3MVSA

Structure of the n-terminus of cadherin 23
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N terminus of cadherin 23 reveals a new adhesion mechanism for a subset of cadherin superfamily members.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Cadherin-23
total genus 48
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA02
3LNHA 1OP4A 1FF5A 1ZXKA 4AQAB 2OMYB 1WYJA 2EE0A 3UBGA 2A4CA 3K5SA 3K6DA 2V37A 4NUPA 4AQEB 1EDHA 3FF8A 3Q2VA 1O6SB 1NCHA 2QVIA 1NCJA 3K6IA 3MVSA 2YSTA 2YQGA 2OMTB 2WHVA 3UBFA 4AXWB 2OMZB 4ZMTA 4ZTEA 3FF7A 4APXA 4ZMOA 4ZT1A 3LNDA 2X2UA 4ZI8A 1ZVNA 3LNFA 4ZMNA 3LNGA 5JYLA 2O72A 2WBXA 5CO1A 1L3WA 4AQ8A 1WUZA 4XXWC 3K6FA 3UBHA 4AXWA 5KJ4A 4ZMWA 4AQEA 3Q2LA 2WCPA 3PPEA 2OMVB 4OY9A 4QD2E 4AK1A 3Q2WA 4ZMLA 3K5RA 4ZMXA 1NCIA 3LNEA 3QRBA 1NCGA 2A4EA 3Q2NA 4ZMPA 4NUQA 1SUHA 4AQ8C 4XXWA 5DZVA 2OMWB 2QVFB 4AQAA 4APXB 1Q1PA 4NQQA 5JYMA 4ZMQA 2WD0A 2OMXB 5CZRA 2OMUB 4NUMA 4ZMYA 3LNIA 4ZMVA 4ZMZA
chains in the Genus database with same CATH superfamily
3X12B 4YH6A 3T08A 1FL5A 5AB1A 4FZ8H 3UBXA 2ZKHL 1WJ3A 3HS9A 2EE0A 1E6JL 4FXKB 3BDXA 3PWLA 3CXHJ 2I5YH 1BMGA 1OGAD 3WEXA 4Q9RL 3L9BA 3DRTA 4OCSL 3E3QE 4W4OA 1NIFA 3TS8A 3V4VL 1UKTA 5DZLA 2JJUA 4R7DB 3TZVB 5HHNA 3PFQA 3OLGA 4EPSA 1MFAL 1GJUA 2ATKB 3AREA 4M56A 5FF6A 3VM7A 4WZ9A 1PG7X 4KKNA 3KPOA 5SWSE 1K85A 3WL9A 1CXFA 3NIFF 4YDZA 4F2ME 4Q6IC 3QC5X 2MNJB 4JM4L 1AYRA 5F7LB 1YJDH 1VEPA 3LEXB 4PJAE 5MP6L 4UV4L 4Y5YC 1E9QA 2MCG1 3K6SA 5HGDA 5TDPA 3P2BA 1QD0A 3P73A 4P48A 4YHOL 4TF4A 4LMQI 3IEAA 5B1JA 2JE8A 3V7AE 4XMVA 4XO8A 1A6VH 1G87A 1OGAA 3S8FB 3VA6A 2DM2A 5AZ2L 2AJZA 2VTFA 1FNEA 2DLFL 3GXTA 1HI6A 3FS9A 4NNPH 4EOWL 3MREB 2XWTA 4IRJC 4R0LA 4GKOA 1E0OB 1PLGH 1R3IL 5TQ2H 3LKSB 3CFTA 3EBAA 4HKXA 1Z3GL 4F3FA 1FBIH 2NY5L 1UWGL 1F97A 4LCUB 1FN4A 3BLBA 4N1CA 3WO4C 4A55A 2YGPA 2BVYA 3DO3A 1W0VB 5HJBA 5J6HB 5GHWL 3S3PA 5GS3A 1BYPA 4E42B 5C0RL 4PP2B 1LK3H 2IG2L 3GSVB 3MCKA 4HJGB 1S7WA 3QJSB 5T3XE 1RHFA 2HVJA 4NSKB 5HYQB 4UDTA 2VXQH 4F2EA 3MZGB 4UQAA 1QEWB 4HCRL 4U1NA 2WB1A 4JY5L 1CYWA 2VDML 4IRSB 5F3FA 5GGVL 2IAMC 2C1PA 2P42B 4X7TA 5DFAA 2CDFA 1UKSA 4AGNA 4LBEA 4G72B 5EU5A 4FI8A 4NFBA 5F97E 5A7EA 5G2NA 1WS7A 3T0XA 3C6EA 2VE6B 2KLSA 1TQSA 3DSNB 3HVNA 3VNZA 2BINA 4XP4L 3L7EA 2WVVB 1PY9A 2XKNA 4YSAA 4KU1A 2LFGA 4I0KA 3V6BR 4JK0D 1M9SA 4Z7NB 5IQMA 3O41A 2V2TB 1DN2A 4G1EB 3UTSA 5D96C 2AJXL 3FONB 3F62A 1U58A 5KSAC 3KM2A 1KT2A 5AW8B 1L9TA 3OKKB 5IEHB 1MJ7H 2FGWH 4U1MA 1HE7A 4GKZA 5D7LD 2BIMA 3RNQA 1IM3B 3OF6A 5ISZB 2OJEA 3QCTH 3SY6A 2Y5TB 2MSPA 3FQWA 3QYMA 4TSBL 3B9VA 2OP4H 4NQDD 4LRNH 3U46B 2ORBH 4ZW3A 3CU1A 4HIHA 4L8DB 1VA9A 3EOBB 4XPHL 1OSEA 4K4KA 2ARJA 3FPXA 2F7RA 5DFTA 1U8JA 4G8FB 4K7PH 3GMQB 3LYRA 4B5ZA 1HQRB 3MJ8B 4JN2B 1XH1A 4F33A 3C5XA 4WEMB 4XP6L 4D8PA 2YPLB 1AZNA 4WUUD 3VB9A 3DARA 1PQZA 4MDIA 3BD5A 4EN2A 3IDXH 3QIUB 4ANUA 5GSVB 4ZMTA 4PB0L 5E2WH 3HNSH 1MIMH 3UMTA 4JM0A 1E4JA 3F6LA 4Y1AD 3GMOA 3O4LD 4CSSA 4I77H 4B95C 4AMXA 4RFNB 2Y7SA 1UB5A 5GIRB 1VCAA 4U3XA 4LCCA 4LLWB 3L95B 1N4XL 3WY4A 5TQ0L 4KNSA 2R69A 1YUHA 3CHXA 2WWOA 4KMTH 6PCYA 1QNZL 1L9PA 4WU5B 3WYRA 3RFZC 2PTVA 2CDGA 5AVRB 1XV8A 3IDYC 1GZQA 2D9CA 5JW5A 1GGTA 2QQLL 4P9HH 2Q8AH 1XR8B 2DQUH 3A6BH 4K8RD 5C08E 2DH2A 4JO5A 4N2MA 1H15B 5BQ7B 2NW2A 5HI5C 1AGFA 3OHXC 3NACL 3FTYA 5JLZB 3DO4A 4H5SA 3UZEA 4N3UA 3T0BA 2P4AB 4IRZL 1DBKH 2DYRB 3LKPA 3D30A 4BCYA 3ZTNL 1E9OA 2R0LH 4GUQA 1A4JB 2P1YA 4GQZA 4I0PC 2WCSA 5CCKH 5I8KH 2BSSB 3ARGB 4P4KC 1Y1UA 5FDWB 4X4MA 4ZUWA 4OU3A 4QHLB 1LP9B 3V4UH 3EW3B 3VXSE 1X5XA 1KG0A 2ZKWA 3O9WA 3QP3A 4EI6A 4AH2B 4BXVA 3QAZB 3RWJB 2G2RB 5GJTH 4R7NA 1NMBH 2NYYC 1OM3H 4JVPA 4NUMA 1JV5B 1QTSA 3UTQA 3O6KH 3ESPA 1OOAA 1MRFL 4RGND 2JJWA 2F54D 5INCA 4UZUA 1BEYH 4BRVA 4KQ4L 1Q0XL 2HPTA 5EIIB 4FFWD 1F4XH 3UTSB 5DQDL 2FT8A 1JUFA 1ZA3B 4J2XA 3DIFA 2Q3ZA 2IEPA 1U3YA 1MEXH 2VQ4A 2C9XA 2D7PA 3QQ9C 1FL6B 1C8QA 1Z5HA 3D48R 4Q6YA 3EO9L 1CLZL 1R0AL 3H3PH 2ITCA 4R4NC 2QHRL 1Y6MR 3K46A 5EUKB 3N91A 1S9YB 2YKLL 3SIKA 1XF5A 3MRKB 1M2VA 4K0OA 3MBXL 1AHWA 5FGCB 5LCVL 3SDXA 5IHZA 5CN1A 3NCJL 1R24A 5EEVA 4HH8A 3MR9A 3VXNB 5EU3B 1UYWL 3WEOA 5B39A 4XWGH 4Y19E 1IILE 5CN2A 4YSQA 1U8KA 3JTTB 3SPIA 4FG2A 3PQYD 4FTVB 2ZP0T 4JN2A 4F33B 5C0DA 3H6AA 1ORQB 1I31A 3A22A 4XP5H 5I0WA 4OQTH 3SGDH 3SE8L 2F19L 3H42L 3JUZA 2ZCZA 2H0PA 3P0GB 5BRZE 3ZZLA 1RZIB 3ELAT 3U7WL 4P2QA 4LO9A 4LCYB 1M7DA 4LOEA 4XNDA 2G60H 1NDMA 1KZYA 4S1DC 5EHFA 5IY5B 3LRSA 2ZT9C 4QHKI 1WA0X 4MD5A 1SHXA 1TU2B 1N12A 2YD1A 5IHHA 4Y1AA 1ACCA 3KYNB 1E4WL 2V6HA 1TCRA 5DT1L 5I9QB 2EDTA 2Z4QB 3LOWA 1CE6B 4LAJH 5L6YL 3Q6GH 2AITA 3L4CA 4GXFA 1FFTB 1T2QH 2X6MA 4K94H 4DP1X 3K8KA 2X88A 1J1OL 4G8EB 4UT7H 5DD6B 4A7VA 1J12A 1ZMYA 4A39A 1T7ZA 2ARJQ 2LABA 1E7UA 1F2XK 1PY0A 2OMVA 3H0TA 2WIMA 3U25A 1ZCRA 3ZKMC 4HX1A 2AABH 1K6QL 4KXCA 2QGDA 3SODB 4U05A 4NFDA 5CGTA 5ID0A 2X6AA 1RSFA 2EXWC 1U95B 1O5DT 5JA9A 5KYWB 1Q9LB 2EDBA 1OXYA 3INUL 4ZG1A 3WHXB 2TAAA 3BAJA 2X1OA 2YMOA 1HOCB 1GZPB 1RZIA 4WK0B 1CFSA 1MFUA 4HUUA 5F9WB 5AAMC 2VSCA 1WBYA 3PV7A 5EDXA 2P9RA 4MXVF 2DMGA 1EJ8A 4M1CC 3VGHA 3IS0X 4GKSA 2Z7WA 4N5UA 1Q4NX 4BUGA 2QVFB 3CPLA 1TLMA 1UA7A 2X4OB 4S1SH 1EXUA 4HWEL 2DQCH 4G70B 1XTMA 3VW3L 4I1RA 4MJIE 1B3JA 5B38G 3KHOA 5IBUB 8PAZA 3RX8A 3N1GC 3I75B 4QRRD 2D9QB 4ZTPL 2PPAA 4JFQA 4BM7A 4F7TB 1IGYA 1P5VB 3E38A 5FS5A 4YHYC 3VXSA 2AXGA 2Z91B 4FMVA 1YNLH 3CDYA 3FTSA 3VG0L 3IDIB 2WYZA 1IKOP 1ILUA 2WQWA 3L13A 1U8PA 2BSTB 2EEDA 5I5IA 4MCMA 5DJZA 2X89A 2V17L 3G6JF 4H25B 3P30H 4ZAKB 3Q6FA 1BBJB 4WJ5B 5DVOA 2FJGB 5C0CB 2KT6A 4XVOA 4BSWA 3HW7A 3X3GL 2OTUA 1AO7B 3EUUA 4I0CC 2AK4B 4F3FB 3SPCA 2CA4A 2QEJA 4UWQB 4FS0A 3NYKA 1S7RA 4XOCA 1HEZA 1T21B 3G5ZA 1Q9KB 2J73A 1UWEL 3VTMA 3IGAA 3VSUA 4RH4A 1MLBA 3S4SG 3OR7A 2ZX6A 4OH2A 4NQCB 1FLTX 3WNKA 4B3EA 4ZUTB 2JLPA 4G43A 5HY9B 1NUFA 1ES0B 4HCGA 4WI0B 4OLUL 4AMWA 1YEIL 2YD4A 3ASWA 5CLWA 4NQED 4BXSV 2V7HB 1PLGL 1G7MB 1T3FB 2GY7B 3H1ZA 3CGTA 3L3JA 1DJSA 2X89D 4BZ1A 1SQ2N 3SQBB 1NGZA 2BNUB 1GPOL 2E6JA 3EADA 4BH8A 3PDDA 5F1NB 4FP8L 4R3SA 3V7MA 2OMWA 3BFOA 3R8BB 3RY6C 5BOPA 4OZGE 1ZLUK 1IT9H 3DMMC 1SJVA 4Z95L 4ODWB 2Q3AA 3D08A 4LL4A 4GBXC 3P0VH 4ZFFA 4OZFH 1XF2B 1I8KB 4HIJB 1KTRL 2WXLA 5J56B 1FV1B 4BK5A 3GEFA 3GKWH 3EFOA 3KYOB 3N41B 1BLIA 4J6RH 1HHGB 3MNZB 3UGUA 2EDOA 5JOFA 1JVLA 4KI5C 1D6EB 3B1UA 4J8RB 4MSWA 5FYLL 1ZPLA 4LPUA 4YX2H 1CLYL 3C75A 4YS4A 1F6AB 4APQB 3MGAA 4IMLA 3MLUL 4B6ZA 2XIDA 3GFUA 1EHLL 1FL5B 3TBTB 1QTPA 1B0IA 3B7YA 2Z92B 3QI9A 1DDTA 1AR2A 3MBWA 4YLBA 1BOYA 3PL6B 3O11A 5D7SH 2Z65C 1U2HA 1ESOA 5IQ7L 2X09A 5I30H 2WQAA 2IO5A 4DVBB 2V7NB 2XLLA 3PQYB 4FTVD 4NZDA 5KEZA 1BF5A 2WTPA 2P26A 4QHUA 3EYVB 3NSYA 2NY2D 5I6XC 5ESQB 5HHPB 1GW6A 1SXBA 1UD8A 1DYZA 3NIFB 3FOLA 1DHKA 2AI0L 4JFTA 4EZKA 4PP1D 1Z66A 4FNSA 4FFVC 2VR7A 3T04D 1P5UC 5J0BA 1WBZB 5B4MD 4NOFA 2DI7A 1XGTB 1QI5A 3UYRL 4L9DA 2F8XC 1JYNA 5ID1A 1J10A 1EEZA 2KZ1B 4RZCB 3TBTA 1MWOA 1KTBA 4OJYA 1BLNA 2A6KB 3EH2A 1BBDH 1OY3B 1KJ3H 2WWKT 2ZOKB 4PJAF 3VXPB 3M46A 3ILQC 2ZKXA 1K8IB 3VGGA 1QACA 5GRUL 3I50L 3RP1A 5KYUA 3H9SA 3P02A 4IHOA 5EN2A 1H3PH 2ZJSH 2CGRH 1W80A 3GMNA 1YECH 3JSSA 3BXNB 4QRPB 3RURA 4PRPA 4CU7A 1JWSA 4YXKL 4KKRA 4YAQA 1KXQA 2F68X 3L1OL 3MNWB 5C0IB 2BSED 4R4ND 1W2KT 4AGLA 1DQDH 1WV7T 4H2AA 4MCYA 1F45A 4L23A 4TMPA 1UOLA 1AE6L 2R69L 1P84K 5K39A 2MTPA 2R4SH 4G3YL 5AB9A 3TIDA 1FVEA 3HNTL 2VN6A 4H8WC 4DGIH 4QO1A 1EEZB 2CM6A 4RZCA 4NRXA 3HE7A 3BH8B 1KCVL 3H85A 4I4WB 2Q3XA 3QQ4A 3BPNB 1GVIA 2IANA 1KDIA 3L2MA 3AQYA 5J8OA 2VW6A 5EIIA 4ZX6A 4JDTL 3B2UD 2DQFB 3G5YB 4Z7UE 3V0EA 4I0PA 1HWGB 4ODUB 3GBLA 3OHMB 5EH1A 2H47C 4HUMB 4IKJA 4MQXC 3WTYA 5DUBB 4ORZC 4F57H 4KI5D 4NHCL 4AQ1C 1CBVH 5GS2D 4U1JB 1J18A 1DUYB 3QXDA 1QR4A 1GHFH 3QEQB 4GYBA 1C5BL 1OAJA 1RZ7H 2OL3L 5ISZA 2PTTA 4KTEL 2AJZB 4KKLD 4QRFA 3SYQA 2X4UB 3QUZB 4Z7OB 4JHAH 3VD7A 3BT0A 1T6WA 4J8RA 4MSWB 3VGDA 1L7IL 3K71A 1BSIA 2EDDA 4D8PB 3MLRH 3SE9H 4IRSC 4IU2B 1S7TB 4KV5E 2K3TA 2Q76B 2GEEA 3Q1EA 2A1WH 3U0PA 4NO0B 4GEIA 3AMKA 3INUH 3U6XS 4XBPB 3UC0H 2NRDA 3NJIA 5C08D 4AEIH 3NMEA 2ZUUA 4UDUA 2FUTA 4XZUA 4AGOA 1EK3A 3OWRA 1HH9A 1RU9H 3ZY7A 5B3JF 3SYOA 1BZ8A 1EPFA 3V4VH 3PDOB 2D7QA 5KYXA 5BUGA 1AHWC 3HCVB 3LRLA 4EQ2A 3ASOB 1G5AA 1QO3B 1T2QL 4K94L 5HHNB 3G6DH 1NFDB 1A1OA 3D52A 5GGRA 1M71A 1RJZA 2HKHL 3VD9A 3O6MH 5HD8D 3OMIB 4APQC 4WEBL 4IRJB 5L6YH 1ZTXL 1K3IA 2FBJH 2F08A 5DQJA 4LAQH 2IC2A 3THML 5F7NC 4ZXBA 5A2KH 2XG4B 2IMMA 2BM3A 2ZAIA 1EZVY 3L16A 4TSCL 2EKSB 1WWAX 1FCCA 5IKCB 4R6UA 4D9QD 4TVPE 2AJSL 5E1AB 4N22A 5F7WC 4H1LB 4N6RB 5DEGB 2F19H 4LL1A 3DMMB 2E76C 1KJ2B 1E42A 5CIPA 3U7YH 2PYEE 5FFOA 4PGEA 2OXGA 5FECA 1SF3A 2UX7A 2YHGA 4KRPC 4J3BA 2EO7A 4UILH 4RRPM 5E6ZA 3BDBA 1BZ9B 1MFAH 3KDMA 4DEUA 5F7HA 2V4LA 2WHVA 4I2XE 3KYKH 5A3ID 4HIIB 1IKFL 5HGDB 4URKA 5KOMC 5L7XH 4E9YA 4KGLA 1DJZA 1VENA 3LZNA 4JFZH 5DA4A 2M1KA 5AL0A 3VI4E 2ZICA 2IFGA 3BWZA 5KSAD 3ECBA 3QZLA 4JM2C 3C60C 1VF5C 5MENA 3RVXD 2VLJE 2Y6TE 3KDMB 4UINH 4F58L 5TJWK 1NIBA 4HFUL 3EJZD 1EFQA 2A6IA 5CO1A 1FUNA 2ZE0A 3JV4B 3U79A 3TO2A 4HEMA 1FZKB 4LSQH 3BAKA 5C0JA 3CQQA 1TJMA 3RL1B 1KCLA 2ITCB 2MCPL 1IBZA 3ENEA 1N6VA 4HYTB 4AQEA 2Y36L 3F85A 3TVMB 5D8JH 1V3MA 5IB1A 2WQUA 3VFSB 4DKEH 2BWDA 2F7QA 3DWTA 3GBEA 4L2YA 1ZTMA 3UOAB 2RQEA 1A47A 4GEJA 2OLDA 2YAOA 4X8GA 1OK0A 5AKTA 2PETA 4O9HL 4LT7A 5IG7B 2FWOA 2WSDA 3FB5B 2WGNB 4NQXB 3JWNE 2V5YA 5GS1C 4PJ8A 1QBAA 3HB3B 4X4ZA 1HNFA 2OCCB 5FF6B 5DJCB 3NJJA 3X3FL 1BZ7B 4TLSA 5EUOB 1YNTA 4M48H 4GW5B 2OMYA 4OFDA 1SDDA 2WLLB 4K5MA 4RISH 4RAUB 2DMBA 1A1OB 2AJ3A 4KMTL 1T1YB 2GK0A 4WUUB 2DEYX 2WAQA 5K5YA 4XCNB 5E2VH 5GGQL 3VGFA 2DQEL 3LNHA 4P2RD 3D3VA 2NUPA 3II3A 4P9ML 5FA3B 3A23A 1WF5A 2IBGA 3S3CB 5L8KB 1XH0A 1X6NA 4XVUC 3SDYL 3VGEA 2HJKA 2ZAGA 3KDPB 2J71A 4NKIL 3O2DA 3WOVA 3KS0J 4WFFE 3HNSL 3UTTE 1JNNL 3RUGB 5D55A 2CCLA 4ANVA 2EZ0C 4XOBA 1HT6A 1OTTC 4JQIL 1JF5A 3DMMA 2DJSA 3OHXB 3U2JA 3GQFA 4UIKH 4HC1A 2CSPA 3MO1B 5HDBE 5CEXB 1ET8A 4JG1H 4XVJH 4MASA 5AVSB 3TF7C 5D7JB 3FQYA 2ZOTA 4J27A 4GW1A 4U31A 3RTQC 2CR3A 5I8CA 5LQBH 1YYLH 4ZX5A 1DBMH 1LO4H 3LB6C 4XVTL 4N28A 3O8XD 1PFCA 4XPHH 1AIZA 3L8QA 3NABH 5F7AA 5BW7A 3EOAB 2PR4L 2UY6B 4L3FA 4MQ7B 5T1DL 1XSIA 4K3GA 4Y4HB 2VDRB 2PO6D 3F6IA 4JHZA 4OUUB 3QCTL 3QISA 5B3SB 3LKPB 4U6XA 4XO4A 4GSDH 2FHFA 3M45A 4U1KB 1KBVA 1O75A 3EOAA 4K55A 5EC2B 5C07B 3QQ3B 4Z76B 5KN5B 1I8LA 2BNRA 5DJYA 2HTKD 3TWYA 3ULSA 1NCCH 2RFXB 3UC0L 3T8XA 1SEQL 3DX7B 3PIQB 3LNEA 2ENJA 2JIXA 3CH1A 4W70A 5FM4A 4FNRA 5BV7B 1BWMA 2H6OA 1FGVH 1RY7B 3GMNB 1YQVH 1QR1B 3GSUA 2ZKYA 4PJ6A 3A5VA 3LKOA 3QR2A 1S2EA 4X83A 5L4JA 2Z35A 1XHHA 1NIEA 4HWZA 2VZOA 5CHNA 4OLVL 5IW6B 1AH1A 4PJ8D 5JIPA 3CLWA 5KVFH 4ZFQA 1T1ZB 5GISH 5DMKB 3OC8A 5I0ZA 5FUZH 4NKOB 3MJ7B 3UERA 1DJYA 2XC8A 4ISVA 2VZSA 2VITB 2HUEA 4IOFC 1F1AA 4ONHB 2D7NA 1QG3A 3KBPA 1N64L 3LKOB 4JKLA 4UQEA 4JGUA 2FB4H 4NRXB 1U30A 1FV1A 1B90A 3OLIA 5DVNA 3WIHL 2H9GB 3BLPX 5C2BH 5C86A 1MCOL 4WUUA 1Z32X 3UCRA 2YD5A 1L6PA 1VGEL 4AIXA 2BOCB 1QFUL 3CVHH 5EMYA 2XOTA 2BMKA 3HHSA 3PHOB 2OMYB 1WAAA 1RURH 3SKJH 3V4PA 4QAMB 2BO0A 3OAYK 4XP9H 4AMKH 4UM9D 1HINH 3H54A 2ISDA 3MRDB 5I19H 2ZXBA 3N41F 1CO1A 1BXXA 3HE7C 5B38B 1S9VB 3GXIA 3LKNA 1FC1A 4GKZB 2GIYA 1S7XA 3PQYA 2I07B 2NUTB 4JUTA 2R83A 3MN8A 1NL0L 3WAKA 5D2NB 4HXAL 1IC5L 1XF1A 4PJ7F 1A3RH 5J1SC 2X70B 4HH9A 2QADD 2OMTB 1TTUA 4M5SA 4AXWB 2W88A 1PZDA 3KW8A 4PUBH 3TF4A 4KXBA 2J6WA 2GJZB 1HZKA 4DESA 4J3OF 1E3FA 4TTGA 2ATPB 2ZXAA 4GFXA 5JIMA 3TV8A 1RZJH 5BV7L 4QXUH 4DP9X 3HN8A 3ZHKA 1FE8H 1CFQB 1UT2A 3W2DH 2ADIB 1QBLH 3Q8AA 1H6TA 3DDGA 3CDGA 2H6PA 4M1GH 4G8AC 5TK2A 3ZSSA 5KVDH 3KL0A 5IB4A 3FZUD 3HBPA 3QWRA 1L7TH 2JCCB 2B8OT 2W91A 4EUPB 5A6MA 4LVHB 2WZAA 4CBZA 4QD2E 4MX7B 5HHMD 1JN6A 1S7VB 4MMXC 1NKGA 3HE6A 2MFNA 1OLLA 3L3OB 2QMJA 1EFXB 4YHPA 3O3DB 2QPFA 2RR3A 3CV5A 3FT1A 4IJ3B 3D4GA 4TLUA 2D3NA 2F0CA 1FSKC 4QF1A 1G5GA 4NENB 4ELKB 4W9FC 4EZJA 4XCCH 3HRPA 3BSZH 3CPLB 3QUYB 1R4XA 3TYGH 1ROWA 3PAVA 1PTZA 2G5RA 4DVRL 3N42F 2XN0A 3Q3GA 4BSWB 4U1HB 1N5YL 3CFNA 4NQTA 4FYSA 5G5DB 3V8OA 5HHOB 3GPSA 3HS0B 4I85A 4LVOC 4LL9A 3VXUA 5IWLC 1G1YA 4NENA 5L0QC 5EZPA 1R75A 3SDAA 4RWYH 5BZDB 1YMMB 3PWNB 3I9AA 3H9HA 1KBWA 2CHXA 1WBXA 2MNUA 5DI8B 3CDZB 1IJNA 4XPBL 1JN6B 1S7VA 3AUWB 1CE1L 3SGJA 1TVHB 5FW6A 4V1DD 1D9KB 4CN1A 1FDLL 4J3OG 1KTLA 2XWZA 3QEGH 5SV3A 2P7TB 1QRNA 4PREA 3T3ME 2VB5A 4XH2B 3EH5B 2VM9A 4XCFL 3LRGA 3R0NA 4AQEB 4ALAL 1U93B 3S4SB 3RHWF 1IGIL 1V54B 1EJFA 3QDAA 3AS2A 1KSRA 2EXYC 1SEBB 1BFTA 1Q9KA 4XB8A 3C60A 2D7TH 5BRPA 1CL7L 3UMNA 5IR1B 3TEZA 1S78C 1NMAH 1YA5A 4P23D 5DVLA 3QFJD 5IHUH 4AV0A 4YBLC 3M8OL 3VFNA 2YKKA 2K8MA 1IQWL 5J1TC 1NIAA 3RVWD 3O4OB 4XBPA 5JW4Q 2A83A 3LTVA 1CB4A 3ZYJA 1XF5B 3MRKA 4F9LA 1HH9B 2HAZA 4YDKH 1HWHB 3S98A 2DQUL 3A6BL 3B9AA 2AEOA 5GJSL 3LPWA 3VE0A 1VCBC 2WYIA 4U1IB 1SVBA 2WB7A 2NTSP 1OP5K 4X98A 1REIA 5E9AA 1D2OA 1G9ML 1X9QA 2YQ3A 3P30L 4GRLA 5I0VA 4NRZA 3QCUH 5TE4H 4RFOL 4OT1L 1JRHH 3LEVH 1D5MA 1E4XL 1R5IA 3L3DB 3MRFA 4MJID 1F4WH 5E4EC 4EEEA 1WUZA 3RIFF 3PJSB 2ZSVA 2R56H 1J88A 4P2QB 3FSWA 1A7OH 3E80A 4RX4D 3G08A 2CCVA 4Z78B 2MOGA 1GGIH 4JB9H 5LNDA 3QGVA 1KPUB 3ETTA 5ACZB 4FI6A 3ZE0B 3SO5A 4MX7A 3INOA 1W8NA 4PGBB 3CSBA 1J7VR 2DKUA 2B4CL 4Q58C 3SCMC 3UTOA 4A7GF 5G55A 4OFYA 4XNMA 3AVEA 5F96H 3QXAB 1KGXA 3RAJL 1QBBA 3VWKA 3CFKB 1E27B 3C6LB 3QDGA 1SUHA 4XMPL 3U82B 3PJLA 3BIAX 2R1YB 3LPPA 1U8CB 1PG7H 3KLDA 1F42A 3ZHFA 4WJKB 2B4CH 4TUOB 1RJYB 1YY8A 4GAJL 1BAFH 4M93C 5A2CA 2CJTA 1KIPA 1KYOJ 4MZ3A 5BO0D 5I1EL 2UZXB 5DFVC 3C2AH 1EZSA 3W9EA 2CRMA 5C0AB 1PAMA 3H9SB 1WSST 4MQ7A 2V2WA 4JFXA 1XGTA 1OAZL 3UTPE 2F54E 3DO7B 3VXUE 4Y5VC 5BVPL 2KI6A 2PNDA 4N2OA 4UTAA 2YPLE 2G2RA 3H4HA 3BP5B 1GS7A 4Q9BA 1D5RA 1AIFA 4IGBD 4V2BA 2XVBA 1I53A 5DR5L 3RTQA 3U9UB 3NJMA 3VXPA 4JHBA 4F7PB 5DSCB 5I6KA 3UTSE 1IEAA 5T3XL 3ARBB 5F7KC 4KJQD 5J06A 3KGTA 3EHBD 3O4LE 3TBVA 3QYNA 3HNTH 5I76A 5E2JA 1AQDA 3ARGC 1A7QH 2E6PA 4P4KB 1O9WA 4FD0A 4UAOB 3B7SA 5ANME 4G82A 2VC2B 4XC3H 7TAAA 4BFRA 3EDJA 4IYKA 4KV5F 5I71B 1LNUA 2QVIA 3FQRA 4XO5A 2F58H 4PCSA 4XWGL 2VQ1B 3CFDB 1CUOA 4HF5L 3QZNA 3LB6D 3RVVC 3MBWB 3UAEA 2P28B 1IC7H 3BPCB 1YECL 1T6VN 2VLJB 5HHXH 1KENL 1FNSH 1F6AA 1QUNB 4ONGL 4ZS6C 3P4OB 2D7MA 5AUMA 4Q89A 4A2FA 3HPJA 3BUYB 3LVTA 3PGCB 1JZ7A 3HZYB 4G7YH 5FO7B 4NBXB 3CQPA 2PWFA 1G9NL 3MOAH 2Y07L 3UACA 2MRYA 4HFWA 4Y4KD 5I5RA 1BMZA 1KJ3L 5H37H 1AY1L 5FA3A 4OCLC 4LCWE 2A6DA 4IGBB 5JIKA 3PL6D 2DLFH 5GRWA 1FZJA 3BWUC 4HZLB 5CP7A 3T6VA 3HN3A 4IRJD 3FBQA 1EDYA 2X1WL 6TAAA 4H20H 3VSQA 3OB0H 4RBPH 2E7BA 1QVOA 1Z9LA 3FO2A 3S96B 4MDJA 2NY2B 1CGXA 1PJ9A 5KSUA 1IEBA 3N50A 4PRHE 4KC3B 5IMKB 3N0AA 4NKDB 1JF6A 4WCYL 3D87B 4JG9A 4NO3B 5IQ9A 3TWCL 5CEZL 4ZO8A 5KS9B 4N2GA 1F0LA 1NCGA 1XEDA 2ZXEB 3MRJB 4HMEA 5F1KC 2PKDA 3L5JA 1EQWA 2Q8BH 1KFAH 2VDQH 4P23C 4YBHA 5D4HA 1NKRA 2P5EE 1E4KC 3TA3B 3T4AB 4PGBA 3RBGA 2WY3B 3SB3A 5E6SB 5LG1A 3T0EC 5HYIA 3HC2A 1ASQA 4JNXA 2CRYA 1B9ZA 4KITB 5TK4A 4FABH 2CR0A 5IB3A 4QHKJ 5AOZA 3GO1H 1MY7A 2DF3A 4JRXA 5KSAB 3KPSD 5PCYA 4Z7UF 4QJ4B 2H1XA 1PD0A 2YA0A 2R29H 3CZKA 1Y07A 5E5MA 1DFBL 4ZNCD 3MLYL 4N8CH 2OXHA 3E9TA 3LKQA 1B9KA 4FFTA 1K9TA 2BH0A 3JV6A 3LMJL 1WYJA 2DBJA 3UEZA 5I74C 3ZYOA 1QYGL 1QPKA 3KPMB 3QNXB 1FAIL 1MFCL 2D0FA 3O4OC 5CEYB 3FO1A 4G7SB 3EDKA 3X1EA 1DVYA 3QORB 1VJSA 1YPZB 2O5YL 2HTKC 4LCUA 4PD4J 2XWJA 1YMME 3QEUA 3LKQB 5I66A 3D3VB 3FQNA 5ANMA 4BKLB 4KRNA 2F2HA 4QF1B 1VFAB 4MMZB 35C8L 2QPUA 4HCFA 2DYPD 5J6GA 1RD6A 3O2DL 5I5JA 4XBEL 1M1XB 4BA0A 3H7BB 4X5WB 1DTUA 5MEND 5BJTA 4WU7A 4MMXA 4MJ5A 4NNYB 5E5MB 3IE9A 4GIPD 2Y72A 2AJUL 3HA0A 4PJIA 4BWWA 4YSCA 1OAQL 1A8JH 5HY9A 2NQCA 5E7FA 1YEJL 1WT5C 1EAPB 2W0FB 4IBSA 4M3HA 3RNKB 4Z3JA 4PW4A 5DJ6A 1GC1L 4PW9A 3AM8A 4RA3A 5ALCL 1HAWA 3IU4L 3BZFB 3TJEH 1S78D 3IRZA 1I9IL 1F3DH 1JZ4A 4FDWA 4HPYH 2ZX5A 3QG7L 1MRDH 4D9LH 2ATKA 2WVUA 3AREB 3HNVL 1J1XL 3WFCL 5I1IH 3QORC 1C9SA 2B2XL 1R5WA 4NQCE 1JP5A 2C9SA 2W5PA 4BUQA 5KSUB 1H3GA 1KLGB 1MCHA 4PJBA 4G8GE 4YZFF 5FO2A 2BMKB 3HHSB 2E47A 2NR6C 4MD5B 4MMZA 4J28A 4K3JL 3HAEG 2VMCA 1MWAH 4Q6IB 2Z31C 1FSKB 4Q7DA 3K2KA 5I18H 1NFDA 4S0SD 3RDTB 3GSWA 3OQ3B 5F1OB 3GZQA 3L3OC 3LZOA 2N7AA 4M7LH 5DUBA 1M1SA 1IL1A 2DIJA 1B3IA 2VZ3A 4IEFA 4MMXB 5FHAL 5FYLD 5LBSH 4X6FA 3SGJC 3W11C 3HG2A 4R7XA 2WLYA 3RVUD 5GGUA 5DQ9B 5J6SA 1ZHNB 2ZWZA 4E41A 1VACB 5KYYA 3VXOA 4OKDA 3SKOB 5A7BA 2X4SB 1IX2A 4L8SA 2XWTB 4YR6A 2FLMA 3WMPA 1JV2A 5DR5H 3JQOB 2IDCA 4YHKL 5D1ZB 5BCAA 5CFHA 1SHSA 4QRSB 1CD8A 4S10A 1QAWA 2E9IA 4YC2C 5CN3A 1NFKA 5IVNA 5TQ2L 2VDNH 1R3KB 5EORH 3TJHD 1CXIA 1NGPL 1GKOA 3IAPA 5EO0B 2EIMB 3QO1B 4PQXA 1M3IA 4PBVC 3K3QA 4HWZB 3HTLX 4HPOL 3CVHB 5CHNB 2DQJH 2YBRA 4F9LC 3MCG1 2XVLA 2VMFA 3P40A 1AOZA 2L3BA 2YGVA 3EZJB 4XP6H 5F9DC 4MJ6A 1DVFB 2JJSC 3SE3C 3QPXL 3FL7A 4ISVB 4HJTA 2WUCH 3FZUC 1LQSR 2QQQA 3ARWA 5B22A 1TQBC 5ERWB 4HBQA 4JJHA 4PPTA 2XTSA 3PGFL 3IJ7A 2FATL 3D25A 4GRLC 4ZPVB 5EIQA 5DD5H 1DCLA 5KG9A 4AH2A 4IDJH 3CHSA 1G7HB 1YC8A 3DKHA 3ZKSD 3EYFB 3CVIH 3MU3A 4U1KA 5JHLH 3PDGA 4KZEH 2NY6C 3MRDA 5AOIA 1AG0A 2YPVL 3D7PA 3GS0A 3MZTA 4O2FB 4DKTA 4EQ3A 1MCOH 4UTAL 4YL9A 2VLKB 4XXCC 4MLIA 1TEYA 3VGBA 3CPUA 1Q94A 1YC7A 3TFKC 3VRIA 4XI5C 1S7XB 4N90D 1E90A 3IXAB 3NCYS 1BOGB 5K9JL 4C56A 1WFTA 4DK5A 4GG8A 2X42A 3HG0A 1SXCA 3G6JE 1G43A 1GCYA 5TPWL 1SXAA 3OXSB 3QRLA 3QNFA 4Y0GA 2AQ2A 1C12A 2W80C 3IBOA 4L1TA 1IAII 3K1KC 3V0VA 4KRPD 3L48A 3NA9H 4OZGA 4NN6B 2O5XH 4ZPVA 2H32H 1FFQA 1U8HA 1XMEB 4X6DA 2NX5B 1KV3A 3F7PC 3ILPB 3O6FC 4QTIL 4X4XA 4Z3FA 1MAML 5D72H 4YE4L 1WFJA 1MI5D 2BVOB 4RDQG 4LCCB 4P46C 3RB7A 4GIOA 4YPJA 4GRWH 1M6UA 2AJ3B 4G8GA 3RUGA 2MQGA 2OS7A 3TL5A 3WNIA 5HYJD 1OARL 1WD9A 2FZ3A 5C9JB 4KDTC 4X6DB 5ABAA 4JHWH 1KV7A 3UZQA 4NKMA 1OE2A 3CN1A 3IN2A 4IRZH 1WFNA 1WZ1H 2EZ0D 2NSMA 3DX4A 3JTBA 3ZKNC 2FJFA 1HILA 2IBBA 3ARXA 3Q6FB 3IB4A 2FX9L 1IKNC 3FCGA 4NCC2 4O5LL 2HT4C 5CLYA 3LD8C 3U4EA 3DBSA 4M6OL 4LSQL 1R3KA 2E86A 1UXLA 1I1AA 1YAIA 4ZYKB 5J7CC 2WLKA 1JBJA 4TTDC 4BSJA 3ZZSA 4U1IA 4UM9A 4ODTL 3QIUD 4ELMB 1BQLL 4KJWC 5F7MC 1F4YH 1VFUA 2EAEA 1AMYA 3PWVB 3J27A 2AI0H 3P3TA 2AJYH 5KBKA 4S2SB 4JFZL 4YFEA 4U6XB 4YHIA 4LDEB 1ICTA 5HVHB 1N59A 1IGJB 4FNTA 4YFDB 4Y1SA 3NFSL 3IDXL 3VG9C 5T5NG 2A5UA 3IXTA 1USQA 3G5VB 3F04A 2HB0A 4F9PA 2WXPA 5ID0B 2KBGA 4R97C 2R7EB 4W9JC 4B9ZA 3H9YA 1X9RA 2BP8B 3H3KA 1NC2D 4JFOB 2DD8L 4HJIA 4XH2A 1IAOB 3EJJX 5D7IF 5I1GH 3REWA 3Q8BA 4Y16B 2RH0A 4WO4A 2AMGA 4LLUB 1H0DA 4GO8A 4CMMA 2OSWA 4MYWB 3ULUH 1PU0A 1J5CA 3A4FA 5ADOH 3IFNL 3IDUA 3KPPA 2CNYA 3D85B 3EGDA 3CU7A 3FAXA 3PP3H 3D6GA 3THMH 1RURL 4HBCH 1LE9B 3US9A 2X53A 4GSXA 5HDQH 1NDTA 1ZAGA 5AFAA 3OKNA 1DR9A 3VAEA 1CCZA 4ZSOE 3WXVH 1WLHA 1FYTE 3V0WH 2VDPH 2IQAB 4HK3J 4MNQA 3J07A 2XUWA 1KC5L 5DHVA 3JVFC 5DRWA 3SJVB 1YMMD 3B8SA 2GJRA 3I6SA 4H25A 4LEXH 2IGFH 2YWZA 5C0DB 5IHBA 1A21A 2JJTA 4A7QA 5GS1B 4X6CE 4FG6C 1HH6B 5KBLA 2K6YA 2FYYB 4JKKA 3NVQA 4MDRA 1SXSA 1ML0A 1CQYA 1A4KA 2ZOLA 3CN0A 4PJCF 4IBQA 5DWUL 1HSAB 3P3SA 5C2UB 3DNKA 1AC6A 5CMAB 4KK5C 1VEMA 4DEPC 4HKJB 2Z8VC 4AV5A 1FL6A 4EXPX 1B6DA 2QSVA 5EZOH 3X2QB 4PJIF 5IMLB 1I1FA 2Z4QA 4MD4A 1KGWA 1UM6L 2QQKH 3IKCB 2YXMA 3VFTA 1NGZB 2WZ5A 1PF3A 5IROD 1DBAL 1Q72L 5K9KA 1MCRA 3GS7A 4KAQH 2DQGL 3FDWA 1KLFA 1M6OA 3DYOA 1I1AB 3QUZC 4H7VA 3AT8A 1R3IH 3AWFA 3GNML 2HRLA 4X6EB 4YSPA 4AL8H 4KHXL 1MG2C 5IOKA 3VXRB 4IJ3C 4K3DL 5GS0L 1FVCA 2C9AA 5G4NA 1UM6H 2QQKL 1MJUL 4PHXA 3RWFA 2YXVA 3HI1B 2EIJB 5KYXB 2PR4H 5I28A 3QIWA 4A6YA 2DQCL 3VW3H 4PJDF 2D3LA 2C9PA 2YEZA 4AUYA 2OKMA 3T0WA 4K9EC 1II4E 1ZT4A 3TEXA 5EU7C 3F7YA 1KXVC 3PHOA 4MCZA 5FV2A 1PIGA 2FD6H 5IROA 1JXFA 4UYPA 1A4BA 3ARFD 3W81A 5JXEA 1UT9A 2O61B 3U6XA 4LPTA 3IFPA 4DETA 5IT2L 1RZQA 2GITB 4H40A 1A6AA 2YK1H 3GHBL 2AXGB 3H7LA 3FT4A 5IKCA 1KTJA 4OGXH 4I3SH 3ZL1A 4Y16A 1ZD6A 1XB6A 2VXVH 4L4TA 4WUKL 4PYHA 1U21A 3AC0A 3IS1X 1KIRA 4RWYL 2H8PA 2XZAH 4P3DA 4PJHE 1NLDH 2WAHA 4OD2B 1P4LA 2C3HA 3HKFA 4WO4B 3Q0HA 1DE4A 3I3DA 4IDLA 4QKTA 4Z7QE 4AWJC 1RIHL 3MRQA 1PX4A 3TLRA 1W15A 3APCA 5CCJA 2HX9A 1JE6A 4TPRH 5IFAL 4AIZB 3U4AA 4OJEH 1WC7B 1HHHA 5E94B 2BSDA 1OB1A 5A2BA 3FMGL 3K1DA 1ODAA 4L8SC 3QHZL 3QXVA 1NBZA 4NO0A 3H42H 3UPRB 3T8MA 4HIEA 1XX9C 2P8LB 3BFQG 3OKLA 4XVJL 5CP3A 1ODUA 3FT2B 2WSKA 3LJ3A 2YZ1A 1BQHG 1TDQA 3LEYH 5DJ2B 4MZ2A 3L54A 5C08B 4ODVL 3IJHA 2UZYB 3QHZH 3KGRA 5T33H 5DZ9A 2NLJB 2ADFH 4FQXA 3FUDA 4W68A 4N2NA 5JR1H 4RMVA 1L5GB 3KPRA 3C60D 1MI5E 4KOCA 4PD4K 3SE3A 5IMKA 4BQCA 1EERB 4KHTH 1LO0H 1EO8H 3TC9A 5FGRA 5LWYH 1OW0A 1EEYA 2BVPB 3GJFA 3X14A 4F7KA 2AQSA 2H5UA 3ZIMA 2DQHL 4J8QA 3PHQB 4JPKH 4P57A 4XAKE 5E1HB 3UPCA 1QA9A 3TO4A 5KW9L 4WUKH 3OGOE 1G7JB 3ECUA 2EXSA 1MIML 4NNXA 3MACL 2OCJA 4KO7A 2EIKB 2Z92A 1U4EA 2VITA 4JO1H 4LCIH 4IIZA 4J3TA 2VR3A 3T4YB 3EO0B 1EHNA 2QGEA 3KLAA 3N9GL 4ONGH 4WNQA 1AXSA 2YFOA 1J9QA 2VERA 3P4OA 5AUMB 1VZGA 4KK6D 2J4WH 1HZHL 4GUCA 4C4KT 1L0PA 2YXWA 4X98B 4U1NB 3B2UC 3PS6A 4ANKA 1EWHA 4FQLH 4KXAA 4ZS7H 2EINB 2HWZH 1UZ6F 3IPBA 4PP1C 4JDEA 2NDGA 2NUPB 2R59A 3WY2A 1JHLL 1XL4A 3C5SB 5H4ZA 5H4YA 1UT1A 3Q9QA 4CKQA 4KO5A 1JGEA 3IK2A 2NTFA 5DWPA 4WNQB 4KRLB 4HAKA 2R1XA 4RSYA 1X5KA 4EDWH 3BZEB 3VXRE 3RKDC 3BDYL 1F90H 2LOEA 4BZ1H 1BJ1J 1GAFL 3F2LA 3FT4B 3SDXF 3G5XA 3CVHL 2LV4A 3DOIA 1BFOA 1LK2A 4QXGH 2V2TA 1WCBA 1FLRH 4HUKB 1BLNB 2A6KA 2X2UA 2E75C 1NZRA 1JVOA 2UY7A 3LIZA 3QBTB 4L4VB 5F7FA 4UI2A 1KYAA 3SGEH 3VVWA 1EVUA 1LE5A 1P2CA 2WKOA 1HI6B 3TGXA 1P5UB 1MXGA 1TYJA 2FJSA 3RNQB 4QOKD 4AVHA 1QMUA 1RQ5A 1MFDH 4OJDH 4JFEA 4OJCA 2BY0A 4O51A 4ERSH 4I77L 1BVKA 3D69A 1FI8C 3CX2A 1KEGL 3K6SB 1CFNA 3LPFA 4GY4A 4BE6A 4DERA 2JJVA 2J5LB 4M1CD 1WC7A 4XNUH 5HHPA 1GOHA 1NBZB 3D39A 3BVNB 3BMVA 1M9WA 1DLHB 4C58B 3KVQA 3BSHA 3OSVA 3U9WA 3DVGA 3NTCH 2ZG3A 1R3LA 4UT9L 3N2JA 4L3CB 1GS8A 1FCGA 2EDFA 3BKCL 5CKAA 2K45A 4AGPA 4LXFA 3BKYH 4FL4C 4NN5C 1ZTXE 4K9JA 2HT4D 3VNYA 5I19L 4RGNC 3MBEB 1CG9B 4F1SA 4XGZA 2H0JA 5IB5B 2PP9A 4LK4A 4FJZA 1QEWA 4GI6A 1FFPA 4MRBA 4ZUVB 2O26U 1KJMA 3N5AA 5FWQA 5F7UA 1AI1L 4NGHL 4F9PC 3OJ2C 1TMCB 1KXTA 4M61A 3B2VL 5D2NE 3KJ4C 1SJXA 2NZ1A 2NNRA 3M7FB 4BZ2H 2R8SL 1I8IA 2HYMA 4MBOA 5GGUB 3AQXA 3W9DB 2MJWA 3WLWC 4UV4H 4W9KC 2FO1A 4U3SB 1RI8A 2ZCKH 3TH3T 3FFDA 4KVCH 2IQAA 1SN0A 2D31B 1R47A 2COQA 3FCSA 4M5YH 4TVUA 2BVQA 1I8MA 1TJHH 5B1JC 3VQ2C 2VCOA 3QC6X 4RMWA 3AY4C 2NY5C 1AVAA 3SGKA 1AFVL 1LO3L 2OJEB 3NEXA 3T6WA 4DNLA 1RJZB 4HJEA 1R3JB 2GFBA 3W11D 2AC0A 1YQVL 3M8OH 2E6QA 4IRJA 4H8QA 4R0LC 4CA4A 43C9B 4CVUA 3LRSB 1S46A 2R23B 3KBHE 4IOSD 3U0WL 5CIPH 2VN4A 2V5RA 2BVQB 1I8MB 1Q9WB 1AGCA 4D0BB 2WO2B 3APNA 3C60B 2DS4A 2J20A 3OKYA 3JWNH 4P5TA 4WI8A 5DTFA 4ZTEA 1MCNA 2A38A 3LSOA 1DN0B 1PSKL 1NA8A 3MUGA 1ZGLA 1UZ8A 5HPMA 2E9BA 2XX1A 5FGCE 1ADQL 2JJTC 3JWNG 1VZHA 1KYFA 1T0OA 3NCBB 3PY9A 3QZBA 2JCWA 2G3ZA 1ZOXA 5DJDB 3CVCA 4CNIB 1KCSH 1TZGH 3I6KA 3IE4A 3DOSB 5CF3A 4IIQB 4P2AA 1FGNL 4AQ8A 5KSVB 1OO2A 3Q8EA 5DD3H 4FF9A 3NCXA 1RSYA 5ICXB 3RZCC 3V5DA 1NMBL 4K8RH 1MQKH 4L4VA 1KTKE 4X7EC 1XR9A 3N1MC 2EH8L 5FDYA 5BO1L 5E6IC 4NC1C 3ULVD 4GKNB 4HGMA 2BY1A 1ZEAH 3QIBD 3NEOA 1QUPA 3QS3A 4P2RB 5GS0C 3SE4A 5FKPB 3MRHA 3DHJA 3I75A 3MJ7A 5KSAA 3KPMA 3H2QA 3QNXA 1CF8H 3OJVC 5JHAA 2J43A 5CJ8A 4X7SH 4PWKA 2WXRA 1TQWA 3BVNA 1WFIA 2XFXB 4TULL 5I26A 3F84A 4L3EE 3S36L 3NIGF 1ZLDA 3DVGB 2BOCA 3P0YL 4M7JH 4D3CL 5L4IA 4NRYA 5EBLA 3QDMD 2OW7A 4XVSL 1IAOA 4PGCB 5AYQA 3FB7B 4YIQB 1AR1D 1D2PA 4PJ9D 4QCIA 4LU5H 3BXNA 3C9NA 4QRPA 2IPUK 2HT2D 2YJQA 4B96A 4EI6B 3LS5H 3FFCB 2CE6A 2UZPA 2V2XA 4FULA 3DV4A 1ASPA 3L9YA 1I9RH 4ZUWB 3S3BB 5IJVA 4WGKA 5AWNH 1UACL 4DP0X 3JZYA 3KGSA 2HKFH 4P2OC 5C6PB 2EDRA 1YYMH 2BZCA 2YAHA 3ATEA 5DJYB 4F8PA 5JHDD 3WU1A 2QVKA 3MFGB 2XXMB 1Z5LB 4Y2LA 2WO3B 5M95B 3TBSA 3W39B 2JIXB 5C07D 1MVYA 1XBDA 4KUCF 4RIRA 3E3QC 4RMSA 1BGXH 2CJUH 2NY0C 2UWEB 4KNUA 3C2SA 3CFMA 4KKBC 1TPXB 3ZYZA 2YEVB 5DMYA 5CILL 2R2CA 5EU6E 4GXVH 3QPQD 3QJHA 1XCWA 1ZTXH 4LIQE 4M4PA 5EU6D 1UD5A 4TSBH 3OKOB 3FFCA 3QZOA 4YX2L 2YD9A 5KVEL 2MCPH 5EZJA 4OCYL 1AMXA 3H8NA 3OHXA 3E9UA 2CK0L 7PCYA 3A21A 3V4PB 5DK0B 1MCKA 4AENA 3EDFA 3ZO9A 1FQ9C 4G5AA 32C2B 3ZJAA 2VMJA 1BZEA 1JWUB 1YUHB 5LXVA 4DAGL 5IF0A 5JUEH 5I15L 4XXWC 1IT9L 3EOBA 3MLXL 3M1OA 1PLBA 1XGRA 2J56A 2OX5B 2P80D 4OIIL 2EVGA 2G4EA 3ESMA 3MOBL 4NNXB 2OQJB 3ZT7A 3REVB 4JKPH 2XCMC 5ILTH 3I2CL 3U4BH 3BN9C 2VLMD 1DBKL 3FYIB 3V0JA 2W38A 4DP5X 4RMRA 1JWUA 1PCXA 4I1NB 5LBGA 2XRAL 4UV7H 4OSUH 1C5CL 2WJ7A 1FHNA 4AKQA 1Y6KR 1F8TH 5FCUL 2YUZA 3QFDA 5F9JA 3DX8A 1ZLVK 1UOKA 1A9BA 4XCNA 2IDSA 1HSBB 1QZ1A 1KEML 4YZWA 4Q56A 2VXQA 1JK8B 2WYHA 5FUOL 1IGFL 5J12C 2UVFA 3D9AL 3OC5A 1S3KH 3WXWL 1X6LA 4NT6B 5DRXB 4N85A 4ONFH 1LYQA 3NN8A 1CT8A 1ZT1A 2X4NA 3S35X 3DYMA 1K6QH 3JT2A 2PWGA 3LDBB 3LRMA 1TVBA 3DV6B 2C1PB 4HIJA 4MMYA 1T0MB 4XWOC 1T20B 1F4HA 4QCIB 3QFJB 5E24E 4OFKA 1CPUA 1HCZA 3KJ6H 4L48A 2EEAA 5KG9B 2R4SL 4IK7A 1MIEL 1RJYA 1YY8B 1E4WH 2GJ6A 3UG5A 5DEZA 4XBEH 2HJLB 3WNMA 3BP6A 1MHCB 2DQTH 3PL6C 4Z7OF 4IIQC 2R51A 2OZ4L 4FG4A 4Y9GA 2ZWSA 4QYAA 2NW3B 1ED3A 4ZTOL 1MFEH 2BJMH 4S1SL 3W5NA 1CMOA 2BS71 4YSTA 5H94B 4PG9A 2MHAA 4PY8J 4AIZA 2XWRA 3NP4A 3GI9H 5C0CA 1PKOA 3AMLA 3WO3B 3FTVA 4DF9A 1OSZA 1GIGL 4BA8A 1EFXA 4YHPB 5BRQA 3LHPL 1XZ0A 4EDXB 5IBTH 2BY2A 2CD0A 2PXYA 2BRRL 2Z0BA 4Y4FB 5AZEL 3HI1A 3APFA 2AABL 1WE5A 3MLYH 1NGYB 5TF1H 4Q9RH 5HYSA 1ZY9A 3MGTB 1MW0A 4LLMA 1G7PB 3FQNB 5ANMB 2KZWA 1H3TA 3NDZE 1U33A 4BKLA 2AVGA 3MNVB 4PV8B 1CURA 2GSGA 5EU6A 5GGVY 2ICEA 4EDXA 3US1A 5D4IA 3GMPA 5FYJH 4P05A 5B21A 3QCUL 2DQ6A 1XZWA 2H2SD 4Z9KB 5HYSB 2UZIH 1VKXA 1PZ3A 3NJHA 2BNUA 3JWNC 4G6AC 4FXKC 2OA9A 2OMVB 3KJ4B 4FZEH 4W9ZA 1DEEA 5FW8A 4RAVA 1QRNB 2JQMA 4PREB 3VFNB 4PRPE 2GUYA 5GJTL 1OAUL 4J6IA 2BY3A 3MPCA 4NI6A 4ZMXA 5C0GB 3KMDA 1X5GA 5DK2B 5IVXB 1K5NB 2H3NA 4ENEC 1UFGA 1TT6A 1OP3K 3WHXA 3IVKA 4LQFH 4DPBX 3MBEC 2B59A 3VYNA 4FFYL 3PPSA 1FO0L 1NFDF 2VSDA 1UJTA 3BESR 5LGHH 4X50A 4HV8A 4JFYB 3U2SB 4O00A 5GRUH 4LSRL 1KYUA 1IGTB 4G80B 4ALAH 1AGCB 4HQQH 2QHRH 5E8DH 5IJBC 3IKCA 2DLIA 3MTRA 4PJXE 4X9IA 2OMUB 5CGYD 3NRFA 3BSZA 1GGCH 2ADGB 1NLDL 1UJ3A 2L7UA 5I8EB 1TZ8A 1ORSB 5E99L 1KPRA 4HJ0D 2C1OB 3FW6A 4HHWA 2I07A 4LSTH 2GW5A 5CD3A 1CDBA 1QFWL 4LSSH 1UENA 4QYOB 2VWEE 4PJ5D 1IBGH 1ZWIB 4OLYH 3NN8B 4MLSA 1U3HA 5IM7A 1CTMA 4KVNL 3CLEH 2QKIC 3N40F 1ZS2A 2C3VA 2JKWA 4XCYA 4P5MA 3K6DA 5FB8B 4CRPA 2N7SA 1NCBH 4DVRH 3POHA 1WO2A 2RHEA 4PTTA 2G0LA 2XN9E 5H94A 5KSBB 3R7QA 3K71B 3FTWA 1DBBL 3PNWB 3IWUA 4L3CA 4GBXA 1UWEH 5LAPA 2NXZD 2WZ6A 4OBSA 2PLTA 1A7QL 2WWMC 2XICA 1CFQA 4P3CH 4Y4KB 2Y7NA 3F8UB 1E50A 1OSZB 1EGJL 2C8NA 3UTQB 1QX1A 1G6RL 5IK3B 2VRQA 4NS0A 5DD3L 2CLVA 5I75B 2VDNB 4PG9B 1JPFA 1Z2KA 3OSKA 4HLZH 2HN7B 2X4OA 2LU7A 3WD5H 3FMGH 1RUMH 3CBJB 2Q5BA 4U6HB 4IM8A 2A4ZA 2ZUVA 3C8DA 3OKMB 4PRPB 4BGLA 5BVPH 5B39G 2Q2EB 1XIWD 4BKTC 4JO3H 3QI9C 4JRWA 1NGWB 4B53A 4NO5B 3C6SB 1FJ1B 2WKGA 3VCLA 1KB5L 1GJWA 4J6RL 2FIRT 4HALA 2V9QA 3D33A 4JG0L 1RUQH 3HJEA 3VD4A 4KI5F 5DQJB 3NFPB 3VFOA 5KS9A 3D2UD 5IB2A 4HGKC 3QEQD 1LO5B 2Q87A 2V2WB 1BAFL 4JFXB 4LP8A 1GKEA 1X5JA 2WLIA 3QCVL 4L29B 4TSAH 4B0MB 1MF2L 1N7ML 1MCDA 5D9SB 1IGCL 3SKNA 1DZ0A 2PYEA 2F7OA 1JWMA 3GXPA 1I7ZA 5IBUG 4WDIA 3EH1A 1N3NB 3FT2A 1CU4H 4L2LA 4I2XA 1TENA 2IFFH 3PJNA 5EBGA 1SBBA 2VM3A 1J8HA 4QT5A 4CL7A 4PJBE 3ARBD 3QDHA 3RFZA 2Z1PA 3KPRD 3CXDH 3IJ9A 5EZIH 1MF2H 3EHBC 2VLME 4F7EA 1N8ZA 3GRWA 1IC1A 2K3HA 4J4PC 2R0WH 3DLQR 3AT9A 3QEQA 4X5RA 1IBHA 2QADC 2TSAA 2VLJA 4XPAL 5AVWB 4PS4H 3ATFA 3HFFA 3OWEA 3WI9A 4F5CE 3AABA 1GZHA 1QUNA 1Y1DA 3KWXA 4HEME 5F8QC 1J8HB 3TA4D 3VWKB 2BNQD 3HHMA 1RJLA 4I9WE 2UUDH 5FIEA 2A9MH 5J11C 2EEFA 4MCZB 5KBNC 2Y7OA 3IN0A 1FA4A 2Z8RA 3QDME 1ZXKA 1YMHB 1ZHNA 1A6UH 3GSNL 5IIEA 1KCVH 1U3HB 2FO4B 5I1GL 1F58H 3BDYH 3JV0A 5DUJA 4PS4L 3MNWA 4R5VA 1JV2B 1HTYA 1YRKA 3FUFA 4N90E 4QHPA 2EXTA 2WLNA 5KWYC 4I89A 2WLMA 2JTDA 3PXLA 3JTSB 2V9UA 1WG3A 5FUCC 1TTAA 1YJDL 5DWUH 1X5ZA 2BSEA 5FGBC 3DO7A 2GTZB 1NCDL 4NZUL 2FL5B 2MCAA 4BUHA 3MV7B 1CZ8H 3GXUB 2C4FT 5HPOA 4QY8A 1BFSA 4RFNC 1WZKA 3S5LA 2E7HA 2CHZA 5HVFB 2FTAA 1Z7JA 2B20A 3BZFA 4XBGB 3NZHH 4HZ1A 4ZT1A 3BFWA 3PE9A 1IE4A 4YIQA 4WAFA 3MBED 3KLHD 2V8LA 3HRZC 4HIEB 4PTUB 3UROR 2E5EA 4XN8A 1U3NA 3TA3D 3O6KL 2AJUH 1E3ZA 2AF2A 2HN7A 3KPSB 4PN6A 3VFOB 4IRSA 2HVJB 3L7EB 4NSKA 3FOMA 5HYQA 3OGCB 2VABB 5DZNA 2BDNH 5LDUA 1JGDA 1S5IL 4IBUA 1JJUA 1AGBA 4GI8A 2VDLL 5B8CB 5LNGA 4HD9A 3KS0H 5I73B 3DTXB 1QSEB 4JJ5A 3PWJB 4ZW6A 2QSCH 1DSYA 3QFJE 4X8JB 1JZ3A 1B88A 4W6XB 3DV4B 1I9EA 3WTSA 1OP3H 2DQMA 4LEOB 2FNBA 1HZHH 2AW2A 5D1ZD 4AC4A 2EYSA 3ULVF 4LNVA 3WLBA 4JO4L 2NQDA 1BF8A 1UQSA 2BWIA 3L4TA 4PJFB 1RUAH 3MROB 4APQA 3ZE1B 1A1NB 5I66B 3AQZA 2ARJB 1JYWA 1KGUA 3KCPB 1ZSDB 1FH2A 2W9DH 5LO7A 3GBNL 3P73B 2MCMA 3U1SH 3PL6A 2FEDC 3MLUH 2HZHA 1KELL 5CZKA 3RUGE 2K9UA 3VTTA 4M5YL 1I85A 4ZXBB 1FORL 2CO2A 2RB8A 5A2IH 2DL9A 2BVTA 2PPCA 3BD4A 4KVCL 2VDKB 4MAZA 3MREA 1N0XL 2GBVA 3TBWB 1B0GB 2AK4E 5GGSB 5KANG 2H2PD 3NT0A 2OR9L 3RPIA 3FU5A 4XODA 3B2PA 4FTVE 2H7WA 3P0VL 4LP5A 4UZSA 1TIUA 3ZHLA 4N2IA 4CMHC 1NGXB 5T5FA 4ZQTA 2BSCA 4PUBL 5CBAA 1A7RH 4YPGB 2Z6FA 2EDKA 2J25A 3D51A 2VSKB 3NZUA 4TUKH 2HG5B 4ZDHB 3CFUA 2VC2L 2IWFA 1I8AA 2K70A 4DZBA 1FHGA 1MCFA 5EOQL 1IIKA 3UBXB 2ICEC 3CWGA 1AJ7H 4OB5H 5FYKL 4B27A 3DK0A 4LLVA 4OVVA 2G4GA 3HG5A 43C9A 4WLCA 5T1LA 1PLCA 4LHUA 3F3HA 1S7WB 4R2GC 2DW5A 4PGDA 4KUCD 1LDSA 2O5ZL 1FZJB 2YXFA 4S2SA 2ZP9A 2FQEA 1CFNB 1CGWA 3QNZB 1CI3M 2XVGA 4F91B 2ATAA 3T77A 2E9JA 3MA7B 4KKCC 1DDHB 3GRWH 1FNLA 4GPVA 3UEQA 1UC6A 1TKWB 2CBOA 3QH3A 2NT1A 2OPCA 3MBEA 4ZFGH 1L3WA 2YBGA 4O2EB 4PJ8C 1YNLL 5K9JH 1ZDSA 5BZWA 2XJLA 2X44D 4LARH 2FEJA 2IDTA 5DEGA 5GQBA 2XWJB 4BZYA 3GRWL 3L81A 4LHUD 4HUXB 3T9WA 1QSEA 5LBSL 2WMPB 2VR4A 3Q06A 5F9OL 3MKKA 3ZUNC 2V9TA 2GJ6B 5C0EA 3FOMB 1UJ3C 1S9XA 2I24N 4YE0A 3FQ2A 2J12B 4PG2A 1MWAL 4OF7A 4U2YA 3S48A 4C57C 3ABMB 1YEHL 2J2ZB 5JA8B 4GRWF 1N2RA 2HX8A 2ZF9A 4JPQA 1PKQA 5SWZD 4A37A 3QPQC 3VRIB 5KVDE 4X6CA 1RPKA 4JMXA 4UB0L 5KVFE 3GNMH 5DC4B 3L2NA 1PZSA 3N6YA 4HPYL 2DPKA 1MCEA 3CN3A 2RFXA 4GSDL 4NN5B 1UWYA 4MQXD 3S37X 3SZKC 4X4KA 4H0LC 5B4MC 4XNBA 1XCTA 3EYFA 3OXSA 5A2JH 2Z34A 1JXGA 5CZXD 5FPIA 5INDB 4IU2A 5E8EB 2HLFD 4TXVB 5KVMC 4PY8I 4UQ9A 5AYTA 3VU2A 2IIJA 4BWTA 2QMKA 3C2AL 4AZ8B 3FH8A 2FQFA 1E8YA 3QJOA 4OD1L 4OF6A 4YO0B 2WBJD 3QWOA 5DJ8B 3ZU8A 2UUDK 5C09B 4NN6C 3MV9D 4P2OD 2QPDB 2R1WA 4YXLL 4LRIA 1U91B 2AXWA 4PR5A 1CK0L 1MCIA 3VH8A 4RAHA 5BQ7A 2X4NB 4NHUA 3ZOAA 4M8QA 3BE1H 2OM5A 1MREL 4NUGL 1MCQA 4ZSOB 2EECA 4ODHL 4PMEA 4G9DA 5BUAA 1PX3A 3ME0A 1KYOK 4N2BA 2EIBA 2BOLA 4TV3A 3HI5H 3MRPA 1YLBB 1RFDH 5HJ3A 1WZLA 3HLAA 1IAIL 3ASNB 1JFQH 3K2IA 5HDBF 2ERJC 3VFGH 4AL8C 4ES8A 2ZWLT 2XN9D 3V6ZB 1IARB 3GZPA 3QK0A 4FKEA 1VADA 2IG2H 2FT6A 5ECGA 4GH7B 5J3HC 5LXGL 4FC3E 1AGDA 3U36B 5JW4N 1T66C 3GIVB 4ZXBD 1JF1A 5D71L 3GMQA 3LKRA 5HJ3B 3N43B 3MRGB 2NY3C 3QO1A 5ILTL 3POCA 5F21B 3C5SA 5C09A 1I9JL 2F74A 5JHLA 1XH3A 3MYJA 4PMFA 1BV8A 1UB5B 2QGCA 3IJEA 4GINA 3BH4A 2YD7A 3RWCA 7FABL 2D03H 3SO3C 2ED8A 3CFCL 3TN0C 3EH3B 4O2EA 4CJ1A 1MAKA 3AG2B 4YBQD 4OGYL 2CRIA 3MI6A 2WPGA 5E56A 3QUYD 5JDSA 4PJHA 1UEYA 4E41B 4RFEB 1BEXA 1JHTA 2A2QT 1DO6A 1URIA 3MV7E 4JG5A 1ERNA 4Y4HD 1DQDL 2C26A 3IXAA 5ALBH 2HWZL 3RGVC 1ZLSH 5JLZA 5JPNC 4L05A 5ESAB 2LQRA 4JY6B 1A14L 3O45B 1RPUA 5CEZH 3WAJA 3PP4L 2AJYL 3QO0A 4MTMA 2BC4A 1SMAA 2P43B 2JKSA 4A68A 3T8VA 3MLTB 4WY7L 3MRCA 5F44A 1THAA 1SLUA 1GY1A 2EC9U 4JRLA 4G42A 4JBSA 5JHDA 3PRZA 1K8DA 1QHPA 1PJWA 3B1TA 3NSDA 4XVUD 2B3RA 3RVXC 5TPWH 3R4RA 4G9FA 4DCQA 4Z5RA 4DP2X 1EBPA 3L3DA 3FONA 4AEFA 4E9QA 2IJ0C 4X9BA 4Y4HA 1NC2B 4DPRA 4K9EL 1MI5A 4U1HA 3ZDXF 3NAAL 3WUWB 2DQDH 5B1AB 4I9WD 2CO7A 5HYJA 4F8TA 4TNWF 5KS9F 3FUNA 3ZE2F 1YEKH 1EAQA 1CIUA 3I3BA 4DW2L 3C08L 1R5VA 5BS0E 1TQUA 1QEXA 5E95B 4XMWA 3AADB 3V9FA 1KB5B 4V11A 2W0PA 5DZAA 3WNLA 3UG3A 3WKNA 3ZGIA 1ZK5A 2Q8BL 5EU6B 4Q4IA 3AS0A 2FYYA 2NX5E 2BZDA 3BPOC 4NBZB 4WIQA 3QDJA 2J88H 4I87A 4TOYL 1ZLVH 4ZFFB 1JG9A 2YD3A 3V55A 4BQ6A 1DVSA 1QATA 2YFNA 2V33A 4BQ8A 1EXUB 3EXJA 1ZS8A 2VUOA 5DRZA 2DKMA 2Y3NA 3GI8H 5CZVH 3TWCH 4AE1A 4KTGA 4XNXL 2EUXA 4N2EA 1HCYA 4O02B 1KNOB 4DPCX 1OTTD 5BO1H 3DETC 4ZAKD 4HUUB 4D7PA 4DKAA 4AKOA 3Q43A 1CICC 3FUHA 4P9HC 1CICB 4CMHB 2HRGA 1N6QH 2M8XA 4H2CA 4NO2A 3FRPB 4OZGF 4U2ZA 3V6FB 3CC5B 3VXRA 4JREC 5DMIH 1PNDA 3CFJA 2ZP8A 2ZWKA 5EUOE 1TZGL 2HVBA 4P5TB 4H0IA 5DTFB 4DN4L 3BRFA 4ZOCA 3NFNA 3AZUA 3EYQD 3QIWB 3O2WL 5JQHC 3KXFA 3F5WA 4TYUA 4PBXA 4AEIL 2X0WA 4PJ5B 4FP8H 2F15A 4FXGA 2G9HA 4KY2A 4HG4J 4HUNB 3BKCH 3JZ7A 3KYNA 4NQDE 2OJZL 3QUYA 4L5FH 2X9YA 1BQSA 4Q0XH 5CBEB 2Y9RT 3RAJH 3X13B 1CICD 5D1XE 4ELDA 3IVKB 4AW7A 1EUUA 3VFVB 1P6FA 5GGVH 4KUZH 4DZBB 3MV7A 5FA4A 1L9RA 2WINA 1NCOA 1WDAA 4R7VA 3ULVH 5E51A 1LEKB 1FYTD 4XP9L 5ITBH 3WSQH 1W6LA 3MRBA 3B37A 5GZOA 2QPEB 4A38A 3R1GL 1OD7A 3K0WA 5G5DA 5HHOA 2B9BA 2RQ8A 1Q0YH 3WUZA 1FBIL 3HVDA 2X2HA 3RIAF 2PW1B 4O4YL 2B77A 2CCWA 4S1QH 4AKPA 1J5OL 4YK4B 3W57A 5IHZB 3T77B 4K2UL 3IMBA 4IBTA 3UCQA 1JGUH 1GOFA 1ZLEA 3UAAA 3U30B 4N0FB 2PP8A 1CN4A 3QUMB 5IREA 3MDJA 4OCXH 2CQVA 4JREB 1Z3RA 3CK0L 2AK1L 3EYUL 5KANI 2QLYA 2N56A 4X5XB 2UVEA 4K23L 4ZQKB 3RGVB 4QXTB 4Z7NF 3Q13A 3VMOA 5E9DD 1QR1A 5F89B 3U1QA 3F7RA 1H0DB 4W6WB 3PNRB 1P4IH 5HVGB 2NSQA 2NY1C 4HKBB 1XGPA 1JXJA 1L5GA 3BH8A 2B2XH 3BRDA 1OAKL 1MCBA 3S88H 1EMTL 5KBMA 3W56A 3GIZH 1U8MA 3AG1B 2GT9A 1IEAB 4AK2A 2MQ3A 3K8LA 1NEZA 1CFTB 1LWRA 2D31A 3DRQB 3GEWB 3M6DA 4FQJH 3RI5K 4PJFF 3RWEB 2CAKA 3WY1A 3FRUA 5H2BB 3VFWA 3SDDC 1OAYL 5FGSA 2NUTA 5K1JA 5I1KH 4UQ3A 5I8OL 4KZDH 3TBWA 2WCGA 3SCMA 3OAUH 4OCYH 3BCDA 4FX5A 4PG2C 1ADQA 4HH9B 3VWKC 3WS3B 1P6AB 2VLLA 2O72A 1TFPA 2WXMA 3BUQA 5F9AC 1FORH 2ENYA 3LEVL 4BSVA 1HHKB 5AAPA 2DWEA 3VFWB 5FO7A 1TG8A 4WHYG 1DP0A 1ND0B 3ARFA 1CXLA 5F0PB 4MAYA 1LILA 1CGTA 2O93L 5I1CL 5FO9B 1JVKA 3C12A 1VLXA 1P7BA 4PBDA 4Z0BL 4PRDB 4MZRA 3L2LA 3RA7H 1TR7A 4CAGA 4EDWL 2ROXA 4Q2ZB 4KZEL 3LS4H 3E2HB 4BH8B 1CGVA 3BZEA 4EI5D 1XGRB 2OX5A 3FO9B 1D5BB 4H8PA 5GGRY 1DJHA 4D0CA 4MZIA 4EUPG 4KK5D 1ULVA 1ZT7A 3NCYP 3S88L 4WVRA 1B4RA 2OSLB 1H8LA 1NAKH 4FEIA 4K7PX 5DK3A 4PJDE 3KL5A 4NKIH 3K7UA 4LRIC 4NQQA 4TN9A 2IH3A 1VEOA 4YUEH 4NPYB 1VADB 4D94A 3B2XA 4GBXD 4X6BA 2ZX9A 2EE6A 3WEBA 4JL1A 4QHUB 4FABL 4ZUSA 1A4JA 3MJWA 5EPMA 3UZVA 3HC4L 1SZNA 1BCIA 1PZ5B 4I9XA 2APWA 3CC1A 1EAOA 2R4RH 1R3HB 3RJOA 2IV9A 5KW9H 5I16B 3ULUE 5IFJA 2B5IC 2GIXA 5EBMA 2X4PB 5E1QA 3RU8L 2UY7B 4TULH 1NGWA 3G9VA 3U83A 5JQ6H 5KTEH 2JELH 3PGDA 1L9SA 4YUEL 3CVDA 1SF5A 5GGSY 4JFPA 5HHXL 2SODB 1OM3L 2KPWA 3EO1B 3O2VL 4Q52A 4WWKD 3HMXH 2VUKA 2YIHA 4LEEA 4WRLA 3APDA 2J8UE 1RZGB 4P46D 1A6ZB 1H8NA 4WV1B 5JIHA 1ACXA 1JMXA 3VX1A 1F1GA 2WKLA 2EVJA 5E23A 5T33L 4H8HA 2Y7MA 3OBAA 3VDAA 4D0DB 4Y2OB 4E41E 2WTOA 3QXAA 4NZRL 2F53E 5CR1A 1JWMB 1INEH 2LVCA 3UPAA 5EEYA 3UAJD 5TH2B 3HC0B 5DHYA 3LN5B 1KF9B 4V1DE 3RL1A 5IG7A 1NANH 3L3JB 1DQJB 1CFTA 1NBVL 3DRQA 3EO0A 4WUUE 3F7LA 3IDMB 4ADIA 4TUOA 1DVUA 1NSNH 4GRWB 2XV0A 3W0WB 2F5AL 3BWSA 3JWOH 3C8HA 5T1MA 1SLXA 3MLZH 3ILQD 2G5BA 1QI3A 3FN0L 5JPNA 4P2RE 5E08H 2P52A 1QNZH 4ZX3A 4DZ8A 5I17B 1IGML 5DVMA 4L3EB 4DVBA 4M5TA 3DMMD 1DQLH 5E00A 1GXEA 3HAEA 4P23A 4XP1L 3ZX1A 4AX3A 5LNEA 3QB7C 1QWUA 3T3PB 2VLJD 1JCVA 4JFVA 4MA8L 2IDQA 3QNYA 2J44A 3MNVA 1JFHA 4HF5H 4PV8A 3QNZA 4U6VH 1A7BA 3S5ZA 3FC8A 5KVEH 5CGMA 2PTUA 3LQZB 1LO3H 1UZ6E 3TPKA 4EZMA 4ZMAT 4I7ZC 1WIUA 3ELQA 3MRFB 1U8QB 5L0QB 2XTJD 1EV2E 2IV8A 2QJDA 2UXVA 3MNDA 2W65B 3GI8L 4X4ME 2R27A 35C8H 3OF6D 1DJIA 1M6OB 5F0MB 1MREH 3R18A 2ZCKL 4LCWB 4PWGA 1SPDA 1BM3L 3B5TA 5FKAA 1T83A 3BHBB 4FQPA 2WANA 3RWDB 1CXKA 1JD7A 4PJ5E 4QOKA 1GGIL 1I1YB 1U8IA 1VACA 4H13C 3HG1D 5C9KA 5FYKE 2ZTBA 2R2BB 4ZMQA 4OV6F 2OP4L 3JBG7 5LBVA 3I9GL 1FIEA 1TNNA 2HFTA 1KJ2H 3FN3A 2HKHH 4UANA 3FT3A 5CD5D 2IADB 1X9LA 2X6CA 4KDVA 4QXVA 2ZG2A 3JV4A 4HV8B 4JFYA 3U2SA 3RDTC 2YARA 4ABWA 3STBA 5E5LA 4P59H 5J9PA 2JK5B 4UNUA 4UQBA 1QSFE 1GW0A 1AXIB 4PJXB 3ECBB 1V55B 3JWDL 5EU5B 1RK1A 3GJFK 2K7PA 4LPYA 2DD8H 3V4PH 4PJCB 3ZUCA 4YSEA 2ZOWA 1PMYA 3VFMB 1MJ8L 2I9LA 2WW8A 3HG1B 4AT6A 4MDJB 3TA3C 4EKXA 3BO8B 1MAJA 2YMXH 1T1XB 2A74C 2K78A 5KVGL 2VXUL 2BP3A 2E46A 1SOSA 4JZNB 5AVTB 4CDGC 4UMGA 2XZQL 3ZMEA 3GMLB 2FJGA 1NCJA 5C6WH 1W0VA 3QH3B 3AM8C 5TDNA 5J6HA 3ZE2B 4PJIB 1T4KA 5AOJA 1FFOB 1QLEB 4P2QE 3BMWA 5CJOH 4GXUN 2I9LB 4HKXB 4A2EA 1QPPA 5SX4I 3C09C 4JFFB 1FDLH 2IH9A 1O9VA 3GJEB 3HRZB 4X99B 1I7RA 4L18A 1HDMB 3LPGA 1MCPH 3KNBB 4QI3A 1A1NA 5D6DA 5ANHA 2NR6A 4BBWA 1G9MH 4MMZC 5KJ7E 4O4YH 3BYTA 3VTAA 5L88H 4S1RH 2EYRB 4LEOA 3AXIA 4OLXH 3BH9B 1Q0XH 2MIZA 3ZT6A 1G7LB 1YEJH 3MSPA 1UCBH 4HKZB 3P2DA 4XZ4A 4CU6A 4U1GC 5KAQF 3LVEA 3KYAA 4Z1PA 4A1RA 1ONQB 1R46A 3IDMA 5E00B 2AS5M 1C08A 1GY2A 3ARUA 3LDBC 5CEYA 1OOWA 3HPJB 3T0ED 3VRLF 2VISA 1YJDC 1HWWA 3DYPA 3DPBA 2FUQA 1KCUH 4OQ1A 4S1RL 1NUDA 3IFLH 2GBAA 3JV6B 4J2QA 5GZOC 5JPMB 1C1EH 3FB8A 3MCYA 4AYFB 3IXTB 4DQOH 1CVRA 2G75A 3N85H 5B3NA 3CFBA 2XWDA 2DIEA 1U4FA 1COBA 2E7CA 4G6KL 3IDNB 4NUQA 2KC0A 3BT2L 4E5XB 3DJ9A 1RHHB 2OAAA 2XIIA 4J4PD 1E9PA 4YLCA 4UTBH 1GSKA 1Z5LA 4APXB 2EADA 4PVBA 2PCFA 3O3BA 1T2XA 2CUHA 3NA9L 3BEVB 1YN7A 4Z7IA 3T0EB 3ARBC 2A7BA 2C3XA 1ZV9A 2FJFB 1I9RL 1H15A 4HJSA 3SPJA 1TJGL 4EZLA 3CBKB 3QWRD 4MA7L 4OCRH 2F1BA 4JLRA 1X3DA 1KXHA 5B38A 2X0VA 2WBJC 1QBML 3O45A 2DWXA 4JZJC 1WRFA 1HILB 4M7JL 2UY6A 4UTAH 4Q9QH 4WI7A 2RCSH 1X5IA 3ZBMA 3VACA 2H3XC 3ARGD 2WVTA 4R2GD 1TPXC 4L1SA 3SDDA 1IFHH 4TVPL 3GIVA 3RYMA 3PP4H 4Y1TA 3P4MB 3VXQA 2RMNA 3ME0B 1A14H 3ESOA 3FU3A 2OQJA 4K7PL 3I6GB 2QR0A 4JHWL 2FATH 4NN7B 1RAMA 2VR9A 4YDJA 1N26A 2F54B 4HWNA 4JQIA 3SKOA 4Y5VA 5IVOA 4CSTA 3QT2A 1CLCA 1DQVA 3DTUB 4M29A 1J0YA 4XPFL 1OTSD 1X4XA 1R19A 4PLKC 4MAYC 3BAIA 5AKVA 3CZFA 1I4FB 1YEDA 2IOOA 5KZCB 1HNYA 2AV7B 3AAZA 3GGWB 3W2DL 4PRHB 1P7KB 2DBLH 4XC1H 3VWJA 3K4ZA 1SUJA 3OR6B 3ARGA 4HT1L 4NX0A 4M6ML 4I8DA 1E65A 1U8HB 3O8XB 3IWVA 2VXSH 2G3XA 2YGQA 4KJYA 5DCCA 3AG3B 5MEOB 4XXDA 4HOWA 1M3JA 2D0HA 1QABA 1F00I 1IAMA 3A4DA 4Y4KC 1CGSH 2OZNA 3GINA 4L8DA 5ICYA 1BA9A 5AG9A 3PP3K 4NWTH 1F13A 1S3KL 2IMNA 4X8CA 2ZXCA 4Z76A 5IB1B 2ERJB 4I3RH 3QEHB 1A3ZA 3ULUC 1NCDH 2IPKB 3TV3H 2MTAA 3GHEH 2QZ5A 1AR1B 5IMOA 1PEZA 3ZKXB 2PCXA 1T7XA 2FEEL 4H1LG 5CJXA 1E67A 4RGNE 1EH9A 4GRWE 5GRJL 5I1LB 3NIDE 4OJAA 5TGBB 2VR8A 4TNVK 1FNFA 1KCRH 5HHVH 2RACA 1A6UL 2YOAA 3GSNH 2VUYA 4PI2A 4RETB 5F72S 2EDQA 4IMLB 2P7TA 5C0EB 3VQ1C 5EFIB 3JWDH 4ESKA 4LOUC 2ESVA 1EIBA 5IGXH 4OZHA 4LF3B 5LBSA 4LDCA 3S3JA 3H4FA 2R39A 3I3EA 1AI1H 2DLHA 3MNZA 2LLGA 3O9WD 5JOFB 1S9WA 3R4DA 3FUMA 4U3HA 2ZOLB 5EEXA 1SNRA 3P77B 4GQPH 5B7FA 1OAQH 4GMSL 3O6ML 1F5WA 4C56B 3CXFA 1SXNA 3EF4A 3I9GH 3TVMC 3VXOB 4BWUA 5C70A 4MB3A 3ZE1E 3ZVVA 2YGNA 3VUAA 5CSZB 1E4KA 1LEKA 1JI1A 3CBRA 4XX1G 5ETUA 2A83B 4N87A 4HWEH 3H9SE 4LMQE 4Z3GA 4QLRA 4YFLF 3RWFB 3O3AB 4AJVA 3GSWB 1XGZA 5CXPA 5EOTA 4FQQB 3OX8B 4X4YB 1BD2D 3QDJD 3X1FA 5BPPA 2E7LC 1IAIM 2WSPA 2O1AA 4U0RC 4QRRA 2KHAA 3SQRA 1AD0B 2QSTA 2YAFA 1SJEA 3D5OF 2QELA 3SBWC 1FJ1A 4LESA 5L2KA 5C0GA 4HWBL 3DA0A 5ISZE 4G7VL 3ROLB 4E9WA 2R15A 5DD6A 1E6JH 4XPTL 4DN4H 4NZTL 3V5DB 1DQLL 4LVHC 2AZUA 5H8DA 1I1YA 1U8IB 2PO6A 1NLBL 4HJJL 1AD0A 4U4BA 2PWEA 4K9EH 1K72A 5BZDA 2KMWA 3IGAB 2ETWA 3IFLL 3WIFA 2QKIB 2VLRA 2ZD0A 3L9RA 2YN3A 5IGXL 3T5WA 2FX7H 1VSCA 3IGLA 3RWHA 3FU6A 5D93C 4DP8X 4YSUA 3G7TA 3CE1A 4ANWA 4QKXB 2EIEA 4F7TA 2PO6B 2WNXA 5DO2D 1YMMA 4DUWA 4OM0L 2VZTA 3BKMH 1N0LB 4NAQA 4G9FD 2XETA 1EFXD 2D3VA 3STLA 1E6OH 1SY6L 2NZ9C 3JWDC 3QWNA 1WS8A 4RSVA 1N18A 4A04A 3TPUB 4YXHH 3D85D 3TO2B 2HPOA 4HETA 1NCIA 2KL6A 1AJ7L 4ODXB 4TRPL 2H32A 1CD1B 3KWWA 1VZIA 3QJVB 1AHWB 3V0GA 4EBQH 2GVYA 5E9DE 3GXNA 3HI6H 5EUKA 2L4OA 4ACPA 1NGYA 5C7XL 2DMKA 4OFPA 3ARSA 1HYSD 1INQA 3LH2L 3TYFB 1GTNA 3S3SA 4KVNH 3HE7B 4F93B 3EJTA 3VRJB 1KJMB 1BQLH 3WKMH 1BVOA 2Y06L 3RIAK 5EEZA 3KPPB 3O3DA 4N2FA 4ODXA 4XRCB 5T1MB 4YXHL 1MNNA 1FGNH 1YMHA 2N0KA 2VNCA 3CMOL 4DTGL 2DQFA 4W9EC 4PRPD 5JXAL 2DM4A 2CO6B 2CGZA 3ECVA 4QEGA 1MRCH 1WZAA 2ZPKL 4OZHE 5AVZB 3QI9D 3D85A 4AQ1B 5ESVA 1T1WB 5CJ5A 5JXEC 1OD9A 2O6PA 3ILPA 4HIXL 4NO2B 4WFEE 1X5LA 4C83A 1N67A 3O0LA 3TT1H 1WVZA 2RBLA 3WDIA 4K2UH 1KGJA 4M00A 5IFJB 5MENE 1EEYB 2BVPA 5LG6A 4DCQB 3HE7D 1URZA 3FSVA 1TNMA 5CEZE 1J8SA 3PWPA 4LQFL 4D7BA 3VXRD 4M1DH 1WA2X 4M6AA 1MQ8A 1F3RB 3H0TB 3LS4L 1M05A 1SYSB 3DVNA 4D9RD 3LEYL 1N6UA 3G6AA 5EZOL 3MUHL 4UM9B 4Y4FC 1AS7A 2BZ7A 5F88B 5JXED 2FE0A 5GGRB 3NJGA 3CDFA 3CXDL 1CF1A 2JI1A 4N8UA 5EBMB 3MV8A 1G7IA 2PN5A 1RZFH 1CR9H 4KK8D 4M7ZB 5HYSG 4WQOA 5DC2A 4J3WA 1NFAA 1E7VA 3C5ZB 2XACC 1TTBA 1WWWX 3K0YA 3KLAB 5AW9B 5DO8A 1SEQH 2ZUQB 5CLZA 1AGEA 4JDEB 3WDHA 1BFOB 4LEXL 3BHBA 4NZFA 4NQVA 3TFBA 2YAPA 2HFGH 2YUXA 1N7MH 2CZNA 3G6DL 2BOBB 1FNGB 3TH2T 3BGMA 3FTUA 3MRIB 5F3BB 5JYLA 1DQKA 2V7NA 2NY0B 3ZKQD 1HHJA 3NSJA 4YLQT 1N9PA 1AGDB 1RVFH 3U36A 1LEIA 2APBA 3MCLL 5IBLD 2FWUA 3K6FA 2A9NH 1TMQA 1AC0A 5K39B 1B0RB 3VDCA 2Z8WC 1F3DJ <