2QHRH

Crystal structure of the 13f6-1-2 fab fragment bound to its ebola virus glycoprotein peptide epitope.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
b'EVQVVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISRGGGYTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCSRHIYYGSSHYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 13F6-1-2 Fab fragment heavy chain
molecule tags Immune system/viral protein
publication title Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
pubmed doi rcsb
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2007-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrH01
1LWRA 4OIAA 2QTEA 3BAEH 1NAMB 3INUH 3GKWH 3NCJH 3RRQA 2LVCA 1A8JH 1CK0L 3QRGH 1U42A 3PWPB 4WIQA 3RZCC 4U4BA 2OL3H 3BPCB 3FQUA 3VI3E 1S9KC 3O6FA 2IBBA 5EPMB 4ZAKB 5D7JA 5KZCB 3PWNB 4FA8A 1R5VB 1DUZA 4HULB 2CQVA 3MBXH 4JY6A 2AJZB 5I17B 5I1EL 4LCWE 2I9LB 4F7PA 1WJ3A 5LG1A 1FL3B 4ZS7L 4K94C 4G9FE 5DFTA 3ZKNC 5DEFB 4MXVF 3QUMA 4WNQA 4RAUA 3OX8B 3GSNB 3L3HB 3PXJA 1G84A 1BFOB 2FYYA 2NXZB 1KCLA 4NP4L 2HFFA 3BKYH 3HG1B 2IMMA 1BQSA 3W0WA 3FCTB 1BQLH 4M48L 2VKWA 3GMNA 2A77H 4NDMB 3L95B 4I0PD 3GGWA 5ITFA 1D5MA 3QDAA 4FQCH 1X3DA 4N8PA 1BJMA 4HBQA 1P7QD 4HPYL 4PBXA 3VXRE 4D0BB 5IHUH 1RY7B 1QRKA 2VERN 5EO9B 1OGAA 4RGOH 4IDJL 1LD9B 3TO4B 1DZBA 1MCFA 3DUHA 3RWJA 3GIZH 4XAWH 2DQHH 1F3DJ 1QSFD 1T4KB 2FR4A 2HFEA 4NBXB 3P40A 1MCWW 4RMTA 2BSRA 3T0BA 1E28A 43CAB 1PEZA 1AKJD 4RFEB 3EYFA 4HGWB 3PNWB 4KROC 5I15H 3UMTA 5C0GA 4YXHH 3O8XD 4LSDA 1UXWA 5DHYB 5KS9F 1TMCB 1KC5L 1QBLH 2EZ0C 3BISA 1U0QA 4M6NH 3NIDF 4QEGA 1GGUA 4QWWC 1U36A 3W82A 1JNNH 2IEPA 1FLRH 3B3IA 2AJUL 4NM8L 4OGZA 1SYSA 3STLA 5HGBB 5H37H 4I48B 5HI5C 5IW3A 2HH0L 1SM3L 5TF1L 3IJYA 1FNSH 1OP3K 1A4KA 1A7NH 2H26A 5I16B 1LEGB 1N59B 35C8L 3DECA 5A2IH 1UB6A 3ISWA 3U83A 1OP5H 4M1DH 4U1JB 2QADD 4I1NB 5HVWA 1A7RL 5J6GB 4HS3A 1WBYA 5B38B 3HRZB 4YWGH 4OLVL 3MGTA 1J86A 3FN9A 3UC0H 3NH7L 1F8TH 3X14B 3FOMB 3OXSA 1T6WA 3EW3B 4PGEB 4D0DB 1G9MC 3ZMRA 3L3OA 3BVNA 2HMIC 4RRPA 1YY8B 4F9LA 1NGZA 2O26U 1ZLUK 2XKSA 1E28B 1NUNB 1U2CA 4OZIE 3X11A 1RURH 1FFPA 5CEXA 1HIML 3VA2C 3D85A 1RZ8B 4DKFH 3PG2A 2R0LL 3BPNB 4I0KA 4LSRL 3T4AA 3WV0A 3L3IA 3KNBB 1BBJA 1YMMB 4MQ7B 5C07D 3RWGA 5A1AA 1NC4D 3ULUF 3NAAH 3UTQB 1V7MH 4TULH 2DS4A 4JFFE 4AIXA 2N7AA 4HIEB 1IAIM 4YO0B 4BFEA 5D7SL 5M95B 3RGHA 4NDMA 3T3MF 3WIHA 1M6OB 1MELA 4FXKA 5I8EB 5J11B 3LOWA 3NTCL 3VWJA 4JCLA 3LKNA 5GISH 1YUHB 3SOBL 4ZFFB 4XP1H 4Y16B 5ICYA 4Z7WE 4KKBC 3MRCB 5IOPA 5LGHL 4B7IA 1K4DA 2ZG1A 5DRZA 1QP1A 1N64H 1UACL 2BVTA 2DLFH 1W72L 4XC1H 3BZEA 5I16A 2EDKA 5IWLA 4CN1A 4FQXD 5DZLA 3LKPA 4KGJA 5HDQL 5DUPH 3DSFH 5J0BA 3CNKA 1X5FA 1U8HB 2A74B 2PW1B 3P30H 2OS7A 5CP3H 1MHCA 3ARBB 1I1FB 4HT1H 3G08A 3NIDE 1BVKB 5DQ9A 2NTSP 4I18C 1KTLB 3PWPA 4JKLA 1A1MA 4NN6B 4O4YL 2AKRA 2DQFB 2DTMH 3VGEA 2BERA 3OJ2C 2VXUL 4FN0A 3LIZL 3BPNC 4MA7L 3RKPA 1AKJB 1U95B 3D3VE 4TVPH 1TIUA 3U0PB 2R2HA 1CR9L 2XNAA 1B0GB 1WQVT 2ID5A 2LVEA 4M8QA 4BK4A 2C3VB 4ZNEA 3MV8B 4WJ5B 1Q1JL 4DTGH 5EO0A 4CMHB 1CR9H 3BO8B 5DJXB 3SE8L 1UZ8B 5IUSA 4NQDE 1WBXA 2BSSB 2J8UF 1IGJB 4JRYD 4P4KA 2B0SH 4XNUL 4QHNA 3KPTA 4HLZG 4FQQB 2QQKH 1UT9A 1HI6A 4OCXH 4YHYB 4KMQA 5F1NA 1WLHA 3PV7A 2VZOA 3HKFA 3JVGC 3U7YH 4ZSOB 5IG7B 3GSVA 3P30L 1LDPL 1AGCA 1AP2A 1J0HA 2GAZB 3MBXL 4YEEA 4PJGA 5C08E 1MJ8L 4HFUH 5K9QI 4XCEB 1BLNB 1X5IA 2EYRA 5E6IB 3EJYC 1HKLH 3VWKC 5DQDL 3QG6B 5IT2L 2VH5H 5DEFA 2VDRL 3KPRA 3NPSC 4RGNE 4TSAH 4UMGA 4P49A 3BWUC 1G7LA 1T1XB 2A1WL 4G42A 5IFJA 1MEXL 4YDLC 5J6HB 1RUAL 4LLMA 2Q8BH 3V4UL 2BNQB 3NFPA 4O2CB 3RI5K 1SM3H 4H1LA 2NY1B 4LNVA 1MHHB 5EZIH 3IDYB 5TDOA 3CK0L 1PG7L 3RBGA 4GBXD 5DR5H 2NY1D 5FXCH 1K6QH 3A0OA 3QPQC 3SDCB 1ZHLA 3SDAB 5F44A 4FQLL 1WSST 3O6FD 1S7WB 5BMFL 1HXYB 3OSKA 1OWRM 1NGPL 2CLRA 2M8XA 4LQ1A 1U2HA 2A0LD 1VFUA 5LXGH 4Y4HC 3GIZL 1BM3H 3RX5A 1W0VA 5CP3A 2DMKA 5E2TL 5L2KE 5C08A 1JWMB 1ZMYA 3LHPL 4HS8L 3D0LB 5BV7L 4L29A 2QSTA 4LPVA 3BZDA 2HT2D 4R26L 2EEAA 2JLLA 1QLRA 2BVQA 4HZAA 5BOPA 2YD6A 1TFHA 1KIQB 1KCKA 2UUDH 3B2VH 2YRPA 1R3IH 2HKHH 4BK5A 1KLUB 1UH4A 5EN2A 4DZ8A 5DDHA 1INEH 2D4DA 2P24B 4PV8A 3E2HC 1J1XH 1MJ7H 2I9TB 3NGBB 1MRCH 2Y4SA 1D6EB 2XWTA 2V7HA 2AXHA 3QCTH 1QFHA 4XPTH 4P9HL 3AAZA 4F15B 1QKZL 4DCQA 3HUJE 5GSVA 3OZ9H 3UDWA 2IG2L 4N0UB 2XZQL 1BZQK 4K23H 2ATPA 2B8OT 4OFDA 5GRUH 1J8HD 3KPMB 5FDYA 1D5IH 3A67H 3M17A 2HWZH 2BP3A 1OT2A 4ONGL 5HHME 1JF5A 5TDPB 2C1PB 1MWAH 4PRBA 4M6ML 1U3HB 1AFVL 2FWOB 4UIMA 1X5ZA 3L5JA 1RHHA 3HG1E 5KG9A 1OVZA 5EOCL 4I2XB 1F2QA 3QFDB 2VC2L 2WLZA 4PREA 1G6RB 3RDTB 1IGTA 2UWEA 4MS8C 3HZMA 1XIWC 1ZSDB 5BO1H 4HLJA 4LVNC 2Y23A 5C6TH 1N6QH 1CICD 1X5XA 3F65A 1DDHA 2CIKA 3FOLB 1BOGA 1NLBH 3I84A 4NOBA 2EICA 5C1MB 3DXAD 3T3PF 2GAZA 4MLIA 2I25N 2VWEE 1YJDC 3DROB 4PJEF 1U8QB 3LD8B 1HN1A 4GFTB 4UUJA 5F7EL 3RNQB 3VD3A 5FYKL 5EC1A 3Q3GB 5CEYA 4M48H 5C2BH 2ZUVA 5IB1B 3H9SB 2AEPL 5I0DA 3C9NA 1U3ZA 1JE6A 3TO2B 2V5TA 4RSVA 1G7QB 3DHMA 2AEPH 4WHYG 1OGTA 3O41B 3NBNA 5ENWB 3V5HA 3C6LC 3RIFK 3TC9A 5ETUA 5TE6H 4JDTL 3RDTA 4OLUH 1C5CH 3B2UD 3KPOA 3QNYA 1UG9A 1D5ZA 3AVEA 1TVDA 1AKJA 3SGDH 1QRNA 4Z7QE 1N5YH 1W72B 2WAHA 2E6PA 3L3DA 4NQEB 3RDTC 3UJJL 2X2YA 2P5WE 1AGDB 1IL1A 2XWBA 4WI6A 3NZHH 2VL4A 2A74A 2DDQL 2IH3B 3IAGC 1CD8A 1XF3A 3LPWA 3LB6D 1NFKA 2KL6A 4FNLH 3D25A 2RHEA 4RGNC 3VFUB 3DARA 1YEJL 5KAQF 1IE5A 5GRJL 3L6FB 5BW7A 3PGFL 3ZLQC 4PJ9C 4R0LB 2FBJH 3WEXA 5IESH 3PDGA 5L0QB 3ARGC 3JWDC 3SHSA 4FTVA 5C0EA 4ZS6D 3ZKXC 5C0AA 3MO1A 3QQ9D 4P59H 3WN5A 1C5CL 3S5LA 3QCUL 5T1DL 3VFRB 1XGUA 1FLTX 5LWYH 4X6CE 1GZPA 4OV6F 1XCQA 4MQSB 1I9RL 1JV5B 1UJ3A 1FPTH 4Y4KA 4BH7A 4KK8C 1CFSB 3BHBA 4M6OL 3UZQA 5JIHA 4Z76A 2F54B 4NZDA 4OIBA 3UZEA 5CJOL 5ICZA 1KJ2B 3DVFA 5DQJA 1CTOA 1PVHA 1S7WA 3AS3A 4G3YH 3FFDA 2PYED 3KVQA 4HJGA 3TJEL 4UILH 4LLQB 1LE5B 1GAFL 4BFBD 4PJCB 3T0WA 1J8KA 2W65A 3D9AL 4PB9L 2NY4B 4JFDA 4TOYH 3D3VB 4I5BA 3L3GB 1OTUC 3W39B 3Q48A 1LILA 4OFYA 3P9LA 4WCYH 2XTLA 3R1GL 4G42B 1IRAY 2DQGH 2VXTH 1A6UH 4D9LH 1MNUL 4IDLA 5C8JB 2EDEA 2I27N 4ZAKC 3EZ8A 3N1PC 2D4FA 1UC6A 4ODXB 1GHFH 1BQUA 5C08D 1HOCA 4PY8I 1NQBA 1BLNA 3EOTL 3QIWA 3DETC 1VEOA 3HLAB 2ILLA 3PGDB 3CXHK 2VDML 2V2TA 5IGXL 1YYLH 5K9JH 3QUKA 1BQHB 3OR6A 1ZGLB 3ALWA 3ES6A 1HI6B 3C8KB 2D7TH 2EIBA 4N9GB 1MCEA 2BNUB 2AXGA 1L0YA 2G5RA 2DWEB 3O4LD 2DD8H 2XY2A 5I8CA 3VXRB 1S7VB 4H8WH 4MJIE 4XPTL 3MLZH 2X4UB 1GOGA 1FZMA 1R6VA 2V2WB 4P46B 3VDAA 4NN7B 1E4WL 5KVFL 4S1QH 4LLVA 3BEVB 1I8LC 3DYMA 3IFLH 2RIKA 2ZKHL 1FVDA 4RFEA 3DI2B 2PNDA 4PV9B 3VMNA 5MENA 4LSTL 4TSBL 4N0CC 4W70A 1IM9B 3QDMD 5E5MA 4L9DA 1EV2E 3ARXA 3L3JA 5D7KD 5D1QC 5FF6B 4NP4H 3VI3F 2FX9L 3GK8H 4OLXH 1NGYA 4D2NA 1VFMA 1FNHA 2XFXA 5HVFB 4M9PA 5IVXA 2PW2B 4RFNC 4MNGA 3SDXA 3UTTD 1R3LA 2B0SL 4HIJB 1GGYA 3F7RA 5CMAB 5DK0B 2AV1A 3CH1A 4L8SB 1YY9C 3MRCA 4UNVA 3RUGB 1BFOA 4RAVB 5MP6L 1OLLA 5L88L 3DMMA 3GSUA 2C7UA 4Z7WA 3WLWD 1EMTH 4HJGB 1BJ1H 4OI8A 5L6YL 4JRXE 3QIUD 5F1KC 1N5AA 5HYJE 3H3BC 1ES0A 1CLYL 4NQCE 3DX7B 3O4OB 1KJ2A 3CLEH 1QFPA 1QSEB 1J8HE 1DBKH 3EIFA 1M71A 3SDDC 4YXKH 4Q9RH 3MREA 4NZTL 4QHKI 1J8HA 4OZFG 5C07B 2FEEI 4ZUUA 3EYVA 3UTSE 4MVBD 1I4FB 4F7TB 3WHXB 5HYJA 1VKXA 3QDJD 1JF6A 1KJ2H 4S11A 3BP4B 4PLNC 1OAYH 3T4AB 4F37F 3TN0B 3MO1B 1NDMB 3WN5B 5IROA 2JJSC 2VZVA 2R8SL 1A7QL 3RX7A 5D1QB 3MZTA 5DJ8B 5DMJB 4Y89A 1QUNA 2X4PA 5KW9L 1YNKH 4I9WD 3HE7C 2D7MA 2Y07H 3T4YB 1BBDH 5D72L 5DMYA 1T3FA 3B8SA 3PV6B 4JHAH 3GMQA 2HRPH 2FO4B 4UT9H 3I85A 4JVWA 2YR3A 1INEL 2EC9U 3O2DH 3QWOA 1VPOH 3MRDB 4X6CF 1IQDA 4U2ZA 3MV7A 4HV8B 4W6YB 5F70A 5F88B 4YDKL 3TZVD 2VQ1A 2EDFA 3U2SA 5KSUB 5CSZA 3WUWB 2NXZC 4CMMA 1QO3B 3ZSTA 3IJYB 2APBA 2WQRA 4ZUWB 4EVNA 2WBJB 4PRPA 4B7LA 3BE1L 3CFEA 3D0VA 4APQD 1F45A 5C0BA 4QOKD 5BW7C 3K2MC 1FORL 4M43H 2QADB 1PG7H 3MJ9H 1OP3H 1YPZF 3HI5H 5DJDA 3P4NB 3MXWH 3TIDA 3HI6H 3QI9B 1UXWB 5DHYA 4MQXD 4X7SH 5EC1B 4JY4A 4ONGH 1ZOXA 3IS0X 4L3ED 4NO0A 4CW1B 2I26N 2BSRB 3W9DB 4WEMB 4I3RL 1UVQA 3P9MB 1KN2L 4UILL 3PDOB 4M6OH 2CMRH 3W81A 5C0ND 2IALB 3U9PL 3B5HA 4ELMB 2FJFB 3SDCD 4X4YA 1N8ZB 2YZ1A 3SBWC 3VXMB 4APQB 1A6WL 3LS5L 5FDWA 2LAGB 1H15B 3MRJB 3MXVL 1S8DB 1OD9A 4QWWD 5DI8B 4P9HH 4PP1D 1ULVA 2P7TA 2J12B 1AE6H 3VD4A 2WUCH 1RK1B 3LZFL 2N4IA 2EC9T 2UY6A 3DVNA 5ISZE 3EHBD 1HHHB 3ZHKA 3LSOB 5I15L 1TQCC 3W0WB 4AK1A 4MAUH 2R0LH 1T04A 5J12C 3P4OA 1JFQL 3KDMA 1JL8A 4PP2A 4AEIL 4D9QE 3ESVF 3OX8A 4U3XA 2X1QA 3MLUH 3VMOA 3U79A 3NA4A 4HIHA 2NY7H 3TIEB 3AXLA 4PJ5E 1UYWH 1QR4A 2XRAH 1AD0B 2QADC 3QUYD 4OCWH 4J3OC 2K7QA 4GKNB 3VWKB 1J1PH 2EYTA 3MC0A 3HNSH 3QI9C 2ICEA 3NPSB 1WCQA 1EFQA 3QEQE 4JM2D 3IDMA 3MLSH 1A0QL 4FQCL 5GS3A 2XZCH 5CS7A 1EERB 2WBWB 4X6EB 5CJ5A 1ORQB 3MXVH 4M1GH 1PY4A 5TE4H 4FTVE 4H0HB 3BRDA 4Y19A 4NUJA 2AK4A 1RSFA 3BH8B 1JN6B 2IADA 3QFJD 3VG0H 3MRDA 1KN4L 2V9QA 2F19H 2FHFA 3C6SB 5EB9A 5IVNA 3S4SA 1A1OB 2HJLA 3EO1B 2EXWD 4OV5A 1SJEB 3EO0A 4JQVA 3W9EB 2IFFH 1HHIB 4FFVC 3LKQB 4Y4HB 2VLRE 3HE6B 4MYWB 1TQCB 5T1MB 4OM1L 1D5XA 1JN6A 3UO1L 2VLRD 1RV6X 5D1QA 3MV7E 5F7LB 1SJXA 5J9PB 4PJGF 2ESVB 4NQCB 5T3ZH 1T66D 3VFNA 1PX3A 1R3HB 1XGTA 5SX5K 2BNRA 1UEYA 2I5YL 3MNVA 3SJVB 1RUML 5HHNA 4RNRB 3EYQD 3KYMA 4TPRL 1TETL 3G5ZA 1V3JA 5DVMA 4X7TA 4JY4B 1CFNB 4OD3L 3NGBC 5DRWB 3V5DB 4LVEA 3DOSA 5T3XL 5IM7A 2FEEL 4HS8H 1I9EA 4POZD 4F57L 4DKAA 3LY6A 3VDBA 4XBGB 3S3JA 4HEPG 2GIYA 5E8PA 1G1YA 2FD6L 5C0JA 4JDZB 2D0FA 4ZTOL 2NZIA 3D39D 4GW1A 2OTUB 4YHIA 2VDLL 3WUWA 5T1KA 3QEQB 3BGFB 4RMWA 3P0VH 5E1AB 1U3HC 3CFKA 2HAZA 4NQCA 2MJWA 1NDGB 1ONQA 3DHJA 3K4DA 4FMFA 1D5XB 1FFOB 1MJUH 3AMKA 2DN7A 5DD3L 5FO9A 2MQCA 5GIRB 3HMWL 4OM0H 1CXIA 2VDKL 3MA9H 2M1KA 1ZA6B 3HI6L 1X6LA 1S3KH 3CXDL 3MA9L 4QLRA 1ADQL 4X80H 2QQQA 4PJ8D 1FRGH 1EXUB 4LMQI 2XXCB 2AK1H 4WFGD 1H5BB 4F58H 5CINL 3GMOA 2EE6A 4OSUH 4WU7B 3SDXE 4POYA 3L1OL 1LO4L 4LF3A 4I3GA 1KIPA 1WTLA 5FOBB 3WD5H 3S37X 4ZD3H 1RUPH 4TSCL 3RVXC 5IF0B 5DJDB 1KCRH 4S1DD 3DO3A 3QNXB 2PKDA 5SWSD 5EOQH 2NX5B 5LJYH 2HJFB 2NW3B 4ZO8A 4OCXL 2IMNA 2D7PA 3WHXA 2VC2H 5MERA 3LH2L 4P2YA 5EIIB 2XQYG 1U8HA 3WIFB 4YDLB 2GFBB 4U1SB 2F5BL 5DEZA 2EDQA 4XBPB 1XR9A 1JUFA 4X4MA 3O3AA 1GAFH 2L7UA 2PCPB 5FB8A 2NR6D 3UYRL 3IDYC 1S5HA 32C2B 5LGJA 2VR4A 3GIVB 4ZDHB 3SDAC 3OKEB 5KVDL 3CDCA 5EWIH 4DUVA 2QHLA 2UY7A 5E99L 3WDJA 3CU1A 3WXVH 4HSQA 4G5ZH 1NGQL 5D9SB 5DS8A 5AUMB 3GMQB 3F58L 4N0FA 4PG9B 5F89A 2AQ2A 5IQ7L 2OTWB 2VR5A 4PLJC 4XNQB 5D2NE 5C9JB 5IB4B 1JPTH 5KSAD 3TZVA 4DVBA 1XF5A 4KK6C 1NCUA 1LDPH 4LARH 3RVVC 2BC4A 5FYLL 1C5DB 5D1XD 3G5YB 4HHAB 4XCNB 2Q20A 3P77B 2L4OA 3MODL 3QQ4A 5L0QC 5CEZD 1FVDB 4XCCL 1U8PB 2WWKO 4QRRD 4TRPH 5E8OB 4XNXH 4F9PA 2APXA 4F15C 2LTQC 3NZHL 4OCWL 3U36B 1DQDH 1NAML 4JQIL 1JZ8A 4MMZC 4QTIL 4XPFL 4XRCB 4QXGL 3U0WH 2GSIA 2YMXH 3PQYE 1TTFA 2Z91A 3N85H 1PLGH 4JFZH 5GQBA 4JM2A 1QSZA 4H5SB 3V0VB 3CAFA 1UB6B 1NCTA 4LCWD 1VSCA 4QKXB 4WW2F 4M4PA 3MACL 1ITBB 3S37H 1YN7A 1TETH 3UBXI 4F33B 1VA9A 2RJMA 2AK4D 1PEWA 3EGSB 4HF5H 3ULUD 2J8OA 3QFJA 3TFKC 1PBYA 3C60C 4GW5B 1JK8B 1IT9H 4LVNB 1NGYB 2ORBL 3EGSA 1EGJL 1J9CT 2F15A 1JGVH 4TVSa 1IT9L 1YNTB 1DQTA 1HINL 2CIIB 5HI3D 3Q6GL 1MFCL 5EORH 4EJ1C 4M5YL 3HC3H 4G8GA 2APTA 2LABA 2A83A 3BP7A 5J06A 3UTSB 1A6TA 3ME0A 4RMUA 4ZXBD 2E8YA 2FR4B 5H37G 5KN5A 4X9GA 2BRRH 5JPNA 2F53B 4PRIE 2JJTA 1KJVB 4LPCA 5HXMA 1JHLH 3UDWC 2YK1L 5I8CB 5FAAA 4GUPA 1NBVL 1FZKA 5C0RH 2AXGB 3MCLH 2X1OA 1ZT1A 2VJXA 4KXZH 5DMKB 1WZLA 4BZ2H 5F7YC 3L95A 5F9OH 3SGKC 2QLVB 2VDMH 4K8RC 3C6LD 4P46C 3WO4B 1LK2A 4QRUA 4Y19D 3FCTA 2BK8A 3TA3C 4E42B 1IKNC 5CBEA 5HHPB 1P2CA 2LU3A 3QH3B 3U6RA 2FNBA 5JQ6L 1R24B 1FHGA 1BD2D 4OZHF 4AH2B 2NY6D 4NKIL 4BFGA 2EH8L 1IFHL 3C60B 2AAVA 1MHPH 4MNQA 1I7RA 2GEEA 3I3BA 3FFCB 3IFPA 4HIJA 3WO3B 4I5BB 2IPUK 3ULVD 2W59A 1F90L 3MLXH 4OFIA 4NWTL 3PWNA 3PL6D 4P2RA 4NYLA 1EBAA 1EZVX 1BP3B 2BOCA 4EI6A 2VWEC 1P2CB 4G8EB 4KGLA 4JZOB 3L3DB 3KPMA 4LSTH 1EDQA 1OSPH 2HTLD 4E5XB 5KVDH 3OL2A 1GJIA 3ZKXB 3BRFA 5IMMA 5I66A 5ESQA 4JREC 3FO0L 4PYGA 4UNTA 1OSPL 4JPWL 2PYFB 1I7UA 4TUOB 1LQSR 2YN5A 4K3EH 3WNOA 5B39A 5MI0B 3SKMB 4AIOA 5GS2H 2YZ8A 5FYKH 3GKZA 3EKCA 4G6AD 2DQUH 4ZOAA 1G7QA 4XP4H 2R9HD 5I74B 4K7PY 1LO0L 2OMBA 4UTAL 3PGCA 3VXNA 5DFVC 4M1CD 5E2JA 5DO2C 1IZKA 4CDGC 5EU6A 3C08H 4KK5D 1KLUA 4JFEE 5D2NC 5JO5A 1G7HA 3GMLB 3VFPB 4I9WE 1OCWH 1JTTA 4G8GB 3F5WA 1JNLL 1J87A 2H3NA 2NY4C 1OCWL 1S9VB 2YD8A 5EZOH 4IRZH 4IMLA 1ZHBA 1E6OH 1OARH 5HPOA 3WE6B 4AMKH 5L6YH 3IT8D 4QHKJ 5FYJD 4KDVA 3VXUE 1JK8A 4NCC2 4KROB 3REVB 1QYGH 4P5MB 1TPXC 1E0OB 5E9DD 1OLZA 1JWSA 3SDAA 3O3BA 2V2XB 3D9AH 3WFBL 3VMPA 2FZ3B 2OSLB 1IGYA 4DGVH 5IFHL 5DS8B 3ARRA 1DBBH 3N50A 3BDBA 3CPLB 4G5ZL 2LFGA 1YN6B 2GHWB 1E4KA 4GRMB 3FKUS 5C0JB 5IBUG 1OTSC 1PQZB 4OF7A 5JHLL 1OGTB 3O41A 1RK0B 1CU4H 2JCCA 4P57A 1BEYL 2UVFA 4MCZB 2AI0L 1A0QH 5DQJB 3U4EA 1M05B 2J6EA 1QOKA 4A6YA 1K8DA 4NC1C 1MAMH 4KROD 4JG1H 1IEBB 5IHLB 4BQ8A 2X41A 4W81A 2WIMA 4G43B 2J7LA 1NBYB 4O9HL 1S7RA 4JPIA 1MF2H 5F93C 1FDLL 1OQOA 1NC4B 4OAWB 4PG2C 5K9JL 4X6BA 4M6AA 5I76A 2XWTB 3HNTL 3SE3C 5FYJE 5BJTA 5I1KL 3ARED 4LKCB 4KVCH 4EDXA 2WV3A 2EDBA 4L8CB 1KJMB 1OAXH 1P7QB 1KNOA 3TH3T 3OR7B 1FORH 2JF1A 2YD7A 1EGJA 5J1AA 1ZSDA 1IGML 1OB1A 1UZ8A 3L6FA 2OXHA 2P5EB 3FFCD 2CLVB 4PJGE 3RL2B 4RFNB 1XZ0A 2OLDA 4LQFH 2YA1A 3W2DH 3QCVH 2KBGA 5FO9B 1JZ5A 2R23A 5C08B 1D5IL 2ERJC 2NZ9C 1ZLWK 2N56A 2F53E 4PRIB 2NLJA 4NRXA 4PRBB 1KACB 3D18B 3H42H 3LRHA 5F71A 4DGYH 3HC3L 2HMID 5E24E 3N9GH 1TJHL 2FRGP 32C2A 1Y6NR 5BOZG 1I1FA 1VENA 2UZXB 1G0XA 1RHFA 2A6JB 2P8LB 3FAWA 5FIEA 4K07A 3Q6FB 5EBMB 2GY7B 2C26A 3QEHB 3SDDB 3V7MA 3ARFB 3FAXA 1W8OA 4LHUD 2BX5A 2F5BH 4V2CB 1G7IB 4Y88A 3WIIL 2D9CA 4QTHB 1E4WH 4HKBB 2IBZY 2XV6B 4MVBC 1KIPB 3WN5C 4X7TB 1OAKL 5E6IA 1QD0A 3GMOB 3OJVC 1TZIB 1DQQB 4YDIL 4NN6C 4U2YA 5IHZA 1P7KA 4NHCH 4WHTB 1X4YA 1LO2H 4PJIF 3DVNB 5HYJD 3AY4C 1LEIA 1C5BH 3N06B 3VFNB 4CU7A 4P4KC 4L3EA 4FFWC 1CDUA 2NYYD 3LRSB 3IU4H 4Y19E 3DV6A 1ODAA 3RKDD 4HG4J 3HZYB 3QEGL 4FG6D 3KNBA 4H25B 1YQVH 2HN7B 1LO0H 3E3QC 2GI7A 3SDCA 1RUPL 4WDIA 5EO0B 1RZ8A 5DVLA 3RVTC 3MRLA 1K4CB 4ZXBA 1B0GA 3DIFB 3NIGF 4YIQA 2VISA 4XBEH 3NFSH 4NZUH 1HXMA 2IANA 4UIMB 2EDTA 4O58L 4QRRA 1NSNL 5BVJA 5HYQB 3DX8A 4ZUVB 1ACYH 3MGTB 2Z9TA 4PJFE 1DBAL 1DFBH 2VZTA 1FBIL 2GJ6D 1PD6A 1G9NH 4K8RH 4JFFB 1KTDA 3GFUA 5D6CA 5F96L 1BFVH 1PYWB 3VXUD 1LEKB 2H2SC 4FRWA 1ZEAH 5CUSH 3UJIL 1HYSD 3MLTA 4XC3L 1J1PL 1ACZA 1AP2B 4JO2L 1ZT4A 2OZ4L 3UTZA 2E27H 2ICWA 5E99H 1T89C 1K4DB 5JA9A 2QSQA 3TF7C 1QBMH 3STLB 4ENED 5EU6D 2DBJA 5DRXA 2F74A 3AU1A 4P4KB 3QT2A 3ZKMD 3RWIA 1T04B 1JP5A 2X42A 3SDCC 4ISVA 2Y72A 2FO4A 3JTTA 2WWMD 1NCNA 4XPBL 5EOTB 1DLFL 2EIDA 4YGVB 1RULL 1RK1A 5E5RB 2XNAB 3ABZA 3KPPA 4A2MA 2ZJSL 1EA9C 1DTUA 5A40E 1JWMA 1DBJL 2DLIA 4KHXL 5J12B 5LCVL 3WFHB 4J1UA 5ID1B 1U91B 3RVWC 2BJMH 4WEBL 3KLAA 5F3HA 3OV6A 2A2QT 1OP5K 3MGAA 4LMQE 1DANU 3U1SL 1DQML 2BRRL 3EDJA 1H5BC 1K3IA 4LPUA 1GZQA 5B4MC 1J8HB 3I02B 5DD3H 1T0NA 3E2HB 5BS0A 5IEHA 1F3DH 2VZUA 2OR9L 3D5OF 1YY8A 2D0GA 2YD2A 2J2ZA 2QJDA 4L3CB 5CBAA 4OZIB 2YC1B 4JZNA 3QUYC 3K0WA 2HH0H 4UT7H 5GGQH 5FO7B 3VXME 1NCBL 2AJXL 5GRZA 3KPRB 1CD9B 4JQXA 3ZKQD 4NJAH 1CDBA 3SE9H 2XKNB 1UWEH 4JM2C 5ABDE 5GGUA 5HGHB 4HIXL 4EBQL 2XI9A 3T2NL 1G7JB 4MD0A 3BKJL 2Y06L 4YE4H 2AV1B 2FD6H 3CH1B 4L8SA 4LPXA 4GG6E 1CZ8H 5F3BB 4LSUL 4X7CC 2Q6WB 1T20B 4WW2B 1AGCB 4YXHL 5IMOB 3GSVB 4P3CL 3NAAL 4MJ6B 3W11C 2C4XA 5D1XB 1MFAH 3VGAC 1Z5LA 3E6FA 4W4OC 5E9DA 3KS0J 3BPCA 3FQUB 1P9MA 2OR7A 1OAXL 3UXFA 2ZP0T 1A6UL 2FJFA 5ISZD 2FBOJ 1KJ3H 3QRFM 4GRLA 1KF9B 4OZGB 1XIWB 4AEIH 2GITA 3H9SD 5EU4A 2VXVH 3CIQA 3RWDB 2I07B 2R2HB 1KCVH 3DRTA 2Z8WC 4LGPB 5HHOB 2R15A 1DQJB 4X4XA 3B9EA 3RWDA 1I7ZA 3TT3H 5ANMA 4XPHL 4IM8A 5K59E 5T33H 1UWXK 4QRPD 2VQUA 3K81A 2ZOKB 3HMWH 2DQFA 3QUYB 4ALAL 4OF3A 5DQ9B 4KJQD 4KDTC 3LD8C 3BWAA 5EBWB 1KPVA 1Z0NA 4JG0H 4LEXL 1KTKE 2LTQB 3OR6B 3GGWB 2A6DA 5E2VH 1UM5L 2HLFD 4WO4C 4U1IB 1SVCP 5ALCH 2DICA 3PDDA 4AIZB 3MRIB 4PJ7E 3PWJB 1ORSB 4F7MB 1KIRA 4WW2C 5IOPB 1B4RA 2FYYB 2VDRH 3BGFC 3MV7B 4ONFH 2YUZA 4M6NL 5E1HB 3T8XB 2EIZA 3STZB 3SO5A 3X17A 4AMKL 1JNNL 4OQTH 1DBMH 2E6JA 3MUZ1 4YHNB 4P2QD 3MRNB 5ICXB 1QHOA 2AJZA 5I17A 2EXYD 5TFSH 1YEKL 1DN0A 3KPQB 2H1PL 4ZUSB 3T09A 2NXYB 5C0CD 4NQSA 2XFXB 5T1LB 3OPZH 2CRMA 4UTAH 1BBJB 4MQ7A 2MPAL 3V95A 3ZL4L 2X89D 3ARBD 3TH2T 3VCLB 5KSBA 1QBML 4PJ8C 4JFZL 2M2DA 1Q0XH 2DYPB 4F37K 2E6QA 1QFWI 2F54A 1UM6L 2JE8A 4PJ9B 5FM5M 2W0FB 2KDGA 4PJ7F 2X7LA 5C6WH 5M94B 3DGGA 4JO3L 1K8IB 5D1XA 1WF5A 2CR3A 3RDTD 3GMNB 4LLVB 3QG7L 1RD6A 5F3BA 1EIBA 5BVPL 2WW8A 2DI8A 1P53A 1A4JA 1RIHH 5JR1L 5JUEH 4WO4B 2D03H 5DF0A 4OZHE 1N0XL 4PJ5A 3S35X 3O3DB 3HZKA 2I60L 5JPMB 5ITBL 3WO4C 2RBLA 3MGOB 1N59A 2VH5L 1A1NA 1EX0A 5IESL 3Q1SL 3OXRB 4MX7B 4WI4A 2QQNL 4IHOB 3ARUA 3UEZA 4ZS6C 3TBTA 5IVXB 1JPGA 3AB0C 1S7SA 3G6AB 3HR5A 2R0WH 4JO1H 4LQFL 5AAMA 4OFVA 4ODXA 1XAUA 2NPLX 4TVPE 5HYSG 5CJXA 4Z8FL 1SYVA 2ZCLL 4Q9QH 1YPZA 3G04B 1ZLSL 1ND0B 4IDJH 4TQEH 5F9OL 3S96B 2GUOA 2O61A 1DSFL 4R26H 3THML 4F8QA 5EZJB 4YNYB 3TNNB 5L8LB 1RULH 1HCFX 3ZE2F 5BS0E 1J05A 1QFWL 1RMFL 1OHQA 4GAGL 5E2TH 5EU4B 2OI9C 4DFHA 5I18H 1DJSA 1JPSH 4RFOL 1ZVHA 3IU3A 2Q86B 1MF2L 2I60H 3P4MA 1AGFA 2IG2H 4KI5D 2HVJA 4YC2C 1V5JA 2GTWA 4N9GA 3LRSA 5K9QG 1A7PH 1OTUD 4AEHL 2VXQL 3ES6B 4U6YA 1TJIL 3H3PH 4PJBB 4S10A 5JW3H 2Q3AA 2VTFA 4DUWA 4AEHH 1UJTA 4XHQA 4NHUA 5I74C 2OJEA 3IETB 3SE9L 5I1LA 3ZE1E 1BJ1J 2BRQA 3TJHC 1L9MA 2PXYB 3L3HA 4FTVB 3EYSH 4P3WA 4J7RA 5IGXH 4M1DL 1QLFB 4G6KL 3MRBA 3MV11 4KUZH 1KBGH 4QHUA 5CHNB 4FFYH 4Y4FB 5HYQA 3BAEL 4QXWA 1Q9OB 3V7AE 2ZOLB 3C60D 3RIFF 1NEZG 1ETZA 2X4RB 5H94A 3WUZA 2WIIB 4MSWA 5DYOB 4KMTH 4JFDD 5HGAA 1GZQB 1XR8A 3F62A 1U3HA 1AC6A 4UQ3B 5LBSH 4OT1L 4PTUA 1A5FH 4FS0A 4YUEL 1S9XA 3BE1H 3OAZH 1RZKH 4PJXE 5SX5H 2VLJE 3PL6A 2ZCKL 1A14L 4V2BA 1FGNH 2V17L 1C5BL 3VRIB 4N0CD 1LP9B 4G6JH 2BVYA 3FT3A 4YC2B 1I9JL 1JNHB 1JV5A 4D8PA 1RUAH 3TH4T 1KT2B 2XA3A 5FECA 1DL7L 4ISVB 3O9WA 1OB1B 1FN4A 1WC7B 4JG0L 1J88A 5C0EB 3MRPB 4DGVL 5DEGB 4JDTH 4P46D 2W9EH 4GKZB 3C5SA 2PXYC 3RGVD 1I3RA 1FG9C 5FYLE 5GSRB 3ARGA 1T5XA 1D6VL 5EUOA 1YY9D 3LCYA 3TN0C 1S5IH 5D7JD 1TCRA 1CIDA 1W72H 4Y4FC 1CU4L 1NBYA 3VRIA 4L29B 2ITCA 4OLYL 4JGJA 1BOGB 4KH2A 3DX9A 2ADJA 3HE7B 4X0KA 3DJ9A 4JFOA 4EDWL 3CZJA 4KAQH 3NZ8B 2JJUA 1RZ7H 1BECA 1QTYT 1WFOA 5B39G 1OM3H 2JTDA 2BDNL 4R3SA 1MFDL 4O2FB 3RP1A 1J1OL 1OL0A 2BDNH 4EN3C 1SEBA 4M4RA 4M8VA 3BXNB 3OF6A 5EZIL 5MI0C 4HH9A 1C16A 1CGSL 2Z92A 3ELAT 1QLFA 2NNAA 3HZYA 3QFJE 1H3PH 1JWUB 4K23L 4JR9L 4HXAH 4PD4K 5JLZB 1I75A 1CDCA 4RMSA 2OZ4A 3QXVA 1JVKA 2RQ8A 1UWXH 4KRLB 1ADQH 3ARFC 3UTPD 2MKLC 3JWNC 3ZTJG 3NCFB 3SKOA 5ALBL 4NNXA 5DFVD 4UV4H 5EUOB 3TNMA 4EDWH 5DO2D 3PF2A 3OKDA 2W9DH 1JF1A 1YDPB 4EUPG 2Q3ZA 4LEOB 1CDJA 2CIKB 3QDME 3IDIA 1BVLB 3OGCB 1HHGA 2Q7YB 5AYUH 4DW2L 2R2EA 3IDGA 5JHDB 5FKAA 2NXZD 3O45B 4OGAD 5DC9B 3T2PA 3RY4A 4ZG1A 3MLXL 1FG2A 1MWAB 1IC4H 1IARB 4XAKE 2H9GA 4KJWD 3LEXB 4PREB 1O7VA 3RY5A 1F6AB 4APQC 5IJVB 4YNYA 3TNNA 2J8UE 5HGDB 3CPLA 4JFFD 4EI5D 5DJ2B 3BESR 1IGYB 5ACMA 4W6WB 4WWKA 3X13A 3ARQA 4PRPD 2IQAA 4ORGA 4M7LH 1ZHLB 4KKLC 1SJHA 3D18A 4FQIH 1VERA 2X89A 1FGVL 3IXTA 3ARBA 1NBZB 2IPTH 1ZLSH 1G9MH 4L4TE 1S7QB 1S7SB 4CAGA 1ZHBB 5CSGA 4PRAA 1Q9KA 4HKZA 2W92A 1FAIL 1I7RB 3OKYA 1T5XB 2A73A 3CC5B 3MRKB 5HYSA 5KVEH 2QV2A 2HG5B 4P4RA 3V7AG 2R2EB 3IDGB 5JHDA 5E08L 1RZFH 3MFGB 3IXAA 3BH9B 3R0MA 1BVLA 1MIEL 3OGCA 2ZCHL 1RJYA 3CSBA 3QXUA 2J88H 4KI5E 3GK8L 4OLXL 4AEEA 1EAPA 1BIHA 4Z5RB 3T2OA 43C9A 4HJJL 4B0MM 3F7VB 4LLDA 3S35H 4AL8H 2Z4QA 2CXGA 2PYFA 3N1MC 4GRWH 3P73B 4IMKA 1AIFA 4HKXB 1IKFH 2G75A 5FEBA 4A6YB 2ERJB 2D31B 2NX5E 1Q0YH 5IW6B 3BI9X 1ZGLM 4HH9B 4NO3B 1FE8L 3MLSL 3HE6C 3BEWB 4LSSH 1IAKB 4PJAE 2GCYB 3V6OE 3IDXL 3L7EB 4MNHA 5EZJA 2XYCA 1ETZB 2KQNA 4MQTB 1G7MB 3EDDA 5HVGB 4IRSD 3QCVL 4CKVX 4FQXA 3FB8B 4DOHE 1RIUL 5ICXA 3GBLA 1URLA 1P5UA 4Y4FA 3ARZA 4Z7NF 3NFNB 3B9AA 4Q9RL 1MCQA 4K3HA 4MJ2A 5GGRA 1CQKA 1WBYB 3PWPD 2PN5A 4X0KB 4OLZH 4U1JA 1I8LA 1KIRB 5ADOH 2A77L 5F97E 3AM8C 3UO1H 1MLCB 3TCLA 2NY5H 4YZFE 4MDIA 3IB4A 1CQYA 1R3KA 5ISZB 3WNLA 4U6YB 3BP6A 1OAYL 1OT1A 1KTRL 3VFWB 3TYFA 4PJAF 3LKNB 2QQLL 3U1SH 4IRJB 3ULUL 2G60L 3H9ZA 4HKJB 2CR6A 4P4KD 4MJID 4L8BA 3UTPE 3BJ91 3MJ7B 5CWSA 3HPLB 1MFEH 4XZUB 1FZJA 5FCUH 1A6TB 4FG6C 4KHTL 1AH1A 2BNRD 2I07A 2ENYA 4HUUA 1JPSL 3QA3B 4RFOH 2BNRE 5A2FA 2AJSH 2CIIA 1U58B 3ULSB 3UPAA 4KQ3L 3CVHH 4QGYA 4D9QD 5D7KE 2BC4B 1U8OB 1CLZH 2OJZL 3ULVL 4Z9KB 4NYLB 3ZHDA 3MLZL 3TBTB 3ROOA 4ELMF 5BO1L 1X5HA 5H94B 1NCCH 3OF6D 1IGIH 1CT8B 1CLCA 4NC2B 5HHQB 1JFQH 3HS0A 3BKMH 4M7JL 3FOMA 1IC7H 3RWCB 1I3VA 2FIKB 4XXDB 3MLUL 4PRHB 1KEGH 2X4NA 2GJ6A 2DQCL 2QQNH 4L9LA 3WNPA 3WUWG 4X6FB 2RB8A 1RVFL 4OCSH 4NQCD 4OB5H 2G5BA 3FO1B 4ZYKA 4EXPX 4GG6B 1A6WH 2KPNA 5DJZA 2X9WA 1ZEAL 1Y6KR 4R4BA 5KANI 1DUZB 4CVWA 2VN7A 1O5DT 4S1DC 5AD0B 3UX9B 3LS4H 3UTQA 3QUZD 4L4TA 1V3LA 1Z9LA 2F5AH 1J18A 3VCLA 1C5DA 3WIHH 1WFUA 5KSBB 2EZ0D 2V6HA 4ZFGH 4F80A 3QQ3A 5I30H 4J2XA 3A6BL 5FV1L 4IIQA 3QUXA 4LF3B 2X4QA 3BN3B 1U92A 4ZSOE 1T21A 2YWZA 1GC1H 3HB3D 3MFFB 4PGZA 5CZKA 2J8UA 4ODWA 1DBKL 5CCKL 3H2WA 1QVOA 4KUCF 3G5XA 4PJ8B 1ZS8B 4XP6H 4PGEA 1HH6A 4OTXH 2J3SA 3FB5B 1C08A 1M7DA 2R39A 4CU6A 3LKOB 5B38A 2B1HH 5SWSE 4GKOA 2ZNWA 4Y1AE 1U8KB 4D0BA 1YEKH 4M7LL 1AC0A 3L3KA 3FB6B 2XRAL 3TT1H 4NO2A 5J4MA 1GVIA 1EFXB 5DD1L 1S5HB 2CK0L 2DQJL 2YXFA 3GRWL 3MRIA 2ED8A 2JJWA 2OTUA 4FQHB 5DD1H 1LEKA 5IFAL 1A02N 8FABB 4NZJA 1YMHB 1P84K 5D1XC 5GRWA 3VGAB 4WTXA 3LS5H 1A9EB 1C8PA 2IGFH 3ZDYF 2GSIB 2J6EH 4GG8A 5FGSA 5FO7A 2Y5TA 4BH8B 3WJJA 1XGPA 5C0BE 2AJ3B 2ZNXA 3MRQB 2AEIT 2IPKB 4PRPE 5I1EH 2IANB 3AB0B 1G7MA 2P8MA 4U1GB 3UJJH 2MHAA 3B9KA 3L9RA 3O8XA 5CD3A 5F21B 1EXUA 3PABA 4EQ2A 2KKQA 4WVRA 4U31A 5KJRL 1ZLWH 5GGTA 3VFOA 1MRFL 4OZGA 3U46A 1BVZA 1JZ7A 5KOMC 2D31A 1KJ2L 4WEBH 2BY3A 4WW1B 5EO9A 3TCXA 4JEGB 2EO9A 4CADB 5CEZH 3HAEH 3GSQA 4GO6B 3U7YL 1D5MB 2DQHL 2OI9B 3S7GA 1KPUB 1VADB 3CSYA 2XKUA 4JKWA 5L2KD 4N8VA 4QHMB 5HVHC 3C08L 1H3PL 3BD4A 5IHUL 2HJLB 1X44A 3BP5B 4XH2B 1RZIA 4C59B 1FO0L 3HCVB 4KJYB 2HFFB 5J1SC 3VA6A 1HIMH 3MOAH 5GGUB 4MD5B 4JKMA 4GQ9H 3BH8A 2EE3A 2G9HB 4P3CH 1H8NA 3ARWA 4WO4D 2R0ZL 2A73B 1CLZL 3LVEA 2I9LA 4L1HA 4PJ5D 2MKWA 5DRWA 3V5DA 2APVA 2KQMA 4PRDA 4RWYH 3ZYOA 2O5ZL 4LLWA 3PIQB 1WAAF 4O00A 3KYMB 4GKSA 3CFCL 4G9FD 4JFFA 2FB4L 2NXYC 2EXYC 4HZLB 1EH9A 2NW3A 5A16A 4TUJB 5KBNC 4JGUA 5FCUL 4PJXA 4ODSL 4LPTA 4JHWL 5CINH 4YWGL 1TDQA 1CD1A 2QL1A 3GJEB 5IF0A 4XNYL 1NL0L 5B3JE 1PZUB 3HI1A 3JWOH 4N90D 4ZUTB 3ULUE 1DQJA 4LK4A 4X4XB 1F6FB 1UACH 2DLFL 2HTKD 3GI9H 2RR3A 3TA3D 1U93B 5L8KB 3HC4L 1I8IA 3QXAA 4N8VB 4QHMA 4R4FL 4TTDC 5KAQG 1RZFL 4IRSA 2R0ZH 4JREB 1KSRA 1ZKAA 3OKOA 1K2DB 1WIPA 2IADB 5AG9A 4G9FB 3REWA 4EIZC 2Y7QB 2W0LA 1FAIH 1CK0H 4NNYA 1DP0A 1F3JB 4ELKA 1V3KA 2F8XC 3MCG1 4LKCA 5A2KH 2NY3D 3ULVC 3RTQC 1UVQB 3X12A 1MJJB 4PS4L 1GC1C 5GHWH 1A6AA 3SGDI 3MX0A 4YUEH 3MNWA 3BFOA 5HYFA 1MVUB 1YNLH 7FABL 4NKDA 5D2NB 1R5WA 3CVHB 3I75A 4XP6L 5DVOA 4QTHA 3DX6A 3DNKA 2HTLC 5IW1B 2UV3A 3WDHA 2UZYB 12E8H 3SKNA 3S36L 2CGRL 4FHBD 4ZO9A 5F96H 3DX8B 3ARFA 5D7LE 5FUOH 3MR9B 4Z95H 1EHAA 3MUHL 3P4OB 4EVNB 4WUUE 2FLBT 1CD0A 3BUYB 1TPXB 4MXQC 5SV3A 3ARSA 4RWHA 3I3DA 4U3HA 1L7IH 1QEWB 4WDIB 4KKNA 1PKQB 4Q97A 3I6GB 1GGCL 5F3HB 4LHUG 2ESVA 1JRHI 5JNYB 1H15A 3MRJA 2JELL 4YBLC 3VFSB 3GMPA 4O58H 3VE0A 1AO7A 1OAZL 3KPPB 3EO0B 3WMSA 3CH8A 3CSPA 3ZHLA 4GT7A 1D9KD 1KFAH 1HNGA 5HDLA 4TN9A 3T4YA 3LEVH 5D2LA 1J1OH 3RTQB 4AQ1B 4NO0B 4QTIH 3KPRD 1U6AL 2XN9A 4KRMB 3GJEA 3G6DL 3NCEB 3TJHD 4S1RH 1MFDH 4HZLA 2DWDB 2W0PA 3HUJF 4D0CA 3IDMB 4WI8A 2R1XA 1T1WB 4WUUA 3S9DB 5B21A 3HZVA 3KYKL 4CMMB 4JG1L 1MFCH 3CFJA 4XMPH 4KRPB 2VE6A 3P2TA 2N1KA 5ID0B 2P44B 2FGWL 3LAFA 1XIWD 4HWZB 4JFYB 2VYRE 2B39A 3O11B 4OJFH 4LIQE 4RAVA 3PQYD 5IV2B 4LU5H 4WI5A 1JGLH 3SDXF 1CICC 2PO6D 3MA7B 3RPIB 4OUUA 1BZ7A 1PSKH 5IBTL 1RJLB 5J13B 5CJBA 1TENA 3SEPA 5JTWA 1FAKT 3V8OA 5TF1H 4OD1L 4MJ4A 1EO8H 5DT1L 3NCCB 3UYRH 3QDJA 3C5ZB 1A3RH 3BN9C 2ADGA 4U6HA 2CLZA 3E8UH 2YSSA 4X4YB 4ELMA 3K8LA 5DJ0A 3U46B 2E7LA 5BJTB 2EKJA 4X6DA 5E8NB 2C4FU 2BXZA 4YK4C 4ONHA 4JPIB 5BV7H 5FV2A 2CPCA 3I50H 4PV9A 15C8L 4FQ1H 1RUMH 2VSCA 1P5VA 2WLYA 3O6LL 2X70A 5HHXH 4J6RH 1KGCD 3JTSA 2IPKA 5JQ6H 1MQKH 4GUPB 2YPLB 4N9OB 1KB5L 1M4KA 1XGYH 4G7VL 4GG8B 2AW2A 3RGVA 3BZFB 4J4PA 1S7VA 2F53A 4IRJA 1IM3A 1L6ZA 4FMKA 5DC4B 1INDL 1T22B 1MCOH 2C7UB 3HNTH 3H9HA 3SKMA 1BJ8A 1I1RA 4Z18A 4C56A 4QOKE 1HCVA 3QUXD 3GBNH 2J1KA 3WLBA 5BRZD 1HEZA 3QZWA 3FO0H 1CICB 5D6DA 3BPOB 1AD9B 1I8MA 2PTVA 4Z77A 5GRXG 4EN3B 4C54A 4JZOA 1FZOA 2WUCL 1G0DA 2X10A 2XZQH 3REVA 4ZFOL 3NTCH 4I4WA 2ARJA 4Z7UE 5GGRB 3PJSA 1F13A 4NRYB 1FP5A 5EU7C 3U82B 3DXAA 3ESUF 4X5WA 1BD2E 3EDKA 2ZSVB 4U6VH 5EH1A 4NZRH 4MX7A 2J4WL 3MRMA 1H3GA 1GGIL 1G9EA 2BHZA 4MLSA 3PE9A 4U6VL 5HJ3A 5F1IB 4NO0D 2YD1A 2IH1A 1REIA 4RBPH 5MENB 4LDLB 1I1CA 3TT1L 4QT5A 3BIBX 3G6JA 1MI5B 1ZANH 1T5WA 5KANG 3UP1A 2HT4D 3OR7A 3T0EE 4QHLB 2APWA 4HX1B 4YHOH 4KVNL 2X4UA 3TN0A 5CZVL 3GMRA 1ZVYA 1WAAA 1P4BH 4LHUA 3G6JF 3RI5F 1SHMA 4GXUN 5D5MA 4F7EA 1T0MB 2FX8L 5C6PB 3HTLX 4FNLL 5I2IB 1F58L 2R1WA 4JGMA 5DURB 1AXSB 2NY2B 3LIZH 4OCYL 3RIAF 3U4BH 4BUHA 1NANI 3V4VL 4XCCH 3JV0A 3FO1A 5FUZL 1EEUA 4PPTA 4KJWC 4AM0A 2XTJE 5FKPB 5JDSA 3FO2A 4S0TD 2CLZB 2X4SA 4XT1C 2BOCB 4ZODA 3DUUB 4YDJB 2AEQL 4WI3A 1NLDL 1T1YB 2VAAA 1IC4L 2FIKA 4GRMA 4C4KT 4D3CH 2X05A 4XVJH 4MCYB 3P9WB 3CLFH 5JW4N 2FZ3A 2OSLA 3RVUC 3QIWC 5C2BL 4HC1A 1KCSL 5D9SA 5J57B 4N8CL 3T65A 4LSPH 3PHQB 3ROOB 1CE6A 3AC0A 5FGCE 3V0WH 4AH2A 1DR9A 3AS1A 4NKOB 2CUHA 2FH8A 4F9LC 3Q6GH 3FQXB 4N5EC 5F7UA 3BQUA 2HKHL 1D3CA 1DLHA 2H3NB 2ORBH 5AWNL 1NSNH 3ARDC 1HEZB 4Y4KD 5GGRY 3VH8A 3WLBB 2ZUUA 1NCCL 5CLTA 4JM2B 4UQ2A 5I1GL 1YEFL 1DCLA 1L7TL 4JKKA 5TE7H 1XGQB 5JHDD 3DUSA 2ZWLT 1B90A 2OJZH 5E7FA 4LDEB 1ZHKA 1F97A 5HI5D 3PGFH 1XGUB 3KPNB 5HYEA 2P5ED 4L4VD 1I3GH 1YMME 3U36A 1XH3B 3G6DH 1A6PA 5D1QD 4ODTL 3VRJA 2YMXL 5HD8D 2WUBH 4P2CG 3C8KA 3BP7B 1YDPA 4BYHA 3RZCA 2XWJB 3CFBB 4OGXL 5F1IA 3VXQA 1NFIB 4MNQE 4NJAL 5IP4A 5CEZL 3N1GC 1E4KC 5ESQB 1OSZA 1E4XI 4Z6AT 5A3IC 9CGTA 1NCAH 1Q72L 1NGWA 3SGJC 5BS0D 4YPJA 4G8EA 1KENH 1XF3B 4OLVH 2LU4A 5KTEL 3OAZK 1MFBL 4U6HB 2ARJB 3G9VA 3QBTB 5GRUL 3GMPB 1VFAB 1N64L 2L0DA 4IRSC 2BY1A 3QFJB 4HPOH 4F58L 1NDGA 5GJSL 3IDJB 1J0KA 3PXHA 1UM4H 3I6GA 4N0FB 3LS4L 4PG9A 1SEBB 4KPHH 1F4WH 3QZWB 1T20A 4WW2A 1BZ7B 4XBEL 3PUCA 3BZ4A 3D3VA 4WTZA 1CS6A 2BJML 4BSVA 3BIAX 4C56B 2VLKE 5IV2A 1X4ZA 3MR9A 4JDZA 3GSNL 3KR3H 1X4XA 2VLRB 4RWYL 4R90H 4GXUM 2VXVL 3V5HB 3VXSB 2X4SB 1IM3B 1SEQL 5DSCA 4LPWA 2JK5B 3PWPE 3CFCH 2WUBL 3RGVB 1JGEA 2XN9D 3C9NB 3QO1B 5FYJH 5FA4B 3P0GB 4B50A 2R0KH 3EO9H 3ZDXF 4DOHB 1FFNA 3CFDB 2C1OA 5EUOE 2DQEL 1XCQB 2CO6B 1YYLL 1U8JB 2DWDA 3WYRA 2B1HL 3MROA 4JANB 3VFRA 4XP9H 5DJ6B 3S34H 2Y06H 3J7HA 1B0RA 5TH2A 2H6PB 3U48A 1CXKA 2ADGB 3DBXA 3S36X 1WBZB 1XF5B 1E4JA 1CGXA 3LN5B 4JKPL 3Q5TA 2Z0BA 4MB3A 5GHWL 2YD9A 5DUPL 2BSTB 3PWVB 2BVQB 4UBDD 4XB7A 3ZKSD 1CFTA 4RX4D 1MLBB 1U93A 3IFNL 3VFTB 4AT6B 2VDNH 3D0LA 3IYLW 1TQBC 3OAUL 1ZA3B 1KFAL 2M26A 4YPGB 4G9DB 1NBZA 1QZ1A 4IJ3B 2A6KB 4PJIE 4ZDHA 2ADFL 3KYOB 1WITA 3TBYA 1AGEB 2R1YA 3X13B 1QEWA 3UTZB 5F7DA 2AP2A 2O5XL 3BMVA 1VGKB 5DJ2A 1FNSL 4GH7B 5HHOE 2GY5A 5J56B 1JBJA 4XBPA 2EYTB 2XZCL 1ITCA 3S34L 1ZV5A 3NFPB 3H9HB 4O2CA 2H9GB 1T22A 1DBBL 5IJKA 5CJXC 4XPBH 1AD0A 4PJAA 4L4VB 5ENWA 1X7QB 1UB5B 3HNSL 4FXGA 5BZWA 5L88H 3LMJH 2H32A 5C0CA 2DIAA 5GXBB 2JCCE 4Y5VA 3I6LD 2G9HA 2H41A 2MTPA 4LOUC 5GRYA 3MV9A 5EG6C 3IDIB 4F2MB 1CE1L 4NKDB 5D2NA 1JTPA 2HJKB 4HDIB 4Y0GA 3MOBL 4MB5A 3GUTB 3OKDB 3TLRA 3BW9B 4Y5VC 5HHNB 4QCIB 1MJJA 1UKQA 1KLGA 4M7KH 4PP1C 5IB5A 4X6DB 3O2VL 1UWGL 3FRUB 5F1NB 3QDGD 5ERWA 3TBVB 2ATKA 3MV7D 5IVOA 1BQLL 1DDHB 4JE4B 4HFWA 4JN1L 3REWB 5I30L 1J0IA 1GCFA 1DN2A 4U6XB 5JHDE 3W9EA 4HMCA 2A6IA 4I0PA 4LSPL 5T3ZD 3LKSB 4JFQB 1JZ4A 3SE4A 1MCWM 1IGTB 1MRFH 1BBDL 1A7NL 5IBLD 5FUCC 5TDOB 5E2WL 3MV8D 1F4YH 3V4PH 2XA8L 2F9BT 3O8XB 1BGXL 4I2XA 3A6OA 2HWZL 3HC4H 5D5ME 1NAKL 5LWYL 1I1AC 2FGWH 5L2KA 2Z35A 3GSWB 1QA9A 2AJXH 3OB0H 1NAKH 1F6LL 1HQ4A 4H0IA 4Z7VE 4PRNB 3MPCA 3P4LA 4OB5L 5IW1A 4X9IA 4QRSA 5HHMD 1UQSB 4HUXB 1TZGL 3QG6A 1JPGB 2RCSH 4PJGB 4OF8A 2D0HA 5I73C 1OM3L 3V5KA 1YMMD 2V7HB 5E08H 3HAEB 1PFCA 1KEML 4JN1H 4U49A 5TE7L 4EQ3A 1KCVL 2AVGA 4CNIA 1BPVA 1EEZA 4J3XA 3FB6A 5GGSA 3MRHA 3OKNA 2XACC 2E7LC 1CYGA 3ULVE 1YUHA 4OZFH 4G9FA 4W68A 4ORZC 1ZVSA 1KJ3L 1S7UB 2AGJH 1H5BA 1UYWL 1A4JB 4RMQA 1YNLL 4TPRH 3ZE1F 3VFTA 1ZS8A 2CUIA 4ETQB 2CKBH 3BDYL 2DMCA 2C3VA 1PZ5B 1T66C 4QOKA 4Y5XB 5FHBH 3VWJD 3FQTB 3L5HA 4JO2H 5EIQA 4L8DB 3ZYZA 4UDTB 1FSKC 4BFIB 1AFVH 4CNIB 1I1AB 3KS0H 4TUJA 3FRPA 3QNZB 1WVZA 2NX5D 5B38G 3K46A 3MOQA 1QBAA 3VG0L 4R4FH 1FYTE 4U0RB 5AAWA 5IB3B 1UM5H 4ALAH 4TUKL 3WJJC 4ODVL 4PIRF 5KVFH 5DMGD 3IFNH 2P49B 4JLRB 3QIBC 3L3OB 5JW4M 4KZDH 4Z7OE 4ELME 2VDOL 3KPSB 4YXKL 4PRNA 5JIKA 1NLBL 3GNML 2XQBH 2IQ9H 1F58H 2FH6A 1NLDH 4QRPB 3VU2A 4DVRH 1PQZA 3OPZL 1U3HD 3TVMD 3T8XA 4MD5A 3DO7A 1TVBA 5D96C 3CGTA 2FLRT 4WHCA 4YXLL 1ORSA 4F7MA 4YH6A 1RZIB 3CX2A 4H8WC 4AQOA 2AEQH 3F7YB 1VEPA 5CSZB 3CVIL 1KELH 2FCBA 1HSAB 1N4XL 4PUBL 5F8QC 1VFAA 3F7QA 4Z7VB 4LNRA 4N68A 2XICA 4JB9H 5HHVH 3QUYA 3LV3B 2AJYL 3VI4E 5FK9B 1NGWB 4QXUL 3VGHA 2DRUA 4U0QB 1X5JA 5LGKA 3S4SB 4TRPL 2HJKA 1FZJB 4YJZL 3D3VD 3ARTA 3WFEL 5DJ8A 1ADQA 1D9KA 4XWOD 4UOJA 1LMKA 5F7WC 3BGAA 4JPVH 5FK9A 3L5IA 3O9WD 2ZG2A 2E7HA 2E5EA 2OM5A 4L4VA 5A16B 1CFVH 3SGEH 2ARWA 1VKXB 1QPPA 5E9DE 3S4SG 4ZFZB 4K71B 3T1WA 3BIKB 1VHPA 4GKSB 4PRPB 3SDAD 1HYRC 4LP5A 2R8SH 2DLEA 3ARGD 1WWAX 3GMMB 3PWLB 3CFIC 1QSEA 2UZIH 3F7YA 4GG6A 2DIBA 1VFBA 1AO7E 4GSDL 1L6XA 5HHXL 5F88A 3C2AL 2NY0D 1AJ7H 1CGVA 4MXQD 4CVZB 2L7JA 3ARFD 4Z7WF 1I7TA 5E03A 1FNEA 2ZUYA 4PGCB 4PRHA 1X9QA 3I9GH 4HLZH 2EKSB 4KK8D 4YBLB 2BFVL 4JJ5B 2DAVA 4PB0L 4UI2A 3BP5A 4XH2A 3HS0B 2YC1A 2X9XA 3G5XB 4PJ8A 3FO9B 1HQRA 1Z0MA 2OXGA 2Q8AH 3PNWA 4MNGB 1XGYL 2PW2A 4OCRH 1IEHA 5BV7C 5D7LA 1I3GL 4PJCA 3ZT7A 3O6MH 2GCYA 2XTJD 3HUJB 1U8OA 1BIIB 3E6HB 3SPVA 1D9KC 3RWEB 4GAJH 5IW6A 1KB5A 1U91A 3BP4A 4OFKA 1SEQH 3IKKA 4KI1A 5CEXB 1MSPA 4YFLI 1UXSA 4GBXA 1MIML 4Z0BL 4BQ9A 3NCMA 4X4ME 3SE4C 4HWUA 1DVFC 1U3JA 1AQKL 3ALPA 4IOIB 4AY0A 2I24N 4X80L 1EVUA 4KKLD 4L8BB 1T89A 4ZYKB 3H3PL 2FSEA 3OXSB 2V2WA 4K9EC 4P46A 1NC2B 3C5JA 1QLEH 3K4AA 1FVCB 4ODUA 1WAAE 5F6IB 1YPZE 2VITB 3IXAB 2MPAH 2DWEA 4P5TC 1A3LL 5GGSB 3ZYIA 4MD4B 1DE4A 3U9PH 3RWCA 3TFKD 3MRKA 3QUKB 5HYSB 4ZPTA 3G6JE 1MAJA 4JFPA 2OL3L 4AIZA 3QEGH 4OBRA 2EH8H 1MH5B 4PLKD 1EFXA 5EA0L 3U2SB 4YHKH 1FGNL 5LBSL 2AGJL 5J13C 3TP4A 4B53A 1DBML 2HFGL 3PJSB 5EA0H 1JI2A 1CDYA 5BV7B 1NBVH 1JYXA 4ZXBC 1KEGL 2Y9RT 1HH6B 3L3JB 1OQXA 5SWZA 1D9KB 2DF3A 4GRLC 2IANE 1QA9B 5HTSA 3WHE0 4G8FB 4UIKL 1TITA 5L2KB 3L3GA 3W39A 1MPAH 4WFEE 4HK3N 4YXLH 4GLRI 1D5ZB 3FQWA 1U9KA 1RZJC 4CGTA 3R4DA 4YGAB 4IIQB 5TQ2H 3KLHD 5ETUB 3EYSL 3HE6D 3ARDB 4P3DB 4K8RD 4H25A 4K9EH 1OGAB 3UBXB 2W9EL 2NW2A 5C0FA 3DV6B 2BNUA 1NJ9B 3MJGX 4GW4B 4MHHI 5EU5B 4RDQG 2NY6C 3NOIA 5L8JB 4IRJC 1HH9B 3WLWC 4GMTH 4J4PC 3VH8B 1T03L 1KPRB 2Q6WA 3DX7A 3QIUC 4P9MH 1UA6L 1HK6A 3S5LB 4HHAA 4NRZA 4XCNA 4XMPL 4Q9CA 3QG7H 4Y1AD 5AYUL 1FCGA 2AQ1A 3BPOC 4X6FA 3GSNA 5TQ0H 1Z9MA 5I18L 1JWUA 1Q1JH 3UJTL 5TJWK 1F11A 4HCRA 1MPAL 4PG2A 3MCKB 4NPYA 5MEQB 1F4XH 4ZTPH 3VG9B 4L3CA 5CBAB 3QZWG 3D25B 3BJLA 4KY1H 4DKDC 3TV3L 1WZ1H 1Z3GL 3KJ6L 2UUDK 5GRJH 1FYTA 4OZ4B 4Z8FH 3RHWK 1YA5A 3BEWA 2VDPL 5F7DB 1RU9H 1Q9WA 1FRGL 1I1AA 4S2SB 1CXHA 4R96B 3LEYH 1NAMA 3OWEA 4G6AC 1ZWIA 2MQ3A 3VXMD 4Z76B 4L8DA 4OM0L 5D70H 1BWMA 1ZA3A 5GSVB 4KV5E 2NQCA 2AI0H 3K7UA 4OLWL 2LV4A 2X6MA 3TYGL 1XZ0B 1TZGH 1TCRB 3SBWA 2YKLH 1E6JH 3IRPX 3CDYA 1ZHNB 1GPOH 2NY2C 4KAQL 4Q0XH 2NY4D 4GKZA 3TO2A 3VFMA 4NQTA 1LDSA 3ARYA 1QSFB 3WKMH 3DURA 3K1DA 4JFXA 5TH2B 5E2WH 3MLRH 1JF1B 4RIRB 2VXQH 5MEOA 5L7XH 1NL0H 3EDEA 2O93L 2V2TB 3D69B 2IWGA 4X7FC 5MHSE 4JFDE 4O51B 3AS2A 3VG9C 3BT2H 4LASH 3QIWB 4Z7UF 5INCA 5T1DH 3FOLA 4I4WB 2NTFA 3VFSA 4F8TA 3CDFA 5K33A 1ZTXH 3OHXB 3QIWD 4R96A 4LCCB 4M7ZC 4HC1L 2JK5A 5KS9E 1ZTXL 2CKBB 3K3QA 1KIUA 5DSCB 4CVXA 3F12B 4XCFL 4MJ5A 1F5WA 4RA3A 3O6ML 2KZWA 3O2DA 5HGAB 1S7TA 5C0NC 5D7LD 4U05A 2X9YA 2GQHA 5GRVK 3QFDA 4IJ3C 1Q94A 1DQLL 5E00A 2Q8AL 2ZOLA 4LLQA 4MA1C 1CDIA 1KG0B 5IHBA 4ZD3L 1FG2B 3ARDD 1G7LB 4DVRL 2WK2A 5ESVB 2HFGH 4TUKH 1GC1L 2SEBB 2ZPKH 4H26A 4H20H 4X5XA 3OJDA 4HT1L 4PJHE 5IVZA 2VIRB 3MJ6A 1SBBA 4XNXL 4ZQKB 3HB3C 1HDMA 3VXOB 3FTGA 5D7IB 4ZS7H 3TO4D 1CFSA 3BHBB 5ERWB 1MNUH 4L3EB 4OCLC 3WE6A 1PX4A 4PJCE 1UJ3B 1OAQL 1WZMA 2O5XH 4NSKA 4JPWH 3OAUH 5IG7A 2PR4L 5MEOB 3F5WB 5F6HI 3QDGE 1NFIA 3BW9A 3LDBB 1Q9LB 3QJHA 2NMSA 3MV9E 3R8QA 2I9TA 1PAMA 3F58H 4U1GC 5J9PA 1U8LA 4XGZA 3ZTNL 2P24A 2GTZB 1TXKA 4PV8B 2R56L 4LGRB 1L7IL 3DVIA 3QXTA 5EN2B 4DZ8B 4HBCH 3PQYB 5EWIL 4K9EL 3VXPB 4IRSB 2AV7A 4POUB 2HLAB 1S78D 1A47A 2PO6B 4P0DA 4ONOA 3RU8L 3KLSA 1J05B 4KV5F 2YD4A 4XP9L 1T7XA 3T0XA 3FQWB 4TNWK 2FHCA 3KLDA 4RRPG 4WWID 3QEUB 4PS4H 5GJTH 2QR0A 1AGEA 2R1YB 2OP4L 4UIKH 5HVHB 4TNVK 4PTUB 4U1MA 1KTLA 2QR0B 4D9RD 3G08B 1RMFH 4NKOA 5F9WB 1JZ6A 3H3KA 1JGUH 1QRNB 5EO1A 3RUGF 5HGDA 2R23B 4WUUB 3CMOH 4L5FL 4JQIH 2EO1A 4O51A 4FQLH 3SN6N 5IK3B 1L0XA 4WHYH 3RL2A 4LHQB 2CK2A 4NPYB 1XT5A 4MNQB 1A1NB 5MEQA 2UVEA 1CG9B 2EIEA 3KWWA 3CXHJ 5DGRA 4O5LH 2OZ4H 2E7MA 2YA2A 2ITDB 1MOEA 4HUNB 1MUJB 1WEJH 2E9WA 3QH3A 3U6RB 2YRZA 3L7FA 2MOVA 5GZOD 4BZ1H 5D7IE 3D2UD 2X1WL 1MJ8H 4L3EE 2XA8H 3NFSL 5FECB 4FABH 4KK9C 2W07A 4MMXC 1S7RB 2IGFL 1Q72H 4KDTA 3RVTD 1AO7B 5LCVH 2X7LB 1MRCL 4E9LA 4WFED 2DKMA 4DGIL 1GXEA 1TQBB 3OJDB 4WW1A 3L3IB 1DBJH 1OAUL 3VD9A 1AQDB 1V7ML 4TULL 5JPNB 4ZPVB 1RJCA 3VXSA 2V5SA 4UQ3A 1NPUA 5I8OH 4N0YH 2UWEB 4M7KL 3SGEI 2ICES 1CWVA 4OIIL 3D2UB 2DLTA 5MENE 1U95A 2O61B 3N0PB 4LFHG 4G8FA 1P69B 5FYJL 3TIDB 3MRMB 2ZCKH 1NGXB 1HYSC 5DVKA 1RUKL 5FFLA 1V7NH 4NRYA 5CZXD 2BFVH 4NQEE 1NUGA 1F11B 3MRGA 2EIZB 3NN8A 3STZA 4JFHE 4JFEB 4RISL 4JFOB 5J1TC 1WFNA 5GGVY 2CDFB 4TTDD 5AYQA 3ORJA 1T7WA 3LKPB 1QO3A 3D85D 3OXRA 4OJFL 3ZT6A 3RVXD 3D69A 3QEQD 4I3RH 1EJ6A 1L9NA 2ZUWA 1RI8A 1V8HA 2ENSA 5EBGA 2VQ1B 2WWMC 4AZ8A 2W9LA 5EU5A 1UZ6E 2N7BA 4GW4A 3U30B 4MHHG 4FP8L 2QSCL 4KJPD 4OD2A 4XC1L 3UROR 2R2BA 4X5LA 1P4IL 4U6TA 2NY3C 1DQMH 1AGFB 4I77H 5DDHB 4HJJH 5DK2B 4Y1AA 4ODUB 2QSCH 3QIBA 3RTQD 1RJZA 2MNUA 4NGHL 3KYAA 4PLOB 1DVFA 2BNQE 3GI8H 3RVWD 2VNCA 4L4JA 1QLRB 4MDJB 2FB4H 3WXWH 3GJFB 3K8MA 1I3UA 4FQJH 1K8IA 1U92B 3FZUD 4OKVA 4R7DB 5FUZH 2BHYA 3DRTB 1ROWA 2EH7L 3E1F1 4K7PH 3SGJA 4RISH 3ILPA 3JV5A 3IU4L 1ED3A 1RAMA 5IBLC 3BQUB 5D8JH 4OCSL 1LD9A 1N3NA 1LNUA 2BMKA 4NHCL 4Z7VA 2EEBA 1WFTA 4DTGL 1I1AD 4PLJD 4Z7QF 1FE8H 1KULA 1T7VA 4XX1E 4Y7MA 3T65B 3B9DA 1A3LH 4LLMB 5E5UB 1D7FA 5FYLD 4DUXA 5I73B 1X6NA 3MCKA 4JCMA 4MCYA 5FYLH 1OTTC 1KLFA 4MD0B 5IEKB 1DE4B 3UJTH 2VABA 2NCMA 1P6AB 4ZFFA 5C3TA 5CGYC 1BEYH 4K8RL 5E8DL 2CH8A 1DFBL 5HHPA 1A6VH 4GMSL 4Q7DA 4AM0B 4KRPC 2J88L 4ZNEE 4E0RA 3EYUH 4K7PL 2APFA 4N1HB 4NHUB 4YBQC 5ESAA 4JY6B 3UAJC 3CSYB 4OLEA 2BVUA 4QNPE 1Z2KA 4ERSL 2CGRH 5C92A 5E70A 4H1LG 4UT6H 5HGBA 1J5OL 3V4UH 1J12A 4Y5XC 1OP9A 35C8H 4LGSB 4JM4H 5DFWH 5E2UH 2VN4A 1LNUB 2BMKB 2B5IC 1I9IL 2B2XL 3BO8A 4JRXD 4K3DL 4FTVD 3CJJA 4XMKL 2Q76A 1QRNE 3C5ZC 1LO5B 3ULUC 2MHAB 3B9KB 4S1SH 4Q9BA 2ZJSH 3FO9A 5EC2A 1OPGH 3V6OC 1H3VA 1YEGH 4D0DA 1EMTL 5SWZB 4FZ8L 2VDQL 1RZJH 4YK4B 1YEFH 2AKRB 3QIBB 4TSCH 3TO4A 3HRZA 1UCBL 2DB8A 2RGSA 4DKFL 4CVZA 3O3EA 5I9QC 1KYOK 1D5BA 3OKNB 4G6FB 4XWGH 4KVCL 1BQHA 5I6XB 2C3WA 4HAFA 3CFKB 3Q1SH 4YHPA 3TEUA 1C12B 4HWNA 2H26B 2MQ0A 2DQDH 5F6IC 2A6DB 5DRZB 1H3UA 2OK0H 4MD4A 3MLRL 3MLPA 4ZMAT 1B6DA 3O3EB 3GB7A 3DRQA 4HUXA 3V79C 3KXFB 1YEDB 3MRGB 3NN8B 5DC0A 1QLEL 2P43B 2Y6SD 3WSQL 1FVCA 3BZFA 4LKXB 3WJLC 3KPSA 1HQ4B 3LQAL 3L5XL 4R8WL 2B5IB 4OZIA 3K2UL 1QVOB 4TNWF 5J3HD 3LQAH 2YKLL 5GJSH 1R5VA 4XNZC 4JFHD 3S88H 2Q76B 4GBXB 3L7EA 4BA8A 4H8WL 4RGMC 4PD4J 4G80B 1T4KA 1MCOL 4NQDD 3TBSB 5FM5O 4KFZC 1IFHH 1WV7T 1NMCC 2Y25A 2YD5A 4NQDB 3RWEA 3E6HA 3U7WL 4RA0C 4UDTA 2Y7QA 1FFPB 1KV3A 4NQSB 3QWRA 1ZLVK 4IIQC 4LVHB 5T1KD 1P9MC 4IRZL 3R8BB 3PL6C 1LK3H 4OF5A 4Z0XA 4KQ4H 4ODTH 4LVOC 3IGAA 3V6ZB 1WUNT 1RJLA 2CJUL 4ETQA 5IMKB 1GHFL 2EE9A 5EU3B 4LSVL 4JN2A 3RY6C 5MEPA 3AS0A 2PETA 4LLAA 4YDIH 5HGHA 3RWIB 4HC1H 1NFDE 1N6UA 5EUOF 4A6YL 5JIIA 3GRWH 4JFYA 2IBGA 1GGIH 2R4SH 4R0LA 4P4RB 4U1HA 5IEKA 1NUFA 3PWJA 3QIUB 4F7PB 1CGUA 3WCYA 4PGDA 3VFUA 2NY0C 4KDWA 1QSED 2BSED 5E94A 2R9HC 5CZVH 4I48A 2E27L 2J6EL 2P8LA 3T77A 4M1CC 3FN3A 3BWAB 4HCRH 5EBWA 1KTDB 2CUMA 1AGDA 3IF1A 4G6MH 3TBYB 3WFCL 4NT6A 1JHKH 3H9SE 3GSNH 3QNXA 5EZLA 2F54D 4HIHB 4JRXB 4UB0H 1TJIH 5GRVL 4QRRB 2Z35B 3GSWA 1NMCB 2FO1A 5FOBA 4ZFGL 1C7TA 5DJCB 2P45B 1ACYL 1UH2A 4J3WA 2Q7NA 4WU7A 4J3SA 1ZT7A 3O2VH 4LCIL 1II4E 1OARL 1QACA 4UINL 1B4JH 3HPLA 5FGBC 1RUQH 2CLVA 3DI3B 1DVFB 3CX5K 1EUTA 1MHEB 2VXSL 2AS5M 1E27B 3GSQB 5FKAB 4E41B 3EDFA 4I3SL 3X3FH 4P2QA 2ESVE 4OZHA 1F4XL 4ZTPL 4FQPA 1KJMA 1P7QA 1OGAD 4LCWA 3WDIA 4QY8A 5E1AA 2JB5L 5JXED 1OTSD 4K3DH 1CN4A 5I76B 1QNZL 2DQCH 2P42B 3VFOB 1OF2B 2YPVL 1IM9D 2C1OB 4NSKB 1N5YL 3BUYA 1DQQA 2CSPA 4G43A 4OT1H 1PYWA 4G8IB 5D93B 5T5NG 3KXFD 2VZ1A 5FA4A 4MA8H 4UT9L 2FEDC 3HFML 5KSBE 5FHAH 4XMLH 2JB6A 4PBVC 4PLKC 4S0SD 4AJ0A 4C56D 1IC5H 4N90E 5I1GH 3EJZD 1NGXA 5ITBH 4UINH 1FDLH 4G8GD 3VXSD 4OZIF 4YZFF 3DVGB 1CVRA 3ARVA 3D0VB 4PJBE 5IBTH 5IVXF 4NQXA 3LQMA 2VISB 4O2FA 4WUKL 1RIVH 4RNRA 1KOAA 2YEZA 3WS3A 1RHHB 4LCCC 4M7ZB 2FGZA 1K4CA 3VH8G 1OF2A 2DQDL 3HI5L 5HDBE 3EFFA 3U0TA 1I1YB 3IDNA 5JOFB 1GIGL 4U6XA 3V2AR 3KYOA 4BZ1L 4P5MA 2QSVA 3BKML 1JPFA 4XVUD 1Q0XL 3TBVA 4R6UA 2X09A 3RA7L 1BM3L 1S9VA 5KZCD 5IROC 3RGVC 5B8CB 2XZAH 3EO1A 4HJ0D 4RIRA 2NY6B 3NCBB 1WICA 4HDIA 2RCSL 2PYEA 2CKNA 3TN0D 5I1AB 1YQVL 3OKKB 1BD2A 3VDCA 1ZVSB 4HKBA 1UJ3C 3QDMB 3VGGA 1QQDA 2AXFB 3VFMB 3KPLA 2WWKT 4EDXB 3IDUA 3LDBC 3FHAA 4OBSA 4OCNC 3O81A 1XCTA 1K5NA 2BOBA 5LQBL 4QO1A 3FN0L 1JYNA 1NC4A 4OAWA 3WFDH 3CFDA 5C07A 3P0YL 5AG8A 5DHVH 5E2VL 5C07E 4XVSL 2VDOH 2DQGL 1UGNA 4P5KA 5TGBA 3VWKA 4EI5B 3NCYS 3FQNA 3R06B 1FBIH 4LIQH 2A9NL 3G9AB 4DK6A 1IZJA 4MCZA 4P57B 2IQAB 3EFDH 2C5DC 4U1HB 4HK0B 3FQXA 2BVPB 4MJIB 1UENA 4QF1B 5T33L 5KJRH 3H0TA 4XPHH 4OGYL 4EOWH 5LGHH 4YIQB 5C0IB 4JRYA 2GK0A 3AMLA 2NYYC 4X9FA 2YUVA 4PY7B 1FYTD 5IJVA 1CFTB 4CN6A 3DTXA 3H7BA 2J8HA 3GSOA 4XXCA 5CILH 2Q87A 3LKSA 4JFQA 3B9VA 3GZKA 2A6IB 1VADA 4I0PB 5CHNA 1T83A 4JO3H 1JWSB 4WFHD 4XNMB 1T2QH 3B43A 3E0GA 2DI7A 4UOW1 4WY7L 5SWQA 2D2OA 1U8LB 1WBZA 4NO5A 3VXMA 1WWBX 5DZNA 3AGVA 1OW0C 1NEZA 3N1FC 4JANA 4UNUA 1NUDA 4OGAC 3EOBA 5L9DL 1B3JA 2X44D 4KKAC 3OAYK 4HH8A 1QBBA 5EUKB 4HUUB 5GGSY 3SJVD 4A6YH 4QXTB 1Z6JT 4PJBA 5D8JL 4F2MA 3RY6A 1FZKB 2Q8BL 4Y5VB 1EO5A 2BSSA 4EI5C 1FZMB 2EH7H 1X5GA 3D1MC 4PJHA 5ESVA 3HMXH 3HNVL 5CGMA 1NH6A 1A7OL 4X8JA 3DSNA 3DRQB 5C9KA 4S1SL 4RMRA 3Q6FA 5EBMA 3ZYJA 1IAMA 4UDUB 4XVTH 4XP4L 4N8CH 4ODSH 1SBSL 4JFED 4JVUA 4MDIB 4X99B 4WFHE 4LCUA 3S98A 5JW4R 3I6KA 3HHRB 4YHPB 1YNTA 3S3PA 3TBWA 4MA1B 4MGXA 1P6FA 4HV8A 3V52L 1NMBL 3RAJL 2W60B 5A2LH 3O8XC 2P5WB 2E7BA 5LAXB 2ZZUT 3NABL 5H2BB 2A9ML 4N8VG 3RIAK 1P4LA 1PSKL 4DKEH 2XN9E 1J7VR 2HT3D 1LE9B 4PJEA 2DQTL 1RIHL 3P0VL 2Z31C 5C3LD 1BX2A 3QHTC 1KUMA 5ADPL 1EEQA 3MGOA 3C5SB 1OOAA 5EU6B 3CVIH 3DURB 4YDJA 1FNGB 2JKXA 2VR9A 3VXNB 2H6PA 3GJFH 3FO2B 4LAJH 4WWKC 3P3YA 3T2QA 4HPYH 4M5ZH 5BZDA 5DHVB 5FCSH 3LMJL 3H8NA 4BH7B 4FZ8H 4L9LC 5C0DA 5J89A 2VDQH 4X6CA 3F7VA 4ONHB 1S78C 1W0WA 4HIIB 1F4WL 3RWGB 4HWBL 1FNFA 3TM6A 3GMRB 5EOCH 4DKEL 3L1OH 2DM3A 5T5FH 1HWGB 2YBRB 3GHEL 3C5ZA 1AE6L 1X5AA 2CMRL 1MFBH 1FYTB 4LAQH 1FSKB 1PW3A 3KPQA 5DWUL 1R0AH 2AJUH 2Z31A 3NIFE 4BSJA 1LP9E 3WFDL 4PRAB 4OUUB 2ED7A 1AHWC 4JJ5A 3ULUH 3IDJA 4U0RC 4YX2H 4PRID 1CFQB 2PTTB 2P5WA 5IQ9B 2AABL 1W0YT 4QF1A 2PXYA 2CKBL 3BDYH 5D2LF 1LVEA 3FQRB 1NMAH 5D1ZA 3SCMA 1ZLVH 4IMLB 4JHBA 2AERT 4WWKB 2WQ8A 3RX8A 3GMMA 4NUGL 4N0RA 2XWJA 3CFBA 3PHSA 4H5SA 1FH5L 2GFBA 1T0MA 4KVNH 5D96B 4PJDF 3EJJX 3RBSA 3S97C 5TPWL 3F6LA 1WCBA 3B3IB 3KPSE 5D5MB 2IF7A 3MV9D 3BRGC 1WGOA 2X1XR 5C6TL 5CIPB 1CE1H 4QHLA 5HHMB 1LO3L 3D6GA 2XN9B 2E3VA 3B6SA 2D3VA 3D39B 3MTRA 4W6XB 3RNQA 3BP6B 3UTSA 3QIBD 4P9ML 3RTQA 4XI5D 1N2RA 2H8PA 4XPAH 2GITB 3K4ZA 3RWJB 4UT6L 1SYVB 3FQRA 3DXAB 5E6ID 2YSSB 2V5MA 1YC8A 4J23A 1FYHB 2ADFH 4M9OA 1YEHH 5LAXA 1DL7H 2QQLH 5SWQB 3B9KC 1CL7L 2E7CA 5F6HJ 1YEHL 4KZEH 1CF8H 2YWYA 1I1YA 4OGYH 4EOWL 4ERSH 4MJ6A 1TNMA 4LRIA 4KTYA 3IFPB 3QQNA 2JB5H 2GYSA 3HG1A 4JM2F 4K71C 2XXMB 2W65B 1LE5A 4P99A 4XBGA 2UWEF 2E9JA 2YBRA 5JOEA 3U30C 4PJHB 5FKPA 4HF5L 5JDSB 1EHXA 1B9ZA 5LGJB 2FSEB 5DMIL 2YPLA 4QYOB 4JZNB 3EJYD 1R3JA 1AIFB 4HKXA 1RIUH 3VWKD 4YAQA 4HS6A 1CLYH 2IAND 5FYKU 3DX9B 4LPYA 4YDKH 5BS0B 5IEHB 2IAMA 1ZT1B 1F4HA 4XWOC 1CLOL 4JO4H 5IKCA 5EPMA 4ZAKA 3CX5J 4K94L 4PJ9A 5E8NA 2YK1H 1XCTB 1CLOH 5JZ7C 1PG7W 2MWCA 4GRWF 5FM8A 2W1NA 4NWUH 4MB4A 2AXFA 3VJ6B 1VACB 4NO5B 3VXUA 1DQDL 2DYPD 4XNZB 4P2QB 2QHRL 4GBXC 1BD2B 4H0GA 4N0YL 1K2DA 3NH7H 4RGMB 4YFLF 5C09D 3VGBA 5HBBA 3OB0K 2FHBA 3MRFA 1AI1L 3UPRA 3VXTA 3M07A 1CG9A 2IH1B 5C0AD 5KW9H 4GAYA 1PZ5A 2R0WL