3MVSA

Structure of the n-terminus of cadherin 23
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-23
publication title Structure of the N terminus of cadherin 23 reveals a new adhesion mechanism for a subset of cadherin superfamily members.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA02
4ZMOA 1NCHA 4AQAA 2OMWB 2EE0A 1OP4A 2X2UA 3Q2NA 3LNDA 4ZMVA 2YSTA 3LNGA 1Q1PA 4AQ8A 4APXB 4AQEA 4ZMLA 4ZMXA 4NUPA 2WHVA 4APXA 2OMZB 1ZXKA 1NCIA 3LNIA 3LNFA 3K6DA 3UBGA 4NUMA 4ZMYA 2WCPA 1SUHA 3FF7A 4QD2E 4AQ8C 4AQEB 3K6FA 2A4EA 3LNEA 4ZMPA 4ZMQA 2V37A 3Q2WA 5JYMA 3QRBA 2OMUB 5JYLA 1ZVNA 4AXWB 2WBXA 3K5RA 4NUQA 5DZVA 1WUZA 2OMVB 1L3WA 4AXWA 2OMXB 4ZI8A 4ZMWA 4ZMNA 3UBFA 2O72A 1O6SB 3MVSA 3Q2VA 2YQGA 4XXWA 3PPEA 2OMTB 1NCGA 3Q2LA 4AK1A 1EDHA 2QVIA 2OMYB 3K5SA 1NCJA 4ZTEA 3UBHA 5KJ4A 4ZMZA 3LNHA 3K6IA 4NQQA 5CO1A 5CZRA 2QVFB 4ZMTA 2WD0A 1FF5A 4XXWC 1WYJA 4AQAB 4OY9A 3FF8A 2A4CA 4ZT1A
chains in the Genus database with same CATH superfamily
4YR6B 4KVCL 3IFPA 2WJ5A 2A83B 2JK5B 3CLEH 3L5WB 2NCEA 2ENYA 4RAUA 3ILPB 3GHPA 4L37B 3EUUA 4QJ4B 3QDGE 3T8MA 1GGCL 1YPZA 2XV3A 5JXAL 1BPLB 1NKOA 4DFHA 4D9RE 4P05A 1RUQL 1EDQA 1WAEA 3AG1B 1K85A 5EOCL 5FX3A 3OR6A 1QBMH 5AYTA 1JV2A 1Q9KB 1JFHA 4NEHB 4KWUA 1TCRA 1E8ZA 4IOIA 3KDMA 4GSRA 5FM5O 5ESQA 1SOKA 2QSCL 3DX9A 2UZYA 5HHOB 3UAJA 1I82A 2A9NL 3GMQB 4RGMC 1G6VK 2N7AA 3B7UX 2WXGA 5A2LH 4KKZA 5GSRB 1LEGA 1BLIA 4MA8H 4I5BB 5BRZA 3BUBA 4DP6X 1IARB 2OK0L 5EOQH 1P1ZB 4U4IA 4M48L 5K93A 2B1OA 5D93C 2EYTA 4LHUD 4B95C 2IFFL 1I8MB 2MTAA 3DIDA 3K81A 3SKJH 1FH5H 3VVVA 3W9EB 3VGFA 3ABMB 1QLFB 4IYKA 3O45B 4PCSA 5I6OA 5DD6B 5CIPH 5SWSA 1GZHC 3TLRA 3ESUF 5CIPA 4Y5VC 5JA9A 4Y4HD 3U9PL 4M7ZB 4WHTB 5E6YA 3G6AA 1I7UA 2X3AA 1K6QL 5ADPL 1G1OA 2CA4A 4X98B 1ZHBA 4J27A 4CC1A 1KCWA 2W1NA 1JGVL 3D39B 2OMNA 3AT9A 3PWNA 3UEQA 3FFCB 4U1JA 4IBSA 4JRYE 4TPRH 3ZMNA 4OZIB 1TOXA 2PETA 4WV1A 1F6AA 3E8UH 1HEZA 3HNSH 3OF6A 2DKMA 2ZF8A 4F7CA 1OB1B 1HOEA 3BDXA 3GUFA 5DXWA 2R2EB 2PPDA 1J05B 5E8OA 1XAUA 4EIZC 5MEOA 2AKRA 2IADA 4K3EL 2XETA 1J0IA 1EGJL 2DF3A 1SXZA 1BPVA 1FWXA 2AJXL 1ES0B 5HVHB 3HLKA 3JTSA 3CVCA 5DTFB 4Z0XB 4X99A 3FO1B 2LABA 3NT0A 3Q5OA 5L0QC 1MJUL 4XTRC 3RVWC 2WLJA 3VMPA 4OLVL 4A55A 4UQ3B 2DEWX 4P5SA 5DLLA 2IMNA 2LFEA 5E0FA 1YEEH 3IDUA 2YSSA 5CWSA 1AI1H 1A1NB 5I0ZA 4OLUL 1MCQA 2VB5A 4L18A 2QTEA 2A9CA 2OJ1A 1PAMA 4IJ3C 4G7SB 3CFQA 4NWUH 2P47B 2GUYA 5AL8A 1A4KA 1DLHB 1PSKH 3ZDZF 1CF1A 4FXGB 3AMLA 5EHFA 4FZ8L 4FFYL 32C2A 1ZIAA 3A47A 5KSVA 1YY9C 1QEXA 3QJRB 5D7SL 1X4XA 4AT6B 3L8QA 1DZ0A 2VRAA 5IR1A 3EH3B 1EBPA 3V6ZB 2WXRA 3MRFB 5IJKC 4G8GB 4KK5D 3A0OA 3P3YA 1Y07A 4FS0A 3R8QA 4ZFGH 3ML8A 3ZSTA 4KBPA 4AKQA 5KJRH 2WCPA 3NJXA 4JR9H 4N4YB 4GW5B 4PRIE 5C70A 1YA5A 5ITBL 4ETQA 3BZFB 4WWID 5HBBA 4YXLL 1I75A 4DK3A 4XZUB 4POZD 1TZIA 2X6VA 4M8QA 2J5LC 2XN9B 3MUGA 2KH2B 4JE0A 4PYHA 2XA3A 4PJDA 3FO0L 1J9TA 3BAEH 1RUMH 2WOYA 5G5DA 1JZFA 4UT7L 3FL7A 4ZFOL 4XP9L 3QBTB 2WQWA 1ZVSA 2NY3D 3MACH 3KYKL 2BIQA 3K6NA 1U8OB 5HYJA 3MYJB 4FC3E 3GBLA 2I9TA 2DBJA 4CADB 2B9BA 4NN7C 5KEZA 5A2JH 4V1DE 1G9NC 1W72H 4GPVA 4DGYL 1W72A 2ATKB 1SEQH 3WKQA 1AZZC 4G9FE 3Q8FA 3O3DB 2BFVL 2C34A 4XWGL 2ADGA 3MOAH 4HX1A 3CSYB 5HVGB 3IXTB 3HS8A 3IMWA 3VRJB 3H7BB 2OR7A 5BO1L 5IFHL 4OUUA 2XZAL 3IVKA 4AV5A 5DMKA 3MHZA 5J12C 1B0IA 4RMWA 3G5ZA 3FTYA 5C0JB 4XPAH 3B5HA 1I1AB 4LBEA 1ASOA 2XNAA 3RZCB 2X3BA 4I0PD 4U1SA 1GC1H 4WFGE 5EU5A 5E4EC 2J8UE 5SWQB 4R4BB 2XG4B 4FZEL 2W9EH 1X7TA 2GJ6D 1LVEA 2CALA 1CE6B 3U2SB 3QRGH 4WY7L 2FSEB 3DVNB 4PEEA 5GRVL 4U1LB 3BT0A 3DTXB 5GS2D 5GSVA 3WEXA 4XNMB 1RUPH 3QJQB 4ZFFB 4N3UA 1DCLA 3N43F 2YQBA 4CGUB 3T4AA 2CU9A 4I2XA 2C9QA 2N59A 3MREB 5DC9B 2AJUL 4MKTA 3KPNA 2XBDA 3GXIA 3L4YA 3EJYD 3T2LA 5DJAA 4QRUB 1RHHA 2ENQA 4FYQA 2AJYH 1PCSA 2C3XA 4XNQB 4H8QA 3CXDH 3AS1A 3MRKA 1RZJC 4S1DD 1B0GA 2HVJA 1X7QA 3RA7L 4YBLB 1D5MA 4U3HA 4L4TB 3RIFK 1HIMH 1UT2A 2OMBA 1ULVA 4XP5H 5GGQL 3Q1EA 1DQQB 3O6KL 2KDGA 5LCVH 3WELA 2AK1H 2VLRA 1NEPA 2NNFA 3MLWL 1GGBH 3LXUX 5DMGD 5LCVA 3UACA 2MQCA 1PNDA 4L3ED 4ODVH 3LD8C 2XY1A 4LMQI 2NY5L 3DOIA 5F44A 4X6DA 1UA6L 3ERXA 3ZL4H 4LAQH 1X6NA 2CRMA 4WUUE 2E6QA 1R17A 4AEFA 3WUZA 1C5BL 4XMKH 3MRMA 1HT6A 1U21A 4PB9L 5C3LD 3P30L 3N9GL 5F0MB 4P57A 4S1DC 4H2CA 3SKNB 4YHNB 4DNLA 2PP9A 1XD0A 3GO1L 5GJSH 4R96A 4NJ9H 1MF2H 3KBHE 2X4UA 3L08A 1FYTA 4GP4B 5C3IA 1N8ZB 4HT1L 1Z5LA 4YVUA 3T6VA 5DMGC 2MKWA 3WJLC 4FL4B 4J6RL 4PRAA 1NCBL 3RKDD 3KPQB 1MCEA 1SEBB 4JHAH 5A6LA 2RTTA 2L8AA 3BWSA 4HH9A 4CL7A 1EO8H 4B9FA 1RUKL 2RH0A 4WUKH 4I13B 1AZVA 1PEZA 3S3CB 4BKLB 1JD9A 2H32H 2WIIA 1TQVA 2YK1H 4MAYD 3FRPA 4RMTA 5FC9A 3TBSB 1I3RA 2CBPA 2H32A 1GJWA 4IDJL 5FGBA 5CCKH 4HU2A 4YXKL 4AI7A 1KCUL 2A38A 3OJDB 5EZJA 3ARFD 3WEOA 4Q9QL 4MMZC 4G6KH 4O4YH 1NCWH 4OFIA 2HTKD 2A9AA 1JGDA 1IILE 3GMLB 4RETB 2DJUA 3V6BR 1RQ5A 1SXAA 2DQFA 4HK3N 5AL0A 4DO4A 3AREB 4PJXB 4V2CB 5I1GH 2A4CA 3ATEA 2YHGA 5DUPL 2EE9A 2VR5A 4XMVA 1MWAL 3WL9B 4DEPB 3L5XL 1NLBH 3MRJA 5EEXA 4MAYC 1UOVA 5T5FH 3THMH 5F7FA 2R0LL 3QR1A 3EYOA 1A7QH 1AD9B 2IG2L 5HDQH 5T5FA 5TPWL 2BNRE 4NQVA 1E50A 1A65A 1HQ4B 4BBWA 4Z1PA 3FQ4A 3QB7C 3ARFC 4Q9BA 3QZNA 2BS71 4HIEB 5E8PB 3WKPA 5A2KH 5MEPB 2NW2A 2XTLA 5AW1B 1LWJA 2CHWA 1KB9K 2FBRA 3NIGF 3QFJA 5JUEH 4XB8A 4H88L 4HCGA 2FJGB 2ZKHL 3RI5K 1XF2A 2AJ3B 3TBWB 4Z7WA 1M7DB 2VQ1A 3I6LD 1AVAA 2Z34A 2DDQL 2I9LB 1SGKA 4Y9FA 3D9AH 2AGJH 1AFVH 5L7XH 4MWFB 1WWAX 2GCYB 2VLJD 2CMRL 4GKNA 1IM3D 1UWXK 1C16B 4OZFH 3CFEB 3VGAC 1CGSL 4AX3A 2CO1A 4OZFA 4UNTA 1NIBA 3TBYB 2Q10A 1RZPA 3IDIA 4KI5C 4N2HA 5CLXA 4Y2DD 2Z7ZA 4NX0A 3TFBA 4L9LB 3CZLA 4GXVH 3DXAA 1OV8A 4O58L 3VRIB 2PYEA 4IEFA 5E4OA 1KELH 1L0XA 1VLXA 1MAKA 5B1JC 1UXLA 2V8LA 3K6SA 3GSRA 5EU6A 1AOHA 4G5ZL 1JGUH 1KIPB 3QO1A 2V3FA 2YPLE 2OMUB 2CKBB 2UWEF 5DFWH 4M6MH 3GZOA 1JPTL 5J7CC 2A1WH 4HJTA 2AAAA 1D5IH 1R24A 1SVBA 4ELMF 5J1SC 5AYUL 2VZ3A 5DHMC 4NWTL 5FPIA 3VWKD 2P8PB 5PCYA 3GS0A 5LKNA 1BM7A 1OAKL 3OB0H 4TL5A 1DQDL 4Y9EA 2BLFA 3PS6A 3T9WA 2LVCA 4I0PB 3ULVD 3WFHA 1OALA 1FO0H 5TD4A 2IGTA 3DX8A 3CHXA 3QHFH 2DYSB 3K2UL 5BXFB 5I2IA 2GJ6B 4OCYH 1MKFA 3ZGHA 3V6OA 3ZO9A 2XQYA 3HE6A 1U93A 1BF2A 3CC1A 4IU3A 1XIWA 3NFSL 4GAJL 4L5FL 3ROLA 3QIWD 1PX3A 2DH3A 5H2BB 4AYFB 1DQJB 4MXWL 2YMTA 2Z92A 1KENL 1CL7L 4TQPA 3L4XA 1RV6X 4ZMZA 1XHHA 1JPGA 1KTKE 4AW7A 4AY0A 2BHYA 5BUPA 2EC8A 1FF5A 1PLGL 1PDKA 2BW5A 1MXDA 4RIRA 3QORA 3TNMA 3ULVC 1ITBB 1N5AA 5I75B 5C0DA 1BAFH 4K5LA 3QYCA 3VD4A 4MJ2A 3GT6A 3WTYA 3GHBH 4WGVB 4U3SA 4FQXD 5CLZA 5CEZE 2F5BH 2GBVA 2J88L 4WKZA 4OB5H 5F3HB 4YNYB 2NUTA 4X6CB 5B7MA 4X4ZA 3EYSL 3C6LD 1UZ6F 1E0OB 3IFLH 3NEOA 2NQDA 3UJIH 4M1CC 4S1SH 4OZGB 5MERA 3F5WB 2X1WL 4N8CL 4PD4J 3JUZA 3QWRA 1H8NA 2Z7UA 4UTAA 3KWTA 1WAAE 1MFAL 3N1FC 1UKSA 4KUZL 4WWKD 4HJGB 1H9DA 1NGYA 2CR3A 4KJQD 1U8NB 3LNIA 5B4MD 4K8RD 2IDQA 4PVBA 1ZK9A 4J4PD 3L95A 5BVJB 2AV1A 4IRJB 4UDUB 2OMZA 2V7HA 5A16B 2F5AH 5KSAD 4FQXC 2GTQA 4WI3A 1GAFH 2XUWA 4L1DA 3ABGA 3RWGA 3T2NH 4PN6A 1JYXA 1N67A 4M43H 5T5NG 1CE1L 4YC2C 5ABDE 3ARZA 4JO4H 3TO4D 2NXYC 1FHGA 2KUTA 2QPUA 3VH8G 4HUVB 3PWLA 3W0WB 3NGBB 4ODWB 4QTHA 3HUJF 4JFFD 3BUYA 4WWKC 5AKRA 1L9TA 1ZHNA 2KPNA 4PGCB 1WSST 5TE6H 4QRRA 1DVFD 2BZDA 4P99A 4YFLI 3CDYA 1AC0A 3VQ1C 2EKSB 2Z3FA 5EUKB 4RMSA 3VFSA 4G43B 4LLQB 2WXPA 5I66B 3ULUE 5DD1L 3FHQA 3RUGB 1JBJA 3GMNA 2FECL 1D6VH 1PIGA 3GMRA 1DSFL 4G8FB 4JRXE 5C0CE 3ZKQD 1O5PA 4GAYA 2AANA 4K94L 1T20B 1JCVA 2W0LA 4JLRA 4LCWA 1H3VA 5ANMA 3V7AG 5IIEB 3CFDB 4BKTC 1I4FA 2YD6A 1FL3A 2CZNA 2EDFA 3O2VL 3QWQB 4JFEA 1K2DA 1VFBB 4BUQA 1MVUA 4H2AA 2EXTA 5A6IA 2P7TB 3BUTA 3MCKB 3NPSB 3BN9D 4JDVB 4TYUA 4XVTL 1NMBH 1ONQB 1MCIA 3C8DA 2FIKB 1AXTH 1H3TA 2JFCA 4EDXB 4QHKI 2WJ7A 1ZLUH 5HGAA 3RWJA 2P26A 2C1PB 2XSKA 4BXSV 4HAGA 4PB0L 2OI9B 4AQAB 1CU4H 4ELDA 3ZMRA 4YDNA 4FD0A 4MMXB 4AGLA 4WTZA 3TIEB 3LRGA 4R8WL 5D9SA 4BWTA 3NJGA 2VLJB 2XRAH 5FW8A 5JA8B 4R3SB 3G9VA 1M1XB 3AB0B 4X8XA 4ZMVA 1AOZA 3MV7A 2I25N 1R9FA 2D7PA 4Y2DB 1CCZA 1Q1PA 1Y18A 3L3IB 3AGVA 2OX5B 5D4JA 2FL5B 5L2KD 3O3AA 2CLZA 1BQRA 2PKDA 1URIA 5KAQF 2FR4A 3LN9A 4AYDC 2FB4L 4JG1L 4DQOL 1CLCA 5DFTA 2LTQB 2YOCA 3VNZA 4CSTA 5FYKD 5LLIC 3TN0D 4Z7VF 4XB3A 5DHVH 1U3HC 1VGEL 4GBXC 1F5WA 5DHVA 2O5NA 4JHWH 2ITCB 2UY6B 2FX8H 5DS8B 3II1A 1JPFA 4BUGA 1B0RB 3QFDB 3VWKB 4IIQB 4OCRH 1FN4B 2Z35A 3O9WD 3O2DH 2BSRA 4DGIL 2BP0A 1HNFA 1Q94A 4PJ7E 3O2DA 4KI5F 1INQB 5G2NA 4J23A 1SM3L 2F7OA 3TO2A 3VRLF 4KOBA 3QDGA 1KXVA 4X6FB 5IFJB 1IGIH 3W39A 2MTPA 3LKPB 2WVVB 2ITEA 3BWAB 1I3GL 3GTTA 4Y4KC 3U2IA 5M7QA 1FFOA 1E9PA 3FQUA 3TN0C 5I73B 3QIWB 3RL2B 4JJOA 1ZVNA 2OYKA 1W6WA 4J3OG 4J39A 2HH0H 3CZGA 4J3VA 1UD5A 8FABB 5ETUA 4F1SA 4UYPA 3LXAA 4JM4L 1J5IA 5GGRA 3RIAF 2R1YB 1S6NA 1S7TB 4F7MB 2YRZA 3NQKA 2FQGA 3RX7A 2CE6A 4XBGB 4H0IA 3MVSA 1S7QB 3UIYA 2IPTL 4FQLH 5GIRB 5DDHA 1SDAB 5IF0A 1EQWA 3A22A 4NKMB 1GSMA 2GG1A 3QUXB 1SJMA 5IB2B 4KVNL 5AZEL 6PAZA 4LOVA 4XC1L 4U2ZA 5HHXH 3SBWC 3UTTD 3MV8D 3X3GL 2F58H 4RFNC 2CUIA 2ITDA 3GMMA 3FTXA 2ORBH 5E03A 1O7DC 2G5UA 3T08A 4N6QA 2X1PA 1EEYA 5F7DA 4AOFA 3H9HB 4DW2L 3HIZA 3ULVF 2IOOA 4DJMA 1H6EA 3NAAL 1RJYB 2ZG1A 4N9GB 1OTSC 2QKIB 1L7IH 2AK4A 2IQAB 3FOMA 4JRYA 4DETA 4Y9CA 5GRYA 2V4LA 3P9MB 5KSAB 3VSVA 1MUJB 2QPEB 3FCBA 5I1EL 1YNTF 1Z3GH 2EDLA 2D2OA 3QQ3A 1AS7A 3D50A 1U95A 4U7MA 1TENA 3STZB 4O02L 3R7QA 4HCFA 4HCRA 1A9EB 3TO4B 1BLNB 3ZDZE 5CZKA 4X8JA 3FQNB 2LR4A 1WHOA 1WZAA 1NOLA 3EGSB 4I87A 2DL9A 3F58H 4JFFB 3KXFA 3EGXB 3MRLB 4OCWL 3IEAA 1DVFB 4AZ8B 4Z7OB 3HG0A 1BAWA 1D5XA 1Q0XL 4OZIE 4I1PA 2Q8BL 4YL4A 4E5XA 3T1FA 5KJ7E 4DN3L 2A74C 7PCYA 1DO6A 1DJZA 3FONB 4PBDA 3A6CH 2GITB 4TV3A 4X80H 4JS7A 4XAWH 5D71H 3BIAX 1MVYA 5JHLL 1NFDF 2VWEE 4U49A 1A66A 2AV7B 2NNCA 3C8HA 5F9WB 3CGTA 4HIXL 5JYMA 3GLDA 3VDCA 3PP3H 1J11A 4LSPL 3D85A 1KTRL 3QK0A 3ZRFC 4RWHA 2ICWB 4KY1H 2W60B 3UJJH 3MCLL 2FNBA 5KBLA 3Q5TA 4ANVA 5CM1A 2FQDA 4RSYA 5ERWA 5A2IH 3REVA 1F3RB 4FTVB 3P9LA 3WKML 4DTGH 4NCC2 4Y4FD 2ZCKH 3LXBA 3WN5B 4PUBH 5D5MB 4GYBA 4QHMB 3QAZC 2ARJA 3WNPA 3MBEA 1V55B 2VUKA 3AAZB 4PRIA 3QCTH 5DJ6A 3WAJA 2PUQT 2HPOA 3MA9L 3P1VA 1WZKA 2BM3A 3AG3B 3MRPA 4LB8A 4ODXB 5AKTA 4FQ1L 3KVQA 4JDTH 4BFGA 2VDRL 1ACYL 2DQTH 4ZD3H 1JPST 2ISDA 1MCWM 4XGZB 2RFXA 5H94B 2ZWKA 4HA1A 2X4QA 3FTGB 2DD8L 2Y9RT 4LCCC 5IBLD 5AOZA 4GSDH 4NQQA 4FX5A 3QYMA 1ILUA 4U4BA 5E6IB 4X7CC 1QFHA 5E2TH 1KCBA 5EN3A 4PRPE 4YSOA 4QHNB 1P7KB 2CO3A 4Y4FC 3VYOA 5HHME 3RTLA 3D2UB 5FOBA 3CPUA 3D09A 4PGEA 1AC6A 4NPKA 4F24A 4V1DA 3P4MB 3R06B 2VZTA 4YSPA 4QYAA 2V5YA 2YXVA 3MOQA 4G7RB 3M17A 3MGTB 1BQHG 3BH9B 4MJHA 4ALAH 5HPOA 2WWNA 3MNVA 1WDAA 5AOMA 3E6FB 4N0RA 1V7NH 3P77A 5EU7E 3RPIA 4WO4D 1L0YA 4UIMA 1A4BA 2KHAA 5C0EA 1VCBC 2HRHA 3D25A 3DGGB 3NCXA 4WW1A 5IBLC 5BW7C 3WE6B 3GUTA 1QTYT 2F7IA 1KB5L 1EXUB 3D0LA 1T4KB 2FJHB 3UG5A 2QR0A 1HXKA 1TR7A 1HJBC 1TZHB 3VSQA 1K8IA 4FEIA 2XQBH 4JX0A 3S4SB 1BQLL 1YN6A 3FB5B 1FIGL 1S7VA 2B59A 4FEMA 4DN4H 3C5SA 4YDKL 4Z7NB 5J89A 3LMJH 5D7LE 2X41A 1Z9LA 3F62A 4FNSA 3HG3A 1LWRA 1ZT4A 2QQLL 4QAMB 5FGSA 4JREB 4JY5H 1JNJA 2Z31B 2OP4L 2OKMA 3DLQR 3JWDL 3MQIA 3T6QC 5GS0D 4AENB 1MZZA 3ZIMA 1BZOA 2VIRA 1R47A 3WSQH 1KC5L 3B1TA 4NRXA 1F13A 2ERJB 3UTPD 3OLDA 1NKRA 4OJFH 3G6DH 4O51A 4PJ8C 4JBSA 4FYRA 5KN5A 4AUYA 1ZS8A 4N22A 1S7UB 2MOQA 3APFA 5K9JH 3QVAA 2DQGH 1KLFB 2D7QA 5AD0A 4GFXA 3ZUNC 5J11C 5E7FA 5AVTB 4LLYB 4H5SA 1TU2B 2J12B 3UPRB 3MV8B 4AXWA 3VFPB 1PZDA 2H1PL 3UJTH 3W38A 3HRZB 4X7SH 1T0NA 2YC1B 3H3PH 3V10A 4Z78A 1H6FA 3CZJA 5IG7A 5D7IA 4LOEA 2ADYA 4MNGE 3LEVH 4GUPA 2PWGA 2XXCB 5GS0C 3ECVA 4PLKD 1SLVA 3GEFA 2YPKA 1XGUA 3NIFB 1G6RH 3MPCA 1XV8A 1G6RA 4XCYA 3S2AA 4PI2A 4FABH 1KGCD 1HS6A 3O8XD 4IRSC 5I1JH 1ZLSL 1LE5A 3UC0H 1S7RA 3GEWB 5TGBB 1KXTB 4MSWB 3D1MC 1AXSB 3FU7A 3Q5YA 4WUUA 2X2IA 3CFMA 3S2CA 2ZCLH 5KYYA 1FNSL 4MAUL 2PWFA 3NSFA 4DKTA 1WYJA 1IC4L 1I9IH 2WB1A 3S5LB 2WSDA 3BVNB 3CFCL 3HEIB 5D7JA 4QT5B 4N8VB 2CHZA 2CBQA 3S7GA 1R0AH 1TVBB 4WEBH 4PLNC 1OW0C 1MFCL 3N55A 4JPVH 4WQOA 3FQYA 2WZPD 5DJCA 3WTVA 2P8MA 4YLBA 2NZ1A 3VE0A 1FE8H 1KY6A 5DR5H 3KPLB 2EO1A 3FUJA 1NKGA 1F3JA 2K9FB 2G4GA 2NY6D 4N1CA 3EZ8A 1ZT1B 3CZSA 3KLSA 4GMSL 5JPNB 1PY4A 3UTZA 4AMKH 1E2ZA 4G8IA 3TCLA 1RZKH 1QBML 4KQ3H 4R9HA 1NCTA 1DUYA 4E41D 2YAQA 4HPYL 5HGBA 3LRHA 1R5IB 4ZYKA 4OH2A 4JFXB 4E9RA 4EXPX 1YQVL 5T3XH 3L16A 5IVZA 1P2CA 3NIGE 4JFPA 2DI8A 3BW9A 4LOUC 4ZMYA 3LIZL 1LMKA 4JM2D 4Y1AB 2GT9A 3BIKB 4QLRA 3SJVA 1K4CA 3NQIA 1U8IB 4XN8A 4E2OA 1A1MA 3M1OA 2NY6C 2KZWA 4UIKL 1U8CB 3A24A 3MRBB 5SX5K 3LPPA 1E4HA 1E8YA 3SDYH 4WK4B 1T83A 4PBWD 1OF2A 2E46A 2OMXA 2ED7A 3T0AA 3G5XB 3QJHA 1UM5H 2VXUH 4HLJA 3ZIYA 4B7IA 1QSFB 4Z5RB 5GISL 4RBPH 1T66D 1QZNA 2EUXA 1ZHLA 4OSUH 4YHPA 4U1HB 1XFPA 3ZHFA 1FFQA 3BX7C 3O0RL 5E2UH 2XVLA 1RZFH 1N12A 2MPAL 2UWEE 4U1NB 2C5DC 3LHPH 4L8SB 4Y19A 2R29H 1MQKL 3DSNA 1KUMA 3OPUA 3A67L 1DBKH 2R29A 3V2AR 1QHPA 2COVD 4JDEA 4NXKA 4XMLH 5EIQA 1BG9A 2DIAA 2IDSA 2G3MA 3GSUA 4HG4J 5DJXA 1H3PL 4ZOEA 2ZXEB 4X4XB 4I48B 3WIFA 3HI1B 3TWCH 1IX2A 2WANA 5DVMA 1EV2E 3TWYA 3NABH 2V3DA 5L4IA 3OKLA 2I07B 2VDKB 3FU5A 3UTSD 5SWZD 1U3NA 1RZGA 1TKWB 1NCJA 3T3PF 1L7TH 1S7XB 4V11A 3DUSA 1KLGA 4WO4B 5JORB 5IJVB 1Z2KA 4IGBA 1ZDSA 4KHTL 2LU4A 3GXUB 3GGWA 1WFUA 4MCNA 2XVBA 1PQZA 2VXQL 5BPPA 4DH2A 4FADA 2XJKA 4BGLA 2GKIA 3H9ZA 4CW1B 5FYJL 3L3DA 4AITA 5IVXB 3TBTB 3QUKA 3AMKA 4Q0XL 4X50A 5EIIA 2ZSWA 1JZ3A 2BP8B 5K39B 3Q2NA 1GYUA 1LGVA 3RNKA 3LKQB 2ZYRA 2B1HH 2PWHA 1MRCL 2F74B 5D6DC 4J8RB 3L3GA 2D03L 3NZ8A 1PJWA 3EO1B 2OJZL 2WUCH 2Y23A 4ODUB 2J2ZA 2VC2H 1XGYH 4PTUB 1HCYA 1WWCA 4XCCH 3RURA 3Q01A 3X11B 43C9A 5JHDD 1B6UA 1UZ6E 3MBWA 5DZNA 4B53A 4NP4L 4RRPG 4GI6A 2XWEA 2IAND 2Y36H 3D69A 4JZJB 1IGYA 2Q3XA 3DGCR 4OZHB 1A6UH 3SE6A 5BUAA 4K55A 1TQBC 3WLBB 4ZFGL 5IQ9B 2WNXA 1GGUA 2AXFA 4HALA 1NBQA 3RWEB 3CFUA 4XX1E 4LASH 3FF7A 1QR1A 3SKMB 3EYFB 4LVEA 3MO1A 2GJ6E 2YD0A 1KT2B 1L0PA 2BIIA 2IWKA 1VHPA 3JSSA 1UYWH 2UXVA 3ESPA 4FI7A 5CP3A 5IKCA 4RAVB 4F8LA 3S8FB 1S9VA 4W9FC 1CI5A 2YEQA 4MHHG 4N28A 1DBMH 1HXYB 5JOPD 2C3WA 5CEZH 4PI0A 1M7XA 5DRWA 4HS3A 1PZ2A 2DB8A 1UJ3C 1U3YA 1G7QA 1HHHA 4KY2A 4OD1H 1GJUA 2XKNB 3T65A 3K74B 4G1MB 4DVRH 3O8XB 3LS5H 1U92B 1M9WA 5AAWA 4QRQA 3ES6B 1JDCA 2VDLH 4E68A 1WAAA 2Y5EA 4JO8A 3RQ3A 3ZY7A 1QWNA 3FCUB 1GZPA 2XJLA 5AZ2L 3FO2A 3UZVB 1ESOA 4YHLH 2VW7A 3RJQB 2SODB 2PP8A 2ICWJ 1KGWA 3FQXB 1G7JA 1HSBA 3QUHA 2CA3A 2CBOA 1L9SA 2VZUA 4UQCA 4NRYA 4LPTA 4L3EE 5D1XB 2X3CA 4KUCD 5CUSH 3VG9B 5J6HA 1UADC 3L3KA 5T1KA 3UBHA 1AKPA 2ZP9A 5FFGA 1QUPA 3DA0A 1BMGA 1TMCB 5GZOA 4F93B 1JZIA 3DYOA 5DS2A 1KTLA 2O4EA 3OG6B 1GC1L 3GJFH 4P4KC 1UD3A 2DWXA 3VJ6A 3KJ6L 4BIKA 2WSKA 4ZPVA 3GJFA 3RE0A 2QPSA 2BZ7A 2EILB 3TNNB 4XAKD 1SQMA 4IW4C 4Q4IA 4U3XA 4E41B 2W9EL 4ENED 3ME0A 3JWNC 4F27A 4Q2ZA 4UM9A 5IW1B 3F7YB 3RVTD 3LKSB 3DVGB 5F3FA 1T1XB 3K4DA 4XNUH 1H5BA 1A6WH 1DFBL 4JM2B 2WMPB 5CJQH 5E5UB 1N26A 4KXAA 1HWWA 1MFVA 2JQZA 1U8KA 3F12B 3BFQG 1FV1B 4JRXA 5C0CA 2G2RB 4NM8L 1UB6B 1GHFH 3S3SA 4AL8C 2O93L 5AOJA 1RZ8A 3ZE2B 4MX7B 5F1OB 2VZVA 1U41A 5D70L 2ZJSL 3FT4B 4KDVA 3UCQA 4IMLB 3I75B 3HAEH 5A6MA 4LLMA 1H3WM 3HAEA 5KBKA 2J21A 1FP5A 2ZOOA 3O6FC 3RVTC 2AEWA 2FJUB 4WSKA 2WXJA 5LCVL 3CQQA 2OYMA 4OBRA 3V95A 4QXUH 1GGBL 2N0MA 2BRRL 3ARBC 1JYWA 2D4DA 4P2AA 3KL0A 1YEFL 5ICZB 1NBYA 1UACL 1JWSB 4HUWB 4MMYB 3U7AA 1F90L 3MRRB 2R8SH 3G6JF 5EN2A 5C0BE 4LAQL 3WTSA 3RRQA 2WTOA 1Q1JH 1WISA 4NO0A 5F9JA 1HVXA 1JHLH 2X2JA 5IB4A 3L1OH 3D06A 3FCGA 4KI5E 5SX4H 1XGTA 1I8IA 3NCJH 5DYOB 4JANA 3Q06A 1QRNB 1AZNA 4X5RA 2CLVA 3D0VB 1MF2L 3CBKB 2WTRA 3S3BB 3LH9A 4HS6B 5ALCH 2LGNA 1N19A 1RUAL 3GQFA 3IXAA 1YEHL 2FGWH 1JGIA 4BQ8A 3BEWB 3UPCA 3MFFB 1RZQA 1F6LL 2E75C 3I6LE 1NICA 2GSGB 4OCSH 4JHAL 1DBBL 2FWOA 3X3FL 4P48A 2VLJE 5B8CB 4XXDB 4JY6B 3CIQA 1SLUA 3TA3A 2TSBA 3OHXB 4YHKL 2C9RA 1UM6H 1CLVA 3S98A 4MZ3A 4MS6A 4J1UA 1JXGA 1I8KB 4PJ7A 2IBZX 1YJDC 1ED3A 3LPFA 3U1PA 1OP5K 1KIUA 3CQFA 3QC6X 3U4EB 4CMMA 1D7DA 1EK3A 1SMOA 1WBXB 4R0LC 3EHBB 4HIHB 4RFOH 2KI6A 2SEBB 4PWEA 1A4CA 1IBFA 4Z7UF 2DLEA 5JHDB 4QWWC 4Z3EA 4LRNH 5F7MC 4DCQA 1YNKL 5DGRA 1O6VA 1ZGLP 1NBVL 5KWYC 3HTLX 3BI9X 1WEJH 3BFOA 3ZE0F 1MFUA 4P3CH 4EZKA 4W9KC 5CSZA 4U31A 3ULVE 1MAJA 4YR6A 1WBYA 2A83A 4J8QA 2JK5A 3INUL 5JIKA 4KAQH 3L5WA 3ILPA 1PZ5A 5LO7A 3HJ0A 2VSDA 5HHVL 3NRPA 4GRLB 1TTGA 2MEJB 1LQSR 1ML0A 5FHBH 5JUEL 1WFTA 4FP8H 5G55A 2QHRL 3C5ZD 3OJVC 3NCMA 2CGRL 4I18C 4WW2B 4QXTB 5FUZH 2ZXAA 1AFVL 3PHOB 3PQYB 1WP6A 5HHOA 4G8EB 5E56A 2HFTA 2E59A 4OLEA 4Z7AA 4OVUA 1X5KA 1IBBA 1BFVL 2QGBA 5GSRA 2MQGA 4I5BA 4D0DB 5FECA 4FFWD 3NP4A 7CGTA 1QEWB 3BAWA 4POUB 2NX5E 3D8MA 5DEGB 2YJQA 5T3ZD 2QFRA 4M3JA 4A2LA 4KZCA 4NZFA 3O45A 5IESH 3C5ZC 4LQFL 5DD6A 4J3WA 3GSWB 3L5JA 2CWRA 5EEUA 1EMTL 2PLTA 5IBTH 1E7VA 3KPSD 3VXSE 2XIIA 4WHTA 4NNYB 1MJ8H 4P9HH 1KPVB 1PKQB 4F2MB 3STBA 3WS3A 1G9EA 3BN3B 4X98A 1AQKL 5I1IH 3S5ZA 2XLLA 3PE9A 1OTTD 3D39A 1FO0L 4FFWC 4HW6A 4PG2A 4NUJA 3UL4A 2E7LA 5AVSB 3S3DB 1E9QA 4XP1H 4P5TD 1UEYA 2VLLB 3HZVA 3IK2A 4M56A 2H3NA 1UD2A 4OZIA 4PS3A 1DQLH 4R7DA 4PJ9D 5JOEA 4PV9B 2R2EA 1ZLVK 1J05A 3T71A 2ZXCA 3LHAA 2CO6B 3BJLA 5ISZB 2AERT 5HY9A 2XN2A 2J1XA 5EEVA 1RP9A 3PUCA 1ES0A 3D5OF 3HI6L 4ZAKB 1GZQB 3I6GA 2W88A 5DTFA 4Z0XA 4JFFE 4XXWC 3Q8BA 1A3RL 4UDTB 2H7WA 3L5HA 4KO7A 5FR3A 3SDCA 1WO2A 2ZUQC 4FGMA 1KJ2H 3MODH 2H8PB 4F20A 4LIQE 1KJ2A 3G3LA 3L48A 4P5TC 4BCZA 4UQ3A 4YFLF 3ZYJA 8CGTA 4TSCL 3P0VL 4ZS6D 4LPVA 2HKHH 4XMXA 1HAWA 4GO8A 5MEQB 3BEVB 3KVDD 3FUNA 3LNGA 1CLYL 4KXZH 3IFLL 4ZO7A 1FORH 4KXBA 4AQ8A 1NSNH 5FUOL 1VFUA 4LCVA 1DLHA 5I8KL 3JUYA 5B3JF 5HPMB 2AAVA 4S1SL 4UT9H 3M7OA 2JV6A 4GXFA 1DO5A 3JV0A 1FBIL 3M86A 4UT9A 5HI5D 2F8XC 5HHNB 3ESVF 5FA3B 2B4CH 5IB3A 4KJWD 2P48B 3INOA 4RLDA 2KERA 4IBYA 1NCUA 3ZYZA 2OSWA 4AQZA 2YA0A 3RWFB 3MRFA 2WBJB 5KUMA 5D5ME 5K59F 4ZS6C 4PRPA 1G9MC 4R2GB 1SHMA 2X1XR 3KH3A 1SJHA 2O5ZH 4M43L 4DPBX 5IV2B 3IJSA 5I8EA 5IUSA 4P5RA 3BZFA 4GRWF 1CGUA 4XVJL 2BDNL 1BMWA 3BKMH 3NDZE 2H0EA 1A64A 3DOSA 3KZ8A 4BUHA 1TIUA 1FL6A 4JHBA 5HI5C 4XPHH 2PO6D 3BMVA 4JQXA 1A6ZB 3NSDA 2O6EA 4BH8A 4DP1X 2QT6A 1Z9NA 4HETA 3C9NA 4W9GC 3GINA 3HG1B 3KLQA 1YDPB 3B9KB 5L2KE 1AP2B 1E6JL 2H26A 1YEDB 4CADA 4ELKB 4ZS7H 2MFNA 4HOXA 1FH2A 3NRQA 1QNIA 5F9OH 5FYKE 2JKJA 1KLUB 3CDZA 5AZUA 3RY6C 3GXNA 2VN6A 3KYOB 5C7ZA 2HVKB 1MNUH 1OAXH 3FSAA 1OXYA 3BPOC 4LFHG 3VI4F 1B2WH 4KKLD 1OM3L 3O3DA 4YGVB 5ALBH 2R2BB 3VWJD 4H4NA 2VDNB 2EIMB 3CSYA 3IXTA 4QRAA 2V33A 3KYNA 4L0PB 5D7LA 2PO6C 3L5IA 3MV01 3H7BA 3IFNL 1Z9PA 4KTEH 3VRJA 3KW8A 3GRBA 2HSIA 4QMEA 3E1F1 3HC3L 1E4XL 1JI2A 2A9MH 1NMBL 1OE1A 1ZLDA 4PVMA 2DMGA 2FBOJ 2APWA 4JHUA 2IQ9L 2WD0A 3L1EA 4CJ1A 1KCLA 4OLYL 5BV7H 1T6VN 3RZCA 3GTVA 5IHUH 4OY9A 2BJMH 2R69L 1BVOA 4YDIH 3AT0A 5SWQA 4YHZL 1CU4L 4R4BA 2ARWA 1MY5A 2XG4A 5CD3B 1R75A 4KKLC 4Z7NE 2OULB 1PZUB 3NA4A 3OG4B 2J73A 5F8RC 3U2SA 1CE6A 1O7DE 5KYXB 2FSEA 4OGQC 1HZLA 1QW9A 3PWUB 3F3HA 4OU3A 4G1EB 4PJGB 4U1LA 3DTXA 1X5ZA 3G04B 4HC1H 4XNMA 4ZFFA 1THCA 5MENB 4CILA 4HC1A 2EEFA 4N68A 3BVUA 1AKJB 4XPGL 3F7VB 3BKCH 3UPAA 1OSPH 2Z4QA 3MREA 1F4AA 1RU9H 1JGEA 2ZE0A 3SGKA 4LHUA 4JPIB 4XOCA 1R3KA 5A3ID 4N2OA 4R90L 4XI5D 1PYWB 4XCEB 4CC0A 4ZUUB 3BOVA 4NPYA 2BC4B 2EUVA 4JO3L 1CYXA 3UTTE 4PP2B 4Y4HA 3FHEA 4L4TA 4EUPH 3HCVB 5E6SB 3BXNB 1BECA 1YAIA 3N42B 5F96H 3V0AC 3DX4A 3S96B 1EA9C 1GOGA 1ETZA 3QXAB 2J5LB 4JMNA 4OCRL 4G6AD 3QZMA 3I6SA 2C9XA 3V5DB 1KJMA 1IC5L 1RPKA 2HFGL 1C9SA 3SZKC 3I3EA 4WZ9A 2WQAA 4XI5C 4XN5A 3K80A 4PJ9B 1M6UA 5I26A 2TRHA 2WKOF 3X13A 2L3BA 4ZXBD 5B1BB 2E86A 4YHNA 3SKNA 4BHUI 5I8OH 1XT5A 4CJ0A 2C3HA 3FOLA 1PD1A 1FPTH 3FW6A 3Q6GL 2CJSA 2JWYA 2P4AB 4QRPD 1MCOH 3TS8A 2GTZB 3GJEB 2VDOB 1LEKB 3ARGC 3P40A 3KPQA 3OAZK 3WHXB 2HJKA 4BM7A 4XN1A 4W81A 1AO7E 4GY4A 4YDJB 4ONFH 3TBSA 3WXVL 3MA7B 4ZXBC 4ACTA 5K1JA 3K6IA 1IQDB 3EH4B 2GB2A 3DROA 4GFTB 2IALA 2WOBA 1ETB1 3VXMD 3T3PE 4M6OL 4KNUA 4JUSA 1C5CH 1CMOA 1FAIH 4AEHL 1R3IH 2MOVA 3H9YA 4P2RB 2E6JA 3GMLA 3WXWL 3HBGA 3KM2A 1NBZB 4PJXA 2P80D 1UVQB 1NCHA 1OCWH 2FX9L 4PLJD 3FNKA 3GS4A 4N8PA 1M2OA 2JI2A 5HXMA 4QJ3B 2BW4A 4AWJC 4LVHC 3ATBA 1LK3H 4MQXD 3X1BA 3LNDA 3RKPA 1Z3GL 5DZJA 2VR9A 4NQDD 4PU2A 4RGNB 2ODHA 3PLYA 3UAJD 3CMGA 4EQ3A 1YYLH 3P11L 1HQ4A 2DMBA 3HI5H 2B20A 3ZL1A 1PU0A 5MEPA 3L4CA 2WO2B 2GSIB 3F58L 4NUMA 3ZDXB 1A5FH 2FJGA 4UQBA 1JAEA 2AJ3A 3QIUD 4PRHD 1M7DA 1WVZA 1Q9WB 3TBWA 2ZG2A 2I9LA 4N6RB 4LCYA 1ZTXE 1QLEB 2XX0A 4MWFA 2OPCA 4ODBD 2GCYA 1CO1A 1ZT7B 3D4YA 3TXAA 1FNLA 1C16A 5D71L 3A6CL 3D4ZA 3CFEA 5HJ3B 1J5OL 4PJEB 1S7WB 4G3YH 2OFQA 3UAJC 3TBYA 1MSPA 5F0PB 4MA7L 3HUJB 4KRNA 2Y22A 4WFED 4L9LA 3AQDA 1T5WB 1ZD6A 5EA0H 3QPKA 3VRIA 5CGTA 1Z9MA 3FBKA 1TEGA 4U1IB 4QJ5B 1DJSA 1L3NA 3VWJB 3ULAB 4AYEC 3TF7C 4X9BA 2W0KA 2WAHA 3EDDA 1LP9E 3F83A 4P04A 3BH4A 4UTBL 1KIPA 1A3LH 2WZAA 4UB0L 3JTBA 3S5YA 3T0DA 2OMUA 3BSHA 3QIUC 3D12B 2Q7AA 2O26U 1QYGL 4AVIA 2CNYA 1XH2A 1EAPB 3QEQB 4HCIA 1KXQA 1QP1A 1IAIL 4LKCA 2BX5A 4R26L 1M2VB 2P8PA 4ZMWA 1OCOB 4HXBH 4EE2A 1N64L 3B6SA 4ENZA 5KVEH 2WWMC 4I0PA 3ASOB 2HXAA 4MYWB 2AQSA 1HI6A 4ZNEE 2YBGA 3QCTL 4F58H 2PN5A 3T2QA 4BFJA 5BXFA 2DMHA 3E6HB 1QHQA 4K3JH 1A6TB 2GJ6A 3O2WH 1AR1C 3WEMA 3CHSA 3FMGH 3JWOL 2WCGA 4ZTEA 1BA9A 2NY0D 4JO1L 4YSAA 1YEGL 5KJ4A 5GS2H 1PLAA 4UQ2B 4WV1C 4A7SA 1IMHC 2R0ZL 5H2BA 4AYFA 1DQJA 3BKYH 3QCUL 4LMQE 3WJJA 4AE0A 3UTPE 5TK4A 4QHKJ 5E2TL 4XNAA 2OYPA 3B37A 1NJ9B 2BSSB 3DIFA 3VFGL 2GW5A 5I17A 2MJWA 1I8LC 1NDMB 2IH1B 2KMWA 1KWGA 5CN3A 5IOPB 4JZNA 4KKRA 4KGJA 4ALAL 3FQ2A 3V4VH 1IC7L 1L6ZA 3V4VA 2ZICA 1G43A 2NY0C 1H0DB 4MXQD 4C83B 2QGDA 1MJ7H 5B38B 2NY2B 1R33A 3SY0A 3UXFA 2RJMA 4YDVA 5F3HA 2G2PA 4YNYA 2DBLH 1CL7I 4XMWA 4ZMXA 1DN2A 3H2WA 1HE8A 4L3EA 4Z7VB 4DUXA 3MGOB 1BIIA 2VDPB 5AB1A 1TO4A 3F5WA 3SPIA 1CXIA 4HZAA 3QDHA 3SGDI 2WYTA 3FSZA 3SYPA 1BIHA 5J13B 2XQBL 4HJGA 1S9XB 2AMGA 2F61A 3V79C 2PW2B 3C2AH 3S35L 1U8NA 3HS9A 1HJCA 4LVOC 3ZT7A 2HYMA 1FJ1B 4NJAL 4DN4L 4IRJA 3VXRB 4UDUA 1ZWIA 3AC0A 2D3VA 2V9RA 1NPJA 4ZW8A 1HTYA 3KPRD 4YZFF 3VTMA 4AV4A 3WFBL 3BZ4B 4MXQC 5CMAB 2B77A 5HYJD 1SLXA 1E3FA 4KRPB 2IPUG 4NDMA 4LCIH 1UWGH 2WXOA 4LCUB 5EPMB 2RQ8A 3QXVA 3G6JE 2FYYA 3NVQA 1J1OL 3G6DL 3SDAD 4HUVA 2F19H 4JFOB 2HTLC 3IN0A 3W0WA 2BVQB 4ODWA 2XWRA 4NKIH 5JW4N 1E6OL 4HEME 2DN7A 2VITB 2VW6A 4KX8A 1MFEL 4XNYH 3IBOA 1BZ7A 5I0DA 4U33A 4X5PA 3UG3A 1RY7B 4DP4X 3UJTL 2W65B 2EKSA 3NIDB 2YRBA 4TULH 5EUKA 5KVFE 3VXMB 3H42L 3B2MA 4G43A 2YD9A 3M1CA 5I66A 3LEVL 3QG7H 3RUGA 2BNQB 5DHEA 4G8FA 2WKLA 4O2EB 5CCGE 2CDFA 1UZ8B 1T20A 4ORZC 5IIEA 3SDAC 5E4IA 2B2XL 4PWHA 3ZE2E 1I7TB 4XXCA 4AG4L 2J1KA 1VFBA 4EZLA 1FGVH 2ADIB 4XO8A 4BRVA 4ZTOL 3T04D 3SE4A 4NQDB 4JDVA 4N0YL 1KEMH 5ID1B 2R23A 1CF8H 1ONQA 1TVHB 3ARUA 5I1AB 2FIKA 3GFUA 3KPMB 5F1IB 5H35A 4EDXA 4I3RL 4NXSA 3V4UH 2YKLL 3WIHL 2VISB 1ZJBA 1GPOL 2NR6D 2C1PA 1OCZB 3SN6N 3QPQC 4Z7UE 4KRMB 4D7PA 1UCBH 4AQAA 2PTTB 1YNTB 2X28A 3GMOB 5AVUB 3EOTH 2PR4H 3TV3L 3TIEA 1GC1C 3ZE0E 4KKBD 2DM7A 5ECGA 3KGSA 1J48A 1HZHH 4N0UE 4KROD 2VLJA 4AW4A 2DLHA 3IGKA 3MXWL 2HFFB 4R3SA 3B2VL 2XG5B 3O11B 4M1GL 4MBRA 1M1XA 5E94B 1P7QB 1WPCA 4JFTA 4Y2DA 1JCKA 2VLRD 3L3IA 3UTSE 2G60L 2X0WA 2OX5A 3L6FB 2FL5A 2X4PB 1J88A 5DWUH 5SWZE 3OB8A 4XH2B 3T4AC 1WT5A 4OFKA 4ZDHA 3Q48A 4HFWB 2HCZX 1YPZF 4WHDA 1A7NH 2Y2YA 2DIEA 1A21A 3UZEA 5KANG 3I50L 3TH2T 4ZFZB 4PJIB 2ITCA 2Y6SC 1SDYA 3L13A 1N10A 4KKBC 5HYEA 1E9OB 4YC2B 3CD4A 3CHRA 2JNZA 2XZQH 4KROC 2CNZA 3QNZA 5C0AD 1B0RA 3QFDA 3VWKA 4IIQA 2DV6A 4TNWK 4K9EH 1PBYA 1FN4A 5AQ0A 3NESA 1CDGA 1FZJB 1ZHKB 2COQA 3EGDB 4N2KA 3TYFB 4ABQA 4PRDB 1FIEA 4JEGB 1INQA 1R5WB 1RFDL 1ZV5A 3N41F 1GXEA 5DT1H 2DLGA 1RK1B 2J1YA 4PR5B 3M88A 5ENWB 4X6FA 2R4RL 1JYVA 5IFJA 3RIAK 3GSXB 2O5XL 2WBXA 2DEXX 2YBRA 4R5VA 4FLHA 2WVVA 3BWAA 4Y1TA 3P3RA 2YS4A 4L3CB 2CPCA 1WFOA 1BDYA 3J27A 3QIWA 1XR9B 2PPEA 4YL9A 2IANE 3FU0A 2FBJL 3LX9A 3FT3A 2HMID 3BE1L 3HC0B 4LSVL 5FLUA 1N5YH 4FQQB 4NKDB 2ED6A 1C5DB 3LS4L 4K73A 4XVUC 5AVWB 3V52H 3OWRA 3HNTL 1S7TA 4F7MA 2H2SD 4XBGA 2HUHA 2VXSL 1XCTB 4N25A 1XMEB 3UBXG 2R7EB 5GIRA 2DM2A 1LO4L 3BCDA 3LH8A 1RVFH 1AQMA 1TJGH 5TTRA 4UILL 3HB3D 5JOPE 4TQ8A 1F41A 2LLNA 3Q1SL 5IB2A 4MCMA 3J2PA 5CCJA 1OP3K 1QVOB 2Z91B 2HMIC 2O5YL 2E7BA 1MHPH 1T22B 1DVQA 3C6LA 4FJ6A 5FGBC 3IMTA 2NNXA 4G11A 4JPQA 3VXQB 1U58A 4OW6A 1F11B 2WZ0A 1UKQA 2OMWB 4RGOL 5FYLE 1U6AL 2Y7OA 3MRDB 4EN3B 1TCMA 4K8RH 1HNGA 2UY7A 1PKOA 1RJYA 2XT1B 1AH1A 4GQ9L 1DDHB 2HWZH 4J4PA 4N9GA 2B1HL 3JWNE 5DQDH 5F6HJ 1KOAA 2YSTA 1QRKA 2ZXDA 3H4FA 2IQAA 3WHE0 6FABL 3KPPA 4I4WB 5DD0H 5KSAA 3QEHA 1MLCB 5DD5H 1IGFL 1MUJA 2NNAB 2WUCL 3QP3A 3QZLA 2DQDH 2NY4C 1B3JA 4XPTH 4YWGL 4LU5H 4YO0B 5GRUL 4BDVB 2VOTA 5DEFB 5B3JE 4YSDA 43CAA 3KGUA 1A9EA 3TO4A 5BMFH 4RZKA 3FQNA 1MFDL 3U0WL 5GJTL 3N85H 4P8QA 5FEBA 2I60H 4K5MA 4XP4L 3EGSA 2P24B 2EH8H 2VGLM 3KNBB 4JFFA 2WO4A 3CUPB 3EGXA 3P4NA 2XXMB 3MRLA 1M7IB 1DVFA 4AZ8A 2RBLA 5EU6D 3BAXA 3WENA 5C0GB 1CDBA 4LIQH 4MJ5A 3V55A 3V4LA 2BFGA 3IRPX 4WI0B 1MI5B 3FPXA 1BJ8A 1J8HD 1J87A 2OW6A 4KJYA 5CJ8A 3FONA 2XTJD 4MD4B 4LSQH 4P3DB 3QDAA 2CXKA 3FUIA 4NGHL 3P0YL 2AV7A 3DRQB 5L9DH 4P2OD 1MCDA 4A38A 1JWMB 3WI9A 3P9WB 2IDCA 2PXYD 4C4UA 3KE0A 4UV7H 2VQ4A 4KKNA 2OR9H 3CVIH 4XO3A 1MRFH 5KVGE 2CM6A 4HFUL 2PPFA 3WIAA 5INDB 4PBXA 2ICEB 1BZ9B 5JTWA 2ICWA 2F7PA 3O6MH 2VDLL 4LEBA 3U46B 4PJDF 3U4BH 3KS0J 1G1YA 4ZTPH 4R4FH 2CO7A 1P6AB 2M2DA 1A9VA 2C8NA 3WN5A 5D5MA 4QHMA 4Q9RH 3PDOB 1ERNA 4PGBB 5CJ5A 2E0PA 2YUVA 3CBRA 3VI4E 3AAZA 1WGOA 2VL5B 3MRHB 3QORD 3BVXA 4NN6C 3D3VB 2QSQA 1BZQK 4ODXA 2X6BA 3AG2B 4YDLC 4QRTB 1KIRA 5HDBB 1VRSA 5FKAB 3U1QA 5H94A 3V6OC 2OM5A 3CN1A 3HE6C 1IKNA 2JCCB 3P2TA 1XIWC 5KSUB 3FTGA 2CQVA 3ZKSD 4UQ9A 2IIJA 3OKDB 3MI6A 4EF3A 3KG5A 4ZMOA 1EXGA 5L2KA 3PV7A 3K4AA 4FA6A 3AUWB 1P7KA 1MJJB 1DTUA 1FNAA 4JO2H 4QHNA 5I1CL 3ULUL 3D2UA 1U3JA 1CFBA 3DUHA 3SBRA 1XO8A 3P4MA 3KHQA 3L1FA 1WRFA 2FEJA 4Q6IB 3MGTA 3QORC 1GHFL 3BH9A 4HIJA 5CBAA 3QEUB 2QQKH 3QJXA 5JXEA 3F7LA 2FQFA 5J06A 1PG7H 3E6FA 4XPFL 3T77B 3D48R 5C0AB 4PJAE 4Y5XB 4ADIA 1Q90A 2ATAA 3UO8B 1MW3A 2F18A 3O9WA 1EBAA 3DGGA 1QWHA 1XL6A 3WE6A 4NO2A 3U30B 1UB5B 3UBGA 2VM4A 4X4ME 2Y1AA 1T4KA 5I19H 2FJHA 3DV4B 1O75A 4MRCA 1R3LB 4BZ2H 3S3JA 3MLZL 4BZ2A 4M6NL 1TZHA 4MQ7B 3QUZB 3GC3A 3S4SA 3UZQB 3FB5A 1EZUA 1MRDL 1IBHA 1QWUA 1DANU 3HFML 2P3YA 3VVWA 1CFTA 4XWOD 4B27A 4L4VD 5DQJA 5EF0A 4PGJA 4OF7A 3KR3L 4Q9CA 2CG9X 2OXHB 3N2JA 3WUWA 2Z31A 4E9LA 1BXUA 3ZRSA 4JAMB 4NAMA 4AENA 3D7PA 5LNGA 3FAWA 2XWZA 2DICA 5EWIH 5I0XA 4J2QA 1ZANL 1KCVL 3RWCB 5E6ZA 5FAAA 4ABUA 2Y7MA 1X7SA 3BGFB 3LKOB 1OIOA 1P5UC 2OZ4H 2FGWL 3HB3B 4ERSH 2DM4A 2OZ4A 2MSPA 4MZ2A 1S7UA 3DX0A 4X6DF 4A2DA 3L45A 1AGEB 1KLFA 4LARL 3FQRA 4ETYA 4XWOC 4LLYA 2HFEB 3UTTA 3ET9F 3MV8A 4IOSA 4FQHA 4PG9B 3VFPA 4LDEB 2DWDB 3HRZA 1MG3C 2YC1A 4ZSOB 5EF2A 3DUUA 4D9LL 4PJGE 3FT0A 3KLHC 3NZUA 4ODTL 2FJFB 2E9JA 3B2XA 4HULB 1FFRA 4G6JL 5AAPA 3IDJB 1WC7B 4PS4H 2NQCA 3DDFA 2X4OB 2N7SA 5C0IB 5T3ZE 2YUZA 1GR7A 4ZOCA 1J0HA 3ETBF 2WXIA 4N8UA 1KXTA 4MSWA 1AXSA 3AZUA 5AG8A 3G7TA 5JQ6L 5LJYH 4NC0B 4G80B 1IFRA 1MCRA 3LZLA 1E5AA 3DBSA 3KPSE 2P5EB 4LQ1A 1NMAH 3MV7D 5D7HA 3QJUB 1N18A 3BVNA 3IKCB 1K5NB 4H20H 2AZUA 5IUCA 4I89A 2VSMB 4QT5A 3JV4B 4N8VA 4TSBL 1ZLWK 2L7EA 3HR5B 5CFHA 4NHUB 1XGQA 1TVBA 3L9YA 4XOBA 5CU9A 4X7EC 5DMIH 2BHFA 4F80A 3GIVB 3O3UN 2DY2A 3KPLA 3BAIA 4O5LH 2J5WA 1GY1A 1J8HB 5JPNA 3WIIL 2XTJB 2WLIA 3HMWL 3MLUH 1HL4A 4UT6H 1OLZA 1NCIA 4UT6A 2MCPL 3MLSH 2K1MA 1L9MA 5E8EB 3PYCA 5KYWB 4P2OB 3W9DB 2BSTB 1R5IA 2PXYB 4JFXA 4LSUL 3BQUD 4E36A 1KPUB 4QD2E 3QPXH 4J3OD 4IHOB 3MJ8B 2QFPA 1D2OA 4Y1AA 5DFVD 3BIKA 1BHGA 3MJ9L 1RZIB 1TEFA 3VSUA 3GK8H 3H56A 3ZE1B 2E27L 4HXAH 1U8CA 2CDEB 3AFLA 3LZPA 4Z7WF 3MRBA 4IKJA 5JMRA 4K3DH 1O9ZA 4YX2H 4WHCA 3CCHA 3DWTA 3GMPB 4OD2B 4EMZA 3N44B 4OGZA 1E7UA 5BOZG 2ZWLT 4MBOA 4Z5RA 1QTPA 2J8OA 4HV8B 1OZUA 3C60B 3RTQD 5IJCC 2ESVB 4U1HA 2C3GA 1NZRA 1YNLH 1RK0B 4ZFOB 2LLGA 1T7ZA 2CBMA 1KXVC 4U1NA 1W91A 4L8SA 1OGTB 5LXGH 1NDGB 5EIIG 1SPDA 5HI4D 4FF9A 4PJHB 1DBJH 1JZEA 3GS7A 3LQMA 1ZTXH 4UQAA 1EFXD 2X4SB 3DETD 1N6UA 1W15A 4X4XA 4I48A 5I71C 3HI1A 3QH3B 4HJJL 2D3NA 2K7QA 4F91B 4A2EA 4I8DA 1T3FB 4KZEL 2I07A 2XBZA 1QFWL 3N1PC 2V7NB 1TXKA 3OL2A 4Z77B 5I16B 5ADOL 2BSED 3DJRA 5SV4A 1TKWA 2JCWA 2P8LB 5I74C 1R6VA 3VG0L 2K78A 1S7XA 3ZDXE 2WWKT 2WW8A 2GBAA 1LP9A 1JXJA 2AK4D 1TYRA 1XSJA 3KJ4B 4WO4A 3DX3A 4XNXL 3VH8B 5L88H 2AQQA 5D1QB 2KZBA 4AJ0A 3EYUL 2R9HC 1F1GA 3VGGA 4CW1A 1VPOH 2X9XA 2Y1VA 4PJEE 3AXIA 4WJ5B 3LEXB 1DVXA 3V0WL 1JZDC 4G6ML 2BP8A 5FV2A 5K39A 4K7PX 3CN0A 1DEEB 4P06A 4YZWA 3LKQA 5DC0A 2XC8A 5EO1B 4DUWA 1AANA 4L4VB 4HIIA 5E95B 4J8RA 5I6MA 2J55A 1GKOA 5I18L 3LZNA 3SPVA 3EO1A 1GTNA 4FA7B 2FATH 3AU1A 3B2PA 4PTUA 2B4CL 3X11A 4H44C 5GS0H 4YE4L 2FO4A 1BVZA 2K9UA 2DEYX 4JZJA 3WGUB 3MZTA 3HC4H 1P1VA 1R3JB 4FG2A 4JKKA 3IDYC 1CLZH 5IQ9A 3WLBA 4HISA 4DAGH 4N2IA 1H8SA 2P5PA 3EJPA 5E9DE 2VJXA 3FB8A 2O5ZL 4ZMQA 3SKMA 3EYFA 5EORH 2WCSA 4OKVB 2ZUSA 4N0CD 1T2QL 2X1QA 5GGVY 1S78D 1KT2A 2JLPA 1AIFB 2EDEA 3SQOH 4RNRB 4RAVA 4IJTA 4YZFE 5IHBA 2A6IB 5E1IA 4DPCX 2R27A 1HXYA 4KFMA 4DGVH 4ZODA 2D3LA 3QJTB 1QO3B 3CZNA 2JELH 1TSRA 1RZ7H 3D51A 3QDME 2XX1A 1Y1DA 3CDFA 3MRCA 3I02B 2XKNA 4G1MA 3RX5A 3O8XA 3T3MF 3IDGB 1U92A 4OF6A 4Z76B 3ES6A 3OZ9L 4JFHD 2IPKB 4PFEA 1QSEE 2QMKA 3BWZA 2GPZA 3LN4B 3G9AB 4N0CC 1MPAL 4XBPB 1S78C 2ADJB 4BKSC 1S8DA 3BSZH 4XO5A 3UZVA 2WLNA 3BSZA 3KEDA 2PCXA 3FQXA 2G0KA 3ECWA 2VXVH 4NP9A 1MCFA 5TF1H 1RL1A 2WZPA 5IM7B 4NKOB 2BZCA 2LW3A 4FOMA 4DGUA 4R7NB 5ICYB 3PNWB 1IT9L 5D2LB 1SJEB 3GKWL 5LBSH 4OZ4B 1CT8B 5D1ZI 5C09B 5LBSA 2BJML 4YK4C 3HN5A 4HEMA 2X88A 1QW8A 3TNNA 3IJYB 5DRZB 1DQMH 2ZXWB 4E41A 4TUJA 4TN9A 5IW1A 4W9ZA 3F7YA 2H2PD 4OLXH 5KVFH 3BD5A 3BQUB 3PGCB 3LKSA 3DVGA 4QRPE 1T1XA 5CJOH 5C6PB 1SOSA 4UINH 4FMVA 4JM2A 4ISVB 1AGCA 4S1RL 5C9JB 3GI9H 3TH4T 5F7UA 4I77H 2V9TA 1FV1A 1UFGA 2R83A 2G2RA 5HDOA 1ZEAH 5ABZA 5GRVK 1A3QA 2YRLA 1MWAB 4WIQA 4QNPF 4P59L 3JZ7A 3BZDA 4LEOA 2WXNA 4F57L 4MX7A 5TE4H 1HH9B 4WNQB 1UD6A 2CK0H 3CTTA 3QQ4A 4TOYH 1N4XL 2XA8H 3FT4A 3QIBB 2WYHA 3AROA 3I75A 5EC1B 3Q0HA 2XXGA 3C87A 1IGCH 2G5BB 3RTQB 5LUMA 1RMFL 3L3JB 4F15B 3SDXB 3UYPB 4MJIB 5IHLB 1FG2B 4MJ6B 5DGQA 1OGAB 3MROA 1XX9C 1KCSL 1M6OA 1LJMA 1HEHC 2FT8A 3SCMD 4PHXA 1JWSA 4HUWA 4HBCH 2J56A 4MMYA 1KBWA 3MRRA 1PTZA 4GAGL 2OSYA 4AV0A 5J6GB 4U3CA 5EOCJ 3SY6A 5IREA 5AW3B 4BCYA 1B3IA 4N0UA 4NQDE 4JFDD 4JPKL 4C57C 1MREH 3T6ZA 4TSAL 4BA8A 5DYOA 2XU9A 3SO5A 1SYSB 5GGUA 3VW3H 3D0VA 5E5MB 5TFSH 3UTSA 1FPTL 2MMXA 2OS7A 3D52A 4HS6A 4N85A 1ACCA 1SXCA 3PHQB 4DEWA 2WC7A 2X42A 2OSXA 4AMXA 5LDUA 5DJ2B 3UBFA 3BEWA 2HX8A 4Z7QB 3MFFA 4PRHE 1OANA 5I0VA 3X17A 4PJ6A 3N06B 3F8UB 2ED8A 3G5VA 2VLKB 5ECJE 1VFAB 1IGJA 4LEXL 2ZKXA 4Y16B 5B8CA 4XXDA 2BY3A 4JY6A 1J9QA 2ZIDA 2VJ8A 3ZUCA 4BQ9A 1PF3A 1NFKA 5DLMH 3OHXA 5D96C 5I1HL 3UYRL 4O2CB 4WFEE 3EZJB 3MV9B 3MRQB 1ZLVH 3ARTA 3CZKA 5D7JD 2QVFB 2R0WH 3ZL2A 1I8KA 4FLSA 5EBMB 3MXVH 1RULL 2JB5L 3UOAB 1F4YL 1IJNA 5CINH 1C5CL 4QAWA 1VADB 2HN7B 3MFGB 3OAYK 3ARDD 1R3IL 1C08A 1LDSA 2HA1A 4JN1L 4CVXA 4HBQA 2ZX9A 4HIHA 2SEBA 3HRPA 2WQVA 4DK6A 5C08D 5JHDA 1SBSH 4KQ4L 3LH2H 4KX7A 3VI3E 2C7UB 3U6XS 3U1SL 3D33A 4F37F 1IKFL 1VERA 1WK0A 2HP4A 2BOLA 3D07A 5M95B 3HS0B 1G9NL 4MA1C 5FM5M 5FM8A 4PJFB 1CYWA 3PCYA 5D7JC 2YAOA 1AGDB 5EBLB 1DSYA 3OZLA 4E9XA 3B9VA 1ITCA 3AGWA 3C08L 1ID5I 4NKQB 3SJVD 15C8L 3Q9PA 2AVFA 5H37G 1T6BX 1I8UA 2D7TH 2XKSA 2B14A 2QDWA 1A7OH 3PFUA 4LLWB 4YUEH 1KBKA 2DLTA 3O6FB 1DVYA 4AM0A 4HOZA 2BY0A 3UDWA 3OR7B 4WW2A 2EICA 2FUQA 3MZGB 4OKDA 1KV7A 3ARBB 1SDDB 1RZKC 3F00A 1DJYA 4GRWB 3BH8B 2BERA 4QXWA 4G8EA 4HUXA 1A6AB 4IK6A 5J4MA 5ELIA 2Z4TA 3U82B 3MCYA 3QI9B 4EBQL 5GGTL 1OD7A 1JHKL 5AOIA 4MAZA 3S37X 3VTTA 1B9ZA 4NOFA 4WEMB 5DEGA 5LVEA 1HDMB 1X5XA 1DVUA 3VFNB 5D2NB 2XPYA 4L3AA 1JN6B 1OAZH 5AVYB 5IQ7L 3FN0H 1BQHB 1K72A 3QQNA 5DSCA 4U1GB 4HQQH 3RY5A 1PZBA 2XWCA 3GSWA 2AQTA 2CJUH 4TLUA 4F5CE 3RDTB 1T83C 4NENB 1UXMA 1DJXA 1YECH 1K3ZA 4B3EA 3IAPA 4N5ED 3ZYIA 4M62H 4NNYA 1KPVA 4GW1B 4QO1B 4GUQA 4HMCA 4UOW0 1PKQA 5E08H 1E43A 4W9LC 1JV5B 2A73A 4N86A 4YHMH 1N6QL 1BOGB 1RZJL 1P84K 4PW9A 3STLB 1EVTC 2L7JA 1G94A 2A6DB 1F8TL 4LSRL 4K15A 3CK0L 3G5YB 2BHZA 3IJHB 3KLLA 1MFBH 3GF8A 3DHUA 1D9KD 1HH6B 3KPRE 3LB6D 3CC5A 3O81A 1NIAA 5JIDA 1U8MB 3FMGL 5HYJE 1U33A 4HJIA 4YHYC 1DL7H 1BW8A 3LEYH 1YEJH 3BYYA 1NAML 4GMTL 3LIUA 3F05A 5F88B 6PCYA 1MAML 3PABB 1S46A 1IFGA 5FB8A 5FHAL 5DJDB 1HCFX 2EYSB 3GYRA 5DK2B 2AXWA 4ZAKA 1GZQA 3TEZA 3EYQD 1CG9B 5AW5B 5E1AA 3HE7D 1OT4A 2JJVA 1T7VA 5KTEL 5JHAA 1FRGL 4FG4A 4IRZL 4TUOB 3TPUB 2H8PA 4IGBC 4QOKD 2DKUA 5EFIA 3HKZA 4WJKB 2HLAB 3LB6C 4M3KB 3PJSB 5DUMH 1JPSL 2HJFB 3II2A 4KH9A 4XC3H 2H9GB 3CDGB 4N1EA 2HRLA 4JN2B 1AXIB 4TXVB 3WLWD 4JFWA 3FFOA 4AQEA 4PIRF 5E2WH 2DBLL 5I30H 2B1AH 3BEVA 5B39G 1FDLH 3RX9A 3SCMB 3OMAB 5HPMA 4XCFL 2H3XC 5L8KB 2XCMC 4LP5A 1OKEA 5TH2B 4M6AA 3EYQC 4FFZH 3HE7C 4S1QH 4KHXL 4JFDB 3ZTCC 5I8CB 1QQDB 4FFZA 4M9OA 5F6IB 1JF6A 2Y1ZA 3K2KA 1INDL 3PGFH 4L2LA 4W4OA 3ZTJH 12E8H 3UP6A 3WKNA 1IZJA 3NJIA 3BPLB 4HHGA 4I2XE 4WSJA 3WLWC 5A40E 1UKTA 4CKVX 2ALWA 4DPRA 4OT1L 4NZJA 3R1GL 4LCIL 5IV2A 3KCWA 3N6YA 2P5WD 3QJFB 1LNUB 1QFUL 5F70A 1QASA 3GXMA 1LYQA 3TEYA 3VFMB 4CVWA 5BJTB 5ID0B 4OCXL 1FZOB 2J4WL 2KLRA 4MDJB 2HT2D 1QZ1A 4PRNB 4FHJA 4NKIL 2A0LD 4L0ZA 2OL3L 1CWVA 2DS4A 2FHBA 4PJAA 2WWKO 2VLRE 5IB1B 1MH5B 3HG1A 1YDPA 3B9KA 1AP2A 4K9JA 1E5BA 1BM3H 1YEDA 2VO5A 4X4MA 1IIKA 4X6DE 3C6SB 2BHUA 3ARDB 3PAVA 4I9XA 1XMWA 3C8KB 2YQGA 1VIWA 1KLUA 2QL1A 4QIRA 3PV6B 2OMTB 3KYOA 3RYMA 3CWGA 5C08B 5AAWC 4NQEB 5B7FA 3OC8A 3HN3A 2A99A 1IAKB 3PAYA 4I18A 2ZOKA 4YGVA 2VDNH 3K5SA 3OAZH 2R2BA 4QGTA 5C0AE 1T0MB 2HT2C 3EADA 4PWIA 1BGXH 2JH2A 5JW5A 2IH8A 5F7YC 2F7RA 2IWEA 2ZT9C 3CVHL 5D7IF 3IF1B 2AEPH 4UOZA 3D18A 2ZUQB 3VD5A 4Z3FA 4YOKA 3VGDA 1E5UI 1UT9A 4GJTB 1MLBB 4EI5B 4EUPG 3WJMB 4FLQA 3WHE1 1VCAA 5DO8A 2AFNA 3MJ7B 5CZXD 5B7EA 5KS9E 3TGXA 5CD3A 5GZOC 4OGYH 2IOMA 5BUGA 2FLRT 1M05A 4GG6B 1ICTA 1KN2L 5ESVB 3CFNA 1KBGH 1WE5A 5TQ0H 5KYXA 2JIXD 4G1EA 4PJGA 4B9YA 2IV8A 1E4XI 5IMKB 1SVCP 4NZTL 4JL1A 1H5BC 1X3DA 4PP1D 1Q72L 4E42B 3F7VA 3N3EA 3FSWA 4A7TA 5JO5B 2BWIA 4XOAA 3AG4B 4Z3IA 4JPIA 4Q4EA 1E4WH 2WLLA 5E99H 4JCWA 3QQ9C 1PYWA 1OTUD 4QTFA 4XCEA 1YMMB 4AQ1B 4CRPA 1EHNA 3AXLA 4H7VA 4KZDH 4ONGH 5H4YA 2I69A 2BC4A 3GIZL 4NO0D 1LXMA 4O02B 1KEGH 1B9KA 1KY7A 3IFOB 4PP2A 5GGRY 1SY6H 3HCVA 1Z7JA 3KPSA 4U0RC 1SY6A 3BXNA 3TJEH 2CXGA 5EO0B 3RWDB 4BH7B 2QVKA 2BIOA 3MLVL 1OSEA 3KHOA 3QXAA 4TUKL 3ULVL 1JNLH 2GY7B 3CHQA 1HKLL 2YOAA 3QFJE 4PP1C 4U6XB 3V5DA 2JMRA 4A6YL 4OQTA 4CSZA 1NTDA 4WLCA 3CPLB 1VA9A 3OAUH 4JFZL 3S0PA 1D9KB 1YC8A 1K3IA 1RAMA 1OTUC 4PJ9A 4YQXH 5ESAB 1Z0MA 2F54D 3U0TB 4WDIB 2L7QA 1NINA 3MV11 4YSQA 3TA3D 5JPMB 4KKCD 3CFBB 4Q56A 4EOWL 1N5YL 5CSBA 2MHAB 1CBVH 4MCYA 2OQJB 3V52L 4RFEB 4ZX5A 4JQIH 3TT1H 4AIEA 1LK2A 4JQIA 2K70A 2OJEB 1XCQA 2VDOH 2ZONA 2GTZA 2IEPA 5EU6E 3GJEA 4BFKA 4BZ1H 1LEKA 3KCPB 2X7LB 2VAJA 4BZ1A 4QOKB 1TZGL 4M7LH 2WYZA 5HHQB 2ZD0A 3WHXA 5EEWA 2KKQA 1TJGL 1A7PL 1WZ1H 4NNPH 2QADD 2ZOLB 1P7HL 3DX7A 3RHWF 4LPXA 2HRGA 1QACA 3V0IA 1AJ7H 3MA7A 4LLUB 1CFNB 1UQSA 2VAAB 3MNMA 4KKCC 3TA3C 5J57B 1IQDA 1P84J 3NJFA 3UTOA 5C07B 3QZOA 2NTSP 1XBDA 1DQKA 4LPYA 5KANI 1MHEB 4B50A 1B4RA 1F42A 2VDRB 5L4MA 3AS3A 1EJ6A 4P2RA 3V6OE 5LN4A 3RVVD 2APSA 1NBZA 1UVQA 3I9GL 1UM4L 2Q8AL 3GSVA 5DHYB 2X6CA 4IDLA 2E7MA 2HWZL 3O3EA 4NO5A 5DQDL 1MIML 1EH9A 2AJSH 5CD5D 4RMVA 2KT6A 2DQDL 3EFOB 5FW7A 2E6PA 4O2FB 5EBWB 5HHOD 1LDPL 2BNUB 2AXHA 2GC7C 1T04A 3UTQB 1N0XH 4HEPA 1I9RH 4KTDH 5GS1B 3ALWA 4Q14A 2NYYD 3N85L 3CSFA 4X7TA 1BP3B 4G82A 1EHLH 4WWOA 3OPZH 3FBQA 2W92A 2ZYSA 4OTXH 1OK0A 2NRDA 2YMXH 3W11C 2XV6B 1DUZB 2AEQH 4N6RA 1KB5B 1QLEH 4LIQL 3QSKB 1EJOH 1S5IL 4OF8A 2MCMA 1BJ1H 3V0DA 1TNMA 3DYPA 4U0QB 1ZT7A 3UBXI 2DL2A 2IH3B 2HKFL 4PVLA 3OMNB 1PFCA 1S7WA 4PJEA 5BZWB 4PJBB 1NC2B 2WPGA 3EG9B 3ZHNA 1T5WA 2ZF9A 3KS0H 3LZFL 3QCVH 1V7MH 2VRQA 3VWJA 1P4BL 5JIIA 1DDTA 4M1DL 5HDWA 2FEEL 3FFCD 4NZ8A 4GW4B 1WUZA 5D8JH 3C09B 4H1LH 4GKZB 2UV3A 4FQJH 3HZKB 4H1LA 3BDBA 4XVSH 4ZX3A 2P42B 2H0FA 3QNFA 4R4FL 3PGDA 3T3ME 5DHXB 1EAPA 3V0FA 2RR3A 4ZUVA 2VH5L 4URKA 3OKNB 1ZSDB 4PWFA 2GIMA 4M7ZC 4XN7A 5G4MA 4M7JL 4P9HC 1XB3A 4L4VE 2IAMB 4AH2B 4XP6H 4F9LA 2ZCHL 4EDWL 4U6YB 3APDA 4OJAA 4CN6A 1WAAF 4LK4A 2E7LC 2Q7YA 3ROOB 2ZWSA 3GSNL 3V7AE 1KULA 4UQ2A 1ODAA 3K7UA 3LQZA 1S9WB 1XB8A 4JMXA 2Y25A 4OF0A 2H47C 2CJ3A 2IF7A 4X9GA 1IAII 5T8IA 4HWEH 3Q8AA 3R7RA 1NJ9A 4LCWE 5CKAA 1IZKA 2BSSA 4HUKB 5ANME 2VN4A 4HHAB 5D1ZD 1WLHA 4WVRA 5FYKL 2JKWA 3NCCB 2AJVL 1NDMA 2IH1A 4G7VH 4DZBA 5HVHC 1L5GB 5IOKA 5C0RH 5IOPA 3ASWA 4UI2A 3TESA 3SDCC 1XD1A 4P23B 3L4VA 1PG7L 4M93B 4NN5B 5TE7H 5IMLB 3DNKA 3QRFM 5DRXA 4NUPA 5I15L 2LHAA 3RDJA 1H0DA 4C83A 5B38A 2ATPA 2MRYA 4G8GD 5FS5A 3SYCA 4AIZA 1F02I 2KLTA 1YPZB 1MEXL 3SIKA 4FKHA 1P4IL 3DO3A 4MLIA 2EEBA 4W4NA 3UEZA 3GNMH 3SOBH 2P1YA 3CZEA 5E4AA 3LSOA 1RURH 4AQ8C 4LPWA 3OR6B 5KAQG 2V17H 3L3OA 1ZDQA 2XN9D 1S9XA 4HUUA 2WUBH 4ODHL 1AR2A 2PW2A 2F54B 3KDMB 4EZMA 1EO7A 4FQCH 2AQ3A 3DX9B 3GBMH 2UZYB 3KDPB 4QF1B 4W9CC 3U7WL 3VXRA 3MV7E 3E2HB 2FD6H 5IBUG 4YPGB 3P54A 4KKQA 2GBTA 3DPBB 1T7XA 2X09A 2XKUA 3KLDA 1E4KA 1N70A 3BZ4A 5CMAA 4QRPA 3TTYA 2DQEL 3ZR5A 3CSBA 3GXDA 4L1TA 1A3ZA 4M4RA 5DUBB 5LGYA 2YFOA 5EWIL 2WYIA 1P53A 4R7LA 2EYTB 5EPMA 4XHJC 1JF1B 2KZ1B 1M7UA 2Y7NA 4P5MB 4JFOA 5SWSB 3LZQA 6CGTA 2BVQA 5CIPB 5A2AA 4BQCA 1FUNA 2VCOA 2VITA 3QEGL 4DOHE 4FI8A 4GO9A 1CYGA 1S5HA 5EU7C 1T89A 4TVSa 1TLKA 2XYBA 4GRMA 2R2CA 4XMUA 2W65A 3L9RB 3B7SA 4HVBA 3RU8H 4TMPA 3VXMA 3LN5A 1ZHBB 4MTMA 2BIMA 4QXGH 3BVVA 2NY1D 1WQVT 4UOJA 2BNQA 3BT2L 1AR1B 5EC2A 1QHOA 1G1KA 1I1AD 1KGIA 4O2EA 3WDJA 2P80A 3ZDYF 1I9JL 3RZCD 4Q7DA 3LNHA 1ZMYA 2QQNH 3ZTNH 1QD0A 3RL1B 1I7TA 3FTVA 2BVPA 1LLAA 4F8QA 1MW2A 3DMMD 1UXWB 2J7LA 3BAKA 4XZ4A 5MEOB 4NQDA 1CD9B 4DKEL 4XE0A 5ID1A 5IROD 2FX7L 2GC4C 2G4EA 1BQKA 3HBZA 3KPMA 5F1IA 3TYGH 1ZV2A 2AZAA 4N2MA 1NMAL 4OD3L 5IT2L 3SDXE 3V4PL 1KGUA 2VISA 4H20L 4WU7A 3HA0A 3WFEH 4CU7A 1VESA 4PJ7F 1S9KC 1K8DA 3REWA 1I1AC 4D3CH 2XHNA 2WXQA 2WV3A 4OFYD 3QIUA 4UZGA 4PRHA 3RZCC 5BV7C 3GMOA 2X4NB 2YSSB 4AYSA 1CDIA 5CWSB 4CMHC 3TF4A 3LRKA 5LWYL 1TETH 4S2SA 3LKNB 4RQQA 3DDGA 3H2QA 3KD4A 5IMOB 5FGCE 2DQCL 2WGNB 3CX5J 4MNQB 4L4TD 2HFFA 1DBAH 3B3IB 25C8H 2XG5A 3CN4A 3FCSA 3O11A 4NLAA 5E94A 1S9YB 4NLHA 5IROC 4G7YL 3WFDH 2NT0A 3T0EB 1OAUH 3GRGA 3L6FA 5FO9B 2Q76B 2X4PA 5L8JB 4BV1A 3ELQA 4NB7A 1EWHA 5E8DH 4OIBA 1MCBA 4OLZH 2Y7QA 4XH2A 4HU8A 4CNIA 2AK4E 4A66A 2DQIH 2PWDA 3SGKC 1FGNH 4S11A 5LGKA 2IMMA 4P9MH 1KN4L 4RWYH 3M45A 5IR1B 4WNSA 2OAAA 2V37A 1YO4A 4PJIA 4L8DB 1S3KL 1E5CA 1E9OA 3FTWA 4HXAL 3VI3A 4URTB 4ABVA 2GK2A 3NSYA 4YAQB 4YBLC 4Y4HC 1RIHH 2LE9A 4OM0H 4WCYH 4DERA 2EXYD 2EH7H 1SNRA 3TYFA 1I8LA 4PRDA 1R5WA 1F1DA 2VMFA 2YWYA 3KXFE 4OIFA 1QATA 4KPHH 1RK1A 4L5FE 1WICA 1SUJA 1HXMB 3PJNA 1YUKB 2PCFB 1BWWA 3IMUA 3NCEB 1AQ8A 5LAXB 4L3CA 5BS0B 4UMGA 1YN7A 5LXGL 5FCUH 2I9TB 2Z6FA 5BRQA 3HC0A 5CZVH 1DBJL 4FQQA 1G9HA 3QWNA 3DURA 3L9BA 3FQWA 4N26A 5EG6C 1IEBB 5D1ZB 3GTNA 3MRNB 3S36X 4N2GA 1INEH 2XZZA 2LVEA 2R7EA 3BPNB 3NACH 1I1CA 2DWEB 4LF3B 2X6MA 3ARED 1U8LB 2QVMA 4B97A 2FEDD 1RD6A 4OUUB 3IVKB 1BBDL 1DHKA 2XWTB 3G5ZB 5DF0A 3V0VB 4OZIF 2Z91A 3DRTB 4XMPL 4LLDB 4ZOAA 1A1OA 3CV5A 2I5YL 2W9DH 3L2LA 1T22A 5E2VL 1ZKAA 1OO2A 4F5CA 2ZXQA 4YIQB 4TNGA 1ZPUA 2ZWYA 1KBVA 2ZYIA 1ZE3H 1Y6MR 5CFAA 4JFHE 3MC0A 3ZRCC 2WBKA 1LE9A 4JGNA 2OMWA 2NUPA 3MRDA 4EN3A 5EZOH 5IGXH 5T1LB 1DDHA 3MUHL 1P6FA 3MRGB 3NEEA 3AREC 2FEDC 1EJ8A 1AGFA 1UENA 4TVPL 3GB7B 3HMXH 1A6VH 1MLCA 3IT8D 3KPRA 4HKBB 2NNAA 4I0KA 5GSVB 4JB9H 2FATL 2HLFD 3A23A 3HMXA 2EIDA 4Z95H 4EI6B 5GS0L 4X6EB 3F6IA 3GDCA 4KK5C 4DEPC 3SE9H 1MXGA 3NEXA 4BDVA 1I3VA 2ZWNA 4P0DA 5TQ2H 5J56B 1C7TA 4AYID 2E7HA 4L48A 5DJAB 3BYTA 2JB6A 3MDJA 5KYUA 2BSBA 1CLZL 5CXPA 3SDAA 4C47A 1QKZH 3VQ2C 5CKGA 1XF1A 4POZC 4PV1C 2HVJB 2VE6A 1D5MB 5GGVH 3QE5A 1HKFA 2DQJH 4DVBB 3S37L 1OARL 3ZZLA 5C0GA 3IN2A 4WI7A 4PWKA 2FT6A 4KTGA 1NEZG 4M61B 4WI0A 2G9KA 2NY3C 1N6VA 3ZZ1A 3BKJH 2IOIA 4HWBH 2HLFC 3VFOB 4P3DA 1YEKL 2NY1B 4DGVL 4HWBA 3CZUB 5EO9A 1AY1L 3I85A 3K72A 3ZJAA 4GAAA 3WAKA 3LZRA 1HILB 1DLFH 3PP4H 3QUML 4G8AC 4L9LC 1UGKA 4R97B 5JQIB 1ZSHA 3O41B 4UBDD 1I31A 2ICEA 1BZ9A 3DMMB 3HPJB 3IU4H 1HEJC 1X44A 1N2RB 5GRJL 2GI7A 3U46A 3J07A 1HINL 1JTOA 3TBCA 3QFGA 4QUOA 1FNEA 1GH7A 2X4UB 3WDHA 2Y5TA 3NH7H 4KX9A 1Z5LB 1VFMA 3IDMA 4M5ZL 5ICUA 5IW6A 4I0CC 5FYJU 1KB3A 4BJLA 2NR6A 3GI8L 4MD0A 4PRAB 3W1ZA 4ADJA 2X70B 4PGBA 3VFRA 1NCAL 35C8H 3QS3A 1CLOH 4HH9B 2VL5A 3MRHA 5DK0B 4AEIH 4I0PC 3D3VA 2WIIB 2Y07H 3ZHDA 1CDUA 1I3RB 2H32B 2L04A 1KZQA 4DK5A 3LQAH 4N3TA 4I3SH 3Q7JA 1LO5B 5T1DL 5D7IE 5FKAA 3LZOA 1MZYA 4TQEH 2HG0A 4K5OA 5KSUA 1SJXA 2KQMA 4YXHH 2CR0A 3A4FA 4AGOA 1EVUA 1NGQL 5G4OA 1T1YB 5A7BA 5I6XC 1JGDB 5F0JB 3WJJC 4Y9GA 1MJJA 2DQFB 4GSQA 3L4WA 3U0PA 1FA4A 4UINL