2QHRH

Crystal structure of the 13f6-1-2 fab fragment bound to its ebola virus glycoprotein peptide epitope.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
EVQVVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISRGGGYTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCSRHIYYGSSHYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 13F6-1-2 Fab fragment heavy chain
publication title Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
pubmed doi rcsb
molecule tags Immune system/viral protein
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2007-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrH01
3FJTA 1LQSR 2VDQH 3EO9H 5IQ7L 5GRWA 1AO7B 3X14B 4PY8J 3L3HB 4NC2B 3KPTA 4R26H 4NNPL 3P4OA 1IBGL 1OGAE 1OAZH 3OHXB 5L2KD 1TPXC 1U8KA 43CAA 2LTQB 1KPRA 2OZ4L 4PRAA 4TOYL 2AVGA 4FQPA 4Y5YC 3EYFB 5JHDB 3FOLB 1D5BA 1G0XA 4R7NB 5MENB 3BVNA 4NOBA 1U93A 1WF5A 1VFOA 3MYZA 3FQNB 3MRCB 1HOCB 5J9PA 1CS6A 2FB4H 1I8KA 4JY5H 3MOAH 5F96H 1BZ7B 3OR6B 2Z31B 1PKQA 4AEHH 4MJIA 1RUPL 1S9YB 3FCTB 3SDXA 4IDLA 4FQ2H 1H15B 2H2PD 1ZHLA 1ZMYA 1FYTB 3QZWB 1VKXA 2F8XC 4LPVA 5F88A 1PYWA 3WUWG 3W5NA 1GZPA 3RI5K 2EH8H 4G80B 3QDJD 5BVJA 3C6LA 2RCSL 5DK3A 4DFHA 1KTLB 1ROWA 1MSPA 1HYSC 4LSTH 4HUVA 2X4TA 2X4QB 4Y0GA 2BY1A 5DFWH 4JFDB 32C2A 3TJHC 3QNXA 4DAGH 4KVCH 4XWOC 3OZ9H 5K93A 4ZFGL 4FQIH 1A02N 2IANB 4LARL 4FQHA 4WUKH 3W0WA 4EOWL 5DGQA 3DURB 2NNAB 4ODWA 2A6IB 4LSUL 1MFBH 4GS7C 4Y4KC 3L7EB 4CUCA 1AQDA 4L3ED 5T3ZL 1AGBB 5L9DH 4PRPB 4WW2A 1U91B 4LFHD 4WFFE 2B1HH 2CR3A 4OGYL 1BGXH 1Z0MA 5EU3B 3SE3A 4NRZA 4PP1C 3QWRD 3FZUC 3V4UH 1N2RA 3EOYG 5KSBF 1MCLA 3MLUH 1KB9J 4M8VA 3Q6GL 3QP3A 5IVNA 2FX7H 3U30B 3MV9B 1G7QA 2ADIA 2GJ6B 1R3KB 2P45B 4NN5B 5C0BA 5TFSL 4NP4L 4R90L 3LD8B 3UTQA 1OP3H 3PHSA 4ZODA 5GJTL 1SEBA 3PE9A 3C8DA 4KUZL 3LKPA 2CKBB 4F9LC 3CFIC 1S7WB 1JVKA 5DHVB 5I8EB 3S36H 1B4JH 5JXEA 2K9UA 2QHRH 3EYVA 1NC2D 3RU8H 4ENED 4O2EA 3GBLA 1FNHA 4AEFA 5CD3B 1DQML 2HT2D 4OLYH 3ROOA 1KJ2L 3FFCB 4D9LL 3C9NA 2FJHB 2JTDA 3QRGH 5CEXB 4Q9RL 1IGTB 3BE1H 1NFIA 4KKLC 2CO7B 5KSBE 1CIUA 5DJ0B 4C58B 1VFBA 4HD9A 5I9QC 3BI9X 1HH6B 1NANH 1JHLL 1KB5H 1MUJA 2DQDL 3IJSA 2NY4D 2FIKA 1BQLH 3RWDB 2NXZB 4M7LT 4P3WA 2VXTH 2DN7A 4BSWA 2P4AB 3MC0A 1L6ZA 4GLRH 1U8OB 2DM2A 4UQ3A 3EO1A 5EU5A 3ULSB 1E4JA 3V5DA 1EVTC 2CK2A 2ICES 2LU4A 5D93B 3O0RL 4LPXA 4Z0BH 5KS9B 3MFGB 3V9FA 3QAZC 1RK0B 4C83A 5GS1B 3T4YA 1U3HA 4U6XB 5FXCH 1MAJA 1RY7B 5HDLA 3NTCH 4G8GE 1IC7H 1U6AH 3KYNB 2NW2A 4G5ZH 1OP5K 4WHTB 5HBBA 1GIGH 5FOBA 4N0CD 4QCIB 5FOJA 3C5SA 3EHBD 3BFOA 2ZSWB 3OKYA 4KKBC 4X4MA 3SJVA 1AD9B 4E41A 5DJCA 3N1MC 2SEBA 2A6KB 5GGSB 3E6FA 3PWNA 5HYFA 5HYSB 1ZE3C 4A2LA 4PGEA 4C56B 3GK8L 1B90A 4M7JL 4HKJB 1CL7H 1Q9OB 3VXPB 4J3WA 1B0GB 4QXTB 1CE1H 3OKOA 3OGOE 4AIXA 2D7OA 5JOPD 2XN9E 2MCPH 2R56L 4ETQA 3BDBA 2G75A 3CCHB 4TSAH 4BFIB 5CKAA 3NGBB 5LGHL 3ZYJA 5E7BA 1ND0B 5EO0B 2F9BT 3WE6B 2VISB 3K2UH 5KSVB 2JCCF 4O51B 3V79C 1JV5B 3H7BA 4XXDA 4MDJA 1AFVL 4HIEB 3GKWL 3UC0L 5EBMB 3VXRE 5GRVL 5GGUB 3QJHA 2DMCA 2AABH 3FQWB 4D2NA 4PRHE 1X5KA 4K7FA 1HYRC 2AK1H 1UCBH 4H1LH 4ZTPH 5MP6L 2FBJL 5I1KH 5C0RL 3KPSD 3VGAB 4F2MB 2IAMD 4CN4A 4IRJD 3CDCA 3QFJA 3HI5L 2VLJA 4OD1L 3O3UN 1RUQL 2F54A 1LO5A 3AREB 1N59B 1ZLVH 2R29L 4KMTH 2HT3D 1E6OH 3C60D 2XZAH 4MXWL 3FOMB 4MNGE 5LAXB 3FO2B 3FQUA 3TNMB 2JCCE 5IHZA 2V7HA 3HZVA 1FC1A 1HIML 5T1DL 1I3GL 1RJZA 1UWEL 1EEYA 3KYOB 3TLRA 4LASL 3BKYH 4N8CH 1I1CA 5IBLC 1I7TA 4QOKD 1LEKB 3TGXA 1FNAA 4EI5C 2DQFA 1FHGA 2AK4A 3DSFL 5KBNC 5ENWA 1QFWI 4GW5A 3NFSH 3PWJA 3T0XA 1X9QA 2CLVA 1E4KA 1CR9H 1UFUA 4NKDB 5E5RB 4R0LB 3EGSB 1AY1H 4RFNC 2BVYA 2VDLL 2H32A 4YHML 3TF7C 1G9NH 1HCFX 2VJXA 3D0VB 3UP1A 5DR5L 2R0ZH 4LLUB 3RZCB 3D1MC 2BVOB 1U95B 1IGJB 2VC2L 3C09C 4HC1H 4M8QA 1QEWA 3UBXI 3BGMB 1OGAD 1NBZB 4PB9L 4F7MA 1K8IB 3UTSA 3VDAA 3B3IB 3TN0B 5L6YL 1IT9L 1IAIL 5EC2A 2EKJA 2AXFA 4P5MB 2HP4A 4UOW1 1Y6KR 2NLJB 5E2TH 3VG0H 4RA3A 2KKQA 4FABL 4GKOA 4R2GB 4PGDB 2X40A 4LDLB 3BUTA 4LKCB 3MGTB 3IFPA 4CMMA 1CDIA 1TZGH 1A1MB 1N3NA 2OXGA 3SEPA 1QR4A 1X4YA 5EFIB 4LVNB 2YXFA 4GRLC 4XCFH 1DBMH 3P0YH 2XXMB 4PJAB 4HPOL 4LHQB 4Q7DA 3IETA 3RUGB 4NQCB 4BELD 4P2QB 3DIFA 1BP3B 5BW7C 1WLHA 1KELL 3DRTA 4I18B 5DHYA 3TBSB 2VLKB 3QUYD 2FHFA 5FYLE 2ERJB 4Y16A 1MCPH 3GMPB 1NAKL 4UT7L 2VDOL 2VDNL 2ZUQB 5AZ2L 3H0TB 9CGTA 5L7XL 3S8WA 4AIZB 1GGCH 2V5RA 3QWOA 1P7QA 5L88L 4WFEE 2XPGB 1A6WL 3IT8D 2EDNA 3MBEA 3ARBB 1INDH 4B50A 4PPTA 4Q97A 1I8IB 3QISA 3FB7A 4WW1A 1YEHH 3TT1L 5FF6A 4OCRL 1X5AA 3VI4E 5IGXL 2HJFA 2C9AA 4XVJL 4K7PX 4FFZL 1B2WH 2YBRB 4OCXH 4WFFD 1UZ6F 3EIFA 4OJFH 4QO1A 1CDGA 5E56A 2W0PA 5EBLA 1G7LA 4XX1E 5ACMA 1UVQA 5FCUL 3LIZL 1JNLH 3U1SH 4KY1H 3HE7B 5D70H 4NKIL 2BX5A 3TP4A 1LO0H 4U3XA 3V0WL 4YC2B 2R9HC 3C8KA 4Z9KB 3EYOA 3MRPB 2VR9A 1JGVL 4FG6C 1ETZB 4KHTL 1CFNB 1FNLA 3J7HA 1YQVH 4DVRH 1MRCL 4WV1A 2Q1EA 4JLRA 3H3PL 3VXTB 3T0EC 1KB9K 2H8PA 1PVHA 1KB5B 5FAAA 4UT9H 5FUOH 3DX7A 2DLIA 1D5MA 4HFUL 1G7HB 2DLFH 5JXAL 4XC1H 4PYHA 1DSFL 4JDTL 4HS3A 1RJLA 1IM9A 4YHKH 3TVMB 5HYIA 3FMGL 4U7SA 1UZ6E 3DUUB 3RWEB 1CICA 4NKOA 1ZANH 4ZPTB 2ENSA 4G3YL 3L3KA 3THMH 1RZKH 4A6YA 1GHFL 4QRUA 4J3OC 5ICXA 4BFEA 3M8OL 3UCRA 3N06B 3VFVB 4F33A 1EFXB 3ARGA 1FPTL 2EO1A 1BQHB 1FP5A 4LOUD 2ZKHH 3FT4A 1JPGA 1U8PB 3IDXL 5GGTL 5JW4M 5IFJA 4PTUB 3PV6A 1FG2A 4PREA 3WXVL 1QPPA 3JV0A 2JJTA 4JFZL 4X7CC 4K07A 4FFYH 2BSSA 4G6AD 4HWUA 5HPOA 4EXKA 3QIWA 1MVUB 1MJ8L 1ULVA 4G8GD 3BN9D 5ADOH 2MQCA 2FR4A 1NL0L 4JO3L 5E7FA 3T4AB 2XZQH 3MOBH 4X99B 3S35X 3WFDL 1PDKA 4IMLA 5C09A 3IB4A 4KTEL 4CADB 2QTEA 2JK5A 4X8JB 1G9MC 4M1DL 5SX5H 4F57L 4UTBL 5D7JC 5ILTH 2AEPL 4YDVB 5I74B 2FHCA 1JFQH 3RTQA 3P9WB 2YUZA 5DFVC 1JGDA 3IJYA 1JI1A 1IC4H 3EJYC 3GMRA 3FHQA 4Y4HD 1IQDB 5HPMB 4N5UA 5C6TH 5L2KB 4HGWB 4NHCL 1ZHNA 4ZUSA 2ZCKH 2XA3A 1W0WB 1PG7H 4N0YL 2COQA 3MRGA 3RI5F 3SKNB 1F4XL 4RWYH 3V8CA 5DJZB 3QUMA 3QUXD 4N0UA 2XN9D 1XGRA 2FRGP 3DTXA 4YBQD 5ID1A 4BQ9A 4H1LB 1N0XH 3I9GL 1S9WB 3CVIH 1UJTA 4M02A 2OI9B 1C5BL 1TTGA 1OF2A 4FQLH 4XI5C 4YHPA 5FA3B 5GISH 3S4SB 4KRNA 4N9GB 1FNEA 5GSRB 1F2QA 1YMHA 4L3CB 3VXRD 3UTZA 5I71B 4R7DA 1T1XB 2LAAA 1JPTL 4HT1L 4L9DA 4PRHD 2PW2A 1TDQA 2YD7A 1H3PH 2JE8A 1WZLA 3CFJB 3JUYA 3VXOB 5IEKA 3QDJB 5JMRA 1KPVA 2FJFB 3CUPA 5HGDB 3VCLB 5JW4Q 3NZHH 1BQHG 2ITDA 2DKUA 2LE9A 4LLDB 1CCZA 2X4SA 1NFDE 2AP2A 1SM3H 5IKCA 4YUEH 1M1SA 1OB1B 3OAZK 4UILH 3PNWA 4XGZA 3SKJH 5DK2B 4HJ0C 4YHZH 5FUCC 3SE8H 4IRSD 4U1IA 3BUYA 5INDA 3VG9B 2A2QT 1GC1H 5D1ZC 1QLEL 2PO6A 2HKHL 4L1DA 4U05A 4OZGA 4JJHA 4OF0A 3BAEL 1FZMB 4DKFL 5IIEB 4ALAH 4L3EB 1F00I 4M43H 2I60L 5EO9A 1CD9B 5IB3B 3VFPB 4FXLA 1XZ0A 5FKPB 1U8QA 4V1DA 5IG7B 1LO2H 3VXQA 3UDWA 3W2DL 3WS6A 4I0KA 4NKMB 4BH7B 3TV3H 5J6GA 4UT6L 4DK6A 3QDMA 1YDPA 3BW9A 5TE4L 4FTVE 2ITCA 5C8JB 4G6JL 1A4KB 3BH9A 3S3PA 4MD5A 3BMWA 1P5UA 1R3JB 2YA2A 1I85A 1CGSL 4H1LG 3NABL 5FM4A 4P46C 4FP8L 4X9GA 3S4SG 1SVCP 3TA3D 1QTYT 1NC2B 2E27H 3OXRB 4QLRA 5F3BB 2C4FT 4NO5A 5E00B 2NXYC 3SBWC 1OTUD 3FL7A 5T5FH 1XR8A 2J4WL 3S96B 5CHNB 5ITBL 5J13B 2JJWA 4E0RB 2R2CA 3O4OC 3HRPA 5BOZG 3L95B 2Y07H 4O58L 5EU7C 3P30L 4KK9D 4EN3D 2AV1B 2NY4B 1DANT 1WIUA 4Y5YA 3VFNA 1QLFB 4JREB 5IF0A 4M6OL 3ROLB 2Y06L 2APTA 3TWCH 5KTEH 2BY2A 3CGTA 4CJ0A 4HUMB 4PUBL 4D9RE 4MS8D 4ORGB 4U1KB 3D39E 3GBNL 1KIRB 5K9JH 1WEJH 4KH2A 3WN5B 4DN4L 5FYLD 4YHLL 2FYYB 1EH9A 4POZD 1T20B 5E8NA 2ZCHH 3MNZB 2OJEB 3NA4A 2L7UA 2HA1A 1XCQA 2AXHA 5GJSL 1A6ZB 3P9LB 5A2FA 2NTFA 4U1LA 5EPMA 5CEZH 4XAWH 1QQDB 2H3NA 4L5FH 1AXSA 3PQYE 1JF1B 5GQBA 2R1XA 4UTAH 5GS0C 3CPLA 1JF5A 4JHAH 4WFED 4LFHG 5C2UB 4LPWA 2YC1B 1J0HA 4APQD 5C0IA 5HVHB 4NBZB 4NNYB 5E94B 1JK8A 5HI3D 4OLXL 2AJVL 5MEPA 4X8XA 5HI5C 4ZUVB 1MY5A 1Z9SA 2UWEB 3VRIB 1KC5H 2A74B 4U6VL 4OCSL 2CKBL 3MQIA 2HT4C 1JWUA 2DB8A 1U3ZA 2HJKA 1FL5B 2Y9RT 2OK0L 5H35A 3G6JB 4WTXA 2FO4A 5E6IB 8FABA 1B6UA 1NFKA 5KVEL 1JJUA 4JKMA 4IJ3B 4S1QL 2N7AA 2BZDA 4DTGH 4K3HA 4KGJA 4JZOA 5FK9A 4Y4KA 3MA7B 3JTTA 5EU4B 2F58L 4K3DH 4HV8A 5C3LD 3OKMA 3ARFD 4Z7QF 4BFBD 4M62H 2AJXL 1BF2A 3G04A 4TTGA 5F3HB 5D71L 3EOAA 2R23B 3V0AC 5E2UL 5AAWA 1F3DJ 1YYML 4U1NA 5TGBB 4F7PA 4ELMA 1YYLL 1MCWM 2WWMC 1HXMA 4UNVA 3KPSB 4LLWB 4IS6A 2IAMB 3GSVB 4IRJB 1LNUB 2PYEE 5ID0A 1S5HB 3UYOD 2IF7A 2WK2A 1KCKA 1GZQA 3U0WL 1JHTA 4P9HL 3KWWB 4F9LA 4U1HB 5MHSE 1BVKA 1MJJA 1U92A 2QADC 3C60B 5GZNC 4HGMA 3SGKC 5I19L 4MQ7B 2UVEA 1WAAF 4XBEH 2ZSVB 1YPZF 4OFYD 3V4PH 3BOVA 4Z7QE 1KTDB 1QD0A 3LQMA 2P24B 4OV6F 4XP5H 2IH1B 4KPHL 4TSBH 2AEQL 2F19H 1D5IL 2MNUA 5DO2C 6FABL 1DQLL 5HXMA 4QOKB 2EO9A 3L3OB 4GMSL 5IJVA 1GXEA 2EXWD 5CILL 4JY6A 1HHKA 2DQJH 1ES0B 2QBWA 3RIFK 1P2CB 1GAFH 1TMCB 1MWAH 3LKRA 4EDWH 4NUGL 3D0LA 2UZIH 4J12A 3F7PC 4LEOA 3O9WD 4GFTB 3TNNA 5DQDH 1HILB 1WAAE 4KHXH 4MVBC 1OGAB 4PRBA 4AMKL 1YPZE 1U36A 3LS4L 5C0FB 4M00A 4XB7A 5TE6H 4O00A 4NZDA 2D7PA 4S11A 4PJDB 1QSVA 1PX4A 3F8UB 1P9MC 3BP7B 4JKPH 4PD4K 2DTMH 3E1F1 2HVJB 5HHQB 2VKWA 2Q6WA 2HMIC 3WV0A 1CVRA 3FT2A 3IXTA 1X5ZA 4XNUL 1IFHH 5MI0B 4ZS7L 4DUXA 4LLMB 5DD6A 3GFUA 2BMKA 3PDDA 4KK5D 4E42B 5AZEL 2DICA 3O3EB 2WSKA 1I8LC 4HCRL 3QEHB 3CX2A 3WFCL 3MFFB 2YSSA 1PQZB 5DJXB 4CU8A 4I2XE 4OAWB 1BMGA 4ZPVB 1WVZA 4EVNB 3QCTL 3KXFE 4PY8I 2C3GA 5GRVK 2VDQL 3EO9L 1AI1H 4N68A 3RPIB 3QUYB 3N1PC 3B43A 3U0PB 5I8KH 2XKUA 2NY6C 4TULL 4AM0A 4K7PY 4R26L 5GGRB 2VL5A 4FXGB 1R3IH 1RIVH 4R96A 1OARH 2VQ1B 3GSNL 1OAZL 1AR1D 2O61A 4JGJA 3ZL4H 3GHEH 2RQ8A 2BSRB 3N1QC 5LG1A 1KV3A 4GRWF 4MQXC 4JB9H 3VXNB 2BVQA 2G5RA 3HB3D 4GQPH 4PJ9D 1MFEH 2FB4L 5FYLH 4JY5L 3MOAL 3GSRA 4WJ5A 4DZBB 1LEIA 5FGSA 4JCLA 4KU1A 1XEDA 1T4KA 4PJXA 3MRFA 1QSFE 4AEHL 2OYPA 2X9WA 3CFEA 5C08E 1XGUA 1L4IA 3P11H 3KR3L 4Y7MA 1WQVT 3IDNB 4P2OC 1KN2H 2A73A 4JZJC 2NY2D 4JFQA 1NAML 3BZEA 1E4WL 3CFKA 4S1SL 5LQBH 3CDFA 4FTVD 4N5ED 2QQLL 5I1AB 4LSTL 3OAYH 1OQXA 4EI5A 3DARA 4GRWE 4TSCH 1BM3H 4WCYH 1ZT7A 2C3HA 2O5ZL 4BUHA 3U7YL 1HQ4B 5DMJB 5IW1B 4DAGL 3NCYP 3OZ9L 3QH3A 3T0VA 4XCNA 4P2CG 3U82B 5E4EC 5D2LA 5IQ9A 2WW8A 3FQRA 2X4NA 4HK3J 4PJBA 1QBMH 2IJ0C 5A2LH 1N5AA 1XF4A 3B8SA 3FONB 5FO8B 3MNWA 1D7FA 1MFBL 3HAEH 3VXSE 3QCUH 5KSBB 4YHIB 4JO1H 3PWLA 4Z77A 3PL6D 2GK0A 2YD3A 4CVWA 3MO1B 3QUZD 5SWSA 1VACB 3KPNA 1EDQA 1BGXL 4B5EA 4QT5A 2WP3O 3DHMA 3HZKA 3V4UL 1I8MA 5DS8A 3MLUL 2WINA 3TYFA 5I1CL 3RWCB 2FX7L 4D9RD 3SDAD 5ABDE 3D39D 1PBYA 3HMWH 1G7MA 1ZWIA 4N1HB 1IGCH 4NM8H 4QHNA 3VXUE 5KSUB 2QQNH 4JM2C 1BEYH 1IC5H 4YR6B 2Q3ZA 4GRLA 3QIUC 2X4RA 1S7UA 5CZVH 5DGRA 3LH2L 3S36L 3PQYD 2RB8A 5F89B 4XPTL 3I02B 5BW7A 5FGCE 4HMCA 3J8F7 3PG2A 1EXUB 5F7EH 4OLYL 2Y36H 1ZOXA 4Y4HB 4Q0XH 3QRGL 1I9IH 4Z7WA 3BE1L 3WFHA 3WO4C 1WJ3A 4Y2OA 3BPNC 3GHBL 1KB5L 2CJUH 5FYJE 1BQLL 3HC0B 2VXTL 5F93C 4AIOA 4X5XB 3QUXB 2I9TA 2XN9B 3ARQA 1XIWD 3BJLA 4JVUA 5HHOB 2FX9L 1D5BB 4PRHA 2K7QA 5EZOH 1VESA 2V5YA 4HUWA 1TETL 1KGCE 3LQAH 2EC8A 2EICA 1YJDC 1C12A 1QSEA 4G8IB 1F6LL 3KNBB 1IC7L 3EUUA 4NRYA 5D96B 1JGEA 1T83C 3P4MA 4O2CA 5FO9B 1W0YT 5JOEA 1V3KA 3VXRB 1GIGL 4WHCA 4M1CD 4WUUA 2VIRA 3HNTH 3GMQA 3STZA 4BZ2H 4K2UL 5IBUB 5I30H 2AERT 4V2CB 4WTWA 1QACA 1VKXB 4J23A 2PYED 1X3DA 3T0EA 1Z5LA 1EVUA 2HRPH 4OT1H 2C3VA 2VZSA 2FH6A 1CL7L 5J4MA 5E9DA 5MHSD 4HJJH 5F9WC 3LDBC 3E3QC 1RZ8B 1HN1A 2GJZA 4IRSB 3O6KH 3EO0A 1VEPA 4I77L 1UJ3B 3QO1B 5TQ2H 4MNGB 3WNKA 3SO3C 2JCCB 1DQJA 2MCPL 1MWAB 1CGXA 1UENA 2R0LH 1GGIH 5A43C 1DN0A 2FEEL 3UTTE 4KK6C 3Q48A 4NKQB 4EJ1C 1QVOB 1FVCA 1W0VA 3KLAA 3CVHH 3FQTA 4WI9A 3W0WB 1XH3B 3UBXB 5H37H 2YMXH 3O2WH 3IYLW 3GJFA 3LEXB 4WEBH 3ZE1F 4G8FA 4KQ4H 5ALBL 5CMAA 2ZUUA 1YMMA 4MGXA 2DQCH 4JQIH 5DA0B 4WW2B 1EAJA 3JWOH 4X6EA 2VZ3A 2AK1L 1UCBL 3OR7B 5B22A 1OW0C 4PJEF 4NRZB 4TQEH 4KK8C 3MRDA 1C5CH 3Q6FB 1RZ7H 3L5XH 2PR4H 1QHOA 1T7ZA 2X1WL 1UC6A 4BZ1H 5K9KA 5KSAC 1MQ8A 5C0BB 3I85A 1MH5A 1RZGA 2VTFA 3A6OA 4GAYA 3OG4B 5CSZB 2XTJB 3TA3B 4D0BB 1E6OL 3EYSL 4KDTC 3IU3B 5D7JA 1F8TH 2Z35B 2PXYB 1NDMB 3QEUA 4HFWA 3ZE1E 2VLRE 3LMJH 5C9KA 2WIMA 3JWNC 3WL9A 4MA1B 1KG0A 1NMCB 2BOBB 1HHIB 2WMPA 2EKSB 4KTDL 3DNKA 4JPWL 3V6FB 4EN3B 1XR9A 4MZ3A 4OTXL 1ZK9A 5A16B 2J88H 4PJEE 1KCSH 3CFBB 4CN6A 2XWJB 4NC1E 4OFKA 4WU7A 3OJ2C 3QXUA 2GCYA 2P48B 5I15L 5JDSB 4JFPA 3OL2A 2RFXB 1W8NA 4RX4A 3KXFD 3G5VB 1JMZA 4YFLF 1FL6A 4I0PC 4BSWB 1UYWL 4Z6AT 1I7ZB 3MACH 2R39A 4QXGL 4LAJH 5E2JA 1U2HA 6CGTA 4QF1B 1RJYB 4HC1L 1CT8B 4IHOA 4TUOB 1G0DA 4FQXC 4OKVA 4P59H 4C83B 2BP3A 3E6HA 1JZ7A 4W6YB 1FSKC 4YIQA 3SHSA 3DUHA 5ACZA 1RZJL 1E6JH 4R9HA 5IK3B 5D7LE 1R3HA 1GSMA 3HMXH 2W65A 5C6WH 3F65A 3OJDB 3DMMC 1S8DB 3UBXG 3WFEH 4APQB 5LGJA 3PUCA 4G8EA 5D72L 1QFHA 1CBVL 3T2OA 2BXYA 1NEZA 4JFFE 3NPSC 3QQ9D 3DV6A 2C3XA 2L4OA 1UZ8B 4N0RA 1KIUA 3O3DA 3WKNA 4NWUL 1CLOH 5DJCB 3NVQA 3RKDD 3WYRA 2SEBB 5EH1A 3OJMB 1QSFD 5IWLC 4QWWC 5C08D 3AU1B 4P4KD 5GGQH 4XMKH 5D1ZA 2CMRH 1JE6A 3PDGA 5HYQA 2EE3A 1T1ZB 5T3ZE 1PZ5A 5DZNA 3QXAA 4NO2A 5JW5B 5CIPH 4PTTA 1D6VH 4WIQA 1FLTX 3LN4A 5DD0L 1RK1B 2NX5E 3ESUF 4HWZB 3HAEB 2MQ0A 2OQJB 3ARFB 3S7GA 1MCPL 3KYAA 3WCYA 4JGMA 1X5XA 3M17B 3U6RA 4YFLI 5SWQB 1CFTA 3RGVC 1GGCL 2Y7QA 2BCKB 2EXYC 4RRPA 4ZMAT 2N4IA 1HSBA 1A1NB 2PKDA 2APFA 4FZ8L 4ODUA 4XZUA 1JPSH 5I1LA 2HFGH 1HI6A 1FG9C 1AIFB 2XXCB 2Q8AH 2W38A 3MV8E 4M7ZC 4GBXD 1D6EA 3OKNA 1FFNA 1DE4A 1C08A 3N9GH 1MIML 4M9PA 3X13A 3RIFF 3VXSD 1U8MB 4J3XA 3BP4A 4P3CL 4YHNB 4P46A 1FL3B 1UM4H 1B2WL 4U7KA 4L29A 3HNVL 3PF2A 4M7KH 4KWUA 4NO0D 5ICZB 3E2HB 3HLAB 4YLQT 5DD3L 3O11B 4ORZC 1ZVSA 1JNLL 3SBWA 4XPGL 3U1SL 4KY1L 5H2BA 1A6AB 4X98A 2F54B 4XNMB 5EBWB 3LV3A 1ZA3A 3L3DA 4WHYH 3VFTA 5JQ6H 4YAQB 1CXFA 1A64A 4H8WH 5IMOB 3WHXA 5AAMA 3CX5J 5IHZB 3VXUD 1FYHB 5E8OB 2XTLA 1YQVL 2LVEA 4JKLA 4DVRL 5F7UA 1CFVH 4TUJA 4WWID 2JB6B 2A6DA 2B4CH 3BO8A 4UT9L 5FUOL 3I2CL 3TIDA 2P43B 1CXLA 4YDJA 5FO7A 3WIHL 3G5ZB 1M4KA 5CLWA 2DLFL 5ENWB 4Z8FH 4XC1L 4Y4FD 5ERWA 3ARXA 3K2MC 2DIJA 4YHKL 1DL7H 4TRPL 2KL6A 3G6DH 2IQAA 3O41A 3O9WB 4ODHH 4U33A 4XX1G 1ZANL 3KPQA 3EJJX 1R3LA 3F5WB 3THML 1RZKL 4OCMC 4WWKD 2J6EA 1QLRA 5E8PB 3RVWD 3C08H 2RGSA 1NC4A 3BJ91 3LPWA 1QEWB 1G9EA 2VDMH 3ESVF 4YXHH 1Q0XH 1A7NL 2GSIB 2ZKHL 4KQ3H 1F3JA 1WFUA 3UTSB 1A0QH 4U6YB 5M95B 4TUKH 1DZBA 2EDRA 2AXFB 4OCNC 4JO2H 1REIA 1KGCD 4FFYL 3GMOA 4XNXH 2D9CA 2IPKA 5HYJA 2EZ0D 4LRIC 4LCWE 3ZKXC 1T2QH 1FO0L 2XZQL 1ZXQA 3SDCC 1NFDA 4UDUB 1A1OB 4LPCA 3QULA 3X3GH 4GMTL 5D7SL 2NYYD 2DI9A 1KEGL 3DVIA 2X89D 4LLVA 1NGYB 4X6DA 3W39A 4RRPG 4B7LA 2GK2A 3RNKB 3L3GA 5ILTL 4ZFZB 3KJ4B 2I5YH 1JFQL 3UMTA 3VD9A 2EYSB 4Z78A 1F6FB 2P8LB 3P77A 2IG2H 1FNGB 3EYUL 3DX6A 4ZOEA 1GGBL 3CVHB 3DRTB 1CFQB 4OFPA 5C6TL 5ESQA 4UZGA 2ZCKL 4DW2H 4ZFOA 3TESA 1PG7L 3OB0K 5KG9A 4JO4H 3QG7L 2E9WA 1F6AA 3MR9B 4H25A 4HEPG 3CVIL 4PJ9B 3QWOB 5E8DH 3UTTD 3W82A 1HH9A 1NGWB 3GIVA 4MAYD 1NPUA 5GISL 1K4CB 4AG4L 4MNQE 5F1IA 3JSSA 1KN4H 1CDUA 2C1PB 3T2PA 3OKLA 1UKQA 1K2DA 3KPPA 3SGKA 2G60H 2NY0D 4PJ8C 4Q9QH 2VABB 4NZRH 3WMSA 2VXUH 4ZUUB 1H3PL 4J8RB 5ESAA 1WTLA 4JFEA 3O6FC 2HTKC 1MREH 1MFDH 2FECL 5C70A 2DRUA 2DQGH 2VOTA 4FFVD 4FTVB 2MQ3A 3FN3A 4XRCB 2GSGA 2DLTA 4NGHH 3QJFA 2CLZB 1JHKH 1VGKA 4S10A 1SM3L 4CW1B 4AQOA 2X6MA 4YUEL 4XP9H 3IDYB 3T0WA 4NUJA 3OSKA 2I24N 1I7RA 5CP7B 2QQQA 4ZXBC 1KXVC 2EIBA 4UILL 7FABH 1UXSB 4R4FH 3G5XB 4YHZL 4JLRB 2B2XH 4U1SA 4Y1AA 1NBYA 4GOSA 1SY6L 5KVGH 2H8PB 5CWSB 3TPUB 1GC1L 3S37H 5CS7A 2DF3A 3TO4D 1R5VA 3AAZB 5DEGA 4CN1A 5DUMH 5HHXH 1ZLWK 2YWZA 4NQSA 5HHVH 5SWZE 1YEIH 5IR1A 5BRZB 1LHZA 1TJIL 2CK0L 2VLRD 4NJ9L 2VQUA 1AJ7H 4LP5A 5JIIA 2CSPA 4ALAL 4B41A 2HJLA 2OL3A 2VXSH 2WBJC 5CJXC 3PL6B 2NZ9C 4NQXA 4DEPB 5JNYA 1MCCA 2ZP0T 3QUZB 1JNHA 1P53A 1JF6A 2C7UA 1OQOA 1P9MA 3S88L 3L3KB 5I66A 4HULB 3W11D 3NIDF 4YQXH 5L0QC 5KVDH 4NWTL 4TVPL 1JYWA 1EHLL 4Y8AA 2VDPH 1I9RH 1L0QA 3SDAB 2OMBA 4JHWH 1OTTD 3D39B 4C57C 1PZUB 3PHQA 4S1DD 3CXDH 1VADA 1MHHA 2LU3A 1EPFA 1IAII 3ORJA 5E0QA 1DEEB 5IUSA 3U9UA 1LVEA 4GXUN 5D2NE 1I8LA 5IW3A 3O2DL 1JRHH 2ESVA 1OSZA 5E99L 4XMLH 3PQYB 1A7OH 4Q74A 3D69B 1MIEH 5D7LD 4PJIA 4F58L 4ZUTA 5T1MB 1FVEA 4OIBA 2YR3A 3RY6A 5T5FL 1WZKA 5EULV 4OF7A 5CIPB 1HQRA 3RFZC 3NIDE 5IHBA 4JFFD 1TLKA 4CMHC 2Y07L 1SEQL 1T3FA 4YEEA 3SOBH 5C0CA 3DETD 4U1JA 1T89C 5C07E 2BY3A 3LRGA 2VWEE 4TYUA 3ZDXF 2W07A 2KPNA 3MJ9L 3BHBA 1MHEA 5TJWK 1WBZB 1XF5B 3TWCL 5KTEL 3L5HA 3VD3A 3MGOA 1IM3B 4GKZB 4EKXA 1MI5A 1XIWB 5JORA 2DDQL 3EFDH 3ZDZF 3MPCA 4QRQB 2MWCA 2OR9H 3QEQE 1T7WA 5T3ZD 3P4NB 5T5NG 5HY9B 5F9JA 4KRPC 2R2BB 1NKOA 4O2FA 4XP1L 1C5DB 3ES6A 3QNZB 5EUOF 4DCQA 1BVLB 1D5ZA 2ZZUT 5ID1B 2NY3C 4BQCA 2ZG3A 2NX5D 2VZUA 5DF0A 4HIJB 5E1HB 3VU2A 3U46B 1U8JB 2ZCHL 3I6KA 2JB5L 3D3VA 3LKSA 3PWPE 2EE9A 1EEUA 4ZTOL 3BGFC 5IHUH 5CEZL 4XAWL 4PLKD 1KSRA 3LHPH 3VFMA 4L5FL 4P2OA 4UTAL 2NY7H 5JUEH 4RGMB 5D9SB 3CH1A 4TPRH 1RU9H 1U8NB 2Q76A 1O7VA 2DMKA 3ZDXE 3UTZB 4I48A 1BOYA 3MV8D 5DJ8A 1FNSL 4IOSD 4LCYA 1WIOA 2PYEB 2W0FB 2ARWA 1OGTA 2YPLE 4HK0B 3OX8B 3VGHA 3V7AE 2F8OA 2RIKA 1G7JA 3LKQA 2HRLA 3ZDZE 1KC5L 3ISWA 1NQBA 2QR0B 2BVTA 4Q58C 1T1WA 3MLTA 1R6VA 1K8DA 5E8EB 2ITDB 4XCCH 5EUOE 1UEMA 3U0TB 2E9IA 4X0KA 1S9VA 1MCKA 3I84A 4ZUWB 1YY8A 4LQ1A 2WIIB 2X4UA 5HI4D 1VFAA 4LNVA 2RR3A 4MX7B 1Q9WA 3PGFH 4JG0H 1EJ6A 5I0DA 2WWKO 4U6TA 1MQKH 1FFPA 1BX2B 4Q6IB 1LDPH 1DUYA 3X11A 2FCBA 1IAKB 4JDZB 3STLB 4GUPA 3QIBD 4OQTH 5EO9B 3CX5K 3OAZH 3NCJL 2HN7B 4HDIB 4J6RL 3I3EA 5ECJE 1TCMA 1BFOB 3HG1B 4YNYA 1U8QB 4NQVB 4MQTB 3NACH 5DVOA 3LQZB 1J1OH 3D9AL 5J6GB 1YPZB 3BW9B 3QIUA 1YEKL 2R4RL 1ZHKA 4X6BA 5LBSH 3P9MB 3FTGB 4YWGH 4MD5B 3DXAA 4OV5B 5I75C 4GKNA 3DBXA 3LKOA 5IM7B 2FL5A 5F7MC 3F6LA 3L3IB 4Y19E 4HUUB 4JRYE 4Z7UE 4ZSOE 4I2XA 1D9KD 2FD6L 4M6MH 4XP5L 1RUAL 5DJAB 4TSBL 3FRUB 2F19L 3LN9A 3AS1A 1X5FA 1IEAA 4BH8A 4FXKA 5MERB 3RWJB 1V8HA 3DX8B 1LE9A 1OTSC 1IGMH 3UO1H 4LCWD 5HGAB 4ELKB 3FO9A 1GAFL 4RGNC 3T1WA 2E7MA 4XP6H 5F7WC 4Y89A 2QSTA 2RAMA 4Q9BA 1IBGH 4ZDHB 1F02I 2DMBA 1L7IL 4GO6B 2DQUH 2EC9T 4YHYB 3DVNB 4UQ2B 1KJVB 1RIUH 3U2SB 3UPRA 1ZGLA 1J05A 1OY3B 5DQDL 1AQKH 5JDJA 3MA9L 4KHXL 5HDOA 1ED3B 4LDEB 5TE6L 5B38B 2X7LA 4KI1A 1HHGA 4H88H 4LCCC 5HD8D 3T77A 2AJ3B 1LEGA 2DTML 1XCQB 2YUVA 4DQOH 3T0BA 3GI9H 5AWNH 4KV5F 3TBWA 3TCLA 4K94C 1E27A 4RQQA 5IMLB 1RUPH 3VRLF 3Q5YA 5BV7L 1IRAY 5MEQB 4BUGA 2R1XB 1DLHB 5H94B 3ULVC 3ZKMD 3L3JB 1X5YA 1R5WA 3VXMA 1A7RL 3HFMH 4OUOA 5GRYA 4MNQD 1TVBA 2FJGA 1QSFB 3T3PF 2ATKB 5C08B 1TVHB 4P4KB 3MRQA 1A3QA 1DUZB 2RCSH 3BSZH 3OKEA 1FFRA 3HE6C 3DV4A 5DMGC 1DVFD 2GHWB 3TCXA 2H26B 5H35B 4PJCF 5AYUH 4NFDA 1DTUA 4ZFGH 2NY1C 4ODVH 1R3IL 1RIVL 1F90L 1OARL 2YK1H 4R97C 4W70A 4PJFA 4KV5E 1AKJD 3ZKQD 5B8CC 5FK9B 4IDJH 2VSCA 1ZGLM 1JCKA 3VRLE 4ZD3L 2A83A 3NCEB 4NRXA 2BNRE 1AGFA 4LSUH 2EIZA 4C4KO 1B4RA 1SMOA 1OW0A 2ATPA 3QPXL 1AGCB 2VDRH 4ONOA 5T3ZH 2R69L 3B9EA 4JB9L 1PLGH 5IV2A 3T3PE 1G6RA 4GBXB 5ANMA 5KOMC 5SWZD 3BYYA 2XRAH 5KSAA 2R2EB 3VXSB 4GW4A 2KH2B 3NZ8A 5EBGA 3EZJB 3Q6GH 4DN3H 4WEUD 2H45A 2BHYA 4PRIE 5KW9L 4NO0B 4PJCE 4NIKB 5D6DC 5F6HJ 5TFSH 4Z95H 4NP4H 3VFRA 1HHHA 3P11L 1E28A 5IB2A 3CJJA 1J0JA 4I0CC 3X12B 1OD9A 4CKVX 4XT1C 4LLQA 1MJJB 1KN2L 2WZPD 3RVVD 4KUZH 5EO1A 3T65A 2BSTA 1YC8A 4XBPA 2YRZA 4JM2F 4MA3A 3HNSL 2Z9TA 3VXUB 5LQBL 2BOCA 4P57A 3I3DA 4ODBD 3NFNA 4PV8B 5KOVC 2HFFB 2YN5A 4KKCC 1PJ9A 1RHHB 4TSCL 2D31B 3HPJB 4ACPA 4CDGC 1DQMH 1KJ2H 5I9QB 5JPMA 4Q9RH 5D1QC 1TZIB 1ITBB 3MRMB 4JFOA 3SDDC 5GS3A 3U7WH 3IXAB 4I0PA 3GUTA 5FGCB 2DQDH 1JHLH 1FGNL 4O02H 4PRPE 1QBML 4OI8A 3ZZ1A 3CU1A 1XGYH 3EOBB 1JN6A 3UX9B 4WWKB 2BNQA 5D1XD 4FQXA 3QCUL 3D0LB 1L0XA 3IJHA 4JO1L 2OSLA 4UV4L 3OKKA 5C07D 4HKXA 4MJ5A 1NGXA 3MV9E 4GW1B 4IOIB 5M7QA 2GJ6E 3GSUB 4RMRA 5C71A 3VWJC 1A3RL 3DMMA 3EBAA 3O45B 5BXFA 3GJFH 4Y2DC 5CGTA 1MLBA 4ZNEA 4WU5A 1FLRL 4PRDA 3QEQD 4QXUH 1X7QA 3VDCA 1PAMA 5HTSA 3HMWL 1YN6A 1H0DA 3BEWA 1FZOA 2V9QA 1IGCL 2Y4SA 2Q7YB 2DYPD 4OZFA 4PV9B 3HR6A 3T1FA 2YPKA 4LCUB 1J8HA 3A6BL 1BEYL 5IWLA 1IC5L 1QBLH 3P73B 2ADFH 3PWPD 2BMKB 4AYFA 3EJZC 1F45A 5CZVL 2XV6B 2GITA 1BLNB 4AL8H 5DRZB 3RDTD 1S5IH 4TVSa 2ICWB 3QI9D 2Z4QB 5EIIB 4J1UB 4M7JH 2X70A 2BVUA 5F7EL 1G9MH 3D2UD 1Z2KA 5FGRA 4XC3L 2W60B 4PB0H 1AP2B 3WIFB 2YPLD 1MCHA 2R56H 1VENA 4K23H 2BDNH 2LTQC 3RGVA 2J12B 2CJUL 2VITB 2IPUK 3DUSA 5LGHH 1LE5B 4G6FD 3QQ3A 1DDHA 3IFLL 4WRLA 3DGCR 4KJYB 1WCBB 2YRPA 3AS2A 5JIPA 3OBAA 5T1KA 3HC3L 1CF8H 2LV4A 1N6QH 2V2TB 2EDEA 3IVKA 4U1MA 3OWEA 5C0AE 3JUZA 3REVA 1AFVH 3UTTB 5LCVL 5EZOL 4DVBB 3GKWH 3QNYB 4MAYB 1OAYH 5IMKB 5I17B 1KT2A 3H9SE 3MUGB 3SPVA 2Z31C 3B9KD 3C2AH 1NUGA 3SO5A 3CZFB 3PHOA 5MP6H 2FBJH 2NY0B 3LN5B 3V5KA 2YD4A 3KPMB 5E08H 4F15B 3HNTL 2Q86B 5I6XB 2CDGA 5HHPA 1JWMA 1SYVA 4BZ2L 3EFFB 1RUQH 2BVEA 4Z76B 4XBGA 1KYOJ 4KJWD 2PETA 3BDYH 3GMMB 1SJHA 4MD0A 1OHQA 1Y6NR 3WHE1 2A73B 2VLRA 3TO2B 2OZ4A 1F4HA 3AM8C 4HXBL 2JJVA 4OT1L 1HIMH 3HN3A 3F7QA 1I3GH 1TQBC 2HLAB 3KPRA 1ZAGA 3MRJA 1ORSB 4LASH 3IDJA 3O6KL 5TQ2L 1BBJA 1P4IL 4HQQL 5TDNA 3TO4B 1M6OA 4AENA 4FNLL 4X80H 2R0LL 5LKNA 3DLQR 4LNRA 4Y19D 4JRYD 1A5FH 3UZEA 1NCWL 4RFNB 4KRLB 2MSPA 4OZHA 3HZMA 3LSOA 3PABA 4PJ7A 5TPWH 3BIKA 4LP4A 3DYOA 1CDHA 4L8DB 4OZFG 3PWVA 1UCTA 4WEBL 4PJEB 3O4LE 1ZS8A 4KQ4L 5JW4N 5DR5H 4K9EC 3CDGA 3SCMD 1IZJA 3UJTH 4UINH 4LSVH 4JQIL 2XWBA 4U3HA 4Z0XA 1CQKA 3FQXA 1FJ1B 2LAGB 1UA6L 5E1AB 4NPYA 3SGEH 5BJTB 1P5VA 2P5WA 5I18L 5SWSB 3BZFB 1INEH 4JANB 3U30C 3UYPA 1ZT1A 1KPUA 4PB9H 4CVZB 3P3YA 3K1KC 4TQEL 1ADQA 1ONQB 1C5CL 3LD8C 1RZ7L 1P4LB 4XXCC 5FCSH 2Q87A 4X4XA 1YN7A 3B5TA 4WNQB 4FABH 3SDCA 1OCWL 4QHKJ 1S7VA 5D7LB 2QKIB 5CCKL 2NY5C 4MWFB 2J8OA 3U9PH 4ODSH 3K8KA 5DMYA 5AUMA 4QHUA 1LP9A 4MDIA 5I1DA 2O26U 1YNTA 4JFFB 5BQ7B 3RP1A 1A7QL 4HPOH 5GRJL 5DMKB 1A7BA 1TIUA 1BD2E 1T1YA 1KELH 1KCSL 2NXZC 4Z7WB 3OAUL 1RIHH 5AD0A 4UUJB 2R1YB 4MJ6A 5GSVB 2CXKA 2VDOH 3QDGE 1IGYA 4TNVK 3P0VH 4H26A 3FT3A 5GS1C 2I9TB 5EOTB 2JIXA 3RNQB 2NX5B 5L8JB 1T0MB 2GIYA 3TEUA 2VLME 4XB8A 1KCLA 3QUKB 5FKAA 2ZPKH 5AG9A 1N64L 2L0DA 4KI5F 4PJ8A 3QSKB 3GSWB 2X4OB 4HIHA 1SBSL 2BNRD 2GUOA 4OCRH 1O5DT 4YXKH 4A6YL 5EN2A 5JA8B 3VMNA 3QPQD 4FFWD 2J6EH 3ZE2F 5IGXH 4XVJH 5K59F 3O6FA 4FFZH 1U3HC 4R4ND 2VO5A 1T5WA 2BERA 5DQ9A 2KQNA 3MV8B 2PTVA 3UAJD 1PW3A 5FCUH 3LRSA 4I4WA 1MAKA 1H8NA 4HF5L 4NQCE 5MEOB 4ZXBA 4MXQD 4JN2B 3MRHA 4PRID 1NCNA 1V5JA 2DJUA 3V6OE 5K9QI 1JI2A 3T0EB 1JGVH 1KJ2B 2AXGB 5GGQL 1CVSC 4XMKL 3AB0B 2CMRL 3ULUL 4LCIL 3NGBC 4PP2A 1I7UB 1UH4A 4H5SB 1DBJL 4Q2ZB 4JCMA 3R8BB 4KI5E 1D6VL 3IS0X 4JFHE 5CJXA 1VCAA 3RL1B 1FIGH 4LLAA 2CLRB 2C4XA 4BSVB 2DLGA 2E7CA 3C5JB 4HX1A 5EC1A 5JXAH 4P5TD 5K59E 1DSFH 2V2XB 3D5OF 1MEXH 2WQRA 3IFNH 1FVCB 2YD8A 4I3GA 2DBLH 1LILA 4G3YH 4AEIH 2HFGL 2YEZB 4PRPD 3M8OH 2Q8AL 1N8ZA 2DD8H 5TDPA 4P2RE 3AXLA 3T0AA 5CJOH 5M94B 5I1GH 3TZVD 1U8LB 3IDXH 5GGTH 1UM4L 5F1KC 3AREC 1T03H 1FFOA 4G9FE 3MV9D 4NCC2 5CAYB 4JFZH 1BFTA 1UXWB 2GJ6D 4AT6B 3BPLB 4K8RL 3D25B 2HFTA 5I2IA 1HDMB 2J8UF 1WBYB 1MH5B 2YD2A 4X6CF 4MSWA 3LS5H 1D9KB 3ILPB 2Y6SC 1R5IB 4PLJD 5FYKL 3WFDH 5JQ6L 1A6TA 1T21B 3RBSA 1XGTA 4NT6A 4KTEH 1HE7A 1YEGH 2UY6A 4J4PC 1T89A 5J7CC 4OLZH 4M1DH 4F57H 4LCWB 4UTBH 1CFVL 1XGPB 2AEPH 1I1AD 3OG6B 1KG0B 2OTUA 4UMGA 4DKEL 2X1PA 4R0LC 4QGTA 4OUUA 4YGAB 1URLA 4Z8FL 4HEME 4MD4B 4KUCF 4NHCH 1ZSDB 3OGCA 3G6DL 3FB5A 4ODHL 4D3CH 4JFPB 3DVGA 4M6NH 2H2SD 2OP4H 4KFZC 3BIAX 2J8UE 1Z0NA 4PGBB 5DEZA 4X6CE 3QFDA 3TN0C 3C08L 2P7TA 3EOTL 1C5BH 2DL9A 1J88A 3QXDB 1B0RB 5B4MD 4HPYH 2OR7A 3HPLA 4PJ5A 5IB1A 1Q0XL 2MCG1 3BKCL 5FM8A 3KPLB 2BRRH 3DHJA 4R2GC 4NN6B 5C0AD 4TUKL 3L1OH 5DC0A 3QG6A 4JO2L 2UY7A 3U4EB 4D8PA 3H9SD 4MNQB 4RGOH 2ED8A 4F37K 1JPTH 4HT1H 2GKIA 3PGDA 4LVNC 5T1LA 4NCC1 3BX7C 2HVKB 2ZG1A 2A77H 1DVFB 4NN7C 4OCLC 2XA8H 5CZXC 4I18C 4WDIB 2I5YL 1QA9B 4IOFD 4XAKE 5D1ZB 3K8MA 3HZYB 2ERJC 3ARDD 2Z93A 1BIIA 4GG8A 5C0ND 4NO2B 1AKJB 2ZUQC 1C16A 1QLEH 3LRHA 5IJKC 4HZLA 4XVUD 3BAEH 1H5BB 2FEEI 5F9OH 1KYOK 3RBGA 4DKFH 3QBTB 1M05A 5B39A 4QRPE 2GAZB 4M3KB 3WXWH 3ARBC 2I60H 2GI7A 5ETUA 4Y16C 5IVZB 2EYRA 4IRZH 2VZ1A 5SWZB 3LB6C 2P5EA 1AGDB 2PYFB 2XYCA 3DOSA 4AK1A 1N7ML 4LLYB 3OF6A 2NW3A 2EYTB 3MMEA 5I1LB 1CDCA 4MYWB 3W2DH 3JWDC 5JOFA 1MCEA 4RAUA 3C5ZD 2E3VA 1RHFA 5DI8A 5I16A 2NQCA 3O4LD 3MRKA 4U2ZA 5TE4H 3WSQL 4NZRL 1FE8H 3HE7C 4A2MA 1Q94A 2VXUL 4YC2C 5BS0E 1CGSH 4U4BA 2HTLD 4NQDE 3ECBA 1G7PB 3VH8A 1ZVSB 1MFDL 4W4OC 1K5NA 4HIIB 3MREB 4FP8H 1TQCB 2H6PB 3MLYH 4NFBA 4JJ5B 4G9DA 4LEXH 4XH2B 5D2NB 1JHKL 5DSCB 5DWUL 2CIIB 3VFTB 5CGYC 2J4WH 3WHXB 4XP9L 5ITBH 2N56A 4P48A 2GTZA 4R4FL 1A4JB 1IAIM 3SY0B 5FB8A 2Z92A 1TITA 2ADGB 4O58H 3WEXA 5KVGL 1R24A 3D48R 3S37L 5KJRH 4YPGA 2EDHA 5HHXL 5DUML 4L9LB 3K7UA 5FO7B 1CGTA 1MY7A 1AJ7L 5D1XB 1UACH 4M5ZH 1K4DA 1GPOL 4PUBH 4ONGL 5C07B 4MXVF 1BD2D 5BVPL 3GBNH 4LCCA 4GG6A 4YQXL 5E5UB 4RIRB 2F53E 1UQSA 3DROB 4YHLH 3RZCD 5FA4B 4M7LH 3OJVC 2CPCA 4C55A 3QEQB 1FVDB 2WUCH 4DWHA 1Q1JH 5GJSH 4EI6A 4JHWL 3QDGD 1UH3A 1TENA 2ZWLT 3S3SA 5EB9A 3CXDL 1PEZA 1HSAA 3MRRA 2DYPB 5F7HA 1T5XA 1YUHA 3MRBA 4L8BA 2H9GA 3TJEH 3VGEA 3SN6N 1J86A 4QHLA 4I1NB 2VLMD 1YZZA 4MMZC 1Q8MA 3ALPA 3RPKA 3PWPB 5D6CA 5J11B 2PW1B 1JRHL 1IKNC 1JTPA 3HE6A 1FRGL 4RFEA 4PRNA 4TTDD 5C0GA 4OLXH 3RDTB 1QRNA 1A7OL 5K9OB 1CN4A 3QI9B 3HC4L 2KBGA 5EUOA 5B39G 5IVXF 4JRXA 4MXVE 3D2UB 1ZA6A 4N8VB 3RGHA 2G5BA 2YPLB 3MROA 4OFVA 3RVUD 5B8CA 1B6DA 3SOBL 3I75B 3MYJB 4NQCD 2R8SH 4KROD 4G6FB 4PJGF 3F7YB 5GZOD 4L8CB 5IB4A 3JBG7 4L4TA 5FECB 5B3NA 4TNWK 5JW4R 4YDKL 2R1WB 5I8OL 1ZT4A 3FB6B 5DJ2A 3EFDL 3GM0A 1W72A 3MLVH 2OR9L 2VNCA 4CBPA 2OI9C 3BP6B 2V5TA 2X2YA 3HCVB 1S7XA 1F42A 5D71H 4KI5D 4LHUA 4M6AA 4HBQA 5E2UH 3B9KB 3VH8G 1F6AB 4JFHD 1YYMH 2JELL 4RMUA 3MV01 1WWBX 4K7PH 3RL2B 4PY7A 2H2PC 1HH9B 2MJWA 5IVXE 3GIVB 1YJDH 4LL9A 5BZWA 3VFWB 1R0AH 4WO4D 3EDDA 5IHUL 5I71C 4IIQB 2VLLB 4R3SA 5ISZA 5HJ3B 2NY7L 4G42B 1NCDL 5CD5D 3TBVB 4P9HH 4WTZG 4TPRL 1RU9L 4PJGE 2WP3T 4ZOBA 4X7TB 4P2RD 3G6JE 1CLZH 2Z91B 4Z7UA 5DJDA 5I19H 3AMLA 3CMGA 4JFEB 4CNIA 1FZJB 5D5MF 3KYMA 3QHTC 4BKLA 4L8SB 5DRWA 5IOPA 5EU6E 4U7MA 4KPHH 4MNHB 2QEJA 4G9FD 2AEQH 4LHJB 3KDMA 5D1QA 1D5IH 3SDDA 1PGRB 1DQLH 3CC5B 2P44B 3FB8A 6FABH 3VG9C 2GY5A 1BREA 2AAVA 4XTRD 1HWHB 3TBYB 3C6SB 4OI9A 1RJCA 2IALA 1NGZA 4Z7VF 3KPOA 2APBA 4QHMA 3VFUA 1G9NC 1NBYB 4UV7H 3KS0J 4PGCA 4LSQH 3WUWA 1QR1B 2UYLA 2G9HB 3L6FB 4NBYB 1AGEA 3PGFL 5DEGB 1KIPA 4Y5XC 3QB7C 3ZHDA 1MQKL 3NAAL 1KTRL 1ZLSH 1Q9LB 1OLLA 4UIMA 1HHJA 3SCMB 3TVMD 4GRMA 1CXKA 3GRWA 1Y0LA 4XNZB 4Y2DA 3U7AA 3V7AG 1TZHB 4KZDL 3G9AB 3GB7B 4Y8DC 2HFEA 1IVLA 1UWGH 2IH3B 2PUQT 5D5ME 3HR5B 1CXHA 5EZLB 3GGWA 3OXSA 3PIQA 5GIRB 3Q0HA 3IDGA 3NACL 4HUXB 4EDXB 2AJZB 2HG5B 1ZLWH 3BP5B 4YO0A 1OD7A 4P23D 2DWEB 3PHQB 5D7KE 4D0DA 3WS6C 1IEBA 4XNUH 5LBSL 4PJDF 4ZS7H 2EE2A 3JV4A 2V17L 3CZJA 4YWGL 5T3XH 3NPZB 4ENEC 4D0CA 4TNVF 4CVXB 1YEDB 3BD4A 3IGAB 5D4QA 3FO1B 4YDIH 4U0RC 2IADB 2CUMA 2HT2C 1AO7A 3X14A 4DKAA 3DRQB 2YA1A 3L3HA 4HCRH 3KLDA 4M6ML 2XIDA 4KVNL 5DDHB 3GDBA 3MXWH 3LPFA 4GKSB 3OHXA 2AV7B 4F3FB 2MHAB 3BRDA 4LHUG 2NY6B 3QCTH 2NY4C 3ARWA 3MTRA 3EYFA 1IGML 5JHDA 3FOLA 2OCFD 1HQRB 1MHCB 4I8DA 4JREC 4K3GA 4R7NA 4KUCD 5MENA 5E4IA 3RY4A 4NFCA 4TULH 4F80A 3IFOB 3ZT7A 3FQNA 4XP6L 3MRCA 5AEAA 1HOCA 3MJ7A 1MHEB 3GSNH 2DQUL 1JWSB 1RVFL 2XKNB 4EUPH 3BXNB 3OR6A 3G6AB 3WN5C 4PJDE 2NTSP 1RIUL 2Z31A 4XAKD 5L2JB 1OAKL 5F7FA 1AQKL 3FCTA 1S9YA 1WSST 1H15A 1LDSA 1BJ1H 1FYTA 4N0CC 2BNRB 1ORQB 4P5KB 4ZFFB 4H88L 1ZVYA 1ZKAA 3EHBC 3I6KB 4QRPD 1IARB 4Z18A 3MV7E 4DQOL 4G80A 3GI9L 5AWNL 3TH3T 5C0EB 1KTLA 2V2WB 5HVHC 4JZJB 2X4QA 3KR3H 1U8IB 4JFDA 3HUJF 3AM8A 1CE6B 3HFML 3NA9L 3F12B 2VRAA 4OZIF 1NBQA 4PRIB 3AVEA 1NAMH 4PJCB 4HIXH 1E4WH 2C4FU 2FECI 3CIQA 4M61B 2IANA 3BSZL 3MLSL 4S1SH 4NQEE 2QQLH 1JPST 4IJ3C 1GGUA 5CKGA 3DURA 2NNAA 5BS0D 2O5ZH 1EBAA 2A6IA 4PJHF 4NQDD 3U7YH 5AYUL 1CG9B 3L7EA 4F7CB 4ODXB 3HI6L 3MCKB 1RZKC 4PRPA 4TVPE 5EORH 5BZDB 2FX8H 4ODVL 1U91A 4P5TB 4POYA 2YK1L 1JYNA 4UIKL 5EU3A 5D7IF 4IDJL 2WAHA 3GI8H 5L8LB 3LEVH 3L5WB 3AS0A 1A7PH 1FFPB 3HUJE 3TBTB 4OM1H 1Y18B 2GJ6A 2P8PB 2VDRL 1R3KA 1QO3B 1P7KB 4OZIE 2IAMC 1PLGL 1T7YA 5I76A 4IRJC 1INQB 4XXCA 2Q3AA 2XRAL 4QRSB 3K4DA 3TZVB 3EYQD 2CKBA 1NCUA 2E8YA 5F6HI 4DGIH 1S7WA 1VPOH 4R4BB 4DN3L 5I1CH 2AQ3A 5DHVA 4LPUA 5I8EA 2E9JA 2HT3C 3C60C 4PJHE 3B8YA 3WFBL 4JM2B 4P3DB 4Z95L 1T2JA 2P8MB 2F53D 1UM6H 1RULL 1EAPB 4UDTB 3FFCA 5SV3A 3RVXD 2FJHA 3LKOB 1EEZB 2IMNA 4HLZH 5DJ0A 3LH2H 1HH6A 3MLZL 4XPTH 3DO3A 3RWDA 1I1AB 4KRMB 4QY8B 3GM8A 2GT9B 4ZQKB 3BDXA 2NR6D 4ZAKD 3BPNB 3H9HA 7CGTA 1U8OA 2FLRT 4PS4H 3ULSA 3QZWG 2FSEB 3KHQA 2DI7A 5KS9A 3CSGA 3B2VL 3GHBH 3U7WL 1RK0A 3FO9B 4O4YH 4O02L 4F37F 5GS1A 4JHBA 4X6FB 5I1HL 1XGYL 1AXIB 4HS6B 1JL8A 5CEZE 1CDYA 1K6QH 3KYNA 2D03L 1KJ3H 4WHTA 2UUDH 2QLVB 2APWA 1QUNA 2FX9H 4QCIA 4MHHG 3V0VB 4FQJH 1TETH 2ZSWA 5TDOB 4HKZB 2M8XA 5FHAL 1XF2B 1A6VH 5C0AB 5GGSA 2X7LB 4JEGB 4MCZB 3QA3A 3SE4C 5MI0C 4QXUL 1UADC 4NZTH 5KAQG 4LRNL 1KOAA 3H9SB 4C56A 4HKJA 4OZ4B 4RQQB 2DQTH 1Q9OA 3VXPA 1B0GA 4QXTA 4LSPL 4K2UH 5CP3A 1QBLL 2I07B 3B9VA 4HWEH 2ADFL 1CIDA 2ZUXA 2X4PB 4L4VB 3VE0A 1M7IB 3CCHA 4BFIA 4AL8L 4KJQD 1S5IL 1XCTB 4MQSB 3SDXF 3QUYC 1ND0A 5EO0A 3WE6A 5HDBF 5HHNB 5KSVA 2R4SL 1G9ML 1X5IA 4O51A 3ARDB 3SKOB 4ISVA 3GBML 4I77H 4HHAB 4PB0L 5E6ID 3KGRA 1S7SB 3U36B 2ZOLB 5DMIL 4HIEA 5EBMA 3UJIH 4K23L 2BDNL 5GGUA 2MMXA 5HHOE 3FQWA 2ICWJ 5EU6D 4C59B 5C0DB 3PXJA 4X7EC 1JMXA 1CF8L 4OGXH 1N6QL 5ESVB 2ICEB 4FZEH 2BJMH 5HDQH 2FZ3B 2VUOA 4F2MA 2RJMA 3GSQB 1MJUH 1IGFL 3RIAK 3VWKD 1RURL 5ALBH 4F9PC 3VFOB 1OAYL 3EDFA 3KYKH 4OFDA 1PKQE 2J5LB 5EWIL 3C2AL 3C5ZB 3AREA 4IBLT 4MJIE 1N59A 3SDXE 1V7MH 3O4LB 3FOMA 3O6LH 5HDBE 5LAXA 5EOCH 3FO2A 1ZHBB 3TNMA 5E08L 5IMMB 3ARTA 4WW2F 4QYOB 4BA8A 3KYOA 1KIQB 4I9WE 5J1AB 1QG3A 4J4PA 3BDYL 1IKFL 2ED7A 3EYSH 4J3UA 3F62A 5C2BH 5D7KD 1YEJL 2X9XA 4NKDA 1T0NA 3ILQD 1C1EH 3EGSA 4R0LA 5F72S 4NQUA 4XPHL 4KTDH 4JPWH 3B6SA 2V7NB 3D0VA 3W0WE 4OTXH 4X80L 3SQBA 4LK4A 3GSNB 4LLUA 3VRJB 1A5FL 3NCYS 2BVOA 4OD2B 4EUPB 1JPFB 1AD0A 1U95A 4RISL 1IGJA 2D4DA 4YX2L 4G43B 3PWUB 3BGMA 5I15H 1KLGB 4HH9B 3MLWH 4KJPD 5HYSG 1NBZA 1T04B 1J1PH 5TPWL 1K8IA 4NSKB 4NNXB 3B3IA 1BD2B 3TN0A 1QNZH 2VERN 4BJLA 1MELA 1EHXA 4P5MA 1UYWH 5CINL 4L1HA 2A9ML 1P84K 4LOUC 4GSDL 2NLJA 3UJTL 4BSJA 4UINL 4LSVL 4QXGH 3DO7A 1FSKB 1WUNT 4PGDA 3V8OA 3V6BR 4HKXB 3QHZL 3VJ6B 4MJ5B 1INEL 3QDGB 4O5LH 1B9ZA 5GGVY 5C0BE 4LKCA 3KG5A 3DMMB 4G6AC 1A1MA 4NC0B 1RZJH 2VDKH 2PTTB 2XTJE 1T6VN 3D6GA 3BN9C 1S7QB 5EFIA 5KVFH 4QHKI 1YNKL 4D9QE 2JJSC 5A3ID 5JMOC 4X4ZA 3JV6B 2X09A 5ICYB 4TNWF 1YN6B 4QTHB 1TTFA 1NAMB 5D72H 4PJAA 4RDQG 1CBVH 3N1GC 3RUGA 4NQCA 3ZKND 2YD9A 3RVTD 4P2QA 3U9PL 4I18A 3TBSA 3MV7D 2VLKA 4NWUH 4ODSL 3UJJH 3RX8A 5DURD 3NN8B 4Y4HC 3OKDB 1KUMA 3GMPA 3O3BB 1HXYB 5IJKA 4AIZA 3BQUD 3UZVB 4KROB 1UB5B 5TE7L 2AI0L 4JVPA 4BFGA 2XPGA 4N90E 1RIHL 3ARBA 3QUXC 4YBLB 5DD0H 4NQED 4YBQC 3RGVB 1I8IA 2XZCL 1MCQA 2YRLA 4X5WB 3IDMB 3P0VL 4U1GB 3WNPA 3ARUA 4RBPK 4FZ8H 1ODAA 2YBRA 4TVPD 5EDXA 4N9OB 2X5PA 3K81A 2ZPKL 4WO4B 3GNML 3HE7A 4YXKL 2ENYA 1GH7A 1ZVHA 1MIMH 1VEOA 2J6EL 4N1EA 4P3CH 3MRPA 4X4ME 3SJVE 3ZHLA 4W4OA 5GS0L 5I8CB 3BKML 1ETZA 3BWAB 3BZDA 2NCMA 3HNVH 1E4XL 1CFNA 5J1SC 4P2RB 3OTTA 5DD3H 1Q0YL 3VXTA 4XPGH 5F7DB 2CO6B 1KB5A 1IMHC 1B88A 4KMQA 4G9FB 4MD0B 4AJ0A 1G7HA 1UJ3C 3SGDI 1DEDA 5J56B 3V6ZB 2Y23A 3DUUA 3RWEA 4ZPTA 3REWB 2K1MA 5EG6C 5IP4A 3GIZL 2HLFD 3I2CH 2D0FA 5ELIA 5K9QG 2ARJB 1FIGL 3WIHH 4LNRB 3VFVA 1EFXA 2WLZA 1MEXL 4TRPH 1BQHA 1KBGH 4C54A 4XMPL 3IFNL 3WNOA 3O8XD 1F2XK 1U8PA 2DBLL 3D85D 4AEIL 3RWHB 5J3HD 3PGCB 4PTUA 3VD5A 2MKWA 4PG9B 4E5XB 4FMKA 4ZFOL 3GSOB 5EZJB 4UU9B 1LGVA 4M5YH 2DD8L 1MVUA 3QFJE 4PGZA 1XF3B 2J8UB 2P5WB 4P23B 2VLJE 4QRRB 4WGWB 5CJOL 5CEZD 1A7NH 5I1GL 2Y5TB 4X99A 1IKNA 4XNYH 4X6CB 2F54E 4K71C 4RFOH 1T03L 4CADA 1IC1A 5DEFA 4HXAH 4J3VA 3TA3C 2APVA 3ZKXB 4DOHE 4X8JA 4YDVA 4KDVA 4XPFH 1OTUC 4UAOB 3DJ9A 1NUFA 3LS5L 3TIEA 1FO0H 3QR2A 5DRXA 1HINL 1V7NH 1IQDA 4MA1C 1NMCC 5DJYB 5HPMA 4GMTH 5D7SH 1DN2A 4HGWA 5L2KA 1KEGH 4KK9C 4EN3C 1YEGL 2CUIA 2AK4E 1J5OH 4OLZL 1W0WA 2YUWA 5E03A 3SKNA 2DI8A 1YNTB 1F3RB 1SJEB 5DJZA 4QNPF 5CLTA 1U58A 4PD4J 4H1LA 3O2VL 3EYUH 1S9WA 4YGVB 3ZMRA 4MS8C 1G1CA 1GGBH 2QQKL 1I1YB 1RMFL 3S4SA 5FA3A 4UB0H 2FWOB 3MRIA 4WGVB 2CDFA 3ARPA 3GO1L 4D3CL 2I27N 4POZC 4Y5VB 4M6NL 4WY7L 4N9GA 2OP4L 1XGQB 3QG7H 5F6IB 1L7TH 5GSRA 1CFSB 3E8UH 3FFDB 3PP4L 3UTSE 4L3CA 2J3SA 4M03A 2JIXB 5HHOD 1SYSA 1T1XA 5HGHB 1ZLUK 4HPYL 1JP5A 3ZDYF 4QRPB 2WWKT 3VXOA 4AG4H 3QDJA 4AQ1B 5CEYB 1U8HB 2FJFA 4APQC 4EQ3A 1A2YB 5HGDA 3VCLA 2BRRL 2VE6B 2EEDA 5HI3C 4LLDA 3L1OL 4QNPE 5KVMC 1M7DB 4OGAD 3SE9L 3O6FB 4RGOL 1IQWL 1OB1A 1YEEL 4MJID 2UVFA 1EFQA 5DK2A 1JYXA 2JJUA 4KKAD 2A77L 3LRSB 3O3AB 2O5YL 4BYHA 3TYGH 2XA8L 1MCSA 4HWNA 1FZMA 3BZ4B 5BS0B 3OMZA 4NQDB 4G6ML 4FMFA 5IIEA 2ARJQ 1G7IB 3C6LD 4L3EA 4I9WD 4Y5XA 3ZDYE 4MA8L 3ARFC 2BC4B 1IL1B 1SY6H 3MLXL 3VFPA 1FN4B 3W9DB 3QWRA 1JIBA 5FKPA 2W9DH 2DQIH 2WBJB 5IG7A 2FGWH 2CK0H 1TJIH 1OSPL 3NFPB 3DI2B 4NJ9H 5F9OL 1CD1B 4NKMA 4BH7A 3ZT5A 1UGNA 3WXWL 2C1OB 4RNRB 3W0WD 4IRZL 5C8JA 1A4KA 4N0FA 3S88H 2A0LD 1R3JA 4NWTH 4YBHA 4TVPH 2R2HB 5CSGA 1EHLH 1LMKA 3BH8B 4X4YB 1N8ZB 35C8L 1NGQL 3B2UD 3E2HC 4HJGB 1NC2A 4PGJA 3OXRA 5F3BA 3NH7L 3VW3H 5E00A 2F53B 3B4NA 1FE8L 5LGKA 4HLJA 5CHNA 4OSUL 4E0RA 3O2DH 2WANA 4JFXB 1T66D 3L95A 4FRWA 5C0BD 3PV7A 1HEZB 5E99H 1RI8A 4HS8H 3MLYL 4FQ1L 2EXWC 2AV1A 2XTJD 4LIQE 1Q9KB 2VZTA 4LEXL 3R06B 4F58H 3G5YB 4D9QD 1QLFA 2MFNA 3ROLA 4U6HB 1EO5A 1YECL 4WFGE 1MRFH 1L6XA 3KHOA 4XWGH 2Q8BH 4ZAKB 2PXYD 1WBXB 4CMHB 3WKMH 3I3BA 2AJYH 5BRZE 4P99A 1AHWB 4B7IA 4OFIA 4OM0L 1A9BB 4OCYL 5JXED 4ORGA 1ZEAH 1SEQH 4OGZA 3ULUF 1KIRA 2OTUB 5KJRL 3WN5A 3O9WC 3MJ9H 1EJOH 2LQRA 3LQAC 3RHWK 1QKZH 2AJSL 1AC0A 25C8H 2OJEA 3MNZA 4DK3A 2EDBA 4WVRA 3CLFH 1A6ZA 2H1PL 3P9LA 3IDIB 2DDQH 5GS2D 1UACL 2YUXA 4M5ZL 1A3LL 1QQDA 2NY3B 4OLVL 1JF1A 3DVGB 5E5MB 4XP1H 5KANI 1DQQB 4N90D 4J2XA 3BMVA 4OF8A 1MF2H 2W9LA 3TFKD 4WI6A 3BGFB 4M7LL 4OLEA 4KKNA 2JB5H 2P7TB 2WUCL 1Q1JL 1WFOA 4LU5H 1N5YL 4KK5C 4ZTOH 4FQQB 2G2RB 4ZUVA 1OM3H 2UWEA 1RAMA 4C4KT 3VRIA 2A74A 2F5AL 3TJEL 5I1IH 4MJ4A 1FC2D 4OCWH 4XHJD 4ZOCA 3ULUE 1FL5A 5IVXB 3G6JA 4NHUB 4X7DC 5HHMB 1KULA 4Z7OF 1OL0A 5C09E 2VXVH 1FNSH 5CJ5A 5F71A 3RIAF 3K74B 3KJ4C 3S34H 4W68A 4UBDD 2IBZX 3SJVD 3MA7A 4PJGB 3CFDA 3EDJA 3EW3B 3P2TA 1BOGB 2VZOA 3S6CA 3I6GB 4RZCB 3F7VB 1KXQE 1WICA 2VH5H 4S2SB 1AR1C 2FEDD 5F3HA 4ERSL 3V4VL 2R23A 3BT2H 2R8SL 1EO8L 1M71B 5EU6B 5TGBA 4GG8B 4PLOB 3O6ML 1UB6B 3MOQA 2VXQH 3JWOC 4N0UE 3IKCB 3KPSA 2BHZA 4LLWA 4EZMA 2IAMA 1MLCB 3HB3C 3GSVA 3MLVL 2OLDA 4IRJA 4PJ9C 3ZYIA 3VWKB 1LNUA 5DYOB 2MOVA 1S5HA 4RMVA 4I5BB 4KZEL 2WBWB 1EO7A 5E6ZA 3KWWA 4U1HA 3NCJH 2V9RA 1X4ZA 5FHBH 4K7PL 5SX4H 4OZGF 1ZGLP 4J6RH 4XNQB 1WV7T 4YE4H 3C60A 1YJDL 1R0AL 4LVHB 4ZYKB 3CXHJ 1LD9B 2ZSVA 5FYKE 1RFDH 4QRTB 4YXLL 4G7VH 2NY2C 3D9AH 3CSYB 5J0BA 1KTDA 1T22B 1KLUB 2P24A 4MAUH 5D5MB 3HI1B 3VA2C 2IH1A 5E2WH 1YEKH 3FO0H 2R4RH 3RWGB 2A6JB 1FO0B 4QOKA 5JLZB 3L3OA 4N5EC 3PJSB 2IFFH 4Y88A 3ZKSD 2EDFA 3QFJD 1CLZL 2ORBH 2HAZA 5D8JL 2OTWB 2ADJB 1N6VA 2VLJD 1ES0A 2DQHL 2PTUA 4JDVB 3GMNB 3QQ4B 1P2CA 2GTWB 1K5NB 2F54D 2WUBL 3IDYC 1MJ7H 3X17A 4Z7VB 5IW6B 5IB5B 2FD6H 1RUAH 1S78D 2B5IC 2XACC 2AGJH 4IM8A 1NBVH 3LZFL 2XNAA 4JG1H 5DTFB 4OZGE 4RA0C 4RGNB 2QL1A 3OB8A 1NCAH 2V5MA 2BVPB 1Q38A 1HILA 3GJFK 1ACYL 4GAGL 4UV7L 1OGAA 4LSQL 5JO5A 3PL6C 1I3RA 2BNUB 4DEPC 5C0FA 2IQ9L 3GJEA 1WT5C 3QUZC 2DAVA 3AGVA 2HH0H 2AK4D 4JPIA 1L7IH 1ZLSL 4F7TB 3BP7A 3HG1E 3S5LB 2HVJA 4V1DE 5C9JA 2NPLX 1K4DB 2DWDA 5IVOA 3MA9H 3SE4A 2PCPA 1UWGL 3QDME 5DQJB 3SDAC 3QO0B 4LLMA 3OPZH 1P1ZB 4WENB 4LMQE 4E42A 3CAFA 1PY4A 2C3WA 3L9RB 1X5JA 3R0NA 4UI2A 3O3EA 1BZ9B 2OR8A 2MPAH 3QEHA 2XWTB 1WK0A 3T04D 1DCLA 3PXHA 3MFFA 3UTSD 1PQZA 3S35L 5DJXA 5BV7H 5IROA 4OAWA 4ZPVA 2AS5M 2VQTA 4EVNA 5E2VL 5T3XL 3MV7B 1A7RH 3RPIA 1NSNL 3QUYA 4YDIL 1MCJA 3U0PA 2GFBB 2NY5H 3MJ8A 4LMQI 4M9OA 5DURB 3U4BL 2J2ZA 1QRNB 5GGRA 1H3XA 4FXGA 2WBKA 3LEYL 1NCCL 4S1RL 3MXWL 4L3AA 3BQUB 3WS3B 2BSRA 2NY1B 2DKMA 2W91A 1EK3A 4U49A 4R97B 3RY6C 4LSDA 4NQEB 3WNMA 1XIWC 5EA0L 4ONHB 3VXNA 1J8KA 2JLLA 1F90H 3BEVB 4RMWA 4F9PA 3S97C 3Q1SL 4M93B 2ICCA 1MVFA 4ZD3H 3SKMB 2F74B 1FCGA 3CMOH 3KAAA 5DRNA 4NDMB 3WLWD 5GS2H 3QPXH 2EH7L 2R69H 1MAML 4M1CC 2AEWA 3IDNA 1P7QD 4XHQA 3HRZB 4JY4A 4RGMC 3DPBA 3HUJB 1EGJA 2YN3A 3MBED 5K33A 4OZIB 3BPOB 1WC7B 3W5MA 4MCYA 5KW9H 1I9JL 5I1AA 4F7EB 4H8WC 1FV1A 4ELMF 3BPCB 4XVSH 3RWFB 3CU7A 1HQ4A 2LU7A 3TM6A 43C9B 2B4CC 4PJHB 4HIXL 2I9LA 5DJDB 4NM4L 4AH2B 3HNSH 3SGDH 5DC4B 5DT1L 1IAOB 2B1AL 3FN0L 1AXTL 2CIKB 5INCB 5BOPA 3INUL 1IAMA 2VN7A 3FONA 3L7FB 5FO8A 5D7IB 5CBEB 4WI7A 5KSBA 4YHIA 3QXVA 2PN5A 3JTSB 3VGFA 5EORL 5FDWA 3MO1A 2FX8L 3VMOA 4Q6IC 3V5HB 1VACA 5DK0B 4P4RA 3DWTA 5DJ6B 2EDXA 1U41A 4WFGD 1FGNH 3GI8L 3O8XB 2XFXB 1S7TB 3D85B 5BRZD 3LEVL 4ELME 1A7PL 4XCEB 3MBXL 3RWCA 4OM1L 4UV4H 1D5XB 1IM9D 3VWJB 3P40A 5KSUA 2CDEB 1CICD 2ZUVA 4G8GA 2JJSA 1A3RH 2HFEB 4YR6A 1RPQA 4DGIL 1VPOL 1FLRH 1MNUH 5DD5L 3R1GH 1RZIB 4ZS6D 5IEHB 3ARGD 5F89A 5F1NB 3I02A 1S7RB 2D7MA 2CH8A 3BKJL 1UM6L 2K3TA 1EXUA 3GSXB 3A6BH 3H2WA 4JAMB 4Y4HA 1JRHI 1IGIL 5JZ7D 3RWIB 1V3JA 4ZOAA 4EQ2A 3MRLB 3QIWD 1YNLH 3DX9B 3UROR 5I73B 2VAAA 3V52L 3HC0A 3IF1B 3ULUD 3N1FC 4X5XA 1LO3H 3QUXA 2XN9A 1KF9B 1CLYL 4JQXC 5C09D 4MJ2A 4PS4L 2MKLC 4XC3H 5HHOA 1A9EB 5CBAB 3KLHD 1AE6H 4YHYC 5C0JA 3RTQD 4O4YL 3M45A 3IFLH 4HWBA 3P4OB 4G8IA 1FGVH 3RZWA 1YA5A 3KNBA 3HC3H 1K6QL 3MJ7B 1ZTXL 3WDIA 1KJ3L 1U8KB 5FO9A 43CAB 1KPRB 4PRAB 3VXRA 5LCVH 2IGFL 4FQJL 5TF1L 3BVNB 1A14L 1U93B 4LGPB 1MFCL 2H32H 4YDLB 1A6VL 2YD1A 3DGGA 5FDYA 5J9PB 1I8KB 2CQVA 3QQ9C 4NZTL 5FYKU 1PKQB 4K8RD 3RKDC 3P4LA 4MJIB 2DQTL 1LO4L 3SDXB 1ADQL 1RZ8A 4P4KC 1ZHLB 4IRSA 4HWEL 1UJ3A 3QO1A 4MNGA 2JCCA 5FYKD 1MWAA 5F88B 1PYWB 4PBXA 5EUKA 3N85H 1GZPB 4PJXF 1TQBB 4HXBH 4LAQL 2E7LC 2K7PA 5BVJB 3C6LB 1QVOA 3B83A 4M48H 3IRZA 3CXHK 4NQTA 4LQFH 4HUVB 1XH3A 2X4TB 1A47A 3UBXA 3WIIL 1F11A 3WLBA 3LEXA 32C2B 2P46B 1P4IH 2ICWI 4HQQH 1TNMA 4KXZH 3QNXB 4FNLH 3UJIL 3MODL 4ZO8A 1NCWH 1CU4H 2D0HA 2EC9U 3OR7A 4FQHB 1VSCA 4OGXL 2XQYK 2PO6D 4FZEL 2BJML 5HDQL 4OLUH 2VSDA 3Q6FA 3CFCH 1MJUL 4GBXC 4ODWB 1S3KH 3B5HA 1RSFA 2M26A 1YY9D 2GY7B 1AQDB 5D2LF 5J06A 3KYKL 4DUVA 1NMAL 1UA6H 4PJXE 4MB3A 4PJBF 5I76B 5I18H 1V7ML 5CSZA 3TA3A 3JWDH 4D0BA 3TPKA 5BV7B 3O6LL 3IU3A 5EOQH 3HG1D 1N2RB 5EOCL 4V1DD 5C3TA 2Z35A 2PXYA 2CGRH 1NDMA 1Z6JT 3RHWF 1G7QB 2ADIB 3QDMD 1OCWH 5DVLA 2BOBA 1HHIA 2EKSA 3UTQB 2IBGA 3V6FA 1VDGA 4EN3A 5CCKH 3QWQB 2XG5A 1SEBB 5A16A 3LKPB 3CFBA 2XWJA 5C2BL 4Q9CA 3WFZA 3H3KA 5JDSA 1C1EL 3MUZ1 1P4BL 2RFXA 2V5SA 2GEEA 3EYVB 5D2LE 1BJ8A 3G5VA 4Y4FC 4O2EB 1A7QH 4G6KL 5GRJH 2KUTA 4PJBE 4WI8A 1I7ZA 3H9HB 3MUHL 3SGJC 3ROOB 2DJSA 5IBUG 3K0WA 3AS3A 1KCRH 3C9NB 3UZQA 4QF1A 3RAJL 3OAUH 1RJYA 5BO1L 1CT8A 1NFIB 4WWKC 4LIQH 4TUOA 3MLWL 3MCG1 1VFBB 3RVWC 1J1PL 1MUJB 3IJSB 1QNZL 2FIKB 2F5BH 5SWSE 1DR9A 1S9XA 5IK3A 4KAQL 4Z7WF 3OJDA 1S8DA 4JKKA 5DFTA 4APQA 4UQ3B 3EO1B 1X5LA 5EU5B 3DECA 1A6UL 2IBZY 2XT1B 3V5DB 1EHNA 1BPVA 4O5LL 3FHAA 1N64H 4EBQL 5IT2H 3T4YB 1U3HB 1SBSH 2VDKL 1BJ1J 1UZ8A 4A6YH 5I1EH 5JR1L 1CD8A 2EZ0C 4PBWD 5KVFL 3QA3B 1MRDH 2NW2B 3AU1A 5FOBB 2NYYC 4JHZA 1BBDH 1OWWA 3C5SB 1T1ZA 2HWZH 2VAJA 5JW5A 2DM7A 4HF5H 3SJVB 4E41B 1QP1A 3VE0B 3UJJL 4NJAH 2D4FA 1RK1A 3E6FB 3PWNB 4HWZA 1HYSD 3HAEA 2OQJA 4X83A 3ARFA 1E0OB 4Z7WE 4PGEB 5SWQA 2EIDA 3M17A 4YK4B 2B8OT 3ULUH 4LCIH 3TJHD 2BCKA 4XWOD 2CRZA 1DBJH 2W59A 4GQ9H 1A1NA 1NGPH 4ISVB 3OKOB 1OVZA 2ED9A 2CUHA 4ETQB 2G75B 1AIFA 1IILE 1I3VA 2ID5A 4MAYC 3Q3GA 4Y4KD 5CBAA 4OB5L 1U8MA 4YHNA 4K3EL 1FL3A 1QSEE 3H7BB 4XXDB 4MDJB 1FORL 2AEIT 3S98A 3H8NA 2IPTH 5ICZA 3HLAA 1VFUA 3O11A 2NY0C 4PP1D 3FZUD 3QJHB 5C92A 1JNJA 1A6AA 4OFYA 3QUMH 4WUUE 4F15C 1MCWW 4RWHA 5EZIL 4XNMA 4K7FB 5EBWA 5DUBA 5I6XC 3B9AA 4RMTA 3CNKA 3IU4H 1RQ5A 4YAQA 5IMOA 4AEEA 3X3FH 4FFVC 4JQVC 5E8OA 3QFJB 4K8RH 3RA7H 3T0EE 1F5WA 2VLJB 3A6CH 2JB6A 5FV2A 1LO5B 1DBAL 2JF1A 5E9DE 1PKOA 2A1WL 5FYKH 3G5ZA 2DLEA 4DOHB 3FQUB 2V7HB 3TO4C 3HZVB 4U3CA 1T0NB 3O9WA 3KS0H 1RJZB 3F7RA 1SMAA 5J89A 1EEYB 2X9YA 4ZO9A 1TVDA 3F5WA 2AQ2A 4DKEH 1I7TB 4KKLD 4W81A 3B6SB 5E8PA 2DQFB 2AK4B 4JPKH 1B0WA 3KJ6H 4CDHA 1AD0B 3W11C 4NC1C 4GW5B 3PWJB 4KDWA 1KENH 2CLVB 1KBGL 1YMME 1J1XH 4EIZC 2GSIA 4HAFA 4OQ1A 1VB9A 3MCLH 3QRFM 4XPBL 4U6YA 4LGSB 4LBEA 1OTTC 2H32B 4S1DC 1LK2A 3T3MF 1FZKA 3EOTH 1LWRA 4JN1H 4M5YL 3DO7B 4PFEA 1C7SA 1SQ2N 3FAWA 4M8QB 5C7XL 4DGVL 3HAEG 3QQNA 3IKKA 2A9NH 4XNYL 4F7MB 3BKCH 4UDUA 1A1OA 1MPAL 4RFOL 3TT3L 2OM5A 5EC2B 1NGYA 4HXAL 1YEFH 2QSQA 3RNKA 4ZFZA 3ZO0A 3VI4F 4KKBD 4XPFL 2EYSA 4NN7B 4P9ML 2P8LA 1J11A 1FNGA 1V7NL 3FKUS 3IFPB 4CMMB 1PG7W 3CVHA 1N3NB 1CFBA 1CFQA 4UOW0 3DETC 1RZFH 1FNFA 1J5OL 4UNTA 5BMFL 3T3ME 3WUZA 2EDOA 4HG4J 3MR9A 3IETB 2XQBL 2W9EH 4PJ9A 3DIFB 2R15A 5JHLH 1NGWA 5DHYB 4UB0L 1K4CA 4Y16B 2C1PA 1BAFH 1CLCA 1L7TL 3E8UL 4M4RA 2VABA 4PLKC 1P7QB 1N7MH 4ZUUA 4GJTB 4J8RA 3QYCA 3MBEB 2WM0A 2X05A 4FTVA 3FB7B 4WW1B 5FF6B 4XRCA 2E6QA 2CLZA 4M1GL 5DVKA 4K94L 2HJFB 5IBTH 3WSQH 4CW1A 3VGBA 3ULVL 5EOCJ 1Y6MR 2YD5A 4NO3A 5CP7A 1UXSA 4RBPH 5FUCE 3G5XA 5EBLB 1G7LB 1UVQB 4CJ1A 3QXTA 1EBPA 4BK4A 5CWSA 3TPUA 4QTIH 5CJ8A 3TYGL 3AB0C 4PYGA 1Z3GL 3AAZA 3HKFA 4KGLA 5BRZA 1V3LA 4WEMB 5DWUH 3C8KB 1P7HL 3EYOB 4IMKC 5HI4C