4DW2L

The crystal structure of upa in complex with the fab fragment of mab-112
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
215
structure length
214
Chain Sequence
DIELTQSPAIMSASPGEKVTMTCRASSTVSFHYLHWYQQKSGASPKLWIYATSNLASGVPARFSGSGSGTSYSLTISSVETEDAATYYCQHYSAYPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Rezymogenation of active urokinase induced by an inhibitory antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 45
structure length 214
sequence length 215
ec nomenclature
pdb deposition date 2012-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dw2L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dw2L01
1FNSH 2IANE 1FVDB 4WHTA 4XNYL 2EXYC 3RGVB 5CLWA 4CMHB 2D0HA 4NQCB 5LWYH 5LGJB 3ZKMC 4J6RH 3BFOA 1PG7L 3OJDB 1EBPA 3SDAC 1CICA 4QXGL 5EO9A 2VDPH 1MLCA 4WV1B 3RWGB 4ZFGL 1FL6B 4XC3H 3GK8H 3QNXB 5I1AB 1GL4B 2LFGA 2VB5A 2HYMA 5HVFB 1SJXA 4XTRD 1WBXA 1ZANL 3QDGD 5IW3A 2DKMA 3UTSE 1NJ9B 5DRXB 1B6DA 3KDMB 3FT2A 3NIFF 4XNYH 5EO0B 3U7AA 4RGNB 1MCRA 4ELMF 4F7TB 4S2SA 4FXGA 1A4KB 5KSVA 4F33B 3MO1B 5A2JH 3BQUD 3D1MC 3G5ZB 5IG7B 2EDQA 1OAYH 1PG7H 2DYPD 3C8HA 43CAA 3OB8A 4MHHG 3VJ6B 4JKPL 1AD0B 3ARTA 5GGRB 4QXGH 4ZFGH 5I76A 1S3KL 3DSNA 1HSAA 2GUOB 1H8OA 3NACH 3HZMB 1ZE3C 2CR3A 1ZANH 2BOBB 1T83A 3N50A 1FFNB 3FTGA 4D0CA 4QRRE 1M7DB 4AQ1B 3RTQC 4PJCE 4FTVD 4EZMA 1E4KC 3FB8A 2Y9RT 5D7IF 5F1NB 3MA7B 4OT1L 3ZDYE 3QXDB 4P2RE 1G1CA 4HWBL 4OV6F 3VFNA 4NT6A 3DXAD 2LTQB 1LO3L 3W9EA 2OI9B 2ZUVA 1UJTA 3NCBB 4URTB 2VQ1B 4P3CL 4F7CA 4JKPH 4EI6A 1U93B 3QA3B 1A1NA 3MGAA 3FO9A 5FYJH 1S3KH 2CMRL 5J12B 2HFEA 3QNZB 3F62A 3JTTB 4U1SA 5F7DA 1T7ZA 3T0WA 2QSVA 2EH8L 1EK3A 4L8SB 3QFJB 5TQ2L 4X8JA 5IIEB 1GOHA 2ICWJ 3RWFB 4OGAC 2YD4A 4IRSA 5IMMA 4I1NB 2R23A 5JOFA 5I0ZA 4OT1H 1CICD 1KLUB 2HMIC 4M4RA 3VFRA 1P5UA 4HWBH 1NUGA 1UA6L 2VABA 1UXWA 4JRXE 4EEEA 2IFGA 2PF6A 2Q87A 4P3CH 3RU8L 3ZT7A 3T3PF 5E8NA 5A16A 2CR6A 4X9GA 2WWKO 1AO7E 3QXAB 2DI9A 1HHJB 2CMRH 2DLFL 4NKIL 5EBMA 5ESAB 1R3IL 1SVCP 4L4TE 2KZ1B 2EH8H 1WZKA 4H0HB 1RUML 4PGCA 5TQ2H 1T7VA 3QCVL 4JN1L 2P5WE 2V2XA 1L0QA 4PJBB 1P1ZB 4GKSB 3OR7A 4KQ4L 4KTYA 5GZND 1K2DB 3DARA 3QIUC 2VIRA 2VDOH 5BS0B 5GS1A 5SWSB 3BD5A 4C55A 1NGZA 3RU8H 5DR5L 3MLTA 3MV8E 1BFOB 2CLVA 5F7YC 2UYLA 2BFVL 1D5ZA 3ZT6A 3MROB 1K8DB 3RIAF 3BP4A 4N90D 2DLFH 4NKIH 1FCGA 1QFWM 2WUBL 5E56A 5E1AA 4L9LB 3GSNL 1MCJA 2NY3B 1CFTB 3QUKA 5I1JH 4I18C 2BSTB 4H1LH 4KRLB 4N8VA 5DVKA 2VN4A 1UT9A 1ZT4A 1JPTL 3D6GA 1RUMH 3BHBB 3L6FB 4E9LA 3KYMA 3QCVH 4JN1H 4HKZB 3WNNA 1ZWIA 2AXFA 4KQ4H 4LKCB 3QCUL 1RZKC 5E7BA 3RNQB 2VJXA 1WITA 4YHPB 3M17A 3U0WL 1FLRL 1S9XA 1DBKL 4Z7WA 4X4XB 1YDPB 1KB9J 4R2GD 1FL3A 4YFLF 2BFVH 4M1CC 3O8XC 3V5HB 3I3BA 3S5LG 2WUBH 1QD0A 3ILQC 1M7XA 4IRSD 1D9KB 2VL4A 2HP4A 4DWHA 4FQQA 1JPTH 1TZGL 1AGFA 4S1SL 3RGHA 1EGJL 4PD4J 2Z31C 4NO0B 3V5KB 4LCUB 3D0LB 4PRIE 2QEJA 1U8JB 2HVJB 5CBAB 4EI5B 4QCIB 1VEPA 4OKDA 2XZZA 3GMMA 3U0WH 4LGRB 4JFFD 4N8VG 1DBKH 4UQ3A 4PR5A 4JPIA 5D2LB 3W9DB 3BWAB 3GIVA 4NKOA 2ITCB 4JEGB 5EIQA 1MSPA 2BP3A 1GGIL 4I5BA 3NABL 4C56D 4NKMA 3RDTA 2NY5C 4G6ML 3VRJA 1RZ8B 3HPJA 3SO5A 4NJ9L 1K3ZA 5E8PB 1TZGH 3VXTA 4S1SH 1EGJH 3ET9F 4WUUE 3G5VB 2EKSB 1UACL 3CC5A 5IB1B 4L8DB 2OCFD 3IS0X 1JGUL 3SDAB 1YYML 3TYGL 4HX1A 5J6GA 4U3CA 1T3FB 1I1YB 4Y19E 3MJ8A 5KSUB 1FN4B 4JY4B 3T0EC 5I17A 1GGIH 2FSEB 4NQDB 2VTFA 3NABH 4LFHD 2OJEA 3DUSA 4L3AA 4PJ5E 3H7BB 2P44B 4G6MH 1TQCC 3GHEL 3P0GB 5ETUB 4YHNA 2I9TB 2C4XA 1GC1H 1CE6B 1KB5L 3VRIB 4Y5YA 4MAYC 2RCSL 1UACH 3V6FB 1ZHBB 1U2HA 3HR5A 5DRZB 2IH3A 5E6YA 4P5TA 3H3BC 1RZIB 3B6SA 4OF7A 5FKPB 4MD0B 4LPUA 1YYMH 3TYGH 4JGJA 2XWBB 1BOGB 1F3RB 5GGSB 4X7CC 4A6YB 2M26A 4ZUSB 5D1ZA 3H8NA 1S7QA 2CRYA 1H5BA 4CVXA 2MQ3A 4Y4HC 5I6XC 1F4WL 1IC7L 1E4WL 3KXFE 3TA3A 3MRQB 1EO7A 1W8OA 3WXWL 4ELMB 3MRDB 3GHEH 5GGVY 3RTQB 5EC2B 3OJVC 4O00A 3RL2A 3UTOA 1EVTC 4APQC 1KB5H 4LLMB 4ZPVB 2RCSH 4GQPH 1MAKA 4Q9QL 3RWCA 5DD3L 5DDHA 4MHHI 1KTLA 4IIQC 3RZCA 3RDTD 3GSWA 4OD3L 1WQVT 1U8KB 3BDBA 3RI5F 1F4WH 5FO9A 1ZS8B 4DN3L 3UZEA 1A7PL 1LP9F 1E4WH 2H2PD 2Y5TA 3CVHA 4PJFA 2FL5A 3WUWA 5ISZB 1MCLA 4IHOB 2CDEB 1XGRA 3GMQA 4M6NL 3WXWH 4YHYC 1JF5A 4OAWA 5D7IB 5CHNA 3BEWA 2DQCL 3TCLB 4FQXA 3EJZC 4GAFB 4ZUUB 5F96H 3N9GL 1BP3B 4F58L 2XV6B 1J05B 3F7VB 4L3EB 5F9JA 4Q9QH 3S3PA 5DD3H 3H3PL 1WK0A 5IEHA 3QJHB 3UCRA 1NGXA 3O3DB 3QP3A 4NUJB 4G7VL 1KJVA 4OD3H 1UKTA 3U36A 3MNZB 2DTML 1PKQB 1I8LC 3M1BA 4DN3H 1TTGA 4QRQA 1PZ5A 2VLMD 3GMNA 1VACA 3VXOA 4M7LL 3UBXA 4M6NH 1MY5A 1NCCL 3B3IA 4PLKD 4MSWA 5DD5L 3PL6B 1Q0YL 1EHNA 4I9WE 2DQCH 2EYTB 4P5TD 4WNQA 2O5ZL 2BNQB 5HGAB 4F9LC 3N9GH 1WBZA 2AEPL 3V0WL 3P30L 3QIUB 4F58H 2X05A 2DS4A 4MB4A 1ZOXA 1U8NA 3LS4L 4PIRF 4JFZH 5D1ZD 1INEH 1J1XL 3WUWG 1FYTA 3H3PH 4Y5XA 2XKUA 3H9YA 1IM3A 3TA3D 3W82A 1G84A 4JKMA 4YR6B 1X5XA 2H9GB 3OKNA 2YD8A 4OD2B 4PJ7E 1IRAY 4G7VH 4N0CC 1F6AB 4M7LT 2DTMH 1LE5A 3F8UB 4I18B 1KCKA 4RMSA 3SN6N 5ITFB 4M7LH 3TPUB 1V3LA 4HS6A 1T04B 4NUGL 5DTFA 3LN5B 2WNGA 1UB6B 5DD5H 1Q0YH 1RHHA 2O5ZH 5MENB 1JUFB 2GJ6E 4OZHE 3RZCD 2AEPH 3V0WH 3P30H 3VFMA 1A64A 2J5LB 2EE2A 3LS4H 2YBRA 5F88B 4R96B 1DUZB 1J1XH 4RSVA 1X5AA 3V0AC 2R0KL 1KLGB 1F13A 2H26B 5BW7A 2AK4A 5ICZB 2E9WA 2J8HA 1XF4A 2KKQA 3O8XB 4GW4A 4NFBA 1GGUA 1RZJH 4JHZA 3U2SA 3UC0L 4FQXD 5C0EA 5IVNA 4U1MB 4YGVA 1GSMA 3NFSL 4Z78A 3FQUB 5H8DA 4EDWL 25C8H 4NUGH 4QGYA 4XXDB 5EZIL 5FDWA 5C0NC 2Z31B 1BFVH 3CX5K 1KV3A 1FFQA 5E9DB 2YD1A 1XIWC 2J1KA 3MRRA 4YJZL 3WNOA 3GSVB 1BQHA 3K8MA 2ZG3A 3HA0A 1H3VA 3NGBC 5D93C 2EDHA 1X4ZA 3FT3B 4X5LA 3VFPB 4DGYL 1K85A 4XRCA 3UTTB 5FK9A 4OZGA 5FM5O 3UYRL 3KNBA 3HI1B 1P84J 3UC0H 5E0QA 4NPYA 1KIPA 1BJ1H 4HIIB 1B88A 1HXYB 1WTLA 3V2AR 2ID5A 4EDWH 2DQGL 2IANA 2Z4QB 5EZIH 3MX0A 1FPTL 1FYTD 1VA9A 3MRIA 4JZJC 1IEAB 4RQQA 3S35L 1P2CA 4OKVA 3I50L 2I27N 2ZPKL 3KYKH 2Z91B 2EIEA 4DGYH 3G6JE 3OX8B 4O51A 4CU6A 2B7DT 4ZYKB 3UYRH 3T0EB 4XNUL 5E1HB 3U46B 1ZTXL 3KPNB 1MJUL 2W60B 2A6IA 3QXVA 1JYNA 4HWZB 5C0BE 2QL1A 1TQCB 3D69B 3QWOA 4XCNA 3UTSA 3F65A 5KG9B 5MHSD 3QCTL 4YXHL 5FM8A 2DQGH 4AQOA 1QVOB 2FJFA 3L5WA 1PJ9A 4X6CE 2CDGB 4KROD 3SBWA 4MAYB 2AK4D 1IMHC 1T2QL 2J6EA 3S35H 2ERJC 1ZVSB 3I50H 3IGAB 1HH9A 2ZPKH 2HT4D 1KT2B 1QFOA 4LCWE 1CL7I 1UB5B 2EEAA 4TN9A 2PXYC 5INDA 1HH6A 4Y4HB 5I6XB 1A02N 5D70L 1ZEAL 4XNUH 2DWEA 3QEQE 1ZTXH 3TBWA 3VCLA 1MJUH 1HHHA 1T0NB 2YPVH 1NFKA 3K46A 3IT8D 1N8ZB 4M7ZC 1CGWA 1HHGA 3QCTH 3HE7A 4YXHH 4QRRA 2L7UA 4IMKA 3PXJA 4APQB 4PJCA 1AI1H 4XX1E 4F8QA 3VFOA 3BGMB 3T77A 3VFWB 1CFQA 5HD8C 1OF2B 3IDGA 1T2QH 2V2WB 4P2RA 4YBQD 4Z7OF 4IIQB 4G8EB 1HYSC 3QIWA 3LZFL 3B4NA 1U8PA 4M03A 4OM1L 4NOFA 1JZ8A 1UKQA 4LPWA 1ZEAH 1MHHB 1OY3B 2IAND 3QQ4B 5C0GA 1A2YA 4W4OA 1AHWC 2XWJB 4YHYB 3OR6B 4KV5E 1CL7H 2BNRB 4LOUC 5F6HI 3RPKA 1AIFA 3IETB 5C09B 4HH8A 5D2NC 3X13A 5HYJE 1KN4L 1OSZA 4RNRA 1WF5A 3LKSA 4D9LL 2YXMA 4JRXA 3HNSL 3OJ2C 4NP4L 3LZFH 3NAAL 1ZLVH 3SDXE 4OM1H 4CW1A 4KUCD 1LP9B 1C1EL 3UTSD 1PX4A 1AO7A 3HE6B 3KYOA 1I85A 2FNBA 1P4LB 5DHVA 1NBYA 4FS0A 4L4TA 4N5ED 1ZVHA 1MQKL 5BQ7A 4X9BA 5C9JB 1S9VB 3GHBL 3QUZC 1F90L 2P5WA 1UM6L 1TNMA 3FQNB 2BCKB 4PJGE 2HAZA 2I24N 2PO6A 1KN4H 2OTUA 3BQUC 4C83B 4QNPE 2YHGA 4D9LH 3LCYA 4XMPL 1EEYA 2CIKB 2DI8A 1UXSA 1ZHNA 3GJFB 3HNSH 2UUDH 3TJHC 3FRUA 4NP4H 3NAAH 4PP2B 4O5LL 3MV8A 5GIRB 1Y6NR 1C1EH 1NUNB 5DMGD 1N26A 3HE7D 3QEUA 1YA5A 5IBTL 4QRRD 1O0VA 3I3EA 4MLIA 4FXLA 1ACYL 3SJVB 1BHGA 4OI8A 1YC7A 4ZSOB 5F3BB 5JW4Q 2YPKA 1DBJL 1MFBL 4MD5B 3GZKA 4P2RD 2F19H 2V7HA 3BP6B 4HEME 4JDVB 4PLOB 5DS8A 3DUHA 4LAQL 3GHBH 4U1IA 4XCEA 1F90H 3QIWD 4FQHA 1UM6H 5DJZA 5AG8A 4R8WL 3MFFB 1YY8A 3SKNA 4HIXL 8CGTA 3AU1A 3I3DA 3ZSSA 4XMPH 1OAKL 1PEZA 5JPNB 2FX8L 4LDOB 3RA7L 3U6RA 4P5KA 4O5LH 2D9QB 3C9NB 5I66A 2R2EB 5T5NG 4UZGA 5D8JL 1N64L 1Z2KA 1OT1A 5I8KL 3CVHL 3LEYL 1ZGLM 3BH9B 3MREA 4X6BA 1WWWX 1GXEA 3J8F7 1NCBL 1N7ML 1ACYH 3D3VB 4UB0L 5K9OB 2PW1A 2X4QA 3I75B 1DBJH 1VADB 3VE0A 4QHLA 4LAQH 4JRXD 2DF3A 4G9DB 4WI4A 1XIWB 1CICC 2FR4A 4R8WH 4PRIA 2Y6SD 3NGBB 3MGTB 5D93B 1NGYA 3C5ZA 1E4JA 4HIXH 2H2SD 1OAKH 2FX8H 4MA3B 3EDKA 4POYA 4H1LB 3RA7H 4K3JH 3QBTB 5T1KB 4L4TD 5EC1A 5DK2A 5D8JH 1N64H 4YWGL 1EH9A 5AWNL 3SGEH 5F9WC 3RL1B 5I8KH 3CVHH 3LEYH 5CEXB 4HS3A 4N9OB 2Z92A 3OKEA 1DLHA 4BKLB 4XP6L 4XP9L 2P5WD 1N7MH 4X7FC 4UB0H 1I4FB 3ZE0E 3ARUA 2HT3D 2J2ZA 4FQPA 3IFPA 1B0GA 2PO6D 2X4NB 4K55A 2AJUH 4EN3A 4JZJB 2F58L 1WISA 3K7UA 4OF8A 1K4DA 3R06A 4WUUA 5DUBB 3MV8D 1BF8A 4ODVL 1OAUL 1HQ4A 4UT6L 3P73B 5IR1B 4Q9CA 3MOBL 3WL9B 3ZYOA 1UENA 1JGLL 1GGCL 1C16A 1YEFL 2FHCA 3GSNB 1VFAA 3N06B 1RJYB 2YD6A 2BVQB 5HTSA 2FEEI 1H8NA 3WHXB 2ICWI 1T83C 4Y19A 1D5BB 2EC8A 4G8IA 3CK0L 3MRJB 2YZ8A 4YWGH 5AWNH 4PJEE 2NTFB 1KCSL 4XP6H 4XPGL 4XP9H 3PXHA 3IXTA 4PJ5A 4P57A 3RIAK 3V6ZA 2WLYA 4M61B 5EB9A 4HT1L 3E2HC 4JKLA 5I1LA 4LSQL 1LMKA 2RGSA 3BN9D 2F58H 4LLYB 4X9HA 5EPMA 4XCCL 3IDIB 1X5YA 1H0DA 2CDFB 4BYHA 1ZSDA 1MHEB 2ERJB 4MWFB 5IM7A 3RIFF 3BUYB 4GKZB 4ODVH 1OAUH 4GJTB 1KPUB 1SBSL 3FB7B 5SWZE 2R4RL 3MOBH 1ODAA 3O41A 3T0VA 1JGLH 1GGCH 5C3LD 1R5VA 1YEFH 2PXYB 2HJKB 5DUML 4R2GC 5CIPH 1X6NA 2XOTA 1AGDB 4X0KA 3NH7L 3TC9A 2RR3A 3LKOB 4BSVA 3CK0H 3UTQA 1RV6X 3KXFA 3S97C 1KCSH 1VEOA 4XPGH 4M7ZB 3F6LA 3STBA 2ED9A 4XP5L 4QOKB 4HT1H 4PRID 3BKMH 1X5HA 4NQEE 3WE6B 3H9HB 1ORQB 3C5ZD 4LSQH 2X6MA 5SV3A 1QUNA 4MQXD 4XCCH 5DVNA 1F00I 3TCXA 5F7UA 1KENL 2Q20A 4HBCH 3Q5TA 3GSRA 4I77H 1SBSH 2R4RH 3EYFA 2JK5B 3MRNB 3UPCA 1K5NA 2ZCLL 4RFOL 4WFFE 5DUMH 1PGRB 2Z35A 3MTRA 3LKRB 5CJBA 1KJ2L 3NH7H 3VMNA 4EN3D 3MRKB 1AHWB 1E28B 3HAEB 4L1DA 2QQKL 3QRFM 4NC1C 3SDCA 4WUUD 4WEMB 1FNLA 5DVLA 1OGAE 4TOYL 2JJTA 5D2NB 5AUMA 4TTDD 1FFPB 3T0XA 1IAMA 2CGRL 5IVZA 5H2BB 4OV5A 5D9SB 3VXPB 2EH7L 1CT8A 5ACMA 3L5HA 1KENH 2Q86B 5AYQA 1Q9OB 4Z7WF 4OFDA 4Y19D 5T3ZE 5IROA 1MFDL 2WUCL 4XVUD 1SQ2N 1A7BA 1YNTA 2ZCLH 1NC2A 4HUWB 4RFOH 2YN5A 3EKCA 4PJ5D 1AY1L 2X70A 4C4KT 2P42B 1JBJA 2YMXL 3OKMA 1KJ2H 4F9PA 4BSJA 3AM8C 1KB5B 4WTZG 2QR0A 4NO3A 3C2AH 4G6JL 1JP5A 4X9FA 3MRCB 3QUZB 4I2XE 5CJQL 1X7QA 2VWEC 1R3JA 4QY8B 5IOPB 1MIML 2CGRH 3BQUB 2J6EL 2AJZA 2C26A 5HPOA 2EH7H 3ARZA 4HBQA 3C87A 2P45B 5TDPA 2DD8L 2AV7A 2WUCH 4JKKA 5E8OA 4M48L 1QBMH 5F9AC 3TO4D 3KXFD 3NA9H 3OKLA 4PJ7A 1CLOL 1AY1H 4LF3B 1FGNL 2A74B 5IB2A 1BVLA 3IDXL 2YMXH 2MCPL 1CQKA 4Q9RH 5I30L 1NFIA 2DKSA 3SE3A 5HDOA 3KS0J 4FTVB 4G6JH 3DIFB 2GAZA 1CR9H 2I07A 2GHWB 5CJQH 3MYJB 3TP4A 1RFDL 4L5FL 3DXAB 1IEBA 1MIMH 2GJ6A 3GEWB 4OZHA 1UQSA 1NBZA 3CJJA 2CIIA 2EYRB 3GMRB 1PD6A 1P7KB 4D0DA 3QHZL 3NCJL 3EZ8A 1HHKB 2DD8H 5KW9H 4M48H 3RDTC 3GMOA 3RPIB 1LE9A 1A6AA 4Y4FA 3V8OA 2ICEB 4HIHA 4NHCL 1PW3A 4WHTB 1IAIM 3SDCD 1CLOH 2N7AA 4KKCC 1FGNH 1JV5A 1NCWH 5AZEL 4TVPD 4HC1A 4V1DE 2MCPH 1TQBC 2H2PC 1UCBL 3MUY1 5DRWA 1CFNB 2XQYK 4FZEL 4O2FA 5CZKA 2CRMA 3BRFA 3RI5K 4RGNE 3EYUL 5CZXD 4ZUWA 1CICB 1MLCB 1RFDH 4L5FH 5IHUL 5BMFL 2APBA 3PDOA 2EDKA 5IMLB 1NC2D 3FRPG 1QLEL 3PWJA 3QHZH 3NCJH 1YEGL 2B1HL 1OP5H 1WBXB 1LILA 4NOBA 1O7SA 3MNWA 5EOTB 4JHBA 5FB8B 1J0IA 5D7LE 1JTPA 3SEPA 3FT2B 1WEJL 4NHCH 1XGUA 4MXWL 2W91A 5F9WB 4S2SB 5L9DH 3GSQA 4I9WD 4FZEH 3GJFK 4Y5YC 3SE4A 4PLKC 4WFHE 3EYUH 3K4ZA 4IRJD 43CAB 2E9IA 1UZ8A 4L4JA 2BRRL 3UJJL 4HULB 5IHUH 5BMFH 3O81A 3GDBA 4CMMB 4HKBA 3WJLA 3V5DA 2X42A 4JO1L 5D1ZC 1QLEH 1H5BC 4FQIL 1YEGH 2IPKA 2B1HH 3H7LA 3PUCA 3TA3C 2HLAB 5J56B 1U8IA 1G0YR 3JWOC 3G6JA 1AD9A 3FTGB 4D0CB 1WEJH 1U9KA 1A6ZA 2UY6A 4MXWH 3BRGC 1V8HA 3FB8B 4F8TA 2X5PA 5EBWB 4X7EC 5C0BA 3QFJE 4WDIB 5TH2A 3VFNB 3E2HB 2XPGB 2GJ6D 3BIBX 3W9EB 3S96A 1OT2A 4F7CB 4EI6B 2BRRH 3UJJH 4X6CA 2RAMA 1W72B 4JFQA 4MQTB 1A1NB 5DI8A 1NBQA 3QDMB 4Y4FD 3EYQD 4JO1H 1CIDA 5IF0A 3U0PB 3MBXL 4FQIH 4U1SB 5F7DB 3WXVH 4NKQB 4R2GB 3U79A 4UOW1 4LCWA 1KLFA 2ATKA 4P23A 3ZHLA 4C54A 5C86A 4RMTA 1X5JA 3KR3H 4JFHE 4X8JB 3WNLA 3T2PA 5KN5A 4IRSB 4FQXC 3QEQA 4L4VE 5HHMB 3PWVB 2R23B 2Z8VC 5JOFB 4U33A 3MGOB 1QFUL 2FLRT 4BZ1L 4QGTA 2WBJA 3VFRB 3B9VA 4Q2ZB 2W07A 4NRYA 2EDFA 5EU7C 2VABB 1UXWB 1N0LA 3QJFA 5GRVK 2FBOJ 1OQOA 4KC3B 2UWEF 5E8NB 5A16B 2CUMA 4PY8J 5BS0E 5JTWA 2HJLA 5EBMB 3MBXH 3TF7C 1Q94A 2YRLA 2OTWA 4BZYA 4JFFB 3V52L 5IBLC 3RJQB 2Z9TA 4FOMA 4QHNA 2J4WL 3WSQL 5F7LB 4PGCB 4EOWL 4LBEA 4C56B 2V2XB 3BO8A 4OCYL 2GSIA 1MHPL 5F7HA 2DN7A 3OR7B 1QFUH 4BZ1H 4WGWB 1HHIA 2UZIL 1B0WA 4WWKA 2EDBA 4M43L 4Y5XC 1CN4A 3MLTB 3REWB 3S9DB 1JNHA 2CLVB 3TYFB 3U0TA 5HYJA 1D5ZB 2MHAA 1ZA3A 4XNMA 3BP4B 3N85H 1EEUA 5E1AB 3QUKB 3V52H 1ITBB 5FUCE 1ZA6B 4EIGB 2CO7B 3SDXA 5C0BD 1KG0A 2J4WH 3WSQH 1ZT4B 1M4KA 3SGJA 4EBQL 1YN6A 4EOWH 2D7TL 2JTDA 2DQHL 3KYMB 1A1MB 4OCYH 1MHPH 4S10A 5GGTA 1ZWIB 5HGHA 3B8YA 1JRHI 4U6XA 2UZIH 1QG3A 3ABZA 1F3DJ 3M17B 2CSPA 2OXHA 4M43H 4BQBA 5JO5A 3WFDL 4U1GC 4Z7WB 1E6JL 2G75B 1UZ6F 5IFHL 4CBPA 1FL3B 3W5MA 4LCWD 4JZOA 1XAUA 1EEZA 4PJGA 1UJ3C 3Q48A 4P23D 5IV2A 1JRHL 2VDKH 2MSPA 4UNUA 5ELIA 2YK1L 4LLQA 4JFXA 4OZGF 1N5YH 1S9WA 1MJ7L 3DO3A 3L7EB 3QEQD 3O6FA 4OCNC 5D2LE 4F7EA 3NZ8A 2Z93A 2WBJD 1V3KA 4RAVA 3O9WC 1AGFB 4EBQH 5EIIB 3T4YB 2D7TH 2DQHH 1OB1B 1VFUA 4XBPA 3MRHA 5IVXE 5GSVA 3X12B 1C5DA 1MQ8A 5DJDA 2FJHA 4E0RA 2DLIA 4YZFF 3GMMB 4IJ3C 4YC2C 3WFDH 4POZD 5CMAB 4PR5B 4JPIB 1INDL 5IFHH 1L9MA 3GIVB 3R1GL 4NKOB 5DGQA 1JRHH 4I4WA 2GY7B 2YK1H 5EUOE 3L3KB 1I8IA 4NKMB 5FHAL 3RDTB 1MJ7H 4WY7L 2P8MA 3C60A 3MZTA 3VRJB 1BBDH 1DQLL 3NCFB 3HPJB 4XWOD 3FZUD 1QP1A 4KUCF 3VXTB 2P8LA 1EDQA 1TQBB 1XR8A 2VDQL 4J3TA 4O02H 4OBRA 1Z6JT 2AXJA 4WWKD 3GMLA 2YD9A 3NCYP 3QEGL 5CZVL 3CC5B 5HYJD 2XG5A 2EIDA 1KOAA 4XGZA 4RDQF 2R0ZL 4HX1B 3ZDXE 1TNNA 5J6GB 3OBAA 4PJHE 1M05A 1MF2L 1AKJA 3MJ8B 3R1GH 2IMNA 3KPSE 3VFUA 5I17B 2CRZA 3FN9A 2BY3A 2E6QA 3CFEA 3NFNB 2OJEB 4WY7H 4UOW0 1AGCA 1DQLH 2XA3A 3CX5J 4LRIA 4GRLC 4YHNB 4CGTA 2VDQH 2UVEA 3SBWC 4Y5YB 3EJYC 2WP3T 4PJCF 3QEGH 5CZVH 1L6XA 1QRKA 2DRUA 4N5EC 3RY5A 3HR5B 1KTDB 2IH3B 3ZDYF 1N6UA 5I1IL 3B6SB 5F9DC 4X5WA 2R0ZH 3HC0A 2A38A 4W70A 3O6FD 4R0LA 5D1ZB 4GFTB 1MF2H 4P4RA 1S7QB 5F6IC 3S6CA 1H5BB 1XF5A 2B4CL 4CVXB 3TA3B 3VA6A 5GS0C 5GGRY 4MMXC 1WVZA 1OWRM 3MJ9A 4NC0B 5DMGC 4KKAD 5C0AE 3HE7C 2VH5L 5ISZE 1A7QL 4IMKC 1T20A 3RL2B 4S1DD 4PJEA 1V3MA 3WMSA 1P7HL 5GISL 2NY0D 1JGEB 5AEAA 3LS5H 4Q7DA 4NCDA 4JLRB 3Q2CA 4D9QE 3DO7A 1KTLB 2APWA 5I1IH 3T0BA 1CD8A 1NLBH 5BVPL 32C2A 3L7FA 3O6ML 3C60D 1PEWA 1N0XL 3EOYG 4NWUL 3ZSTA 4X6EA 2GSGB 2B4CH 2DIJA 5FO9B 3N1FC 2Y5TB 1ZLUK 4CADA 1T7YA 2FL5B 4NCC2 5SWZA 3JZ7A 3GMQB 4LHUA 3HRZB 4OAWB 5ILTL 4OZ4A 4PTTA 5CHNB 3BEWB 1L0YA 3DSFL 4NC2B 4HC1L 4FQXB 2FATL 2VH5H 1A7QH 3UTZA 4PJ9C 1X5ZA 4U6YA 3DV4A 3PNWA 3DVIA 4XH2A 4PRAA 3UJTL 5F9JB 5GISH 1AKJD 3ARPA 3QHTC 1KACB 1R5WA 2FBJL 5IEHB 1ZXQA 5GJTL 4NQEA 2VDRL 1UGNA 3HKFA 1NGXB 5BVPH 4OLUL 3T3PE 4XPAH 3O6MH 1KJVB 4NWUH 1N0XH 5I1GL 3CSPA 2AJXL 1CTOA 2G9HA 2Y7QB 3IDUA 4PP1C 1FNEA 3M1BB 4QRQB 1PZ5B 2H2SC 1VACB 3DHJA 3VXOB 2AAVA 3UBXB 2EYSA 3B3IB 1QR4A 3TIEA 4J1UB 4MSWB 5ILTH 1C7TA 4MA8L 3CIQA 1OP9A 3DSFH 4HC1H 2FATH 3DYMA 1WBZB 1T7XA 2BVEA 4RBPH 5LBSL 2HT3C 4LVNC 1U8NB 4NO2B 2UWEB 3UJTH 1MOEA 4ZO6A 1FYTB 5MENE 1OGAA 4Y5XB 2NW3A 3BSZL 2FBJH 5GJTH 4KRNA 1IM3B 3L5IA 2VDRH 3WKML 3OKNB 3TZVC 4OLUH 4ZFZA 5I1GH 5B38G 2AJXH 5E00A 5IK3A 4ALAL 4XBGB 2KZWA 4HIJA 1AGEA 3NFPA 5E5RB 5DTFB 5HHQA 4B7LA 2D2OA 2FGZA 4MA8H 1RZFL 4XCFL 3ARRA 3B9EA 4J7RA 5JQHC 2HVKB 1J7VR 5LXGL 4TVSa 3ELAT 2JIXA 3VFMB 5LBSH 1I3GL 5AD0A 3NIGE 1ZLWK 4KROB 2VZOA 4I2XA 3BN9C 1G9EA 2I9LB 5E9DE 4U1GB 1YMHA 2AK4B 5B21A 2X4SA 5FIEA 3WKMH 5SWZD 5C0IB 1DQDL 1UJ3B 4LHUD 4GLRI 2PTUA 2B8OT 5F1SA 1N59A 1MWAA 3U2SB 5E03A 1HWHB 5JW4R 2D31A 4GG8A 4ALAH 5C0EB 3GB7A 3CUPA 1WWCA 3F6IA 4WHCA 4PJIB 5B3JE 3JXAA 4YGVB 5FCUL 1NEUA 3RIFK 3ULSB 3DVFA 3MYZA 3O9WB 4MLSA 2VAJA 1CYGA 4G6FD 5FDWB 4WEBL 1ONQB 1RZFH 4XCFH 4Z0BL 4YFEA 4NZDA 1XGPA 5J06A 4NQED 3EDFA 1MH5A 2VMFA 5LXGH 3LRGA 3MRRB 1I3GH 1BQHB 2EC9U 4OGXL 4R4NC 1S7SB 4IJ3B 4YC2B 1P9MA 3QDJE 1DQDH 2IALA 4OZGB 1CFSA 3M8OL 3KNBB 5B39B 4OZFG 3MV11 4WFFD 4LSRL 4NPYB 4WV1A 1KIPB 1A6PA 2V9TA 3WO3B 3LQMA 3KPRE 5FCUH 3P0VL 5I1AA 4GLRH 1BM3L 4WEBH 5FEBA 4EN3C 1OGAD 4Z0BH 3MRIB 4V1DA 2OYPA 1SY6A 3KDMA 4G6AC 3JWNC 1PAMA 1VEMA 4UNVA 4RQQB 1WIOA 2JJVA 5KVDL 1P2CB 4ZTOL 4OKVB 4ZQKB 3DX6B 1MRDL 4OGXH 1B4JL 5T3ZD 3MO1A 3IKKA 4O51B 4P4KA 3ZZ1A 4I3RH 1UADC 3G5ZA 3ZTJH 4JJ5B 3M8OH 3VJ6A 2W9EL 5GGUB 2A6IB 4XVUC 3W0WE 1EEQA 4WFEE 4XCNB 2CD0A 5CS7A 3UTSB 1OW0A 4QHUA 3ZO0A 2JIXD 3P0VH 4GRLB 1BZQK 4H0GA 5D7LA 4NNYA 3FOMB 2FJFB 5SX5K 1WCQA 5GGTL 3V79C 1A6UL 3KYAA 4MB3A 7FABL 4ELKA 4UT9L 4ONGL 3CFDA 3W5NA 5KVDH 4ZTOH 1HH9B 1MRDH 1DVFA 1B4JH 3ARGA 2YEZA 3S37X 1YMMB 2YA2A 5DXWA 5F7MC 5INDB 5F6IB 1HH6B 2FB4L 4RX4A 2R29L 2IG2L 2DWEB 5AZ2L 2L4OA 3TBWB 2FO1A 2W9EH 4TRPL 4KAQL 3TO4C 2VDLH 5KVEL 5GGSY 3V4PL 2WWKT 3JVGA 1HHGB 4YIQB 3S36L 3HE7B 2KPNA 5HHVH 3LVEA 4QRRB 4ZOBA 4YO0A 4GXUN 3BVNA 1AJ7L 4PJCB 3VFOB 1KEML 5GGTH 3T77B 3UTPE 1CFQB 3CU1A 1SEBA 1A6UH 2BNRE 7FABH 3IDGB 4UT9H 4L8SA 5L6YL 3QFJA 4ONGH 4P2RB 4QYOA 4M6AA 4UU9B 3V0VA 3RWFA 4HPYL 3E6HA 1HQRB 5C09E 1MCHA 2W9DL 2LABA 4PRDA 3ARQA 1U8MA 1U8PB 2J88L 2JCCE 1B9ZA 3MZGB 2FB4H 3MA9H 3BP5B 2R29H 1JZ2A 5AZ2H 4KAQH 4ZODA 3PDGA 4V1DD 5KVEH 5M95B 1JI2A 5IB4A 4RZCA 3V4PH 1V7NL 2VLLA 5FECA 3S36H 1J12A 2X1OA 3P3YA 1AJ7H 4PJ9B 1AIFB 5ESAA 3ARSA 1KEMH 4L4VA 3X13B 4P4KD 1JZ5A 1OSZB 5L6YH 3MJGX 5CZXC 4RNRB 5JORA 3AY4A 1PG7X 3LKSB 4JFOB 2FGWL 4HPYH 4JRXB 1T1WA 4ZOCA 2W9DH 3O6LL 4GKSA 1CU4L 3SQBA 4CW1B 3LRHA 2J88H 2ZNWA 2BVYA 5HI5D 4IM8A 1R0AL 3KWWA 5BS0A 1JHKL 1B2WL 5D7LD 4CVZA 3KYOB 1JYXA 2AABL 4PJ7F 3EDJA 3U9UA 5DHVB 1NBYB 1RUPH 3RX7A 1T6VN 1TFHA 4L4TB 3KLHD 1WZMA 2EDRA 4WFHD 2CKBH 1DVFD 2P5WB 3BRDA 3ARGD 1AFVL 4LSUL 4NGHL 4LVNB 5IEKB 1YN7A 4RX4D 4FN0A 4IRJC 1XFPA 4KK8D 2FGWH 1EEYB 4OZHF 1JYVA 2B4CC 1ZHNB 3TZVB 5DYOB 1TENA 1NGQH 3O6LH 3S3JA 5FV1L 1Y6MR 4GAJL 1CU4H 5FGSA 3MV8B 3O3EA 4LKCA 4PPTA 2AV1A 5I1HL 5HHNA 1R0AH 3NCCB 3X14A 1JHKH 1KNOA 3QEUB 1B2WH 5I71C 2AABH 1RUQL 5H37G 1YDPA 5DFVD 3OHXA 4O2CA 3MJ9L 4L8BB 2YPKB 3U7YL 5LQBL 3V5HA 4DUWA 3LV3A 3SE3C 3QFJD 2V7HB 1DQTA 4DUXA 3D3VE 4XCEB 4U1IB 2BOCB 1FORL 3LH2L 1AFVH 1DN2A 2RQ8A 4FQHB 4LSUH 4NGHH 5DJZB 1UCTA 5FM4A 2XXMB 1ZT1A 1V7ML 3SKNB 3AU1B 4LCUA 3LOWA 3U6RB 2K7PA 5D96B 2K3TA 3KPQA 4GAJH 1U8JA 2XFXA 5I66B 3SKMA 3JUZA 4EI5A 5I1HH 5CJ5A 4QCIA 5LGHH 5D6DA 5T1DL 1A9BB 3X3FL 2AJSL 5EU6B 3MREB 4JFHD 4X6BB 1A7NL 1EHAA 4YK4C 1QRNE 4L4VD 5D2LA 4NYLA 5B8CA 3G5XA 3WS6A 4N9GB 3BISA 5LQBH 2NXYC 3VE0B 4F2MB 1B90A 4QHLB 4MAUL 1FORH 3LH2H 3OGOE 1MFCL 5C7XL 5DMJB 5IVXA 2FCBA 4MS8C 1I3RB 4PRIB 5FOJA 4WO4A 5I1EL 1NGYB 2XWTA 5BS0D 1V7MH 1AC0A 4GRWE 1DBMH 4DAGL 3G5VA 4KQ3L 4K94C 3RWHA 3EGSB 5EC1B 5T1DH 4TYUA 3X3FH 2AJSH 3VU2A 3HNTL 4HDIA 5EUOA 4HS3B 3D2UA 3OKEB 1DLHB 1BMGA 5DT1H 3FJTA 1A7NH 3GBNL 4ZMAT 1XMWA 3NMEA 3D5OF 3TWCL 1FZJB 1B0GB 1U36A 3DMMD 1XR9A 1FN4A 4JY4A 4EN3B 3F7QA 4MAUH 5D7KE 1K4DB 1VDGA 3R06B 1MFCH 4WUUB 3CXDL 5C7XH 3ME0A 3QPXH 3RBSA 1F2QA 4X6CF 1IGJA 3WJLC 1HQ4B 3OAYK 4D8PB 5HYQA 5I1EH 4YFDB 3WCYA 3REVA 4DAGH 1MVFA 1C16B 3VRIA 2WANA 1VFAB 4KQ3H 3KHOA 4PJHA 4M5YL 1ZHBA 1EO8L 5DK0A 4KJWD 4H0IA 5HY9A 4G8IB 5T3ZL 1A6VL 3PWPE 4Z18A 5FKPA 3OMZA 3KPSA 2WM0A 3HNTH 2Q7YA 5GZOD 3BDYL 4JDTL 3GBNH 4OCMC 4FNLH 4PJ5B 3V6ZB 1RUKH 3TWCH 4FXKA 2X4TA 2NY1D 3PP4H 2JF1A 5I1LB 4ONOA 1NCTA 3MRQA 1RK1A 4PY8I 1H0DB 3V9FA 5J8OA 4QOKE 3CXDH 1ZSDB 1E4KA 5IM7B 1BFTA 3B5GA 1CWVA 4EI5D 3DV6A 4NQTA 3O41B 5KOVC 2QHLA 4PUBL 1ZHLA 1XEDA 1R5VB 1Z0NA 1ZAGA 1BVKB 1EO8H 4N0RA 1MWAL 4YPGA 4ODUB 4P23C 1QSZA 4ZFFA 3TT1L 5FO8A 1CFBA 1QBLL 5SX4I 5T3ZH 1A6VH 3UTQB 2M1KA 1EAJA 2DJUA 4ZS7L 1IAOA 1KIRA 3TO4B 3UYPA 4OI7A 3RVUD 3BDYH 4JDTH 1U8KA 2XG4A 1F6FB 4QT5A 2WBJC 4KXZI 3BX7C 1BWMA 1ITCA 3NCMA 4WO4D 5C0AA 2WBWB 3ZHDA 5E5MA 1RULL 4FMFA 2OSLA 3M45A 4BH8A 4D9RE 3PV6A 2NR6D 5D2NE 4ZUUA 1WFOA 4TQEL 4Z7OE 5ADPL 1Z9SA 2HRPL 3QUXD 3EYFB 3D2UD 4POZC 1J05A 1LNUA 3T1WA 3NN8A 4N1CA 4R4FL 2PYED 1A6WL 1MWAH 2Z35B 1LEIA 3VXUE 1S9YA 4LPVA 4XAKE 3TT1H 2XIDA 1QBLH 3SDXF 4XP4L 2XZAL 2F54D 4XB8A 3SDCB 4OLXL 4XWOC 5H94A 3FZUC 5KBNC 3BKYL 4IMLB 5AUMB 1SY6L 5SX4H 4WWKC 2YD3A 2BJML 4TPRL 3EFDL 3BD4A 3SKJH 4OV5B 1CT8B 3EOAB 1J8KA 1IAIL 1RULH 1UEYA 4N8PA 2EYTA 2VDNL 5HGAA 4TQEH 4PJGF 2Y72A 2IADA 3KPSD 2HRPH 2NY6C 2UV3A 5JR1L 4QNPF 3B9DA 1YNTB 1NC2B 4AMKL 4F80A 3QXTA 4R4FH 1QSFE 1EUUA 1XF2B 1YEHL 1A6WH 2X70B 2P8PB 4KI5D 3SGJC 4D3CL 3OKMB 4D94A 3TO2A 5F8RC 4U1JA 4YR6A 3P9MA 2H9GA 2O93L 4AY0A 3GO1L 3QO1A 3ROOA 2XZAH 1EHXA 4NO3B 4OLXH 4U2ZA 4BQCA 3JUYA 1DQML 1X7QB 4XT1C 1O7VA 2E8YA 3BKYH 4UAOC 1SY6H 2DKUA 1I9JL 5DQ9B 5E2UL 3TPUA 2BJMH 4TPRH 4QLRA 3EFDH 3CU7A 2AJZB 1CLZH 1RY7B 1IGFL 4KK9D 1RURL 3O2VL 4IRJB 5JW5A 5E94B 4CUCA 4G5ZL 5TDPB 2BY2A 3PWUA 2AV7B 1F3DH 2VDNH 4YHOH 4Z0XB 3DX8A 4MJ4A 5E8OB 5MENA 1JUFA 3ILPA 4UDUA 1RAMA 2X7LA 2W65A 3VFGL 3O6FC 1BX2B 3OKLB 5JR1H 3VGDA 1OGTA 4AMKH 4R96A 4UMGA 4PJ7B 3MLRL 5I71B 4GXVL 5IB2B 1BVLB 5C0AD 3BKJL 1NFIB 1IAKA 4AIOA 3GO1H 4CN4A 2LVEA 3NIDF 3NPSC 5A43C 2D9CA 2N4IA 4PLJD 1HILA 4S1DC 1DQMH 2WZPD 4U1MA 4D9QD 4F15C 1ORSA 1I9JH 5E2UH 1YEKL 1IEBB 3FQUA 4OZHB 1UQSB 1NBZB 2CIIB 1IGFH 2NY0C 2Z31A 4U1NA 4D0DB 2VUYA 4G5ZH 3QRGL 1II4E 4ZNCD 3VXNA 2DOCA 5E9DA 2A9NL 4JO4L 3C60C 1A6AB 3VFGH 4HIHB 3GSVA 4AH2B 1JV5B 3MLRH 2NTSP 2E6PA 4GXVH 5HGDB 1D6VL 1XGYL 3FQRA 4Y5VA 5DJ6A 3KYNB 4YK4B 1SBBA 4O2FB 5C6TH 2NXYB 4YXKL 1OAZL 2CO6B 4K3HA 4ZUWB 2ZUQC 3WBDA 2FX9H 3ZE0F 4HIIA 1YEKH 3PGDA 4KVNH 4NRXA 2ADGA 3PDOB 2H6PB 5GGQH 3NOIA 3P9LA 1I1FA 4ZFOA 3QRGH 1K6QL 1WV7T 1J8HE 2R39A 1Z9OA 4JO4H 5KSBE 5CCKL 2W0PA 3QDJA 4OUUA 2C4FU 1XGUB 4LRIC 1XGQA 1D6VH 1XGYH 1FVEA 3GSQB 3OX8A 3RY6C 3ARFA 1X4XA 3LN4B 3LKPB 1DLFL 2EC9T 3KPRA 2P7TA 3P0YL 1TETL 2HT2D 4YXKH 1OAZH 5LCVL 1Y18B 1LGVA 1X5FA 1UZ8B 3MV7B 4KGLA 3D69A 1MHCA 5H37H 1TDQA 3V5DB 1X6LA 2BSRA 5E4EC 3CD4A 3O3UN 1G7IB 4Z7QF 1QVOA 2AJ3A 2IPKB 2EDLA 1LEGA 1K6QH 1U8IB 3QDME 1A3QA 1AD9B 4FA8A 5CCKH 5IGXL 4DK6A 1A6ZB 2ZJSH 4LLWA 5F1OB 5GS3A 5C0BB 3W0WA 4BM7A 1DLFH 1JK8B 5TH2B 5F1KC 3P0YH 1CG9A 1TETH 5LCVH 4BFIB 5IB5A 5FHBH 3S96B 1A9EA 3FOLB 1TJHL 5HHME 1VGKA 4LSDA 1T0NA 2HG5A 4X6CB 5L88L 2H32A 2BY0A 1N8ZA 5DI8B 4ISVA 2BHUA 5MEOA 5IF0B 4NN6C 1J0JA 3MLPA 1VKXA 3AREA 3VFWA 1WT5A 4LCWB 2ATKB 2V2WA 4P23B 5MEQA 5GHWH 5IGXH 4HHAA 3MRLA 2LU7A 4HMEA 4JFFE 4HUMB 5BV7L 5KN5B 3WFEL 5JNYA 2DDQH 4ZTPL 3O2DA 2R56L 2DIBA 2W59A 2WBJB 4K3DH 3QO0A 4C56E 3RVWD 4P5MA 1Y6KR 1TJHH 5J1TC 1D5IL 3QJFB 1S78D 3OR6A 2ZOLA 5L88H 1F42A 2ZWLT 4MJ2A 4NQVA 2BNRA 3QDJD 3EYVA 5LG1A 4LHQB 2DLHA 3E0GA 2OTWB 1I8MA 5C09A 1WAAE 2ZSWB 4QHNB 3ARFD 3CFIC 2BXYA 1CIUA 5DQDL 5CEZE 4U4BA 1CFVH 2JCCA 3KPRD 4CJ1A 3HPLB 4JHAL 4LBEB 2V5SA 3ZL4L 5BV7H 3BO8B 1DEEB 2GSIB 5EH1A 2J7LA 1BREA 5LVEA 1HHIB 1D7FA 1WZLA 4WWKB 1D5IH 3HZKA 3N1QC 3O3BB 3VXSB 1JNHB 4XI5D 3U0TB 3UP1A 5HYJB 1S7VB 4YDKL 1ZA3B 4XNMB 3S35X 2VWEE 1S9VA 1JL8A 3L95B 4F9LA 2NY6B 3ZKSD 3OZ9L 3FQNA 4PYGA 3SDXB 3W0WD 1KG0B 1FHGA 5DQDH 4WFED 2VR4A 4C83A 3D39E 1YN6B 4P3WA 4JHAH 3ZL4H 2CIKA 1LO2L 1B0RB 2K1MA 3MUZ1 3V4UL 3F7RA 5C9KA 5HGHB 2MQCA 5GIRA 3TVMA 4JZNB 2X1PA 4UAOB 4MJIE 1KEGL 5JO5B 3ARED 2QTEA 2BY1A 4MD5A 4JZOB 1EEZB 4PJGB 2XQYG 5IV2B 3UO1L 4YDKH 1J11A 4JDVA 4R9HA 4OLYH 4LLQB 4JFXB 4HK0A 4LLVA 1S9WB 4KFZC 1P7QA 4F7EB 3O6FB 3L3OA 3NZ8B 3WDIA 5GXBB 3OZ9H 3STZA 3BESR 4RAVB 2Y07L 4HFUH 2GK0B 1LO2H 4A6YH 2HA1A 4XBPB 5GSVB 3ARYA 1TVHA 3NPSB 4BUHA 3UTPD 2FECL 2BNRD 5DJDB 3RVXD 1RIVL 2FJHB 1FL5B 3EJZD 4F15B 4AYFA 4HG4K 3D3VA 1PDKA 1KEGH 1WICA 3FL7A 1P9MC 2NY0B 5ICXA 1PG7W 2OTPA 3R8QA 3UO1H 4GW1A 2XQBL 4DQOL 4WENB 1I8IB 3Q1SL 2P8MB 3C60B 2UZYB 1RJZA 2OR8A 3T0AA 1QFPA 4FQLH 2Y07H 2P8LB 3S4SA 1XR8B 4EIZC 4X7TA 1BJ1J 3GMLB 4W68A 3MUJA 4L3CA 1KF9B 2VZVA 1QRNA 1KCRL 2ZUQB 1KJ3L 4U6TA 4XGZB 4RMVA 1RIVH 3E6FA 3RL1A 5JDSA 1GOFA 1SYSB 5CEXA 4U0QB 3B43A 4BKLA 1S7UA 3H0TA 5HI4D 3FB6A 2DLTA 1NH6A 1I4FA 1M05B 2C1PA 4WVRA 4P4KC 2E6JA 1AKJB 2GIYA 5DRNB 2DJ4A 4N8CL 3VFUB 1M71A 2XQBH 4DQOH 4I3SL 1SYVA 4XVSH 4HMDA 1F02I 2IEPA 3H2WA 5DUBA 5GRUL 1AGCB 4X99A 3ZYJA 2VLJD 1OW0C 4JQXC 3EO9L 3VFSA 4FQJL 3TVMD 5HI5C 3P73A 4HD9A 4BELD 5IJKA 4G3YL 5IKCA 4JANB 2MMXA 2E7CA 1MEXL 1XZ0A 1U2CA 2ZG1A 1KCRH 1KJ3H 5CUSL 1ZT7A 5TF1L 2ITDA 3VD3A 2NYYD 5JUEL 2RB8A 4NJAL 1K4CB 1A47A 3HC0B 1DVFC 3ARGC 5C2UB 4XXCC 1X5LA 1P7QD 4O2EB 1I3UA 4WCYL 1QTYT 1GRWA 1VSCA 5E4EB 4M4PA 1XF5B 2E7LC 3HI6H 4N8CH 3E1F1 4I3SH 1TVDA 4KK8C 4LLYA 4H1LG 4AG4L 3BN3B 1RZKL 2CDFA 2KH2B 1MHEA 3QULA 2DBJA 2OK0L 4K7PL 5I1DA 3EO9H 3BUYA 4FQJH 3JVGC 1MCSA 1MCPL 3DHMA 1T20B 2JB5L 4G3YH 3PWPA 4XVJL 5DJCA 3G08A 3G9VA 5DFVC 1MEXH 1JGDA 1DE4A 1ZMYA 5C0ND 5CUSH 3DO7B 4B7IA 4YHML 4N0YL 5JUEH 4NJAH 3KPMA 5EZJB 1RVFL 4IS6A 4LRNL 5EU7E 32C2B 3L7FB 3EHBD 3NTCL 4WCYH 4NN6B 4YFLI 4QOKA 5E2JA 4XCYB 4PS4L 4QEGA 3WE6A 1JNJA 3RZWA 1ORQA 4CADB 2V7NA 5FUOL 3FO0L 5SWZB 3IFNL 1RZKH 4LHUB 3MBEA 4OZ4B 4PTTB 1QRND 2OK0H 4K7PH 3I9GL 3BYTA 1RSFA 1MCPH 1X3DA 5EN2A 2D3VA 2ICCA 2JB5H 1Q9KB 3UTZB 3QT2A 4XVJH 4U6YB 2C3VA 3DV4B 1CDBA 3PNWB 5ENWA 4XH2B 4PRBA 3ARBA 4HW6A 3U4EA 1AGBA 1R5WB 2NY5L 4K3GA 3AY4C 5IESL 4NQEB 3HAEA 4N0YH 3EUUA 5D71H 2E7BA 1DDHA 2UWEE 3NBNA 4LRNH 3OKKB 2N7BA 3SE8L 4XBEL 3NTCH 3MPCA 3IJYA 4ZFOL 2B39A 2G9HB 2HTLD 2QBWA 4PS4H 1FNEB 1LK3L 2PKDA 4FFWC 1QEWA 1H9VA 5D2NA 5DO2D 2EE6A 1D5XA 5A40E 3FO0H 3IFNH 3LPFA 4M00A 2EYSB 4HWEL 2VN7A 3TIEB 5GRZA 1UC6A 1OSPL 1BQLL 1S7XA 4HMCA 1DQQA 1X9QA 3I9GH 3VXUA 3JSSA 3KJ4C 1T1ZA 1AH1A 4M9OA 1NUFA 2PETA 5ABDE 4UT7L 5D7KD 1EZVX 3ULVE 1CXIA 3DMMC 3H9SB 3IVKA 1FFRA 1OGAB 2NW3B 2NY5H 3WNPA 5IESH 4HJJL 3ORJA 1VENA 4K2UL 3SE8H 3MRCA 4TSBL 4OIIL 3QUZA 2DLEA 1BD2E 5E00B 5IK3B 3SY0A 2YPLE 1RI8A 4KTEL 4QY8A 3PWPD 1FO0A 4HIJB 1AGEB 3NFPB 5FUCC 4HWEH 1F8TL 2YZ1A 1OSPH 1BQLH 4JPWL 1QSFA 3HAEG 3WDJA 1SHMA 4PJIE 4WI3A 5GZOC 4TUKL 1TCMA 2JIXB 3WEXA 1FZOA 3IJSB 4UT7H 2GJJA 5I8OL 5CFHA 3AMKA 2NY1C 4YHLH 3ARWA 4KVCL 5IVXF 1KCVL 4I2XB 2OZ4L 4YH6A 1YMHB 4JGUA 5HD8D 1MCCA 3PJSA 2DM4A 2X4SB 1T4KB 1FQ9C 2X4PA 3UMTA 2NCMA 1N59B 3MBED 4TSBH 1MWAB 2D31B 1QO3A 5D6DC 4GG8B 5KVMC 4KTEH 3CUPB 5BV7C 5DMKA 4LEXL 1OVZA 1UWGL 3GMRA 5EUOF 6FABH 5B8CC 1F8TH 1VGEH 2B1AL 3WS6C 4JPWH 1D3CA 3ARBD 1GCFA 3O2DL 2W1NA 1XGPB 3RVUC 3RPIA 3V7AE 1U58A 5TE7L 2ICEA 1U91B 5C0FB 2AI0L 3T3MF 1JTOA 4WO4C 4D9RD 1KTKE 2AKRA 1CFNA 2OZ4H 4DUVA 4LCCC 4YZFE 2E9JA 3AS0A 4JFYB 4KZDL 2IALB 1CFSB 2XXCB 3AVEA 5I18H 2NR6C 3ZDXF 4PJHF 4K3EL 4YUEL 1TTFA 3VXUD 1V05A 3QUXC 4XAKD 1BWWA 4X7DC 4LEXH 1D5MB 5IMLA 3FB5A 2PTTB 3VXME 1DL7L 2B1AH 2MJWA 4UI2A 3LKQA 3O2DH 2J3SA 4V1DB 2PW2A 5KANG 5EOTA 2KUTA 4KI5F 3VI4E 2WINA 5FB8A 3IDJA 3P4NA 5EIVA 2AI0H 2FZ3B 5E8EA 1N2RA 3QUZD 1OP3K 3V6BR 1CGVA 4F37F 4P9HC 4P4KB 1G9NL 3STLA 4KZDH 1J1PL 4POUB 5DZLA 4IDJL 2C3WA 5EU4A 2FO4A 1F45A 1TCRA 1QSFD 4XPTL 4K3EH 4YUEH 1YMME 2DICA 4FFZL 2CLZA 3TJHD 1EIBA 1DTUA 1S7RA 1J8HA 3FCTA 4CMMA 2HJFA 4QHUB 2BK8A 5KSBA 3QFDA 5D7LB 2BC4A 1DL7H 4NNYB 4KI5C 2HLAA 1T5WA 4ELKB 4U31A 3BP7A 3CFDB 4K9EC 1ACZA 1DVFB 2NY7L 3ARGB 3L3JA 2YEZB 2DM3A 1SJEB 5EBWA 4WDIA 2C4FT 1G9NH 2XPGA 1UWXK 1J1PH 4KK9C 4IDJH 2FX7L 4DW2L 3H42L 4XPTH 4FFZH 1PX3A 1W72A 3WV0A 5ESVB 2E3VA 4JDZA 2W0KA 2YOCA 3QDMA 1GH7A 3U0PA 4YO0B 3BVNB 4KTDL 5M7QA 5HGGS 3GJFH 4EXKA 4QRSA 3BPNC 1SEBB 1UWEL 4LGPB 2ZKHL 5EOCL 1CGTA 4QYOB 3V0VB 3BEVA 1IZKA 1KGCE 3E6HB 4PLJC 2EECA 3TBVA 5I2IB 3PWVA 2NY7H 4RFEA 4PRDB 3MGOA 4LPTA 4S0SD 4BSWA 1U8MB 1WBYA 4N5UA 4AEIL 3QQNA 4Q2ZA 1LO3H 4LSSL 1CGSL 4CDGC 4DW2H 4MMZC 3WKNA 5T33L 4GH7B 3TN0A 2ZUYA 3CSBA 3PIQB 4YNYA 5IB4B 2HKHL 4RZCB 3RUGE 2VLLB 5FECB 1UG9A 4K23L 3VRLE 4KTDH 4JFFA 1FG9C 5FYJE 2WK2A 5FAAA 3FQXA 4L4VB 2R1WA 1UWEH 4Y16A 2ZKHH 3U1SL 1A6TA 5GRVL 5EOCH 1N3NB 1RUAL 2VOTA 4C56A 5JORB 5DHYA 2GI7A 3VGBA 1L7IL 1T1WB 2VXSL 4NN5C 3BZDA 5E7FA 1J8HD 4AEIH 3JV6B 3WYRA 3QZWA 3KWWB 3WUZA 4X4YA 2HFFA 4LSSH 2QJDA 1CGSH 1UA6H 4CVZB 5F3HA 4MNHA 4PGZA 5CSGA 4S1QL 5T33H 3REWA 1WAAA 3U9UB 4DK3A 2K7QA 3C6LA 3TYFA 2HKHH 4YX2L 3KJ4B 4K23H 1I7RA 1MCKA 5DD1L 1ZA6A 3WLWD 4DFIA 1R3IH 3ZE1E 3MMEA 2V9RA 3RWDB 2VSCA 3DMMB 3U1SH 2HT2C 1EZVY 1RUAH 1YN7B 2LAAA 4NHUA 1LK2B 3BH8A 1A1MA 3AM8A 3S34L 3O4LE 1L7IH 4JY6A 3NIGF 3O3EB 2YRZA 2AV1B 2YKLL 3QDMD 5HHNB 3X14B 1KNOB 2OLDA 4OQTA 5SV4A 3MLUL 3TNMB 4GRWH 5DR5H 4ODTL 1YJDL 2G75A 4S1QH 3OHXB 4O2CB 5B3NA 3MLVL 3LV3B 5EU6E 4YX2H 2EDJA 2FD6L 3GKWL 1JPFA 3D39A 5B3JF 3GSNH 5IQ9B 3L7EA 5HHMD 3BMVA 5DD1H 4N0FA 4YE4L 1BZ7A 3F12A 2NY1B 1ZT1B 2A83A 3T4YA 5EIIA 1RK0A 4U3HA 1OB1A 2PUQT 4OF3A 1BAFL 4MJIA 4LVHC 3X12A 3TN0D 3KPQB 2XFXB 4P2CG 1HWGB 2OXGA 1CD1A 2VAAA 2YKLH 3QCUH 3SKMB 1SEQL 4QRUA 5BV7B 4MJ6A 3TPKA 3MLUH 4Y5VC 1FLRH 4ZUVA 5CMAA 1A1OB 4ODTH 1YJDH 4M6OL 4NYLB 4ZO8A 5B8CB 3IDMA 3G5XB 4LFHG 4Y16D 4HUVA 3MLVH 4JM4L 4LMQE 5E70A 1KN2L 2FD6H 1S8DA 3L3KA 3CLEL 3GKWH 5FUZL 2H3NA 1RMFL 2F5AL 1L7TL 2DI7A 1NMAL 5IVXB 4YE4H 5EA0L 2AERT 1XF3A 4P2QE 1P6AB 3ESVF 4WO4B 1IC1A 2XWTB 3B9KC 3RVWC 4LCCB 4CU8A 1S78C 4YEFA 1JWSA 3WN5A 1BAFH 5JW3L 5C8JA 1OLLA 3C6LD 4R90L 4YEEA 3RWHB 4DFHA 5DVMA 1SEQH 1G7PB 5CEZD 4LGSB 3QUXB 4HDIB 5EUOB 3VDCA 3D2UB 1J0KA 4M6OH 3ARFC 5DC0A 5KVFL 3R0NA 2PYEB 2V9QA 3P4MA 4YXLL 1XR9B 5T1MB 4JM4H 1HDMA 1KN2H 5FA3A 3NFNA 3CLEH 2BSSA 3KHQA 5C08E 2JELL 5E2VL 5I9QC 1UH3A 2F54B 1RMFH 2F5AH 1L7TH 1NMAH 5EOQL 5EA0H 1LVEA 3DX9A 1I1CA 1IGJB 4NJ9H 1T1XA 5HYQB 3HAEH 4WGVB 3REVB 2Y36L 2AXHA 1TXKA 3HG1E 1A7RL 2C9AA 4PJHB 5E99L 4XI5C 5EUKB 4LQ1A 4LARL 3BMWA 5DK0B 5FA4A 1KTDA 5LAXB 4LLAA 4R90H 4CKVX 5HY9B 1JGUH 1FG2B 3KPSB 2HKFL 3D39D 5DMIL 2Q7YB 2ICES 2ILLA 4AIZA 4FXKB 2BVUA 3CMGA 2X4TB 2ATPA 4NZJA 3CFJA 3TT3L 5AAWA 2VQUA 5K59F 3MLZL 1RK1B 1ZV5A 5KANI 2JELH 5E2VH 4LDLB 4MJID 5K9QG 1K8IA 3P40A 4MNQE 2Z8RA 5EOQH 4DZBB 5F7FA 4HF5L 3DV6B 4JQIL 1NDGB 1TITA 1FC1A 1ZHLB 2Y36H 2YD2A 3AREC 3K8KA 1WT5C 1A7RH 2M8XA 4OF0A 5E99H 3VG0L 2GITA 1JGEA 2X10A 4LARH 4YPGB 4JLRA 4ZFFB 1XH3B 5FO8B 3L5JA 5C0JB 1OLZA 3Q0HA 1CQYA 1IAOB 1KIRB 2HKFH 2JCCF 5DMIH 2VXVL 3UJIL 2DMCA 4UOJA 4QT5B 2GSGA 4KKCD 1G6RA 1Z5LB 3TT3H 5C0AB 1IC7H 1XF1A 3BPNB 1WSST 4HAFA 4TUJB 5IFJA 3HRZA 5E5MB 4BH8B 2OSLB 4HFWB 4TVPE 2D7NA 3PV6B 1MELA 3RVXC 4QXWA 1WFTA 4HF5H 4JQIH 2EDXA 5F93C 4NFDA 2I5YL 4U49A 1KCLA 3FONB 3HHRB 1BIIA 4NBZB 3QPQD 1LNUB 2IQ9L 3NN8B 1I75A 3VG0H 1LEIB 4ODHL 1S9YB 2YD7A 5D4QA 4RIRB 4AJ0A 2A77L 4WJ5A 3SE9L 2XKNA 2XACC 1Q72L 3SO3C 2Y7QA 5H94B 1F4XL 1A7PH 5T5FL 2VZSA 4Y4KC 4DKDC 4N0UE 4AENA 1NAMA 4J1UA 1G9NC 3DGCR 3CX2A 3GGWA 3MOQA 2I5YH 2IADB 4NN5B 5HI4C 5L8KB 4HUXA 4GBXA 5DJYA 4NO2A 3TBSA 2IQ9H 2UWEA 3ZT5A 1SM3L 2XI9A 4H88L 1ZLUH 5JA9A 2AJYL 1T1YA 1IL1B 4P2OD 3TO2B 1S5HA 4U1JB 3P9MB 2A77H 3MCLL 3LN9A 1G0XA 3QO1B 3SE9H 3ROOB 3KVQA 1U0QA 3DETD 1Q72H 3TVMC 2WMPA 4LP5A 3LD8C 1PFCA 1F4XH 4XBGA 5T5FH 5MP6L 3GI9L 3K2UL 1YY9D 1NCCH 1SVZA 2H8PA 4GAGL 1H8SA 5DZOA 2XNAA 5DHXB 5JW5B 2DM7A 3PWUB 3KAAA 3BYYA 3DX8B 2NYYC 1KIQA 2HVKA 3HNVL 4MDJA 4K7FA 4EDXA 3ILPB 4UDUB 3GJEB 2X7LB 1FZMA 2W65B 1OGTB 1XCTA 4R6UA 4ETYA 5J89A 1SM3H 4H88H 1IBGL 2AJYH 1BD2A 2I9LA 3UBXG 2YPLA 1W72L 1NPUA 4U1KA 1AC6A 5C0IA 3MCLH 1IM9A 1G7LA 1UJ3A 2VLRE 1IAKB 2IWGA 1QSEE 4JG0L 8FABA 2EE9A 3MLYL 1MNUL 1JZ7A 1HILB 1CLYL 4PJIA 5M94B 1ORSB 5MP6H 4U0RC 3GI9H 3K2UH 3IXAA 4XHJD 3ULSA 3VA2C 4MZ2A 3O9WA 4GAGH 4WTWA 2VXUL 3B5TA 4U1NB 2ZUUA 1ONQA 4GS7C 3BI9X 3HNVH 3FQTA 4LVHB 3VXNB 4P3DA 1T66D 2G2RA 3DBXA 2APVA 3EHBC 1IGCL 2DQIL 4GRWF 4CRPA 4GO6B 5F70A 1S7SA 4H8WC 4HXBL 2R0KH 1IBGH 9CGTA 4Y5VB 3FQRB 5IBLD 1UEMA 5DJ6B 1W72H 2RFXB 2XY2A 1I9EA 4QHKJ 1H3XA 1ZGLP 5T3XE 5B39A 4JG0H 3TIDA 1ZKAA 5FV2A 3GKZA 3MLYH 1MNUH 3DJ9A 4OLEA 4X98B 1DCLA 3IDYC 4E42B 2B0SL 2CJUL 2X89A 2FIKA 1ZLWH 3NFSH 3PGDB 2Q8BL 4NRXB 2ADGB 1JNNL 1T21B 4GBXD 4WI9A 3B9KB 2LE9A 1SMOA 2VXUH 4WUKL 2JB6B 3MV7E 3P9LB 4ZFOB 1I1FB 3DLQR 4R97C 3H3KA 2AP2A 3ZYIA 4OZIF 1LD9A 5T1LA 4LPYA 3QDJB 4OUUB 1IGCH 4ZQKA 2PCPA 3Q6FA 3DX6A 3QUMB 2IBBA 2HTLC 5IJKC 1XGQB 2Z0BA 5DO2C 1FVEB 3ARFB 4HAGA 3KPRB 2P7TB 2M2DA 4JJ5A 4OD1L 5CEZL 4OIAA 4HG4J 3VXMA 5GGUA 4Q6IA 3WS3A 1BOYA 3ULVD 2VZUA 1NANI 5I9QB 2BVOB 5CJ8A 3MCG1 2B0SH 4MXQD 4AIXA 4YPJA 3WIIL 1MHCB 2CJUH 1BQHG 3WLBB 4GRLA 2Q8BH 2BSRB 1JNNH 4WUKH 4CL7A 3FOMA 5EORL 2AJ3B 3O3AA 1FPTH 5D72L 1BD2D 1LEGB 2YPLD 1IC5L 5B39G 4A2LA 5DJ8B 1DJSA 2VITA 1IM9D 1YJDC 1REIA 4K71C 3CFBA 4OQTL 3ZHKA 1IGYB 4OI9A 4UV7L 1J5OL 4DKFL 4LLWB 5CSZA 5L8JB 1YMMA 2APFA 4FQ1L 3W0WB 4N1HB 5I8CA 3V7MA 4ZPTA 2L0DA 5IB5B 1CG9B 3GM8A 2K9UA 1OTTD 3O9WD 4OD1H 1A9EB 3QXWA 1VGKB 2HG5B 3MXWL 4PG9A 2H32B 1U8OA 3MCKA 3WIIH 4YIQA 4ZNEE 4KH2A 4ISVB 15C8L 3TBTA 5MEOB 1VKXB 4ZXBA 3ZE2E 4YDLC 3AREB 1FIEA 5D72H 3N1MC 1NANH 1IC5H 2HFGL 3CDFA 3FN3A 1OTUD 5MEQB 4HHAB 3MRLB 2NNAA 4UU9A 5D5ME 3MBEC 1IQWL 5IW1A 3ETBF 1HQRA 4OQTH 3RVVC 3VW3L 1IGTA 5JNYB 5D1XC 4UV7H 3N1PC 2ZP0T 1X5GA 1T0MA 4DKFH 5TDOA 1S7TB 5C6WH 4FQ1H 3S88L 2X89D 3QO0B 2X9YA 5SX5H 3BP5A 1YPZE 1NMBL 2FIRT 5D70H 4NBXB 2I26N 4RMRA 4P5MB 5CD5C 3ARBC 5HGBA 4RDQG 4ENED 1EJ6A 3MXWH 5K9QI 2ZOLB 3BIKA 5CJOL 3SDDA 1CDHA 4NQVB 5T1LD 3FO2A 4LDEB 15C8H 3EYVB 2X40A 3DX7B 1QQDB 4PJ9A 3VXSE 1I8MB 43C9A 5J7CC 2VISA 2C3XA 5FO7B 4J4PA 2VQTA 3PP3K 5ESQA 3TBYA 2HFGH 3PHQB 3LQZA 4ZOEA 3S7GA 3L3DB 2JCCB 1JIBA 5HVHC 5I1CL 1IQWH 4JFOA 3VXMD 5KS9E 3VW3H 3BZEB 3QISA 2Y06L 3UZQA 4HKJA 3S88H 3SO3B 2C7UA 4YGAB 2EO9A 4GRLD 4RMWA 2FYYA 3OSKA 3RUGA 1NMBH 1ROWA 3HZKB 4Y4KB 4B5EA 5HHPB 4HJGA 3EJYD 5CJOH 3EFFA 3A67L 1HZHL 4AM0A 5C3TA 1T89A 4BUGA 3GI8L 3HZYA 3ULUF 1M6OA 3GBLA 1YMMD 2O26U 5IEKA 2P47B 4LQFL 5L2KE 4P46A 5I1CH 1FAIL 4F37K 3AUVA 4PGDA 1P53A 2BZDA 5BZDA 3TZVA 5DYOA 5GS0D 4KDTC 4KY1L 1FSKC 3Q6GL 4HH9A 4FRWA 2VLJB 2Y06H 3D18A 3TVMB 4BFBD 3CDYA 3LD8B 1U8QA 1IKNA 3JWOL 3IYLW 4X5XA 5ALCL 4ZXBD 4RCAA 1AXSB 3LRSA 5HBBA 3RWEA 1HI6A 4L8BA 1RQ5A 1TPXC 1XCQA 2QHRL 1C5CL 3A67H 1HZHH 1MQKH 3QQ9C 4OTXL 3ULUC 4LLVB 4HK0B 2BOCA 4QXTA 1OHQA 1E4XI 1P7QB 3GI8H 3MV01 3O4LA 3L3OB 5CJXA 1NUDA 3STZB 1KJMA 3SGEI 4LQFH 4E41E 1URLA 3W11D 4UNTA 3DGGB 3ZKXC 4FHBD 4KY1H 3Q6GH 1E4XL 2NZ9C 2BHYA 4BH7A 1TVHB 1QA9A 5K33A 1I7TA 3E3QC 4JRWA 1G6RL 3SDDD 3G6DL 1A9BA 3BPLC 3JV0A 3OKDA 3S36X 3SCMD 5IBTH 3NIDE 5EU6A 1DFBL 5ACZA 3JWOH 5ALCH 3CZFA 4PJ9D 4U0RB 1KGCD 3OXRA 1MCFA 3CDGA 4J4PD 3T2NL 3JTSB 1HE7A 1MFBH 1CK0L 1FDLL 4N9GA 5ICXB 4KJQD 4WWID 2QHRH 4F2MA 4GS7B 1C5CH 3ECBA 4GW1B 3QDHA 3VI3E 3B83A 2P5ED 3VD7A 4PTUB 3PHOA 4QTHB 4I3GA 1RJZB 2GYSA 5F1IA 1I3RA 5HYEA 4K07A 5A3IC 4PP1D 3S4SB 3G6AA 3UBXI 5KSBF 4X7TB 1GGYA 3B2UD 1MJ8L 1GIGL 5FYJD 1FNHA 1E4XH 5IBUG 4L3CB 2E5EA 1R3LA 1QRNB 3EGSA 1G6RH 4Z77B 3G6DH 3RNKA 3GRWA 1CXHA 3E6FB 1CD9B 5JDSB 1DFBH 3IDYB 2P4AB 1S7UB 3H0TB 3FB6B 4ESKA 1NCBH 2C1PB 1NAML 2EE3A 5DEZA 1FZJA 4C58B 1CK0H 1FDLH 4R97B 4P2QA 4XWGL 1M71B 4P46D 1BIHA 1SYVB 3HN3A 4NBYB 1NC4B 2R69L 4GRWB 1KXVC 2MKLC 3TZVD 4LCIL 3EOBA 4U05A 4X99B 1J1OL 3VFSB 3S98A 1DANU 4D8PA 3FQWA 2A6DA 4Y0GA 3U7WL 4PJDA 5IKCB 4MX7A 2IGFL 1MJ8H 1GIGH 1XZ0B 2EDEA 4UIKL 3SKOA 5L2JB 4XAWL 5F7KC 1ZT7B 2X4RA 2ITDB 1FNFA 1C12B 3KPLA 3WLWC 5C08A 2BERA 3O4LD 7CGTA 1NAMH 3ROLA 1HIML 1GYAA 3ULVL 4OZIB 5TGBA 5DD6B 1YEJL 2Y23A 1G7MA 4Z7QE 4RGMC 5HHOE 5JQ6L 3O11B 2R69H 3LEVL 3HG1A 4LCIH 4KI1A 2IMMA 3CCHA 3QULB 2I25N 4K71B 4MCZA 3TFKC 5I1DB 1J1OH 4UT6H 4JJHA 4X6DA 3U7WH 3PWPB 5EU6D 3D25A 3MRMA 5DJCB 3G08B 1BVKA 2IGFH 1JGDB 2YN3A 3K1KC 1DE4B 2CLRA 4ODUA 4UIKH 3L9RA 1INQA 3TO4A 1HCVA 3KPMB 4IS6B 5IT2L 3OAYH 1HIMH 4YDLB 4MNQA 1VPOL 4R4ND 3NVQA 1BEYL 1FJ1A 2VZ1A 1YEJH 2V7NB 3ZYZA 5JQ6H 2H45A 2DTSA 2IH1A 3LEVH 3TN0C 3MBEB 1BLNB 1GGBL 1WAAF 5D1XB 5EN2B 4JO2L 5CILL 1NL0L 5K9KA 4J8RB 2C3VB 4TNVK 5J9PA 2MQ0A 5ENWB 5TE4L 4UV4L 4Y16C 4PRBB 3ARBB 3U4EB 1AGBB 4W6WB 1F4YL 1CXFA 2HTKC 4P2QD 2P46B 3DTXA 1PQZA 1GZQA 4G6AD 4LEOA 5IT2H 1DDHB 4XB7A 1IGIL 1RD6A 3H9SE 2CK0L 4XP5H 3F58L 3IJYB 4ZG1A 1BGXL 1VPOH 4HZAA 3DVGB 1BEYH 4IMLA 4WEUD 1QEWB 1D5XB 4PRHE 3EOAA 5HVHB 3C6LC 1X5IA 1S7XB 3C5SA 1DQQB 5IHLB 1GGBH 1U8HA 3QXUA 3VXUB 1T1ZB 4ORZC 4KJYB 4JAMA 4JO2H 5CILH 1NL0H 4KKLD 2BVPB 4EUPA 3MRFB 4OJFL 1DBBL 2D4DA 5C08D 2P24B 1FLTX 2D7OA 3BDXA 1XF2A 4UV4H 2CK2A 2P8PA 1IQDA 1S7WA 3IVKB 1F4YH 4MJ5A 4O9HL 1FAKT 1UFUA 1IE5A 2DMKA 2QQKH 4GG6E 3HG1D 2XT1B 1EAPA 4N0UA 3F58H 4TOYH 3SY0B 1IKFL 1TMCB 2X1XR 5DQ9A 1FO0B 4IRJA 4J3UA 5E94A 1QPXA 4JVUA 5LWYL 3BW9B 1QSFB 4Z0XA 2PNDA 1MFDH 1EXUA 2SEBA 4WW2F 4HQQL 1FSKB 4HUUA 3KPOA 4F7MA 4XNZC 2R9HD 1BX2A 4G42A 1JHLL 4OJFH 3WEXB 1DBBH 1FZOB 2VR9A 3D0VA 1BQSA 5DURD 4MNQD 5GS0L 5EG6C 3GK8L 5IMKA 4O9HH 3PJSB 2O5YL 1TPXB 3BPOC 2X4PB 3BKCL 1W0WA 1TTUA 5D1QA 4LHJB 1TIUA 1QO3B 1IKFH 4DCQA 5ANME 5JXAL 3UX9B 2NY4C 5BRZE 5DMKB 1GGTA 2J6EH 3K80A 3PG2A 4PJAF 2YSSA 4WW2C 2XRAL 4LAJH 3ZKXB 4HQQH 3HB3D 1OAYL 1U58B 3UXFA 1MRCL 1JHLH 5ICYB 2VLRA 4W4NA 3BPLB 5ECJE 1QSEA 2GY5A 4AH2A 2R15A 2BX5A 5HGDA 3IDXH 5GS0H 3KYNA 2AKRB 2WWMD 4OBSA 4R4BA 2ZUSA 5I30H 4ONHA 3NACL 2O5YH 4L9DA 5CSBA 3WN5C 3BKCH 5IJVB 5C0CE 3PF2A 1U8LA 3T8XA 5JXAH 4U1LA 1A4JA 1FNGA 3QPQC 1GPOL 4LKXA 5IB3A 5DUPL 5E6ZA 2H6PA 3IB4A 3FB5B 5DJXA 5GQBA 1J9CT 3LKQB 2XRAH 1A22B 3TH4T 5DD0L 2PW2B 3WNMA 1BQUA 2WINB 3IDJB 5GSRA 1MRCH 3VD9A 3C5JA 4Y8DC 3P4NB 3HLAB 1Q8MA 4GRMB 2VRAA 5E8EB 5AZEH 1N2RB 5FYJL 1UCBH 3LN4A 5HPMA 3LKPA 4H20L 5I73C 3STLB 5J13C 1Y18A 5EU4B 2F8OA 2FO4B 4Z7UE 1TCRB 3MV7A 2NX5B 3O6KL 2CLZB 3SHSA 1S7RB 1J8HB 1F2XK 3FCTB 1GPOH 2HJFB 5ID0A 5DUPH 4MYWB 5KSBB 1N4XL 3QFDB 1G7IA 2BC4B 1I9RL 1A3RL 4LPXA 4HIEB 4P2OC 1CDGA 3QQ3A 2XY1A 5JMOC 1T5WB 5DD0H 4YAQB 4LLUA 3WNKA 3BP7B 1QFWI 1RJCA 3VDBA 3DETC 3SGKA 2X09A 2X4UA 1NFDE 3DOSA 5D1QD 3RX8A 2ESVE 4I0PC 4LASL 3L3JB 4WU5B 1ZHKA 5DHVH 4QRTA 1RZ7L 2OQJA 4H20H 1JK8A 1YY9C 3GUTA 1P5VA 4BFIA 2C5DC 1U3YA 1QFWL 3FOLA 2YC1B 3P11L 3U9PL 4DEPC 4RGMB 4LVOC 2JJSC 3O6KH 1H3GA 4JDZB 4GXUM 5I75C 4JM2A 3IAQA 2AJVL 1N4XH 2VLRD 1NCAL 1JGVL 1QSED 5JZ7D 1I9RH 1A3RH 4QRSB 2VDOL 4F7PA 2NXYD 1TJIL 2E27L 3BEVB 1UYWL 1EBAA 2FH8A 2EIZB 3TBVB 4LASH 4PBXA 2LV4A 1CD0A 4JE4B 4RFEB 2HH0L 4BSWB 1WBYB 2O5XL 1RZ7H 4MS8D 4XHJC 2GT9B 3VXRE 4ZNEA 5CP3A 1QFWH 5I1JL 3P11H 3U9PH 3EIFA 2VKWA 3Q3GA 3HR6A 3TN0B 3V6OE 4YNYB 3LQAL 2D03L 1R24A 1T66C 4I0KA 4LNVA 2AJVH 3PL6C 1YUHA 4J12A 4LMQI 4I13B 4QXUL 1NCAH 5T3XD 5D5MA 1JGVH 3S5LA 2VNCA 2FWOB 4PYHA 2ZSWA 3FQXB 3OWEA 2R1WB 2XICA 3PE9A 4TSAL 4Y16B 3C2SA 2GFBA 1A6TB 4LNRB 3GRWL 1TJIH 1W0YT 3BUTA 2R2HB 3HPLA 2E27H 5DHYB 4DVBA 1UYWH 1YPZA 1N6VA 1DEEA 1T80A 2MNUA 2R0LL 3F7YA 3MV7D 4X4ZA 2HH0H 3ULVF 2O5XH 3IAGC 1BF2A 4M6ML 2WIIA 3QZWB 4GBXC 5JW4M 4X4YB 2HFFB 2XZQL 4X80L 3O3BA 5F3HB 4MNHB 3VXSA 2NQCA 5GS2D 4DJMA 3C6LB 3LQAH 2R1XA 2D03H 5FYKE 1S7VA 5JHLL 4U7MA 4I48B 3DECA 4GUPA 3L95A 1I7RB 4QXUH 3C6SA 5IW6A 4Z6AT 2YUZA 4ZOAA 2XN9A 5KS9A 1QR1B 2J5LC 3MMEB 4M8QA 4TSAH 4PJIF 4ZUTA 3GRWH 4MGXA 4MNGE 4NHUB 3BH8B 4XX1G 1B0RA 3ULVC 4JQVA 2R0LH 4JY6B 4MXQC 3ZTJG 3MRBB 3TNNB 1Y0LB 4JZNA 4JM2D 4M6MH 4ZD3L 4L29A 5ALBL 1F5WA 2OJZL 2XZQH 4PRPE 4X80H 3PV7A 2FDBP 4QHKI 3RVTD 1NQBA 5DQJA 4JRYE 5FGBC 4DOHB 2A6KA 5JHLH 3K74B 2X9WA 1OAXL 3I02A 1MPAL 5L2KA 1JPFB 3D39B 4XNZB 1MCEA 4RFNC 4N0FB 1BZ7B 1L6ZA 4MA7L 3F12B 2E7HA 1OTTC 2A83B 5DC9B 1RK0B 2GK0A 1OOAA 1TZHA 4MJIB 3BPOB 1R3HA 5FGCE 3UDWA 4L8CA 1CI5A 2VAAB 1CD1B 4ZD3H 1DBAL 4FABL 1FL5A 2P48B 4NQUA 5ALBH 4CVWA 4QRUB 2OJZH 1G7JA 2NY4B 3MACL 4MJ6B 4B50A 5DK3A 3RFZC 1BBJB 4ZUVB 2EDWA 1E6JH 4WW2B 1FC2D 2GTZA 1OTUC 3I6GB 3IDMB 3VXQB 1QBAA 2ARJQ 4HUVB 1GC1L 1OAXH 2WQ8A 4Z76A 4RA3A 4E41A 1MPAH 5IHZB 1S8DB 3OF6A 4OF6A 3DUUA 1PYWA 2H3NB 2ARJA 2PYEE 2QLVB 4MA7H 1XF3B 5I74C 3HUJE 3ARDC 3C8DA 2OMBA 3T3ME 3IAPA 3VI4F 4ENEC 1EFQA 2F54E 1JWSB 4AT6B 3WN5B 3VXSD 5C8JB 3T0DA 1BPVA 2V17L 2PYFA 4TVPL 3CNKA 1MREL 1DBAH 4FABH 4JB9L 1SYSA 1ZGLA 2MTPA 4PJAB 3QIBA 3QB7C 3MACH 2NY6D 2XN9D 5CP7A 3AS3A 4IEFB 1WUNT 1INDH 5DRNA 1NKOA 3P4MB 4TULL 4G80A 4PRNA 1HDMB 5FA3B 5DEFA 5FHAH 4UINL 3KLDA 2BSSB 4Q6IC 4GW5A 5FDYA 2OBGA 1KC5L 4KI5E 3DX9B 1A14L 1T1XB 3RY6A 3O45A 4JANA 4A2MA 5I73B 5A2KH 4XVTL 2Y4SA 3K8LA 3UZVB 5J13B 5GRJL 5FA4B 4E5XB 1DQJA 4U3XA 2V17H 4TVPH 4LLDA 1AQDA 1MREH 4JB9H 5IMOA 1K4CA 5L2KD 4YHZL 4O2EA 1G7HA 4NQSA 5INCA 4AIZB 3AAZA 5J4MA 3INUL 5F96L 4TULH 2ATPB 3CFJB 3FAWA 4P2OB 5BOZG 3LB6C 4UINH 4GT7A 3HS0A 4EUPH 3BD3A 3EOTL 3MXVL 1K8IB 4RMQA 1KC5H 2YUXA 3OGCB 1T22A 4I0PB 1QOKA 5DA0B 1JCKA 1PY4A 1A14H 4ODWB 3H9ZA 3OQ3B 2VKXA 2GQHA 4HLZG 4ZXBC 4NN7C 4XVTH 1DANT 1ND0B 2GITB 4OCSL 5GRJH 3V8CA 4DEPB 4B53A 4DTGL 4OFIA 3MUGA 4LVOB 5I16A 5I1KL 4E41D 5EZJA 3OB0H 3OF6D 3MRGA 4KMTL 4YHZH 4P99A 5I75B 5HHOA 3DRTA 1F6LL 1T5XA 1MUJA 1NDMB 5DJAA 4XCYA 1FFOA 3INUH 1G6RB 1ETZA 2V2TA 3W11C 1M7IB 4HUKB 4JFZL 5BCAA 1INEL 3RUGF 5IFJB 1KBGL 3EOTH 3VRLF 3MXVH 4CVUA 5EU5A 1MJJA 3SDDC 2AW2A 3SCMC 2WIMA 3GSXA 1Q9KA 3QIBD 1BIIB 2BVTA 5D6CA 2X2YA 5E2TL 4J4PC 3HE6C 4KJQC 1T2JA 4OCSH 3WJJA 4DTGH 3O2WL 4OGYL 5I1KH 4KMTH 4WJ5B 2XKNB 3OKKA 3PHSA 2WBKA 3HCVA 4PB9L 3QWQB 3QUYA 1EV2E 4WTXA 5C92A 4K94L 3CSYB 5MERA 3B2UC 3KG5A 4OFKA 1KBGH 1E27A 4AENB 1NAMB 3FO1B 5T3XL 5CLTA 2F8VA 1FCCA 3ARXA 4ONFL 3QG6B 3G5YB 1KPRA 3K4AA 4UUJB 5BZWB 3ZE1F 3GGWB 1QFHA 3SKUD 1T89C 4F3FB 4OSUL 1TJGL 1PKOA 5JIPA 5E2TH 5CIPA 5CAYB 1RZJL 4HUXB 4GBXB 4Y7MA 5DJYB 3TBSB 2MOVA 4FP8L 3T65A 4JFEE 4KRPD 3RKDD 3H9SA 5FFLA 2NXZD 4Y8AA 1P4BL