3MVSA

Structure of the n-terminus of cadherin 23
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
210
structure length
210
Chain Sequence
QVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N terminus of cadherin 23 reveals a new adhesion mechanism for a subset of cadherin superfamily members.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Cadherin-23
total genus 48
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3mvsA02
4APXB 3LNIA 1FF5A 4AXWB 3QRBA 4OY9A 2OMUB 1Q1PA 3FF7A 2WHVA 4ZMWA 3UBHA 4ZTEA 4ZMLA 2OMYB 5JYMA 2O72A 2A4EA 3MVSA 2OMVB 4AQEB 1WUZA 3LNGA 1ZVNA 4NUMA 3LNHA 2YQGA 3LNEA 4NUPA 3LNFA 1NCHA 4ZI8A 1EDHA 3PPEA 4ZMQA 4AK1A 2OMTB 5DZVA 4ZMPA 3K5RA 4NQQA 2OMWB 1NCJA 2WCPA 5CO1A 4XXWA 3K5SA 5CZRA 2A4CA 2V37A 3Q2VA 2WD0A 4AQEA 3K6IA 4ZMOA 1L3WA 3Q2NA 3Q2WA 4ZMZA 2QVFB 3LNDA 1SUHA 4AXWA 4AQAB 1NCGA 4XXWC 5JYLA 1NCIA 3FF8A 3K6DA 2QVIA 4ZMTA 4ZMXA 4ZMVA 2X2UA 1WYJA 3UBFA 2OMXB 4ZT1A 1O6SB 4NUQA 1OP4A 3Q2LA 3UBGA 3K6FA 4QD2E 4AQ8A 2WBXA 4AQAA 4AQ8C 4ZMNA 1ZXKA 2EE0A 5KJ4A 2OMZB 2YSTA 4APXA 4ZMYA
chains in the Genus database with same CATH superfamily
1IGIL 3N1GC 3VGDA 4DP7X 2PR9A 3HN8A 1OSEA 5KANG 1IL1B 2AJ3A 4YHMH 4L4TD 1MIMH 1VEPA 4J2QA 1NEZB 4PYGA 1WT5A 3ARFA 4FYQA 3V7MA 1AQKL 3EG9B 1JGVH 5LBSA 4OD2A 2VDLB 1AO7A 4XXDA 2O5YH 3LN4B 3NK4A 5IKCB 1E5UI 1KJMB 4FTVD 1TPXB 5K9QG 1BAWA 3MZGB 1KYAA 5DUMH 2R23A 3BCFA 2OQJA 3QQXA 1CL7I 2BNRB 1O6VA 2APWA 2QHRH 3RL2A 5KG9B 2V2TA 4Y9EA 1VZIA 1ADQL 3UBXG 4MNQD 3V6FB 2GABA 3AABA 5KWYC 2DD8L 1J0ZA 4P4KC 3RYMA 4GP8B 4RZCB 4UT6H 4Y19B 2FX7H 1WVZA 3X14A 5J89A 3C8KA 4LCWB 2FEJA 5LGHL 3CN3A 2V8LA 1YSOA 3HR5B 3VXRB 3WN5C 2EADA 5BVJA 1F3DH 3VM5A 3QEQA 4UYQA 4A37A 2P9RA 3E6HA 3JWNG 4PRHE 5SWZE 2IAMA 5HHVH 2D3LA 5JPNC 3GSNL 4MNGA 4Q0XL 3T0EC 1F56A 4UDTA 1A4KB 2VXTH 1HFUA 1YNTF 1DFXA 1JFQH 3NCJH 5T1KA 2ZCLH 3RGVC 1Z9OA 5CFAA 2VISB 4H8UA 2FJHA 4JR9H 1HZLA 3TIDA 3QCTL 4A6YB 4J4PC 4ORGA 1T66D 3LJ3A 2J5WA 2VDQL 1KIQA 3L3JB 2BRRH 1NCOA 1OGTA 1A9EB 2WLIA 3QZPA 3MV7D 1F1GA 1KPUA 3UTSE 1QFWH 2IIJA 4RGNB 4WV1C 2AXGB 4GW4B 4WHCA 3KXFA 1MJJB 1E9PA 1DP0A 2GTZA 3A24A 4HJEA 5EC1B 3WFEH 3OKDA 5KBNC 2JCCE 2ZCHH 3MGTB 3U9PL 4APQB 2MOGA 3D85D 1MNUH 1F97A 2YKLL 3N1MC 2J8UA 4HBQA 4DP0X 2BSTB 4ZMTA 2NX5E 3IJ8A 2D0HA 5E6IB 3RTQB 4WFED 1GOFA 1N64L 4LLYA 4XP1L 5DVPA 4FQ2H 2ZD0A 3OC5A 2G9HA 1IU1A 4KPHH 1BX2A 1DVUA 3PLYA 2FUQA 1OWRM 4MJHA 5B1JC 1T89C 3WS3A 1W91A 3ARBD 3IKCA 4FYSA 5AUMA 4KK8C 5F1IA 4BA8A 1BXXA 2X4SB 2DBLH 2I26N 3KPSB 1KEGL 3F5WB 4KRPD 3HC4L 2BMKA 3L54A 3P77A 3TCLB 2P8PA 4HGWB 5CHNB 4JN1H 2V7NA 3RILA 2FO1A 3SBQA 1N70A 1WZLA 3PWJB 4OJAA 4KI5F 3H9HA 5EOQL 4PIBA 4BFJA 1NMCB 2YUZA 4M61B 5IOPA 3ML8A 2DJUA 3RZWA 4JFDD 1P7QB 3MRMB 2EVGA 1T20B 5CM1A 2DQJL 4OIFA 3KLDA 4YQXH 1ZD6A 3HBZA 3PNWA 2BVEA 2NY3D 3CZUB 4XB3A 3HE7B 2WZ6A 2OSLA 2WKLA 2QGEA 3MNZA 4KPHL 5F7LB 2Q8AL 4H88H 3UACA 1AQMA 2KHAA 2G9KA 1DBBL 3QUMA 4R2GB 4YHOH 2V2TB 3HI5L 4IOFD 3VXQB 2Q3XA 1JDDA 1KF9B 4UQ9A 4CU8A 4RQQA 2R29H 2V33A 1L7IH 1U6AL 3SE6A 2C3HA 4YWGH 2VR7A 1CI3M 2HX7A 4M8UA 4H8WC 1R0AL 1ZHBB 3CDFA 4GAGL 2X2HA 3MREA 4O2CB 2AI0L 2YA0A 4OZ4B 3DMMB 1Q38A 2A73B 4ZMPA 5LG6A 1T1YA 1YEDA 3GSVB 1V3LA 1JPGA 3G04A 3BP5B 1G1CA 2DQIL 2XCMC 3FFOA 4ZPTB 1UQSB 4L8DA 3EHBB 3MDJA 4L29B 5DMGC 3V0JA 1T0MA 3TBBA 1U8MB 1G6RL 1S9VA 3JV0A 3QEGL 3QHTC 3VXMB 4NGHL 1MNNA 1I8UA 3L3KA 4MJID 3VXPB 1X7TA 3QUZA 1AIZA 1TQVA 5I75C 2K70A 2H9GA 5IOKA 5ECJE 4P2YA 1L7IL 4YBQC 3OLIA 1AFVL 1KIPA 3SZKC 1BWMA 2LT9A 1S7VA 2GJ6E 4MWFA 1A6UH 2BSEA 3FT3A 4GSDL 4QXUH 1B0GB 3EFFA 1TJXA 1MREH 3F01A 1SUHA 5CMAA 3B56A 4X5WB 2QMJA 4L4TA 4CU6A 4NZTH 5EBWA 1OP3K 5D7KE 2UX6A 4QY8B 4PJ8A 3IFOB 3ENEA 1KXQE 4X4MA 1CFNA 1HSBA 3V0DA 3K71A 4DN4H 2PO6B 1HCZA 4MNQE 4FMKA 3X1EA 1UGKA 4PD4K 1QKZL 3TPUB 5KW9H 3CFNA 4BCXA 1SYVB 1LVEA 3WMQA 5BRPA 3ILPA 3QULA 3WTVA 3HUJA 2BP5M 5ID0A 1AI1H 4MS8D 2VC2L 2IWKA 1A3RL 3L5IA 3EYUH 3RUGA 5KJ4A 4APXA 2XQYG 4I18C 3I6LE 3TT3L 4WUKH 4PVMA 4HGWA 3QG7L 1Q94B 5CHNA 1KXTA 1T22B 4POZD 4TN9A 5EOCH 4KMLB 5HHOB 4NRZB 4GW4A 1FE8H 1QA9A 3FS9A 2EYRA 3BUDA 1JTTA 3IDGB 5JR1L 3D05A 4K5LA 2BC4B 2Z31C 3KHOA 1LDPL 5DHVB 2CIKA 5KAQF 1I3VA 5FLVA 1U8IB 2DIEA 4N9GA 4S1DD 4X6EA 4B97A 2V8MA 5HD8D 1W0VA 5A2KH 1FFQA 2PNDA 2DQGL 3BH4A 1BIHA 1A6PA 5EN2B 1OAYL 5I6PA 4D8PA 3US0A 1INEL 1MFNA 1Y0LB 1GOGA 2OTWA 4KZ0A 3OPZL 5F96H 2GC4C 2VLKD 3X1BA 1DL7L 1NEZA 1KPVA 1QBLL 3A67H 4HPOH 5DD3H 2FHFA 3TBSB 2FATL 2MNWA 5I1KH 4CDHA 5B7MA 1AC0A 1R6VA 1GZPA 2YAQA 3FU9A 1FC2D 2D7OA 2NCEA 2V7NB 4OZHF 1KFAL 2O93L 4Y2DC 5T5FL 4POYA 2EDEA 1KY6A 1DJZA 1VFBB 3VB8A 1PNCA 5HHMB 1E65A 1YG9A 2HPOA 4R83A 4J5VA 4XCYA 3PJLA 1ZGLM 1F42A 4HJSA 1P4LA 2RGSA 3UTPD 3QQ4A 5DFWH 2NTSP 4TRPL 3WKQA 1RJZA 4FFYH 3O8XA 1V3KA 3QE5A 3BIBX 1GTFA 3L2MA 1AHWA 4WQOA 5KYXB 3IGKA 2NLJB 1PG7H 2E86A 5C07D 4BKLA 1X9QA 5BVJB 4E5XG 5FGCB 3A4FA 4LAQL 3T8MA 4HHGA 5BRZD 2ZPKL 2A4ZA 2OBGA 1DQKA 1YEFL 4U0QB 4G8GE 4HFWB 4GIAA 2B3IA 4M6ML 4GMTH 5IM7A 2VUYA 3QHFH 1BZOA 1S7VB 4S10A 5M94B 1CLOL 1OB1B 3G5XB 1DJSA 1PZ5A 3ZW3A 5TGBB 2XT1B 3O6KH 3SDYH 3KHQA 2YRZA 5CF3A 1L6XA 4KMTH 4MHHG 4I3RL 1JZDC 3RWCB 3DMMA 3SKOB 7FABH 2XHNA 2WKOA 3R7RA 4F58L 1ETJA 3VFSA 3WFCH 3WUWB 4AT6B 1U93A 3HPLB 1JTOA 2EDTA 4OFYA 4MB5A 1Z9MA 4I7ZC 1I9IL 1P9MA 5GGTL 1S5IL 1HESA 1U8OB 4KK8D 4NUGH 3LV3A 4XPAH 3HPJA 4PH8A 3C6SA 5L4IA 3I3DA 4AV5A 3S96B 1PYWB 1RKRA 1S9XA 2WOBA 1C16B 5IB3A 1JUFB 1QTYT 4JO8A 2BOBA 1ZA6A 1EDYA 2YEZA 1EQWA 5AKVA 3NH7L 1NLDH 3PJSA 1ASOA 3JWOH 4H26A 3GLEA 4WO4A 3S8WA 1RZQA 1F11A 2PUQT 4OVUA 1QHQA 5EN2A 1P1ZB 1CGUA 3OGCA 1NGZB 1OP5H 1LEGA 2ATAA 3HG0A 1IBBA 3GMQB 3UTZB 3PL6D 4HOWA 1XBRA 3C2SA 3D7PA 1FIGL 3NAAH 4N3TA 2IMMA 3WAJA 4OAWA 2OYMA 3DXAE 4G6KH 4TQPA 5D7EA 1KB5A 2QGBA 1GZPB 5F7NC 4HUWA 2BP8B 2F54A 3NABL 4NO0D 1N0LA 2A6IA 2PYEA 4AYDC 3LKQA 2X4NA 4UF7C 3FQUA 2B2XH 5AUMB 4AVJA 2BVUA 2L3BA 4YHIA 4GI8A 1A6UL 2DM4A 4NPJA 4ODTL 4QXUL 3BZEB 3SKUD 4WWOA 5F9JB 1KPRB 4H0LC 1HWWA 4Z7VA 4JFEB 4YX2H 5DHVA 3WY2A 2OZ4L 1C5DB 1JYXA 4NQSB 3TEYA 5LXGL 4N9GB 4L4JA 3TFKC 3FC8A 1BECA 4TKWA 4PRPA 3BWSA 4D9RE 5AWNL 1JV5A 4HOZA 8PAZA 1FIGH 3NAAL 2A74B 1FZJB 3VFUA 3PHAA 4PP2A 3LPPA 3ULVD 4ZUTA 4GQPH 4F9LC 3DGDA 1DBAH 3FN0L 3SGEH 3LMJH 1TEFA 3P9LB 5E1GA 3KDMB 3S5LB 4BCZA 5AZUA 5IJBC 4L3EB 1PG7L 1U8HB 4XO5A 4YXLH 1QI4A 2F53D 1S3RA 3HE6A 2YQ3A 3QAZC 4E9VA 3W0WA 2EKSB 32C2B 2UXGA 2XFXA 2B59B 4UQ2A 2B4CH 3PHQB 2GSGB 3VRLE 4HH9A 1LO2L 3SDXE 2ROXA 4M03A 4X4XA 3IN0A 1EMTL 1N10A 1THCA 1D7BA 5DS8A 2QQNL 5EZOL 2VOTA 5AW4B 5HHOE 4W9ZA 4GBXA 1QO3B 3AY4C 4KXDA 1TYEB 1U93B 2AKRA 3B2DC 1U36A 2GJZA 2QADB 3BUPA 4HIIB 5C09A 5C7ZA 2GBUA 4B27A 3WIHL 4O00A 1WPCA 4Z7AA 3CX2A 2YPLE 2IGFH 4M9PA 1ADQA 1JBJA 3EO9L 3AM8A 5BZDB 2ZX9A 3S8FB 4J3OG 3PAZA 2JELL 4B53A 2PP7A 1NFDB 2W81C 4PB0H 1QVOB 1QAWA 1PFOA 4I2XE 4L8SA 4NM8L 5KYUB 3EW3B 4LLQA 4PY7B 2WTOA 2RTTA 2Z92B 2EIKB 3BN9C 4F5CA 2VLJD 1IJ9A 4CMMB 1RUPL 1Q0EA 2DZEA 4HK0B 5T3ZH 2XV3A 2B9AA 5A2FA 3FCSB 1MXDA 2MOVA 1GRWA 3P9MA 5KS9A 3GUTB 1J8HE 4U1HA 3NK3A 3LQZA 5KUMA 43C9A 4GG6B 4NIYE 4KHTL 3WNLA 5C08B 1UEMA 4X6DB 1SOQA 3KGUA 2M1KA 5GJTH 3RPIA 1P1ZA 1CURA 4KXCA 3S88L 2R0LH 1HK6A 3PDDA 5F9DC 1CFNB 1DVSA 3WLBA 2AXFB 4I0CC 1A3ZA 2WBJD 5ABZA 1E6OL 2EVHA 3GMOB 1JD9A 3RU8L 1MCEA 4FLOA 4GRWF 3HN3A 3DX9A 2X4PA 3S3JA 4WI0A 1AACA 4QHUB 1D2PA 3IJYA 1JGEB 1E6JL 5KSAD 3T0DA 4OQTL 5FHBH 3QZLA 3FQUB 5DC2A 5GRUL 3CVHH 1ZGLA 4P2OB 2BOBB 3SN6N 3QUKA 1HEHC 5T3XH 5H94B 5EUOA 4JFFB 2CLVB 1BEXA 2BNQE 4KK9C 4LCIH 3PUCA 1TO4A 1RY7B 3FO2B 3CFIC 4N8PA 3V0AC 2H2SC 4AMKL 4XCEA 2NY1D 4NBXB 2RALA 1J1XL 3D0LA 1ZHKA 2IPUG 1S7SA 2D31A 4UNUA 2EXWC 2XN9B 3ESOA 4WFFD 1FNSH 2BFGA 5E1AB 1I1AD 1AQKH 3SKJL 3H3BC 2GY5A 3ML9A 2CIKB 2NCMA 5FOJA 1PQZB 3KLHD 1E28A 4NQCE 2W92A 1G5GA 4P59L 5IV2B 1NDMB 5DFTA 2UVFA 4PJEF 4CW1A 1HKLH 4FQXA 3VFOA 4AUJA 3QZMA 1KTDA 5KVEL 4H0GA 5ETUB 4HH9B 3W39A 2E7BA 1E67A 2FZ3B 4TVSa 2OYKA 3Q2LA 4DAGL 2H26B 4EN3C 1MCRA 5IM7B 1HXMA 3JUYA 1L3NA 1PMYA 1DR9A 1VF5C 4QD2E 4U1LB 1NGYB 2R2CA 3VFPB 2WLYA 3ARWA 5C08E 4Z77A 4U0RC 2OX5B 4OZIF 3SQOH 4NRXA 3VI3F 5FYJU 2GJZB 4HIIA 1I1AA 2ILLA 5HDWA 4JVWA 2W9DH 4ODSH 4CDGC 3VD1A 3FSOA 1RSYA 1P5UA 4U6HA 2JSFA 4NPKA 1MCDA 4PJ7A 4N87A 4U4BA 4PP2B 3MBED 3GZOA 3NFPB 4K7PH 4DK3A 5JW3H 1KG0A 4EDXA 4NO5B 1TZIB 5JZ7D 2J57A 4AVHA 1QKZH 3DOSA 2UUDK 3RGHA 5E1IA 1NJ9A 3HE6B 3U0PA 4Q74A 3O4OC 3ZRFC 3K3QA 2O72A 3DUUA 3ZLQC 2NY6D 1RJCA 2X41A 4RA0C 5D2LA 2CKBL 3TEWA 5F0LB 4NNXB 2COQA 1IFHH 3N42B 4R7XA 1UVQA 3KJ4B 3RX8A 4UWQB 1MJ7H 1S9XB 3LQZB 3HKZA 3ZYZA 2WBJA 3BVNB 3ZHNA 1LWHA 2BIPA 4LHJB 1EHKB 4UANA 1R9FA 3LQAH 2FBRA 4AW7A 4FQLL 4YSDA 3X14B 3ABGA 3ZL4H 4HJJH 1KGJA 1QFPA 2HJLB 4TVPL 5C09B 3HNVH 3R19A 4G5ZH 2H3KA 5E95B 1DEDA 1QFWL 1RP8A 1NGZA 4J6RH 1E27B 2WBKA 5T1LD 2WGXA 1MQKL 1HSAA 4ZD3H 2V37A 2V9UA 2HT3D 3IDYB 4HIXL 1JDCA 3AT0A 3S36X 5KJ7E 3ULAB 5LHDA 4A6YA 5FYJD 3N04A 5I24A 2QPEB 1CK0L 3SJVD 2F54B 4A7TA 4IW4C 5EIIB 4AJWA 3M07A 3UJTH 1IEAB 1I85A 1ZS8A 4I9XA 4EN2A 4WI6A 3ARBB 4AXWA 1MAKA 4FQHA 2P5ED 4OM1L 4X5LA 5H37G 2MIZA 1E5YA 2YGVA 3LEVL 1BV8A 1MFVA 1HT6A 2WZ5A 2IPUK 4MCMA 1AGFB 1E90A 4FCAA 3ESVF 3EO1B 4NPYB 4PJ5B 1TCMA 1H5BC 3FOMA 5E6ZA 5LWYL 3CFJA 1AANA 5JTWA 4UU9B 2DMGA 3UABA 3GSNH 1WIUA 3IK2A 1JMZA 3K4ZA 3L5JA 4Q0XH 3F00A 3VFUB 1UD3A 4NX0A 3R06B 1T6VN 3KPSD 1A4AA 2HFEB 2R0WH 2ZONA 3H7BB 4JDTL 4G6JL 1OM3L 2ERJC 1CMOA 2ITCB 5IR1B 1BXVA 5F21B 5DC0A 1SHMA 3NIDF 4UQCA 4Z77B 1NBVL 5HGDB 5T1DH 4BSVB 2ZOWA 1F6AA 2Z31D 2OMBA 1LDPH 3MLPA 4LPCA 4DAGH 4MA7L 2K0RA 5A6MA 1AXTL 4G8IB 4MNHA 4PMFA 2BIOA 4NBYB 1JPSL 2CD0A 4MD0A 5LGYA 4TQHA 3ZE2E 5JA8B 1SY6H 4UZGA 1IQWH 1EO5A 2R2HB 2OPCA 3NG5A 4J39A 4ZMLA 1H3GA 3ISRA 3SYOA 3D48R 4B3VA 3DX3A 3ZXAC 4Y2LA 1A6VH 1U9KA 2VN6A 3N1FC 2QKIC 4GRWB 2BNRE 4ZQTA 2Q7NA 3P1VA 2HRHA 4QHKI 4UUJB 1XGRB 2DLHA 2Z35B 9CGTA 3BAWA 2ZOKA 4P07A 2W65B 1PNDA 2ARJA 4XO8A 3KPOB 1BLNA 1AHMA 3GSXB 4IKNA 1B0GA 1CF8L 3EFFB 3VNYA 3CQPA 2VQTA 3B2UD 5C2UB 4YHNB 4PJBA 1LEKB 3QO1A 1AIFA 2XKNB 3KPPB 3D25B 1WS7A 1O9VA 4LLMB 1Q9LA 3GKZA 1PKQA 2A77L 1TR7A 3X3GH 1WFNA 4X8GA 1IBHA 3T8XA 3H1ZA 2WZAA 5ACZA 1UOWA 4WSGA 4O51A 3QS2A 1FYHB 3WJLA 4GSDH 3NBNA 1FNAA 2ITDB 1IARB 4NOBA 2CM6A 3BRDA 5D1QC 3ZDXE 1E2WA 4F3FA 4L29A 2XWRA 1BAFH 1XMEB 1IAIH 4BWUA 4ERSH 3VXTA 1J0IA 2CO7A 3NESA 3NQIA 4F7PA 1J18A 1O7SA 5ID1A 2ZUUA 3V6OC 3K6IA 5F89A 3B8SA 4KK5D 4J2XA 3Q9PA 1ACZA 3Q2NA 1I1FB 5LGHH 3QCUL 2P5PA 4PGEA 4P5SA 4F24A 2FX8L 1IC1A 1GS8A 2QZ5A 3QYMA 2W0FB 4W9EC 3V0EA 1DDHA 2DV6A 4N0UE 4GRLC 3WAKA 4DQOL 1PD1A 5JO5B 2B9BA 5EZJA 3FFCA 4H2CA 2OI9C 5L4MA 1YEEH 1NIAA 3IFPB 3IU4H 2FBJL 2VDRH 2WUBL 5D1XA 5GS1C 5IROA 2VJ8A 2W59A 2AZAA 2NXYB 4KQ4H 1H3VA 5ILTL 5BQ7B 3WY1A 1T1WB 2A38A 4F93B 3QR0A 5AW9B 4APQA 2GBTA 2DQDL 3SOBH 4FQJL 4HBCH 5CLZA 1T1ZB 5K1JA 1OTSC 1WAAE 1FA4A 2NNAB 2H8PA 3LXAA 3QQDA 3ZBMA 1UWYA 2LOEA 4UQAA 4APXB 5FV1L 3CDZA 5A2BA 1I53A 5EZIH 2BVQB 1KJVB 1VA9A 4WI0B 1U92B 1S7QA 1FSKC 3MRJA 4PJEB 1ZVSB 2EO9A 4HWNA 1U8JB 1GAFL 4PJAA 5K39B 4N1CA 3G5YA 2B14A 3AREB 2DMCA 4PJGE 4TVPE 1QI5A 1FNFA 2RR3A 1ETZB 2PTUA 5DT1H 5EU6B 4HT1H 2EDHA 3AXLB 4LLWA 5BV7C 4JZJB 3NIFF 2AERT 4TOYL 2UXVA 5JMOC 1F4WL 2H32A 5JYMA 4Q89A 1QHPA 5CR1A 5SWSD 5CBAB 4LKCB 2I24N 2ZIDA 4U3XA 2HFGL 3HS0B 1N6UA 2NQCA 4HMEA 1J12A 2Q2EB 4UUJA 4X2UA 2OZ4A 1BZ9B 5DC4B 2QBWA 3CFKB 5IVZB 4IU2B 3NCBB 3IXAA 3CLWA 4XVSH 4WNJA 3VFWA 2WXGA 2BVPB 4X50A 5FWRA 4FQ1H 5E5MB 2Y7OA 4MVBC 1FC1A 1RZKL 2JB6A 1XQ4A 1GMIA 1S2EA 3EGDB 4P5TD 4XZ4A 4U2YA 2VMJA 4R7LA 5DO2D 4UAOB 4G9DB 4PJAF 4G8IA 1J9CT 4XAWL 3X1NA 4Q7DA 5ACZB 1FAKT 2Q0ZX 4JRLA 2J56A 2R4SH 1OAXH 1J9RA 3G6DH 1GR7A 1M53A 3C6LA 3GM8A 4M8QA 4J8RA 3QZNA 1WCBA 3LPFA 4WIQA 2VW6A 3TVMC 4OR1A 3VWJC 4WAFA 2EDDA 1LGVA 2VWEE 5MERB 3DVNB 1UH2A 1MH5B 3EJRA 5HDOA 1OAKH 4FNUA 1T2JA 5ALBH 2IPKB 5A1AA 5I18L 1NCGA 3WS6C 4CU7A 2KZKA 2VT0A 3KYOB 3P30L 3QDGE 4BCYA 1A6TB 4PJHF 5G2NA 1CLZH 4PJBB 4DPCX 2YD3A 2FYVA 3SYQA 4MAYB 5JPNA 5EEYA 4UINH 4DTGL 5D2NC 4LSSL 3L3DA 4UT6L 3QEGH 2NXYD 3CDGB 2F5BL 3NJLA 5DRZA 3FT3B 3VXSD 4PMEA 3WEMA 3ZO9A 1EFXD 3P2BA 4PCKA 4J4PA 3WIFA 4GBXC 4JRXD 1BQSA 1AD0B 5DSCB 5K93A 2HVKA 5ESAB 5E9DB 2OMYA 2C1PA 3AMKA 5EC1A 1RPQA 3T3PF 5FXCH 3H55A 4FF9A 1NZRA 1AR1C 9PCYA 1P6AB 4HUUB 3D1MC 3QIBC 4HF5L 5HYJA 4XCCH 5GGQH 1RJYB 3F7VA 2IH8A 5DDHA 3ASOB 1A4CA 2CDGA 3FULA 4XNZC 5BV7L 2R51A 1UOVA 3OX8B 3F84A 1A7OL 3TC9A 4I4WA 3G5YB 4R6UA 2C26A 1G9NC 1X5JA 4Y4HD 4JVUA 2G2PA 4LLWB 5HI5C 4GW1B 4JM2A 4RMSA 3F04A 5F0PB 4MVBD 1LQBC 1QUNA 2X3BA 4LIQH 3V95A 5HHOA 3QIWC 4WO4B 3KL5A 1KN2L 5I1DA 3RWHA 3GI8H 2KLSA 1TTFA 2W94A 3MRPB 4U3HA 4F8QA 3TO4A 1KN4H 5DHYA 4Z76A 3JZYA 4XP5L 3KYNB 5J1AB 4JE0A 4AKQA 3ULUH 4MDJB 5DQDL 4JMXA 3CZJA 4FADA 1I3UA 4KJYA 4X42A 1EH9A 3T1WA 1XIWD 2Y25A 4K7FB 3BCDA 3P9LA 3SD5A 5D7IF 3U4BL 4YSOA 2YAHA 1DO5A 2B59A 4UQ2B 2CRMA 5K39A 1BMGA 3KLHC 3II1A 5FPIA 4MX7B 4DKEL 4XE5B 4JFEE 2DL9A 2Q20A 4EIBA 1WWAX 3GRWH 3EADA 2C9QA 2DEYX 3F7LA 1GPOH 2FATH 2R1WA 3CLFH 1XH3B 4HJIA 3QQ9C 1IAKB 4XOEA 4F7MB 1MCOL 2UWEF 1C9SA 1WBXA 1YY8B 2DQJH 4ZYKB 3UC2A 1E3FA 3ZL4L 4KQ4L 3DHUA 3H3PL 4NN6C 1XIWA 3DDFA 1GGIH 1HI6B 4HAKA 1F41A 3CD4A 4F3FB 1L9QA 5EBMA 1BQRA 2LQRA 2NY2D 4OZHA 5F0JB 5FCUL 3ZE0B 1CN4A 3SE4C 3HZ3A 2AMUA 4G82A 1TTAA 1SY6L 3QUGA 3M46A 1PY9A 1WAPA 4G8EA 3QQ3A 1TJIH 2RCSL 2DQHL 1MELA 4F2MA 4F91B 1UJ3C 5HVFB 4H1LB 1UZ8B 1X7QB 3HTLX 2C3XA 4AQ8A 3UCQA 4L3CA 4YDJA 4AQ8C 5I6MA 2EDLA 4B9CA 4H20H 4F20A 5D7JB 3GZKA 3X12B 4U7SA 3UP1A 3P4NB 1F4WH 3BZ4A 3OXSB 3DARA 5GSRB 1XTMA 3HNTL 3HAEG 5C6PB 2AJZB 3CXDL 2H6PA 4LCUB 3LRSA 3OKEA 4R3SB 4MDIA 3HC0A 3FW6A 2AVFA 4QRFA 4DW2L 5KBDA 3FF7A 3KYOA 2AEWA 4RZKA 4KQ3L 1DZBA 2EDYA 5F7EL 1TJIL 1YN7A 2NXZB 4XO4A 3IGLA 4LFHD 2APVA 4ONHA 3MVSA 3UXFA 4S1RH 1NPNA 2VW7A 4J3TA 5DZAA 1TQTA 4BH8B 4HU8A 2OCCB 1P4UA 2D31B 2C9SA 4B9JA 5AW3B 2K1MA 4BFOA 2W9LA 4ENZA 2P24A 4ANKA 3RPIB 3U0WH 1KELH 3LNEA 1GSKA 4JZOB 3C5SB 1BOGB 3MBXH 3PUUA 1BIIA 1N26A 4DVBA 2F1EA 4IJ3C 1RQ5A 3HI1B 3E8UH 5E8DH 5DRWA 3QRFM 4YGVB 3OKNA 1HDMA 3BPCA 5C70A 1A1OB 4F33A 1YN6B 2VZTA 3GC3A 3QUXA 4I9WD 4QT5A 5CFHA 1T2QH 3EYQD 1WJ3A 3NEOA 5E6IA 5EUKB 1H3TA 1HINH 3NJGA 2GW5A 4WW2A 4ZX5A 4QHUA 3B2PA 5J6HB 4QGTA 3B7SA 3CMOL 3KYMA 3CFKA 4EIGB 4KNTA 1ZHNB 3MLVH 2NZ1A 1HH9B 1N0XL 5CEZD 2X1WL 5EOCL 3Q7JA 4XPTL 4HUXA 4FG6C 4QRPE 1N4XH 4QTIL 3V10A 4LPWA 4A38A 2X9ZA 1WV7T 3STLB 1IGTA 4C54A 4CBPA 4YDIH 4WRLA 1GHFL 5KVGE 3TFKD 3QP3A 2XWCA 1MCPH 2ICEC 3VI4A 4DFIA 3CVDA 1VPOL 1A7RH 3GRBA 2K7QA 4LOUC 1EUTA 2XZZA 3B83A 5I1LA 1UWXK 1ET8A 1D5BA 4P3DB 3QUXD 2WXIA 3N91A 4XWOD 1HJBC 1ILSA 2IWGA 1JHTB 2VIRA 4QTFA 5C0BA 4GP5B 5DQ9B 4KX8A 2IGTA 5DVMA 4EEEA 1O6SB 2BVYA 1MH5A 5I1KL 1IGJA 4WW2F 5ICYB 1HNYA 1MCBA 4LHUG 2CA4A 1E6JH 4ANXA 5IB2B 2EC9U 1FNEB 5JHBA 2F08A 4IU2A 1G4MA 4Z23A 4K55A 1A6WH 1MPAL 2EIDA 4KROD 1VZGA 4DKAA 4IBQA 1A0QH 1RUQL 3PWVB 1MHHA 4G11A 4IDJH 2K4AA 2IOOA 4X6CA 4YL4A 4WGWB 3UAJA 4AGLA 4DVRH 5DJ0A 2M83A 1AH1A 1H8NA 4CKVX 1NL0H 3LD8B 5B7FA 4JPWL 2I5YH 3RJOA 3WIHH 4DGYH 1S8DA 1A1MA 1UOLA 3F12B 5I73C 4U6TA 1A1NA 3MREB 5IBUG 1AJ7L 2VDOL 4ONFL 4PHZA 1AYOA 2AQSA 2DQCL 3NACH 1AHKA 4OLUL 2EEDA 3OR6A 4G7VH 3PV7A 2CDEA 4M6OL 1E4XH 1I4FA 2WLHA 5G55A 3KPTA 2ZCLL 5D7LD 4XP6L 3QG7H 3KH4A 1W72B 3N44B 2OMYB 4Y4KB 3U1QA 4B9GA 1QX1A 1UT9A 3DMMC 4ZX3A 4G5AA 3K1KC 3QUZC 3BC9A 3BAEH 5D7IB 3S8GB 1N8ZB 2ZJSL 1XGUA 1BGXL 4Y16D 1FAIH 4J27A 1KZQA 2WMPB 5EG6C 4JKMA 4MQ7A 5IROD 5E4AA 3KH3A 3MLWL 1JXDA 4YNYB 5F3FA 4CBZA 3QDMA 5HJGA 1L0PA 4YR6B 1JWSB 1XSKA 2XY2A 2XVLA 4O02H 5CMAB 3L3JA 2VZOA 3ARSA 1WBYB 4U31A 2APBA 5GGVH 1DEEB 3B1TA 3RVVC 4WFGE 3TASA 3HBGA 5ADPL 4J3OC 5BOZG 4M7KH 1M3IA 1U4EA 3QWNA 2OZ4H 3KPQB 5FUOL 2EH8H 3MRPA 1KXVA 5ICUA 4QAWA 1EXUB 3KYNA 1K4CB 3T0BA 4PRDB 3Q5YA 5DCCA 1FL3A 3KR3H 2ZJSH 4IGBD 3BLPX 2ZKWA 2PO6C 4E9LA 3ZDZB 4DQAA 3OZLA 5DJZB 4KMTL 4KO6A 1CE6A 1XF2A 2VMEA 1NAMB 1E9OA 5DMJB 3MJGX 2X40A 3BW9A 3SPGA 1F6AB 3M17B 5AW8B 1E3XA 2CZNA 5HPOA 2VR8A 3QUKB 2FLRT 3O3AB 1FJ1B 4NSKA 2YPKB 1GXEA 5JXAL 4OQTH 5EO1A 3TX4A 4OLZL 1A7OH 4Q6YA 3RWGB 3LS5L 2JIXD 5E1AA 2VLKA 3CFJB 5I5RA 2XRAH 3L7EA 3C9NB 4JN2B 4GXFA 1L9PA 1PGRB 4Z3FA 1R19A 4GT7A 5EUOF 3ULVL 5F93C 1T5KA 2EE0A 2HFEA 2OL3L 2J12B 3O6FA 5ES4B 4HK3N 1G4RA 5F7EH 1KLGA 2H2SD 5J06A 1ZE3C 1JGDA 2Z7WA 3NOIA 4OCYH 2ZICA 3IDXL 4YXKL 3LH9A 3RIAK 1K85A 2Z1KA 4QWWD 2LTQC 1RK1A 1R34A 4EKXA 4AW4A 1WA1X 2CGRL 3V4PB 4IRJD 3L3OA 4ZFOB 5FYJE 1PKOA 1CJYA 1AG0A 3MCKB 4LT7A 3HMWH 3ATBA 1WH0A 3U0WL 1WD8A 2J6EH 3GSRB 3QQ4B 3OR6B 4CUCA 4RIRB 4PRBA 4XN1A 1ZHBA 2BWQA 3GWJA 1XL4A 3MNWB 1B4JL 4KHXL 3EFDL 1I4FB 4Y2DB 3X12A 4Z3HA 1U8PA 2EICA 4PRAA 4Q4IA 2GITB 4XZUB 3BHBA 4HUMB 1UATA 1DBAL 3FN0H 1UM4L 3GDCA 3L4ZA 1U33A 1JZIA 2Z64C 4OLEA 2WMPA 3B2MA 2VLLB 3MRLA 3VB9A 4EMZA 1RZ7L 3I2CL 3K0YA 4KJPD 4TPRH 2X1OA 5D5MF 1TEYA 1WHPA 3O9WD 3WMSA 4MMXB 5GHWH 4B6ZA 5LXGH 2QHRL 3ECWA 5I1AA 4MB3A 4G6AC 1SMAA 2VE6B 5D2LB 1JVLA 3EYVB 2EACA 3BZ5A 3W38A 2ALWA 2V5TA 3SPVA 3EGXB 3DXAB 3CVHB 4XX1E 3F7KA 2GJ6B 2HG5A 4IK7A 1WRFA 4UTCA 1SDYA 3GSOB 1NOLA 3FQTA 1N6QH 3SE9H 5BS0D 1VSCA 2G0KA 2YRLA 4OM0H 3OXSA 4XBEL 1BEYH 1T1ZA 4BFKA 1LP9E 1AQDA 2CKBA 2CU9A 1NC4B 1INQB 2O6EA 3B7RL 4KDVA 3ARGB 4XRCB 1SYSA 1CIDA 2JCWA 4YDVB 5BNXD 1WE5A 3MRJB 4FQXD 4P3CH 2WO3B 3RB5A 1T04A 3ECQA 4ISVB 4K3JL 1NCIA 3OJ2C 1U8JA 1R3HA 4A68A 2IAMB 35C8L 3RTQA 3KAAA 3G9AB 4JEGB 4P5TA 5KSUA 3LS5H 5JO5A 1U2HA 2XG4B 1JI1A 4FZ8H 4IMLA 3TJEH 2K45A 5E2VH 5EZLA 4HOMA 4CJ0A 4G9FB 5D6DA 2IH9A 3ABLB 5B4MC 5HY9A 1CXKA 1NM9A 2MQ0A 3ME0B 4UM8A 3VQLA 3SKNB 2AJSL 2P8PB 4JRYE 1WGOA 5D2NE 1FDLH 4QCIA 4G8FB 1KPUB 1FFPA 1EAJA 2VDPB 1IGMH 1SXAA 4PM1A 3SOTA 5IQ9B 3L95B 5L88H 4ZUUA 1NBVH 1JZJA 1SQ2N 3OZ9H 4R96B 3TNMB 3DC0A 5D1QE 2WLZA 4JQXC 2EEFA 1FZOA 2OK0H 3L8QA 2UYLA 2X4QA 5D1ZI 1RUAL 1TZGH 2Z7UA 3GEFA 4HS6A 4NLAA 3ZZSA 4UV4H 3IM1A 1FIEA 4PP1D 3IJ7A 3EJQA 5FB8B 1MFBL 2RACA 3VVVA 4YDMA 2AK1L 2VXVH 5BZWA 3GI8L 4M62H 2NW3B 2W07A 5DFVD 2Z6FA 5IP4A 1P4IL 3TT1L 2NT1A 1C5BL 3GB7A 1XR8B 4XWGH 4O4YL 5KOVC 1NGYA 2IH1B 1GMEA 4WI4A 4P0DA 4AUUA 1HHJB 4F15B 3MXWL 4PJDF 3LX9A 1RU9H 4G42B 2F53A 5LAPA 4LIQE 3Q44A 5FR3A 1P5UB 4U6HB 3TOPA 1NFIB 4C4UA 4X6DE 4WI9A 3VTMA 2GAZB 3NMEA 3JWOC 4FFYL 3PNWB 5ISZE 1HHKA 1YMMB 4XI5C 5HDBF 1S9VB 4Y7MA 3NFSL 3T0ED 2VJ0A 3HFML 1TLKA 3QUYB 2Y6SD 3QQ9D 1FBIL 4CVUA 1BMWA 4XVUC 4NHCL 1RL1A 3QT2A 2NQ3A 4LF3A 5GJSL 1B9KA 4PBXA 3DPDA 4AQEA 1GZHA 3ILDA 4NQCB 4Y8DC 1RUPH 4AOFA 4JG0L 2BFVL 5DWUL 2BSCA 4MJ2A 3QFJA 4GO8A 2FUTA 3AUWB 5ESAA 5J5EA 3GHBL 3TA3B 4DPBX 2YK1H 2BCKB 1RH8A 3BP4B 1UGNA 4Q6IA 4Y5YB 2K8MA 1NBYB 4L0ZA 3ZKXB 2ICCA 2Q3ZA 2XZQH 3ULUC 3NA9H 5ANMA 5E08H 3BESR 4L8SB 3S37L 2IANA 3UYRL 5C3TA 4IOIA 2C9AA 5EEZA 3DOHA 2WNWA 2IQ9L 2W95A 1TVHA 3MMEB 4RWYH 5MEQA 2FNBA 4HFUL 2WZPA 4AGMA 4TUUA 2FQEA 4MB4A 4NUQA 5I1EL 1TJGL 4CL7A 5TQ0H 2I85A 1PX8A 3OKOB 5HYSA 3UBGA 4ZQKB 1UYWL 2CQVA 2J5LC 1LEIA 5CN3A 4DK6A 3D4ZA 1RPUA 1Q94A 3NPSC 3F65A 4Y4HA 2GHWB 1UUSA 4UIMA 2WXHA 3MBEC 4U6YB 2WQXA 4WW1B 5CINH 1PZAA 5I8OL 2EC8A 2NX5B 4MJIA 1VDGA 4FFTA 4N68A 4OY9A 4JDEB 5I8KL 2F8OA 3O2DL 2FO4A 4FJYA 3EYFB 4QYAA 2PXYC 1QLEH 5EEWA 4YDVA 4NQTA 4OUOA 3NCWA 3CPUA 2ESVB 4NYLB 5JIHA 1FZOB 3FRPA 4WHTA 4OJCA 1RZ7H 2X7LA 3I2CH 2AZUA 1ZAGA 4Z3TA 1OARH 3VGGA 4AZUA 4I4WB 4KAQH 5BZXA 1Z9PA 3CC1A 1S9WB 4QXTA 4X80H 3L3OC 3DGCR 4YHIB 1UURA 3ECBB 2GJJA 3VXOA 3RL1B 4ADJA 4FX5A 5C7XL 2XTLA 5J6SA 1GJIA 3TH2T 5DJCB 1JE6A 4NQDD 1Z32X 3U2SA 3IFNL 2WXNA 1XIWB 1MJUH 3OAWA 3N50A 4JZJA 3TVMA 3VAEA 4E5XA 1O7VA 2V2WA 2ZWLT 1VFAA 4PJ9D 5GZND 2X05A 4BSWB 2W60A 1KIRA 1LMKA 4D94A 3QRGH 4UMSA 5B3JE 4ATWA 3CVIH 5A7BA 2YGOA 1LD9B 3PHSA 1ZT1A 1XSJA 2ORBL 2P47B 4OD3H 1YYML 5KYNA 3KDMA 5HYSG 1CICA 4JX0A 3UCRA 3VFGH 3IRZA 3UTTA 1H0DA 4MNQB 2YXWA 1GGYA 1I8KB 3H9SE 4J1UB 4TNGA 3D39B 1L9OA 4L3EE 4WU7B 1JXFA 4YHKH 4ZMOA 2W80C 1DQTA 2ZYRA 1FH5H 3RA7H 2ARJB 4HJGB 2I9TA 1ZLSH 2QVFB 3O2VL 5FKPB 3KLAA 3ARFD 5D7LB 1CGWA 4PB9L 2H0EA 3ARPA 3P3SA 1HZHL 5JYLA 3ATEA 3BGFB 4LLMA 1KJ2A 5ADPH 2Y5TB 2LAGB 5I6XB 4OV5A 3W5MA 4RISH 5DTFA 3LZFH 4GUOA 2XN9E 4KZDH 1ZHLA 3JZ7A 4IIZA 4ODWB 4IOIB 4TTDC 5EPMA 4XE0A 3VG0H 1KJ2H 2IDSA 4L23A 1NIDA 4IU3B 1OT1A 2BNQB 3NIGB 3QIUA 1I7UB 1KELL 1UHVA 1VFMA 4FNTA 5AOIA 2C9UA 3IWVA 1TZOA 4BXSV 2YO3A 1GCFA 1E50A 1WEJH 2R23B 4ALAC 4HK0A 2H4EA 2VDMB 3QFJE 5BJTB 5I71B 3SE8L 2XXMB 4FQCL 4P46C 4Y9FA 5D8JH 5F9OL 4XT1C 4Y0GA 4QNPE 4QO1A 3RWFB 3TS8A 5D7SH 4G71B 4NNYB 2JKNA 4X8JA 2BIHA 4X5XB 4AM0B 2R2BB 3UAJC 2J6WA 1YUHB 3FSVA 3VVWA 4YDLB 4RWHA 1II4E 3B8YA 2NY7H 4RMVA 1SXCA 3OLDA 5IBTL 4Q56A 3VGHA 2E7MA 5D72H 4LASH 2V2XA 3HRPA 4M5TA 3RTQC 3DX9B 5EC2B 4K9EC 4TSCH 4GP4B 5DHVH 1MHEB 1NFDF 1WFOA 1MAML 2AXWA 5A7EA 2VN3A 4ONGL 4HX1A 5EDXA 4P2OA 1WSST 3I50L 1ACXA 4E41E 2JFCA 4AQZA 5MEOA 2ENJA 3FFCD 5I28A 3BUTA 3MFGB 4M4RB 1WISA 3F85A 4TNWK 5BZWB 4F37K 1J8KA 4G3YH 3VSUA 1AGFA 1E4KA 3H4FA 5EU7E 2OAAA 3PAVA 5AOZA 4AWJC 3REWA 3IT8D 1BCIA 1NCDL 1OKEA 2BWIA 1A25A 3BVDB 4Y1AA 5EWIH 3VXRE 2QMKA 4ELKA 5C0FA 3WHXA 1UZ6F 2P48B 1OCZB 4MDJA 4PN6A 4W6XB 3NIGF 3WIAA 1SN2A 3V0VB 1LO3L 5MEPB 4PRPB 5BCAA 5F7BA 5JW4N 4BUGA 3RGBA 4XAKE 3EDDA 2ITCA 4A7UA 5IR1A 4BH7A 2PLTA 2L7JA 3UP6A 3N85H 2APTA 4ZUUB 3UYPB 2CO6B 1NGWB 2BSBA 1SN5A 4UTBH 5AB2A 3FT0A 3WNKA 4ZOCA 3BEVA 1RZJC 2RFXB 3SDXF 5FM4A 3HJ0A 3R1GH 1IGFH 4WGVB 1PL3A 4AVIA 3DNKA 3CFBA 2XWJA 3ELAT 4PLKC 4JRXE 2ZWYA 2E4TA 3IETB 1N0LB 2WTRB 1WUNT 2JI2A 4RGNE 4W9CC 4OM1H 4I88A 5C0CE 2QADD 1ID5I 2WNKA 3CFEA 3ROLB 3SDAD 3T65A 3KDPB 4HKXB 4LCCB 3GMRA 5I2IB 4M6NH 2ZXGA 2ED9A 5HSFA 4UB0H 3IDIB 5D1XD 3WL9A 2B1OA 5CBEB 1YY8A 3BPLB 3WJMB 1ZT7A 4JRYD 2DMHA 2N7AA 3JQOB 3KD4A 1OT2A 2BHYA 1SM3L 1HIMH 1EGJH 2X9WA 3WNIA 1N2RB 1QSFD 4ZMNA 2X9XA 4TSBH 3GTTA 3QEQB 4LHQB 3NFNB 3U0PB 3GDBA 2WQRA 3P4OA 4GLRH 5GRWA 5HI3D 1O6TA 4LPYA 5CU9A 5I75B 1RHHA 3B2VL 3TEZA 1X5FA 4NHUA 2CMRH 4PV1C 3WXVH 3U1PA 1MJ8H 5C0ND 1CGSH 1PLCA 5T1KB 4JFDA 4TQIA 4YSPA 4Z5RB 4BV1A 1A1NB 3IGUA 1VFUA 1I8MA 3CFMA 2DWEA 2YAEA 2CLRA 3WGVB 4LKXA 5IJCC 4OIIH 3ULUD 2QV2A 5AW5B 1TFHA 5GGVY 3D2UD 4NKDA 4Y4HB 3ZKSD 1EZSA 5JDSB 2X5PA 4JHWH 1G6VK 4ZXBB 3QFJB 4PV9B 4PJFA 2AQ3A 1S7RB 4PCYA 4LVOB 3WIFB 1JPGB 5ID1B 1OK8A 5DQDH 1CU4L 2Q10A 1MFEL 2EILB 2O6DA 1XF2B 4YZFE 4FL4C 2ESVA 3DX7A 1WZ1H 1OTSD 3U1SH 4MS6A 3QHFL 1MIEL 3T0EE 1EA9C 3FU7B 3HZYB 3EO0A 2XPGB 5A2AA 3PPEA 4H7VA 2R9HC 1HHGA 2YJLA 3CK0H 4ZAKA 2P80D 1BD2A 2DN7A 3K2KA 1TCRB 3BZDA 3C60D 3JWDL 5E8OA 1F90L 4CNIA 3BVTA 5FM8A 4X5WA 1LNUA 1OE1A 3TBVB 5CO1A 4DGIH 4X99B 1INDH 2IC2A 4QY8A 3STBA 4AV4A 3T6VA 2E46A 3U2IA 2FYYA 2GUOB 2O5XH 4X9HA 5KVDE 4ELDA 4PSPA 5B1AB 3F2LA 4GG6F 2GHZA 3BE1H 2D0FA 4PJFF 1MFDH 5IOPB 2JKSA 2NXYC 4GXUM 5T1LA 1L0QA 3WNMA 3F83A 4MSWA 3N1PC 3ERXA 4JZNA 1YCSA 3H7BA 3G6DL 3MKGA 2VZ1A 1DVXA 2OSLB 3ROOB 1DVZA 3SGJC 4BZYA 4X9BA 1JAEA 3ZOAA 5HHPA 5CKGA 1DVFA 4PJAB 4P46D 4NERA 5D1QD 4FKEA 5EEXA 5HYQB 4PUBL 2KT6A 3KCWA 5AAMA 1TZHA 3I3EA 1FSKB 1RZKH 1RULH 4ILDA 4QRTB 4F7EB 1HILB 3MTXA 1FO0A 4K23L 5IWLC 3AAZA 3GF8A 4RQQB 4IRSA 3ABKB 1IAOA 2VUKA 1IX2A 2ZT9C 3AREC 4NFBA 5CCJA 5C3LD 1EEUA 3RPBA 5H4ZA 1H6TA 1XGTB 3B2UC 1EERB 4KQ0A 1U21A 5LBVA 3KPNA 2VLLA 4NJAL 2W5PA 2ZXQA 4Z7NF 2CBOA 3FYIB 4D8PB 5J1SC 1QI3A 3MACH 3O41B 2CJTA 5T3ZE 5I5MA 1JGDB 2PPDA 2XZQL 2VDKL 5F2FA 4AC2A 4ZW5A 4HD9A 1FH5L 4QRSB 1ANUA 2DTML 4AQ1C 1IGJB 1J5CA 2UVEA 4XNYH 1TQUA 4KVCH 5DR5H 1YEGL 4M1GH 3G5XA 2VERA 5J9PA 4QJ5B 4HC1A 3VGFA 4N28A 4A2LA 1SDDB 1T5XB 2G30A 4J1UA 3GSRA 1RZPA 1YYMH 3QXAA 3IS1X 1CS6A 3TTSA 4IBLT 2H9GB 2O5NA 2NY6B 5TH2A 3VXNB 5FO9A 4ZPVA 3WD5L 3H53A 4MCYB 4G7QB 4AJ0A 1ES0A 3PE9A 2NY0D 4MMZC 4GRLD 1YJDH 3QRLA 4MA3B 4X6CF 1J9SA 1CL7L 3RFZA 3TWCH 1MCNA 2PO6A 1RZKC 4WVRA 2J8UF 2A73A 4K73A 3A6BL 5CILH 1S9YA 3RIFK 4AL8L 4DERA 1LE9A 4HS8H 4WZ9A 1J0JA 5DZVA 5D96B 1JGUH 3SDDB 3MPCA 5D7IE 5BS0E 1QSFE 2K3TA 4JHZA 4DKDC 4R8WL 1K9TA 3HW7A 2UXTA 2QV4A 4R90H 3T2NL 3WNPA 4K71B 4PWEA 3PHOB 5T5FH 1CE1L 2G2NA 4G8FA 4MAYC 1QASA 4HUKB 2XQBL 1RUMH 5C07B 5D1XB 1XF1A 1YYLL 3VXUD 1OW0A 2D7QA 4NNPH 4QF1A 1AG6A 4PJ5D 2WANA 3DLQR 4X0KA 4X6CE 2PABA 5AVQB 2BC4A 2R2EA 2AABH 1IGYB 1J0YA 4UOQA 1NA8A 3FAXA 5DD0H 1A3RH 3TYFA 5FGCE 2YRPA 1F2XK 3D9AL 4AK2A 4MA8L 2OXGA 3ULUL 4MJ5A 2WUBH 2EDNA 3NSJA 4KU1A 3QUXB 1EJ8A 4Y1AE 3L3GA 3MJ8A 4HIJB 1UASA 4I77L 5D1ZB 4HQQH 5FUOH 3TH3T 4RBPK 4A2EA 1KGIA 4BH7B 5GHWL 4Z7UA 1CFQB 4M5SA 1H3UA 1A02N 4XMUA 3ZTCC 4KXZH 5C0AE 4DSYA 2Q8AH 1CBVH 2VXQA 4KH9A 3QYNA 4FQQA 1B4LA 2AEIT 5CZVH 1HILA 4ABUA 2N59A 1UXWB 5CN2A 4CILA 1A4BA 5BW7A 4JUSA 3UEZA 3U48A 5F44A 4N2DA 2I9LA 1XR9A 2W8CA 3A6CL 4YZWA 4PVLA 3W9EA 1BYOA 2NNCA 3DHPA 2H0PA 1KYOJ 4E9QA 3DIVA 1WCQA 1XGZA 1QYGL 4BGLA 3OXRA 5FDYA 1I1YB 5L8KB 3QS3A 4UIKH 3G08B 1X5MA 5HI4C 4K7FA 4BZ2A 3EDJA 5JXED 1SOXA 3C2AH 2ODHA 4HCRL 4X7DC 4Y9GA 4XP9L 2PWEA 5LB1A 3QJVB 3KPLB 4IMKC 4IBUA 1AZVA 4Y8AA 5CNHA 2I32A 1QRKA 4OGAC 4QRRA 4IIQA 4O9HL 3RLSA 5KVFE 1IGFL 3QC5X 3SKMA 3NJHA 4YDNA 1ZOXA 1CFMA 2Z7ZA 3KWUA 4XVUD 4RESB 2FGWL 2ZOKB 5CEZE 4AQEB 2H6OA 1Z9NA 4HCGA 1FO0B 1HKFA 4HLZG 2PO6D 4YSTA 2W88A 1G7JB 1YAZA 1M6OA 4WJKB 5FIEA 1Z9SA 3NH7H 4XMVA 3QIBD 1V7NH 4XVTH 1XFPA 1YDPB 3MUZ1 1YEEL 4M1CC 2CWRA 3BX7C 2A9ML 3Q48A 4JHBA 4TMPA 5EIVA 4DEPB 2WYIA 2EEXA 1JF1B 3MROA 4NQVB 1AGDA 3LKPB 4MD5B 4JFVA 4K4KA 4PJFB 1MLBA 4ODXA 1EEQA 4P4KA 5H2BA 5DZJA 3ZR5A 3P3UA 1F58H 1Z6JT 4NN6B 4WSJA 3HUJF 4G6FD 4P49A 5KVDH 2DQUH 1FHNA 3NJXA 4BD4A 3WTTA 4CGUB 1THAA 2O6FA 4YC2C 4NUJB 3W0WB 1J0HA 5B39B 2YPVL 2D03H 1ZTXE 1XGUB 3FT2A 2XPZA 5E8NB 3HS9A 4TULH 3RY6C 2WYTA 4NP4H 3WFHA 1EO7A 3CSGA 1N3NA 4JG1H 3WNOA 1BBJA 2AITA 5KBMA 4NENA 2AJYL 3C60A 1KCLA 1A8JH 2GFBA 3V52L 3IJEA 1WD9A 4D0CB 1N59B 4KKLC 3MLVL 2DI9A 4HPYH 2Q2LA 4YUEH 5E4EC 3UOAB 4N20A 1SLVA 3WLBB 2CLZB 3VW3L 3U83A 4X7TB 5E00B 3FU6A 4XCNB 2LU5A 3ZYIA 5BZDA 2I60L 1I7ZA 3HAEH 5LNEA 1OP4A 3K0WA 3RI5K 5K9JH 3Q06A 4N2NA 2XQYK 3ECUA 1FL3B 2WLNA 3NRFA 3PDOA 1S9WA 2ZF8A 1MXGA 2VR4A 3TCTA 3CPLB 2Z92A 4P2OC 2X4SA 2Z91B 4K3DL 4DGVH 4PAZA 3FU7A 2CK0L 1M7IA 4P05A 5J6GA 4IRJA 4K8RH 3UZQB 5SWSE 5BO1H 1QUNB 2YPLA 4HWBA 3AU0A 2HWZH 2HCZX 1CUOA 2WVTA 2IOIA 2A6KA 3U1SL 1RZ8B 4E5XB 2HSIA 4J3WA 2X0VA 3L6FB 1LJMA 1QNZH 1UWGL 4JFEA 3AT8A 4ZFZB 3CSYB 3PJSB 5AZEL 4OSUL 3C5JA 4MA7H 5FKAA 1QRNE 1FVEB 1BFVH 2CCVA 2DQEL 1B0RA 2BCMA 2X4OA 4LDLB 1FN4B 4MAUH 2Z8RA 4KRPB 4HKZA 1IM3A 3OHMB 2VSDA 2OA9A 4PWFA 4PW9A 4Z7WA 5CLWA 3HVNA 4P99A 4PJ6A 4IKLA 4YO0A 1A2YA 3JWOL 5PAZA 3W0WE 2AJVH 3GJFK 2P43B 3QIUD 2FBJH 2VDRL 1A6VL 3ZYOA 1AQHA 1RAMA 3VSTA 4BJLA 2CXKA 2FE0A 4X0NA 5L9DH 1DLHA 5D7LA 5GRVK 3ALPA 2JTDA 3L9EA 4MMYA 4UM9D 3HRZC 3V8CA 2F7OA 3V4VA 3OMAB 5I1LB 4L8BA 1AZZC 1DN0B 1M05A 3QPXH 4P5RA 2DM3A 2IEPA 1IBDA 3LEVH 1I1YA 5TH2B 3V6OE 3VXNA 3QDJA 1TTRA 5BRZA 1PZCA 5E0QA 4MCYA 1NCJA 2CH8A 4H25B 5ABDE 3ETSA 3GSVA 4Z7VE 2IANE 2YLKA 2JXMA 2KUTA 1NCAH 2I07A 2YIHA 2DJSA 4GLRI 1YEGH 3AS2A 1U8PB 7FABL 1G7LB 1NOAA 1ZSHA 3T6QC 1NGPL 4MLSA 1SHWA 4Z7WF 3O4OB 2Y22A 2CO3A 3DX8A 4F92B 3IDJA 3QXTA 4XP6H 1YPZF 3DUUB 1LE9B 3P0VH 4JFOB 3S35X 2JCCB 2BSRB 4BK4A 2FZ3A 3CFQA 4WWKA 5J57B 1F6FB 5DD6A 2XN9D 5JW5A 1VKXB 4H0HB 1LWRA 5DC9B 2Z4TA 5I8EA 3GSQB 2X1PA 3W56A 4WJG3 3WU1A 3GTVA 3DI3B 4XMPL 4AEIH 1LO0H 2NNXA 2Y36H 3L5WA 3L5XL 1IT9L 3VQMA 4W9HC 3EXLA 1UA7A 3FH7A 3GI9H 2ZX7A 3ZZLA 4NQDA 4PJGB 5E51A 4LOVA 1L5GA 4N5ED 5FO9B 5F9OH 1XMWA 5DS1A 1GC1H 4HKJB 4I1RA 1AOHA 4YSCA 4GQZA 4UNVA 1SMDA 1A7QH 2L7EA 2JIXA 2ZCKH 3ASNB 1KACB 4KKRA 1FCGA 2F53E 4POUB 3RY4A 4AQAA 2IADB 4XP4L 5B1KA 2EE9A 2ZUXA 1WZKA 2DY2A 3NDZE 3PWPA 4I2XB 3OKMA 5KVEE 4PG2A 1Q90A 3EBIA 4ICWA 5DD5L 4V1DD 5B39A 1AQ8A 1S7WB 1BJ1J 1TVBB 3IPBA 4KY1H 5GGRA 5C0RL 2ZWZA 1SHXA 2J55A 2OMVA 1EDQA 3QUZB 5J11B 5DJXA 1EEYA 3JYBA 5IB1A 1CXIA 4OJYA 1HL8A 3H9SD 3WS3B 1W8OA 1P9MC 3RWFA 3ARBC 2FWSA 4DPRA 1ZT4A 1BF8A 4YH6A 5CD5C 1HEZB 2BSSA 3KM2A 5IMMA 5I6OA 2X1QA 3ZDZF 2C5DC 4U3SB 5A6LA 1NMBH 5EBGA 1XB3A 1KCVL 4AM0Q 1E6OH 4LVHC 2APSA 1RIHL 3MLTA 4WV1B 4QXVA 4RLDA 1U3NA 3TYGH 2QVTA 4LHUD 1UKSA 3Q5OA 4N2CA 1ZVNA 4BHUA 2G3MA 3W82A 1KJ2L 3F6IA 2GTWA 2B1HL 4YE4H 5DUJA 3TYFB 4YFEA 3ZHFA 1KPVB 4KHTH 5E6RB 3FZUD 1BZ7B 1FYTB 3FB8A 3L95A 4X6BB 3BW9B 2HUHA 4LMQI 1T0PB 1JCKA 3GSUB 3MNZB 4YHZH 1O7DC 4RDBA 4XN8A 3CV5A 1VPOH 1A4JB 4OBRA 1G1OA 3DJTA 2BWDA 1JGVL 3FQ2A 3W57A 1MLCB 4OFKA 2DM7A 1VFBA 1URLA 4DUXA 5FA4B 4W4OC 2BSED 1WWCA 3BPOB 5LNGA 3T71A 2J71A 4M1DH 4XPTH 5D5ME 2XN2A 1ZEAH 2VLKB 1A3LL 3ILQC 5I16A 1LP9B 5D4IA 1Q4NX 1UM5L 2R39A 3NEEA 2DEXX 1KV3A 3H9HB 3KVPA 3O9WC 4GSXA 4ZS6D 3RKPA 3S37X 2X9YA 3VFMB 4M9OA 2YD7A 4YE4L 1NINA 3MTRA 1JZ7A 5L2KA 4OZFG 1FO0H 4N2MA 3VMPA 4BSJA 3Q2WA 4DP6X 2FJGB 3QNFA 3O3EA 3V5KA 1VFOA 4ABQA 1T0NA 1F1AA 3OTTA 3CFDB 3ESMA 3Q6GL 3S4SB 5KSBB 1OLLA 2WQSA 2GCYB 3HE7C 1SM3H 3QPQD 2Y1VA 1QSEA 2JQMA 4P2RA 1M3JA 2DIBA 2XWJB 2V6HA 3MRBB 2CGYA 2GQHA 1BQ5A 5D93C 5JNYB 1IFRA 3GT6A 3RNQA 3GSNA 2Z0UA 3FO9B 2XV0A 4AG4H 4E68A 5TPWL 4XODA 4KNSA 3KW8A 1SJHA 2MKWA 3GEWB 3MRGA 5DJ8A 5EU5A 3VFGL 5KVMC 3GBNL 3TGXA 4G3YL 5BRZB 5INCB 2C9VA 4PV9A 4A2FA 4D3CL 3DTUB 4OZIE 3R7QA 4R9HA 1NSNL 4YIQA 4F2EA 3SEPA 1A6AB 1ZA3B 5BPPA 3FUHA 4FFZL 1LM8V 4QPEA 1JNNH 3S3CB 4AZ8A 3P0GB 4K2UH 4JK0D 3MV7E 4PI2A 3UTSD 4Q9QH 1HZHH 4KX7A 4NKOA 3RTLA 3FCTA 3LKSB 4TNEA 4MMXA 2CPCA 5AW0B 4YWGL 3V5HA 3B7YA 1NKGA 3H54A 1UB5A 4GKOA 5IB1B 4JG1L 4EDXB 4EUPG 1U8MA 4HHWA 3HLAB 1PYWA 4HJTA 3UO8B 3PDOB 3ARTA 4H1LH 3L5HA 1LO5B 2N3JA 5D4QA 4QHNA 4G1EB 4O5LH 2Q8BH 1BG1A 1RK7A 4Y5XC 2CBMA 2HVJA 3RI5F 2BFVH 4EE2A 5CEXA 2OI9B 5CZVL 2QL1A 4GKNA 2ENPA 3QZOA 4PTUB 3QEHA 4TV3A 1B9ZA 4ENED 1Y7VA 1UZ6E 2K9FB 4EO5A 2JH2A 3GIZL 3MRKB 3C60B 2ZZUT 2Y5EA 4H8WH 5HJ3B 3TVMD 2XIIA 4D0CA 4DEWA 4FQCH 5D8JL 4YHPB 2H6UA 4CVXA 4CN1A 5K1VA 2WIMA 3VWKD 4AEHL 2D73A 4XX1G 3IS0X 2OL3B 3DUHA 4BZ2H 1S9KC 1G7PB 4X6BA 1BFOB 2AK4A 1ZLVK 3SKJH 1B4TA 1SVBA 4PRHD 4F33B 2N01B 3EO1A 3VG9C 8FABA 5MP6L 3C6SB 4N3UA 3B9EA 2WY3B 4HUWB 4BRJA 4I0PD 3ARGC 3GKWH 2D3VA 1FFTB 5CD5D 1MHEA 1MLCA 3LSOB 4MZ3A 3M17A 3G5ZB 2LABA 3H7LA 2YS4A 2E9JA 1QSVA 2IAMC 2YMOA 4RAUB 2V5MA 4DW2H 3VRIB 2EIEA 3MODH 2BP0B 5E1QA 2BW5A 4XCFH 1IEAA 2V3FA 4Z3EA 2XX1A 4PWKA 1CYWA 2RJMA 4ZFGH 1ZANL 2Z31A 5HI4D 5JQIB 1T7VA 5JXEC 1RULL 3B1UA 5IQ9A 1TVDA 3KWXA 5F1SA 2PW1B 4NO0B 3VX1A 4JZOA 3K72A 3SB3A 1L9NA 1T21A 5F88A 4MKMA 3NSXA 4V2CB 1GZQB 1Q0XH 1GW0A 4NIKB 3DUSB 2DWXA 2Q7AA 4PWIA 1E2ZA 2BVPA 3CZLA 1BZQK 2XWXA 3T1FA 4FXGB 1AGCB 1SGKA 4GIOA 3LHPH 4OSUH 1LK2B 1U92A 4R26H 5LVEA 1ASPA 4WHYH 5JNYA 5KEZA 2X42A 4HFWA 2BRQA 2QVMA 3QEUB 5FO2A 5DJ8B 1C5CL 3S34H 4LEXL 2HMID 2G75B 2VH5L 3K6FA 1XR8A 3L2NA 2R8SL 1YEKL 3JV6A 3H6AA 2J1KA 1MJUL 1RMFL 2EDWA 3W2DH 3QXWA 1LEKA 4EF3A 4HEPG 1WCBB 2AQPA 3FSWA 3HAEB 5D5MA 3WXWL 3D85B 4BDVA 1I1CA 3CFEB 3N41F 3QQNA 4MJ4A 2WQAA 3DRTB 2E0PA 2X12A 2JVUA 4QTIH 2R0KH 1G7IB 4G2AA 4XNXH 1KCSH 4IOFC 2BO0A 5EOCJ 2NX5D 3LKSA 3QBTB 3TONA 2ADIA 2CDEB 1PD6A 4QWWC 3RURA 3TA4D 4CVZB 5IVZA 2YZ8A 3F64A 2WHVA 3HLAA 4N2AA 5CLTA 3NTCH 3MCYA 1C08B 1P5UC 2EDBA 2QQKL 2XDHA 3LN4A 1AZNA 5CJQL 5TK4A 3BH8B 4M29A 3JWNH 4P23B 5L2JA 4AH2B 3D34A 3VXUE 4ZFFB 2AVGA 1FNEA 1R3KA 5D2NB 4I13B 4GUCA 1OGTB 1SJHB 3MRGB 5EU5B 2JI3A 3GZPA 2IBZY 3KWVA 5DS8B 3UDWC 3OG4B 5DYFA 1IUZA 1I8MB 4GBXB 1KJ3L 4JPQA 2R2EB 3ARED 5EZJB 4N0CD 3H3PH 1S8DB 2ZKHL 3F12A 4BK5A 3PGDB 1ZWIA 1KTJA 3IEAA 3VXUA 3MLTB 4NJAH 4WV1A 2GEEA 2HG0A 3FZUC 3X2QB 4W6YB 1AR1B 2J43A 1SYSB 1NICA 1FNGB 3OF6D 4UDTB 4UOJA 3IJYB 1CFQA 4JFQA 1OAUL 4GKZA 1SVZA 4Q6IC 3D18B 1KB9K 1CFSB 5HHOD 4D2NA 1P4BH 1AZRA 2FJHB 5CJOH 5GGRY 1IKFH 3P3RA 2V5RA 3ZL2A 4ZOEA 1OAJA 3BSHA 3GXPA 4FRWA 4WK4B 3HVDA 3DROA 3ZO0A 1D9KB 4JFYA 5D2LF 5MP6H 5ACLA 5J3HC 3I85A 6CGTA 4FULA 3QEQE 4ODHL 4UTAH 3QUHA 3EGSA 3FT4B 4K3JH 2FWOB 1JWSA 5C08A 2EO7A 2C1OA 2J5LB 5L88L 3EJUA 3SODB 2FWUA 2QTVA 4RCAA 5KSAB 3PWUA 1CVSC 2D9QB 3PGFH 4OGXH 4KJYB 3MBEB 4GS7B 2VSCA 4XCFL 1O9ZA 2C1PB 2J20A 2JKTM 3AY2A 3RB7A 3RWJA 1FL6A 1JHLH 1PAMA 4OCXL 2O26U 3HKFA 5DEZA 4P5MB 3UZEC 3RWGA 1PF3A 3IYLW 4PVBA 2AJSH 4LSVL 1F4XH 1YRKA 1CG9A 1JGUL 5CJ8A 1SXSA 2R27A 3HB3C 4OCSL 5ILTH 4U1NA 4F8PA 2ZCZA 1DANU 1K4DA 3F5WA 3TCLA 1XCTA 5GZNC 4O2FB 2ZWKA 5IFHH 1E7UA 3P69A 4N5EC 1BQUA 1X6NA 3OLEA 4P2RD 1UKQA 1RK1B 4GXVL 3KG5A 5AOKA 4UQIM 5EU7C 3TZVD 5PCYA 3BQUC 3K8MA 1NEZG 2B77A 2NSQA 1ZHKB 2O5ZL 4LRIC 5F7MC 5IK3A 1VGKA 2FQFA 3IFLL 3ARRA 4W9KC 5EUOE 3UG3A 4MXQC 2LGNA 2OW6A 3SDCB 3B9KD 4A7QA 1NDTA 1P7BA 2WINA 5A2IH 1W9XA 2J1WA 2DMKA 2R1YA 3QJTB 5DK2B 2ADYA 2YXFA 1E4JA 3PWNB 3GUFA 2C9RA 3DUSA 3OC8A 4QXGH 5IHZA 4IIQB 2UZXA 3GSWB 5CWSB 4UT9A 3UH8A 2FX9H 2DWDA 2FL5B 2VLRE 3DPBB 2MEJB 2A2QT 1D5IL 3PY9A 3DURA 3BSGA 3MXVH 2QFRA 5C0JA 3HNSL 4WUUA 1CZ8L 5AVZB 3EG9A 1I82A 1P1VA 4GI6A 2X4TA 4P8QA 1YY9C 3O11B 1G7JA 1RHHB 2AW2A 1P7HL 1MQ8A 3NTCL 5A2LH 3THMH 2VL5B 2MPAH 2A9CA 5CZKA 2WW8A 4XPGL 4MYWB 4PS4H 1FG2B 3QC6X 5JHLH 4HH8A 4FFWD 4FD0A 4PTUA 4PJDE 3EOAA 2D7PA 4YBHA 2COVD 4J3BA 2FSEA 1J10A 5E9NA 3ZE1F 2VM9A 3MUUA 3CBRA 3TU6A 2NR6D 5IBLD 4WF7A 4NKDB 4YS4A 1OANA 3BGFC 5TPWH 1SHSA 1VGEH 4CC4A 5L0QB 12E8H 2WSDA 3MV8B 3N42F 1JRHL 5IF0A 2FGZA 1OTUD 1X5LA 5AKSA 1TVHB 3DGGB 3MMEA 5MEQB 3IMTA 5MENB 2X4PB 2WCGA 3FMGH 1QBML 3U4EB 3VGAB 5KW9L 2FCBA 2XQBH 3QG6B 3V2AR 3GIZH 5JHDD 4KQ3H 4LCYB 1UD8A 1CQYA 3V6OA 3O6ML 5EEVA 2WGNB 3I50H 1MAJA 5E6ID 2HVJB 4IJ3B 2J4WH 2C8NA 4N9OB 4P46B 3LQAC 2APXA 1ET5A 3QEHB 5TDPA 1A7QL 3OPZH 3SYAA 2R0KL 2OR9H 5C07E 4NQXB 4G6JH 1E9PB 2W0LA 4HU2A 4EZJA 2ETWA 4LBAA 1A2YB 4OLZH 3APCA 3FQTB 4PWGA 4CN4A 3OD3A 4OVVA 5C08D 2N56A 2AXFA 4GH7B 2OXGB 4Z7OE 3TESA 1EO8H 1K4DB 2R69A 3S2CA 4N8VA 4AUYA 4LCWD 3BLKA 3B9KA 3Q3GA 1RIVL 3BQUA 4FEIA 1KTDB 4BFNA 3STLA 1BEYL 2J73A 3F7VB 3MOAL 3GS0A 2G3NA 4YOKA 5TE4H 4NT6B 3DRQA 5JXEA 1C12B 2EYRB 1OK0A 5LG1A 1ORSA 1R1CA 3HC3L 3HZVB 3UGEA 4UCFA 3L4VA 1NGPH 2AV1B 2ZG3A 5A16B 5GS0C 1H9DA 4ZFZA 5IQMA 3OR7B 1RIHH 3VD7A 1J05A 2DJ4A 2YUXA 4BE5A 2Y72A 1U4FA 2NYZA 3HMXL 4L3ED 3CAFA 3D8MA 3MUHL 3IMUA 4G83A 1YN6A 3MAWA 2WLLA 3TCXA 4F2FA 3VWKA 2ZXDA 2PWFA 1NWPA 5KYWB 4P9HH 3NJFA 4J6RL 1HI6A 5E8EB 1FORL 3OJDA 4LL9A 1E28B 2K3HA 5I1IL 4PS4L 3BEVB 4KKCD 4WUUB 2ESVD 4X8XA 1NCNA 1NFIA 1JPTL 2ZYHA 4Z7NE 2H1XA 3OQRA 4PJHA 4TSBL 2VZSA 3WO4B 1XEDA 4J3OF 1E9QA 1MCCA 3BH8A 2DQMA 3GPEA 5L7XL 2RAMA 3CZGA 2CRIA 3QEUA 4M7LT 5JA9A 1VADB 1HQRB 2FSEB 1CBJA 5T33L 4Y2OB 2X3CA 2ITDA 4U0RB 5IB5B 4P3DA 3UO1H 4BDVB 3PWNA 1FG9C 3GI9L 5DJYB 3MQIA 3DRTA 4LCCC 4OZGE 1NC2D 1UWXH 3BD3A 1Y18A 2DYRB 1UWEH 3B9DA 3MN8A 4LAJH 4CGTA 4ODXB 1VACB 1FV1A 1UKTA 5F9AC 1WTGT 2P42B 3PF2A 3BSZA 4GAGH 4PJIF 4QHMB 5DEGB 1ONQA 3RGVB 5FA3B 1WF5A 4AE0A 3D18A 1MREL 4PRID 1A6ZB 5EA0H 1P5VB 3RWDB 3FL7A 1JNHA 4JG9A 3LQAL 1KTRL 2DYPB 3NIDB 2JMRA 4FFVD 3MNDA 4XTRD 4W9LC 3QQ3B 5DUPL 5GISH 1GS7A 2LHAA 4ZOBA 1LILA 4N1HB 4X7SL 1UZ8A 1X7QA 4ZBJA 4YEFA 5I23A 4N6RB 5IW6B 1NCCL 4DKTA 4HMDA 3HBPA 4FFZH 1A47A 3S4SG 3FTUA 1WAAF 4JO3L 4JY4B 5CS7A 1Y6NR 1DO6A 1WHOA 3K1DA 2DI8A 2MTPA 2KPNA 4I87A 4P04A 3MRRB 4HV8B 3TBYB 1DBML 5DJZA 2YMXL 4LVOC 3Q8EA 4F1ZA 1UA3A 3HPJB 4K8RL 3PFQA 3MA7B 1CDUA 3UJTL 1E9OB 4F27A 3INUL 2YQBA 3HNTH 2FH8A 2P5WD 3PDGA 1YMME 1T4WA 4LASL 1L9SA 2HMIC 1NAMH 3BKML 1CGYA 1T4KB 3N6YA 3LDBB 5BRZE 5CSGA 5EULV 1RIVH 1T22A 3EH3B 1S7UA 5SWSB 1HL9A 3BUYB 3T0AA 4PJXF 5DHDA 4XX5A 4UZUA 4D7PA 3QI9A 3HS8A 3T6XA 4DIXA 5EU3B 5GS2D 4L9DA 2HWZL 1A7NH 3SJVB 5CKAA 2VKXA 1F8TH 2XA8H 1HHIA 5E7FA 2H8PB 3CIAA 4Y88A 1DN2A 5JHMA 4FA6A 3GK8L 3HCVA 3BAEL 1NCDH 5EWIL 4R2GC 1RI8A 1R17A 2CR3A 3AZUA 3N2JA 3N44F 2H3NB 3NJJA 4QRPD 5I8CB 4HDIB 2DAVA 2WCPA 2PYFB 3EDFA 4NZFA 3WEXB 3E1F1 1ORSB 3CFBB 1IBYA 4F7CA 2CA3A 3O6FD 4Z7VB 2K6YA 5KVGH 2X10A 1KN2H 3ROLA 1ZK9A 3PL6C 1MHPH 5E2WH 5HHXH 3AQYA 3O4LB 1IAMA 1MCJA 1DN0A 3HG3A 3IMRA 4EPSA 3H3KA 4JCWA 3AG4B 3VFMA 3D0VB 2VZVA 3U2SB 4OV6F 4BEIA 3ESPA 3LZRA 1CDHA 3RX7A 5FFLA 3B6SA 1SLUA 1N2RA 1EZLA 2AK4D 2YK1L 2EXTA 2WCSA 3NFNA 2R69L 2BVOB 4OGQC 1YJDL 4IGBC 3VACA 4YHOL 1UA6L 1S3KH 4XMPH 2GTQA 2FGWH 4CKQA 2QTEA 1WYJA 2CGZA 4OLYL 3D39E 2Q7YA 5JHLL 5JORA 5ICYA 3GJFB 5KANI 1F4YH 1B0WA 1T6WA 1W8NA 3SDXB 5C0JB 2EUXA 3U9UB 3QG6A 5B39G 4TQ8A 4HFUH 1NMAH 2WBXA 4OD1L 1T83C 1E5AA 5T3XD 1Z2KA 3UBXB 4NWUL 4MA8H 3LH2H 1ESOA 1ES0B 1F1DA 1N12A 4R4FL 1KIPB 2P44B 2Q8BL 3H6JA 3B34A 4GQQA 3T3PE 1ND0B 5HXMA 4UINL 1XGYL 3MCG1 3VXMD 3SJVE 1CT8A 1Z5HA 3OKKA 4QOKD 5DFVC 1VAHA 1CR9H 1ROCA 3OM3B 3P02A 1YYLH 2JJUA 5DZLA 5DYOA 4WNQB 1ODUA 3HC4H 1J8HB 3NP4A 5DUBA 2BJML 1MFMA 4I48B 1M2VA 2EIZB 1NFDE 1WFTA 4TNVK 3IVKA 3PWLB 3L1OL 4LSVH 2HRLA 1T7XA 1JZHA 5DVKA 1JNHB 3T3MB 5ITBL 3ILPB 3QULB 3PABA 2AP2A 5T1MB 1N8ZA 3DGGA 4HLJA 1EXGA 1XSIA 3QUML 4MZ2A 5D96C 2ZUQB 4B3EA 4HQQL 1UFGA 1MDTA 3FO2A 4DP4X 1JXJA 3GKWL 3PQYA 3CDGA 3PWPD 3KYKL 3FFDB 5M95B 4XGZA 1GGBH 3Q5TA 5MEOB 1MJJA 3U0TA 1HL5A 1IV8A 3BGMB 4C56B 2YEZB 4S1SH 4M4RA 1G9MC 3O6LH 3NGBB 1KC5H 1OXYA 2PCFA 5A3ID 4U3SA 3EYOA 3FQNA 1PQZA 1KV7A 4TYUA 2L04A 2HAZA 3UYOD 4N8CH 1AY1H 3DYPA 2YKKA 3BMWA 5GS1B 4JFDE 2WJ5A 4MAZA 3RX5A 3IGFA 2VYRE 3L4UA 8FABB 3U6XA 2EAEA 2IDQA 3ZDXB 1OAKL 4XMZA 3ILQD 4Q2ZB 2OSWA 3T6ZA 3ROOA 3C6LD 2O4EA 2AQTA 2GIXA 3HHRB 4O58H 2A9MH 1QOKA 1SBBA 3D50A 2WD0A 4UTAA 2JCCF 5D1ZC 4Q9BA 4UBDD 1V3MA 5CP3A 3O8XD 4DP9X 5BS0B 4ZS7L 5AAMC 4NRYB 1FZKA 1MI5B 1X4ZA 4IOSA 2Y9RT 4RSVA 1YHPA 2NMSA 3TF4A 1CDIA 1EK3A 1VADA 2BVTA 5IWLA 4RETB 1CD1A 3C8HA 1MEXL 3IMVA 3VWJD 2P5EE 3L9BA 4Y2OA 5LGJA 3DO7A 2NNRA 1KGXA 3E3QC 5IHUL 4X7EC 4JRXA 3ZL1A 5EBMB 3F58L 4ETQB 2GYSA 3IDIA 5I15L 1OSZA 3UZVB 2F6AA 2K4WA 5DO2C 3HS0C 2WXLA 1VACA 2O6PA 3HMXH 4LVEA 1FVCB 5KSBA 2N4IA 3DX8B 1XCQA 2ZNWA 3HMWL 4KTEL 5GIRB 3SPHA 4A6YL 3FU0A 5E5MA 3T04D 2JCCA 3N43B 1ORQB 4AYBA 2EKSA 2UWEB 4MS8C 1ZTMA 4B50A 3DVGB 2UX7A 1HE8A 5GZOD 3BDYH 3U79A 3UTSA 4BELD 1K8IA 3H2WA 1KDIA 3BFOA 3GMNB 1FWXA 4PREB 2YWYA 3O3DA 3ZKXC 3VSVA 3OPUA 3OG6B 1DUYA 3DTXB 5C1MB 1KENL 3O0RH 2Y4SA 5DD1H 1UXLA 2R1XA 1W72H 4GINA 1I31A 5C0AB 4XNUH 2ATKB 4LU5H 2DICA 1OAXL 4JB9H 4UV7L 4G80A 4HISA 5SWZA 5TE7H 4BM7A 1NLBL 2BNRD 2OJ1A 1B4JH 3SY0A 4G8EB 2YXMA 5BUPA 1JOIA 3MA7A 1QPXA 4CVWA 2ID5A 3ES6A 3NCEB 5FOBB 1K2DA 4XOBA 4TRPH 4WNSA 3GIVB 1AI1L 4OCRL 4D9QE 2X89A 4KXBA 4GO9A 3MV9E 1MWAB 5IEHB 5AOMA 1OWWA 4KO5A 4H8WL 3REVB 5BVPH 5TF1H 4D0BA 3CZEA 1NEPA 1Q72L 1R47A 3WDJA 4TPRL 2E3VA 1GJUA 3NPZB 4DCQA 2DM2A 1OPGL 1KCUH 4LNVA 2D3NA 4R8WH 5C0CB 2PPAA 1GIGH 2HKFH 3QVAA 2EKJA 4G7YL 4AY0A 2EYTB 4Z3GA 4WEMB 3LXCA 4ZW7A 1P53A 5IIEB 5GISL 1AD0A 3RPKA 1GGIL 2HB0A 4MAYD 4XNMB 1F11B 4A66A 2WYHA 3HR6A 2IDCA 1EHLL 2X7LB 1SFDA 4B0MB 3KS0H 5FF6A 3BXNA 1BWWA 5F3HA 3TH4T 3TBYA 2Z91A 5E5RB 1WC7A 3PQYE 4ONHB 2AANA 1IAII 2OCJA 2L7UA 4HUCA 1AXSB 2ED8A 3FT9A 5ICZA 1MCQA 4OAWB 1DQQB 2VXUL 5F9WB 5EOTA 5E2UL 1D5ZA 2DMBA 4NO2A 5IFAL 3MJ9A 2R29A 4MQTB 2CBQA 2BY2A 3ABMB 3KPSE 5DRNB 3SBWC 1E43A 3CFCH 4Y19D 1FVEA 2HKHL 3ZU8A 5DK2A 1Q0XL 4ZX6A 4KI1A 3S98A 4M61A 3RG1C 3LN9A 4WO4C 3RWHB 3GK8H 2A74C 1C5DA 2KERA 3D51A 3BPNB 4HPHA 2AJXH 4DOHE 2YGQA 4CJ1A 4L1DA 4R7DB 1I8AA 2ARWA 1FRGH 4KBPA 2GB2A 4KRPC 3O81A 1XCTB 4O2FA 3S3BB 1IM9D 3D4YA 4YK4B 2G5RA 2Z7YA 1SF5A 2Q1EA 3R18A 4Y4FB 4L1SA 1HEJC 4DKFH 3TYGL 2BDNL 2UY6A 2P7TB 3QA3B 1U8HA 4NAMA 5IK3B 4J28A 4A67A 3C5ZD 2B8OT 1A3LH 2C4FT 2P5WE 5DJCA 3U6XS 3B7TA 4MMZA 5HYQA 2H0JA 2FLBT 2HZHA 1ID2A 1Q9WB 4LF3B 2QADC 3GLAA 2VLJB 2QPSA 4LSQL 2ZSWA 1V27A 2I07B 3KJ6L 1AE6L 4UDUA 3MNVA 1W6WA 1XH3A 2NLJA 3ZTNL 4DWHA 3BDXA 5EF3A 4TLKA 1EVUA 3O9WA 4J3OH 4X8CA 1IRAY 1LD9A 4QRAA 1AD9A 3SGKA 1PZ2A 4XN5A 3GLZA 1LO4H 4PPTA 2HX8A 4HWBH 3LKOA 4P48A 5FO7B 2H1PH 1KSRA 1H6FA 2ZYSA 4R3SA 4OCYL 3QPQC 3QFDA 2WWOA 4OZHB 3X3FH 4ZW6A 4OZIA 3WIHA 1ITCA 2DDQL 3B9AA 1OM9A 5BXFA 2FHCA 1U8LA 4FHJA 4PVNA 4WWNA 5HDBE 1G94A 2F15A 4M02A 4TNVF 1FAIL 2BIIA 2EXWD 1JWMB 1UJ3B 2PPEA 4N0YL 3EAKA 3TIEA 1ECYA 3U0TB 4C56A 3GYRA 3Q6GH 1B3IA 3D12B 2CLZA 3APFA 3FOLA 4P4KD 4QKXB 4S1QL 4MJIB 5AQ0A 4G80B 1NFAA 4Q9RH 1SNRA 5BMFL 5L2KE 1U91A 5TF0A 3IU3B 4LGRB 4R4BB 4FDWA 2MRYA 3LPOA 2LE9A 5LQBH 3BH9B 1YMHB 2EIZA 4F7TA 1B0IA 1OCCB 4YDKL 4FS0A 3AC0A 3QDMD 5JOEA 1DQQA 2VQUA 2J8UB 2A6DA 4KV5E 1C16A 4QOKE 3CUPB 2HTLD 1KYUA 2NXZC 2AV1A 3ILEA 3WFZA 3P0YL 5IW3A 3ESNA 4OIIL 3UBFA 4P46A 4NNPL 3RIAF 5I76A 1SN0A 3G5ZA 1UD5A 3ECBA 3NCCB 3V4VL 4EQ3A 5LN4A 4KUZH 4ZMAT 5LBSH 1OV8A 1U3JA 5SX5K 1DSFL 1VB9A 1OEZW 1U2YA 2BNQD 4G7RB 5BW7C 5IIEA 2YD6A 4IS6B 3QCVL 4PJDA 3NJMA 1Z9LA 1A21A 4N2FA 3WGUB 3NSYA 3QZBA 3IXTA 3PNRB 2L4OA 3R0NA 1M2OA 4M48H 4WFFE 5GSVB 3UZEA 1OSZB 2XXCB 5DHXB 3V9FA 3O45B 3EYFA 1GCYA 2XXFA 5MHSD 6FABL 4ZS7H 1SOSA 1S7QB 1CG9B 2DIAA 4I89A 4F37F 2GJRA 3VE0B 4UOZA 5DJ2A 5CZXC 4HSAC 2G0LA 4HIJA 3WDHA 2YPVH 1LK2A 4DOHB 3NP3A 5AYTA 1PD0A 2GEQA 2Q6WA 1MVFA 2QPFA 2IH3B 3ISWA 3QNXA 1KB9J 1BXAA 2YWZA 1F3JB 3P73A 1UACL 2B39A 2QSCL 5HGGS 2EDXA 4PU2A 4HWBL 2L7QA 3VFRB 4IQHA 4JO1L 1QSFB 4HXAH 3QRGL 5CXPA 5JLZB 2RQ8A 5DEJA 3BE1L 4NXSA 1GGCL 2ICEB <