2QHRH

Crystal structure of the 13f6-1-2 fab fragment bound to its ebola virus glycoprotein peptide epitope.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
EVQVVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISRGGGYTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCSRHIYYGSSHYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
pubmed doi rcsb
molecule tags Immune system/viral protein
molecule keywords 13F6-1-2 Fab fragment heavy chain
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2007-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qhrH01
5FUCC 4I2XA 1F3DH 3AS3A 1HZHH 4XHJC 2VXSH 1JI2A 3MRFB 3U46B 4MNQA 3SQOH 2W59A 1FFQA 4RISH 5GSVB 5TQ2L 3WFCH 4JKWA 4N1CA 1F6LL 4U1IB 5EOTA 1XGPA 1A9BB 1CIUA 2QHLA 5F8RC 4Q2ZA 2WBKA 3TBVB 4X4YA 3EFDL 4LSQH 4O2CA 5D7KE 3QUKA 4LCUB 2CDFB 4G9FB 2RJMA 1WSST 5FM5M 3QHZL 5CZXC 4KAQH 4LVEA 1DN2A 4YUEH 3RZCA 1A3LH 3HRZB 5FB8A 2B0SL 3VDBA 1XAUA 5GHWL 3CDFA 1DQDL 3MRQB 4JO2H 1AY1H 2BP3A 5E2JA 5MEQB 3I2CL 4FQXD 3TEUA 3L5XH 4HUNB 2BFVL 3D3VE 4RNRA 3I75B 4OAWA 4S2SB 4JPWH 3O41A 5ITFA 1HXYB 2Z31A 2ENYA 2XRAH 1JN6B 1TCMA 4BELD 2EH8H 5DS8B 4PJXF 2JK5B 4Y4HD 3C08L 1KSRA 4LSSL 3K1KC 2WNGA 2ZP0T 2GJ6A 2JF1A 1N6UA 2XA8H 3PWNA 4NJAH 4W68A 3QUZD 4G7YH 5IMOA 3G5YA 3BN9C 3L3OB 3HLAB 3NGBB 3NGBC 2IH1A 1YN7A 4M5ZL 4KJQC 3D85A 4U33A 1YEHH 2ORBH 2FO4B 4J3VA 3VFNA 2H26B 2YC1B 1TITA 1FZJB 1VFOA 1G0DA 4ZOAA 1O7SA 2A6JB 5HXMA 3SY0B 3QDGE 4LGPB 3L6FB 4H25A 1UQSB 3I6LE 5EOQL 4LLAA 4QWWC 1QR1B 1AGCA 2RBLA 3SJVB 1E4XL 2DB8A 2OR8A 4P4KD 1X7QA 2YD4A 3PG2A 3BP5A 1KCRL 1YQVL 3N1QC 4JN2A 5JPMB 1K3ZA 1VEOA 5A2LH 3NFNB 2V2WB 1A3RL 4ZTPH 2B2XL 3T4YB 1NCNA 1Q8MA 1ZV5A 4XB7A 2ADFL 1IVLA 2PTTB 2NY0B 1WQVT 2NY0C 5E8NB 2R1XA 1T89C 1CZ8H 1RUPL 5CJXC 3P4MB 3MJ8A 1CGUA 4ZUWA 3KJ6L 3QFDA 3D39B 1EEYA 2P43B 4F7TA 2FB4L 5LBSH 4DKEL 2DQUH 5KSUB 4PJAA 4X6CB 4P2RB 3TV3H 2R0KL 4UINL 5BZDB 3HI5H 3HI1B 1NDGB 4JAMA 5FKAB 3ILQD 4OF6A 4HW6A 3FN0L 4GKNB 4Z7WA 1UB5B 2PTVA 3RVUC 3VXUD 2B0SH 1RJYB 5I73C 5I73B 2BCKA 4MXVF 1VADB 2BNUA 3ZSSA 4JFYB 4UDUA 2D7TL 3K2MC 1QBLH 3IDIA 1D5XA 2X4UA 3HNTL 4Y19D 1F4YH 1FO0H 3EKCA 1L7IH 1G9EA 3GBNL 3QG6B 5IHUH 1EEZA 4ZS7H 3C08H 3ES6A 4F7EB 1QNZH 4QXTA 3LIZL 5H37H 3H42H 4XWOC 5CBEA 4KJPD 5D96C 5D96B 5I8CA 4D8PB 4XB8A 2BDNL 1E28A 2AK4A 1BJ1J 1P4BH 3B43A 3OAUL 2AKRA 4ZPTB 4LSSH 2OBGA 1R3KB 4RA0C 5DJ2A 2WP3O 4K07A 1E6OL 4YFDB 2GSGA 4YHNB 4LPUA 4A6YH 1CR9L 3RWHA 4CNIB 3AS1A 3M17B 4RFOH 3SKMB 3RA7L 2WP3T 2Y25A 2HKHH 1F58H 1CG9B 1D5BA 2VZOA 2X1OA 5JDSA 3SE8L 3BIKA 4XNUL 4UILH 4E5XA 2E5EA 1B4JL 2MHAB 4LSPL 4TUOA 4X5WA 1NC2B 5FO9A 2EZ0C 1N64L 4FQQB 4HHAB 5T5FL 2RFXB 4FNLH 4JQVA 2JJSC 1SBBA 2CLRA 4NGHL 3GSUA 1ODAA 1NANH 2XXMB 2XWJA 4QKXB 5DR5L 1I4FA 3BKYL 2VDML 1WIUA 2BC4B 2X7LB 4JO4H 5L9DH 1YEJL 1AGDA 2DOCA 2DQHH 1DUZB 2ZOKB 2O5YH 4KTDL 4WV1B 1KBGH 4WV1C 5ANMA 2QQKL 1CT8B 3IXAB 1OY3B 2ZKHH 3MLRL 5EORH 1OAYL 4O02H 3C60D 3IKCB 1A14H 1CDHA 1QZ1A 2K7QA 1U92A 3W0WA 3RHWK 3SDDA 4ODSL 4RWHA 3PDDA 4Z5RA 1GVIA 5EU5B 4NQCA 3L7FA 4HPOH 5B39A 1S9WB 2R56L 3S5LA 3LKSB 1UKTA 4C4KT 1H5BA 4R90L 1U8PA 1SQ2N 4MAYB 1P6AB 4MAYC 5L0QB 5L0QC 2OP4H 2LFGA 2R0KH 1KGCD 3ZDZF 1TCRB 2NYYC 5I1DA 5DMGC 1GH7A 3JWNC 1OAZL 2YZ1A 2P7TB 2NY3B 2NY3C 4M03A 3GI8H 1KPRA 3B6SB 1FN4A 1K8DA 3PXHA 4M7ZB 4M7ZC 3RWGB 1H3VA 1UCTA 2EEBA 3BPLB 3BPLC 4LLWA 4PBWD 4HF5H 3NAAL 4Z7VF 1T2QH 3HB3C 3HC0A 2OL3A 1I85A 4HPYH 2BVUA 5LGJB 1U8KA 2M1KA 5I1DB 1UH2A 1DR9A 4ENED 4Y2DD 4YH6A 2YPLB 1G6RH 2Q3AA 2ZJSH 5DHVH 5DWUL 5HHNA 3RL1A 3WNLA 2ESVB 4NO0B 3Q5OA 1ZXQA 2GSIB 3CLFH 2N7AA 3OAYH 3MLVL 4MQTB 3CMOH 2EE2A 3JWDH 1YY8B 2Z4QA 3REVA 3V4PL 1QP1A 3ULVE 1QYGH 1SYVB 4MMXC 4D9LH 2JB5H 1X6LA 3QI9A 1LDPH 3WXWL 3QP3A 2VKXA 4P59H 4NQSB 3BO8B 1A7BA 4ODXB 4GW4B 3D85B 2DLTA 3MUHL 1TXKA 3MACL 3HAEA 3ROOB 3DXAD 3KLAA 4MLIA 4P4RA 4U1HB 1CXKA 3BUYA 3OJVC 3I84A 4Z95L 1R3IH 3ARTA 1KBGL 1RHFA 1RU9H 2DQTL 5EUKA 3G5VA 3L3IB 4ZMAT 3EIFA 3WSQL 3LRSA 5IBLD 2DWDB 1OAYH 4MSWB 1A14L 3TO4D 5LQBL 1I3GH 4R97B 3NMEA 4R97C 1Q72L 5F9JA 4LP4A 1LEKB 3QDME 5IF0A 4BKLB 1NAMA 2VLKA 2EYTB 1MEXH 1FVDB 1Z9LA 3CXHJ 4NRZA 2E7MA 1NCBL 3TVMC 3TVMB 4B0MM 1G0YR 2NX5A 4Y4FD 5H35A 1RZGB 4PG2C 5J0BA 4GMSH 3OKOB 3GRWA 5I17B 3DX7A 4P5MA 4C83B 4BM7A 3WDJA 1KACB 3SE4A 4LARL 5TE6H 5JMOC 4G6JH 2Y36L 5FV1L 1ZMYA 5HBBA 1P7KA 4YK4C 4YK4B 2YRPA 3VD5A 4KK5C 4PRPB 1LD9B 5DK0A 1NFDE 4ZOBA 3V0VA 4XNXL 3ES6B 4OLXH 5L6YH 2OJEB 4ORZC 3DECA 3UXFA 4AM0B 3C9NB 1RURH 2I24N 15C8H 1KOAA 2ITDB 4GRWH 5EU4B 1G0XA 4YXHH 4APQA 3QXAA 4FRWA 5I17A 4UDUB 3S35L 5FCSH 5C7XH 2DM4A 1A3RH 3BEWA 3VFGL 4EIZC 4UV7H 4WEUD 5FUCE 4ONFL 3VFOA 5I1CL 3ZYZA 1HZHL 5CZKA 5GJTH 1ONQA 4Z76B 2Z93A 4JGJA 4Y4KD 3O8XA 1J7VR 1MHHA 3VE0B 3OGCB 3I6GA 2JCCE 4XBEL 3JV5A 4ZODA 3C5ZD 1YEKL 4V1DB 2V9TA 2WW8A 1FNLA 4ZOCA 3P4OB 1I8MA 2YPKB 4X9BA 5GIRB 2WLYA 4BK4A 4OD3L 4TVPL 5E94A 3RUGA 1VESA 5C0AB 5SWSE 2EYSA 2C1OA 3RGVC 3RGVB 3HTLX 4DVBB 3X3FH 4QTIH 3WS3A 4PLKD 3CVIL 4LCWD 4ZUSB 4YJZL 5EN2B 4H1LH 1CGSL 1HYRC 5D2NE 4DCQA 2ILLA 3O9WB 1CD1A 3O9WC 4FTVA 1NFIB 1S9XB 1TDQA 12E8L 4TNWF 2VB5A 4UNUA 1PY4A 1KJ3H 3RX8A 1VGEH 5CBEB 5C0AA 1K8IB 3IRZA 4FQIL 4ZFZA 4KZDH 2YD2A 2VRAA 2W65A 1H3GA 4WO4D 1UKQA 4HX1B 5C0FA 1LEIB 4H1LA 1C1EH 2YK1L 3I9GL 3T0EE 4JLRB 3AFLA 3LKOA 1B0GA 3QIBB 3QIBC 2AJXL 4NHUB 5DD0H 3ARFB 3ARFC 5MEOB 4NUJB 4S1RL 4XBGA 1V8HA 3KYKH 1CGTA 4L4VA 4OCRL 2MKLC 2VJXA 3U7WL 2DYPA 3IVKA 4OAWB 5ITFB 1T1WA 4ZD3H 3IDJB 4U7KA 4L4VB 3QNZB 2DYPD 5IVXF 4AH2B 5CZVL 3OXRA 2B2XH 4WWID 1BWMA 4DQOL 1S7RA 4X6FB 4L4VE 3KJ6H 1B0GB 4P3CH 4PJFE 1T4KA 2CIKA 1F3DJ 1PVHA 3BX7C 3QUKB 2VDKL 1BOYA 4EQ3A 3BESR 2FATL 1YNLH 3O4LB 2HFEB 3ZTNH 2G5BA 1PG7L 3MSPA 3VW3H 1TZGL 1A2YA 2EDJA 2QQNH 1DBBL 3MCG1 2Q1EA 3RX7A 3R0NA 4FP8L 4DAGL 1OB1B 2RB8A 1XR9B 2Z35B 3D6GA 4OGXL 2HLAA 1QA9B 3SPVB 3S5LB 4QNPE 3EYUH 1ZAGA 3K74B 4JG0L 1KB9K 4JFHD 4N8CL 4J12A 2R2HA 4OQ1A 3EJYC 3KYAA 1KTRL 4YXKH 3ZO0A 2GK0A 5I30H 1G9MH 4XBPA 3ZTJH 4D3CL 1UB6A 4U2ZA 4HWEL 2EDHA 4WCYL 5IF0B 1LEKA 3FO1B 2X4RA 1MCJA 2A1WL 4M43L 4PJCE 5DMIL 3RP1A 1NGWA 4LLMB 1JV5B 5F3BA 3MV7D 4P5KA 3X3FL 2OXHA 2FEDD 5AZEH 3ULVD 4X98A 5GGTA 2X2YA 4QXUH 3IF1B 2Q8BL 2DJUA 2CRZA 2XFXA 4HWNA 1M4KA 4IMKC 2BRRH 5E2WL 5MERA 4RFEB 3ZHDA 5EFIB 3KG5A 4OQTH 3CH1B 4IOFC 5I19L 1PD6A 1KC5L 5DUMH 3VFOB 4QHUB 4XAKE 1PBYA 1T6VN 2E27H 3INUL 3U79A 3RIAF 5AAWA 4UT6H 4L29A 3QXUA 5E8PA 4PJ8C 4PJ8B 3HMXH 3LKQB 5DR5H 1IEAB 3QIUD 4M7KH 1F6AB 3CMOL 5C6PB 4LSTL 5KSVA 4PYHA 4PRIB 3QXAB 3FO9B 4BFGA 2W38A 2FEEL 3SEPA 2A77H 5CKAA 1FNGB 5E9DD 3RGHA 3QDMD 5EOCJ 3TH4T 5F7EH 5GGRA 1RULL 2WINB 3QPQD 2BERA 5L2KD 1ACYH 3CDGA 5KS9B 3FO0L 3H9SB 4PP1D 4S1SH 3OKKA 4M61B 2F58H 4ZPVA 1QFPA 3H9HB 5E0QA 3EO1B 3MLYL 1A6UH 1F4AA 2DQTH 4IS6A 2D4DA 2GK2A 2ZUSA 4GG8B 1EHLL 5BCAA 2EXYC 4Z7VE 5DJ6B 1U8HA 4FMFA 4OIBA 1YMMA 5F93C 1HIML 5C9JA 2XN9D 3HMWH 1FNAA 3BVNA 3PDOB 4NUJA 3TFKC 1YEIH 4IRJA 2NXZC 2NXZB 1TZGH 3RNKA 1JPTH 3QUYB 3QUYC 1KLGB 4UNTA 1AGEA 4OLUL 4WTZA 2J8UF 2EECA 1Q0XL 3LQAL 3QO1A 1T5XA 3RPIA 5IBTL 2C3XA 2K9UA 2QL1A 3SDDB 3SDDC 5ADOH 4NKMA 3MNZA 2VO5A 4OTXH 5GZOC 3IFOB 1CI5A 5JHDD 1BWWA 5BMFH 5DTFA 5D7SL 3SCMD 3GBLA 1ZHBB 2VDNH 5T1KB 2D7TH 1QRNA 1YEEL 3RVTC 1QG3A 1U8JA 4M6ML 4KK8D 2VLME 1AD0B 5EBMA 1CGXA 1KV3A 4AIZA 5DDHB 3WJJC 4RAVB 3CFIC 3Q3GA 4XMKH 3WS3B 1YEGH 3QHTC 4XAKD 2A73A 2O5ZL 3Q48A 2AEQH 5EU3A 4PJ9D 5DD1H 2I27N 4LSUH 1IGTB 3RGVA 2QKIA 1HHGA 1TTUA 3SDAA 4S2SA 1KEMH 3P4OA 2DMBA 3W0WE 2OL3B 3BJ91 1R0AL 3MROB 5LGJA 5CEXB 3R0MA 5H2BA 1YNTB 1EVTC 1CR9H 2PCPA 4EBQH 25C8L 1Z0MA 5JO5B 1ADQH 3RWGA 3GSVB 1BVZA 1FLTX 1KTKE 3OL2A 3BGAA 3O6KH 2CO7B 4O2CB 3B2UD 2AI0L 4TVPH 5HI3D 4LK4A 1NSNL 5GISL 3VXUE 2E7LC 2EDKA 5ESAB 1RK1B 2VUOA 5I71B 1DVFA 5I71C 1YEFL 1GIGL 3I50H 5IMKB 4OKVB 4LEOB 4HH9A 4UZGA 3BT2L 4DKFH 5B38A 1QSEB 5C07A 5CFHA 2Q87A 4Z7WB 1KLFA 4HSQA 4XXDB 4X4XA 1BAFL 4X5XA 2UWEA 1Q0XH 1U41A 4R7NB 1K4CA 1WICA 4G9DA 1F3JA 5C70A 2E6QA 1OOAA 2XT1B 4WVRA 3DYOA 1T20A 2DQEH 2H2SC 1ZLWH 4QRPE 3QCUH 1AD9A 2D0GA 1FZMB 3CU7A 1WZ1L 1SEQH 5EWIH 5JIPA 1QO3A 4OFDA 3OKMA 4ZS6D 4JM2B 4JM2C 4MNGE 3TNNA 1NEZA 2WIMA 4BA8A 4NZTL 4OUOA 5SWZD 1KENH 2C4XA 3N50A 4OZFG 3MZTA 1JHKH 3VJ6A 5CD3A 3DSFL 4PJ5A 4KPHH 1I9IH 4JDZA 4CKVX 4GT7A 4DW2H 5EUKB 5F6HI 3CPLA 1F90H 3LRSB 3S3JA 3RWHB 1VFUA 4ODBD 4CNIA 4YDIH 1HEZB 3HA0A 1NCAL 1A64A 2JJWA 4U1HA 4HKJA 5JOPD 3D0VB 1MVUB 1R3JB 5F9DC 1DQTA 3SQOL 3BYTA 5J7CC 3DROA 1VGKB 4U0QB 4LLQA 4C55A 2BRQA 2H26A 2YC1A 3B2UC 4NFBA 1R5WA 3TGXA 3MJ7B 3D3VB 3RNQA 2XWTB 3MNVA 4TUKL 1RZFL 5GGSB 3REVB 4X6CF 4Z77B 2EC8A 2VTFA 1NGPH 1MRCL 2H3NB 3EYUL 4UQ3B 3RWIA 2V5MA 5FYJL 4JVUA 2BCKB 1T0MA 2R0WL 3T3PF 3MJGX 3MRNB 3MODH 4NO0A 1G9NL 2VXVH 5DFVD 3C6LC 1FC2D 3C6LB 1JF6A 4D3CH 4HT1H 4OM1H 2EDWA 3O41B 5EZLB 1IC7H 4YHML 3DIFA 1P7KB 4FFVC 5GSRA 1G9MC 3QFDB 4TNVK 4LHUA 1Q1JH 1PJ9A 4NNPL 3WE6A 4ALAL 1HH6A 5DVOA 2Q6WB 1C1EL 3QISA 4UBDC 5CEYA 2XYCA 5T1KD 2AXJA 3RWEB 2WINA 2A9NH 3O0RL 1V05A 4F37K 3PHQB 4LIQE 1KFAH 5GRVL 4PV8B 4M8VA 5B4MD 3BP5B 3SGJA 3GEWB 1HHHB 3ZE1F 4D9RD 1UWGL 3CUPA 3EFFB 4P2QD 3S5LG 5F7MC 5HHOB 1RPQA 3DTXA 4XTRD 1CDCA 1O0VA 1N4XL 1NBQA 1XFPA 3HNSL 3O3EA 4WHTA 4AIZB 4BZYA 1BGXH 1FFPA 3PIQB 5IW3A 3SO3B 3NIFF 3SO3C 5FEBA 3C8DA 1GGTA 5I8EA 2ZUTA 4CJ0A 3T0EA 4KK6C 5LG1A 3MYJA 4OD2A 2P4AB 4XI5D 4PGJA 2YN5A 1A1OB 1YYMH 2ZCLL 1S9XA 2CR3A 5IFAH 1CYGA 3DVNB 3LQMA 4FTVE 4PS4H 4X5LA 4ONOA 1U8OA 2CLRB 2BVOA 1GYAA 1A7RH 2J3SA 4O9HH 2B8OT 2XWJB 3H9SD 1S7VA 1KLGA 4NM8L 2VXUL 3L5HA 3F6LA 3NCEB 5SWSB 3QEGL 1I3VA 1D5BB 5E6IA 4LNRB 4QTHB 3WJLC 1W0VB 2NPLX 2Q76A 5D9SA 1EO7A 3QEHB 5J56B 3BQUD 1I8MB 4M5YH 4HK3N 4FZEL 4QCIA 5C0CA 4KV5E 5GRUL 3RZCC 3RZCB 1FZMA 5EU4A 2P5EB 1Q72H 4LCYB 5EBLB 2ICWJ 2AQ1A 5TDPB 5GGVL 2YRZA 1U36A 5D1QA 2EDOA 1G7IA 3UZEA 1NCBH 2CDFA 3MA9H 3OKNA 1JHLH 2P8PA 3MODL 3DGGA 2AV1A 1RUQH 3D0LA 4QXTB 4FOMA 4JQXC 2MWCA 3WUWA 3IDXH 3JVGC 3DV6B 2VABB 4LFHD 3EZJB 1KELL 5EO1B 3BPOB 3BPOC 1PFCA 4KUZL 5SX4H 2FEDC 1JI1A 1WBXB 3HG1D 4LGRB 3OXRB 4MA8H 1KNOB 2I9LB 1CFBA 2AJ3B 4XP4L 5CIPH 1RJYA 3VRJB 3QQ9D 4JFZL 2GJZA 5T3ZH 3SGKA 2CLVA 2BNUB 5C86A 5EA0L 4S1DD 2NXYD 3UPAA 2LU3A 3A6BH 1DN0B 1CTNA 1PEZA 1B4JH 3BZ4A 4LSPH 2FJFB 4PRPA 1A3QA 4MS8D 1J5OL 1MFNA 1PSKH 4HBCL 2PO6A 2BC4A 2X7LA 4D9QD 1M7IB 5IKCB 4B7IA 4N5ED 1GL4B 4FQLH 4UV7L 5KS9E 3MYZA 1AXSB 3KYOB 4WNQA 3DARA 3U0WH 1IARB 4GLRH 2HT4C 1I8KB 3MOAL 3TIEB 2ZCLH 2B1AH 1OGTB 3IRPX 3O4LD 1XCQA 4YR6A 2NY4C 2NY4B 5GGUB 3RJDA 1T1XB 3H7BA 4HMCA 4PV9A 4DKEH 4AY0A 3GI9L 4OV6F 3BZEA 4K7PX 3TO2B 4MSWA 4WTWA 4OLUH 3IAPA 4IRSB 4IRSC 1IM9A 4KHXH 2CUMA 4EN3A 3DVGA 3WBDA 1L0XA 4U1JB 4N9GB 3P73A 3NTCH 4JFFA 5IB4A 4M4PA 2MQCA 2V7HB 5IESL 2A6JA 1HK6A 3MV9A 2Z9TA 3EOAA 3LQAH 4GRMB 4N0UA 4HUVA 4KKCC 4OBRA 4HGMA 3F7YA 4PIRF 3B9AA 2YPKA 1ADQA 3CXDH 5TGBB 1AFVL 3VRLE 3EJZD 4CW1B 4ELMF 5C3TA 3VFVB 4OZ4A 1P1ZA 2R4RH 4RBPK 3OR6B 3WXVL 2DI7A 3IDIB 1YEEH 3S88H 4BH8A 2DLGA 4NQEA 1T2QL 1M05A 4WO4B 4WO4C 5IK3A 5E99H 3CLEH 3DVFA 1LQSR 1UM4L 4E0RA 1IT9H 1U3HD 5C9JB 3O11B 1EUTA 4NDMB 4D94A 1KYOJ 1I7UB 5CWSB 5F89B 4ODTL 2WSKA 4OZHF 3U2SB 4JANB 3L95A 2GCYA 4JVWA 2JIXA 1YMHB 4HJ0D 3U7WH 3WE6B 4P46A 4DUWA 1OTSD 3LKOB 1U8QB 4MJIB 4PPTA 4RRPG 5D1XA 5BQ7B 2CRYA 4UB0H 3U4BH 5BS0E 2D4FA 4F2MA 3GKWL 4PJHA 3PL6A 3CZJA 4UUJA 3T4AA 3GUTB 1AO7B 2XZZA 1J18A 3BH8A 2BOBB 3O6LL 1WT5C 1WAAA 2DLHA 1QRND 1C5CH 1YEJH 1AXTL 3W82A 3HPJA 1A7QH 1I3RA 4H88L 3MLRH 2ZKHL 3EYSH 3F7VA 4S1QL 4JM4H 4XNMB 5EORL 4O5LH 5C8JB 5F44A 3RPKA 5F9AC 2B4CL 1ES0A 5JIHA 1DBML 2VE6A 3STBA 5DUPL 4CVUA 4KTYA 5B3JF 1JGVH 4NKIH 4XNYH 3X11B 3LS5H 4HK3J 3G5XA 1NC4D 3WHE0 4G8IA 1E0OB 2D9QB 1NH6A 5I1EL 5CJQH 3QWRD 1MJUH 2YSSA 4NKDA 3FB7B 2J8UE 4QHLA 3FFDB 4MWFA 3B3IB 2ADGA 3UTQA 4F8TA 1MRFH 1IAIH 3M45A 2I07B 5ILTL 3QDHA 5F7WC 3QA3A 1XF5B 1DQDH 1ED3B 2HJFA 1MHHB 2ADGB 4G6JL 3IFPA 4B41A 1UH3A 4TUOB 4G8EB 1S5HB 2K3TA 3C2AL 1G6RA 3D69B 4XNXH 4O2FA 1YYLL 1HH9B 4G8IB 4HEPG 1W0VA 2APTA 5L2KA 1UEYA 4JFQB 5AWNH 4K71C 4K71B 1YC8A 1D5IH 4G8EA 4JKKA 2A83B 4OV5B 2X9WA 4PR5A 4JGUA 5TF0A 4PRDA 1FYHB 3MRMB 2I07A 4OLEA 3BYYA 3KXFD 2J4WL 3JWDC 1C7SA 1A6PA 3MUJA 1CFSB 5DGRA 3S7GA 1KXTB 2UWEB 3SGEH 4OM0H 3TO4B 3TO4C 4OD1H 5GSVA 4Q9RH 3KPNB 5C0IA 4N0FB 2W0LA 3FRPG 4F7CA 5ID1A 4QF1B 2D9CA 4NKOB 5C07E 3P3YA 4MB4A 1A5FH 2IJ0C 5DEGA 4OT1H 5FO7A 5ACZA 3QQ4B 2VERN 4XCYB 4HUKB 4I3GA 3QEGH 2VDLH 4N8VB 3IDJA 1GGCL 3MV11 1DTUA 4RRPA 3RZWA 4FQ2H 2IAND 4KKBD 1TVDA 5L2KE 4I9WE 3EYQD 4FQXA 1FPTH 4QRPA 2UV3A 2J6EH 3T65A 3HG1E 1Q9OB 43C9A 1MCWM 5DD5H 1BHGA 1Z5LA 4LCIL 5IVZA 1VFBB 5HGBA 3QCTL 1KCSL 3RL2B 2NTSP 2G2RA 2PW1B 4KQ3H 2P5WD 3ROOA 2FH6A 4HX1A 5C0FB 5HHQA 2N56A 2BNRA 3I85A 3KPRD 2ZG3A 1A4KB 2WWMC 3GK8L 5D70L 4EVNB 1D9KB 1D9KC 1MJ7L 2YBRA 5TDOA 3PNWB 4K94C 3SBWC 1LE5A 4A6YB 3KS0H 1B6DA 3RWFB 1VFAA 5EIQA 4HIXL 2NW3A 4N9GA 2NY3D 1QUNA 1H3PH 1JWSB 1J1PL 4QT5B 2NYYD 2CK0L 2H1PH 5HHPA 5KSBB 1LK3L 2YPLA 4PV9B 3AM8A 1BVLB 1D9KA 4NC2B 5ALCL 4JY5L 1NFDA 1AC0A 4AG4H 1YYLH 1FL6A 2QR0B 3KDMA 4YDLC 4NYLB 5DC4B 4YDLB 1LP9F 2AK1H 3GHEH 2JJVA 4RMVA 3BP7B 3RY6A 2DQDH 3EO9H 1NC4B 1X9QA 3M07A 4LASL 3JTTA 3T65B 1BBJA 1JGEB 1MPAH 2L0DA 1NUNB 3QIWB 2QLVB 3QIWC 3O8XC 3O8XB 4XBEH 5SV3A 3U0WL 1KEGL 4IDJH 1N5YH 1Q9WB 4RFOL 2EYRB 1SYSB 2DMCA 1RV6X 3DOSA 4P2OA 2PYED 1AGBB 4FZEH 1X5ZA 3K3QA 3LVEA 2EE9A 2R4SH 3FOLB 3RY5A 4LKCB 2X70B 4CDHA 5ADPH 1IM3A 1RHHA 5E2UH 3FRPA 2VLKE 2ATPB 4XP9L 5CS7A 1F42A 2CQVA 4L4JA 4BJLA 3HE6C 3HE6B 3NOIA 5KS9A 4HJ0C 1C5BL 2ATKB 3RWDB 5F1NB 4ISVA 1F5WA 5C71A 2IQAB 5ICYA 2H32A 4L8DB 3V7AE 1CGYA 1UYWH 4EEEA 1CL7H 1RZFH 2EDLA 3GUTA 2P8PB 2GTZB 5KZCD 4NQDA 5D6DA 2F15A 5JR1H 1R3IL 1KELH 1FNGA 1FFRA 1T04B 5M94B 3MRNA 4Y5YB 4Y5YC 4R4ND 4H5SB 3S96A 2LU4A 2I26N 3LPWA 2XZAH 2FEEI 4HH9B 4JHWH 3MLTA 4JQVC 4AEFA 2HVKB 4TNWK 5E2TH 1ORQB 2C3VB 2XWTA 3MNVB 4XNQB 3HN3A 4NDMA 4LMQI 1S5HA 2JB6B 4BKLA 2Y06H 4YHIB 3EYOA 3EJZC 1GZPA 2AV7A 4K7FB 4OIIL 1L9NA 3OKNB 4I48A 3CVHB 2Y5EA 3QWOA 2BJMH 5JQ6L 3VXRE 1E6JL 3O0RH 4KY1H 2JCCB 2VNCA 4TSCL 3GMQB 3OPZH 4APQD 1MFEL 4PJEA 5DRZA 2ADIA 5DURB 3FZUD 4NKDB 4H0GA 1DL7L 1LO2L 4P2RD 2W91A 4G80B 2X4OA 1ZT1B 2EDTA 4LNRA 2JJTC 4QTHA 4U1KB 1PG7H 4XXCC 1FFPB 4AT6A 3WIIH 4O5LL 1FNSL 2R8SH 3Q1SL 4ORGA 3ZE0E 4DJMA 3WHE1 1U2CA 4MD4A 1BJ1H 4PJIE 3QNYB 3CFDA 3DPBA 1UKSA 1TNMA 1VKXA 3DVNA 1MPAL 2N7BA 5FK9B 1A1OA 1YA5A 5A16B 4M8QA 1KCUH 3LMJH 4OSUL 1UZ8B 3PHQA 4O58H 1NGPL 4BH7B 4YPGB 1K5NA 3CFKA 1OSZA 2RCSL 2BFVH 5SX5H 3MA7A 1JPTL 3BKJH 3P0GB 5E2UL 4KJWD 4NKMB 1JPFB 4P4KB 4P4KC 1YMHA 3BZDA 3PWPB 3SJVD 4ZFOL 1N5AA 4FQCH 4PY8J 7FABH 2FIRT 2EH8L 5KZCB 1A6WH 4QWWD 3WFBH 5T5NG 4YPJA 3QO1B 4U31A 5GGTL 2YD7A 5GGVY 4PGEB 3GMNA 1M1SA 2HJLB 5EIIB 1WBZA 3IGAB 2CDEB 1S9VB 2ESVE 3HC4L 3S37L 1I3GL 2XACC 4PRBB 4EI5A 5ESAA 1J87A 5DD3L 2IBGA 2DAVA 5DI8A 1V7ML 3D48R 1MF2L 4FABH 1UGNA 5EBGA 1CDIA 1KIQA 4OJFL 5CUSL 1JNHA 5INDB 4XCYA 1AIFB 4JRWA 2PYEB 3NFPA 5T1MB 3WEXA 2F5AH 4UB0L 3HAEG 5JW3L 2BXYA 3UJIH 1I7RA 5CAYB 3O3BB 3H9YA 1IGYB 3OJDA 4KZDL 3T0DA 4NT6A 3LEVL 1WJ3A 2PR4L 2NW2A 3QIWD 3QEQE 3WFEH 4EIGB 1MCOH 5MP6H 5ID0A 1UFUA 5T5NF 4NO5A 1MH5A 4YGVA 5FF6B 4KY1L 1XH3A 1OPGL 2XQYK 5ISZD 1FGNH 3LV3A 5JXEC 1OGAE 3G6JB 9CGTA 2X89A 1S7UA 4U05A 5JUEH 5HD8D 3BKYH 3JWOL 3PV6B 1IM9B 2VLLA 5DQ9B 4AJ0A 2F53D 4L29B 2OTUA 3G04A 5C0ND 5F9WB 5F9WC 4WUUD 1J05B 3MJ7A 2SEBA 4HBCH 5L7XL 4LKXB 4U1LB 3U36A 5DUPH 1QSFA 4XHJD 3WS6C 2HRPL 1OW0A 3VFRA 2HVKA 1ZGLA 3KPMB 4PYGA 3CSYA 2YR3A 4U6TA 4NQCE 5E4IA 4YFLF 3ZL4L 3P0VH 1SMOA 1DQLL 3IU4H 4ZAKD 4HIJA 4U0RB 4U0RC 4HXAH 5D93B 5D93C 4ZFFA 4U1MB 5MEPA 5IFJB 2R69H 3FQXB 1XMWA 1TJHL 5J4MA 4R7DA 3CPLB 5CKGA 1AGEB 5I2IB 5FYKU 2P5WB 1UWXK 3FO1A 4OB5H 2JB6A 4P2QB 4HV8B 1T66C 2WQ8A 3JV4B 5D7IF 4FXLA 1KB5L 1CFQA 1I8IA 5FHAH 1T03L 4HXBL 2YD5A 1WLHA 4U2YA 1J0ZA 1LK2B 2GJ6E 4G8GE 1FLRL 1B6UA 1JZ5A 4JJ5A 1C16A 1KPUB 2XTLA 5FO7B 4L8BB 4WU5A 2NY2B 2NY2C 3VWKB 3VWKC 1NCDL 5T1DH 4JFYA 4KI1A 5DT1L 1NCUA 2AJUH 4ZFOB 2VITA 5J6HB 5IVXB 3SGJC 5D2NA 4HULB 1CFVH 3KPTA 3OB0K 2WUCL 4QHKJ 3JVGA 3AGVA 3SKOA 1I9IL 1PG7X 2WK2A 3RI5F 1CICD 4NQCD 4FFVD 1K2DA 4V1DE 2QHRL 2OL3L 1HHJB 1IM3B 4O4YH 1GOGA 1T2XA 1N64H 1C12B 3NCYS 3QUMB 4P2YA 3VI3E 3NACL 3NZHH 4JFDE 4ODHH 3KPPA 4ODUB 2Y23A 1V5JA 4JN1H 1KIRB 2LE9A 4KK9D 2AJSL 3MBED 4GAGL 5J57B 2Y1VA 5EU3B 4M7JH 2WUBL 4LLUA 3PHSA 3JV6B 1U8IB 1YJDH 1LO0L 5IB1B 1JGDA 2R23A 5I18H 4E41D 1DEEA 3MQIA 3BP7A 4BUHA 3V6ZA 4HKXA 1BFSA 3VU2A 4XPBL 1IMHC 1BIHA 3GJEB 3MROA 1NFDB 5TDNA 4LIQH 2XN9A 4JFXA 2P8MA 2X9YA 1YMMD 1V7NH 3S36H 3NH7L 2RR3A 4DZ8B 2YZ8A 2BY0A 2R2BA 2V6HA 1H8OA 4NZRL 5EULV 3MXWH 2QQNL 5IB4B 2B4CH 1OTTD 3GK8H 2YD9A 3O3AB 2V7HA 5LBSL 2KZ1B 4O2EB 2R23B 3OAZH 5DZLA 3P30L 4I48B 3AXLA 1T80A 3NTCL 5EO0B 3V5DA 4FQ1L 1TQCC 1TQCB 4MXWH 3T09A 1K85A 4HS3A 5JORA 1QHOA 4JHBA 1KIRA 3K80A 3VD3A 2K1MA 4PRBA 4NO2A 3ELAT 2HFFB 1T7YA 1XZ0A 2MCPH 3A67L 4MDIB 5IG7A 4YIQA 2MOVA 4HBQA 4YNYB 4S10A 3BAEL 2UZYB 3BD3A 3VWJD 1Q9OA 3KAAA 4HC1H 2XQBH 4U6XB 3HZYA 3MFFA 2KBGA 3MRPA 1JPFA 4P4KA 3UEZA 4YHKH 1P6FA 4LSRH 3QFJA 5CWSA 2BVPB 4MJID 1A6ZA 3NZ8B 5FDWB 2UZIH 2VDPL 5CHNB 2B4CC 1UXSB 3MRFA 1DQML 1R3HA 4GBXC 4GBXB 1E6OH 1JZ8A 4K7PY 2ZWLT 3SGKC 3FT4B 3Q2CA 2P24A 4L4TB 4TSAL 5ADPL 4MD4B 4R3SB 1CGWA 3FMGL 3I6KB 1A21A 1P1ZB 2C1PA 2Q86A 3C09B 1LO4L 3C09C 3DV6A 1EEUA 4OZHA 5BRZD 3UROR 4UU9A 4YWGL 1MHCA 3DURA 5KSAA 4AIOA 1NBVL 1VGKA 3T77B 2R0WH 1P9MC 1WWCA 5BRZA 1O7VA 3FCTB 4PJHF 4OT1L 3O2VL 4NRXB 3NN8B 2OK0H 4HLZG 3NABH 3DBXB 3BKCL 3K8LA 5FHBL 3WHXB 3HHRB 4NIKB 4HIJB 5FDYA 1ZEAL 4X0KA 2BVQB 4U1NB 5BVJA 3EDEA 1UM5L 3B9KA 1T5WB 3RBSA 4PP2B 5HYQB 4EN3D 4PJIA 4GFTB 1FVDA 2AQ3A 5DMKB 3BHBB 1FL3B 4FFYL 1IAIL 4MQXD 3I6LD 3X11A 1QBMH 1CDJA 4RWYL 1C5DB 1YC7A 4PP2A 5HYQA 4NJ9L 3KPSA 4OJFH 5CUSH 1JNLL 3CFBB 1FIGH 5I8OL 3QA3B 4BSVB 4IMKA 5MERB 3MREB 3PV6A 5MEND 4FQ1H 3ZE2E 3F7VB 1FNHA 4X6BA 5T3XH 1BQSA 3QDJE 3ZE0F 2UWEE 3C5JA 4R0LC 4R0LB 5F6HJ 3X13B 3TBSA 2HT4D 5AWNL 4WWKA 2Y07L 2FX8H 1KIPA 5C0EB 1JK8A 1G7QB 1EXUA 4XXDA 5AUMA 1JGLL 3BKML 1Q9LB 3IJYB 1TTGA 4OFYD 5HSFA 4IOSD 4P46B 4P46C 5D72L 4RDQG 4JFEA 5DA4A 2VIRB 4MS8C 3O3EB 4I3RL 5BW7A 1JFQL 1XT5A 2X70A 4HKBA 1JNHB 4BZ2L 1MLCA 3CXHK 4UOW1 1MFDL 4Y8AA 1HHHA 4O00A 5KG9A 2WIIA 1A7RL 1P7QB 2APVA 3GMMB 3EOBB 5HYSG 1EFXB 4R26L 4X9FA 1WV7T 1HXMA 5DEGB 4CL7A 1BF2A 5C0JA 3IU4L 4K7PH 5GRJL 2CLZB 2ZSWB 1C8PA 2GITA 4LRIC 4WI9A 3M1BB 4X7SH 2JB5L 2YHGA 5I1LB 1PZ5B 2VKWA 1LMKA 2IG2H 4OF5A 4PREB 4MB5A 1EGJL 1P53A 2QQKH 3DIFB 5JIKA 4N8CH 3I02A 4TUKH 3EUUA 2P5ED 3I2CH 4ZDHB 1RD6A 2EDEA 4YX2L 4AL8L 1CN4A 1IGFH 1IFHL 1XGTB 5IK3B 3SE3C 5E95B 2R15A 1ZHLA 3BQUC 3GIZL 3BQUB 3O9WA 3S88L 1VHPA 5HGDA 1YY9D 3CZFB 2DL9A 1KPVB 1J88A 3ORJA 3BWAB 4O2EA 5EU6B 2HVJA 4RX4A 1U92B 3W0WB 1I8LA 5IIEA 3RJQB 3SDCA 4YHZH 5LXGL 1BM3L 5HHME 2ENSA 3IDMB 1U8JB 4K23H 1OAKH 1QR4A 1DLHA 2X4NA 1KCVL 5EZOL 5DRZB 4TUJA 3QEQA 3SDXE 3MV8E 5FYLE 4Y1AA 4OZIF 4X80L 4OGAC 3CVHH 1H15A 4R2GB 4R2GC 4G43A 4N0RA 3KNBA 2VISA 1GZQB 2BVEA 4KHTH 2FX7H 5ACLA 2XG5A 4WI6A 1N2RB 1CU4L 4UT9H 5C2UB 1MCDA 3WNOA 1E4WL 2C4FU 1KPVA 43C9B 5K9KB 3NACH 2PO6B 2PO6C 3EJYD 2RFXA 3V6FA 2VAJA 1JMZA 2JELL 1OP3H 4M1DL 5I1KH 2X4RB 1AJ7L 4P46D 4DVBA 3ULUL 4L9DA 5ICZA 5DZOA 1DSFL 1S7WA 5IB2A 4K3DH 1INDH 3ZDZE 2CGRL 2OZ4A 3QULB 3ZYIA 3MRIA 4PUBH 4OZGA 3MUGB 4PJ7A 4TOYL 5FUOH 3HUJF 3LQZA 4MLSA 4DVRL 3B9DA 1VSCA 5IM7B 4Q74A 5DO2D 1A4JA 3QDJD 5EIVA 5DJDA 4QEGA 1F13A 4AK1A 4Q9BA 1SEBA 1H8NA 1FVCA 2AV1B 5T1LB 5EOTB 4HS6B 5C09E 3IXTA 2FO1A 4I5BB 5IFAL 2G5BB 1YEIL 4WFFD 5HPOA 1SEBB 1U8NB 2AXFA 2MPAL 3ESUF 5AD0B 4HFWA 5ENWA 3GHBH 3AY4C 4PRIA 4PJDE 2F9BT 4GUPB 2RGSA 5FM5O 1EHXA 2I9LA 3OG6B 4X6DE 4ETQA 3VFPB 1JF1B 4P5TA 3LQZB 3T2NH 2P24B 4L4TA 5DGQA 2H2PD 2UZXB 1JZ3A 1TJGH 4WFHD 3C6LD 5DVKA 4XCFL 4DGYL 2A74B 2FYYB 3TVMA 2LTQC 1QBLL 2LTQB 3ULVF 1A7OL 3GMRA 3H42L 3BD4A 5EUOB 5E2WH 1RUML 4LVNC 4LVNB 4Z7NE 1X5JA 3V0WL 4ZYKB 2KDGA 3RDTB 3RDTC 5IBUG 1HSAA 3NCBB 4UIMB 1MIMH 2IC2A 3LN9A 4HD9A 1T89A 1VEPA 1CDBA 1A8JH 3ARDA 4CVZB 5CP3A 3QG7L 5EB9A 1IAKA 3MLXH 4EI5D 1LEIA 1I9JL 3IAGC 3UPCA 1ZGLB 1J0IA 2GEEA 4OCWH 2H6PA 1ZVSB 4NOBA 4JZOA 3SE8H 1Y6NR 1OWWA 1BBDH 4QOKB 3DMMD 2SEBB 1FGVL 4WHCA 4QXWA 1IE5A 3LH2L 4W4NA 4CADA 3PWLA 4LSUL 4X80H 15C8L 4ONGH 2Q7YA 1UWGH 3ZMRA 1P4IH 4RQQB 1X5GA 4A6YA 3FFCE 1U42A 2WUBH 1PYWB 4PTTB 3F65A 3PWLB 3QHFH 3K0WA 3KYMA 4Z7WE 4QRTB 3SY0A 1VA9A 2R29H 3C5ZB 3C5ZC 2ZOLB 3GMPB 5IHBA 4UQ2B 1JCKA 4PRHB 5TDNB 3FAXA 3D2UD 1FSKB 1FSKC 2RHEA 4F2MB 3OJDB 3TT1H 1J86A 2HJKB 1ZLUH 5C0BD 4W70A 1T5XB 3QDGD 1JHTA 1FNSH 2R8SL 1MJJB 4WI3A 5EU6A 4PLOB 2EDBA 1FNEB 3L3HB 4POYA 2AJZB 2DQIL 2EIZA 5I15L 3P30H 5CLTA 1XF4B 1ZOXA 3OJMB 1J11A 1Y6MR 4JB9H 4OTXL 5EU6E 4KAQL 3PWUB 4HWZB 3A67H 4WY7L 1YMMB 4DK6A 2AK4D 4LHQB 2CR6A 2RCSH 1BQLL 4PBXA 1YMME 3KPQB 4MJ4A 4G8FB 4QTIL 5SX5K 3RWIB 1MJJA 4HC1L 4Z7UB 2X10A 1JHTB 3GJFK 2O26U 4GKSB 4WI7A 4ZPVB 3A6OA 4DK3A 4LVHC 4LVHB 1N5AB 1HOCB 3P9MB 3U82B 1TETH 2VLRD 2CO6B 2GKIA 5BS0A 1KB5H 5IEHA 3UTPD 1ZSDA 5INCB 4ETYA 3QCUL 1JNNH 4DGYH 3TJEL 4HS8H 2XA8L 4LPYA 4M8QB 4OI8A 1I7ZB 4CU6A 4QXUL 5AAMA 1AGDB 2V5YA 2FIKA 5IVXA 1T83C 2R1WA 1U91B 4PGCB 5JPMA 3F7PC 3VFWB 2B1HH 2P46B 4OF8A 1JZ2A 3ZKSD 3PGFL 4MD0B 2HA1A 4OQTL 3ULUF 1JFQH 5IEKA 1P69B 1WAAE 2OQJB 4OV5A 1TZHB 3DUSA 5I1JL 5IQ9B 3E3QC 1NC2A 5I66A 1D6VL 1I9JH 4WFEE 4P2QA 1DDHB 4DN4H 5KVMC 2Z8RA 3LAFA 3A6BL 3DXAB 5T3ZE 3C5SA 4XZUB 4J4PA 3SN6N 5HI4D 3BXNA 2ZCKL 4BSJA 3OKMB 2HJFB 5GJSL 1T2JA 4KK8C 1F2QA 2ZNWA 1D5MB 4BZ1H 3BMVA 4XP5H 1OT1A 4XP6H 2XXCB 3MRKA 4NQXA 1QSVA 3BXNB 3LS4H 4NNXA 3BUYB 3P9LA 2CUHA 3P77B 4GG6E 1UCBH 4L3ED 4Z18A 1OW0C 3VFRB 4TUJB 1CTOA 2JK5A 1DQLH 4RWYH 1G84A 1J05A 4GO6B 1IJ9A 2HMIC 1ZS8B 3MO1A 4KMTH 1MQ8A 2Z8SA 4KROC 4KROB 4HUUB 3ARGD 2BSRA 5GGSY 1LEGB 5IVXE 3V6OE 3BDXA 4GUPA 2GSIA 5KVGL 1NGXB 4P5TC 4P5TB 1QFUL 5FUZH 5CILL 3NN8A 3RTQB 3RTQC 3WUWB 3TBVA 4X4YB 4LSVH 2BNRE 4NPYA 3FT3A 3U6RA 4PLJC 4DUVA 1P9MA 2DQCL 5FA4B 4TPRH 4KHTL 4NQTA 4K8RC 4XH2B 2VDRH 3GBNH 5J6GA 2XG4A 1CQKA 1XIWD 2BY1A 2WBJA 5D7IA 4POUB 3TA3B 3BW9A 3TA3C 4NN5B 4NN5C 4XMLH 3VCLB 3FT4A 5HHVH 5J11C 3CNKA 5EZLA 5IT2L 5J11B 4JO3L 5KW9L 3FB6A 1I1FA 2E8YA 2BOCB 1WGOA 1J12A 1IGTA 2CIIB 4P3DB 4XBGB 3QIUC 1FRGH 3QIUB 3DETD 3ULVH 2BVPA 3DLQR 2DLFH 2YPVL 4UQ3A 4Y1AE 3ZTJG 1T1ZA 4C57C 3SKNB 2IANA 4PJCB 4L5FL 4ERSL 4PD4K 5ETUB 2NY1C 2NY1B 4NSKB 3W5MA 4MDIA 5IG7B 1YQ2A 4M7JL 3HAEB 4LLQB 5JOFA 2QSQA 1ZLSH 4FQHB 2V5RA 4MQSB 2VL5B 4U3CA 4ESKA 3U36B 1R24B 5F7HA 4NSKA 3BKJL 4CJ1A 5HPMB 1MLBB 3K8KA 3EFDH 5JLZB 2H8PB 5JDJA 4NQUA 1YN7B 1F00I 2DTSA 4XVTH 1MWAL 1A6WL 3GMOA 2NZIA 5GHWH 1CD1B 2EIDA 1U8IA 4KRPC 4KRPB 4QRUA 5HGDB 1I9EA 4K23L 3THMH 3BVNB 3PDOA 1P5VA 5I0DA 3L6FA 2DICA 3T8XA 1IKNC 1EA9C 1I1FB 5IJVA 5E2TL 4G7VL 3B9EA 1JZ4A 3NFSL 3QFJE 1MREH 3HZKA 4U1NA 5BVJB 2GSGB 5BOZG 1I1RA 1HNFA 3EO1A 1OF2A 4F15B 1NQBA 4L3EA 4F15C 2MNUA 3OGCA 5I1LA 4O51B 4NC1E 3VXSB 1TNNA 3QG7H 4JKLA 5T1MA 5IB1A 1UA6L 2BNQA 1N0XL 2AJYL 3VE0A 5KVDH 1TENA 3SOBL 5D1QD 3V4UL 1ZGLP 5J1AB 4C56D 2EKSB 5KN5B 1AR1D 3UZQA 2VLRE 3GDBA 1CK0L 4J4PD 2L4OA 3ARWA 2V2XA 1TCRA 4U1GC 4U1GB 5E08L 2ED8A 5D8JL 1U8LA 3FZUC 5JXAL 3GMMA 3VXUB 4HGWB 3MLTB 2JTDA 4L4VD 4NWUL 4APQB 4APQC 1AXIB 1RJZB 4MJ5B 1KJVA 4LQFL 4L8BA 4WU5B 3VWKA 1URLA 3VXUA 3KS0J 3E0GA 2NNAA 2HAZA 2NR6C 3LKNA 5JQHC 3IJYA 1FRGL 5BZWB 5T33L 4WEBL 5ECJE 1A22B 2IAMD 1U8MA 1K2DB 3ME0A 1QD0A 4PRHA 2F74B 3RIFF 3CFJB 3WDHA 1XF2A 4QGYA 1CT8A 3IXAA 1GJIA 5JO5A 1BQUA 1MVUA 1R3JA 4NCDA 4R7DB 4TYUA 2CRIA 3DX7B 1PLGL 3T0ED 4ZO7A 4LGSB 1LNUB 4FQQA 4TSBL 3MLPA 1RIVL 1ZA6A 4WW2F 1U3JA 4MNGB 1H3WM 3W11D 2Q76B 5D9SB 1JTOA 1X5YA 5FHAL 3V5HB 3RUGB 3D69A 3WJLA 3OAZK 1TZHA 4MNGA 4PLKC 4YHNA 4OCXH 5ABDE 5K9KA 1QTYT 5JHDE 3U4EB 3FQNB 1ED3A 4NWTL 5EZJA 4ZNCD 3U1SH 3O2VH 4X98B 2HT3C 2VISB 5HHMB 2WAHA 1MCNA 2VZTA 3TC9A 5D6CA 5SV4A 3SKJH 4Y89A 2GUOB 2XTJE 5DHVA 4C56A 2XPGB 4LQ1A 5DFWH 3QUZB 3QUZC 1FIGL 1MCFA 1F4WL 5BVPL 5T3ZL 4NUGL 3VXNA 4JFDB 4PGDA 5IIEB 4EZMA 1HYSC 3GJEA 1QBML 2QADB 2QADC 2V5TA 3PHOA 4L8CB 5C0CE 3NFSH 4GKZA 5IB5B 1OP9A 4KGJA 1XGUA 5LXGH 2CD0A 3U9PH 1N6VA 4Z7UF 4XAWL 3U4BL 3RX5A 4POZD 4WHDA 3GSXA 5HYJB 1XR9A 4G8GA 5CHNA 1WISA 3IDNB 3SE3A 3G6DL 1NJ9B 2ADFH 1FBIH 5DK0B 3IS1X 5JHLL 5D4QA 5T1LA 1SBSH 5INCA 1FVCB 4H0HB 4J6RL 3IETA 5A2FA 2AK1L 3DRTA 4GXUN 3KVQA 2DIBA 2AEPH 3WD5H 4S0TD 1GGYA 2J1KA 5FA4A 5H2BB 4KI5E 2MFNA 4S1SL 5D7JB 5D7JC 4UINH 3MRCB 4NKQB 1MVFA 3QULA 1K6QL 1GXEA 2FBJH 4XCCL 5DI8B 2AJZA 5F9JB 1RZ7H 2GQHA 1EFXA 4X7SL 2VLKD 3E2HB 3E2HC 3KPRB 1X5AA 5GJTL 4G6FD 3V5DB 3KPRE 3TVMD 3KWWA 4BH8B 4YO0B 1KCLA 4Z95H 3UAJC 3BE1L 2HRLA 3RVXD 5ISZA 3WLBA 2HJKA 1CFNB 5HYSA 1QR1A 3ARED 4C58B 2W9EH 4GW1B 1A7PH 4Q0XH 4GMTH 5DTFB 5IMLA 3H9SE 3CLEL 3TBSB 2AJVL 2Z8WC 3V4VH 4PTTA 5TQ0L 2XN9E 3SKJL 3FFCA 3X13A 5IQ7L 2V7NB 4Y2OA 2EIBA 3DUUA 2W0FB 1G7PA 43CAA 3G5YB 1F4WH 2VDQH 5BVPH 3G6JE 1WWWX 5EC2A 3W39A 5KW9H 3KPMA 4JDZB 1R3LA 1Q94B 2Z31B 2Z31C 4GG6F 1IGCH 2EE6A 5JW5A 5CJOL 1FV1B 2ZCHL 2UY7A 2IQ9L 3BHBA 5AYUH 3RI5K 3BP4B 4NRYA 4Y2DA 4DKAA 4MA8L 1W72H 4PJIB 4N0CD 1DQQB 3AUVA 3BDYL 1KCKA 2FJHB 1XF5A 4V1DA 2GTWB 5K9OA 3OHXB 4OCSL 1QO3B 4DFIA 1N59A 4GAGH 2WBJD 1DBAL 1A7QL 3E6FA 1YUHA 4JRXA 2Z91A 3C9NA 3MCKA 2VDLL 1T04A 3MFGB 5FYKE 2P7TA 3FCTA 5E8DL 3VXTA 5E8OB 1T1YB 1ADQL 4P9HL 5EUOA 2IH3A 4ONFH 5I1CH 4M6OH 4OKDA 2R1YA 3BZFA 2GY7B 2RQ8A 2H41A 4F7PA 3ZYOA 3SE4C 3HZVB 5DJYB 2W92A 1L0QA 3IDYC 3IDYB 3NABL 5E00B 3HUJE 1P84K 5E2VH 3UJTL 2DKSA 1HSBA 3OKOA 3QXTA 2X42A 1F8TH 1MI5D 1IZJA 2C3WA 3L3KB 3WFCL 2E6PA 4LOUC 3TBYA 4KRMB 2ZSVB 3E1F1 3JV4A 4KKAD 2V2XB 5KVGH 2UUDH 1HE7A 4P57B 1T1YA 5C0DB 3CK0L 4JKPL 1Q9WA 1V3KA 3J8F7 3MCLH 2XTJB 2XTJC 5BQ7A 2FLRT 2FX9L 4GSDL 4NQXB 2VSCA 4OZGB 4PJ7B 1CLZL 1AQKH 1MHEB 2X4SB 4UNVA 1NAML 3QRGL 1H15B 5CEXA 2IFFL 3BO8A 4ODXA 1OAXH 1ORSA 4GRLD 4XC3H 5CLWA 2WWKT 1TJGL 3LQAC 1BFVL 3GSQB 2AW2A 5ALCH 2HLFC 4GXUM 3ZYJA 1P4LA 4EXPX 3Q5TA 4JN2B 4YHKL 5D8JH 3KJ4B 3KJ4C 1Q38A 1RI8A 1T5WA 2BK8A 1VDGA 2VXQL 3NA4A 5DMIH 4ELMA 3CZFA 4JY5H 5CMAA 1Z2KA 4JJHA 1VCAA 3LZFL 1JZ6A 3JTSB 3UYRH 1DANU 4U7SA 1TIUA 2ZCHH 1N7MH 5KVEH 4Y1AB 1DANT 1OSPL 3A6CH 4IMLB 5DHYB 5EOQH 4F7MA 1B0RB 4RA3A 1BD2B 1U3YA 5B38G 3VD4A 4P48A 1U3HB 1U3HC 4KI5D 3NCYP 5AYUL 3MV9E 4PJGF 2ICEA 5L88L 4WHTB 1NFKA 1VFBA 4GH7B 1QFWI 4GKSA 3GIVA 4MA1C 1VACB 4MA1B 4LMQE 1QQDA 4JRXE 2NY5H 3JWOH 5LQBH 4G6AD 2IG2L 4PY7A 4HAFA 3U0PA 1P2CB 1UJ3C 1UJ3B 4Y19B 4RGOH 1ZT4A 3KPSD 3H0TA 3U7AA 3G6AA 4M02A 4RGNC 4RGNB 4JDVB 3GMNB 3ULUD 2ZG2A 4QO1A 3BIAX 3HRZA 3OG4B 1WCBA 3DJ9A 3QQ3B 3B9KD 3H9HA 3L9RA 4OLVL 1IEBB 32C2A 5FYJE 8FABB 1EUUA 5I8OH 4FG6D 1KJ3L 3RFZC 2AS5M 4L8SA 2DWEA 2R0ZL 1EHLH 1HQ4B 1H3PL 2PXYB 2PXYC 4PLNC 2FD6H 2FX9H 4X4ZA 1MFCL 5EBWB 2QBWA 4TRPL 1RJLA 5LAXB 3OSKA 1MUJB 2NY0D 3Q6GH 1EO5A 2OI9C 2OI9B 4PJXE 3T2OA 3O3DB 4P99A 3STZA 4ZS7L 1TVHA 2O5XH 4GSDH 1GHFH 3BISA 4WI2A 1RZJC 2W60B 3K4DA 1EVUA 4QXGL 1OAQL 2Z8VC 1S7SB 4OF3A 4CADB 3MV01 4OZ4B 3IJHA 1NAMB 1J1XL 2VLKB 2IPTH 3JV0A 4P23C 4P23B 5DFTA 1QFHA 2IH3B 2EE3A 5TGBA 1I1AA 3IKKA 2BNRD 3PGFH 1TFHA 3G9VA 5EFIA 1FVEA 2P5WA 4S1DC 4X7TA 4R0LA 3BEVB 1I1AD 2BNQE 5FYLH 1BBJB 4KKLD 4HKJB 4LLDA 3OAUH 1M7XA 3U0TB 1N59B 4LU5H 1AKJB 1FO0B 1AKJD 3RDTA 5HGAB 3R1GL 3CDCA 4YHIA 4ZNEA 1L9MA 3C5SB 2ZCKH 3CSYB 1XEDA 4RMQA 3VA2C 6FABL 4O9HL 1I1AC 1I1AB 1SYVA 2VQ1A 2F54B 4LSDA 4HG4J 2YN3A 3AU1A 3QJFB 3UYPA 3OXSA 3MGTB 1JWUA 1A1MB 1AP2A 4Y8DC 5CSBA 5GJSH 4BFEA 1CWVA 1MHEA 4ETQB 3STZB 3OF6A 4J3UA 4WW1A 5I1GH 1EEQA 4AMKH 3MA9L 3QYCA 4XRCB 3RZCD 2PETA 4H26B 4YE4H 5SWQA 5EC1B 5D5MB 1ZWIB 1HYSD 1WT5A 3R8QA 4NQDB 5D6DC 3JXAA 2OMNA 3T77A 5A43C 2F74A 3SKOB 4HDIA 3V8OA 4L1DA 5HY9A 5BS0B 4U6VH 5IEHB 3D5OF 3DX8A 4WJ5A 5HVWA 2X4TB 1RUQL 4I2XB 2C5DC 2R1XB 1BPVA 2AJ3A 3ZZ1A 4MJ5A 1YPZF 2I60L 3E6HA 3ISWA 5E5UB 2VXTH 1J8HE 4PV8A 3JBG7 1OAZH 1PZUB 2KH2B 3E3QE 5F89A 1FBIL 3QJHA 5DUML 3VGHA 2HTKD 4JRYB 1FAKT 4MQ7B 4PG9A 4U49A 4X9HA 4XI5C 3AS0A 3NCFB 3ULUC 4PGZA 3G5ZA 4E0RB 4F33A 5GS1C 5GS1B 3U0PB 5GGRY 4DQOH 1Q0YL 2CRMA 4Y16A 4F9LC 3UTSE 5CEYB 35C8H 2Y7QB 1J0KA 4JO3H 4MDJA 3MRDB 4G8GD 4V2CB 3MCKB 1ZHNA 5IHZA 1U58B 5GPRA 4XTRC 1YNTA 2P5EA 4JANA 4NYLA 4PUBL 5CEZL 1RK0B 1FIEA 4HF5L 3KPNA 2HFFA 2VAAB 4FQLL 5FA3B 5D71H 1I7UA 1OSZB 4NP4H 2A6KA 3QRFM 3GFUA 4KI5C 1D6EA 1CICA 2VH5L 1EBAA 4FZ8L 2IAMC 2IAMB 5E6IB 5E6IC 4RMTA 1FJ1A 1INQB 4F57L 4Q9QH 4DCQB 2J8HA 1MNUL 4W6WB 2IMNA 3PGDB 4PRAA 4BFIB 3DVGB 1NDMA 5FKPA 3U9UA 3L5JA 5C0BE 1OM3L 3V9FA 1PG7W 2R2BB 4PJEE 4YGVB 4LHJB 1REIA 2VAAA 5FA3A 4PJEB 4YZFE 1JGUH 5HDQL 5E94B 2J88H 4FQ2L 2YXFA 3WXWH 4NHCL 4F7MB 1EO8L 4QRRD 4C56B 4ELKB 4PREA 4P3WA 3O6ML 1HHKB 5IGXL 4M62L 3GO1L 1LP9B 5DFVC 2GFBB 4PGBA 2XI9A 3MV8B 4HAGA 1M7DA 1WFOA 3L3JA 1UENA 3T0VA 3UTSA 2Y7QA 4M9PA 3BKCH 2MTPA 1EGJH 3V2AR 2W07A 2O61A 4LLUB 1CL7L 1UM5H 3PGCB 1LWRA 5FYJD 4X99A 3TN0D 3LIZH 1SJXA 1X6NA 5F96L 1NFDF 1IQDA 5IFHH 3HR5B 3HE7D 4QYOA 4JDTH 3CSGA 3UTZA 4YHMH 1CD8A 3GMLB 1U2HA 3OKLA 4KKNA 5MENA 1EFQA 2Y36H 3C2SA 4KRPD 3T3PE 3S98A 3MOBH 3TYFA 4X6DF 1MCSA 4GAFB 3O3DA 1RZKL 4JPVL 4TTDC 3RA7H 2Y06L 1D3CA 4OCSH 5CBAA 5E08H 4QF1A 1MI5B 4GQ9L 1BREA 3A6CL 1RULH 4RSVA 8CGTA 1T7ZA 3BZ4B 2LVCA 1SM3L 1CLOL 3VXTB 3V5KA 2V2TB 3PL6C 3PL6B 4WV1A 2V9RA 1FG2B 2YA0A 2V5SA 5SWQB 2VITB 5J6HA 4N0UE 2P1YA 5E7FA 2YEZB 1TJIL 3HI6H 2V17H 3BFOA 4LDEB 4LAQL 1F4XH 1D5ZA 4I3RH 1XZ0B 1HSBB 3KYNB 1QKZH 5I75B 5I75C 2FJHA 3ARPA 3VH8A 3LS5L 5CGMA 1F45A 3T4YA 4U1KA 2DD8L 5KS9F 3N06B 3FQTB 1BGXL 1A6UL 4PRIE 5J1AA 2IPUG 1R5VB 2M8XA 4DVRH 3MRLA 3QCVH 5HI5D 5A40E 3VRIA 1NMCB 1NMCC 1WCQA 3HE7A 1G7IB 4OCMC 4FHBD 5D5ME 3GZKA 5L2JB 2Z31D 2H9GB 3G6JA 2Z91B 1QSED 1FLRH 1KYOK 1YN6B 2ICEB 5TFSH 5CILH 4F58L 3HAEH 1J1OH 4K8RD 4NM8H 2IFGA 1IC5H 2MPAH 1D7FA 4XWGH 5HHPB 3VFNB 4XBPB 4NQVB 4DTGH 2UVEA 3OZ9H 1PQZB 2APWA 3N1GC 2AP2A 5DQJB 1MHCB 3QEUA 3T2NL 5KSBA 1DEEB 5JW4Q 4QRRA 4JY4B 1TVHB 3EOTH 2DKUA 3IDGA 4U3HA 1S9YA 1A7PL 4Q0XL 2FR4B 4KQ4L 1ZA3B 2AK4E 2WM0A 4EUPH 3KPRA 5AZ2L 3V52H 4KROD 4PJBA 5GRXG 3LEXA 2R2CA 5I1AB 2HMID 1L0YA 2YBRB 3UTTD 2FDBP 4G6FB 3MRRB 3TPKA 3G08A 2PNDA 5DK2B 2AEQL 3QFJD 4NJAL 4R9HA 2D7OA 3R4DA 4P2RA 5L88H 2DQJH 1KT2A 4UUJB 5BJTA 4ZO6A 5ETUA 3O2DH 3T08A 3AAZB 4PJ9C 4PJ9B 3L9RB 3ULSB 4UV4H 3I9GH 4WDIA 1I75A 4Q58C 2Y5TB 3FAWA 4JZJC 1W2KT 4JZJB 2WLZA 1KT2B 2YRLA 3AMLA 2R2EB 3P4NA 5BJTB 4YBQC 3WYRA 3QUYA 4JCMA 3UBXA 5DD0L 2PTTA 5FYJU 4YEFA 2DMKA 4YHPA 5HI4C 3MRRA 1ZLSL 1FYTA 1OARH 3RVTD 5FFLA 3IFNH 3QJHB 3MRGB 2EC9U 1P2CA 5D1ZD 3DX9B 4LIQL 1P4IL 4ZFOA 5LWYL 1GGCH 4JCLA 4WHYH 5JHDB 5KSBE 3EYFB 1NGQH 4JZJA 1TZIA 2R29L 2AEPL 1BLNB 2B1AL 2A9MH 5TPWL 3O81A 3BUTA 3N0PB 4W4OA 1OD7A 3QUYD 4CW1A 4G9FE 4KHXL 4AEHL 4ZFZB 4J2XA 3TFKD 4IMLA 1JP5A 4YUEL 5I1AA 2XN9B 3S9DB 1UVQB 5DLML 5F9OL 1X5KA 3F58H 5IV2B 3MOQA 3MR9A 4Z78B 3JTSA 5E4EB 5E4EC 3D0VA 4LDOB 5DUBA 5DVMA 3BRDA 4FTVB 2YOCA 1BZ9A 2P45B 1JL8A 1JWUB 3P73B 3GRWL 3KR3H 3ZT5A 2VDRL 3SBWA 5FM8A 1PKOA 1XF1A 5FECA 2A9NL 5LCVH 2F54A 4O2FB 3MTRA 5IP4A 3UC0H 3N85L 5I30L 5L2KB 1FYTE 3DHJA 2ADIB 4R4FL 2YA2A 3VH8B 4AEEA 4K8RL 1F90L 2IALB 3RKDD 2XA3A 2Q3ZA 3FHAA 3W11C 5HDLA 1SY6H 4Y4FA 5I19H 3EOTL 5E56A 5JNYB 3BGFB 3BGFC 4NO5B 4UT6L 4X7EC 4OFPA 4LASH 1FCCA 3ZDYE 3T0EB 3T0EC 1XGPB 1IBGL 3DMMA 1KC5H 1Y0LA 3R1GH 5C0DA 4NO3B 1UZ6E 5DVNA 2Y9RT 4IDJL 1N5YL 3EHBD 2VE6B 1FGVH 3DSNA 2DDQH 2R2HB 3OKYA 1AIFA 4KDTA 3ARDD 2KPNA 3V6OA 1U0QA 2VLJD 5F21B 4WW2B 4WW2C 5K9JH 4HGWA 1EHAA 5EBWA 5FHBH 2ZUXA 1DVFC 1DVFB 5C0IB 3CX2A 3FOMA 3IAQA 1E4KC 4RAUB 4U3XA 4GS7B 4GS7C 2VSDA 3DMMB 3DMMC 3WSQH 4YFEA 2BOBA 4XP5L 3D0LB 1IGML 2QQQA 2VLJA 1FC1A 2GYSA 4NFCA 3MRPB 5GRUH 2NY6C 2NY6B 4Q7DA 2EIEA 3EYSL 5D1QB 5D1QC 2IADA 4YIQB 3WKNA 3QWQB 1EHNA 1S3KL 1DBMH 1JPGB 3K46A 2APFA 1UZ8A 4GQPH 2FSEA 2DBLL 1IL1A 2VZVA 2M26A 3Q6FA 4HS3B 5JORB 4WI8A 1Q0YH 4G42A 3CVHL 4QT5A 2UUDK 3O11A 4DGIL 2ARJB 1IQWL 3B5TA 5EO0A 1Q94A 3K4AA 3LOWA 4LFHG 3K81A 4IOIA 2NY6D 4R90H 3FFCB 4YEEA 4QRRB 2EXWC 2YUXA 3TM6A 3VH8G 3U4AA 4AZ8A 1RFDH 3UC0L 4ZUVB 2L7UA 2GFBA 4YDJA 3GB7B 3BEVA 3LV3B 5I1IH 2X09A 5DMJB 4EVNA 3CDYA 2R0LL 4WU7A 1HN1A 4GW1A 4I8DA 3AM8C 4UQ2A 5BMFL 5HHQB 4XMKL 1W8OA 5HYSB 5IMLB 4NT6B 3PIQA 5T1LD 1PX4A 2GUOA 1WIPA 4QXGH 1QLEH 2QHRH 3MV9B 4M6MH 5DK3A 2D7PA 1BFOB 3TZVA 3NCJL 1G9NC 1CXEA 4LCCA 5KAQF 3EHBC 1AGFA 3IFLH 3MNWB 4HWUA 3REWB 1OGTA 1JGUL 4UIKH 5HDQH 3VXPB 4FNLL 4D2NA 3T04D 3PP3K 1RMFH 2VOTA 4NBYB 4EBQL 3WIHL 3QH3A 4XNUH 4PJHB 1A6AA 3SDYH 3BH9B 4JFPA 4OFVA 1QFOA 2G2RB 2PW1A 3VXRB 4UTBH 3UDWA 1HNGA 3O3UN 2J88L 2PO6D 1HI6A 4MDJB 2UWEF 3O9WD 3RKDC 1F3JB 5IESH 3OKKB 4XCFH 1J1OL 3DO3A 5ALBH 3VXME 4PJGA 3ARUA 4F33B 3ROLB 1OTUC 2AXGA 1Z3GH 1FG9C 1XIWC 1XIWB 2H32B 2HWZH 3GSRB 4L8DA 2DBJA 1WK0A 3K7UA 5DK2A 2ATKA 3RGVD 1QLFB 4JO2L 4HJGB 3QWRA 3S36L 4IRZL 4PJXB 4CBPA 1U93A 3DV4A 3WKMH 4PJBB 2X4PB 3BP6A 1EMTL 2ZZUT 1RZKH 2OYPA 4YDKL 1XGYL 3L3KA 2J6EL 3RTQD 4YE4L 1YY9C 3FOLA 4N0YL 3HZVA 5DJYA 3V0WH 4WJ5B 3VFVA 5EH1A 3DO7A 1NCTA 1BECA 5HY9B 3B8YA 4AIXA 4OIAA 3WIFB 1IQWH 4LL9A 1JNLH 3Q6GL 3FKUS 3ARGC 3ARGB 4PGDB 1EZVY 4M7LL 3TWCH 3WNNA 4GMSL 1W72L 1RFDL 1JGEA 3HS0B 4GW5A 3GMQA 2OJZH 1EX0A 4LCYA 1BBDL 1YN6A 3OHXA 1UWEL 4L3EB 4HCRL 5D5MF 3CC5A 4HWBH 1L7TH 1WZ1H 2D0HA 4PR5B 5EWIL 3S4SA 1JGLH 4QY8A 5DRWB 1Z9SA 5E03A 1TVBA 3AC0A 4XCNB 1CL7I 4H20H 3F12A 3EGSA 1J1XH 2X1XR 3LEYL 1CG9A 5FYLL 1VENA 3MLZH 3MBXH 1OCWL 1KLUB 1NCAH 1DBKH 1Z0NA 4XCNA 5FECB 3RBGA 4KVCL 2YD6A 1T0PB 5DA0B 3SDCD 5T33H 3L5WB 5TFSL 4CVXB 1TJHH 1QA9A 2IAMA 3VDCA 5DUBB 1E28B 1S8DA 3FQUA 1JGVL 4KTEL 4ONHA 4PJIF 3TESA 3QUXC 3QUXB 5E1HB 4C56E 1ZHBA 1MFBL 4X5XB 1S7TA 5DYOB 3UTTB 3V7MA 5E7BA 1ZLVK 1NBVH 1LP9E 4K94H 2XZCH 4ZQKB 4U6HB 5E9DA 1WZKA 5D1XC 5D1XB 4XCEA 3UPRB 1KG0A 4GMTL 2HKFL 3HI5L 4YO0A 5IBLC 2MKWA 3BGMA 2CIKB 2NCMA 1CDGA 4OGYH 5DD5L 5C07B 2FECI 3MPCA 1E27A 5CSZB 1JE6A 5MENB 3QNZA 4AH2A 1RAMA 4KI5F 4IRZH 1J8HB 1HWGB 2HN7B 3LN5A 4EDXA 3THML 1EO8H 1ZT4B 5CINL 1A9EB 3E8UH 3D85D 4ODVL 2I9TB 4QRQA 1Z3GL 3VXOA 1HQ4A 3ZLQC 1A0QH 1F4YL 3CVIH 2O93L 4MXQC 4TULH 1I85C 4J3SA 4N68A 2GJ6D 1QFWL 3C6SB 1QNZL 12E8H 1IEBA 3JUZA 4LEXL 1FDLH 3MGAA 4C83A 2J8UB 1EDQA 1OGAA 5LKNA 4DEPB 3O2DA 4L3EE 5TH2A 4DEPC 4O4YL 5H8DA 2VXTL 4NO0D 1K5NB 4F3FB 3JZ7A 1FV1A 5FGRA 1B9ZA 2FX7L 1EIBA 2OR9L 2F54E 2YPLD 1CFSA 2BJML 3ARZA 3MJ9A 5CCKH 4JHZA 4OZIA 1NJ9A 3T8XB 1MRDL 1SJEA 4PY7B 3N1PC 1MLCB 3M8OL 2D3VA 3UTSD 4S1RH 1C5CL 1MJ8L 3L3IA 3FO0H 4P2CG 3LD8B 3LD8C 4W6XB 3TBTB 3OX8B 4NP4L 3OXSB 2IF7A 1N4XH 5JQ6H 4F9PC 1OCWH 1R24A 1QHPA 3TCLB 1GOHA 4KZEH 1I8KA 3K4ZA 4M6NL 5TPWH 3BN3B 1K8IA 4Q9QL 3VG0L 4Z7NF 4XPBH 4MD5B 4EOWH 2VH5H 4QOKD 4UOW0 3VGDA 4ZUVA 5HGBB 4OZGF 3HLAA 4PJ7F 5L8LB 3OX8A 4U1JA 3VDAA 3CFCH 5C0GB 2QTEA 2D7QA 3CFBA 4QHLB 1OLZA 3HE7B 3HE7C 3UTPE 3X3GL 4HHAA 3C2AH 1CE6A 4I1NB 2PW2A 4I3SL 5C0CD 4IRJB 4IRJC 4P57A 3WIHA 1A1NB 2B39A 5DJAB 1G7MA 2DQCH 5BV7B 5BV7C 1HHIA 2ZUWA 4ODWB 1BX2A 2CLVB 3KXFA 1ZANL 1RZIB 3KLSA 4ODUA 5D7IE 1OAUL 4XMPH 3N85H 4L1HA 1PKQE 1AD9B 2XTJD 1IGJB 2Q6WA 5IEKB 1GHFL 4HZLB 4E41A 5ERWB 1W0YT 5JOPE 1A7OH 2VXQH 3PP4L 4EUPB 3H9SA 4X6EB 3S3PA 5K9QG 4KKAC 2GIYA 1N8ZB 2BSSA 3DSFH 2G75A 5F1IA 3RIAK 4EDWL 1U8MB 4ODVH 1ZWIA 5DRNA 4MCYA 3FRUB 4K3EL 2HKHL 2P49B 5AZEL 2X9XA 3D18A 1N8ZA 1U8QA 1P7QA 4LP5A 4UDTB 3OAYK 2VDQL 3Q5YA 2D31B 5EOCH 3I6KA 4HZLA 3ARYA 4UI2A 1OP5K 4E41B 5B39B 2J8OA 1UXWA 5F3HB 2F5AL 3QQNA 4M7LT 5DO2C 3QEHA 4WFED 4XPGL 4N1HB 5DZNA 1CFQB 1I8IB 3MLVH 3QUML 4X6DA 4MCYB 4P59L 4LDLB 4PJFB 1II4E 4X99B 1XGRB 3EOYG 3V0VB 1SM3H 4HH8A 2XOTA 1NSNH 1IAII 5GISH 2F53E 4TVPD 2YKLL 1MY5A 5TDPA 2E6JA 5C6WH 4NNXB 4P2RE 1JWMB 1TJIH 3HI6L 3VGBA 1QACA 2HRPH 1FZKA 2QKIB 1EERB 4DWHA 1KCSH 1MAML 2XNAB 4XCCH 4GOSA 1F11A 1DDHA 4M1GL 4OGAD 4JG0H 4ZNEE 4CAGA 3DTXB 4JZNA 4ELME 4YXLH 1CE1L 1AGCB 5FOJA 2FIKB 4Z9KB 2RAMA 5BS0D 1HIMH 2COQA 1A47A 5EU6D 3VFWA 4P4RB 5IV2A 3MYJB 4OD2B 1ZANH 4B5EA 1QSEE 1BQLH 1KB5A 3WXVH 3TT3L 3RVXC 2NW2B 2YUZA 2A2QT 3RVWC 3OGOE 2FL5B 3UAJD 3P9MA 1SHMA 4P9MH 2DF3A 4H0IA 4XMPL 5IKCA 2F53A 2J12B 5B38B 5IQ7H 1JRHH 1Q9KA 1LE9B 4Y5VC 4Y5VB 4MAUH 4QRPB 5BXFB 5D7SH 2EO1A 3AVEA 3OBAA 2CIIA 2DTML 5AZ2H 3V52L 3L3DB 2FHBA 1U8HB 2IGFL 1B0WA 1UXSA 4L9LA 4JFED 3U7YH 4RNRB 3MUY1 5CIPA 3IVKB 5J3HD 2OZ4H 1QYGL 2J7LA 3HI1A 4LSTH 3F5WA 3T1FB 5HDBF 1J8HA 1CXFA 5C0NC 2R2EA 2KL6A 5E6YA 2IBBA 1EFXD 5I8KL 4R26H 3L7FB 2F53B 1IM9D 2F5BH 4Z5RB 5M95B 5HD8C 3ULSA 3PHOB 3BN9D 4L8CA 1HI6B 4JHAH 4G6KL 4HG4K 1SJVA 3ZKNC 1UM6L 4ZSOE 3CFEA 3TP4A 1NUFA 3ZKMC 2IANE 1KCUL 3CFKB 4ZQKA 4FFZH 1SMAA 4K94L 4P23D 3SGEI 5DSCA 1YJDL 3CGTA 4CMMA 4UTAH 3IDNA 3AB0B 3AB0C 2A6DA 3E6FB 3I3BA 4DZBB 3GM8A 5IM7A 1MIEL 1I4FB 3VI3F 2QADD 4XC1H 4LCCC 3Q3GB 4LCCB 4JFDD 3GMOB 4JJ5B 4OCXL 4I0PB 4I0PC 3SJVA 4PG2A 3NPSC 3NPSB 1ZVYA 3EAKA 2JJTA 2LU7A 1JBJA 3ALPA 4YFLI 4JG1H 1PQZA 4XPTL 4R4BB 4R96B 3PABA 5DVLA 1DBJH 4PB9L 2KKQA 3TIEA 4FG6C 1OL0A 4PB0L 1S7TB 5DYOA 4WU7B 3GRWH 1JK8B 3KR3L 4OLYL 3FQXA 3KYOA 4ZUUB 3MOBL 4HCRH 4JY6A 1NCDH 1T0NB 3C8HA 4AYFA 4PJGE 2BX5A 4NWUH 4NRXA 4UIMA 3PWPD 5EA0H 4GW4A 3VMOA 1DJSA 3KPSB 4X6DB 3WFEL 4R96A 3IU3A 5EBLA 4HUWA 1J0JA 2VMFA 4JR9L 3EGSB 2Z92A 4KV5F 5JZ7D 1FP5A 1OPGH 2ICES 4H20L 5ESQA 3D9AH 4GG8A 1WFTA 3ILPA 4X8XA 4IS6B 4CGTA 1KGCE 3NA9L 1SY6L 1IBGH 4ZD3L 4NZUH 4EQ2A 1R3KA 4L3AA 4I0CC 4FFWC 1V3JA 2FWOB 1XGTA 1MFBH 2WMPA 1U91A 2UYLB 2ITDA 2XQYG 2ED7A 4JQXA 2NR6D 2GHWB 2C26A 1S7XB 2ID5A 3PUCA 4Y1AD 1OM3H 4PY8I 3FMGH 2X1WL 1MI5A 1KXQE 1VFMA 3CH8A 2X6MA 3MLWH 4H8WL 1A6VL 1AQDA 5T5FH 5ACMA 1OGAB 3IFLL 1EGJA 2E7CA 3GBMH 3N1MC 3O6MH 3H8NA 3CFCL 2CLZA 2GCYB 2ZSWA 3MJ9H 5CJXA 2K7PA 4RX4D 3UCRA 4K55A 1AR1C 2F5BL 4PJ8A 1IKFL 4HWZA 1F4HA 3WLWD 1A6AB 1ZS8A 3MO1B 3WIHH 3T0BA 4LPCA 1BZQK 4Y5XA 3VFMA 1NLBH 1FYTB 1FNEA 3IU3B 1AFVH 3O4OC 3O4OB 4HJJH 4M43H 4RGOL 3VXSD 5BXFA 4W81A 4C59B 4QRUB 5CINH 3QCTH 2OR7A 2A73B 4PJCF 5TQ0H 1PY9A 4LEXH 3BPNB 3BPNC 4IHOA 3FONA 3O6FA 2E7HA 5HHXL 2XRAL 3KPOA 3X12B 1BAFH 3GGWA 4IM8A 5CGTA 4H1LB 1KUMA 4LPWA 1LP9A 1GPOH 5C0RL 3GJFH 1GAFL 1M6OB 3SDAB 3SDAC 2CK2A 2XPGA 1OTTC 3KPSE 3UTTA 5DHYA 4YZFF 1Q1JL 5I8EB 1MFCH 3LH2H 1KB5B 1DUZA 4YDKH 3CCHA 3UYOD 4JM2F 5JIIA 2HVJB 2AERT 3HE6D 5I1IL 3KLHD 3GI8L 1MELA 3GB7A 3WLBB 4OZIE 4PFEA 4YLQT 1RZKC 5A3IC 3WJJA 3RNKB 4PGCA 1FGNL 5GRYA 2C1OB 5EUOE 3QIUA 2MHAA 4Y19E 3I02B 2GT9A 4PJ5B 1MQKL 1D6EB 2FX8L 4LLYB 2DQDL 2EYSB 2J2ZA 2NZ9C 1ZA6B 1TVBB 3MBEB 3MBEC 4JR9H 1IGIL 3SDXA 2G60H 1FZOB 4KK9C 1MFDH 3O8XD 1VB9A 2WBJC 2WBJB 3FHQA 5ITBL 1HINL 3KHOA 3DETC 4JKMA 2ZUQC 2ZUQB 5IVZB 4G3YL 3C6SA 3MRDA 3NCJH 5FGCE 4XVSH 4KVNL 2BSTB 4MCZB 1T3FB 3VRIB 3I6GB 3JV6A 5INDA 3VXMB 1S78C 3QR2A 3MLYH 5JW4M 1DN0A 1ONQB 1T03H 3QT2A 3CK0H 3RVVC 1JTTA 5C6TL 3TA3D 3L3DA 1MJUL 1YEDA 1BIIB 1G1CA 1YEKH 1NGXA 4GRWE 2WQRA 2VR5A 2ZUYA 3GSXB 3KXFE 3LB6C 3KPPB 3MLUH 4YHPB 3TZVD 5HYJA 1K9TA 5TE7H 1F97A 3MRQA 1ETZA 1T21A 4NKOA 4KDTC 4HUUA 4CN6A 1JF1A 1TTFA 2WUCH 4KH2A 4GKZB 3VI4E 1R3HB 1Q9LA 1U93B 3DV4B 3SGDH 3UPRA 4MMZC 1OQXA 1U8NA 5AD0A 5DT1H 3CU1A 5IBTH 4M5YL 5GGRB 3ZKQD 4P5TD 3WDIA 3ZDXF 1MHPL 4Z7QF 1XIWA 3GSRA 4RAUA 3FOMB 4FXGB 4PJAF 4BQ6A 4GAJL 4F7TB 2X4QA 1EMTH 2NX5D 3F62A 4ZFFB 3UMTA 3RAJL 4TQEL 4CVXA 1LO5A 4JZNB 1AP2B 1KCVH 4Y4HA 3MREA 2A6IB 2AJYH 5DJAA 4X7DC 3I3DA 1BX2B 1PAMA 3CD4A 5I66B 1Y0LB 2A77L 2DWDA 5I1JH 4N8PA 3TWCL 3CX5J 1CF8H 1WEJL 4X0KB 5D7JD 5C0GA 4NGHH 4P9HH 4E42A 3CC5B 1KTDB 4TSCH 3J7HA 1R5IA 4JFZH 1IZKA 1N2RA 1KEML 3TZVB 1NAKH 3TZVC 2NY5L 3V7AG 4IIQC 4IIQB 1DUYA 2JJUA 4I77H 1MCEA 5E2VL 3OTTA 4OUUB 4WEBH 4D8PA 2NY5C 4F8QA 4M1DH 1S78D 1XCTB 5JXED 3PJSA 3LHPL 4WTXA 4NKIL 4LKXA 4OQTA 1UCBL 4W4OC 5GS2D 4POZC 3DURB 1INDL 3TCLA 3BWAA 5KSAC 4J1UB 4RIRB 4X7CC 5KSAB 4DN3H 3SKNA 1QKZL 5IMMA 4N5UA 1KJVB 2VLLB 1ZTXL 3ZTNL 3IJSB 5C08B 3EFFA 5F8QC 3RL1B 3T1WA 5C08E 3LN4A 1JPSH 2ARJA 4U7MA 1DBBH 5ILTH 2FD6L 3TT3H 5MEOA 4X8JB 2E9BA 1IL1B 1AO7A 4I4WB 2G75B 3W2DH 2BSSB 5GGVH 3BE1H 3RWEA 4MXWL 1WFUA 4PD4J 3RWDA 1E4XI 2BNQB 2FCBA 5HHMD 2HT3D 1JJUA 2CXGA 3UDWC 4ZFGH 4Z7UA 4RMUA 4FXKB 5L8JB 4XH2A 1IC5L 3ALWA 3L95B 1A3LL 3BH9A 4NNYB 5GSRB 1RZIA 4M6AA 3SDAD 3U7YL 3P40A 2E9WA 1N7ML 4X8JA 1DQMH 4KJWC 3NAAH 4P9HC 1UACL 1FL5B 5DD3H 3U30C 3U30B 2EYRA 1PYWA 1S9WA 5IJKC 3MRJB 3X17A 5C0BB 5FCUH 3B8SA 3NA9H 3P4NB 1QFWH 5C09D 1ITCA 3JWDL 5JW4N 1MCOL 2DKMA 4G7YL 1CXIA 4XVUC 3HKFA 3W9EA 2XWBB 4PRNA 5B22A 3O4LE 1YEHL 1QBBA 2ORBL 4JGMA 5ANMB 4FQHA 5K59E 3FL7A 3WLWC 3PDGA 3P77A 3V4PH 1AO7E 4K3GA 3QZWG 4FQJH 4UT7H 1N3NA 4JFOB 1I8LC 3MNZB 1AC6A 3QHFL 1T0NA 3L1OH 4RMWA 1HCVA 2QSCH 1S8DB 3FQUB 1D5MA 2DIJA 3MJ9L 1LO3L 4Z8FL 2BXZA 1ZLVH 3FONB 3LHPH 1NGZB 3GI9H 2JJSA 4M6OL 4R8WH 3ARVA 2VXSL 1ACYL 1ACZA 1I1YB 3QDMA 3EYOB 2FBJL 4DN3L 4EKXA 4YR6B 1KLUA 3MOAH 1HKFA 1IC7L 3VD9A 4F3FA 1WZMA 2X44D 2BOCA 4MHHI 4QY8B 5DRWA 5IQ9A 4XNQA 1FZKB 2A6IA 4U6YB 1AKJA 1FO0A 3RDTD 3KYNA 4NBXB 3JUYA 2HG5A 3WV0A 1NMBL 4A2MA 3QO0A 4DGIH 4I3SH 3FT2A 4G9FA 5IWLC 2IADB 4NJ9H 4OFYA 4CN1A 3EDFA 3G9AB 3KLDA