3MVSA

Structure of the n-terminus of cadherin 23
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
b'QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-23
publication title Structure of the N terminus of cadherin 23 reveals a new adhesion mechanism for a subset of cadherin superfamily members.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 48
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA02
2OMVB 2WCPA 1NCHA 2V37A 3LNEA 5KJ4A 4NUPA 4AXWB 3FF8A 1Q1PA 3Q2WA 4ZMLA 4NUMA 3UBGA 3K5SA 3LNFA 2OMXB 3LNIA 4ZMVA 2WHVA 3Q2NA 1SUHA 2A4EA 2YSTA 4AQEA 3FF7A 4ZMXA 4XXWC 1NCGA 3PPEA 4ZT1A 3K6IA 2QVIA 4ZMYA 4APXA 4ZMWA 2X2UA 3LNDA 4AQEB 5CO1A 4OY9A 3K5RA 2OMWB 5DZVA 4ZMPA 2O72A 3LNGA 5JYMA 4QD2E 1FF5A 4AK1A 4XXWA 3QRBA 4AXWA 1WUZA 3UBFA 3K6DA 4NUQA 2A4CA 1L3WA 4ZI8A 3UBHA 3K6FA 4ZTEA 1ZVNA 3LNHA 2OMTB 4ZMZA 1NCJA 1ZXKA 2OMYB 3Q2LA 4NQQA 4ZMOA 4APXB 2WBXA 4ZMNA 1EDHA 4ZMQA 1OP4A 4AQAA 5CZRA 3MVSA 2WD0A 2OMUB 2QVFB 2EE0A 1NCIA 4ZMTA 1O6SB 2OMZB 5JYLA 4AQAB 2YQGA 3Q2VA 4AQ8A 4AQ8C 1WYJA
chains in the Genus database with same CATH superfamily
1CDIA 1UJ3B 1NFDA 1OTTD 5F0PB 4PD4K 1T7VA 2PCYA 4NUPA 5DJCB 1KXVC 5T8IA 2DIAA 1SBSH 3K8KA 5KSAD 3WYRA 2VT0A 4F7EA 3DMMA 3VXUE 1TT6A 3JYCA 3LTVA 3EBAA 1ETA1 5HYQA 1BLIA 1SMAA 4MMZA 2J57A 1A7QH 5D7IE 4B9GA 1U92B 3S3DB 4I2XE 2DIBA 3Q5YA 2FHCA 4ZMVA 5D70L 3SYAA 1HQ4B 2BVYA 3F7VA 1HEZB 2H6PB 4JQVC 3LMJL 5F7EL 1DVXA 2Z93B 4U1KB 4ANUA 1VB9A 3G08A 5GRUL 1LO0L 3RJDA 3KMDA 2N4IA 1YYMH 4WFFD 3QPQD 3LN9A 1X4YA 3UDWA 2IH8A 1U58B 5T3ZD 3L9YA 3PFUA 3RIKA 1PX4A 3HPLB 3OJVC 4X5QA 3ETBF 3ULUL 2OMYA 1KJ3L 3UC2A 3N9GH 4X6DE 5B1KA 1BMGA 3KPMB 2X2UA 5CBEA 4NYLA 1IBZA 4GW5B 1I9IH 1OXYA 3O4OC 5I1AA 5HYJD 1Q0EA 3BH8A 4JFFA 3IJYB 5GGVH 1TJHL 5JUEH 3B9AA 4JUTA 4WKXA 5EU4B 2CO3A 3KVQA 3BGMB 1NANI 5C2BL 1BBDL 3OXSA 4HGWB 2UZYA 3R7QA 2NY3D 4QHUA 3U0TA 2XETA 4BQ9A 3MLXH 4X6CA 3B9VA 4UTAA 4Y4HA 4KROD 1W0VB 4LVHC 2MEJB 4U3SB 3IRCA 4TUOB 4AXWA 1Q9LA 5PCYA 5K9JH 1QI4A 4PJDB 1XTMA 2Z4QA 3FUDA 1QRNA 5AW9B 5EBWB 4PCSA 3OKLA 2GW5A 1B2WL 5EZOL 1A7RL 2XXCB 4FQCH 2E7CA 4M00A 1FYTA 5SWSB 2I7SA 4PJBB 3RZCC 4HJJH 4HKZA 1SYVA 5LN8A 1G7JB 1ZAGA 2QADC 4HIEB 1BFOA 4JFHE 3FB5A 3GBNH 4A2GA 3WO4B 1G9MH 1X7TA 2JI2A 1HXYA 3EGDA 5DI8B 3HBQA 4IRJA 1H3GA 3HFML 3LB6C 4LASH 4YO0B 4ZPTB 3K4DA 5E2WL 5HHXL 6PCYA 2PYEE 4FJ6A 5D7LA 4MDJB 4N0FB 5DR5H 3LV3A 4WW2F 4E42B 1HCZA 1YJDH 5I2IA 1NCIA 1WAEA 1I9JH 4HIIA 3FO0L 2AK4A 1IGMH 4U7SA 1BV8A 4PTTB 5AZEH 4Y4KB 3RVVC 4AI7A 4EUPB 1B2YA 1CGVA 2GUOA 3DETC 5F44A 5TDPB 3RDTC 5DWUL 1J5DA 3LH2L 3VAEA 4UQ3A 4XP1L 5ECGA 5FUZH 2WXRA 4OLEA 1INEL 3QR0A 4QRPE 3L3HB 4P59L 1T66D 4JKPH 4TQ8A 3LPPA 2X4NA 4JRFA 2VJ8A 1XMWA 3SYQA 5E08L 5T5FA 4MD4A 3RKDC 3HR5B 3RG1C 3QHFH 4NKIL 1JZ2A 3H8NA 3O9WA 1HC1A 3FCSA 5FA3A 3QCTL 3ARBB 4F7CB 4Z95L 1NZRA 4Q4IA 6PAZA 1RHFA 5A6IA 2IWFA 3S96B 1DQML 4YDJB 3D39B 3FTXA 1U3HC 4P46A 2AJZB 2WJ5A 1FFNB 5C0RH 1H9VA 2YK1H 2H2SC 5DQJB 2CBMA 5AYTA 1RUAL 1YVLA 4NZDA 1VADB 4CNIA 2UUDH 2WQUA 4YZFF 2D31A 4MXWH 4HCRL 1OP3H 3ZGHA 3CMGA 1Y0LA 5IEHB 2OJ1A 4UZSA 1NCBL 3GSXA 4AGNA 5BUPA 5LB1A 4NO2B 4GG8B 2R2CA 4MA1C 2J6WA 3LNDA 4H0HB 2NX5D 5D1XA 3AABA 3TBTA 4XRCB 1A9VA 3BKYL 2VITA 1YNKH 1ETJA 1FZKB 1GCYA 4PIRF 1UD4A 5IFAH 3QCVL 3C6EA 1AAJA 1L0PA 5ID1A 1AHKA 3V0WL 1OCCB 4M9PA 3BPNB 1OGPA 3LEVL 4KKPA 4P23C 4PD4J 4TSCL 4TVPD 5DMGD 1VZHA 5KUMA 5IVNA 4HEME 4MJIB 5I74B 1U8JA 5AOZA 1FL6B 3DV4B 1T1ZB 3AG1B 1UD2A 1CLZH 4MNHB 5F7WC 2OTWA 1CN4A 5GRZA 4RRPM 2NNXA 4RQQB 5GPRA 5ADOL 1MXGA 1S4IA 3WIFB 3V4PL 5D8JH 3JTSB 1FGNH 4AIZA 4I7ZC 5EZIH 2L7JA 2DIEA 3ARTA 3WJJA 3OKKA 2P45B 1DBBL 3GSOA 1MHEB 2EKSB 5F7NC 3FSVA 3QIBD 5GGSY 4ZFOB 4NN5C 3DDFA 3QUYC 1OOAA 2MH4A 4PJ7A 4U33A 1I1YB 4Y16C 4ADIA 4AQAA 5J4MA 3LQAH 3W5MA 2I24N 5D1ZA 3WIHA 1KBWA 3NRFA 1L6ZA 3BAKA 1AGDA 3BO8A 4AYID 1N18A 3RVUC 1E50A 4PHZA 3QNZB 5F3FA 5GRYA 2YBRB 1FCCA 4X4XA 1WCBA 5JW3L 3L95A 3QCUL 3QXUA 1ZLSH 1OE1A 4L8SC 3UTTB 3FQ4A 3MV9B 2PXYD 4JM2F 2VDQH 2WWOA 4WO4C 5DHVA 5I8CA 2WLLB 3AQDA 4DP5X 3D51A 5EU7C 1EJOL 3TO4D 1U93A 4J3TA 4HUWA 4MCZA 5J1AB 4NRZA 1TSRA 3FCTA 3CFDB 5CS7A 5IM7B 4MA3A 4PP1D 4LIQE 2IG2L 4KDVA 3UEZA 4WV1A 1EHAA 3QXDB 3DTUB 5INCA 1MCEA 2V7HA 3RWDB 4NUJA 1QFHA 1VFUA 5DHXB 3O6KL 3MNMA 5ADPH 2NNRA 1ASQA 3VU2A 2R2EB 4B0MB 5J11B 3RAJL 3SKOA 3NIFE 3P2BA 4QYAA 1BECA 1KENH 1MVYA 3HUJA 3C9NB 1KXVA 4PJ5E 5LCVL 1PTZA 4BFJA 2EUVA 1CICC 4LOEA 2X05A 3WFCH 2M26A 1DLFL 2EYSB 3NPSC 3RY6A 4GAGL 4F37K 4QTIH 1DQLH 3HB3D 3EFDL 3U1PA 3QZWA 1U8OA 1NFDB 4FI6A 4N5UA 4JO3L 2VCOA 2C4XA 3CJJA 1GA2A 4F7EB 4MB4A 4XPTH 5F72S 2FATL 5ITFA 3V5KA 1DVFD 4JQVA 5HYQB 1FLRL 2VAAA 2F5AH 4MMZB 3TEUA 1WH0A 1ET7A 3ABMB 3PHSA 1UYWH 5AAWA 4FQIL 3S37X 4G6AD 4LP5A 4QCIA 4KC3B 3VFTA 2EAEA 3F7VB 3CLEL 1IAIM 5F7YC 3GTNA 4JFVA 4UBDC 1AE6H 1UD8A 3G08B 5AVSB 4ANVA 3K2MC 1JHTA 1BW8A 3FH8A 4PS3A 3QIUB 4QR7A 3V7AE 3RGVC 4JL1A 5IQ9A 5ERWB 3ARPA 1YNTA 3B2DC 5AZUA 3NTCL 2GIYA 4G7QB 4WEUD 4DGVH 1S7WA 4YHNA 2OMYB 3EYFA 2YXVA 1ZANL 3MRJA 4JRXE 1MJUH 1C8QA 4HOZA 5IHUH 4EI5C 3IYLW 3RIAK 2CA3A 1RIHL 4NYLB 5CBEB 3G5ZA 5C0FB 3F85A 4ODVH 3TH4T 5I1AB 2OYLA 3OD3A 3PWPD 3SZ6A 3V8CA 1T5XA 1DFBH 4JFED 5EU5A 3RTQD 4YDKL 4Z3JA 3OXSB 3VNZA 4ZMTA 2UZYB 3U0TB 4QHUB 2B5IB 1XF3A 3NACL 4XNMA 4X6CB 4Y4HB 1N19A 1NIBA 3LZQA 3Q6GH 4S1RH 3IDXL 4A2LA 4IDJH 2A4ZA 4JQXC 4AXWB 1Q9LB 2YPVH 3EIFA 4PW3A 5DHYA 4B7IA 2Z4QB 4WFGD 1QRNB 4WI6A 4ADJA 1BXUA 4EDWL 1TJMA 5BZWA 3CZSA 2EYTA 4M8UA 1ACCA 2X4UA 3OKLB 3P0GB 3VWKD 4X80L 2R8SH 5IFHH 1FYTB 1MVUB 4MAYB 1JGVH 2CHWA 4K9EC 4HKZB 1SYVB 4XT1C 3QEHA 1C1EH 2NY4D 3FB5B 1WFMA 1UKQA 4M6MH 4YE0A 4ZG1A 1HXYB 2NQDA 3EGDB 3A67H 5C70A 1C8PA 1KJ2L 3FQXA 4IRJB 1XL6A 1Z9LA 4UQIM 5D7LB 2C4FT 1A9BB 4KNUA 4MNQD 3LV3B 4ABUA 2MQ0A 4P3DA 3W9EA 4EN3A 5I2IB 4HIIB 3BT2L 3ESPA 2AK4B 2ENQA 4HIHA 1JTPA 4I9WE 1QSFD 1YQVL 1GPOH 5HDBE 1U2CA 3ZT7A 3F3HA 1NBVL 4LFHG 5HGBB 4XXWC 1LD9A 2GUOB 1KB5L 1CU4H 2ICEC 3X1BA 2L3BA 3S35L 5ESAA 4UTBH 2W9EL 5ITBH 4WW2C 3JT0A 4LT7A 1KLUA 4Q58C 2Y7MA 4NN7B 1A14L 3X3FH 2X4NB 1NLDH 3P73A 3WBDA 2ZE0A 4PRHA 1A6AA 1BF5A 2X87A 2EDQA 3OXRA 5E5RB 1U3HA 1NPNA 4Z3FA 5DMIL 4JO5A 4XVTL 2OR9H 3GTVA 1GS8A 4BUHA 3O9WB 1GS7A 1GRWA 2NQ3A 3FCSB 5FA3B 5ABDE 2BIQA 1RD6A 3I85A 4ODTL 4H26A 1GYVA 3PLYA 1KEGH 1MCLA 3VDBA 1F2XK 4P46B 4NUQA 3QHZL 2WINB 4W9JC 2HH0H 4PU2A 3TOPA 2OI9C 2WCSA 2R2HB 1R3LB 4MLIA 3L3OC 2GSMB 5FYJD 4CNIB 2D31B 1IT9L 1OAZH 3MODL 1BFVL 1DL7H 4E41B 1Y0LB 3GSXB 4Z7WF 4YQXL 4I1NB 4A6YA 2YD5A 1XSKA 3MFGB 4BUQA 5L0QC 4P23A 3OSKA 3FO1A 2IAAC 5D1XB 4WCYL 1YN7A 3TBTB 4JZOA 4FLQA 3GO1L 2M83A 3SE8L 2D7QA 3B2PA 1JF1A 4XCYB 2PW1B 5ID1B 1QFWL 1UD3A 2ICES 4V1DB 3ARDD 3SDYL 4M9OA 1U8JB 2NY6C 4FCHA 3SCMA 2W59A 1WBZA 1PZCA 2OTWB 3UTOA 4PRPE 1PAZA 3DURA 4S10A 4OLZL 2W07A 4Y1AB 2OCJA 4TV3A 1P7KA 3T8XA 3WNMA 3DRQA 5DLML 1FG2B 3QUYA 5AOKA 3NEOA 3KYAA 3NIDE 4AIZB 1UZ6E 2XT1B 3JT2A 4LPXA 1RAMA 4Y16A 2HTLC 3W81A 3HNVH 4Y7MA 4A04A 1BVKA 2JQAA 3D9AL 3OKKB 1IKOP 3ZYZA 3GSOB 4PCTA 5CGTA 3KWUA 4OZIA 1B90A 2JIXA 1KWGA 3KPSA 4GO6B 4KOCA 4PJ7B 5L6YL 1G5GA 1AO7E 2EXYC 4U1NA 1AJ7H 2LT9A 3STZA 4LSRL 1JF5A 2OULB 4OW6A 5IVXE 3LEXA 3F58L 4L8SA 1AGDB 5DK2A 3BO8B 1KCKA 5JW4N 1EUUA 5ALCL 4WO4A 2IMMA 4NM8H 1L7IH 3X14A 2D8KA 3H3PH 4NZTH 1JZ8A 3F8UB 4MRBA 1MPAL 1WCBB 2I60L 4X4XB 3L95B 4B5EA 5T3ZH 2ZXWB 1OARL 3D4GA 2VDOB 1WDAA 4LCCC 1H3PH 1AR1B 2H4EA 3NK3A 5FDWA 1U3ZA 1YYLL 4JR9H 1QSZA 1SJXA 1UUNA 3PWJA 5DHVB 4LNVA 4XO5A 4RETB 4AM0Q 2X10A 1TEGA 1FZMA 5I71C 4AYGA 1OSPH 1U93B 1TLMA 1UACL 2IC2A 2A9ML 3F2LA 4HUWB 4MCZB 3FCTB 1YEIL 4IOFD 1LILA 1USQA 4HK3J 4MA3B 1C5DA 3EYSH 4PLJD 2I7OA 4JM2C 1BZ8A 4F8QA 2WVVA 4YIQB 1XAKA 2AXFA 4XAKD 4XNXH 4WV1B 5LHDA 3ISWA 4R7LA 5INCB 4DP4X 4NUJB 4AK1A 4FAAB 2BZCA 4Y4FA 2B0SH 2BNRE 1N4XL 3LDBC 3SKOB 4HXBH 1KN2H 1HJBC 2FEDD 2QJDA 3GMRA 4LOVA 4TLSA 4TM9A 1WS7A 3CUPA 4P2YA 1IC0A 3UGXA 5GGUA 2OJZH 3FAWA 3FUFA 3QZWB 3TJEL 3WKMH 1J5HA 2R39A 3BPLC 3V0HA 5BO1L 3S6CA 5D6CA 5SWSD 3E1F1 2N1TE 2XWBA 3K81A 2WNKA 1BOGA 2WUCH 3V5KB 2IOMA 4HKBA 5DFAA 5T1MB 2PLTA 1NCOA 4H13C 4DHLA 4W9DC 3SBWC 5EF1A 1A25A 4UB0L 2CA4A 3RGVA 3BGFC 2QVMA 4HF5H 4QCIB 4M61A 2R0KH 3VFTB 1WZLA 1WYJA 2Y5EA 2LE9A 4G6JH 4DKFL 1JHTB 1FC1A 2EIDA 4GRMA 4EI5A 4Y4KD 1MCJA 1XGRA 5EHFA 3CZEA 3LPGA 5IQ9B 1NLBL 3E1ZA 1YNTB 3BN9D 4IJ3B 2VN6A 1NA8A 1DBAH 4XMKL 3L7EA 1XB3A 2QMKA 3CSFA 1S7WB 4I0KA 4YHNB 3MRJB 3DYMA 4P4KC 3RDJA 5ES4B 4BH7A 3QJTB 1P4LA 5A2LH 3HFFA 2J88L 3QUZB 4KI1A 1MNUH 2HX9A 1T4KA 3ZIMA 5HGAA 1T5XB 1JYNA 4FQ1L 4OZHE 3ARBD 3Q2NA 3CDFA 1FO0A 4XMTA 5EBMA 4TVUA 3D33A 3U2SB 5K1VA 1T1YA 1EERB 2BVUA 4XNMB 2AJXL 1TPXC 3D39D 5E99H 3AM8C 5JMRA 1MFEL 1LP9A 2GJPA 3NQIA 3CFCL 3DGCR 4FKHA 5DHYB 4PRDA 1MCRA 1NCUA 2QADB 5BZWB 5BVJA 3AT8A 3UERA 1MCIA 1BD2E 1VGEH 1A64A 2HP4A 2X4UB 2Y23A 3MRRA 4OZGF 4WI7A 1NGQH 1A9EA 1TQBC 3RY5A 1WRFA 2YQ3A 5CBAA 1DQVA 2C9XA 3CK0L 2G9HA 5C2UB 3QEHB 3FN3A 3QT2A 2AW2A 3L5WA 1UOKA 3GRWL 3ZGIA 3CN0A 3FQXB 4PYGA 3O4LE 4RH4A 4XXWA 2YRPA 2ENPA 1EEZB 4P3DB 3FQUA 3W9EB 4EN3B 1HCVA 3BMWA 5BJTA 4HIHB 2WM0A 4MJID 4X4ME 1Q94A 2WP3T 1GL4B 1LMIA 1JDAA 5TE7L 3PL6B 3RVWC 1IGTA 1JGDA 1JPTH 1LD9B 1DYZA 2AFNA 3GMNA 4JFXA 4N90D 5IHLB 2E7DA 4S0TD 1MFMA 1F90H 2GFBA 4APQC 4HHAA 4P3CL 4ZO8A 2J1ZA 4HPHA 2WBXA 3U4BH 4AEIL 3Q44A 4N85A 5C86A 3T0EE 3P73B 4PRHB 2OL3L 1A6AB 5C7XH 3OXRB 3OPZL 1NUNB 1SHXA 2JJWA 3V6FA 1H3TA 4KVNL 4XNYL 1AS6A 1PYWA 2ZX8A 4WUUE 1NJ9A 1QMUA 2CMRL 4JKNA 1D5IL 3UACA 4H26B 3L3OA 4KJWD 5TJWK 2H8PA 4JJ5A 3G6JA 5F0LB 1J86A 4KKBD 1YEWA 3EF4A 3MRBA 3OKNA 3ZO9A 4AMKL 2DQGH 4B27A 2R9HD 2B39A 3N85H 4DKEH 4XPFL 5E2UH 1XSJA 4WNJA 1GAFL 4MA1B 4XP6L 2FWLB 5FYKL 3VRLF 3X11A 4KTYA 4FX5A 3MLYL 1C7TA 2CKBH 1QLEL 3UTTD 1ANUA 3MV9D 1MCQA 3OAWA 2YXFA 4KXAA 4A6YB 4W9CC 4P23B 3ASWA 4H8UA 4L9DA 1RZKH 3FO1B 3ZKND 1YN7B 4G2AA 3A4DA 2PKDA 1QHOA 1JXDA 1ZWIA 2YPLA 2XIBA 4LSSL 1FRGH 1JF1B 3C75A 5IB3A 1KIQA 2A9DA 4XPAL 4RDQF 4F5CE 1MFDH 3ZTCC 1ZXQA 3OMIB 5B3NA 4Q89A 2IAMC 1UXSA 2VO5A 4AGOA 3EADA 4QOKE 3SCMB 3U4KA 5CD5C 1WBZB 1DSWA 5G5DB 4K3HA 1Z1WA 1FIGH 5SV4A 1Q1JL 3KJ4B 4N28A 3DURB 5T1DL 3W1ZA 1UM5H 2W07B 3CVBA 3T8XB 4U2YA 3QUYB 3WXVH 3ILQD 1WFUA 3IBEA 4KO6A 2E8ZA 3W11C 4Y16B 2VXQL 5AW6B 4YBLB 3FUIA 1BVKB 2B16A 3BIAX 3AXIA 4PLKD 5DQ9A 1T1WA 5KTEH 1N6VA 3L6FB 5FV2A 3MUZ1 2ZAIA 5ESQA 1ZCRA 1Z5HA 1EDQA 4OZIB 2JIXB 3U36A 2VQTA 3KPSB 4M5YH 3ULAB 4EKJA 3UIYA 3QUMH 1UFGA 4U1NB 2WNXA 3STZB 3QRBA 3VSUA 2Q87A 5IB5A 1ADWA 1ZIAA 4W6XB 1B0GA 3LEXB 4NQEE 2UY7A 4LCCA 2YD0A 3WLBA 3N1PC 2J8UE 2EKJA 4U6YA 4WO4B 4WENB 5I9QB 3RB7A 4ZW3A 4OVVA 3MLZH 2BJML 1IMHC 4Z0XA 3QIUD 4HHWA 5FDWB 3PDDA 4Z7OF 3PWJB 4JVWA 3U7AA 2X6MA 2F0CA 2NXZC 5D7IF 1BVOA 1FZMB 3ESNA 3ZR6A 2AABH 5ACZB 4NRYA 3RE0A 2FDBP 4HWBL 1QNZH 4Y19A 2A6DA 1IV8A 3GUTA 4GAYA 2XQYK 4XBGA 3AG4B 2PN5A 3KNBA 5KANG 2R0LL 3TF4A 1C5DB 1OM3H 2V3FA 1CDJA 1K2DA 2WVVB 3H1ZA 2AXFB 4EZJA 1EJ6A 5I15L 2MNUA 3NPSB 3UC0L 3I6LE 1MH5A 1QLFA 4Y4FB 3UYOD 4ZD3L 4X99A 4Y4HD 4NPJA 1URLA 1HI6B 3GMRB 3DJZA 4UTCA 4M7KH 4X6DF 5EIIA 5AW2B 3CUPB 2F8XC 5EU6B 2ED8A 2NCMA 1A0QH 1QRND 2AJ3B 5LQBH 2AHIA 1A47A 3K72A 3IDGA 1SPDA 1AKJA 3ATBA 3VFUA 3BUBA 1FYTD 1VJSA 4MJ6A 3QDME 4MAYD 1UKSA 1J9RA 2XWBB 3CD4A 4X7EC 4KZDL 3THMH 4PW4A 1BOGB 4KY2A 3MUGA 4KHTL 3T6WA 1MREH 4B95C 5IG7A 4EZMA 2DBLL 4IRJD 2OW7A 3CIAA 2FBRA 1LVEA 3RGVB 5D7LD 4M61B 3T2OA 3ZMRA 3MX0A 2XV3A 2AK4D 1RUKL 5K33A 1HJCA 1ETZA 3P3RA 4GRMB 2Z92A 5DD3L 2VLKB 2QQKL 5I66A 1U4EA 1AGFA 4ODWA 4UT9H 2NY5H 5TGBB 3L7EB 2FLMA 5GISL 3BPOC 4OB5L 4LSVH 5C09E 5LVEA 3RWJA 1FVCA 5DJ0A 1CL7H 4BH7B 5ECJE 1UT1A 4IS6A 3ULVF 4HP5A 4Y88A 1T4KB 5HGAB 3O9WD 5A2CA 2ZSWB 4P8QA 1YG9A 3BUPA 3N55A 2WXOA 3FC8A 3FMGL 1KG0A 4OBSA 4KV5F 3PWVB 5EBMB 5L8KB 1ZPLA 1D7FA 3UP6A 1T1YB 1C7SA 3AFLA 4HS8H 4P46D 3SGJC 5BOPA 1LP9B 1JHKH 1WVZA 1FNSL 5FYJH 2YPKA 2WQVA 4NQVA 2XN9A 4LLMA 4PRDB 4A2HA 1TR7A 1KUMA 3L4VA 5BVJB 2H0PA 2WXFA 3MRRB 4UM9A 3BI9X 4E41D 1G7PA 4F58H 1WPCA 4JKLA 1A9EB 5IV2A 3MJGX 4EVNA 1VPOH 4XP9H 4JQIL 2WQSA 1MCNA 3TIDA 1PJWA 2NT1A 1K6QH 5CNHA 2G9HB 2X2HA 2CNZA 2ENYA 2COVD 3L5WB 5D1XD 2XICA 2XV0A 2YJLA 2A77L 4Z3HA 2ZSVA 4E5XG 3Q2VA 1B6UA 3ARZA 2XY1A 3NN8A 2DQEH 4V1DD 3FQUB 4IHOA 2COQA 4GO8A 5BJTB 3HMXH 1IGIH 1Q94B 2QSTA 3VFMA 4JZJC 3BRFA 1KV3A 1IGTB 2IPTH 2VLJE 2BY0A 2CNYA 2G60H 3GMNB 5IW6A 4UQ2A 4EF3A 1ITBB 4NPKA 4EPSA 3AS2A 4Y1AD 1VESA 5FEBA 4Q8BA 32C2A 5FO7A 1XCQA 4HHAB 4XNUH 3SODB 4X42A 4HCRA 1P7QB 2ILLA 4NP4H 4Z7QE 2YAOA 1R5WA 1FFOB 5EUOB 4F7MA 1YEHH 1QHQA 1YEJH 1FORL 3V6FB 3NSXA 1JWSA 4XC3H 2EDJA 4H7VA 1CD1A 1HCYA 3TX4A 3G6DH 1PYWB 3KWVA 4RGOL 1A1MA 4XODA 2P47B 3L3OB 3VXSA 2XACC 2WC7A 3IGAA 4PJ9A 5KAQF 4M56A 2H8PB 5FKAA 4Z3EA 4FQHA 1I9RH 3G6JB 4HWZA 2D2CC 2C9QA 3MRBB 3OKNB 1VA9A 4XPHH 1FWXA 2NUPA 3S4SA 4ZUUA 4G6KL 4FP8L 3II3A 3I74A 5JOFA 3IK2A 4JGMA 1Z6JT 4RSVA 2X88A 2DLFL 3QVAA 4K5LA 1JZ5A 4KHXL 1Q4NX 3GZKA 3X11B 5B39A 2NYZA 4ZFFA 4GXVL 5L88H 4BSWA 1AR1D 4E68A 5DC0A 3IF1A 1CQYA 3HRZC 3T1FA 4HU8A 3DTXA 3MA9H 4Z7WA 4JO1H 1MFNA 3ZOAA 2O6DA 3V0IA 4KPHL 4PJHE 2NY6B 4QHLA 3LOWA 5AVQB 1ZWIB 2WOBA 1TTAA 5CKAA 2GJ6A 3MNVA 5F7BA 5IB3B 4H88H 1E9PA 3QPXH 4UQDA 3MLUL 1EUTA 1PPIA 3FW6A 4DERA 3EJJX 3RWHA 1V54B 3BRDA 2RCSH 2ZUWA 2ICWI 5F2FA 2BSEA 3E2HC 1B0WA 5C6TH 3HI1A 4JFDE 1YO4A 1ACZA 2GUYA 4AKOA 3DUSA 2FT8A 3KBEA 1J9SA 2QPFA 3WFZA 1AZCA 5DQ9B 1T1WB 5GIRA 2B77A 5IQLA 2DM3A 1YPZE 2BS9A 3F7RA 1O75A 2CCLA 4MX7B 3NIFF 5JNYA 2Q8AH 1IX2A 3AADB 1T7WA 5IB5B 4XN1A 5JTWA 1B0GB 3LNEA 3LJ3A 2UY7B 1MF2L 5IVZA 3WLBB 5I1EH 4U6YB 4GKNA 4R7XA 2OAAA 4ZZFA 2F54A 3L2NA 4FHJA 5CEXA 4N2FA 1ZTXE 4EUPH 3BVXA 1JYVA 1UC6A 1QEWB 3TBCA 1G7IA 4Z0XB 1BGXH 5E0QA 3FDWA 5LCVA 3UZEA 5BQDA 1F4XL 5EC2A 3IXTA 3BW9A 2HWZL 2WHVA 4M7ZC 5F9JA 1E4XI 2R4RH 5C3IA 4NAMA 1AGBA 3IVKA 4Y19B 3AS0A 3SY6A 2A6DB 3GUTB 2WB7A 4WY7L 2CZNA 4XBGB 4M1DL 3KNBB 3P2DA 1BPLB 3AB0C 1BDYA 1DN0A 3QUZD 1K2DB 2LQRA 3QUKA 4OH2A 5TDNA 1M3JA 4OM0H 4HOWA 4X98A 2KDGA 3HIZA 1MH5B 2F8VA 3EOTH 1QLFB 3JWOL 4HV8A 4X99B 1PFCA 5HGHA 5EIIB 3VXTA 1MW3A 5TFSL 4NOFA 1OVZA 4PJGE 2QADD 4ANKA 4BFIA 3MLSH 3FRPG 3VA6A 4LL1A 1BIIA 3IDGB 3K72B 1AKJB 3VFUB 4EE2A 5JYMA 3CQQA 4MJ6B 2IANA 3N43B 2X3CA 5AKTA 1HS6A 2D2OA 2KPNA 5EWIL 2YIHA 2GSGA 3KD4A 2G30A 3MUGB 5CXPA 5KS9E 2F7QA 3SGKC 3ZY7A 2DRUA 5IG7B 1YYML 2X4PA 3OGCA 4MQXC 3D85A 2EILB 3A6CH 3QUXA 3TFBA 1K72A 3DETD 1HAWA 3LQZA 3KYKL 3T3PE 1RUQL 3QDGB 3HNSL 2Q76A 3FN0L 4J4PD 4EN3D 1TQVA 1KCUH 3NAAL 3MX0B 3L9RA 1L6XA 4RAVA 1ETZB 3VFGH 4A63A 2Z92B 3SQOL 3PL6D 5CWSA 1UCBH 4FNLL 5I66B 5IKCA 1AGFB 4ODWB 2HMID 4CW1A 1EFQA 4GW1A 1XR9A 2YWZA 4O2CB 2F74A 3ARFC 1UOWA 2BSBA 2CGRH 2X44D 1NAML 2W88A 4LCWB 1FVCB 3RWJB 5DJ0B 5IHZA 1JVLA 2DD8L 2VXSH 4FNUA 2C7FA 4IS6B 4PRHD 1W2KT 4MMXC 3SE9L 3GGWA 1TPXB 4N8PA 1YEEL 3SGJA 3KGTA 1SXNA 1BJ8A 3LPFA 4K3EH 5HDBF 4Y2OA 2EDNA 2P8PB 1KG0B 4NRXA 2H2SD 1MI5E 1KJ2A 1U4FA 3TH3T 4I77H 4X2UA 1BQUA 3ULVC 3BVUA 2C4FU 1N0XH 2AERT 4ORGA 4IMKA 4WI0A 1INDH 3QPKA 2XYCA 4NUMA 4QEGA 3CAFA 1HZHH 4LLMB 4L3CA 4MBOA 2VL5B 4AMXA 5FHAL 4YE4L 4LSDA 2OXGA 3SKJL 4UM9B 3BQUA 4ONHB 1KB5A 1YECL 2DL9A 5C0BE 3UBXA 4BUGA 4XP5L 5IV2B 4EVNB 1XGZA 3NCWA 3B5HA 5CJ8A 3DVIA 1G9NH 2X1WL 4GP4B 5E94A 1PSKL 1V7MH 5CLTA 5JZ7D 3TIDB 1I9JL 2QSQA 2ZOLA 4P23D 4FOMA 3ZUCA 4NFDA 2XZQH 4JFZH 4DP0X 3KPPB 1SF5A 3GHBL 4R0LC 3VI3A 1KCBA 2EO7A 3AS1A 4LCIL 2ZSVB 2FGWH 4QHPA 5FUZL 3BFQG 4NS0A 4LGRB 4MFHA 4XCCH 4PSRA 3FU6A 3ZZ1A 2RACA 1FBIL 3HHMA 4IHOB 3VMNA 4JFQA 1QZ1A 4X4YA 1QUNA 5HVGB 2B2XH 3CX5K 3GD1C 3SCMD 3VFMB 4F91B 5IUSA 4Z18A 2NY7H 4UQ2B 5IW6B 5LXGL 4LOUC 3QUYD 5FO7B 1XCQB 4OCRL 4BQBA 4GG6A 2E6JA 1A4KB 4Y16D 4J3OF 5HJ3B 3NJVA 3QG7L 1R5WB 4KQ4L 1WFJA 4NQDE 2VLRA 2B20A 2IXQA 1ZLVH 1NGXA 1OPGH 1TZAA 1JWSB 3IKKA 4WHYH 3ARXA 2JIXD 4IBVA 3KPSD 1TQCC 3HMWL 5AVXB 1A1MB 2DBJA 2CO4A 3BFOA 4S0HA 2EDBA 4AYFA 1MW1A 3IGAB 4G5ZL 4PJ9B 5FKAB 4FQHB 5ALBL 4HWZB 3FU0A 1D6VH 3NIDF 1HZKA 2IF7A 4KFZC 3ZLQC 3K2KA 3TT1L 3S4SB 1HH9A 3HRZA 4ZUUB 5GS3A 4WO4D 4C4UA 1I3GL 2VN5A 2DQFA 5MI0B 4CRPA 1FPTH 4R26L 3MV8A 1Q38A 3F12A 5B39B 4ZFFB 4BSWB 1SY6H 4ENEC 1GGBH 2D3VA 4P9HL 3GHEL 3T1FB 1W0YT 5IQNA 4Z7WB 3MMEA 3Q7JA 1NC4A 4WSJA 3DECA 4MTMA 5IVXF 1AQ8A 4IKIA 2E75C 1VLXA 2EXWD 4O9HH 4M03A 4P2RE 2QKIC 2ENJA 4QHLB 1FN4B 4NJ9L 1CFVH 2GJ6B 2V37A 4NJAH 3MNVB 2DWYA 3WDIA 1E9PB 1YMHA 5EA0L 2EDLA 3VRJA 2VB5A 4H8WC 1D9KA 1MZZA 1X9LA 2WXGA 4UTAH 4X7DC 4U1SA 4J3SA 4EOWL 2FHBA 4Y4FD 4HPOH 2WP3O 3DTDA 4HKJB 4MA8H 2BNQA 5GRJL 3I02B 5JQHC 4L2LA 1NOFA 3NSCA 2HPTA 4LF3A 3R06B 3ALXA 3HI1B 2EIKB 3BEVA 3FQNA 1WP6A 4JEGB 5EU6D 1OT1A 3GIZL 4C4KT 4P2QE 4IBTA 4BKLA 1XIWB 3A6OA 3VFOA 5F8RC 5H2BA 3H6AA 2E7HA 2FJUB 1AG6A 5GIRB 5DEZA 5DUBB 2FNBA 2BZ7A 2DQIH 3TN0C 1GYAA 1UOLA 4HMDA 2YA0A 3BESR 5AVYB 4AEHH 1N8ZA 4I0PA 1TTRA 4FNQA 3GZOA 3PV6A 4NLAA 4R96A 2JNZA 3RGVD 3T3ME 1KXQE 4GQ9H 3MV11 1AGCA 3MUHL 4GKNB 1BCIA 2F54B 2JCCE 5CEXB 1KXHA 3SJVE 2D7TH 1FDLL 1RK1A 2OK0L 1G7IB 5CR1A 3VXUA 2VLKD 4UU9A 3ML9A 1IBYA 4LQFL 5EC2B 3MV7E 3BW9B 2YRBA 5D7IA 2HSIA 5F9JB 4TQEL 4J6RH 1JRHI 3H53A 5DJZA 4S1DC 2GYSA 5T5FH 1AGBB 1TKWB 3IVKB 1MRDL 4R90L 3T4YB 2O6CA 3FQWA 1CFSA 4J2QA 2C9VA 1THCA 3DBXA 1DN0B 1YEKH 3QUKB 2WPGA 4UCFA 5TDNB 4BZ2L 1NEZA 1Z9OA 2CXGA 2P46B 4URKA 4QTIL 1DO6A 4X98B 3STLA 3H42L 2IADA 2F1BA 1IQWL 1BJ1H 4LPVA 4JGJA 4HV8B 4XO4A 4IRSC 1HHKB 2JE8A 3FFCE 5HGHB 1ADQL 2BVPB 2FX7H 1F41A 1T0PB 5EB9A 3VXTB 3IFNL 1JIBA 3P3UA 4AYEC 5C0AA 4J3VA 4Z7NE 2D03H 2ARJB 2ZP0T 1OGTA 4U6VL 4BFIB 4NPYA 5ICXB 1WCQA 4GOSA 2O5YL 2ESVA 4HLJA 4TNGA 2ED7A 5FYKU 4JY5L 4OZHF 4YHOH 4ONFL 2IANB 1KC5L 4HHGA 1PLBA 4KI5E 1IUZA 3BP4A 4V2BA 5CZVH 3CX5J 1O7SA 3EO1A 2GSGB 5I0VA 3MOAH 1S3RA 4N2EA 2ZOWA 3K1DA 4UNTA 4BGLA 1N59A 2X4PB 2Q3ZA 5C9JB 1E5ZA 3OGCB 3D85B 4F27A 2WWKT 3QUXB 1A3RH 5KVDL 2G75B 4P48A 3RURA 1GTFA 5KBLA 4ONOA 4D8PA 2HFEA 4JVPA 4LK4A 2OZNA 2Q76B 2XY2A 3ARFA 4HBCL 4JDEA 4ZSOA 3L9RB 2KC0A 1OPOA 4RAVB 4JG0H 1BG1A 2L0DA 5DZJA 2JWYA 3JUYA 3O3BA 3O0RH 4RFEB 5CGMA 4YWGL 1S9XB 3QC6X 4JREC 5IKCB 1PY4A 1WT5A 2Y24A 4CW1B 1N5YH 1XR9B 5BS0A 5TQ2H 5E6RB 4AG4L 4HUUA 3RWGA 4F24A 5KN5A 1P7QD 4OM1L 3HG4A 3V9FA 3WKYA 1QFWM 2PYEA 4OIAA 2CO6A 1P2CA 4XB8A 3VG9B 2V0AA 3GGWB 5IB4B 1CR9L 3M07A 2AEWA 3IDUA 2DYSB 3A0OA 5CEZD 4FEMA 4JRYE 3MOBL 4GAFB 4XWGL 1FA4A 1ZT7B 4Y2OB 2D4DA 4NRXB 3JVFC 5IP4A 2XN0A 3O6FA 1KJ2B 3OZ9L 4KK9C 4WI3A 5MERB 3UEQA 2HKFL 3VGBA 2G3NA 5F1SA 1OP9A 2KL6A 1IM9A 2BIPA 4PY7A 3GSVB 3RNQA 4ZMAT 4ORGB 4QRPA 4WI0B 1EZLA 4M6AA 5C0CE 2YUVA 1R34A 4YUEH 3WHE1 1E5YA 1YAZA 3MRPA 1IAII 4L3CB 3T0DA 2VDOH 4N2DA 2OXGB 4UIKH 2PYFA 4R0LA 2WTPA 3BQUB 3ALWA 1KB5B 2XZCH 3T2QA 3UBXB 5DHVH 4OFKA 5JXAH 4FNPA 3RP1A 3E8UL 3I9GL 5I8KL 2I85A 2EXTA 1A6UL 2A4CA 2ZOLB 1MCSA 1BOYA 4XCNA 3ZE2B 1GPOL 3MN8A 5I1IL 3G5WA 5GSRA 3CWGA 2NY6D 2FSDA 2NSMA 4HMEA 1DVQA 4HGKC 4N2OA 1FNHA 3VI3B 3ZTNL 4K8RL 2FBOJ 2WXMA 2FEEL 1F3RB 5JPMC 5DVKA 1F4HA 1QABA 4H1LB 1QD0A 4NQQA 4P9ML 4ZUSA 3FS9A 2PUQT 2ZG1A 3D12B 3CXDL 3D34A 4FQ2L 4GI6A 4R97C 2CRZA 4JFQB 4X4YB 1QUNB 4FEIA 2ZG3A 3TFKC 1E42A 4QIRA 4BEIA 1GHFH 3TA3C 1I8KA 3OKDA 3FT9A 4PS4L 1NCCL 1FNAA 1KEMH 3QDJA 1UEMA 1BQLL 1ZHBA 2VWEE 5H4YA 3FQRA 3DK0A 2IFFH 3GSRB 1IEHA 2VLRB 4I0CC 2IXQB 3HZMA 2YD8A 1QBMH 1NGXB 5CJOH 4L05A 5AVTB 3FRUA 2R56L 4HEMA 3MBWA 1P6FA 4RISH 2A9NL 2V6HA 4LGPB 3ARQA 1SDAB 1F56A 5AKRA 3B2XA 1E6OH 4ZS7H 4AYFB 3BIBX 4J3OC 5D7KE 1HHIA 3FH7A 5F1IB 4UNIA 2E4TA 1G0YR 4ZX6A 1NIDA 4R5VA 3OX8B 3KS0J 1ZDSA 1TQSA 1YUKB 3HRZB 2V2XA 5IROC 5JW4M 4KKQA 5C6PB 2DQFB 1ES0B 3PIQB 4D9QE 3MV8B 4Q2ZA 3NESA 1JWMA 2BVEA 3F12B 1M9WA 3KH4A 1KIRA 2QKIA 2VJ0A 1G9EA 3FPXA 4PP2A 1H15A 1NBCA 5IHBA 1N64L 5FUOH 3BKCH 2F19H 3FHQA 4MXVE 3MMEB 1NC4B 3HS8A 4X7SL 2VXQA 3Q5OA 1QFOA 2ZWLT 1G7LA 3JWDC 4TN9A 1DQTA 5F7MC 4ZT1A 3Q2CA 2J8UF 4Y19D 4Z8FL 1PW3A 1MFAH 1YQ2A 4JRWA 1T20A 1VFOA 2Z91A 3E2HB 3BP6A 3B34A 4F1ZA 1YMHB 3VRJB 2F61A 1WWWX 1T0MA 1D9KB 2Y36H 4U1SB 3KL0A 2IO5A 4WK0B 2O6EA 4MSWA 3WI9A 2J6EA 2BNQB 7CGTA 4ZMPA 2HX8A 1DQJA 1B3JA 2FO4A 1KIPA 4LF3B 4DVRL 1U8PA 3BEVB 3FQNB 1LO2H 1QLRA 3OJDA 2A6JA 3ISRA 1RFDL 4FQJL 2HKAA 4P5TC 3U7YH 3RZWA 4BKLB 3VFOB 4DGWC 2EYRA 4FI8A 5H2BB 1AKJD 2QHRH 4O5LL 3RWEA 3ZZSA 4CUCA 4YDIL 1XF2A 5DJDA 3K3QA 3ZMEA 3VRIB 1G7MA 4KAQL 1MDTA 1EPFA 2DTML 3LKSA 3OAUH 1PLGH 2CRMA 3MACH 3H3PL 4JE4B 3ULUD 4DF9A 4JPVL 4HWBA 3BSHA 3GUFA 1O9ZA 1N8ZB 2YGOA 4I0PB 5LXVA 2NDGA 5KYWA 1AC6A 4NGHL 4XZ4A 5KJ7E 3PV6B 1RZFH 1R3HA 2BNUA 2WAHA 4PJXB 4R96B 1KELH 2YLKA 4HFUL 2XG5A 5F3HA 2TRHA 1EDHA 5IGXH 2CPUA 3JWNG 1AGCB 3ROOA 3QDGD 1OSPL 3FUMA 1FGVL 1NUGA 5B8CA 1QAWA 1F4YL 4RWYH 4XOAA 2JLLA 3QORC 1RK1B 4GUOA 2EDDA 2FYYA 1SEQH 1HN1A 2MPAL 2RFXA 3EYSL 3VXUB 4K23L 4UU9B 3KW7A 1LHZA 4JFUA 2JTYA 2WTRA 4OD2A 5L7XL 5J9PB 1PS3A 3BDYH 4I8DA 3DX4A 3LN4B 5SX4I 4J3BA 2ZOKA 2WIMA 2WKOF 3AS3A 4LCWD 1WZ1L 3VG0L 2J7LA 2XDHA 2BFVH 1UG9A 2A74C 3FQWB 4KUZH 1KGXA 3DBXB 1UB6A 3ASNB 4LKCA 3AUWB 3DUUA 3WOVA 4L23A 3PP4H 4UMSA 3WKML 4UOW1 3FU9A 1UASA 2AK1L 4P4RA 2IADB 4NX0A 3W0WB 4JPSA 1RERA 4UINH 1JPSH 2JJVA 2JELH 4ZO9A 4G7VL 4JG9A 1I1CA 5F93C 1LDPH 5JDSA 3R8BB 4HYTB 5IOPA 3ZU8A 5C0AB 5EBLA 2YAEA 2Z8SA 3CDCA 4NPYB 3TV3L 1MG3C 2ESVB 1QQDA 3ATAA 5E6UB 3ZDZE 1QTPA 4UM9D 1R5VB 4A6YH 1UURA 2IIJA 4LRNH 3QFGA 3BP4B 3GQFA 5AD0A 1CXEA 1DVTA 1GZPA 2P48B 4R7DB 1JNNL 3CFJA 1N59B 3VE0A 2OZ4L 5AYUL 2DAVA 3ZE0E 1FE8L 3RVWD 4HJ0D 4NZRH 1CF8H 4M7JH 4ZFGH 2BVOA 3S9DB 2ATAA 4HC1H 2CBQA 4D8PB 1G6VK 2HFEB 5B3SB 2G5RA 3DOSA 4ZSOB 3ARFB 4JDEB 1D7DA 2BSTB 3FT1A 3IE4A 2YAPA 4YLQT 4M93C 2AV7A 3ARWA 3BLPX 3P40A 3G5XA 3QZWG 2NLJA 2CXKA 1NINA 4OFYA 3QFJE 1YNLL 4HZLA 2G9KA 3NDYE 1N10A 5BS0B 4HUUB 2QGCA 4OF5A 3RWGB 3BIKA 1HIML 1H0DA 1U8LB 5E99L 2PYEB 3BQVA 2GJRA 2CO6B 1P2CB 2P5WA 4JQIA 2XZAH 2HFTA 4FNRA 4C54A 5A2IH 1L4IA 3LNHA 1VEPA 2YD4A 3R1GL 25C8H 4EN2A 4OLYH 3O6FB 4PR5A 3CN1A 4PJ9D 2QMJA 4HX1A 4CAGA 4OLXL 1L0XA 3FSZA 4FULA 4PY7B 1IM9B 3RNQB 4DAGH 3AGVA 4E9QA 4QRPB 2PTVA 1EVUA 1SXCA 3I9IA 4X4KA 1GOHA 4EO5A 4YHMH 1BAWA 5DU7A 4FFYL 2B4CC 4FF9A 1ASPA 2PYFB 4R0LB 4TVPL 1SXAA 3NOIA 1OHZA 4TNVF 5L4JA 1II4E 1PKQE 3T0EC 3QIWC 5DJXA 1VZIA 1H3UA 1J0JA 1RJCA 4XCNB 1CLCA 5FKPA 3WNIA 3RWIB 2XFXA 1EAOA 3UX9B 4F20A 4ZMLA 2DS4A 2D7MA 5CD5D 2R69L 3TA3A 2GJ6D 5KVFE 2NZ9D 2Z6FA 4ERSH 1K85A 4ZUSB 1KBBA 4N6QA 1ZHKA 2VM3A 5G55A 5FR3A 5A6LA 1XD1A 2HVBA 4PBXA 2ADJA 3W11D 1PX3A 1FV1A 2H9GA 4EBQH 5HVHC 2XTJE 4ABQA 4ZW5A 5E6SB 1I8KB 3OKDB 5C71A 3W2DL 4Y89A 4OU3A 1TG8A 3QDJB 1ZHBB 2X12A 1JK9B 2D7OA 1OSZA 1TQCB 4U1HA 2HJLA 3FQRB 1XIWD 4XE0A 3ZDWA 4JHVA 4PJFE 3MYZA 1QLEB 5FX3A 3K6IA 4YBQD 3HZMB 3B7UX 3FO9A 3LD8B 2FX9H 3IMTA 1ZS8A 3HKFA 1P4IL 3S35X 4DZ8B 1H9DA 4Q6IC 4U1GB 5IROA 1JGUH 2EDRA 4HA1A 3QC5X 3MBWB 3R4DA 4AL8L 4PRPA 5JQ6L 1HHIB 4NENA 4V33A 1PBYA 4U6TA 1SN0A 3QZLA 3R7RA 3QEQE 3QRFM 3VDCA 2V2XB 3HC4H 4LVNB 2O72A 4O02L 1PG7L 2F54D 5DT1L 2CBTA 5LNEA 3K6OA 2YC1A 4KX8A 2O5ZH 4Q2ZB 5EORH 1XGPA 2B1OA 2QKIB 3AQXA 1WZAA 4XN4A 4WTZG 2IQ9H 3T8VA 3GSQA 4PP2B 1AO7A 1H15B 1ZLEA 2RBLA 3CXFA 1S7SA 4HWEH 3WAJA 3ZE1F 1R4XA 1KDJA 3KLQA 3QAZB 1ONQA 4HIXL 1Q0YL 4HDIA 4RMSA 1XZWA 3D06A 5DRNA 2V5MA 4FZ8H 1T20B 3B37A 5L8LB 2Z91B 3BP6B 1T1XA 3MRHB 4LVOC 4GP5B 4N1HB 3LS5H 1T0MB 1GXEA 4MZ3A 4FL4B 3TBYA 4P5TA 3ECWA 1KXTB 4MSWB 1HX0A 5HHVH 5AWNH 3BWUF 5IVOA 3QQ9D 2C26A 2FO4B 3Q01A 5SWQA 1AVAA 1KIPB 3MA7B 1U8PB 2ZKXA 3GLDA 1SJEA 4H20L 2A1WH 1QLRB 3OJDB 4HPYL 4MB5A 2A6JB 4ELME 3A23A 6FABH 5C7ZA 4ZUVB 2B7DT 4ZX5A 3WSQL 2XJKA 2ADFL 4XNZC 2EYRB 3RWEB 2APSA 5DJDB 5F6HJ 3CU7A 1Y1DA 2IAND 1C08A 1G7MB 3D6GA 3ELQA 1MELA 2DWDA 1AYRA 4LESA 4UQAA 4WWKC 3T6ZA 3VXRE 1A6PA 4CC4A 5KJRL 1KFAL 3LS4H 3MLZL 4KZEL 3BX7C 4KGLA 4E0RA 1LNUA 4XVUD 5I30H 1KTLA 4EMZA 1WLHA 3SOBH 5EO0A 3D85D 1R3HB 3QUXD 5MP6H 3RVTD 2E47A 4PJGF 3NIGB 1W0WA 2XG5B 5F3HB 3NZHL 3NCJL 3IPFA 3MCG1 2AABL 3B9KB 3ROOB 3GJFK 3MZTA 1XH3A 1S9YB 4M1CD 5B8CB 2EDEA 2FHFA 1KGYE 3CFBA 4C58B 5HYSG 5CP7A 2KS0A 2XLLA 3S34L 2WTRB 4OD2B 5IBLC 3TLRA 4PJCE 3H9SA 4Q97A 3FF7A 1QI3A 3WGVB 5DD6A 3ARGC 1F4WL 1XQ4A 1J1OH 4N5ED 4BFRA 2ZOKB 4YXKL 5BOJA 5CEZH 5I1JH 1C5BL 3N1GC 3LIZA 5BW7C 2E27L 5E8DL 2ZKYA 3MV01 4LKCB 3AREA 3DUUB 1ID2A 3TWCL 2DF3A 3CVHL 4MZ2A 1XTLA 4P4RB 2YKLH 2VUYA 3GSNA 5EOCJ 2G3MA 2FB4H 2JQMA 4Y1SA 5JDSB 4H0IA 2OTPA 3P11L 1EGJL 5IOPB 4EN3C 5IR1B 1UA6L 3GXMA 1AZZC 4C4KO 3DJ9A 1TQTA 5D7HA 1IBGL 3BQUD 5TF1H 1SM3L 3VXQA 1OV8A 1R47A 4LP8A 2AMUA 1Q9OA 4OZHA 1WIOA 2JV6A 1IE4A 1GZPB 3WENA 5D7JA 1NAMA 2ZZUT 1PD6A 3BZDA 2Z1KA 1TYEB 3CFJB 4ZMOA 5KOMC 4POZC 3VE0B 4YAQA 3WNJA 4M7LH 5F6HI 2QVKA 4P5KA 2F53A 4JREB 2R0ZL 2BVOB 3MVSA 4A7QA 1GC1H 1AZUA 4AEFA 4O4YH 1IC1A 1BAFH 3D50A 3QW9A 4ENZA 1F8TH 1QKZL 3RY4A 3IPEA 3D30A 2F1EA 4M5TA 2C5DC 2WSPA 2OJEA 3B7RL 4WFHD 2AV7B 4WFEE 2HRPL 3G5XB 4NKOA 2YD6A 2NLJB 4UUJA 3F01A 5LGHL 1BEXA 4UM8B 5LAXA 4HZLB 4CKVX 5J13B 4U1MA 2XTLA 2EIZA 2VDML 2N01B 3S3BB 2CH8A 4OV6F 1SLUA 3BIKB 5EG6C 3CMOH 3TWYA 5H35A 1H0DB 1MAJA 2XPGA 2P5WB 2VLRD 1D6EA 3F65A 5J12B 3WU1A 4NC1E 1P4BH 3MJWA 3NJLA 3EJCA 3EYOB 4DP9X 3MRIA 2QQLL 1KYDA 5I1HL 2FECI 1OAXL 3I50H 1KLFA 2WW8A 5EN3A 1PZ2A 4O00A 4ACPA 4FXGA 2Y1VA 3T71A 1D7BA 1EBPA 4OCWH 1BEYH 4XCFL 2HLFD 1WFIA 1CUOA 3U9UA 4ZX3A 1VFBB 1S2EA 2EO1A 1E5UI 1SQMA 2V9UA 5E7FA 3O0LA 3IS1X 2EIBA 1MKFA 5C07A 2Q20A 3MV8D 1RZIA 4OFDA 4P2OC 3U48A 1WO2A 3A47A 3ZRFC 4V2CB 5BV7C 1I8UA 2HXAA 2MJWA 3U79A 5DJXB 1F00I 3VXMA 3HMXL 1NC4D 2R2BB 4QNPF 3I75A 5FKPB 4P5RA 2XFXB 3HG3A 3LKPA 2WO3B 1YZZA 2XN1A 3O8XA 4BH8A 4B97A 1WFOA 1GZHA 2PCFA 2WWKO 3TA3B 5GJSL 4BK5A 2WXQA 2XN2A 3TT3L 1DBML 4BZ1A 1ZE3H 1WICA 3ARSA 3HG1E 3J27A 1CDCA 4NP4L 5I19L 1ZHKB 4IBLT 4XAWL 4K2UL 3U9PH 1D9KD 4F15C 3VXPB 1ZLDA 1ZSDA 4XMPL 1PNCA 2ADJB 5CKGA 1FV1B 1P69B 1YEHL 2H9GB 5D70H 3TBSA 3GJFH 4XVJL 2BNQD 2LHAA 3LMJH 3MUUA 2IDTA 3MC0A 4R4BA 4FQQB 3RUGE 5EEWA 3AGWA 5GRUH 1TF4A 3V0JA 5E00A 1LO0H 5EEUA 1S8DA 3TPUA 1OSZB 3L4UA 3LZFL 1T2QL 2HJLB 5E8PA 4B9CA 3TNNA 3HNTL 3EH1A 3KBHE 1R3KA 4GT7A 4F5CA 3ULUH 5J1SC 3FO9B 1KJ3H 4GSRA 2NYYD 1ZS8B 4L8BA 2X1OA 1N7ML 3ECVA 4DEWA 2QTEA 2P7TA 1M42A 1JHLL 4QOKA 3SGEI 5EV7A 4ODHL 2AITA 1TJHH 4I0PD 4PRPB 5KVMC 4NENB 2MQCA 5C2BH 1BBDH 2EICA 3NCEB 1R19A 4OZFG 1A4JA 4XBEL 5FDYA 3OQ3B 3CSYA 3OHXC 5ANME 1X7QA 2YC1B 4J12A 5GRXG 5E4IA 4W9LC 4J2XA 1V05A 1XGPB 3VXUD 2B3RA 1AG0A 2VO8A 3GSQB 1AO7B 3OLIA 4NP9A 1S7SB 3U7WL 1B2WH 5EZOH 1A7RH 4LSPL 3MRMA 5GS0L 1S9VA 1U3YA 2ZOTA 3ZZQA 1DHKA 1ONQB 2FJHA 3L1FA 3T3MF 1S7XA 3QO1A 3SYOA 3N06B 2JCCF 5A3ID 1FSKB 1KPRA 3I84A 5DRNB 4QYOA 3HBZA 3MNWA 1UKTA 1PU0A 3II2A 5FGRA 5F1KC 4CMHB 3HFMH 5E2WH 1J5CA 1X5XA 4EXPX 3TBYB 4P5TB 2JSFA 3W0WD 1HOCA 1KZYA 2VRKA 5HD8D 5CU9A 5C8JA 1GZQA 1U8QA 5SWQB 3FO0H 1YC7A 1SJEB 2HA1A 2HRLA 3MTRA 1KT2B 1KB9K 2DYPB 5C0AD 1EEQA 5DWUH 4QMEA 3LH2H 2ESVD 4XP1H 2BXYA 1OSEA 3CNKA 2UVEA 3BWUC 1INEH 1C08B 4P59H 3LEYL 1HWWA 1RUML 2DWDB 4XMVA 3RVXC 5E08H 1RHHB 4E0RB 3MCLL 5BRZE 1BFTA 5CN3A 1F6AA 1KTLB 3NMEA 2RQEA 3AUVA 4IKNA 4Y9BA 2QFPA 4K94L 3MXVL 5EO0B 3QCTH 2QLVB 4Z95H 1HT6A 2CKNA 2KDYA 4BZ2A 1OTUC 4DP8X 1L6PA 1W0WB 4ZOEA 1DSFL 1DQMH 4PJ6A 2IMNA 1XH3B 3ARFD 2OKMA 4FNSA 4HMCA 4KI5F 5CP7B 4AYMC 1QTYT 2PTTA 1ADQA 5HYFA 4NCDA 4OLVL 4G9FE 5BW7A 1M7UA 1RUAH 2XKNA 1DJIA 4JFHD 1YSOA 3H9SB 1TNMA 4HCRH 3IU4L 4C56E 5BS0D 1LDSA 1GIGL 4ECNA 2BS8A 2PYED 4Q9QL 4WEBL 1XAUA 1QWNA 4HWNA 3DX0A 2WNWA 4I4WB 3HN3A 1NQBA 2HJKA 3BKYH 4GS7B 3AREB 4AJ0A 3B2VL 4XXCC 4AW4A 2IWEA 3HZVA 1LM8V 1IAOA 2E9GA 3LZPA 4RFNB 3O3AA 3TP4A 4PGEA 2J1WA 2AP2A 3QCVH 1IEBA 3O6FD 3M88A 3V0WH 1CGXA 4TSCH 3LEVH 1NCWH 2R29A 3GSNB 4QTFA 1IM9D 1AZRA 1YCSA 4IM8A 4QRPD 2PP9A 3HZYA 1OCOB 2Z0UA 5C09A 4J5VA 3P9LA 4LSTL 2WLYA 1IFGA 2DM7A 1H8LA 1KTKE 5ADOH 1B9KA 1EH9A 1N8OE 2Z7ZA 3VXQB 2Y4SA 1Q9OB 3DX6A 3VQMA 5KSBE 1WAAE 5C0GA 5CFAA 5D7JB 1DBBH 1NAMB 1NMCB 4WZ9A 5AAMC 3FXIC 1EHKB 4QLRA 5C0NC 1HL4A 4YAQB 3DA0A 2OXHA 4RMQA 5B1JC 4P5KB 2F53B 2ZKHL 4G3YL 2O4EA 3BHBA 4D0DB 2HKHL 4Q14A 3IJSB 3KXFE 4IGBB 4NQSA 4I1PA 4KMLB 2WWMC 1NEUA 3VSVA 4F33A 3UROR 1QZNA 4UAOC 1G7HA 1ZJAA 2Z8VC 4O58L 1Z9MA 2OJEB 3F83A 4WGKA 4NKOB 4UUJB 1KPUA 4A2FA 5JW3H 5LAXB 1CD8A 3ZXAC 1B4RA 3S2CA 4U1MB 3QDJD 2EIZB 4O2FA 2X40A 3HHSA 2MQ3A 5FYKD 4YHZL 4PGDA 2KH2B 1D5BA 5H35B 1NL0L 1NBZA 5DFVD 2XPGB 3UP1A 1D6EB 3RYMA 1GSMA 1EJOH 4U0RB 5TD4A 4PJ8A 3W39A 4Z76A 3MRIB 4CMMA 2ZCKL 3KVPA 3L3DB 2IG2H 2Q3XA 5DF0A 1I1AC 3OR6B 2DJMA 4P2OA 3NCFB 4XVSL 3D69A 4FXGB 4LEXL 1DDHA 3P3YA 5T3XE 3LKQA 3O6KH 4ENED 1CDYA 5DUJA 3U9UB 3DRTB 3RAJH 2KLTA 5C07B 5LCVH 1AACA 1RZIB 4OBRA 4GQPH 1JZ7A 1ZPUA 1U8IA 1DLFH 3NJGA 2PWGA 4GAGH 3MRGA 2FE0A 4ODUB 3EFDH 4NXSA 1MWAA 4KJQC 3SPGA 4JO3H 1BWWA 3VXMB 4G7RB 3MNDA 1BQSA 3CN3A 1T83C 5FAAA 1S7TA 2Y2YA 3CPUA 1EXUB 1MLBA 3I75B 3TBBA 5DD0L 4ZMNA 3WN6A 5JHLL 2FATH 2OX5B 3O8XB 5BZZA 4BH8B 1KB9J 2PCFB 3MAWA 1JG9A 1FLRH 3FKUS 2ZJSL 5D2LB 4K7PL 3T4AC 1VFMA 4P0DA 2NOYA 4MD5A 2H3XC 1EZSA 4FQIH 4N2HA 5DA0B 4S11A 1ZSDB 3NG5A 3ALPA 2YGVA 3TBSB 2Q8BL 4GUPA 4MXVF 4CKQA 2EUZA 3CLEH 1U91A 2FVNA 3ZKQD 4R4BB 3NJFA 2VOTA 5FW7A 3IGLA 1KTBA 2D3JA 5KJ4A 5E00B 1MCDA 3ATDA 1S8DB 3TPUB 2MWCA 4PJHA 3FB6A 3TNNB 3NTCH 1UWGH 2XXFA 1LK2A 1R3KB 4RGMC 1JYWA 5F9OL 5I6MA 4XNAA 1ZANH 3Q0HA 1QPPA 4L8BB 5B22A 1X5FA 2CM5A 1RIHH 4ALAL 2VQUA 4QOKB 2YQBA 1LLAA 4WTQA 3OHXA 3VD7A 3RWCA 1DBKL 4PGBA 4AT6A 4JFDA 4RMRA 2C1PA 3GMMA 4HIJA 2I5YL 4OF8A 3V7MA 3QI9A 2ZXCA 4YDKH 2R0WL 2CQVA 1XGYL 3B9KD 1A4JB 3NACH 3N41F 4FXKC 2QV4A 1RZGA 5KSVA 2FTAA 1X7QB 3IDXH 1BSIA 4W6WB 2WSKA 3ZL1A 1RJZB 1A7OL 1YPZA 1HQRA 2OYMA 1QOKA 4EDWH 1YMMA 1WUNT 1L9NA 5CJBA 4H8QA 4X80H 2X0UA 2NYKA 1MDAA 3PQYE 1S9VB 2HAZA 1XT5A 3MJ8A 4K15A 1L9MA 2P8LB 3TTYA 2FJHB 3MLTA 2UWEE 3N5AA 2J3SA 1P5VA 1ROCA 1S7XB 2XQYG 3QO1B 4PRIA 4YPJA 4G80A 1JERA 5LGYA 3CSTA 3WN5C 1KPRB 1U8NA 4QYOB 1RJYA 1MHPL 1KJ2H 2P80A 5I6NA 4N0UA 4B50A 1KDIA 4OFPA 2X4RA 4IMLB 4QXVA 4GYBA 4KY1L 4F8PA 1WD9A 1HOCB 3SBPA 4Q74A 4BZYA 2QZQA 1CXIA 5E7BA 1RIUL 4IU3A 5C8JB 1GZQB 1U8QB 3BT2H 2YS4A 2VSMB 2ZUTA 2AQ1A 1YQVH 2FX8L 3DX1A 3SGDH 4KK6C 3VXNA 1NBVH 1ZVNA 2J4WL 2VZVA 4FMKA 4MQ7A 1KB5H 2X1QA 5AVWB 2ODIA 3S35H 1JZ6A 1WISA 5TPWL 2W9EH 3IAGC 4GQ9L 1T0NA 1KJMA 1A14H 1WIUA 1I8LC 2WZ0A 5ID0B 1D5MA 3SE3A 1FVDA 4TNWK 1TNNA 5DMIH 5L9DL 1F6AB 4XVTH 2QVFB 1T2JA 1EAQA 1DZBA 4YSOA 4H1LH 3C8KB 2Y6SC 4OCXL 4ODTH 4HOXA 1BZDA 3ZDZF 5J3HC 2F6AA 4N4YB 5JOPD 2DMCA 4FE9A 3QHZH 4E9LA 1X5GA 2PTTB 4P57A 2Q7NA 3BWZA 2QGEA 1MUJA 1HTYA 4OFYD 4H5SA 4DGIL 5GGVY 1RK0A 1IT9H 3MODH 5ANHA 1BFVH 5DEFA 4OFIA 1XCXA 3ZE0F 1CFTA 3GIVA 1XF5A 1YYCA 4YQXH 2N7BA 1XGQA 4KI5C 2E3VA 1QYGL 2P5WD 2HG5A 3ULSA 1K5WA 2WMPB 4Z3GA 3RTLA 4WCYH 4UZUA 4F7KA 4U3HA 1QA9A 1L7TL 2YBGA 2D03L 1XCWA 2UV3A 4ANXA 3BSZL 3GO1H 3HZVB 2W8CA 1IAOB 1Q9WA 4FG6C 4I9WD 3O3AB 4M1GL 3MREB 4ODXA 4PGEB 3SE8H 3L4XA 1IEBB 1RQ5A 1UH2A 2OZ4A 2WZPA 3VI4A 1ET8A 1QFWH 1PZUB 3SDYH 2EEAA 1CLOL 4NN6C 1DVYA 3NZSA 3KYNA 1G6RL 4MNGA 2ZIDA 3GMLA 4YJZL 3P9LB 1HEJC 3K4ZA 1TTUA 4OLZH 3IXAA 4A66A 3T6XA 3DPBA 1I1FA 3RPBA 2DQTL 2ERJC 3DX6B 4N3TA 1E90A 2GSIA 1PCSA 4XOEA 1MI5A 5CSZA 1Q9KA 1LO5A 1N67A 5C0GB 3D9AH 4CJ0A 2X70B 4OUUA 4PWJA 2DYRB 4PUBL 3LVTA 4GAJL 4JG0L 4WI9A 1V27A 2AXGA 3P4LA 3TFKD 5L6YH 2OXHB 2E5EA 5CGYC 2NY1C 3TA3D 2EINB 4NKDA 3MFFA 4LSRH 1BG9A 5LGJA 4NQSB 2FSEA 2APWA 1MRFL 3F58H 3AWEA 1L5GA 4F33B 5CFHA 4XWOD 2ORBH 3K6FA 5ALCH 2ZOUA 1G7HB 3KE0A 3L4YA 2XSKA 3ML8A 2QQNL 4ODSL 2DL2A 2AJYL 4DTGL 2ZYHA 2X41A 4PB9L 1KPUB 4V1DA 2I60H 4MJ4A 1OE2A 1OARH 1E27A 4O2FB 3WIHL 4HXAL 3X2QB 3HHSB 1FJ1A 1ICTA 1YYLH 3P4NA 2GBUA 4PGDB 1D5BB 4EIUA 1Z3RA 2UZIL 2F7PA 2E7MA 1I1AA 1NBZB 1XEDA 3LKNA 3JZYA 3T0XA 1OP4A 4L0ZA 5LKNA 3WEXA 1A6TA 1KN4L 4GSXA 1UACH 2A9MH 1VCAA 3CBKB 4PJ8B 5I18L 1D2OA 3W39B 3ES6A 4Z76B 1YEIH 5IROD 2GK2A 4CMMB 4K5PA 3I6GA 1UJTA 2P9RA 4PRPD 4P2OB 5JIKA 4QGYA 3D69B 1DDHB 1RUPL 3GS7A 2F18A 3LKQB 3OKOA 2DQUL 4Z7QB 2DI9A 4PJFF 1N4XH 1AQMA 4KKRA 2OQJA 5HI5C 4L5FL 2ED6A 1U8IB 3B2UD 1A4BA 4RDBA 2VWEC 5HHOB 5IEKA 3MRGB 5I23A 1AO7D 1NGYA 4NBXB 1XDTT 2FQGA 2WGNB 3TJEH 1AXSA 3W57A 4O51A 2H32B 4QRQA 1UFUA 3T4AA 4ABWA 5BO1H 1S7TB 2QT6A 1E4HA 3D4YA 4JFEE 3EBGA 4G8AC 2LV4A 2VZOA 3ZL4L 5DK0A 3B9DA 3UGEA 1BF8A 3P9MA 2UZPA 5DO8A 4YXLL 1AP2A 2XV2A 5I6KA 1DCEA 4MD5B 3Q3GB 4OIIL 4UB0H 4LBAA 3VFRA 4TXVB 3NSFA 4WFGE 4GUPB 4N2IA 1U91B 4DKFH 1XGUA 4F7TA 4O02A 4HD9A 4K71C 2WOYA 4P2RA 2DYPD 4PJHB 5TK2A 2VM9A 3FB6B 2Z9TA 1NLBH 5E23A 4XOCA 3TVMC 4GSUA 1LK2B 4GBXC 4XMKH 1OE3A 2A7BA 3WNPA 5EF2A 2W60A 1IJ9A 4D9RD 3SD5A 2QPDB 5EEXA 3UL4A 1MVFA 2R1XA 1B9ZA 3UCRA 4FXKA 2YGNA 4TNFA 1OOWA 2J88H 3ZDYF 4MNQE 4ZOAA 4RBPK 3RWCB 4PGBB 4F2MA 3VGFA 4FQ1H 4JFDB 1JZHA 1SVBA 2C1PB 4HIJB 5FUOL 1V3LA 3B9EA 3QI9B 5L8JB 1M2VA 4E9YA 4R6UA 5FO2A 4KTGA 4P2QA 4MS8C 3PWUA 2VDNL 2X2IA 1XB8A 2AJXH 3LHPL 1RZGB 4KRPC 3U1SH 1E8WA 1MFEH 4KK8D 4FYSA 5KSVB 2VAJA 4X9GA 2CPCA 4MXQC 4ZBJA 3CFCH 4GRWE 4H4NA 4YH6A 1YPZB 3MRKA 4MVBC 5SX5K 2PR4L 5DZPA 1YMMB 3H9SD 2FJFA 3SDAC 2RMNA 1IFRA 5C1MB 5CZXC 3F7YA 3GBML 4KZCA 2JK5A 4RRPG 3MJ8B 2JJTC 3RIFF 4YC2C 3E7JA 3MLTB 5A7BA 4PRIB 1KXQA 3CK0H 4RZKA 3DX2A 4G80B 4LEEA 1O0VA 4KWUA 2JCCA 3GRWH 5HI4D 4WVRA 1RJYB 4KK5D 3SJVA 3ARED 1AY1L 5FIEA 4N0UB 3RPKA 1GYWA 4UQ9A 4Z3IA 3KW8A 4A37A 5JXEC 5EEVA 4PJCF 4HJUA 3MV7A 3ELAT 2Y06L 3FZUC 5FYJE 5GGQL 4IU3B 1E5CA 4JO4L 2ZXGA 1E6JL 2L8AA 4XMXA 4ZUTA 5TE7H 4NM4L 2H0JA 2K0RA 4LL4A 2CUHA 4MQ7B 2FZ3A 2ZAGA 4Q6KA 1RZFL 1E30A 4JZNA 3J07A 2EACA 3HPJA 5CN1A 2WCGA 1DR9A 2P1YA 3BD5A 4P3CH 3S5ZA 4AEIH 3CX2A 3KDMA 5CILL 2ZPKL 3PGCA 5CLZA 1D5MB 2OL3H 3B1UA 4N86A 5D7JD 1MCWM 3ARUA 3B7SA 3OPZH 5FO8A 3FFCA 5FOBB 5KWYC 1REIA 5JORB 1EEUA 4NEHB 2A4EA 3H4HA 4KVNH 4XNYH 2NRDA 2CMRH 1D5IH 3S8FB 2F53D 2N0KA 1XF4A 3CVHA 1WG3A 4IGBD 4KX7A 3UABA 1A02N 4AMKH 3NUKA 1GOGA 1M57B 2XHNA 2EIMB 4U1IA 3IFLL 4XPFH 3T1WA 1T2XA 4NNXA 1EGJA 4XP6H 1UB5A 4RAUA 2MCPL 1MUJB 3INOA 3PP4L 4NNPL 4H5SB 5FYKH 5KS9B 1RK0B 5IT2H 3DI2B 3CZUB 4JRLA 1CFTB 1EAPA 2WBJC 1XF5B 3E80A 3GIVB 1QLEH 2F9BT 2KMWA 3MLYH 5B4MC 5EBGA 4X9HA 1XGQB 4LU5L 2JELL 2V9TA 1ML0A 1NPJA 2OMZA 2X6UA 4IU2B 3IDYB 1E9OA 2HG5B 2ISDA 3T3PB 3ULSB 3EZ8A 3LXBA 3T5WA 1QA9B 5CD3A 5L4IA 2X0VA 5EU5B 5HTSA 5TDOA 5C0DB 1Q9WB 3CDZA 5DJ2A 3O2DL 1SXSA 2RHEA 4LSSH 1TZGL 1NWOA 4LZKA 3IETA 3VI4B 4XPAH 5E6IC 5HPMA 1L9RA 4LRNL 2XU9A 4Y9FA 4BBWA 1MQKL 5GS2D 3D09A 2WLJA 1DUYA 4MNGB 3SIKA 4LMQI 1C5CL 2M8XA 3GMLB 2NR6C 3ABZA 2BPBA 2IEPA 4PGZA 1Q1JH 5T1DH 5C07D 2FLRT 4HK3N 1CWVA 3HN5A 3IXAB 4JRYA 4AW7A 2D7PA 3DPBB 2Y1AA 4DJMA 4HJ1A 1KY7A 3D3VA 2GSIB 1RXLA 2VXQH 3M8OL 1Q9KB 1LO5B 3UYRL 3VXMD 4OUUB 2BY2A 2OBGA 2ZKMX 3GB7A 4XAKE 3VWJC 4R3SA 4TLTA 1NEZG 5HGDA 3D25A 4UAOB 1IZJA 4BFEA 3O8XD 3CFNA 1KTCA 1PFOA 2PCPB 3EF7A 5MHSD 1A3QA 4KXDA 3K8MA 2XX1A 2RJMA 4RBPH 5CUSL 1O7VA 4ORZC 1Y6KR 1ZD6A 2I32A 4X8XA 2FSEB 3KYMA 1GVIA 2H41A 1X5KA 5D4QA 2XZAL 3I9AA 4WTXA 5D1QA 4W68A 2Q5BA 1K3ZA 1CXHA 4BV1A 1TZHA 1QW9A 2PTUA 1KBGL 3L4ZA 4Z7IA 2BJMH 1TTFA 5DJ6A 5SWSE 1E27B 3WJMA 1FIEA 1UVQA 1FJ1B 2X6AA 1HXKA 3P4NB 5ICZA 4QY8A 4M3JA 2Y07L 4JCWA 1AOZA 3LKNB 3COOA 1I7RA 3CQFA 5T3XL 3WEXB 1AR2A 1A6TB 3ARRA 4HWBH 4BFBD 3ES6B 1SUHA 3X1FA 1VDGA 3Q1SL 4QOKD 2R0LH 3FOMA 3I6GB 4KUCD 3ECQA 4DT2A 1OP5K 3RUGF 3SN6N 3CFUA 1KFGA 1HYRC 2ADIA 2EP6A 4LFHD 2GJJA 1PZDA 5I15H 3UC0H 3OKOB 2BX5A 5DD5L 1I3VA 4W9GC 2DH2A 4ZD3H 2XTJC 4PYHA 1BQKA 2X53A 1VAHA 3ZMNA 4AYSA 2JKJA 3EO9L 4Z23A 4ZX4A 4FYRA 1OLZA 5J8OA 4NQXB 1VRSA 4E36A 5IEKB 1Z66A 1WAPA 4BDVA 1NGYB 1IBBA 3QH3A 4WJG3 4O51B 3VGAC 3WE6A 4YBHA 4QRQB 4JAMB 3TEYA 3OAYH 4EBQL 5C3TA 4KZDH 2VLMD 3JV6A 3LKRA 5DK0B 2OMVA 5EULV 3P9MB 4KHTH 3VFPA 1NPUA 1AP2B 3OMAB 1QEXA 2AV1A 1MAKA 2DBLH 4JE0A 1U36A 3QBTB 4WK2B 1IILE 4S1QL 1DE4B 2C3WA 1FFRA 3VFRB 4JCLA 3W38A 4TMPA 3AWGA 4I88A 3TVMA 4AQ1C 3NCBB 3WTTA 4GBXA 1AMYA 5CP3H 1OGSA 1XGUB 3QJFA 3VUAA 4F7TB 4O02B 1JGUL 1RUKH 4FLOA 4N0CC 3PHOA 4N1EA 5K9KA 1SN5A 2HG0A 5KBDA 5DD3H 3C6LC 2QQKH 1SRDA 4W4NA 1J48A 4MYPA 1PIFA 4E5XB 1NCNA 2W60B 3PFQA 5GISH 4MZRA 5A16A 5HVWA 5GGRA 4OB5H 1JD7A 4MMYA 1UENA 1E8YA 3I6LD 2E4FA 2HFFA 2R1XB 4U0QB 4KO5A 4FXKB 5IB1A 1F3DH 1M05A 5D4IA 4D7PA 3AG3B 3NFSL 4DKAA 1JCVA 4F2MB 4H44C 2WCPA 3P2TA 2FO8A 4MJIE 4UOQA 3FMGH 2BCKA 5J5EA 2IQAA 3EFFA 1M2VB 4GG6F 3UAEA 4W93A 2C9PA 4OD3L 2Z31C 5LAPA 5IBLD 3PWUB 1KIUA 4N2CA 5FLVA 1YY9C 2IBGA 1ND0B 4FFWD 4HZAA 5IBUB 3L7FA 5KW9L 1HVXA 1F3DJ 3BZFA 1JYXA 1DFXA 2O61A 2JJTA 5IMMA 4GIOA 1FNSH 4JANA 5K1NA 1M71B 3TO2B 3SDDA 3V6BR 4PSPA 1FO0L 3MRKB 2ATKA 1WD8A 2FJFB 1J87A 1HILA 3LS5L 4OV5A 4EKXA 1ZGLM 1BM7A 1FNLA 3F7YB 1W6LA 1M6UA 2JK5B 2DEWX 1YLBB 3V0AC 4JQIH 5JXEA 4WNQA 5JHDA 3T3MB 2ZX5A 3BZ4A 5IQOA 4K9EL 1G9MC 3Q9QA 3C5ZC 3V4VB 2M2DA 2K7PA 2JCCB 5ETUA 1H5BA 4IHBA 5KAQG 2A77H 3SJVB 4F8OA 3WL9B 3RA7L 3CH8A 1YHPA 3G9AB 4LHUG 1EXHA 5F96L 4PWEA 3B3BA 1YJDC 3AMKA 1MIML 2WV3A 2E8YA 1G1CA 2BVTA 3M45A 1CFNA 4AQEB 3RRQA 2LTQB 4F92B 4FJYA 3UTTE 3BUYA 3HI5L 2LR4A 1KCWA 5I30L 3QJSB 3MQIA 2FZ3B 4OZGE 4E2OA 4JZNB 4NUGL 1W15A 3HPJB 1AHMA 4POZD 1PEWA 3H7BA 4TQHA 1WJ3A 5AW1B 1FZJA 1TJXA 2QEJA 4GMSL 3KDMB 4NDMA 3OR7B 3PGCB 3EJYC 2H1XA 2ZT9C 3S5YA 4F8LA 2V2TB 1FORH 4YOKA 1WWAX 3FFCB 3IJ8A 4AH2A 5IIEA 1N3NB 1XR8B 4XO9A 1WGOA 4RGOH 4Z7NB 4F37F 4JHWH 3L1OL 3LVEA 4FERA 1XF4B 3CVHB 2W5PA 1QG3A 3QQ3A 3QEGL 2BY1A 4OVUA 5DRZA 4K0OA 2OSYA 5KOVC 3SE4C 4ZMZA 5CEZL 2YWYA 1WAAF 4G6KH 1D5ZA 2DOCA 4FP8H 1IVLA 3IU3A 4LLUA 5F3BA 2DWTA 4NNXB 4DETA 4DK3A 1NFDE 4RAUB 2DLFH 1NKOA 1UZGA 3BJ91 4QJ3B 1S3KL 4GB9A 3P1VA 4KHXH 5G4NA 5AKVA 5IQ7L 3P54A 4GXVH 1EAPB 2HT3C 3S0PA 3KYOA 2DM4A 3SKMA 2OMZB 2FB4L 1E9OB 1E4KA 1X4XA 2R1YA 1H6FA 1TSHA 4GSDL 3TZVB 4IYKA 4HS6B 4AQ8A 5CD3B 4PJ8D 1AHWC 4TRPL 4KPHH 5TDOB 3CDZB 1FL3A 4OGZA 1IQDA 1LEGA 2NR6A 5DJ2B 2VRAA 3DJSA 5GRWA 3K74B 1H8NA 3DHUA 3IETB 4R4ND 2MSPA 5F1NB 1HESA 1IGYA 2WANA 4P2OD 2K7QA 3BYTA 3QFJA 4G8GA 2BOCA 4K8RD 1X9RA 5E5LA 4H8PA 5IK3A 1MY7A 2A9CA 2NY0B 3WFEL 2ARJQ 1DUYB 4JN1L 3EJSA 3VX0A 2R4SH 2ZWSA 1CF1A 4TLKA 3PJNA 1BM3L 3VWJA 2J72A 1G4MA 4JRYB 4GNKB 5F97E 5HHOD 3D3VB 3RIFK 2VDMB 5I1DA 1F8TL 2DZEA 1R0AL 4PTUA 1R3IH 3UPRA 3CCHA 4NC1C 4R3SB 5HGDB 4QF1A 3D25B 3BVDB 5D2NC 3LQAC 5K69A 4N0RA 3V7AG 4X6CE 1O9VA 5DDHA 5DTFA 3T8MA 3CMOL 3KYMB 5E95B 3U6XA 1QHPA 2XG4A 1MF2H 1DQQA 1J1XL 3FSAA 3QS3A 5FHBL 1PX8A 5D1QB 4OGAD 5E8EA 1TYRA 1TZHB 1PKQA 3FHEA 3Q48A 2EVFA 3WXWL 4BWUA 3DGGB 5I73C 3T2LA 3WJMB 1A8JH 3DLQR 3DNKA 1UVQB 1HXMA 3VTMA 5ICZB 1F4XH 5HJDA 1AQDA 1I7RB 4JHAL 1BEYL 3PGFL 1A21A 5DMKB 3K6DA 2VMEA 3MRNA 4PWFA 1Z5LA 1EHNA 3B3IB 4M1DH 4F3FA 1ZS2A 3FOMB 1J1PL 3AITA 5DZNA 1CG9A 1OP3K 3OB8A 1IKFL 2SODB 2WTOA 3UJIL 4BYHA 2ADIB 3IFPA 2BP8B 4X8GA 5M94B 3R18A 4JFDD 4R5XA 1AFVL 3QI9D 1OANA 4AE0A 4IKLA 3WFDL 3JWOH 4GT0A 4QAWA 4TL4A 3AXHA 2BY3A 1Z0NA 1GKOA 4XOBA 1PAMA 4Z7OE 2PWEA 5TFSH 2WLMA 2EO9A 5FYLE 4BDVB 3DDGA 3G5VB 3O3DA 1YMMD 4Y2DC 1GCFA 3KWWA 3WE6B 3U9PL 3ESOA 5ESVA 1MWOA 3TCLA 2X9YA 2VKXA 4PRID 3QEQA 5EWIH 3LKRB 3WKNA 3BZEA 2OMVB 2AEQL 4BSJA 2IGFL 3VFPB 5I1GL 2CHDA 2YZ8A 2AV1B 4ACTA 2HTKC 3U2IA 1LK3H 2P80D 4QHNA 4AUYA 4UV7L 1A65A 3C6LA 5D93C 2MRYA 3HE6B 3KYKH 4YSEA 3EJQA 3FQ1A 4GW4A 1P6AB 2R59A 2H6OA 1AXTL 1RUQH 3TVMB 1KBPA 2A0LC 2B9AA 3HNSH 4GBXB 3FN0H 3OMNB 3QJFB 3TS8A 1CBVH 3NAAH 4WWID 4KMTL 3RBGA 4JFTA 4E41E 1GTNA 3NCYP 4U31A 1M7DA 2UWEF 3PHOB 3X13A 4ES8A 5K9KB 1TZIB 3SQOH 2Y7NA 2AJSL 1FFQA 3ZHDA 4FNLH 3RQ3A 4NC2B 2MNJB 5C0JA 2ZUQC 5D7SH 3EKCA 5A16B 3V4UL 2EUWA 5GGRB 1NAMH 4MMYB 2Y72A 3BKML 1SOXA 3CLFL 1H3XA 2DD8H 2HFFB 3S36H 4QKXB 5LBVA 5KBNC 2JJSA 4GAAA 3SE9H 1CB4A 5IB1B 4XX1E 1SLWA 1YEEH 1Z9SA 1M05B 1N70A 4KRPB 2JKTM 3HS0C 4X6BA 3PRZA 1TTBA 4ELMA 2FJGB 2BCKB 4OJYA 2DMBA 1A7NL 3EFFB 4WF7A 2F1AA 5ICYA 1KIUB 4HK0A 2XZZA 1SJVA 4Y1AE 3B5GA 3L7FB 5JPNB 3BZFB 2O61B 3A6BH 5IMMB 3ZTJH 3ME0A 4JANB 4IBYA 2AANA 2WYIA 3SDDB 3VXRA 4BE5A 3C5ZA 2ATKB 4YE4H 5FHAH 5B38A 1S78D 1HILB 3QXWA 4J3OG 3SKJH 4OV5B 2Z64C 3VTTA 1PG7X 1T5WA 1YECH 2PABA 3M7FB 4XP5H 1ZLWK 3QG6B 2CJUL 3ZDXB 4WNQB 5JHDB 1PSKH 3BZ4B 3ULVE 1ECZA 4JLRA 4LKXA 1KBKA 1J18A 5ETUB 1H5BB 4ZFQA 4D9LL 3GHBH 3DHMA 4P2CG 4KV5E 2YD2A 3QRLA 3V4LA 4LCIH 4GIPD 3KGSA 1J9TA 4P07A 3GLAA 2NNAA 2NUTB 4YR6A 1P7HL 2WZPD 5BVPL 4AMWA 5J6GA 4FTVB 5GS2H 4PJCA 3N3EA 1RY7B 4LRIC 1FBIH 1XO8A 4DFIA 5IWLC 1CFNB 3S37L 2JKWA 2HVKA 4Y5YA 4OQTL 3BUYB 4D0CA 5C08E 5E9DE 4WTWA 1S46A 2CU9A 5LXGH 4JG5A 4NQTA 1TVBA 4LHQB 4BFGA 4R83A 3L9EA 4OCRH 3H7BB 3TYFA 4OF6A 3O41B 1FZJB 4NDMB 3SY0A 4CVXA 3QG7H 4HKXA 4KQ4H 3AZUA 4FQXD 4MDIB 3SDXB 1BHGA 1LWHA 1WQVT 3WLWD 4AH2B 3MJ6A 1B4LA 2EABA 5IIEB 3KBFA 43CAA 1PQZA 4BZ1H 3HMWH 5A2JH 4OCSL 1Q1PA 1JVKA 2CR6A 3BSZA 4G5ZH 5K39A 5ALBH 1BXVA 1RLWA 1WA1X 3QQ3B 1XCTA 2OMWA 4CN1A 4C83A 5AB0A 3L16A 3TT1H 1JZFA 5DJYA 1KF9B 1D5ZB 4B0MM 3OAZH 3IU3B 1E4XL 4PFEA 1I3GH 4LLUB 5F3BB 1G6RA 2VUOA 5AB1A 2CUIA 1KMGA 4R26H 1U6AL 4CU6A 5I76B 5JW4Q 4X0KA 1QSEB 1EHLL 4WAFA 1TVDA 5B1BB 1A7PH 4NQCE 3VD1A 3P3SA 4IOIA 1MJ7L