3I85A

The crystal structure of human emmprin n-terminal domain 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
79
Chain Sequence
AGTVFTTVEDLGSKILLTCSLDDTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cervical EMMPRIN
publication title Structure of the EMMPRIN N-terminal domain 1: Dimerization via beta-strand swapping.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 10
structure length 79
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3i85A00
4UU9B 4U2YA 5GGVL 1JTOA 4QT5A 5TE4L 5KG9B 1J7VR 3FRPA 3K2UH 2X4NA 4FMKA 1OAXH 2DI9A 3BEWA 3FHAA 2YRPA 3JV5A 5L2KA 1QSFB 4F7MA 3FO0H 3QHFL 3BIKA 5INCB 4P2QE 1I1YB 5EUOA 5JHDB 4UILH 4N9GA 5B38A 3SGJA 1Y0LB 3EJYC 5T3XD 4RA0C 2R4RL 2B4CC 1Q9KA 1YA5A 1MHHA 4PGEA 1EUTA 3OWEA 3GNMH 5IMLB 3AU1A 4MJ6B 2KQNA 5ERWA 1GGTA 1SYVA 3OAYH 3QXDA 1RHHA 3M1BA 5E6IC 3MRLA 3CC5B 4GRLD 4RA3A 5MP6H 2CR6A 1K6QL 2VZSA 5HHOD 3FFCB 4LDOB 3EFDH 3U2SB 3UTSB 1VPOH 3FB6B 2YEZB 4LQFL 2YD6A 1S7TB 4WHTA 3O8XD 4XX1E 3VMPA 5ETUB 1OT1A 2YD1A 5CCKH 1ONQB 2GITA 4Z0BH 4YGVB 2Q86A 4D8PB 4LQ1A 1ZLUK 5CAYB 1DLFH 1TETH 1E4XI 3SKJH 2O5YH 1KIRB 4TN9A 4B0MM 3MXWL 3WO4C 3FZUD 1B0GA 5BRZB 2LV4A 4Z0XA 3WJLA 5D1ZD 1A7RL 3C09B 3CFIC 1DBBH 5F93C 4ZS7L 3WJJC 2XV6B 1LEKA 1T3FA 3HR5B 3HUJA 3FTGB 1T4KA 3OKOA 3E8UL 3IT8D 4KQ4L 5I6XB 1ZLWH 1IGMH 1FH5H 1DJSA 1QRNB 3ULUH 3SGKA 5J89A 4LRIA 5C0GA 1A9BA 1H9VA 1OT2A 5D2NE 2HJLB 2BCKB 2BNRD 5L88H 5GS0D 1WISA 4YUEL 2DICA 4JJHA 1I3GH 2E5EA 1EVUA 1F02I 2DL2A 3RGVA 2A6DA 1AD9B 1X5XA 4V1DB 5JQ6H 1KFAL 4GKSB 5J8OA 1I1FB 1FP5A 1MRCL 1Q9OB 3H8NA 1J1XH 3H6JA 4HUKB 2QHLA 2DDQL 4LNRB 5TF0A 5C0EB 3HI6L 4NN6B 1MJJB 4OBRA 4CJ0A 1UM6L 4P4KA 3HKFA 3L7EA 2W0KA 2Q8BH 3IJYA 1EZVX 1PQZA 3NCYP 5JIKA 4TSAL 3VFWA 1IGFL 4I5BB 3GGWA 3O6ML 4PJ5E 2VISA 3H3PL 3PHOB 3RWFB 2FDBP 4NZDA 5SWSA 4PLKD 3EOAA 5LAXA 2EIZA 4Z7OF 5DHVH 3MROA 2D4FA 1UKQA 2CK0H 4HDIB 4OQTH 1HSAB 3NH7L 1LHZA 6FABL 3W0WB 5C0JA 3P0VL 3W2DL 1CIDA 3NPZB 1U95B 1T83C 3AS3A 5CSBA 4Y2DD 5IBUG 4YHLL 4QRPB 4Q0XH 5IMMB 1NAKL 2X44D 2PW1B 2E8ZA 1SM3L 1YN6A 4PJ9D 3C09C 1LK3H 2H2SD 1CXEA 1EO5A 1K8IB 2BNUA 2R4SH 1CFTA 5IROC 4PRNA 2NMSA 3LMJH 2FGZA 1JZ4A 1BAFL 4PY8J 5CHNB 5I6XC 2DJUA 1HYRC 1HZHH 4ZTPL 3VXNA 1MFEH 5HYEA 4OD1L 4MNQA 4Y5VB 1IFHH 3WLWD 2DLIA 1NANI 1R5VB 4MXVF 3VXSE 5D5MA 5C09E 4PJAF 5LG1A 5I1AB 3RP1A 1N64L 3MRCB 3UTTE 4PLOB 1C5CL 4EBQH 5ANME 3ZKMD 4TOYL 1T04A 2R2BB 4LCIH 4KKBD 1XH3B 3JV4A 4CU7A 1YNKL 4YIQB 2CGRH 2YPKB 3DMMD 4NN6C 3V5DA 2DQUH 3HZYB 4L3ED 1AGFB 5BZDA 4YGAB 3FQUB 1T0MB 5EU5A 4F7CA 1ZEAH 1CL7I 3FFDB 4F15B 4NC1C 2Z91A 3KS0J 4E0RA 2B4CH 3VW3H 5FYKE 3MYZA 3VXME 3WKNA 1MFCL 3DX9A 5DK2A 1R3IH 4P57A 2VDOL 5TDNA 1J0YA 2EDEA 1NGYA 2DM4A 5HYJB 3FJTA 3GBLA 5EBLA 3HPJA 5CJXC 3OG6B 1NCBL 3RHWK 1FFNA 4NSKB 3V0WH 2Y7QA 4KTDL 4PLNC 1H8OA 3CDYA 2DQIH 1RZJC 3QI9B 4N0FA 3MLRH 3K2UL 4KJYA 4OLWH 1OAXL 3JUYA 4N0UB 4YDLB 3FO0L 1MCIA 5TE6H 4UILL 1HEZA 5JUEH 4LLMA 2APVA 4EEEA 3NIFE 4XTRC 3IVKB 3RY6C 4NWTH 4QRUA 3BPOC 2GJZB 3QFDB 2Y1VA 1N8ZA 3GNML 1IL1B 2EYRA 5KSUA 1RJZA 4JREC 5DSCA 3CXHK 3TNNA 5GISH 1PX4A 4KK9C 1KB5H 5MP6L 4Y5VC 5HSFA 3TBVB 1P9MC 3EFDL 1VPOL 1C08A 3C60B 4Q9QH 5C70A 1P2CB 4YXKH 3TNMB 4PJAB 4MA1B 4Z78B 5CCKL 4Z0BL 2G5BA 3BZ4B 5IVZB 3BMVA 5F88A 2V2WA 3MLTB 1DLFL 1TETL 3DXAD 2X05A 3SKJL 2O5YL 3T4YA 1CD0A 2YWYA 5GS3A 3FQWA 4Y16B 1DBBL 4NRZA 5EA0H 3NZ8A 3EJZD 2I24N 3AGVA 4YH6A 3FT2A 3HLAB 4NT6B 5GPRA 3S3JA 3VFSB 1W0VB 3RVTC 2ERJB 4KKLC 3GSXB 1I8MA 1IGML 2WWMC 4GAGH 1FH5L 5I8EA 3ULUL 1T1XB 1AGBA 2JJTC 4Y5YA 4JG0H 5L88L 3STZA 4O2FA 2XN9A 1MHEB 4QRTB 1XF5A 4S1RH 4XAKE 1I3GL 1LWRA 3UZQA 4YJZL 2WSKA 5ISZD 4EDXB 1PKQB 3QI9C 4JFQA 4PTUA 4RSVA 3HZMB 4WWKD 5JQ6L 3ULSB 5JZ7D 4OCRH 1UWGH 2UWEF 4TPRH 4UIKH 4YDLC 1J1XL 5BXFA 5JNYA 3G08B 3QZWG 1T7ZA 5CZXC 4Y8DC 4EI6A 4KROD 3RBGA 3DGGB 1MVUA 3OR7B 4LASH 3QUZC 4IS6B 4OCSH 5DMYA 1RI8A 2R9HC 3HB3D 2Q8BL 3V6FB 4R9HA 3KS0H 4I3GA 3ROOA 4ZYKA 1HHHB 1I4FA 1YN7B 3U0TA 1TZIB 3LKPB 5A3ID 4R4FH 1WZLA 5IVOA 2GJJA 4CVXA 1BJ8A 4LDLB 2PW2B 3RWJB 4WRLA 4DJMA 1FV1A 2LVEA 5FECB 3R8QA 4RWHA 4JFDE 1JPTH 4UV7H 3QZWA 3S36X 1P53A 4YBQC 5I17A 3I75A 2CK0L 3MV11 4U6HB 1Q8MA 4OQTL 4CW1A 4OF8A 3FB5A 1JHTA 3MV8B 3AMLA 1SVZA 4Q0XL 3DHMA 1NGZB 5CMAB 1AR1D 2HFTA 4NC0B 3PQYA 1IKFH 4DEPB 3N50A 1LK3L 3PV6B 1OSZA 2O5ZH 3C2SA 5JW3H 1EV2E 1VEOA 2QJDA 2R4SL 2APBA 3LMJL 3FO9A 2E3VA 2EKJA 1WFNA 2VXQH 2EDQA 4X6EB 1D5ZA 1IBGH 3I6GA 4D0DA 1WBZB 2IQAA 4X5LA 1MFEL 3CX5J 1VEPA 4OAWB 4MAUH 1J1OH 5CD3B 3T77A 2Z35B 1IFHL 2HJFA 3BAEH 3JZ7A 4LCCB 3JVGC 1NBVH 2EEBA 4Y1AB 3DVFA 1X9QA 1L0YA 1AKJA 5EU4A 4EBQL 5GSRA 1RZJH 4DW2H 5I16A 3WIIH 4LCIL 1UCBH 3EOTH 2UWEB 4QRQB 5D7JB 2CGRL 5I73B 3NCMA 2DQUL 3PWLB 4OLVH 1FZJB 1PAMA 2CH8A 3TCLB 3WFBH 5JLZB 4D2NA 1ZEAL 2CUIA 4NYLA 1G9NC 1HINH 5IHUH 1GOGA 2C3VB 2B4CL 3VW3L 1N2RB 4R2GB 1M71B 2ATKB 1R3IL 1WBXB 3QEHA 2VUYA 1LP9E 4UZGA 5F72S 4IMLB 3ZYZA 4F8QA 1IT9H 3MLZH 1U8LB 3GSNA 1OP9A 3LRSB 2CIKB 2BMKA 2NNAA 4LBEB 3V0WL 1BLNB 5BCAA 1FVDB 1QPPA 1YMME 1C1EH 2CK2A 2F54E 3DHJA 2DQIL 2P8MA 3TPUA 3MLRL 2MCPH 2GKIA 1I7RA 2ADIB 4P5TA 4OLWL 4PJGE 1BD2B 3ZE1F 4PJXA 3MV9E 3TA3B 5SWZD 4N0RA 4DEPC 3HE7A 5DJ6B 5TE6L 2XOTA 4EN3B 1E27B 4HCRH 5JUEL 4NWTL 4ZOCA 2JIXA 1U8IB 1G6VK 2GTWB 1VKXA 1WEJH 2UY7A 2VDNH 4HGWA 4APQB 3WXWH 4Z7UF 12E8H 3PWPB 1GCFA 4J4PA 4U1LA 2VR9A 4RX4D 1K8DA 4RAHA 3HC3H 5GISL 1OP5K 3O6KH 1IAII 1KB5L 4X9IA 4R96B 3GHBH 4QOKD 3SDXA 1M4KA 4RDQF 4NQVA 5LCVH 2CDEA 4D9LH 1TZHB 5J1AB 1IAOA 1XFPA 4Q9QL 4YXKL 1FVEB 1G7IB 1K4DB 1IGTB 2C26A 1INQB 4K2UH 4MD5A 1NJ9A 3KPPA 1U8NA 1YC8A 3KLDA 4HPOH 4KKAC 5MEOB 3BZDA 1ITBB 3MNWB 1IEHA 3PUCA 5D7JC 4E41B 1MUJA 1UH4A 5DTFA 3AB0B 3TO2B 2OQJB 3V6ZA 2XPGA 3BZFA 4JPIA 4YDIH 4ONHA 3BWAB 2X10A 5FYLD 2Z4QA 5EA0L 4LPXA 4S2SB 4TSCH 4BH8B 1IGCH 3M17B 4O00A 4UBDC 2UZXB 5DMKA 5FO7A 5FV1L 1U8KA 2ZJSH 3H7BB 1QO3B 3K3QA 2GJ6B 5F9JB 5AYUH 3EDEA 5HYQB 1UKSA 1N3NA 2NY5C 4GAGL 3MRMB 3CFEB 1QSZA 5KVMC 3IKCB 4Y4FD 4X9GA 4M3KB 3MRKA 4JG0L 3VFPB 4S1RL 5HI3D 3C6SB 3CVHB 2DTMH 1UACH 3GUTB 2PCPB 4KRPB 4X7TA 1R3JB 3GJEB 1RK0A 4OCRL 4OKDA 1UWGL 4DWHA 4TPRL 4UIKL 4OZGE 5T1LA 2WANA 2ICES 3TA3C 1ITCA 4KK5C 2V9RA 3TZVA 1ZT1A 1IC7H 2Z8SA 4LASL 4HC1A 4EN3C 5C0NC 4OCSL 4O2CB 1FFOB 2EXYD 3BRDA 5J1TC 1HHIB 3BKMH 5CP3A 4R4FL 5MI0B 4IRSB 2F53A 2AV7A 4Z7UB 3VXUE 2QKIA 5HTSA 5J12C 3ORJA 4G8GA 3TPKA 4QYOA 4W6XB 1BREA 1EJOH 5KZCB 1JPTL 3MLVH 4UV7L 4NN5B 3O4LB 3T65A 4XNMB 2OL3A 3S9DB 2IBZY 4CVZB 2A6KA 4RAVB 3LSOB 4UOW0 1BQUA 2F19H 3RPKA 5ANMA 1EEUA 3HR6A 3VFTA 1Z9SA 5ESVB 4MA7H 1AGEA 3QJHB 5D6CB 1ZOXA 2HN7A 3QUXC 4OZFG 4ZSOE 2AJXH 3LPFA 2YBRB 2Q7YB 3AB0C 1MFDH 1IKFL 3V6OC 5DEZA 4WJ5A 3R1GL 4WHYG 5D7IF 2O5ZL 1SHMA 5JW3L 3QXUA 3GMLB 2ID5A 3NA9H 5FHBH 2RR3A 1CFSA 1G9NH 4QRRE 2ORBH 2VXQL 3VXMA 2VLJE 4MAYC 4WU5B 1FORH 1IBGL 3L3DA 3KLSA 3N1GC 3RNKA 4JY6B 1VACA 1UZ8B 4I4WA 3MRJB 4ZNCD 5L0QB 4MAUL 4C56D 1J1OL 1DEEA 4OZFA 4JKKA 2ADGB 3BAEL 3VWKB 1JBJA 4QXUH 4U1GB 1NBVL 3F7VB 2QADD 2XFXB 3F12A 4U7MA 3P11H 43CAB 4KRPC 3UTZA 3WS3A 4MNGE 4CVWA 4FFWC 1RZJL 4DW2L 4EDWH 2IJ0C 3D0VB 3WIIL 5KAQG 1UCBL 3PIQA 4L4VA 3EOTL 1DLHB 4OZHA 4NN7C 3QDGD 2X4OA 5LQBH 4F2MB 1QSEB 2RFXA 5I2IA 4OLVL 5EPMB 2BSTA 2A6IB 5DO2C 5FOBB 2XXCB 3WFBL 4HD9A 3HNSH 2FECL 1HINL 2JJWA 5IHUL 4RGNB 5HD8D 2AEQH 1J18A 4OKVA 3TYGH 4TNVF 4PJ7A 3ECBA 3WHXB 1B6DA 1IT9L 3MLZL 1KPVB 4FN0A 4JZJA 4XP1H 3LS4H 4GAYB 3KPMA 4QGYA 1C1EL 1SYSA 1F6AA 5KS9E 2MCPL 4O2EA 3S36H 3CDFA 4X9HA 4XNQA 1D5IH 2FO1A 5F7UA 4ETYA 4RIRA 5E8EA 4DK3A 1IQDA 4N1EA 2GCYA 5D7IB 4HCRL 3GKWH 3G5YA 1KGCE 1YDPA 4M62H 5KSAA 3MBEB 1UXSB 1WEJL 2VDNL 4MQTB 2QR0B 4U0QB 4DUVA 2Y36H 3MTRA 5F6HI 3WXWL 12E8L 1GGYA 2FZ3B 3Q2CA 5I1DA 4AJ0A 2AABH 2P48B 3VRIA 3HC3L 2NY5H 1YUHB 3O6KL 5L0QC 3GHBL 2BSSA 3VWKC 2NTFA 2YOCA 1DQLH 3O2WH 1KPUA 4U1GC 1V3MA 5LCVL 4D9LL 1QOKA 4K2UL 4L8DB 5F6IB 4NOBA 3NTCH 3DBXB 5L8LB 4HPOL 5DEFA 1WWWX 1P1ZA 5IG7A 5DK3A 3V6BR 5DJ2A 2IH3B 4U7SA 4F33B 5IW6A 3B2VH 4YDIL 3ARGC 3SN6N 2VH5H 3RHWF 4JO1H 1WFUA 3MGTB 3GI8H 3AY4A 4TSCL 5C2UB 1UCTA 1IGCL 4HLJA 3U4BH 2ZJSL 5AEAA 1FYHB 1S9YA 4M1CC 1CT8B 1D7FA 1PZUB 5AYUL 1FVCB 4LLYB 2ZOLB 4WO4C 4OIBA 4ZFOA 1PDKA 1P7HL 3VRLF 3EO1A 3K1DA 2G9HA 2WBJB 4MA8H 1RZFH 5E4EB 2VERN 4QKXB 3W11D 1CICC 5D7LE 2DTML 3U1SH 1UACL 3MV7E 4HJ0D 5DJ8A 1OGAE 4MB4A 3WIHA 1YC7A 1K4CB 3TJEH 5IQ9A 5HHPA 1GGCH 1T1ZB 4AMKH 4PYHA 1NANH 3IDJB 3KPOA 1IC7L 2ZP0T 2J8UE 4FQLH 4PYGA 2E7LA 3HPLB 1G0DA 3O3EB 3MBEC 3NN8B 4CNIB 3GSWA 4LVHC 1OM3H 2PYFB 1WWCA 2Y23A 3BKML 2C7UB 3KPSE 3QDJB 4CMMB 4M7ZB 2P5WD 1WAAA 4Q6YA 1IGJB 4BYHA 1I8IB 2FBJH 4OV5A 3V0VA 1ADQH 5IB1A 1EJOL 2EDKA 4JQXC 4YC2C 3MLVL 3UX9B 1CL7H 1DFBH 2CLZB 4JQIH 3TH3T 4OCYH 3RJDA 4JDZA 3OKKA 4JHWH 4Y2DA 5ID0B 3MNVA 1PG7W 2F19L 2BXYA 3BKJH 5FM5O 3SJVE 2ICCA 5DJ0A 4MA7L 3WFDH 2OK0H 3G5XB 3L3IA 3UPRA 3ZKND 5HI4C 5T5FH 2AJXL 1MI5D 3OKDA 1XF2A 2W60B 4HHAB 3FRUB 1YECH 3L3GA 3WL9A 2QQNH 3EYOA 3NA9L 3O6FB 3PL6D 5FHBL 1EBPA 2DQJH 4PJ5D 5GRWA 1A1NB 2BVQB 3RTQA 1G9NL 3VFVA 2ORBL 4GW5A 5B38B 1QHOA 2P8LA 1FORL 5BS0E 5ICZA 1LP9A 4L4TD 1MHHB 4PGEB 4MVBC 5DVKA 3BKCH 3AU1B 3TEUA 3IFOA 1KEMH 1SYVB 2XKUA 5IHLB 2AK4D 4JPKH 2WBJC 4QXUL 3M1BB 1H3WM 4R4BA 1ZHNB 3SKNA 4MJIE 5EU7C 2JJVA 1LEGA 2JJSA 1T0NB 5HY9A 3P11L 3P4MB 1MQ8A 3KJ4B 2GFBA 4X9BA 2NPLX 1XR9B 4MJ4A 3DSFH 4EDWL 4WHTB 2X7LA 1AQDB 3I84A 5GS1B 3BGMA 1HSBA 4JFFB 5LQBL 2VZ3A 4J23A 2CIIA 3OJDB 3PF2A 4Q74A 1WV7T 1NFDE 1ZGLP 4QGTA 1V5JA 5B39G 4NKOB 3HNSL 4IOSD 2V2TA 4OLZH 2IFGA 1KXQE 2MQ3A 3EYUH 5I18H 1CXLA 4M7ZC 1T3FB 2AEQL 3TYGL 3DROA 3UC0H 4FTVB 4WIQA 2F8XC 3CX2A 4KUZH 2WINB 3VXSD 4WU7B 5C09D 5HVHC 4GG6A 4JRYA 4J1UB 4G42B 1X5HA 3LEXA 4TUJA 4XP1L 1IZJA 5DJZB 3LS4L 3B43A 1YEIH 2VXVH 3TIEB 4JM2F 2VQ1A 4P2RB 5B39A 4U1MB 1ORSB 2L7JA 3S36L 4Y4HA 5I1HH 1D5XA 4NKIL 3GMPA 2A0LC 2BSRB 3OKNB 2YSSA 4M03A 2CMRH 3T3PE 1JNLH 2YA2A 4KI5E 3SY0A 2XA3A 3GKWL 1UJ3A 3MMEB 4NDMA 3GB7B 5FYKD 3O6FC 3ES6A 4M62L 5SV4A 1G7HB 3SE4A 1JTPA 3L7EB 3LQMA 2Y36L 3QCTH 2X70A 4LNVA 3V4UH 2COQA 3ZHLA 1JV5B 1T89A 4IDJH 1PX3A 2AABL 3VFWB 3BT2H 2NY5L 2CLRB 2VISB 2R15A 3AS0A 4DCQB 5K9OA 1DQLL 3O2WL 3PGFH 5SWSB 2NY2D 4PY7A 4YHPA 2DQFA 4U3XA 3MROB 3KJ4C 4UUJA 4RZCA 2NX5B 4YX2H 1ZA6A 5DYOA 5CFHA 2EDXA 4BH7A 3NTCL 2H45A 1T7YA 3EDJA 2AV1A 1Q9LA 3RUGF 1LO3H 4R4ND 3HE6C 2AJ3B 2GIYA 1WZMA 3B2VL 1S9XA 4L9LA 1TPXB 4WDIB 5TQ0H 2VH5L 4JO1L 4PJIE 1SMOA 4JFEE 3WSQH 3GI8L 1K5NA 3QG6A 15C8H 1YQ2A 2FH8A 3SOBH 3ILPA 3RDTA 4D9QE 3U4BL 1DVFA 4Z7VE 3QEQB 5ID1A 4YDVA 3VXUA 3PWNA 3RWIB 4PRNB 4TNWK 3VFUB 1TTFA 4ELMA 1G0YR 5C1MB 5D4QA 1EUUA 3BD4A 4NKDA 1PEWA 3ROLB 2KZ1B 3WBDA 2APXA 3D87B 4M5YH 1BOGB 5FF6B 3CK0H 4G8FB 5DZOA 3DSNA 4MA8L 1RZFL 3ZKQD 2PN5A 4Z76A 5DD6A 2QLVB 4N1HB 3U1SL 4Q2ZB 5BVJA 3MLSH 4JM2B 5KSVA 4PGJA 3CSPA 3TJEL 1T22A 2PYEE 4MMZC 4WV1A 25C8H 1GGCL 4AMKL 4R97C 2AAVA 2B8OT 3PGDA 1ZS8A 3MUHL 3EDDA 3CXHJ 4JVPA 2VITA 4FQLL 1RJLA 5IK3B 5C0AE 3MRPA 5CSGA 4LARH 2EC9T 4JFXA 4WI7A 4HFWB 1OM3L 4YR6B 3KPQB 3IDNA 4LVOB 4KK6C 5BVPH 3BP6A 3PNWA 1HI6B 1BFSA 2AGJH 2FBJL 3L9RA 4HMEA 2J12B 2XQBH 5C08A 2H32A 1ADQL 1JGEB 3M07A 4XAKD 1W72A 5TDNB 1CL7L 1HYSC 5KSBA 1DFBL 3BPCA 4BZYA 1TCRA 1GL4B 1PBYA 4JQIL 4OCYL 4AYFA 1U58B 5T33H 4JHWL 5E8NB 3ARRA 4MNGA 4EOWH 1FFNB 1MF2H 5GRYA 2XZQH 1NGQH 2Z31D 4C4KO 3WFDL 2OK0L 5C0FB 5T5FL 5JOPE 3RUGB 3DUSA 1J8HE 3ARQA 4N90D 3NCFB 2G5RA 1TPXC 1YECL 5C07B 5EBMA 2QQNL 1LD9A 2V2XB 4KI1A 4KTYA 1NBYA 1VGEH 3ZKSD 1MCDA 2X1WL 3EDKA 5E8PA 1R24A 2DQJL 3ZMRA 4LLMB 3C6LC 3D25A 3C5SA 3LQZA 2NY6B 3ARBC 4GLRI 3ARDA 1MCJA 1JK8B 1TTGA 1FRGH 2EYRB 3BKCL 1Q94B 1W0WB 1KEML 4X4XA 4OZIA 2E6JA 4I2XE 4JPKL 5FUZH 1HXMA 4BJLA 1SEBA 3MUZ1 2IPUK 3AAZB 5IB2A 1CS6A 3RWGB 1KJMA 2CO6B 5KS9A 4EIZC 2UVFA 1C08B 5GGTH 1GGBH 3DSFL 1T7VA 1IAIH 1UB5A 4ZOBA 4X6FA 4Q58C 4Y19E 4LFHD 5JPMB 2BK8A 4X6DF 3MFFB 4F3FA 3BSZH 4S0TD 1NC4B 1T0PB 4L1DA 5A16B 3O3AB 3QUMA 3B6SB 3IF1A 2R69H 5EN2A 3ALWA 2AK1H 1U9KA 3C8KB 4OLZL 3PJSA 1JHKH 1XMWA 3EYUL 4NIKB 5I18L 1IRAY 4LVOC 3DTXA 4PD4K 2X09A 4MA3A 3OXSB 3UC0L 1YEDA 4KUZL 4YDJA 2B39A 4XZUB 1A64A 2NW3B 3P77B 4AG4H 2IALA 2XG5A 5LXGH 3PWVA 4NQDD 3CUPB 3ZSSA 1YEIL 2VXVL 5ESQA 2IAMD 4O2FB 5SWZA 4R7DA 3S96A 3IJSB 2V5TA 5I1HL 4PJCA 4U1KA 1CGVA 4GRWF 2NLJA 4L5FH 3RNQB 3UPCA 1S5HA 2CKNA 2CMRL 5J13B 4MHHG 1JNLL 5GIRB 3OJ2C 2VSDA 4XTRD 3JUZA 2DQCH 2DI7A 5HHQA 4UDTB 4RFEA 5CGYC 3EO0A 3AREB 2EDDA 2VJXA 3QCTL 3V4UL 4TULH 4M61A 5EU3B 4LCWE 4QXWA 1MPAH 4IDJL 2ZKHH 2DLHA 4ONOA 1U8HB 3BT2L 4JG1H 1R5IB 5K33A 5HGAA 1DBKH 4K71B 4J3UA 5DJDA 4HGKC 4KK9D 3HCVB 1HH6B 1YMMD 2F54D 3PGFL 2GW5A 4L3AA 4AH2B 4FG6C 3QQ4B 3ZHKA 3DNKA 1NEZG 4PJBF 5IJKC 3QZWB 5F6HJ 3IAGC 2GSIB 3HG1E 5DRXA 3I75B 2AEPH 2PTTA 4YX2L 1Z2KA 5FYJU 2I9TB 2IPKA 1OGAA 3K7UA 1DN2A 4U1JA 4O4YH 3QXAB 4IEFB 1LO3L 3U6RB 1N4XH 3LKQB 4X6DB 4LU5H 3GMMA 3LN5A 1SMAA 4R8WH 1RZIB 1URLA 5HJ3A 5TQ0L 2J8UA 5CIPA 4FQXA 1UWXK 3WSQL 1P4IH 2L0DA 4XXDA 3VXRE 5IVNA 1WJ3A 3IDYC 15C8L 1FNEA 2WUCH 4ZUUA 1CFQA 1NEZA 3GJFK 1BIIA 4PJ8A 3ARVA 2EXWC 4Y4FA 3RWHA 4KKLD 3FO9B 2VLMD 4YK4C 4LLQB 1X5ZA 3E6FB 4M5YL 1FYTB 2FD6H 2EYTA 4XC3H 2V7HB 1Y6NR 3ZDXE 3CK0L 3P4NB 5FCSH 3G5VB 5HDLA 2P1YA 1IM9D 2X4QA 5J3HC 3CMOH 4PJEA 4GO6B 3QIUB 3MLSL 4AT6A 2ARJB 2X89A 4LP5A 3QDHA 3F7QA 25C8L 1CDYA 1FZOA 4JLRA 5ECJE 1IQWH 1SJEB 1NDMB 5CZXD 3B9KB 3QIBD 5BV7C 3IETA 1H5BC 1WTGT 4O51B 2AKRA 2C1OB 1MREH 3QUZD 5GJTH 3DRTB 4LARL 3BPNC 5B3JE 1MJ8H 4XXCC 4QLRA 1JF1B 3QP3A 1I1AB 5A2IH 2FJHA 4PRPE 1YMHA 1BQSA 5BVPL 3AM8C 4J7RA 2AGJL 4HV8A 3TO4A 3QFJB 4ZMAT 1ZWIA 3TBYB 2XQBL 1BM3H 4YBHA 3TLRA 4KKNA 4H88H 2NW2A 2X9XA 2XTJB 4M7LH 1T5XA 4RQQA 4HUXA 4YBQD 2VDQH 5T33L 4P2OB 3SGDI 2ED8A 4ZFFA 4EOWL 1MF2L 2XZQL 4WW2A 1NGQL 2PXYA 4MCZA 4MD0B 4Y89A 1NGWA 3ZTJG 2WIMA 5MENA 2FJGB 5EO0B 1AD0B 4G8EA 4D0BB 3STLA 4LHJB 4PJXB 1BBJA 4XH2B 5ESAA 2VZTA 1PG7X 1VGEL 3V4VH 2BHZA 1S7XA 1X5JA 4XCNA 4NO0D 1QBBA 3D18A 1N6VA 4WNQA 3BW9A 1VKXB 2W0FA 5DEGA 1HXYA 1FRGL 4LVNB 4NKMA 1JPGA 3IDUA 3FFCE 2VE6A 1KACB 1GZQA 4XBPA 3K74B 2YPVH 4J3WA 5FUZL 4PG2A 1IILE 1YYMH 3O11A 2D03H 2HFFA 5FKPA 3QDGA 3QIUC 1S9WA 2BY3A 4NQTA 5EU6B 5GGTL 3OKLA 5DQ9B 1IAOB 1GGBL 4ZAKA 7CGTA 4H26B 1IAIL 5D2LF 3ZT6A 4CADA 1BFOA 5DFVC 2X1PA 5E6YA 3BMWA 4M8QB 5JXEC 4XPAH 3B9KC 3KPPB 1U8NB 3H9SA 3BSZL 3GMNA 5IBLC 4H5SA 1MY7A 4AEFA 1JPST 1FGNH 4QRRD 2XPGB 2R69L 2VLJD 1E4KC 43C9B 5JW4M 2AK1L 3BRFA 1JHKL 4L29A 4Z7NE 1I1AC 4GXVH 4BSJA 1QRNE 3WS6A 1ES0A 2D9QB 2M26A 4BZ1H 2AQ1A 3FQTB 1S3KH 2IWGA 4ZO9A 2EE2A 5AUMA 1PYWB 4TVPH 2RQ8A 2OM5A 4WI6A 4FQHA 1U8JB 32C2B 2XTJC 3PGCA 4AG4L 1I85A 4NFBA 4ZODA 5LXGL 1CXKA 3WFHB 4S1DD 4V1DE 4IM8A 4P2OC 3BP5B 2P5EB 4YZFF 5CKAA 2ZUYA 3FO2A 2HP4A 3DUUB 1AP2A 2ICWI 4RISH 5HDBF 1R3HB 2E6PA 1EX0A 5C2BH 4N8VG 1KN4H 4L5FL 4W6WB 4PGZA 3DO7A 4HUUA 2HYMA 2DN7A 3RFZC 2HT4C 4Q9BA 1ZT1B 4WI3A 5GSVB 4RWYH 2DQCL 5DD1H 3FL7A 4X98B 4XCFH 4HWEH 5CEZH 5FOJA 4TULL 1S9KC 5HXMA 1DQJA 4NQEE 1MPAL 2CQVA 2ZKHL 4WI8A 4LVNC 4G9FA 5JW5A 3NPSB 4MMXC 2F53B 4JG1L 3PDDA 5JIPA 1DBKL 1BPVA 1A9EB 4WI2A 4N8VA 2I07B 4KGLA 4NQCD 4U05A 2C1PA 1KLFA 1LO2H 5J0BA 3UXFA 1KIQA 3D39E 3CFJA 4QRPE 2AEPL 3U7WH 2A6KB 3GSVA 3F7YA 1S7VB 3OB0K 4O4YL 3VJ6B 3IFPA 5DK0B 3V8OA 4WUUE 1N4XL 1KGCD 2EO1A 4LU5L 4PJFA 5IB3B 4R8WL 2P7TB 1E4JA 2Y5TA 5BV7H 4WFFE 5MEPB 3JTSA 5C0AA 1HILA 1WZKA 1P4IL 5EUKB 4WJ5B 1P7QD 1FFPA 4UBDD 2WUCL 4PJHF 3TBTB 4KXZI 1D9KD 3G9AB 5CJOH 3LD8B 3LEYH 3L3DB 1MHCA 4JPVH 4FFVD 2FD6L 4XC3L 5IEKB 4QY8A 4ZUTA 1VACB 5C0CB 4OCLC 3BIBX 5F71A 3BO8A 1SQ2N 5CEXA 3U46A 3MNZB 3CMOL 4YNYA 2VLKA 4AK1A 1N5AA 3SE3A 4C4KT 5JOFB 3WS3B 4LSRH 3KPLB 5D1XB 3TN0B 3UEZA 4ZD3H 1IQWL 3CPLB 2CO7B 1J8HA 4KK5D 3TVMD 3T1FB 1H15B 3E3QC 4NNXB 2BNQD 4OZHB 4QRSB 2AQ3A 1FJ1A 1MREL 2X4OB 2P5WA 5GJTL 4U7KA 5C0ND 1MJ8L 3CD4A 2BSTB 5TH2A 4C54A 3GM8A 5I1IH 4KMQA 2FJFB 3NPSC 5HHNA 1KPRA 3SDDB 4F7EA 1BM3L 3LN9A 2XWJA 4D0CA 4PJ7B 1KIPA 4H88L 5I1GH 3BN3B 4M7LL 5D7LD 4I2XA 3RVVC 3MV7D 5MHSE 1JPFB 4KTEH 2VDQL 1S7RA 3U9UA 3VXPB 5DRNA 4R0LA 2VDRH 1DUYA 1XGPA 3BH8B 5FYJE 1MI5A 1A2YB 2UZIH 4KDTC 3DURA 3D69A 4LLAA 1ZMYA 4HBCH 3KPMB 4G9DB 4IJ3B 3TH2T 3LKOB 4GRWH 3N1PC 4O2EB 1AHWC 1YY8B 3QUXD 5EO1A 4Q9CA 5E00A 3HI5H 4FXLA 5GGSY 2XKNA 3KPSD 3QUYD 3MA9H 1A6AB 2ZSVB 3V4VL 5LWYH 5BJTB 3BRGC 3NMEA 3UTPE 4L4TA 1YDPB 4PJHB 3QEUB 3N1MC 5C6TH 2WLZA 4NZRH 3EO9H 1HH9B 4MAYD 5DHVA 1T1YA 3MRGB 3X17A 5KOVC 2R1YA 5MERB 4GRLB 4BKLA 3G04B 5I1DB 4HJGA 2YPVL 5HHOB 2R29H 1KNOA 2MQ0A 4J6RH 4LMQI 1YYML 2D03L 2HLFC 3O8XB 5FV2A 3SHSA 3SJVD 3F58H 4K7PH 3OF6D 5J6HB 4Y0GA 1EFQA 1MIEH 1Q9WA 4OI7A 2FB4H 4X5WB 4GS7B 3TN0C 2D4DA 1ETZA 2WIIA 4E42A 1EFXD 2I25N 4XPAL 5D1ZB 5H94B 2P4AB 3WUWG 4U1SB 1P1ZB 5KVDH 4PP2A 1A6WH 1FGNL 3RY4A 1D5BB 3I6LD 1ACYH 3I02B 5TFSH 5BS0D 4JY4B 5AZ2H 4GXVL 4OCWH 3KXFE 3QXWA 5TJWK 4BZ1L 3MRRB 4WFED 2Z8RA 1S3KL 5DVOA 3SDDC 4TVPL 1JGVH 4P9HC 3C5ZD 3HC0B 4MJID 5DUBA 1EERB 2BNRB 4I18B 4L8CB 3I2CH 5DC0A 3HAEH 4M93C 3LPWA 3WUWA 2EE9A 4FNLH 2Y4SA 4M1DH 2I9LB 2EDJA 4K7PY 5FDWA 4RISL 1I7UA 1KJ2H 4K23H 3V52H 3WDIA 5C2BL 1KN4L 5D70H 2DWDB 5JW4Q 2X4TA 1VENA 2LTQB 3BJ91 2KPNA 4P3DA 1FCCA 1G6RH 4PRHA 4XRCA 4RWYL 5EBWA 1AQKH 3VGAB 5DD1L 2ADJA 3T3MF 1IM3B 4ODHH 4R26H 4Z7QF 4XCFL 4ZPTA 4U0RB 3BHBA 4HWEL 4CMHB 5CEZL 5E6IA 1B6UA 1IEAB 1CGTA 2CPCA 3CIQA 3ESVF 4Z7WF 1HN1A 3FN3A 1QUNA 1YEJH 1XT5A 4X5XA 5F8RC 4GRLC 5I76A 1U8PA 4ODUA 3IAQA 3R8BB 4EUPB 3V0VB 3HS0A 1ZV5A 2IANE 5IVXA 3O8XC 3MV8E 1LO2L 3P9MB 3QRGH 2DIJA 3QDMD 3G6JF 3U7WL 4YLQT 3VFNA 2EE6A 2R1WA 3FQXA 2FIKB 4Y2DB 4GS7C 4K8RD 3MNVB 4BFIB 4KI5D 3LKRA 4PJ9B 1I9RH 3WJJA 1MCQA 1AXTH 1EAJA 5BV7L 1BWWA 3ARGD 3OKDB 1INEH 4S10A 5FO9A 3WL9B 4PRDA 1BVLA 5CINH 3EYOB 1U2HA 3QSKB 3RWDA 3EYVB 1E6OH 3DVGA 3VXOA 4XWOD 2VKWA 4PRPA 1KB5A 5GRZA 3MRIB 4M1CD 5CJOL 4IHOB 3MLYH 5ACMA 2P8LB 3LEYL 4JPVL 4WO4D 2APWA 3CH1A 3C8HA 5GS0C 5EB9A 1RZ8A 5ICZB 4UU9A 1FFRA 3VG0H 3CCHB 5KG9A 4YFEA 4GLRH 3H9HB 3EUUA 1CICD 2VQUA 4NFCA 1N7ML 1QSFA 1LEGB 5INCA 1N6QH 1I1YA 4LSRL 5JHDA 4ZD3L 1OL0A 3DMMB 4JFED 4L3EB 1MLCA 1Y0LA 4NUJB 5EZJB 1OAYH 4D9QD 3FN0H 2QBWA 3P0GB 1HSBB 1L7IH 1WWAX 3KYMB 5IMLA 2VXSH 4MJ6A 2VQTA 3VGAC 5J57B 3T04D 1H3UA 1NMCC 3CC5A 3IDMB 5I1IL 3RRQA 1NUDA 3PP3K 1ZVSB 3TT1H 4QTIH 4TUKH 3U2SA 3UTSA 5I1GL 3FB6A 2YEZA 1A22B 2BVYA 5F7HA 1S7TA 4CUCA 2QQQA 1ONQA 4D8PA 4YGVA 4KTEL 4GG6B 1NL0H 2KH2B 3KPRD 2VDRL 1T83A 1IAKB 2UZIL 4OFVA 3G6JB 3R06B 4HBCL 2O61B 5BRZA 5ACLA 1LE5B 3KDMB 3KYKH 1CBVH 1YNTB 2DYPD 3L3KB 5HI4D 4V2BA 5F7LB 3OR6B 3HR5A 3H0TA 5IROA 3HI5L 4ONGH 5ALBH 3FTGA 5MEQA 5LWYL 3MA9L 2YSSB 3SDAC 4NDMB 4PG9B 1UJ3B 3P73B 1QRNA 3MCLH 3VI3F 5D6DA 3BE1H 5C6TL 3NFSH 3EO9L 4NZRL 2HJLA 2BCKA 3TJHC 4P9HH 2XNAB 3KYNB 3QO1B 1AD9A 4ONFH 1YYLH 2R29L 4H1LH 3IXAB 4J6RL 4GJTB 4NO5B 2BX5A 4GKSA 3F58L 1I1FA 4HH9B 4K7PL 3ZKMC 1Q9OA 1MIEL 1AIFB 1UT9A 5C6WH 5JOPD 2FB4L 3DXAB 5C0EA 2EDFA 1MJJA 2AJVH 4KZEH 1A4KB 1X4YA 3DMMC 5TGBA 3NOIA 4MNHB 3MJGX 5L9DH 5KVDL 4YHIB 4OD3H 3VA2C 1A6WL 1G0XA 5IP4A 4I5BA 1U8MB 1ACYL 5KANG 5TFSL 3PHOA 5AZ2L 3RWFA 4OCWL 3E0GA 1K5NB 1GGIH 3BP7B 3QG6B 1IKNC 3L3HB 4I13B 3ILPB 4NQDA 4ELMB 1JGVL 1KTKE 2G2RB 1HSAA 3F6IA 4GUPA 3I2CL 3QT2A 5L6YH 3W0WA 2PO6D 3MA7B 5ISZB 1BZ7B 4JFHE 4FNLL 1U95A 4M1DL 4MCYB 4Y19D 4QRPA 5IMMA 1FHGA 1X5FA 4Y4KC 3EAKA 3GSUB 2FRGP 3MBXH 3BESR 1KJ2L 3P2TA 4K23L 4KROB 3V52L 4N5EC 3DV4B 5D70L 1K8IA 3F5WB 3RY6A 2YPLD 2ILLA 3SDCC 2BZDA 4WW1B 5CHNA 1G6RL 3OXRB 4JKMA 5DJYB 1U36A 4YXHH 1AQKL 5IMOB 4ODHL 1R3KB 2ICWJ 4JFXB 4R26L 2D7TH 4FOMA 3ZDYF 3BD3A 1JNHB 4LLDB 4Y5VA 3O4LE 3L6FB 1II4E 1YEJL 2AVGA 1R5VA 4PFEA 4PR5A 3WO3B 3AS2A 3OKMB 4LCUA 2EDRA 5I1AA 3MRCA 3P9WB 5GS0H 4G5ZH 3BH9B 3D2UD 1W72B 5KSBB 3B83A 1XH3A 5CEYB 4YIQA 3QQNA 2WW8A 5HVWA 1P4BH 3HZYA 4PD4J 4UAOB 4HCRA 1AGFA 4XP4H 3UAJC 1DR9A 1I9RL 3MRDB 3HE6D 4G6JH 5TDOA 1AXTL 2DD8H 3SGDH 3NFNB 3DUSB 4MJ5B 1BQLH 5F44A 1INEL 4LCWD 2DRUA 5CINL 1A6TB 3EZJB 1E6OL 2RBLA 3L1OL 5IT2H 5DVMA 4L3CB 2J2ZA 5HYJA 2JJTA 1LO0H 3MRQB 1M05B 3WIFA 3MLYL 3W82A 4NSKA 5I15H 4EUPH 1H3XA 4J8RA 1TJIH 3VG0L 3QI9A 1TFHA 3MOAH 5EULV 5H37H 3K46A 3ZHDA 1YPZF 1AR2A 4HZAA 4NFDA 3EYQC 5CGTA 4N0UA 1FNGB 4OF0A 1X6LA 4WWKC 5JZ7C 1GH7A 1SEBB 1LQSR 2JTDA 1CQYA 4ZPVB 4KROC 1N6QL 1QSEE 5K9KA 5C9KA 3IVKA 3VXRD 3NFPB 1YNLH 2GJZA 1OAYL 3QFDA 2G60H 3FN0L 3LPGA 3WCYA 4RGNE 1L7IL 3T09A 4F3FB 1IL1A 4W4OC 2VXSL 3T0EE 3WLBA 1HHGA 4DN4H 4URTB 3IF1B 2P43B 1JJUA 2NQCA 4KK6D 4RBPK 3TT1L 5AD0B 4QTIL 3TBVA 4TUKL 2JCCB 3C60A 3TNMA 4PJAA 2DOCA 4Z78A 2HWZH 2NZ9D 2W59A 1NL0L 3BZ4A 3MGOB 5IVZA 1ED3B 4HWUA 3PWVB 3IU4H 3G9VA 1H3TA 4WFGD 4UAOC 3KYKL 3B5GA 2BVOB 2ZCLH 4R7DB 5SWZB 5C9JA 1CBVL 1ZE3C 3DV6B 4U1KB 3RZCD 3BDYH 2WQRA 4ONGL 4MB3A 5ALBL 3HLAA 4NT6A 3VFSA 3O41B 4RFOH 1W0VA 5H2BB 2HAZA 1RHFA 4LRIC 4QHUB 1KG0B 1OWWA 1XGQB 3AUVA 2OI9B 3MCLL 2YD9A 3C6LD 2Z93B 5FFLA 3BE1L 2VLRD 5HHQB 4OUUA 3NFSL 3ARBD 5T5NF 5HGBB 1J86A 1ZGLB 1J0ZA 1MHEA 5C0BD 3RGVC 4QOKB 2VWEE 5GXBB 3JVGA 4P9HL 1X7QB 4ONFL 1YYLL 1PKQA 1XZ0B 3HZMA 1IZKA 1FBIH 1YEKH 5HDQH 3ULSA 4ZO6A 4U1HB 3G08A 4JRXD 4HW6A 2J7LA 1QNZH 3DGGA 1RV6X 3OR7A 2AJVL 4KZEL 3E2HB 2PTTB 4IS6A 4HXBH 3V6FA 5L9DL 2ZUTA 1HHHA 1YN7A 1TZIA 4OD3L 3LKPA 5E2UH 5HJ3B 5CP7B 5F3HB 2PW2A 5CIPB 5DRZB 4LEOA 3RWJA 3Q6FA 4XNUH 1GVIA 1GGIL 5F7DB 1P6AB 1FNEB 4JM4H 4Y4FB 4GW1A 5IEHB 4U6HA 1IC5H 1AO7E 5L6YL 5T1KD 2NY4D 4WI4A 1M7IA 1G7MB 3JV0A 4KXZH 5JIIA 4FQQB 3PWJB 2H1PH 1OWRM 1NGZA 1MWAH 3UYOD 3MBXL 4XBGB 1UFUA 1UM5H 3PV6A 5ITFB 1S78D 3OMZA 2VOTA 1BJMA 3HZVB 4NJAH 3VGDA 1PSKH 2HRPH 3JSSA 3QDJE 2BRQA 4HQQH 1T1WB 4X6EA 3NCCB 4YXHL 5IOPB 2D7TL 3MRNB 5CGYD 3ABZA 4OAWA 1CDIA 5GGRY 4NQCA 1ORQB 5CD3A 5ELIA 2Z35A 4HK0B 1QSVA 1X5GA 4TVPD 1N59B 4LCCA 1UYWH 4PJDF 3MJ9H 1A4JB 3DPBA 5BOPA 2DTSA 1I9JH 4Y1AA 1ZWIB 3HNTH 5GS0L 4G5ZL 1ZANH 3FOLB 2HRLA 1C8PA 2OXGA 2A83A 1OQXA 4OI8A 3QQ9D 3ME0A 4HUXB 2UWEA 2B7DT 4QRQA 3GJFH 3DWTA 5D7JA 4HIXH 4I3RH 1TIUA 3PWLA 4C83B 1P4BL 4XP4L 4GQPH 3F8UB 5L2KE 1FZJA 3DI2B 3KWWB 3TCLA 5HDOA 1A1OB 2OBGA 3FQRB 1NGWB 2ZOKB 4G6JL 5EUOE 2DD8L 4WENB 1BQLL 4V2CB 2C3VA 2IBBA 1N2RA 1M71A 2ATKA 1BBJB 4NQED 1WBXA 4PV9B 1DN0A 1ZKAA 4IMLA 2D0HA 3AC0A 4E5XB 5IT2L 5CEZD 1U8LA 1LO0L 3LRSA 2CIKA 4UQ2A 2RCSH 3NCJH 1HNGA 4P59H 4C56B 4UTAH 4LBEA 5I15L 3TFKD 3PXHA 1FVDA 3D39D 1TJIL 2EZ0C 1QVOA 5E8DH 1GZQB 2QADB 3MOAL 1FN4A 4XBPB 4XPGH 2ADIA 2MQCA 1BD2A 4POZD 4JO3H 1RJCA 5TE7H 4UIMB 1DBMH 3D5OF 1OPGH 4WUUD 5J3HD 3TA3A 2JE8A 1U93B 1JMZA 2HFFB 5DJ6A 3QDGB 1JUFA 1S9WB 2Y07H 2D7QA 4EN3A 4RGMB 1E27A 1CN4A 3NGBB 1FL6B 3X3GH 3MSPA 1YNLL 1RSFA 3WN5B 1U8IA 4P5KB 4KHTH 3O4OB 2G60L 2AXJA 1V8HA 1F97A 1BVKA 3PWPA 4LMQE 2Y6SC 3HUJE 2D7PA 1VA9A 2DM7A 4H5SB 5I19H 4ZQKB 4DN4L 1XIWC 4R96A 2ESVD 4L29B 1NCDH 1OCWH 1DQTA 4AENA 2BOBB 1GOFA 1TZHA 3DI3B 3CZFB 4JHZA 4PJDB 5J1AA 1FL5A 3HI1B 1FVEA 1G7IA 3OKYA 1K4DA 1IGTA 3SKOB 1INQA 3V7MA 2HWZL 3Q5OA 4H8WC 5GQBA 1FSKC 1UC6A 2MHAB 4DAGH 5MEOA 3RPIB 4YHOH 3IU4L 5FM4A 1A5FH 5CWSA 2ICEB 3QUXA 4E41A 5DHXB 2DS4A 2OQJA 3TO2A 2C3HA 1YEEH 2Q6WB 3V6OA 2GK0B 3BWAA 4L8SB 4U3HA 2ZCLL 3U36B 4S2SA 1F3JA 4CBPA 3M17A 3BDYL 5CD5D 5K9QG 4RFOL 1QO3A 5E70A 1KF9B 2FIRT 4HUUB 2GJ6A 5F9JA 4MAYA 5DVLA 1ADQA 3MRMA 3CFEA 3DIFA 1JWUB 1FO0H 4U49A 1CK0H 5SWSE 5MHSD 2E9IA 1R6VA 1F45A 3VFPA 2CDGB 4IRZH 3C6SA 1Y6MR 3GUTA 2PCPA 5FYJD 1R3JA 2QADC 2BVUA 1DQQB 3GJEA 4Y5XB 1UEMA 5HDQL 1FBIL 1DTUA 1YEKL 3QQ3B 1XGUB 2DLTA 2R0ZH 1QNZL 4RDQG 2ZG3A 4RGMC 2DAVA 3RKDD 5CZKA 3NGBC 1FZKB 4HXBL 4O2CA 1F90H 5DFVD 4PTTB 1FFOA 5JXED 3UTPD 1HHIA 4U6YB 2EC9U 5F7NC 2YUWA 5E2UL 1EXUB 2XICA 4BM7A 5IBLD 4Z7UA 3SCMC 2D31A 2IQ9H 2O26U 5HD8C 2WQ8A 1MY5A 3JTSB 2YN3A 4IBLT 4P5MB 4XNUL 2C5DC 4Q9RH 3KLHC 1F13A 3MR9B 4L9DA 5KVEH 5E08H 1WT5A 1EEQA 3BUYB 3OHXB 5LKNA 4JM4L 4XNMA 4CVZA 4MNQE 1IC5L 2AXFB 4MWFB 5IFJB 4RAVA 3LSOA 5D5ME 1MHCB 2IMMA 2UZYB 5ESVA 1ZTXH 3QJHA 5D6CA 3K1KC 2H1PL 5HHMD 4QWWC 3QBTB 2YBRA 3U46B 1MWAL 1W8OA 3PHQB 3T0XA 4HT1H 1D6VH 1UM5L 1N5AB 1I3UA 1S9VA 4PGDB 3GMLA 3QEGH 5F1OB 1U6AH 2BOCB 4NJAL 5FYLH 2CDFA 1A3QA 1PSKL 4HF5H 2HRPL 5DUMH 3KXFD 4HQQL 1RY7B 4B53A 4OF7A 3K4DA 2P5WB 4JY6A 3FB7B 5EC1A 1UZ8A 2MJWA 1N26A 3UO1H 5D2NB 3MRJA 1ULVA 2CKBB 3OB0H 3T08A 3ARPA 1L0XA 3MJ7B 4LF3B 5TH2B 3VWKA 2ADGA 4ZUVB 1UYWL 3MJ9L 3F7VA 2Y72A 1GYAA 5HHNB 1I9JL 2XFXA 3HNTL 5EZLA 1ZANL 2XWJB 3D0VA 4YHKH 1P6FA 1DLHA 2FGWH 3N06B 3OB8A 1B4RA 3U9UB 4HIXL 4I3RL 1DUYB 1QSEA 1MI5B 4KV5F 5EPMA 5EOTB 2UY6A 3D69B 2A6IA 5FOBA 1UZ6E 1K2DB 2UVEA 3Q5TA 3PL6B 4PJ5B 1S7WA 1MQKH 2MPAH 3WMSA 1CLYH 2F15A 1WCBA 3WHXA 5C0RH 5FGSA 5CJBA 4L4TB 1KPVA 2ZZUT 2RCSL 1AGCB 2IAND 3NCJL 1G7QA 4P59L 4UT7H 4UTAL 3UROR 2Q20A 1T7WA 2AK4B 4GAYA 5I1LB 5E99H 1X5IA 3OX8B 3TYFB 4OUOA 4XPGL 4DOHE 1IE5A 4H8WH 4HJ0C 4RFNB 5TE7L 4JO3L 4XVUD 5B3NA 1DBML 1OPGL 3E1F1 2J8OA 2YZ1A 3ZE0E 4X6CB 3NIFF 5FA3A 1Q9WB 2Y07L 5D7IA 3X3GL 3QWQB 3MBEA 1UXSA 4PRBB 2WIIB 4UV4H 1ZLVK 4KHTL 2QR0A 2VXTH 2V5SA 1P69B 3L5HA 1V3JA 3ESUF 1MCWW 5I19L 1CGXA 3BDBA 2NY7H 4GXUN 5D2NC 4WEMB 1GC1C 4JQXA 1NCDL 3VXSB 1OCWL 1NFIB 4QXGH 4IDLA 5C09B 2Z0BA 4RMRA 3KPRA 1P84K 2F5AH 2XN9E 4KFZC 1CWVA 3RVVD 4L8DA 4DAGL 2P46B 3VGEA 2XZZA 4YHOL 2FWOB 1A5FL 2IH3A 2WMPA 5F21B 5JR1H 3CH8A 4F33A 1DDHA 1YEEL 5C0DB 1DL7H 1BOYA 3DX8B 1ZK9A 5FDWB 4JB9H 3MGTA 3U83A 4MQSB 4F37K 4OM0H 4R3SA 1BMGA 4JKPH 4EQ2A 3WD5L 4RAUB 4XHQA 3OZ9H 4GT7A 4RMSA 4Z18A 4LLYA 1ZT7B 2ZOLA 4XRCB 3DVIA 1FO0L 1TZGH 5EBWB 5F7YC 4YHNB 1CK0L 5IB5B 1OB1B 8CGTA 2WBJA 3ARFC 3OBAA 4IRZL 5HYSB 1FLRH 4OLUH 4UQ3B 2NY2B 3D6GA 2W65B 3DVNB 2EEDA 4UI2A 3BQUD 1K4CA 4RFNC 1JZ6A 1X5KA 2GEEA 4PRAB 1J10A 3IDJA 3KGRA 4OF3A 1TQCC 1EHLH 3X11A 2R0ZL 1UA6H 3LCYA 1KLUB 3IGAB 4N1CA 3QHTC 1F90L 2R1WB 3PQYE 4I77H 4CN6A 1KSRA 3HPLA 2K7QA 3O3EA 4CNIA 3NN8A 1SY6H 4PBXA 3SGEI 5E6ZA 1DBJH 2PYFA 3BGFC 2OYPA 3SEPA 2PETA 2C7UA 2A73B 3QIWD 1IGJA 2IQ9L 1I8IA 1RUMH 1V3LA 3T0DA 5AAWA 4Q9RL 1F00I 2YC1B 1X6NA 1FYTE 3S88H 4PRDB 3S35H 5KVEL 5E08L 3K8LA 4M6OH 3RWDB 3VFRB 5F9DC 1QR1B 2C9AA 3I6KA 2EICA 5DC4B 4YPGB 1KB5B 2CLZA 3ZTNH 5ID0A 5GGTA 4EI5D 3ZSTA 5B4MC 2FLRT 2JLLA 1ZTXL 4HKZA 3VWJD 1KB9K 5IFHH 3G5XA 3V5KB 4XB7A 1TNMA 4WUKH 5A2KH 5J9PB 4F8TA 1JNJA 4QNPE 4M48H 1JF5A 2W60A 4HHAA 4HT1L 1D6VL 2Q76A 3IDGB 4MSWA 3FRUA 3BI9X 3LVEA 5CSZB 3QEGL 4OZ4B 1U6AL 3O6FA 4HLZH 3RVWD 1Z3GH 5FYLL 1A1NA 2BVQA 4HF5L 4FXGA 5DUML 1MCBA 5C7XH 1MLCB 4U6VH 3S97C 3ARSA 5DQJB 4NQSB 5IQ7H 1F3RB 4MDIA 5E8OB 3SBWC 3UO1L 5JO5A 5GRVK 2F8OA 3KLAB 3FOMB 1ZHNA 3H3BC 2NY2C 4JFHD 1T0NA 4NP4H 5F1NB 3P4MA 3OGCA 3MREB 4MD4B 1FCGA 1XR9A 5FGCE 3VGBA 3ARXA 4OFYD 4LSDA 4YHKL 1KTRL 1AQDA 4XCEA 2FGWL 2Z31B 5GS1A 5AWNH 2FX7H 4JFFA 3S5LG 4GRMB 1U3HD 4R4NC 2LFGA 4PJXE 3OJDA 1QP1A 5IF0A 1F5WA 3B3IB 1MCEA 1V05A 1TQBC 4PREB 3Q5YA 4NKOA 3KHOA 4M9PA 1BGXL 2DWEB 3GRWA 1LP9F 1MQKL 3H0TB 2MPAL 2X9WA 1CLYL 4FTVA 3ARYA 2R0WH 5MEQB 3U0PA 1J0JA 5C0RL 2WINA 4WU7A 4I0PC 5KOMC 5EIQA 1F4XH 2CKBH 4J1UA 1GC1H 4G42A 3K80A 5DZLA 2EH7H 4GBXD 3S5LA 2BSED 4UT7L 5DJZA 1A6UH 5E99L 4YWGH 3SDXE 3TIEA 4B7IA 2Q3ZA 4PJGF 2Q8AH 4P2RA 2DBJA 4U1MA 1ORSA 4H8WL 1WK0A 1I3VA 2AP2A 4LLUB 5ICYB 3LV3B 1LNUB 4Z77A 2BSRA 2DJSA 1UB6B 4FHBD 3OKNA 5B22A 4UOJA 4X9FA 3PP3H 5GGQH 3H9ZA 2DLGA 2WNGA 3GB7A 3MMEA 3QJFA 1IC4H 3IAPA 4XVJH 1G7HA 2WWKO 4UV4L 3DLQR 2JB6B 5TGBB 2VXTL 5E9DD 2GYSA 5DRWA 1U3YA 2G75B 3IXTB 4WTXA 1NSNH 1VERA 2YD2A 1JV5A 5F7FA 5J11B 2NY7L 2CLRA 2HVKB 1L7TH 2LE9A 3RX8A 4DCQA 4QXGL 4U3CA 4IRJD 3UBXI 4XT1C 1EDQA 3D0LB 4M9OA 5DURD 3P30H 2F5AL 4TTGA 1N6UA 2P5EE 4HKBB 4NQDB 1OD7A 2NX5A 2R23B 4P2YA 1V7MH 1D3CA 2IAMB 5D96C 2V5MA 4GUPB 1QLFB 4RMWA 4PPTA 2Z31C 1MCFA 4CAGA 2AJ3A 5JR1L 4P2CG 4BFBD 3CNKA 4WDIA 1DL7L 3NAAH 5FK9A 1VGKB 3AY4C 4JB9L 4LPTA 3T0ED 2VTFA 4OM0L 1VCAA 1CU4H 4JKPL 3QEQA 3C6LA 3WEXB 2VLRA 5HI5D 3BPOB 3RWIA 3VFUA 3OZ9L 5F9OH 3SDAD 1M1SA 2F53E 3GI9H 3ROLA 1DE4A 1L6ZA 4DK6A 1BOGA 1TZGL 4HUVB 1Z5LB 4G8GE 3U82B 5FF6A 4OGAD 4JREB 2OL3H 4G8FA 4HIEB 2WBWB 3D3VD 2DQHH 1FLRL 4OLUL 1YMMB 2F54B 3TJHD 2YZ8A 3MRBB 4PR5B 2X9YA 4Q2ZA 3WNNA 1JYVA 3T8XB 1S7QB 4LCUB 4JM2A 4OZGF 4PJGB 1BF2A 5F3BB 1HOCB 1ND0B 3I3DA 4LHUD 4F9LA 1EHLL 1OAZH 1UA6L 3LZFH 2R8SH 4NQXB 3IRPX 5IK3A 2E7BA 2V17H 4I77L 1QFUH 4ODXB 1FQ9C 3ZO0A 2Y06H 3QPXH 1SY6L 4HFWA 1DBJL 3UP1A 5F70A 5FYKH 4YR6A 3BYTA 3KPQA 1I3RB 5DI8A 4P46C 5TDOB 3CZJA 4I1NB 1HI6A 1NC2D 1RUML 2IBZX 4J3XA 3V5HB 5J11C 3AMKA 3S88L 1JGEA 2V6HA 4OZFH 3S35L 4M6OL 3B9AA 5ALCH 3X12B 4WHYH 1JN6B 3ZTNL 4DKDC 1U58A 1X5AA 4P4RB 3WIFB 1TLKA 3KR3H 5E8NA 5JW4N 5I1KH 1IM9B 2IAMC 3GSRB 1G1CA 1EHXA 3VDBA 4HK3J 4ZO8A 1E6JH 2R1XB 1FGVH 4J8RB 5C0FA 5IFHL 4WUKL 4PRID 5GGUB 3RUGA 3ULVE 2A1WH 4M48L 3BN9D 4JFYB 4Y4KD 5GZOD 4L4VE 5C07A 4HMDA 1CDHA 4OZHE 4U31A 4DTGH 5I0ZA 2V2XA 4NM4H 3QIBB 4OV6F 4N5ED 1B0RB 1ZSDB 1Z3GL 4P23C 2XG4A 3QUZB 5K9KB 4OJFH 1JZ2A 3SDCD 2LU3A 1WC7A 5C7XL 4U6VL 5IQ7L 1JK8A 2EDOA 5JHLH 1Q94A 1W0WA 4PJ7E 4ZTOH 3WLBB 3HMWH 1HHGB 2HT3D 1AO7D 4FFZH 3PXJA 1YEFH 3AAZA 4NP4L 3RWGA 3LH2H 3EBAA 4LLVB 4MZ3A 3EHBC 3CFBB 1OHQA 3KYOA 4OZGB 2ITDB 5HGDA 1ZHBB 1VEMA 2DQDH 4HWBH 5JPMA 1FG2B 4QTHB 5AWNL 2FX7L 3MFFA 3BFOA 5ENWB 1NC4A 5A16A 3V4PH 3O3AA 3UAJD 3GSQB 3B6SA 3F7RA 3C8KA 3LKSB 5C9JB 4XGZB 4X7SH 3HZKB 3VD3A 5D1QC 3O3UN 4QCIA 3OXSA 4NO0B 4KJQC 4AEIH 2R0WL 3REWA 1PVHA 4AEEA 5EC2B 1KLGB 4XZUA 4Y7MA 4XAWH 1F4XL 2NW3A 1OAKH 3P77A 2ED9A 2CKBL 1T6WA 4NNPH 1GC1L 2O93L 3WNPA 2EH7L 1CG9B 4JGMA 3CUPA 4OUUB 1A6UL 4YWGL 3BP4B 5JORB 2VDMH 5CBAB 1WIOA 2Q8AL 4X4ME 1KCSH 3IJSA 4ZSOB 4DZBB 5L2KD 3LEVH 3EYQD 3RNQA 4RBPH 3QIBC 4LIQE 5GGQL 4GKOA 2DMKA 5GIRA 3A6CH 1RU9H 1IC4L 4XVJL 1QFWI 4XHJC 3VG9C 4HKXA 3TGXA 4QRRB 1MVFA 4UDTA 2VLJB 4YO0A 3AREA 1NSNL 2ESVA 5EU3A 2PTVA 1O7VA 1YEGH 3ILQD 1U8HA 1PZ5B 1R5IA 4C59B 1QBAA 2FYYB 5C3LD 1L7TL 3P40A 4TQEH 4LEOB 3Q6FB 3HCVA 1HH6A 4LCYA 5F89A 4AH2A 1A6ZB 3QQ4A 5SV3A 4BUHA 1HNFA 3IS0X 2YWZA 3P30L 2GSIA 4LKXB 1DP0A 5EIIB 1BBDH 4GW1B 2CRIA 4PV8B 1V7ML 2I9TA 4OTXH 1NUNB 1F6FB 2QQLH 2VN7A 3QXAA 1M7IB 3FCTA 3S4SB 1JPSH 4FQCH 3U6RA 5J6GA 5D8JH 3LKQA 4X6DA 1IGIH 1RZIA 4XWGH 3NAAL 4X83A 3RDTC 2Q87A 1DZBA 1ZA3B 1OTSC 4PB9H 4CDHA 1CU4L 5I74B 5F9OL 4TRPH 4LLQA 3GI9L 4ERSH 3E6FA 1WAAE 1RPQA 1FYTA 1HZHL 2OJZH 2V7HA 1LE9B 1Y18A 2XXMB 3DYPA 3I85A 4P3CH 3P4NA 3MRFA 4D9RD 2OL3L 3QISA 3G5VA 4JCLA 3FAWA 4LGPB 5JPNB 2RAMA 2DQHL 4NQCB 2BC4B 5I8CB 3RGVD 4XI5D 3QIUA 5J4MA 3GSOA 1PEZA 2ARJA 3CSGA 1QLEH 2HKHH 1SJEA 1NDMA 1OAZL 2A83B 2OTUB 3BD5A 3B9KA 3LZFL 2R8SL 1CGSH 4ZFZB 4P4KD 1QBLH 3S8WA 4O51A 5DS8B 2V17L 2C1OA 1QPXA 1QFUL 3DRTA 2Y06L 3QPXL 1E4KA 3VE0B 1ZLSH 1JF1A 4WHCA 4F57H 2P42B 4HEPG 5FYKL 5AZEH 1I1AA 1DANU 1P7QB 4O5LH 2X1OA 3FONB 2SEBA 1IEBB 3QFJA 5F1IA 1QD0A 3TBYA 1D9KB 4FQPA 4NCC1 2HVJB 1A7OH 2V7NB 1DN0B 1L9NA 5ALCL 4XPHH 1NDGB 3DYOA 7FABH 4NBXB 5T1MB 4K3DH 4F37F 3DOSA 1JP5A 2GY7B 4PJBA 4P2OA 4JDTH 4S1DC 4UQ2B 3KR3L 1BJ1J 5I1KL 1OARH 4H25B 4G6AD 4MD0A 4X80H 3R4DA 1E6JL 1FGVL 2FJGA 1QVOB 4E9LA 5EO0A 1AD0A 1FN4B 2F5BH 3HAEG 4D0BA 2A1WL 1V7NH 4L3EE 4XH2A 4DTGL 3CDCA 2Z9TA 3MO1A 4NM4L 3TVMB 2ENSA 2BNQB 2I60H 2XI9A 1XGTB 1JUFB 4I9WD 5LGJB 2Y5EA 2FEEI 2VYRE 4OJFL 5I74C 3T3ME 3ARDC 4HAFA 5GZNC 5KW9H 1BVKB 4ZUSA 5B8CB 5JHLL 3UDWC 2EYSB 1AXSB 5J12B 3QNZB 4ZTOL 4MNQD 3HMWL 3IJHB 4FFZL 3HAEA 4UB0H 5D9SB 4HK3N 4KVCH 1HWHB 5D7LB 4GG6E 4JRYE 2OSLB 4DKEH 3MV7B 3LH2L 4X7EC 4AENB 4HS3B 5EU6A 4U6XA 5DQ9A 3FAXA 4H26A 1FL5B 1SVCP 3IDIB 4JFOB 1A1MB 4NC2B 5IGXH 2DQDL 4HWBL 4M8QA 1NFDF 2NZIA 4M6NH 4XVSH 5CWSB 2DL9A 3QUXB 3V4PL 5FDYA 2WWKT 4P3WA 3KPSB 43C9A 1EEZB 1RZ7H 4ODWB 3QUYB 4JN2A 4X7SL 2QSTA 1F3JB 2GTZB 3FQTA 4XMKH 4W70A 4AEIL 1Q0YH 2EDWA 1PYWA 3RU8H 2HG5B 1D9KC 3BOVA 3TF7C 1KCUH 4MAYB 1U8JA 32C2A 4XAWL 4JVWA 1CCZA 1OAKL 2CR3A 1HQRB 4NNPL 2WM0A 4FFVC 3DIFB 2YUVA 3WFHA 2PR4H 4IOFD 2LU7A 3BP5A 4TUOA 2P5EA 2VDML 4RNRB 4HSQA 3SJVB 5IM7B 2EZ0D 3DUUA 1KCSL 1UH3A 2EDHA 1R3HA 5I9QB 1MEXH 3LEVL 5FO8A 3EYSH 3T3PF 5CILH 4KI5F 5E2WH 3GIVB 5C0IB 5IKCB 1EFXB 4NN7B 3TVMC 1EMTH 3A6CL 1RU9L 1VB9A 4GW4B 5GSVA 3MOQA 5J56B 2YKLH 1AXIB 3HRZB 4X98A 3N9GH 5BS0B 5L8JB 2Y6SD 3VFMB 1YEGL 5B8CC 1E4WH 4K3HA 5D93C 4ZFOL 4ELME 2D31B 1HCFX 3MOBH 3MUJA 2YD4A 1XIWD 4TQEL 1A9EA 1L0QA 4HG4K 3SGEH 2HT2D 2H9GB 2I07A 3C5ZB 4MJIB 4BSWB 4S1SH 2RGSA 1BFVH 5F9WC 1BJ1H 3OJMB 5E94A 4QHMB 4X4ZA 3U4AA 1OGTB 1BBDL 4KDTA 2HFGH 2QQLL 4OTXL 1S7VA 3OKEA 5D2LA 3VJ6A 2OMNA 5DK0A 1JPSL 4FQCL 4G6MH 4BZ2H 5D8JL 1AHWA 1QLRA 4JEGB 4PJIF 1NFDB 4R6UA 5IB3A 1IGIL 2P7TA 2C3WA 4HWNA 4XWGL 5MEPA 2GAZB 1F58H 3VXQA 3CDGB 5EUKA 4AIZB 1PD6A 3D85D 4Z7VF 1S9VB 3QUYC 2IGFH 3N0PB 4PB9L 2P24B 2BY2A 3O3BB 1JGUH 2W0LA 4ALAH 2CDFB 1CGWA 3TBTA 3CFDB 4F7PA 1BP3B 3MJ8B 1WIUA 2H32H 4TRPL 1F2XK 4ERSL 4HGMA 4Z8FH 2D2OA 3LDBB 5IEKA 2OJZL 2FO4B 3C5JB 4P3CL 4F7TA 5C0CA 5EC1B 2H8PB 4ZUWA 2XN9D 5C08E 4GMTH 5CLWA 1EHNA 1H3GA 2DM2A 3TH4T 5KSBE 1WSST 3MNZA 3WDHA 1M6OB 2YUXA 4M4PA 2XZAH 1JGDB 3KPNB 5JOFA 3QDMB 4LAJH 3W9EB 5I9QC 5EZLB 3KPLA 1QLEL 5D1XA 3TN0A 2HKHL 3CPLA 1VADB 3T1FA 1H15A 1CGSL 4NNXA 2N7BA 1INDH 1QBLL 2P44B 4I0CC 4QRSA 5F1KC 1MLBA 3CLEH 4G7VH 3ARGB 1ZLSL 1N5YH 4F57L 5T3ZE 5AZEL 1P84J 3TO4C 4O5LL 4KGJA 3SCMD 3IKKA 3BX7C 5JDJA 1KTLB 2FJFA 3SDDA 1S7WB 2HTLD 1QTYT 3JBG7 1WVZA 1A7OL 3KLHD 1WCBB 3C5ZC 4WO4B 4XPHL 1UEYA 1JPFA 2EIEA 3QR2A 4JR9H 7FABL 5IWLA 4K3DL 4OZIE 2BVPA 3VXPA 4JDTL 4NGHH 4WW2C 2VXUH 2PXYC 3BH8A 1G7QB 1OARL 3WFZA 2FSEB 4FFYH 1A2YA 4ETQB 2AXGA 1R3LB 1RIUH 1JZ8A 4X80L 3GFUA 4G9DA 1CICB 2M8XA 2B1HH 1X44A 1ZHKB 3LKOA 2B5IC 2F5BL 3PQYD 4QWWD 1YY8A 3TM6A 3I3EA 1V7NL 4PJIB 1KCKA 4JFEB 3QUMH 3ZYJA 1A6AA 2ZSVA 2I60L 4XPTH 5FA3B 5BJTA 2NR6D 4Z7VB 1A6PA 4M7JH 3SQBA 1LDSA 3GMOB 2H3NB 1SJVA 2H2PD 3QEUA 4PJHA 4LVHB 3ZDYE 5JXAH 3ET9F 4MB5A 2Q3AA 1HH9A 5KW9L 1D6EA 2H26B 3MRGA 1IAMA 4PP1D 5MERA 3LDBC 1B0WA 4OIIH 4K7FB 4GRLA 3G04A 2JCCE 5DHYA 5HHOA 4UB0L 5FB8A 4KVCL 4M7LT 4YC2B 3O8XA 4GH7B 2QSCH 5DJCB 3VI4F 4DKEL 1JCKA 4BQ9A 1AKJD 3L3OB 5J6HA 4KUCF 3NIGE 3KPRB 1UXWB 4X4MA 3ZDZE 2FL5B 4X5WA 3X13B 3FT3B 4LGSB 2I5YH 1TENA 5SWZE 5IGXL 3W5MA 4K8RC 4MQ7B 5D1ZA 5H94A 4KI5C 4PJCE 4M6NL 4P2QD 4U1SA 4XVSL 2DYPB 4XMPH 4G6KH 1O7SA 2ZCKH 2AI0H 1D5BA 1DDHB 4NHUB 3I02A 1I7ZB 1RZ7L 5HGHA 3WS6C 4JY4A 4XPFH 3QAZB 1O0VA 3WNOA 4G43B 1NH6A 3MRRA 3TESA 4RCAA 4XMKL 4NRXB 3PDGA 1Q0YL 4R3SB 4XWOC 3S34H 5DWUH 3RU8L 2XWBA 3PABB 1KB9J 1KCUL 1BZ9B 1I85C 3HC0A 4LEXH 1GRWA 2BNRA 3T0VA 4I18A 4L8CA 3BEVB 2J88H 2PR4L 1I9IH 4UMGA 1ZLVH 2I9LA 4P5TD 1MEXL 4EUPG 4GKNB 3EYSL 2DWDA 5CILL 3RL1A 3HE7D 4IMKA 5E2WL 5H37G 5IR1A 4N8CH 5E9DA 4LRNH 1EMTL 3X11B 1EVTC 2JIXD 3TBSA 4QO1A 1TNNA 2JB5H 2X1XR 4MS8D 2XA8H 2YKLL 4DUXA 5KN5B 1IM3A 3N9GL 4J4PD 2OXHA 3RY5A 1IEAA 2ITCB 3D48R 3QA3B 1E4WL 3MRHA 4ZXBC 4XCCH 3JWDC 3MOBL 5ACZA 3Q1SH 1Q72H 4EUPA 4KWUA 1JRHI 5E5RB 2K1MA 4S1SL 1BFVL 1NLBH 2D0FA 3EDFA 3PWUB 5GGVY 5HVHB 2PO6B 3P9MA 4J3TA 5E95B 5SWQB 1FFQA 3I6KB 2GK2A 1T7XA 1F6LL 3BISA 5FHAH 3QG7H 1XGYH 5IHZB 2HFGL 2FIKA 4Y19B 2EE3A 4KU1A 4BFIA 4PJEE 4YBLB 4G6ML 4PJ9A 4HKZB 4BZ2L 1AC0A 5IIEB 4NJ9H 1IAIM 1F58L 1MFDL 2YPLB 3KNBB 4RMQA 2Q76B 4MSWB 2X40A 1JWMB 3KVQA 2IGFL 3QAZC 1JGUL 5FEBA 3EYVA 4MQXD 4OB5H 5E5UB 1A21A 1KCVH 4ALAL 1EA9C 3MRIA 3ALPA 3G5ZB 2J4WH 2R2HB 4FXGB 4IHOA 1F42A 3ZDXF 4Z8FL 1NMBH 3M45A 1MFNA 4S1QH 4XVTH 4BQ8A 3W9DB 2W1NA 1GAFH 3QXVA 4MDIB 3BJLA 2CSPA 1AC6A 1EGJH 4G7YH 4GMTL 3CCHA 1NBZB 5JO5B 3ARFD 1YEHH 2MMXA 3D2UB 3H9HA 4ELKB 3L5WA 4KQ3H 4Q6IB 2YS4A 2XZAL 1KUMA 4HPYH 3U7AA 5T1LD 3OGCB 3TZVD 4KHXH 3DMMA 1D5MB 5DD0H 2OTPA 4KK8C 4L3EA 4N8PA 5D7KE 4NUJA 5MENE 4XCEB 1INDL 5EZJA 5B3JF 3HE6B 2YA1A 1OTUC 3SPVB 1OP3H 1SBBA 3KYMA 3CLEL 2FHBA 4G7VL 1T5WB 5IF0B 1CIUA 1N5YL 5FKAA 1SJHB 4LCWB 1IKNA 1Y6KR 3IDMA 4G8GD 1FIGH 3RBSA 1ZVSA 3ALXA 4M4RA 4Z7WA 3QCUH 3JV6B 2QTEA 3IS1X 1XGRB 1JYWA 4AM0B 3U0PB 2V9QA 1RJYB 2HKFH 4JR9L 2PO6C 3UTTD 4LVEA 2F74A 4NGHL 2NY3C 9CGTA 2VXUL 5CUSH 3BZEB 1KN2H 4PRIA 3S5LB 4FFYL 1IAKA 3G6JA 1OW0C 1RIUL 3R06A 2O61A 4F80A 2HTKC 5B4MD 2B1HL 1LE5A 3QDGE 4U33A 4YBLC 3KDMA 4KRLB 5DGQA 1YNTA 4HBQA 3L3KA 4U1NB 4K8RH 3OR6A 1D5IL 1JGLH 4R97B 3QUML 4Z77B 3VXRB 2XY2A 3H9SE 4EVNB 4C55A 1UENA 4XPTL 4HX1B 1CF8H 5IB4B 4M7JL 2HJKB 4PG9A 3QJFB 3P73A 3VXMD 1B9ZA 3EOBA 1EHAA 5JXAL 3L7FA 5JDSB 5DRWB 1MH5B 5IW1B 3QO0B 2DKSA 4OIIL 4EIGB 1ZLUH 1AH1A 3L3JB 1QFWH 1BIHA 2XNAA 3KYNA 4WY7H 3QO1A 5I75B 5LGHH 2OZ4H 4JHBA 3IXAA 4NO5A 2QSCL 3VDCA 4HH9A 1YY9C 1AIFA 4Q6IC 3ULVD 3VD5A 1DUZB 4LK4A 3DXAA 4LKCB 4L4VD 4M8VA 2UV3A 2I5YL 1A4KA 3CVIH 3V7AE 3SKUD 4MNHA 3RA7H 3X14B 4XMPL 4G6KL 4YHIA 2ZCKL 2AI0L 3RZCB 4Z7NF 4HWZB 1U8MA 1NCWH 5FK9B 5KVGH 4XPFL 3C08H 1U8QB 1MCNA 3BP7A 1T66C 3L3HA 3O9WC 3S34L 3C6LB 5DWUL 5IJVA 2VLRB 3MYJB 3ARBB 3MQIA 4LEXL 4XMLH 2LU4A 3JWDH 2G2RA 4I0PD 4G9FE 4PGCB 4HXAH 5C0BB 1DE4B 2J88L 2ZSWB 3MA7A 2ZCHH 1RUKH 1MHPH 4RGOH 1I9IL 4GKZB 5ISZA 1BZ7A 5C8JB 4MCYA 3GJFA 1RQ5A 4WWKA 2W38A 2ATPB 3GSUA 2YD3A 4CU8A 1TITA 4JRXB 3IU3A 3DV4A 1Z0MA 3F5WA 5IBTH 3KAAA 1GXEA 4OQ1A 4N8CL 5K59E 1GZPB 3MUGB 3QUKB 4LRNL 4FZ8H 3MLPA 4WW1A 3MZTA 3OXRA 4PJFE 1LVEA 5KSAD 5DJYA 4W4OA 2JB5L 3J8F7 2XA8L 5IMOA 5FA4B 1R3KA 3AXLB 4EXKA 1JNHA 4LLDA 3BVNB 2MTPA 3ZE2E 3S3PA 3L6FA 4HIHA 5DI8B 1F4YH 3OKMA 4XCCL 4G6FD 2NY1C 3Q1SL 1Q72L 5E7BA 5I75C 3BH9A 1NLBL 3C8DA 1WQVT 5T1KB 2NZ9C 2IADB 2NY4B 1NCNA 5CEYA 1IMHC 5FHAL 3QG7L 1RK1B 1XGYL 3S98A 1U91B 3WXVH 2VDKH 2VLKE 5CBEA 2LVCA 3BKJL 3STBA 1I75A 1N0LA 3H9YA 3MRDA 4NJ9L 3NFNA 3RZCC 4MJ5A 2JF1A 4LAQH 3RL2B 3T4AB 1CLOH 2NY0C 3W39A 3CGTA 4LDEB 3RX5A 4U4BA 1TVBB 1A6TA 2P5WE 5D7SH 4OB5L 4PLJC 3OAZK 5GHWH 4N9OB 1KCVL 4L3CA 3MRQA 2J4WL 3ULUE 2BRRH 1M05A 2X4SB 2C4FT 1WC7B 1Q0XH 3L95B 1NMBL 3PDOB 4S1QL 5L8KB 4XVTL 4JFDD 1GAFL 4CVUA 1EGJL 4G7YL 1A6VH 4J3OC 1KCLA 2MFNA 1QACA 5JOEA 1YEHL 5EORH 3NACH 1FNGA 1XR8B 2P47B 1KV3A 3F62A 2JELH 3RWCB 4KQ3L 4HPYL 4ZPVA 3VD4A 1X4ZA 3OTTA 1HHJB 4QF1B 4BUGA 1FAKT 1MI5E 3KYOB 4KHXL 5E2TH 5DD0L 3UYPA 5HGDB 3NFPA 3Q6GH 4ZNEE 1EO7A 2A9NH 3ZKXB 3ELAT 4I3SH 3VXTA 4HIJB 4ODBD 4NQEB 1FO0A 1RMFH 3FQNB 3IDYB 4L4TE 4P46D 1MOEA 4L1HA 2ZG1A 1FIGL 5AD0A 2WBKA 3QCUL 4QCIB 4ZDHB 8FABB 2JCCA 2AK4E 2EH8H 3REWB 2W9EH 4YK4B 2HKFL 4JDVB 4K9EC 3DX7B 2K3TA 3MGOA 3D39B 4TNVK 2NY4C 1ED3A 5E1HB 1OF2A 5CUSL 1KN2L 5FGBC 5FUCE 1Z6JT 1FIEA 4WUUB 1MCHA 4X6CE 2BVOA 4FXKA 1ROWA 2CLVB 3DV6A 3UZVB 4K8RL 1S78C 1GHFH 5GRVL 1JGLL 1XCQB 1S7UB 3O41A 2D7MA 2J6EA 5H2BA 5CZVH 5EOCJ 5BV7B 3RTQD 2OTWA 1CF8L 1H5BB 4M1GH 1KYOK 4JQVC 3VFOA 4P23D 1KG0A 4QHUA 5D6DC 1XGQA 3BPNB 1RZGB 4DVBA 2Z93A 3BDXA 4HKXB 4RX4A 2FX9H 4YO0B 2RJMA 5HGBA 1ZGLA 3G6AB 2ESVB 4QOKA 2FR4B 1QFWL 2PKDA 1PKOA 1X7QA 5HHVH 4WY7L 5LGHL 2OZ4L 1XZ0A 4JPWH 3GM0A 3WFCH 3K0WA 3MCG1 4LCYB 1YPZA 5F89B 4DZ8B 2YRLA 4JO4H 1QQDB 4U1HA 3EHBD 3QQ9C 5DMIH 3GIZH 3MV9D 4KV5E 3CVIL 3RA7L 5HVFB 4NO2B 3V2AR 4B41A 1T20B 5GGSB 3FCTB 1IGYA 2H6PB 5J6GB 4NRYB 4JHAH 3ZKXC 4N0CD 1QBMH 4BFGA 1NCWL 1X3DA 5CP7A 5KVGL 5F3HA 5DRZA 3C08L 5A1AA 4PRHE 1JFQH 5F7DA 3SOBL 5K9QI 1ZT4B 5D1QD 1LILA 4X6BB 4KJQD 4JRYD 4XMLL 1KT2B 3JWDL 5IEHA 4HXAL 4K7PX 5CJ8A 2J5LB 1B88A 2ZCHL 1RUKL 3TFKC 1G7MA 1MHPL 1Y18B 4RGOL 2J1KA 3MRFB 4FQQA 3PWJA 2HFEB 1UGNA 1NAMB 5IVXE 1O5DT 1JI2A 2EDBA 4POZC 5T5NG 4Y4HD 5E24E 4XBGA 5EO9B 4S11A 5DF0A 5ITFA 3AS1A 4JFZH 4JCMA 3GSOB 4KTDH 3HZVA 5HVGB 5IBTL 3RWEB 3ZT5A 2ZUUA 2HH0H 2IBGA 4GRWB 4FZ8L 2EKSB 1U3ZA 1T1WA 3DGCR 3T1WA 2GT9B 3VMNA 2DLEA 5IOPA 2QSQA 1G7JB 2GI7A 4XHJD 4BQCA 4CGTA 3VMOA 3MRNA 1XIWA 3CSYA 2NYYC 4MXQC 3GMQB 1ORQA 4HK0A 1G7PB 1F4YL 1N59A 2BVEA 5L7XH 4XP5H 1A4JA 2SEBB 4JJ5B 5F1IB 5HGGS 3FOLA 2VIRB 5H35B 4EQ3A 5A43C 1LO5B 4C58B 2UUDK 1KJ3H 4PJBB 5HHMB 1EIBA 3WXVL 2VDKL 4C83A 1QSFE 3B9VA 3KWWA 1NCCH 3D85A 1A1OA 3FQRA 2ZOKA 4F15C 3RVXC 4MX7B 4HZLB 5JHDE 5IMKB 4OFIA 4N68A 5EOCH 2DB8A 4LAQL 4Z5RB 1P5UA 5CD5C 1CLOL 1FDLH 1NUFA 3RDTD 1CGUA 3KXFB 3MO1B 1DVFD 4PV9A 1OTSD 5IUSA 5D7SL 4DFIA 3VXUD 4E5XA 1P5VA 5DDHB 5GHWL 3P4OA 5SX4I 3CFCH 3HTLX 2BRRL 3O45B 2NXYD 1Q0XL 4C56A 4PBVC 4QXTA 5JA8B 3LOWA 3SE8H 5C92A 1W8NA 4ZUSB 2FEEL 2J5LC 5BMFH 4K9EH 3UTSE 1A6VL 2IG2H 3DRQB 5DGRA 3P3YA 3HAEB 3NACL 5EORL 2JELL 4UIMA 1U93A 2R2EB 4LHQB 4U6XB 4N90E 5E2TL 1FL6A 5BRZE 3RKDC 1KJ2B 1C16B 3WN5A 3L5JA 3Q6GL 4P5KA 3I9GH 4U6TA 4HG4J 3RZWA 4QHNB 5C71A 2A9NL 4I3SL 3SCMA 4NPYB 4ZQKA 3B9DA 4FQ1H 1G6RB 1RMFL 3V7AG 3O2DH 2R39A 4UNTA 4L8BB 5F9AC 4JN2B 5C08D 1H3PH 4J3SA 3C60C 2BOBA 3FT4B 4MA1C 4X0KB 1I8LC 4PJDA 3CZFA 2EH8L 2IANB 5HYIA 3HI1A 2W9EL 3VDAA 1K3ZA 3SKOA 3WNKA 1G7LA 5I66B 4F9PC 2MHAA 4MYWB 3ETBF 2WAHA 3RPIA 2ICEA 4OSUH 1S8DB 3R1GH 4Y16C 4TUOB 1YJDC 1OD9A 2Q6WA 1MSPA 2GK0A 4L8SA 3U36A 4XPBH 1GHFL 1SY6A 3QULB 5FO8B 2ERJC 5T3ZD 1OP5H 3A6BH 2HLAB 5CZVL 4M1GL 4NC1E 5M7QA 3MJ6A 3T2NH 2OR9H 2Q7NA 1JWUA 3NBNA 1PGRB 1U8OB 3ARDD 4HLZG 2FX9L 2AJZB 4POUB 1E28B 4KKCD 3UPAA 5JMRA 1WUNT 3RIAK 2V5RA 4JZNB 5GZND 4HKJB 2CDGA 4YAQB 1JZ5A 1FL3A 5HHVL 3DX6B 3EGSB 4NQDE 4JFPB 2NXZD 5J06A 4JPWL 1DQQA 4Y5XA 4UNVA 4W6YB 5FCUH 3WFCL 3QQ3A 1XGUA 1F11A 1I7TB 4MLSA 2ZUVA 3W0WE