH 1EMTH 4APQA 3WFZA 5C71A 1GZQB 1EEZA 2R56H 3NZHL 1DBKH 4GKNA 5I6XB 5KAQG 1I3RA 1DN0A 2H9GA 1GGBH 3BGFC 5GJTL 1BOYA 4D0BA 4NQDA 5IQ7H 1NCWH 4P2YA 3MJ9A 1U95B 3V9FA 2E6JA 3BKML 1IAIL 1R3IH 1QHPA 3QXVA 3KXFB 3KR3H 2OYPA 3KWWA 5BO1L 3HG1B 2GJ6B 2KL6A 2P5WD 3MOBL 1HEZA 3S5LB 4JQVC 5JQHC 5DFVC 4OGXL 4QYOA 4XXDB 3HPLB 5F8QC 5HDBF 4ZFOB 2APTA 1BX2A 4HIJA 4UB0H 3CFBA 2EDJA 1P9MA 3MCKA 4ONHA 5EWIL 3HMXH 4BH7B 2WBKA 5F9AC 3FOLB 3QAZC 4M5YH 2Y5TA 3SKMB 4K7PL 1I4FB 1JTTA 3REWB 3U4EB 1CF8H 1ADQL 4GBXB 1KCUL 3O81A 4Y8AA 3C5ZB 4I1NB 3UYOD 4KJYB 4YXHL 5J9PB 3AVEA 3MLVH 4Y5XB 4IIQB 4NC1E 3AU1B 4UBDC 4U1MA 3JV4A 4U6XB 4OBSA 3JUZA 4U1GC 3U83A 4AH2A 4ENEC 1L0XA 3D0VB 1MVUA 2EIDA 2IJ0C 2CLRA 2XFXB 1NGYA 2YN3A 1KCRL 4NQVA 2PTUA 2B5IC 1NGZB 5DTFA 2QQKL 5C6TH 3F12A 4OZIE 1H0DA 4KDTA 4NZUH 5MEQA 3MYJA 4L4VB 2FECI 2NY6B 3PXHA 1W0WA 2Y07H 2YD7A 4NHCH 3OB0K 4M7LL 1EHXA 3JVGC 1KJVA 3E6FA 4NC0B 4WI9A 3SJVB 5E03A 2VLLA 1EXUA 3B9KD 4M6AA 1BAFH 1BWMA 1UACH 4QHNA 4AIZA 4N8CL 4FOMA 3TT1H 1DSFL 2HFFB 3LPFA 4PJ9B 3PJSA 3W9EB 3D85A 3G6AA 2FRGP 1QG3A 2VXTH 1TCRB 3FZUC 4NWTH 4Y4FA 4JKLA 3QUYD 3ES6A 4L29A 5TQ2L 2XQBH 4MX7A 1IGIH 2O5YH 3Q2CA 1UJ3C 4MD4B 3RU8H 3BP7B 3NCYS 2CLVA 1FYHB 4XCYB 1XF2B 4YXKH 1ZVSB 2X2YA 2P5WA 1M7DA 2XTJD 5FKAB 3BWUC 2BSED 2H1PL 2VLKE 3GDBA 2AABL 2ATKA 3RTQD 1Q9LA