3EOTL

Crystal structure of lac031, an engineered anti-vla1 fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
QIQLTQSPSSLSASVGDRVTITCSASSSVNSSALFWYQQKPGKAPKPWIYLTSNLASGVPSRFSGSGSGTDYTLTISSLQPEDFATYYCQQISGNPWTFGQGTKVEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB FRAGMENT, HEAVY CHAIN
publication title An antibody loop replacement design feasibility study and a loop-swapped dimer structure.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eotL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eotL01
4JFZL 2B1AL 4OZIB 2DLFL 2ZPKL 3F8UB 3V5DA 1F6AB 1ZV5A 2ICEA 3ULSB 1UWXK 1GGIL 1UM4L 4HX1A 3LV3A 4JANA 2A9ML 1CFTB 3S35L 3HR5A 1WWCA 5LCVH 1HWGB 3QCUL 5IUSA 1WQVT 1CICC 1FNLA 3TM6A 3K4DA 3W0WB 1E4JA 3BIKA 3PIQA 1DLHA 2D7QA 4QRPE 2H32H 1PKQE 1XGRB 3BN9C 3TFKD 1OPGL 2L7JA 5F7EL 3GSVB 4WRLA 4AEHH 4YEFA 1T7WA 2R4SL 5D1XA 3U7WL 2P48B 3BISA 4EN3B 3SN6N 3C2AH 4P2QE 1FDLL 3GHEH 4LLYA 4XCCH 2O5YL 3LS5L 1MCPL 3O4LA 1NGWA 2VLRE 1FL5B 3MA7A 4XVTL 5IWLA 1INEH 1NGZB 2GAZB 5E6YA 3QDGB 4CMMA 3ULUL 3HPJA 3NGBC 4CL7A 4G80B 3QIBA 3IXTA 3D18B 4OZGB 4X0KA 5CWSA 2OL3A 4RZCA 5FKPA 2I60H 3TO2B 5CILH 1CFSA 1A1OA 2ADJA 3RP1A 3DUSA 1OTUD 1R24B 3OQ3B 5TDPA 2R0WH 1MCNA 4GAGL 4TPRL 5EORL 1UENA 3MUJA 3S5LA 2A1WH 3A6CH 1OQXA 4PG2C 1QFUL 5I1EL 2OJEA 2QEJA 4M5YH 4L8CA 3IU3B 5E6IB 4NSKA 1NCDH 4QRPD 2CUMA 1YNTA 2PYFA 1JI2A 4C56E 5JW4Q 5IIEA 3EOAA 5HDQH 3O3AA 1WBZB 1H3GA 3NPSB 2P47B 5JXED 3ZMRA 1S7VA 5KN5A 4U1KB 3ARBA 4P2OB 2CDGB 2OBGA 4P2QD 3UTQA 4OTXL 2HJFB 5C6WH 4IRJB 1BREA 5AUMB 3HUJE 4D8PB 3EO0A 2VLRD 4FZ8L 1RUMH 3L6FB 4NCDA 4P0DA 4PJDF 1N0XL 4FZEL 5JIIA 2WLZA 3ARDB 5JORB 5SWZE 3B9EA 4L29B 3N06B 3ZYOA 5CD3B 1KIPA 1CU4H 4WI8A 4OCNC 3T0BA 2O93L 4PJHB 2ZKHL 3QJHA 4JN1H 1T0PB 5L7XH 1I3RB 4JY6A 3C5JA 1J11A 4OLYL 5IVXF 2JK5B 1IARB 4NCC1 2X9XA 3HC3L 1DL7H 3U4BL 2W0FA 3D85B 4H20H 4JO4H 5C6TH 1N4XH 3GMLA 4PLKD 4Y5VC 5JMOC 1IFHH 4QRSA 4PGEA 5HYJE 3DX9B 1BM3L 5CUSL 2VDNH 3THML 4JLRA 4NQSB 2COQA 5IG7B 4C56D 2G60L 4FQJL 3GDBA 4XNMB 5AWNL 4BFGA 3QIWD 2GCYA 5JOFB 4ZPTA 3P4LA 3MJ7A 1J05B 2E3VA 4PJEB 5AYUL 5KS9E 1U3HD 1RHHB 5DO2D 3I85A 1EH9A 3MNVA 1L4IA 3U9PH 3I9GH 5HYSA 2YA1A 1U8KB 1SY6H 2BVYA 1I1AC 3CX5J 4MSWB 3SCMB 4JRYB 5EZIH 4ZO6A 4HPOH 1JCKA 2F54A 3C5ZB 4XTRC 3TESA 4UQ3B 5SWZD 3UAJD 2DMCA 2CJUL 5D2LA 2XTLA 4YAQB 3OPZH 1BF2A 1MFDH 5ID1A 3TIDB 4TVSa 5FUZL 3QXUA 3S37L 1RMFL 4O9HH 5IEHA 1K4DB 1ZKAA 1X7QB 2R23A 2A9NH 5I19H 3WNMA 3OGOE 1GPOL 1FVEA 4WEBH 2FRGP 3OJVC 3RZCC 4HV8A 1AE6H 5HYJD 2R29H 4BKLA 1KJ2H 3U0WL 5MEPB 4RQQA 1ETZB 4H25B 1XF1A 5IMOB 2IALB 3U1SH 5K59E 1T1YA 3NCMA 1Q9WB 1CTNA 2A74A 1DJSA 5F3BA 1VFMA 1FO0B 1DVFB 1XGYL 3L3KB 5FHBL 4GO6B 1UJ3B 4XC1L 3MRIB 5CD5D 2EE2A 1PKQA 4PJ8D 5C0EA 3OAZH 5JPMA 4R90H 4HKJA 1JPFA 3S4SA 1NC2B 5JXEA 3WS3A 1Q0XH 4KMQA 1KN4L 1NC4B 3O0RH 4QRTB 5H2BB 1HSAB 2VLRA 4IIQB 3LMJL 3RRQA 3DO7B 5KSAC 1M1SA 1S7QA 4M5ZH 5DRWB 3RKDC 2NYYD 3KLHD 3UYRL 4PY7B 4S1SL 3L9RA 5T33L 2IAMB 4QEGA 4EI5C 3QH3A 5C08E 1Z2KA 4ZFGL 5DSCB 1E4XL 2BC4A 3C6LD 2V9QA 1KPUB 2EDQA 2QSCH 3CSPA 3PL6B 1OAUH 2W1NA 4P5TB 3QIUA 3NFPA 2HT3C 4NFCA 1GC1C 2VZUA 1Y6NR 2XXCB 4W6XB 3KPPB 4TTGA 4IOFD 2N7BA 2ORBH 2VN7A 1KN2H 3GBML 1X5AA 4MJIE 3ZSTA 3FAWA 1JBJA 1Z9MA 4HWNA 4NQVB 4GS7C 3SBWC 3IS1X 1QLEL 4UV7H 5DGQA 2Y25A 4NKIH 2FD6L 5KJRL 1YPZB 4C56A 3P0VL 2R2EB 3QIWA 5J6GA 1BP3B 4TTDD 3UTPE 3V7MA 2WSKA 4CN1A 1U3HA 5FK9A 2I24N 5KSUA 1QO3B 5LBSH 1OD7A 5DHVB 3QI9B 2DBJA 4MX7A 4I5BB 4OF7A 3NVQA 1P6AB 1QA9B 1V3MA 1MWAL 2W0PA 2HVKB 4FNLH 2X4OA 1S7UA 1NGPH 5SWZA 2AV1B 4P9HL 2BNUB 1MFCH 3U30C 1I7RA 3VXME 1X5XA 5C08D 4XRCB 1CGUA 1MHCB 3BP5B 4L8SB 2GUOB 1FL3A 3QHFL 4X8XA 1J1OH 3I6GB 1I4FB 3BUTA 5DT1L 4R0LB 4NRXB 5C7XH 1OAXH 5GZND 4A6YB 4G42B 4MJID 2ED8A 3D0VA 2DQGH 5HYJA 1HCFX 3V4UL 2V2XA 3PWLA 3T4YB 3L3OA 3VG9C 4NO3B 5D7IB 1YNKH 3C2SA 3UTPD 4HUXB 1OAKL 4Q97A 3T3PE 3ZE0E 5KS9A 4WHCA 5DUPL 1S7RB 4U1SA 1HILB 4GW1B 3ZL4L 3OG6B 2Z8SA 4AM0A 4PJ8A 3BPLB 1T6VN 5FCUH 5GSRA 2BMKA 5GRZA 4Q0XH 1G9MH 2C5DC 1I1FB 4HH9A 5F70A 2DDQH 3PHQB 1YEFH 3MLZH 4QHLA 5HJ3A 4ZSOE 4KGJA 3RX5A 1B2WH 3TV3H 3VXMD 2HTLC 2X1PA 3K2UH 4MAYB 1NCBL 2R56H 5E5UB 1MI5E 2VKWA 5DFWH 3KLSA 2QL1A 4HWBH 4UUJB 4P4KC 3MJ9A 3QPQC 1AY1L 4R96A 1RURL 3DI2B 5F9AC 2IPKA 1TCMA 2GJZA 2EEAA 3C6LA 5KVFH 1KIQA 1T5WB 4PJXF 1NCWH 2PTUA 2OCFD 1L7IH 1TZGL 2VDKH 3K46A 4F9PA 1IBGL 2GITB 2IH3B 1S9XA 1HXYB 4Z0XB 1S3KL 2ZG2A 4FFVC 3HI6L 1U92A 3RX7A 2LU4A 3EHBD 1FPTL 5EG6C 2GY5A 5SV3A 1PDKA 2DQTH 4NT6A 1RZJL 3ZKSD 1KEGL 3P0GB 5ESAA 1P2CB 3LRHA 3IFOA 3HNSH 3GO1H 5T1KA 2VDQL 4KTDL 2EO1A 2CUHA 4FP8H 1KBGH 1U42A 5C0CE 5D96C 2AJSL 3UMTA 4GMTL 4L8DA 3VRLF 3T0EC 2XT1B 3SE3C 5DJDB 2VDML 1EIBA 1JWMB 4XB7A 1MI5D 1MJUL 4M8QA 3K8LA 4JZOB 5EU6D 2YRLA 5D8JL 3Q2CA 5CCKL 2FO4A 4OB5H 3ELAT 4XWGH 3UBXG 5EZOL 3MLPA 2BJMH 5C08A 3CDGB 1F2QA 3CD4A 2EE9A 5HYEA 3QWOB 5D1QC 1INQB 3BZ4A 3SDDB 4O2CA 4YBLB 2VDRL 2WANA 1LWRA 5JHLL 2A6JA 4LP5A 4OLXL 4MJIA 1KCRH 1IC4H 4GW5A 5I15L 4GRWE 3KYNA 1WGOA 2D7MA 2I5YL 1NLBL 1B0WA 2MWCA 1SEQL 5FF6A 1EGJA 1YJDH 1QSZA 2Z92B 5JIPA 4LLUA 2EDKA 4KJWD 3X13A 3QR2A 1P69B 1XGPA 1LO0L 3BP7A 1TJIL 5C0CD 3O81A 1B4RA 1IGJB 4DKFL 1DBKH 1KJMB 2JB6B 3G9AB 5I16B 1ZXQA 4OZIE 1K8DB 1HH9A 3F6IA 1GCFA 2J6EH 1RV6X 1OL0A 1B90A 1RZ7L 5TQ2L 3PDOA 3VFOA 1YEGH 5I1KH 5JOPE 3VXMA 3HAEA 3C08H 3OZ9H 1I9IL 3MUGB 2R1YA 2BSED 3BAEL 4OCXL 1VFOA 3W0WE 5BZDA 4WO4D 4I0PD 3QUKB 4I13B 4R97B 5F1IB 4X6BB 4WU7B 3O6FC 2N1KA 3DMMB 3CGTA 3FB6A 2NW3B 3FQTB 2HA1A 1JHTB 1TQCB 3TCLB 2ADFH 3TJHC 1D6EA 4NGHL 12E8H 3GSUB 1Q94A 4QXGL 3JWOC 2Y6SD 2FLBT 1WISA 1HEZA 3F58H 1C5BL 5JUEH 3C60B 3T3MF 4XNUL 4PRNA 4EJ1C 3T2QA 2BSRA 4PGBB 2Y5TB 3MOQA 4DEPC 3C6SA 2H32A 1QR1A 1BX2A 3N0PB 3QDGE 4ELKB 4NC1E 5GSVA 4H26A 4ONGL 5LCVL 1FCCA 2E9WA 2FYYB 3TWCL 4ZS7H 1FGVH 4OZGE 4D0DB 5HVHB 1E0OB 1I7UB 5IQ9B 3BIAX 3PGCB 2WLYA 4UU9A 3V5KB 4O51A 5JOPD 1YC7A 4LGRB 5EWIL 1A7PH 1AJ7H 2EXWD 1MFBH 1MI5A 3HZMA 3IRZA 5E7BA 3BXNB 3QJFB 5EU6A 3GB7A 2ZJSH 1KNOA 4OZFG 3LQAL 4AEHL 4XCEA 1FRGH 3W0WD 1J1XL 5J11C 3DV6B 3C2AL 4J3WA 1T22B 3QZWG 4LFHG 3GHEL 4KROD 3W81A 4XCCL 3WNNA 3I84A 2G75A 3DUHA 4LAJH 8FABB 1A7NL 4EN3D 5GRJH 2AQ2A 3ARZA 4N0FB 3MRDB 1MLBA 5TDOB 3TNNA 2K1MA 2EH8H 3SDCD 1RIHH 2I60L 5FYLH 2FX8H 5CILL 3QDGD 4R7DB 1PFCA 5JLZA 2GJ6B 3MBXH 4YHMH 5GGVH 3TBWB 4LASH 2R0WL 1BQSA 2E7HA 4NCC2 5KSBB 5C0CA 2HT2D 3A6CL 3MFGB 4R4BB 1VEPA 4F2MA 2FEDD 2GSIA 1A6UL 1A9BB 4FQIH 3GMQA 5DJ6A 3D87B 1AGEB 1XGQB 1NCDL 3DX6A 4GKZB 5JNYB 3CC5A 3B6SB 3GMRA 4L4JA 3L7EB 5HDQL 3QUYB 4U6YA 3K74B 4ZTOH 5IKCB 4NO5A 2HMID 5DMKB 1RD6A 4KKLC 3D25B 3FHAA 3GNMH 4JG0H 4MZ3A 4Q2ZA 4DOHB 1A6ZB 5TDNA 3GKWH 2GIYA 4EI6B 4ELMB 4UTAL 1RUML 4PJEE 2DIBA 1FV1A 2EDEA 4QOKB 4I0PA 4MA3A 4HS3B 1D6VH 4NHCH 4P9MH 4DQOH 4P2OD 4HZLB 2F15A 2JJVA 4R7NA 3IFLH 3EYQC 3F5WB 3HZKA 5JW3L 4QHMA 4OCWH 4JRYE 2C3VB 4M7LH 2GK0B 5FM5M 4YDJB 3JXAA 2XZCH 3IXAA 4JN1L 3MREA 3SPVA 3ARDD 2AJUL 2EC8A 3OJDA 5HHXH 4ZFZA 1AHWB 3DJ9A 4F33A 2J5LC 5KTEH 1M71A 4H20L 2BY2A 4JO4L 3TT3H 4OD2B 1G7HA 5C6TL 1JPST 5I71B 1KCUL 1WTLA 1N4XL 2BRRH 3PWJB 3E6HA 4WNQA 1IFHL 1SY6A 1NMBL 2NY3D 2VDNL 4OV5A 1Z6JT 4GUPB 2KH2B 4XX1E 4I18B 4OZIA 1D5IH 3D85D 1F6AA 3ULSA 3ZDYF 1S5IL 2KUTA 4U1GB 1CFTA 2DQDH 4YBHA 4WW2C 3U9PL 5H94B 3I9GL 1MCRA 1ZT1B 4NN5B 4FABH 1EJOL 4Q9RH 4HPOL 3W0WA 5IFAH 3GI8L 2E6PA 1IGIH 3GSXB 4X6EB 5ECJE 4KK6C 5EU3B 2CRZA 3OPZL 1XGRA 4JRYD 5B4MD 1IGFH 1J87A 3GSVA 4DUXA 2LTQC 3U7AA 2VXQL 3WD5H 4O9HL 1NEZG 2FATH 4EN3A 4P3CH 2AEPH 2A9NL 3MRMB 1ZEAH 4J3TA 3EO9L 5FDYA 5DDHB 1FL5A 4UTBH 3KR3H 1KJ2L 3WFHB 1NGZA 2GAZA 3QDGA 3KLAB 1E6OH 2H6PB 3M45A 3H9SB 4YZFF 4G80A 1CGTA 1NFIB 4OZGA 3U1SL 3VXTB 4K94L 1QOKA 3CFDB 4Z7VB 2PO6B 3TO2A 5GRYA 4YX2L 3BGFC 3SKJL 1R24A 2K7QA 2XV6B 1OWWA 2J8OA 4K9EC 4NZUL 4UBDD 1DVFD 3O41B 4WWKC 1Q0XL 1JWUB 3IU3A 4WUUE 5E6IA 1CDYA 5CEZD 3O0RL 5DF0A 3CFCH 1P4BH 4APQB 3BQUD 2CRMA 2UWEF 1U8IB 1WBZA 1BEYL 5DRXB 3C9NA 4U1KA 1XF4B 3BH8B 4P2OA 3R0MA 1NC4D 2HJFA 4NDMB 3RWJB 3PWPB 4IRJA 1N6QH 1ZANH 5AUMA 4D8PA 5FGBC 4GBXD 3IKCB 4RDQF 3L6FA 3AUVA 1S78D 1M05B 1OAUL 4OZHB 3ARDA 3TVMB 4ODHH 5JORA 1J86A 4L29A 5I1JL 5CD3A 3TN0B 2IAMD 2WBJB 3OKDB 1FQ9C 4HUVB 2IF7A 4LBEB 4FTVB 2ORBL 4PJHA 3IJHB 3EZ8A 1I3RA 1OP5H 4P5TD 4F58H 5TE4H 2JK5A 1NCAL 1QFWL 4UV7L 1H9VA 1MJ7H 3RTQC 4X6CB 2ZOLB 3D85A 4CW1B 4WV1C 1GZPB 3UJJH 2DICA 3DX9A 4WUUD 1E4KC 3UTTB 4NQSA 5GS3A 3GJFK 4IRSC 5IG7A 3DX7B 4H0GA 5D7IE 4XNMA 4OD3H 4OGYH 4BQCA 1Y6MR 2H45A 4XBPB 1J05A 4JDTL 2YWZA 4MD4B 4PJEA 4LL9A 1RHHA 2JELL 3HC4H 1NGPL 1U0QA 4MXVF 1U8KA 4R8WH 5ILTH 4FS0A 4MSWA 3SCMA 4JRYA 2QBWA 5DUMH 1KEMH 5E70A 3C5ZA 1J1OL 2YD3A 4UQ3A 4YHLH 4FMFA 3HCVB 4YNYB 2I07B 5D2NB 4YAQA 5EO9B 1K8IB 5FHAH 2G5BB 1S7TB 1OAXL 1PBYA 2B5IB 4N0UB 3TIDA 3NCJH 4F8QA 2DQGL 2ZWLT 3T2PA 2V2TB 4LHUD 2D7TH 1K4DA 5T5FL 1X7QA 1PEWA 3DETD 3K1DA 3BD4A 3KYAA 4KKBC 1ZTXH 1H15B 3KPRB 1YNKL 4QF1B 3QUMB 3W5MA 5F1NB 4NKOB 5MEPA 4KMTL 3SDXF 4XGZB 4F15C 3Q3GB 2HRPL 1ETZA 4H25A 1FE8H 3BJLA 2H9GB 3ECBB 4PTTB 5IMOA 1P7HL 2IALA 2FH8A 3F7VB 1Q9WA 3GM8A 5A2JH 5FCUL 2NY6B 1FO0A 1DVFA 1G9ML 3L3KA 4Q0XL 3LS4H 4ZTPH 1UJ3A 5IW1B 3MLZL 3MRIA 3DVIA 1B2WL 4XVUD 1CF8H 2WUCH 3CXDL 3K2UL 2R56L 3ARXA 4ERSH 1MAJA 3TYFB 4RA0C 1NC2A 3O6LH 5HHMB 3WO4C 4JREB 2CPCA 4HWBL 4JG1H 3HE6D 3EFFB 1U3JA 1NC4A 4HF5H 4QRTA 4GT7A 4PD4J 3O3UN 5H2BA 4G8IB 2MCPL 5IB3B 1HSAA 2X5PA 4MAYD 4IIQA 3DO7A 5CS7A 3GUTB 2ZUVA 3JZ7A 3QQ3B 5DRWA 5FYLE 5KVFL 1NCWL 4JM4H 4PY7A 3FAXA 2D4DA 1L7IL 2VDKL 1RJLB 1J8HB 2IAMA 4K71C 1A02N 4Q6YA 2BHUA 5DSCA 5E00B 2ARWA 2AABH 3HC0B 1KPUA 3PL6A 3DSFH 4P5TA 4P2RB 4OM0H 5HYFA 4L5FL 3T2OA 1NFDF 3G5XB 4ZXBC 2DQTL 4YDKH 3KPPA 3D1MC 4U33A 4FQHB 4NQVA 3HNSL 3EYOB 3G08B 4HUMB 4FP8L 1KBGL 3C09C 5I73C 2ICCA 3TYGH 2EEDA 1AFVH 1YPZA 3MSPA 2R1WB 1TDQA 2R2EA 1BZ9B 2HFTA 3S36X 3BDYH 3O3DB 1AQDB 3BKMH 1QO3A 3RWFB 1EHXA 4FOMA 5DHVA 3QI9A 4OB5L 3K0WA 5E2VL 2Z91B 2NXYB 2BJML 3IFNH 3O9WB 4I5BA 1QA9A 4ZUUB 2HVKA 5FYLD 1E28B 4MHHI 4U1HB 2AV1A 4MA1B 2EZ0D 2BNUA 4X7DC 3CMGA 4GAYB 1MHEB 4XRCA 2AEQL 1MHCA 4M8VA 3BP5A 4L8SA 2GUOA 4JFFB 5FM5O 5I1GH 3I6GA 1I4FA 3D3VB 3LN5B 3SDDD 4NRZB 4R0LA 5M94B 4NRXA 3QAZB 2VLKB 4OCLC 4A6YA 2X7LB 5IB5B 4G42A 1HKFA 5DD0H 1JJUA 3QXWA 5J13C 3H8NA 4MDJB 4OKVB 5DQDH 5E1AB 5B3JE 4OI8A 1NBVH 4L9DA 3GK8H 3T4YA 1FYHB 1XT5A 3QEUB 4NO3A 1W72B 5D7IA 3FONB 1MCCA 4XXCC 2B2XL 4HUXA 5EU5B 2BFVL 3VI4E 1OQOA 1S7RA 2J6EL 4L9LC 3ZT5A 2BVPB 1HILA 3VRIB 1LP9B 4GW1A 3VG0H 1KTRL 5I1KL 1VDGA 4PJIB 1CK0H 3C08L 5E8DH 4U2ZA 3MGAA 3MXWH 4JFEB 4QYOB 1RI8A 3HZVB 1I1FA 3PHQA 3QUMH 5GHWH 5D72H 1MCLA 4P3WA 3EJJX 5IMKB 4Z7WF 4MAYA 5E2WH 4Y16D 5F9WB 3VGAC 2Y07H 4UUJA 1WUNT 4FQXC 1MIEH 12E8L 3IVKB 3SKOB 4MD5B 4JFYB 1T5WA 2CH8A 3F58L 3P11L 2DQHH 3DMMD 2P4AB 4NOFA 3MX0A 4FQQB 2GITA 1DQDL 3MPCA 2IH3A 1HXYA 4Z0XA 2NTFB 3OBAA 4N1HB 2WQRA 3K2MC 4JQIH 3C60D 4ZS7L 1FGVL 5LAXB 4I0KA 4X4ME 1F58H 4AL8L 1VERA 2BP3A 1P2CA 1NQBA 2GJ6E 4PFEA 1ADQL 1A7PL 1YY8B 3DRQB 3L3HB 1MFBL 3H3PH 1QHPA 1OCWH 4JRXB 5IROA 5DJ0B 5MEOB 2EE3A 5KSBE 3ULUF 1FRGL 4P3DB 4QRUB 1OVZA 4POZC 4GRLC 4U7SA 5DJDA 1JWMA 3WDIA 1R3IH 1G7LB 3P9LB 4RMTA 4HT1H 4JZOA 4AIZB 1KXVC 2EH7L 1RSFA 3H2WA 1XMWA 3WLWD 5IW6B 2HKHH 3ZKNC 4ACPA 3E8UH 1RUAH 4F7TB 2VTFA 3CDGA 3UCRA 5GRJL 5E24E 2W0LA 3U79A 2XG4A 3QWOA 5IBLC 4ELME 32C2B 4PJCB 1INQA 3SDDA 4D0BB 2EH8L 4QOKE 4HK0B 3GSRB 1RIHL 2FX8L 5J4MA 1KV3A 5KVDH 3ESVF 4KU1A 4N0RA 1U9KA 2E9IA 1CGVA 1A3LH 5GGVL 3V0AC 3QUZB 3ZDXF 3KJ4B 3ARYA 4HLZH 4E0RB 2K9UA 5FUCC 4M7KH 1FZMB 2GJ6D 4FQIL 1AIFB 4K9EH 1M4KA 4U6TA 2Z92A 3T4AB 3VI3E 4H88H 1I3GH 1WWAX 3FQWB 4RISH 4LCWB 2D0FA 3I3EA 1IGJA 4ZTOL 2IPUK 1KJMA 2JB6A 1IGCH 3WS6C 4PJ5B 5I16A 4JG0L 3GNML 4Z7NE 4Z7QF 3O4OB 4KUCD 1WLHA 1K8DA 15C8H 3GKWL 4LCCC 3QUYD 1AR2A 5EUOB 4G5ZL 1D6VL 4NHCL 4P9ML 3WHXB 4DQOL 3Q5YA 2ZZUT 3CCHB 5EH1A 5IQ7H 1T2XA 1W72H 3MUGA 5GS2H 3F7YB 4OCWL 4LMQE 1GC1L 1HYSC 4ODWB 4M7LL 1W0WB 2XZCL 4QOKD 1D9KB 3GSOB 1MSPA 2MPAH 5HHXL 4OGAC 3QUKA 1NUFA 5F1IA 4K2UL 4X6BA 3U46B 4WU7A 3S34H 2EEBA 3DMMA 5T5NG 3U0TB 2NW3A 2Y9RT 3FQTA 3HMXL 1JHTA 4Y8DC 3TCLA 2AXHA 3GSUA 1ZE3C 2RJMA 3OKEB 1WZKA 1D5IL 3C60A 1I8IB 1I9RH 4PGBA 4Q9BA 2YHGA 1FORH 2Y5TA 2D7PA 3VA2C 5M7QA 1MNUH 3GIZL 2DQDL 5L8JB 2E9BA 4ELKA 3IB4A 4M03A 4HFWB 2X09A 2FYYA 4D0DA 3WUWB 1I7UA 2WZPD 4C4KO 5IQ9A 3PGCA 4FABL 4NQCB 4Q9RL 3ZHDA 3TA3B 3V5KA 3HN3A 5F97E 4CVXB 5E99L 1CDUA 4K8RC 1VFAB 4J4PC 3BXNA 3QJFA 1S5HA 1MFNA 2J8UE 5HI4D 5CP7B 5I75C 2DF3A 3WD5L 4X5LA 4FFYH 3DV6A 4PRHE 4P3CL 1T22A 2AEPL 4YLQT 1WICA 1ZEAL 2YR3A 4U3XA 3IFPB 4X6DB 2QSQA 3KR3L 2PXYD 8FABA 3MRQB 1E6OL 1CR9L 3RVUC 1T7YA 4N0FA 3MRDA 3PWPE 3C87A 3MBED 5TDOA 2HFGH 1LNUB 3ARVA 5GRUL 4NZTH 5D9SB 1NBZB 4X4MA 1G6RB 4OSUH 4UQ2B 4R7DA 3RGHA 2GJ6A 1CVSC 1AC6A 3RL2B 5F1SA 4KDTA 3TBWA 1JNJA 3CFEB 3QQ9D 4DN4L 1T6WA 2WWKT 5HY9B 2PO6D 1TQBB 5KSBA 4IEFB 4G9DB 4R4BA 1A9BA 4O5LH 5KAQF 1AGEA 1XGQA 5BVJB 4GKZA 4X6CE 4DW2H 5JNYA 3T04D 4X80H 5ISZB 1MAKA 3B6SA 1P4BL 5KW9L 3ULVH 2FH6A 3L7EA 1IC1A 3QUYA 1QKZH 5IKCA 5FB8B 3VFGL 3UTTE 5DMKA 1F00I 2UZIH 5DFTA 2ED7A 3D25A 4NN6C 1A6ZA 3DURB 3VDCA 1N6QL 3VGFA 1ZANL 3OKOB 5SX5H 4APQD 2R1XB 4EI6A 4ELMA 5K93A 3ZSSA 3EYFB 1YMMB 1K5NB 1CICB 4GSDL 4QOKA 4HS3A 4ODHL 2YZ8A 3ILPB 4LRIA 2NR6C 5C0NC 4CUCA 4HZLA 3BW9B 1MY5A 4WVRA 3PWPD 3F5WA 4N0CC 4FXGB 2FO1A 5BS0B 1HI6B 4EUPH 1XGUB 2C3VA 5DYOB 2GK0A 5IBUG 1GL4B 4KAQH 4YDJA 2OZ4H 4M1CD 4HGWB 5C9KA 1R3HB 4F58L 5DHXB 4K3EH 1FYTB 1C1EH 2D4FA 3BPOB 3IDUA 2X70B 1AHWA 3TN0D 2WBJD 2OMNA 1ND0B 5T1LD 2UYLB 4N0UE 4OD2A 4AEIH 3PWJA 1IT9H 2MOVA 1IC5H 5DHYB 1RZIB 3OXSB 1T1WB 1YYLH 3HKFA 3T0VA 4GUPA 3FRUB 4I18A 1BZ7B 3WN5C 4NUGH 4OD3L 1EX0A 4OGYL 5EFIB 3KPRE 5GGTH 4G6AD 3VXSE 4MNQB 2DQFB 3HC4L 3UTTD 2ICWJ 4IM8A 5H94A 2A0LD 3MV11 4R8WL 1ZT1A 5ILTL 2JTDA 3DIFB 2XQBH 2NY1C 3MV9E 4DAGH 4NN7B 4F3FB 5DUML 5K9QI 4LLVB 1ZS8B 3S36L 4KKAD 5EA0H 1FG9C 2XTJC 3GSXA 1LD9B 3TT1H 1CLOL 2B8OT 5I17B 4GAFB 1JTTA 3N9GH 5EU3A 4GLRH 1KB9J 3NCJL 2EIZB 5HHME 4OZ4B 1MCSA 2D7TL 2YN3A 2X4TB 1U8LB 1B88A 3MRMA 5CJQH 4F7PB 2MJWA 4NWTH 3UXFA 4DFHA 5DDHA 1NCNA 5F96H 1ZTXL 1NKRA 4Z0BH 4P23B 4Z7VF 3MZGB 3WFHA 2DM7A 4H1LB 5BVPH 3KLAA 5E03A 3RBGA 5HBBA 1J8HE 1FE8L 2KQMA 3GMOB 5B22A 4RNRB 1NFIA 5DLMH 1ORQB 1EEQA 3VXTA 5HPOA 3KPRD 4HULB 2EDOA 3CFDA 3VXSD 2WW8A 4Z7VA 5IR1B 2PO6A 4EDXB 1NH6A 4P2RE 4J6RH 4MQXD 3LS4L 5E4IA 1GIGH 2YKLH 1MCOL 1GOHA 1YEEH 2R0ZH 4F80A 2E5EA 3DHMA 1CF8L 5CSZB 3MV9D 2WUCL 1UWEL 4UINH 4WTWA 2AJVL 4NO2B 3LSOB 4XPGH 3ZKMC 4ERSL 3O41A 3O6LL 4Y5VB 1JWUA 4N68A 1GH7A 4WI7A 4LSPH 4AQOA 4APQA 1U8IA 2OI9C 3NBNA 4WU5B 5HHMD 1OW0C 1Q8MA 5DRXA 1XF4A 3BH8A 3PGFH 4JM4L 4LQ1A 3PV6B 3MTRA 4NDMA 3RWJA 1G1YA 3PWPA 4KJPC 3IKCA 3TBTB 2AABL 4NNPH 1M05A 3DSFL 4OZHA 1MQKH 3TVMA 2F74B 3AY4A 4X5XB 3TN0A 1J8HD 1A2YB 2C4XA 3OKDA 2WBJA 4YDKL 1ZMYA 4HUVA 4LBEA 3SJVB 1KUMA 4FTVA 3IJHA 4JFFE 3WIHA 3PUCA 2A6IB 1D3CA 4P2RD 4V2BA 1J0KA 3D3VE 2LAGB 1IAOB 2W07A 2ICES 4PBWD 3SE8L 4X6CA 1NBQA 2QADC 2HKFL 1AFVL 2ZOLA 1CBVH 1MRFH 3OKNB 4CW1A 4TYUA 3BDYL 1GZPA 3W2DL 5F9JB 2XIDA 2UUDK 2FJGB 1EEZB 3UTTA 5B8CB 3BKML 4JVWA 3DO3A 3DX7A 3VD9A 3IFNL 3IDYC 4XBPA 5J12B 4MD4A 2NMSA 3IS0X 1CD1B 4OLEA 1P5UA 3DVGB 1LP9E 3EW3B 4PJIE 4IDJH 2NXYD 4U7MA 3MYZA 3O9WD 2BXYA 2JLLA 4JFEE 3P0YH 4M9PA 5SWSE 4CU6A 5I1GL 2VZSA 4XP4L 3HCVA 2V9RA 2ZUQC 2I07A 4YNYA 4CADB 5D2NA 3B2UD 4MDIB 5EO9A 1K8IA 1FFPB 2G5BA 1S7TA 2R39A 1QR4A 4N0UA 4JFFD 5DD0L 5C0AB 1N5YL 1VA9A 3BHBB 2V2TA 3D3VD 5DQDL 3FB7B 3V6OC 1NGXB 3EJZC 1NBVL 3GK8L 2LV4A 4XPFH 4Y5YB 6FABH 4U1LB 2X1XR 3BKJH 4EI5B 1H15A 3KPRA 4QF1A 3VFSB 3QUMA 2ICWI 3BE1H 5F1NA 4MB3A 5DURB 4NKOA 4XB8A 3UJTH 2HTKD 2FECL 2F8VA 4XGZA 3HPLB 1WK0A 2CSPA 3MLVH 2XOTA 3ECBA 2H9GA 3Q3GA 3VG0L 1WJ3A 4PTTA 1DR9A 4NQEB 1CK0L 3M8OH 4UDUB 3F7VA 5E8DL 3WJJA 3MXWL 5SWQB 1Q9OB 1UM6H 4Y2DB 5IW1A 1FNFA 2VQ1B 1C7TA 4GS7B 4M6AA 4JO1L 5GHWL 5D72L 4HW6A 3E6FB 4I4WB 4H1LH 4JFED 3VXRB 5HHOB 3TYFA 5E2WL 2DJSA 4JRXE 1WIPA 1MREL 3FO9B 1T5XB 5IM7B 2EXYD 3EFFA 1M7XA 2NXZD 3G9VA 5I1HH 2OYPA 1VFUA 3QISA 4G8IA 5IB3A 3U4EB 3V5HB 3UYOD 3CVHH 3GUTA 3QQ3A 2L4OA 4PP1C 4DUWA 2IPUG 5EU7C 1A6TB 1RJLA 1J8HA 4N8VB 3T08A 1BBDH 2IFFH 5ETUB 3U30B 5E00A 1P4IH 3GSQB 4JO3L 4PJFB 3HC0A 5B38B 3GM0A 4JQIL 4P2RA 2UVEA 4NZJA 1A5FH 3QNXB 4PJCE 4ENED 3EO1B 3G5XA 2HFFB 1F58L 5BW7A 2EYRB 3BO8B 1XEDA 4FQHA 3ULVE 4TSBH 1OTSC 4KJYB 1EFXB 3EYOA 3STZB 3G08A 3UJIL 2SEBB 1OCWL 5CSGA 1WAAE 3N1QC 1TETH 2J2ZA 3WNKA 3OF6A 2R1WA 4LEOB 1BZ9A 1TMCB 3O3DA 1INDH 1DSFH 4JRXD 4HT1L 4KVCH 3VXOB 2HRLA 1AQDA 5JQ6H 3RWFA 4LCWE 4JZJB 4UDTB 5JMRA 2HKHL 2VWEE 4PYHA 1RUAL 2Z91A 3FN9A 5I30H 3O9WA 3L3DB 4ZUUA 2GQHA 4KI5F 2P5EE 5HGGS 1HHGB 4XC3H 1E28A 4U1HA 1BIHA 2KDGA 3LHPH 1N7MH 2FHBA 5EUOE 3NIFF 3SO5A 4CGTA 4GAYA 3U83A 1MHEA 5KVDL 1U8OB 2HH0H 43C9B 4HWZB 4JFFA 7FABL 1JZ4A 3NTCH 1A3LL 3QEQE 1OM3H 1WSST 3D3VA 3LN5A 4G43B 2E7MA 4NRZA 5HI3C 3O2DH 2VLKA 1F90L 3SGDH 5TH2B 5C71A 2X7LA 5IB5A 5JDJA 3ULVD 4K9EL 1JNHB 1QQDB 3QUZD 5DFVC 2FHCA 4MDJA 1I3GL 4OKVA 5E1AA 3AS2A 4Z76B 4PJAF 5FAAA 3QEUA 1W72A 3LCYA 4OQTH 5T1DH 3FONA 2ADIB 4U3HA 1QPPA 1NCCL 5EU5A 1JZ6A 1N3NB 15C8L 2BVPA 3VRIA 1LP9A 4LCWD 4PJIA 1UZ6F 4NNXB 5H35B 5CHNB 1MQ8A 4JFEA 2P5ED 4QYOA 5IQ7L 3HZVA 4JGMA 3ZDZF 4S2SB 4B7LA 3CVIH 3BIBX 3T0XA 3VJ6B 5MEQB 1F45A 4OZFB 5IMKA 2OK0H 1S9YB 5D96B 2MPAL 5CJBA 3QEQD 4HGKC 2APWA 4AYFA 1U95B 2E7LA 3V7AG 4N1EA 2E8YA 1D9KD 3VWKC 4YDLC 3IVKA 3SKOA 4MD5A 4JFYA 3BRDA 3T65B 3K8MA 3T0AA 1I9RL 1AD0B 4F7CB 2CRIA 3P77B 2CDEB 1FORL 4FQQA 4J8RB 4RFNC 3BSZH 4JFDB 1MNUL 2EIDA 3RVVC 4ODVH 2NTFA 1IRAY 2P7TB 1WFOA 3BD5A 5LAXA 1F4AA 1F5WA 4RGNC 4ETYA 1D5MB 3WSQL 3O8XC 1JPTH 5D6DA 4ONFH 3OTTA 5GJTH 1YY8A 3DRQA 3L3HA 4JRXA 4EDWH 3RNQB 5DJ0A 2DQIH 1MJ8H 1A3RH 2F5AH 4M48H 1MRCH 2HFEB 4PTUB 3TA3D 2NX5E 4P3DA 4OF6A 4QRUA 5DJCB 4FFYL 1WZ1H 1MVUB 2NZ9D 3QHZH 1G7LA 3P9LA 1Q38A 4AIZA 5ISZE 5I18L 2JJUA 2OS7A 5IW6A 1UB5B 2AXGB 4J3VA 1X9QA 4F7TA 1ZLUK 2VAAB 5EUKA 1DN0B 3QFJE 4TUOB 2XNAB 5GS0D 2HFGL 32C2A 4FQCL 2WP3O 4PJCA 1YMME 3PXHA 4NZTL 3GI9H 4D0BA 2FX9L 4NP4L 4HK0A 3GSRA 4OSUL 4XPAH 2CIKB 4LSQH 3QUZA 1WAAA 4NM8H 3BX7C 1MELA 4E0RA 2AERT 3T8XB 1FYTE 1FZMA 1AIFA 3R06B 1ZA6B 3T4AA 3V52H 3HHRB 3FQWA 3IGAB 1MCQA 5FYKE 3ULVL 4U1NB 1IAIM 4I48B 4LCWA 4ZUSB 4JVUA 3ISWA 1BFTA 2NX5D 2LU7A 4HIEB 5LKNA 2UZIL 1BPVA 4PJ5A 2OZ4A 3BH9B 4LVNC 5ISZD 2AEWA 3JUZA 1L6XA 4MNQE 2EDDA 4Y19B 5EUOA 3WHXA 5AEAA 3TH2T 3CCHA 3QFJD 4F37F 1PSKH 4JJ5B 3QEQA 1FAIL 2XRAH 3F7YA 1T0MB 4ODWA 1YMMD 1CFVL 2B4CH 1W0WA 1Z9SA 5JZ7C 1D9KA 3GSOA 1EZVY 3I6KB 4OLUL 3G6AB 4K3EL 5A2KH 1C1EL 3JSSA 5F9OL 1CCZA 3I3DA 5IWLC 3U46A 2CKNA 2DLHA 5BS0D 3U0TA 4Y4KB 5DUBB 4B7IA 2AK4E 1IT9L 1I1RA 1IC5L 3QIBC 1FYTD 1CLZH 1G7JB 1YYLL 1CXFA 4I3RH 3F65A 1XF5B 2CKBB 3OKEA 3KHQA 4NUGL 1I8IA 1CQYA 4QT5B 5GGTL 5FYKD 2FLRT 3QXDB 2IH1B 3PWVB 2HJKB 4HFWA 3NIDF 2JCCE 3KXFB 4JM2F 1QFWI 3WUWA 4DZ8B 3T77B 3QUXB 3CIQA 2XQBL 4DAGL 4NQCA 5EZLB 4KV5E 4MNQD 1UH2A 3TA3A 5GZOD 5EA0L 3RPIB 4XMLL 4CVXA 4XP6H 1VFAA 1OSPL 3N9GL 1CXLA 2NY2C 5CP7A 3ARBC 3PNWB 5IJKC 4DKEH 5FUOH 4RMUA 5CJQL 4JFPB 3IFPA 4NWTL 2V17H 5IHBA 4HK3N 4WTXA 5F96L 2EDJA 4X6DA 2DLGA 2EO9A 3MFFB 4Z0BL 1T83A 5CZXD 5BVPL 3MRQA 1JGDB 2PW2B 1VGKB 4EIZC 4AG4H 1LNUA 4XP1H 5DLML 3MMEB 5I74C 3P9MB 4P2CG 5D9SA 1NBZA 1G6RA 1LO2L 4P23D 4UQ2A 4J6RL 4C57C 4PPTA 1GIGL 2YKLL 4O2FB 4UILH 4IHOB 1YEEL 4IDLA 3RL2A 3SJVE 2XYCA 1KGCE 3CFEA 5HHVL 1LQSR 5TGBB 2VZOA 4ONOA 4UINL 4Y0GA 5HY9A 3KPSE 4G9DA 1DEEB 1EERB 1CDIA 5IK3B 5BVJA 1UYWL 4PGCB 3WKMH 3RA7H 4LSPL 1KB9K 4HMEA 1O7VA 5ISZA 5A3IC 5EIIB 3EOTH 3OXRB 5GRWA 3B9KB 5FB8A 1RZ8B 3PGFL 2YD2A 3MV7B 3G5VB 3TFKC 2QQNH 4WW2B 3DURA 5HHPB 3OKOA 1OP9A 2R1XA 4LCYB 3EYFA 1YMMA 1K5NA 1CICA 5CFHA 4NNPL 1MQKL 3ILPA 5EB9A 3BW9A 4FXGA 2YMXH 5BS0A 1HI6A 1XGUA 3OKYA 5DYOA 4LOUD 2CGRH 4HGWA 7CGTA 1R3HA 4MA7H 5IFJB 2LTQB 3MRNB 4M7LT 3T2NH 1FYTA 5FFLA 2VMFA 2X70A 3I02B 1SYVB 1X5JA 3SJVD 3I50L 4M43H 1ND0A 2MQCA 1KGCD 2UYLA 3G5ZB 1CBVL 1MRFL 5FYJL 5C0AE 3G04B 1OTUC 3SQBA 5DHYA 1RZIA 4K23H 3OXSA 1T1WA 3V4VH 5J7CC 3FRUA 3VFNB 1WT5A 1BZ7A 1YDPB 2N7AA 3ZHKA 5EFIA 4WI4A 2NY0B 3FN3A 4I8DA 4MNQA 1R3LB 2DQFA 2MKLC 3RGVD 4V1DB 3A6OA 1CXEA 4KPHH 4N9OB 1T7ZA 4WENB 3S5LG 1KB5B 4NQEE 4IDJL 1F6LL 5IJVB 1MRDH 3DIFA 3HZYB 5JXEC 4F3FA 1BBJB 1HHIB 4LLVA 1ZS8A 2VLME 3TH3T 4PG2A 1JZ7A 5I17A 2OXGA 4O02L 5DJ2B 1JGLH 3VXRE 1J10A 2EIZA 1V05A 3BUYB 3VD5A 4OZ4A 2OSLB 3BYYA 2X4TA 1BQHB 1U8LA 4F7PA 1RUKL 3RHWF 1VSCA 6FABL 1IEBB 1K4CB 4HDIB 3BKJL 2EDBA 5C0AD 4DTGH 4P23A 2J88H 1H5BB 4H1LA 3UJTL 3MCLH 1G0XA 3MLVL 2NY5C 3GMOA 4Q74A 4RNRA 1T1ZB 3A67H 1ORQA 3M8OL 4EI5D 3UC0H 5IR1A 4EDXA 5DURD 4XP5H 1UM6L 3QIWC 3SKNB 1HHHB 4NQED 3RTQB 1IZKA 1U3HC 5LVEA 5CSZA 2B39A 5DO2C 5J8OA 3P73B 4NO2A 3LSOA 5FA3B 4NKQB 2VLMD 5D5MF 1KCVH 4Y2DD 4Y5VA 1P5VA 1WF5A 1T7XA 5DD5H 1Z9OA 1T21B 4IRSB 2LABA 3VXRD 3GZKA 3UAJC 4K3DH 4KI1A 4WU5A 4D3CH 5HYSG 3CVHL 5E8EB 4P4RB 5HDBF 2AJYL 4X4XB 5FA4B 3PV6A 3HRPA 2IG2H 5D7JB 1ZAGA 2LQRA 3HA0A 1BBDL 4CU7A 2IFFL 1LEIB 1ACZA 3TBTA 5C3LD 2HYMA 3LIZL 3FQXB 4J23A 4NPYB 2F74A 1NUDA 1A2YA 1G7PB 1T66D 3SJVA 1JYNA 1FL6B 3N50A 4K7FB 4K07A 4OLZH 5ESQB 4TSBL 2A6IA 4PB9H 1AQKH 2BSSB 4QXTB 1IAOA 1QHOA 3H6JA 4XCFH 5FGSA 4K8RL 4YPJA 1SBBA 4HFUH 5D93B 3OKNA 4G6FD 1LEKB 4PJDB 3RWCB 4U6HB 4AT6B 1EFXD 1INDL 5F9JA 1DSFL 5IF0B 2FJGA 1EEZA 5CD5C 1GGBL 4JQXA 5B8CA 4R26H 5EBLB 2MQ3A 5JQ6L 1A1MB 1ZHBB 4QNPF 5J6HB 4UT6H 5I30L 3LKSB 5T1MB 5IVXB 4KQ3H 3EYVB 4FMKA 4XC3L 1CD1A 3DVGA 1GJIA 4Y1AB 2BVUA 3LHPL 2VXVH 1N7ML 3S4SG 5DD6B 2NYYC 3KLHC 4EEEA 4I1NB 1G0DA 1OM3L 4AMKH 5I2IB 3WO4B 3DHJA 1KELL 4CADA 2R2BB 4MDIA 4B0MM 4UT9H 1F4WH 1FFPA 5IESH 3O2DL 3C6LC 2BSTB 4CRPA 3LRSA 1FN4B 3DX8B 3OAYH 3UTZB 2ZNXA 5C0AA 3RVTD 3BHBA 4GXUN 4PY8J 1RZFH 4MLIA 4IOFC 4TRPH 3FB7A 3HMWH 3FOMB 1NGXA 3MLXH 2B0SL 2BY0A 5K9QG 4JN2B 4Y5YA 4DVRH 4OQTL 5CINH 4U1LA 1S9WB 5T1DL 4EI5A 1JF5A 2WIMA 3VFSA 4G6JH 1TFHA 2UZXB 2QQQA 4JQVA 2HN7B 3HPLA 3KYOB 3GRWL 3WUZA 4TTDC 2JJSA 3BGAA 4JFDE 3SKMB 4NQEA 4UDUA 1GGYA 5SWQA 3LEYH 4FFVD 4LLWB 1Q9OA 4Y2DA 2VQ1A 4YFLI 3SBWA 1U91B 3K8KA 3DUUB 3VDBA 3CVIL 5E7FA 1CFNB 3E6FA 4I4WA 2OK0L 3WLBB 1QSVA 5DMGD 3VXRA 2WBKA 5HHOA 1PW3A 1EHLH 3OAZK 3FO9A 3P30H 5E4EC 1T5XA 5IM7A 1TTUA 4J12A 4MQ7B 1YQVH 3N85H 1A22B 3ARQA 3U4EA 3BT2H 4M3KB 3V5HA 4U4BA 4LFHD 3VI4F 2P8LB 3QBTB 5GZNC 1ZSDB 3FFCB 1A6TA 3DLQR 2EKJA 2OL3H 4N8VA 1ZVYA 2WUBH 5ETUA 3V6BR 4ODVL 5DVMA 3GSQA 4PJFA 1KSRA 5B38A 1ULVA 2F53B 2IGFH 3QNXA 3B9AA 1KPRB 5F72S 3EO1A 2X4UB 2HFFA 4JFDD 2XICA 2EYRA 3BO8A 5DMJB 3UPCA 3VFWB 1JPTL 2YD1A 4ONFL 4KJYA 1EFXA 5GJTL 3STZA 1CDCA 2W0KA 4JPWH 5H37G 2SEBA 4EDWL 2DQIL 1YYMH 2F5AL 4M48L 5E6ZA 4PRIB 3MNWB 1RVFH 1BLNB 4LEOA 1WZ1L 2Z8VC 1IC7H 4KK5D 3QHZL 3WYRA 4BFEA 2L0DA 1GOFA 3VXOA 3UBXI 3ZTNL 3OJ2C 3PWNB 4LIQH 4F37K 1M7DB 4JZJA 4UDTA 1VKXB 2FDBP 1IGML 3L95B 2NY7L 1QSFB 1TJHL 3BESR 2P44B 1H0DB 3CFKB 3L3DA 1DBJH 5LGJB 2P46B 2W59A 3WXVH 1MCDA 1HHGA 5KANG 4GJTB 2IMNA 2Z4QB 1JRHH 1NMCB 4QWWD 3GI9L 4Y19E 4JFHE 2XI9A 2X05A 3CDCA 2HG5B 1U8OA 43C9A 4XPAL 1CDJA 4LSQL 4HWZA 2YUVA 2AXJA 5FDWB 3QRGH 1UCBL 4F7MB 4G43A 4NM8L 3V4PL 1ZLVH 2DKSA 5CGTA 3MV8E 5TH2A 4GQ9L 3EHBC 4FN0A 2C4FU 1P4LB 1JNHA 2Z31B 4KUCF 1QQDA 3PJSB 3V52L 5MENB 4HJ0D 5D1ZB 3GSNB 4Z76A 1ORSB 2C3HA 1CVRA 5JPNB 4QGYA 1VPOH 4YHIB 5IVOA 3QG6B 4P49A 4UAOB 2ADIA 4ODSH 1BVLB 1EJ6A 1YEHL 1N3NA 4KTEH 2PNDA 4URTB 4HWUA 1RJCA 5CAYB 1I9JH 2FL5B 4NNXA 3VFVB 1PG7H 1N5AB 3ZZ1A 5H35A 5CHNA 3SDAD 5I1DB 5IT2H 5E8OB 2XRAL 4PJ7E 2DQJH 4S2SA 1ZOXA 3A0OA 4Y19D 4L4TB 4L3EE 3VJ6A 3X17A 5MEQA 3L3JB 4OZFA 4JFHD 3WXWL 1S9YA 4OCYH 4PY8I 3ZKXC 4PLJD 4NKMB 4MYWB 1SMOA 4QCIB 4GRLB 4IMLB 1U95A 4WTZA 5CKAA 4QHUB 3SO3C 2DYPB 1VEOA 3MV8D 2HAZA 2DM4A 1CLZL 4PUBH 3GJFB 1EBPA 5DMIL 4I3RL 3T65A 4Z7NF 4MCZB 3A6BH 1N6VA 4HPYH 3NFSH 3PP3H 4Y4KD 3KPMB 3ARED 1AD0A 4F7CA 3P77A 2CDEA 4J8RA 3EYSH 4UB0H 4JFDA 4WFGE 5DS8B 3TF7C 3J8F7 2M8XA 4D9LH 4KJWC 3EOYG 2D03H 4NHUB 3KHOA 3VD3A 2P7TA 4HXBH 1ONQB 1HSBB 3CFJB 4U6VH 1D5MA 1CE1H 4PJXB 3RZWA 3WFBH 4XP6L 3KDMB 4Z7OF 4MA8L 4XMPH 3RNQA 1HZHH 1ROWA 1T89A 2YWYA 3QUXD 3JV6B 2HFEA 2IBBA 4PTUA 4CJ0A 3EJYD 4M3JA 5C0GB 3VRJB 5DJCA 4TQEH 4DKEL 1MVUA 3WIIL 3B43A 2V17L 3JBG7 2C9AA 4WO4C 4I0PC 3HAEG 4YGVB 4LCCB 4PGDB 1UB5A 3VFUB 2AXGA 1ITCA 1CD9B 2VAAA 3MV7E 4ZO8A 1DN0A 5HDOA 4KKLD 4TUOA 2XNAA 3R8QA 3BGMB 4AG4L 1WZLA 4XP1L 4CU8A 1OB1B 2Y6SC 1TPXC 4NNYB 4KY1L 4WFGD 2VQTA 1IM3B 3ZYZA 3WDHA 2CIKA 5FYJU 4GXVH 3BD3A 3VH8B 4Y4HB 2J8UF 1CLYH 5FO9B 3OR6B 3JV5A 1BOYA 1PG7X 4YBQD 3T8XA 3KJ6H 3R06A 4B5EA 1ZA6A 4OGXH 4C58B 3KPNB 2DD8H 3WKML 3RA7L 1WIUA 3IGAA 4YPGB 1LEGB 1ZT7B 1AXTL 4I48A 4U1NA 4ZUSA 2EXWC 2EDNA 4HIEA 4EVNB 1G7MB 2OQJB 2XA8H 1A6PA 4RAUB 2OP4L 4ESKA 3BH9A 3VFTB 1NKOA 1FHGA 3WHE1 3B9KD 3FOLB 4Y19A 5JXAH 4KROC 5E8NB 3SOBH 4K55A 3MV7D 3GSNH 4J3XA 4JJ5A 2YMXL 1FVCB 1T0MA 2BK8A 4EN3C 1CYGA 3RHWK 4NC0B 3GBLA 4MA7L 4HC1A 5I75B 2V7NB 3I6KA 1SJEB 3G6AA 4ODUB 3BDXA 3T2NL 5DEGB 4P2YA 3V0WH 3BKYH 5H37H 1HE7A 4M43L 1QBAA 4KK6D 3UP1A 3SDCC 4Y4KA 5DUBA 2LVEA 4X7SH 3RUGF 4NC1C 5FGCB 3MLSH 1JYXA 4LARH 2NCMA 1D5XB 4K23L 3NH7H 1G7JA 3V4VL 1NJ9B 1XF5A 2CKBA 1QYGH 1HN1A 2YPLB 4P46B 2HT2C 4LSRH 4QT5A 5IHLB 2FEDC 3QXDA 4RGOH 4J3UA 2MKWA 2Y36H 3PWVA 4L4VB 2HJKA 2XACC 5DRZB 2AJXL 3KXFA 4PJBF 4DZ8A 1MRDL 3T77A 3QUXA 2NY0D 2HMIC 4O2EB 5EZLA 1QRNB 2VXTH 3RPIA 1FZOB 1QZ1A 4G7YL 2DOCA 2VH5H 3ZTJG 3MJ9H 3NPSC 1JGLL 4P2OC 1KJ3H 4BQ6A 5KVEH 3PNWA 4LGSB 4JFXB 1EHNA 4UIKH 4NWUH 1B0GB 4JY4B 4JFPA 2Q3ZA 4NN6B 4DKAA 2DTMH 3ARDC 1J5OH 2IQ9L 3MFFA 4DTGL 2J88L 5HDLA 3I3BA 1JGDA 2PW2A 3KNBB 1TENA 1VGKA 3A67L 1A7QH 2BOBB 3MMEA 4U49A 3P9MA 4M7ZC 1R5WB 5F7MC 3PQYB 4RGMC 3UC0L 2NY3C 4M6MH 3RJQB 5D1XD 4XP5L 1NMAH 3DYOA 1A7BA 4O2FA 4IHOA 4MJ5B 2VERN 5E5MB 4XBEL 5LWYH 5IHZB 1J0YA 5TGBA 4FRWA 1X5FA 3AFLA 2Q86B 1DBBH 1I75A 3MLUL 1JNNH 1DEEA 3QEGH 1Y18B 5IK3A 3ROLB 2MFNA 5DD5L 4PGCA 3VD7A 4PJDE 4LKCB 3WN5B 5EIIA 3P4OB 2B7DT 1CZ8H 3OXRA 4K3DL 2OLDA 3B9KA 5C09B 4D3CL 1K6QH 5HSFA 4U1MB 5FO8B 5D7SH 1RZ8A 3MV7A 3V6FB 3G5VA 1EZVX 2WBWB 4WW2A 1H3PH 4ZFOL 2IG2L 5HHPA 4IRSD 4OIAA 2FZ3B 2XWJB 4LCYA 5F93C 1C8PA 2DWEB 5IVXE 4BZ2L 1IEHA 1MVFA 5TQ0H 1DBMH 3IJYB 1SM3H 3D39B 5BZWB 2XTJB 1IAIH 2VR9A 5D7JD 2VZ1A 1ZLWH 1A7RH 5AAMA 1B4JH 4NQDB 1EGJH 2BNQB 2IWGA 1AQKL 5IFJA 1G9MC 2Z8WC 3MRNA 1WFNA 3I02A 1SYVA 3RWGB 3G5ZA 3SQOH 4HFUL 1R3KB 3BP6B 2ZUYA 3O11B 3G04A 4X98B 4OM1L 4EQ2A 5TE6H 2F54E 2Y1VA 4R26L 1RZGB 4QXUH 2CQVA 3VFNA 5D2LE 1YDPA 4UBDC 1DVFC 1XCQB 3C8KB 1UJ3C 3LQMA 3PDGA 4KQ3L 1KPVB 2FJFB 1R3LA 4HIJB 4V1DA 3CLFH 1IILE 4KQ4H 5INCB 3VMNA 2EDWA 2C4FT 3BQUC 2VXVL 3O6KL 1KB5A 1OT2A 4GG8B 4BJLA 5IJVA 3HZYA 2FB4H 1BBJA 1HHIA 1S7WB 2OTWB 4CN4A 3S3JA 1VADB 1R5IB 4AMKL 1NAMB 5TF0A 4GBXC 5F89B 4UT9L 4HAFA 5DJ2A 1S78C 4LAQH 5L2KB 2XY2A 3PF2A 1H8SA 4TULH 3BUYA 2XPGB 2D0HA 4DVBB 2OSLA 1BQHA 4TN9A 3HMWL 4M9OA 3VDAA 3MLXL 2W9DH 2CD0A 4WJ5B 4YE4H 4DVRL 4NJ9H 5F7WC 4P5TC 5CINL 1IEBA 1K4CA 4HDIA 4N5UA 5FGBA 1ZT4B 4G6JL 5JA8B 2FWOB 3DXAB 5HGDB 2F54D 2XZAH 1H5BA 4MLSA 1UWGL 3FFCE 4AENB 3WEXB 5DC0A 1HQ4B 3MRJB 4AQ1B 2VR4A 4WUKH 1RQ5A 3AU1B 1FP5A 3LEYL 1CDGA 1L0QA 2F53E 3DVFA 4ZUTB 3RY5A 1WBXB 35C8H 3VXNB 1DQLH 2AJ3B 3SKNA 4KRMB 1HHHA 3RTQA 5ERWB 3RBSA 3P73A 3I6LE 5FA3A 2F19H 3OKKB 1EHLL 3P30L 3DTXB 3HNTH 4PRIE 2H2PD 4NUJB 3UDWA 3N85L 1EAJA 2WIIB 1T21A 4IRSA 3E1F1 1JZ5A 3BT2L 2VDOH 3AS3A 3IDYB 1YJDC 5E8EA 4P4RA 4Y4FB 5CJOH 3OL2A 4X4XA 5FA4A 4RSVA 4WY7L 4L8SC 5D7JA 2OL3L 5E2TH 1QSFE 1GXEA 1LEIA 4Z77B 1MJJB 5I66B 3FQXA 4R0LC 3DETC 2MHAB 5HTSA 4LLAA 1OAQH 4NPYA 2RB8A 3FFCD 2J4WH 1AO7B 1RJYB 5F1OB 2GFBB 2ERJC 1G7PA 3FCTB 1FL6A 5D70L 4HH8A 2P42B 2UWEB 4QXWA 4K7FA 5ESQA 1BOGB 2F53D 4XX1G 2BSSA 4QXTA 5L9DH 2BHYA 4YXKH 1OP5K 2EDTA 4LU5H 4YXLL 3ZTJH 3NPZB 5TE7H 4X4YB 1RVFL 3KYMB 4PJDA 1LEKA 3RWCA 4U6HA 3HS0B 3T1FB 1NGYB 3I6LD 1IC7L 4AT6A 1QSEB 5AZEH 5MENE 1A4JB 4G6KL 3LQZB 5IF0A 3ROOB 3QIUD 2EECA 4LIQL 5EBLA 4XVUC 1A1MA 1ZHBA 4PRID 4XH2B 3BPLC 5J6HA 4BZ1H 4XZUB 2H2SD 1DBJL 5T1MA 5IVXA 2Z8RA 3B8SA 3EYVA 1EHAA 3HE6C 3WXVL 3RVXD 1JRHL 2AAVA 4Y1AA 4GRWH 4MAYC 1GOGA 3NABH 4QO1A 1TNMA 1QSFD 3N1GC 5DD6A 3ULVF 3T0DA 5KZCB 2CLVB 5K9OB 3QRGL 5BV7B 5I2IA 3TPKA 2R2BA 1XGTB 4JB9H 4L4TE 3V2AR 2BSTA 2YBRB 1ZHKB 1FN4A 3ARUA 3DX8A 3UTZA 2D9CA 3TH4T 2IPTH 4ODXB 1UADC 3LN9A 4YHPB 3FOMA 1JHLH 4JN2A 3ARFB 1VPOL 1S9WA 4JAMB 4UNUA 1NAMH 4ODSL 2Z31D 2VSDA 5MEND 3QNYA 5D1ZD 3U7YH 4KTEL 2HN7A 2AEIT 3DVNB 3KYOA 3DGGB 3SKMA 5BRZB 1PG7L 2E6JA 4BYHA 4KZEH 4LLWA 5IT2L 3ME0A 2DQJL 1U91A 1KCKA 3DUUA 4MJ2A 2X1OA 5BJTB 5C2BH 1CFNA 4NBYB 3WFDH 4Z7UF 4OCYL 3WLBA 3LVEA 5F7KC 4PJXE 1BECA 1JPGB 3M1BB 3SDXB 1J1PH 3K1KC 3OSKA 4MQ7A 1F3RB 1F2XK 1VENA 5FOBB 4O4YH 4L4TD 1RUPL 1YECH 3OGCB 4PUBL 4POZD 5DK0B 4GRLD 4Z8FH 3SDDC 1KENH 3CXHJ 4YBLC 2P8LA 3A6BL 4M6NL 5TPWH 3RY6C 4HPYL 2HJLB 1ZSDA 3FFCA 3NFSL 1MUJB 2Y5EA 4B53A 2DYPD 2EDRA 5FV2A 3SE9H 3EYSL 4UB0L 1QRKA 2P8MB 3GEWB 4Z78B 4LHUG 2A83B 4D9LL 2Q7YB 4FFZH 5DEFB 1MCHA 2D03L 2ID5A 2F53A 3CSYB 3VWJB 1KPRA 2X4UA 5C92A 5IBLD 3EYUH 4I2XB 1MLCB 3VRLE 1HDMB 4U6VL 1EV2E 3VFWA 3OX8B 1J7VR 4G7VH 4QRQB 1EDQA 4RWHA 2FGWH 3NCBB 5DJ8B 3RWHB 4PRIA 1O7SA 3MNWA 3L5IA 3QYCA 4OCRH 1BLNA 4TQEL 2IC2A 4C55A 1NFDB 3PWNA 1TTGA 4QHKJ 2HLAB 1M7DA 1F4YH 1VKXA 3L95A 1YN6B 2V5RA 3FQNB 1QSFA 2JF1A 2I27N 2QKIA 1H0DA 3CFKA 3MR9B 3QDHA 3AMLA 4Q6IB 5LGJA 4Y16C 3STBA 1UKQA 2YC1B 4AEEA 2JIXB 1KOAA 1Q1JH 4KKCD 5T1KD 2Z4QA 4D0CB 1HHJB 2NY5L 3CDFA 4R97C 1BAFH 2HG5A 5T5NF 3DMMC 5ID0B 1A6VH 3IJSB 4GXVL 1AR1D 5FDWA 4KRPB 1TQCC 1UFUA 2VO5A 3AROA 5MERB 4F7MA 2IFGA 1JK8B 3QG7H 4JKWA 1HYSD 4KDWA 3C60C 3HI5H 4YDLB 3KJ6L 1RULH 1P4LA 1OGAB 4OGXL 2Z31A 3PJSA 4ONHB 5MENA 4Y4HD 5GGRB 5D1ZA 3GSNA 3EDFA 1UH4A 1ORSA 4RFEB 1LO4H 1T04B 1V3JA 5JPNA 4YHIA 3G6DH 4RFNB 3QG6A 2XA8L 3VE0B 1EMTH 1BVLA 1D5BB 4XVSH 4UOJA 1J9CT 4UMGA 1SMAA 2XA3A 5KVGL 1K85A 1FFNB 2FL5A 1MFAL 4FXKB 3VFVA 5JXAL 2KPNA 1N5AA 3SOBL 4JGUA 4RGNB 4XXDB 2ATKB 3WLWC 3SGKC 5I1DA 2ZUSA 3QRFM 5E8OA 4W6YB 3QFDB 1QRNE 3NIGF 4E9LA 43CAB 3WFEH 4L4TA 2CUIA 3L3JA 3IDMB 4PP2B 1MCKA 3P2TA 4NKMA 1MPAH 2AVGA 3BPNB 3T3ME 4QCIA 4GRLA 4IMLA 3BKYL 4AH2B 2KKQA 4ETQB 5EULV 5F88B 5HVGB 4L1HA 2PYEB 4QHUA 3S88H 4X7SL 2DYPA 2GYSA 3ZE1F 3Q6FB 1U93B 3MLSL 5EIVA 4LF3B 4LARL 4HQQH 3NH7L 3GJFA 2YN5A 4MCZA 4HAGA 4C4KT 1PVHA 4LSRL 5EU6E 3KPMA 5AZ2H 4RGOL 2WV3A 4Z7WB 2XY1A 5F71A 2WMPA 1FO0H 3JTSB 5DS8A 4KDTC 2X9WA 4PB0L 2Y36L 3EGSB 4NHUA 3NZ8B 2J1KA 5CEZH 1ACYL 4P46D 2DMBA 1BQLH 1HSBA 3CFJA 3VXQB 4AY0A 4CVZB 2FHFA 4YHYC 1MCWM 4DZBB 2VXTL 4PS4H 1UB6B 2V7HB 4PRPB 4PJXA 4OF8A 4OFPA 3KDMA 3QUYC 3LY6A 5DRNB 5E56A 5I1AB 3MJ9L 4TOYH 5DQJB 3JV6A 2QTEA 1QRND 1KJ3L 5E95B 3P40A 4DGVL 5BOPA 1RPQA 1A14H 5C0GA 3VRJA 1CFQB 5IB1B 1IKNC 4UIKL 1C12B 3MV01 3WS6A 1QACA 4YHOL 3V9FA 4N8CH 4LVNB 4RFOH 1J5OL 1Z5LB 4RMVA 4LRIC 4YGVA 4LCCA 4PGDA 3VFUA 4ZG1A 1IAKB 4L3CB 3N1MC 3MLWH 4LCUB 3BGMA 4DWHA 5BO1H 1A7QL 2JCCF 2FBOJ 1CDBA 1U8JB 4KH2A 1IGTB 1OB1A 3MXVH 1AHWC 4KV5F 4M6ML 4NNYA 1GZQB 1IM3A 3D39E 3DOSA 4I3GA 1NMAL 2OJZH 5HGHB 4XNZB 5I71C 3VH8A 5L0QC 4Y4HA 3L3IB 2FNBA 3PQYD 2H26B 1FNEB 5FO9A 3OR6A 1R0AL 2BNQE 4M7JH 1YEIH 3ARTA 4I18C 1DBBL 3N1PC 3QCTH 2VXSH 1T0NB 2Z35B 1CQKA 2H41A 4FA8A 3BKCH 4QHKI 5E8PB 3KPNA 5DHVH 5I1IL 4U1GC 1J18A 2H3NB 1LEGA 4OI7A 1ZT7A 1CZ8L 3KS0H 5SX4I 1K6QL 2D7NA 4XVJL 4EVNA 1G7MA 2OQJA 3FKUS 3GHBH 2H8PB 4NN5C 4RAUA 4LSTL 3CAFA 5HI4C 1Q72H 3VFTA 3VFPB 4QTIH 1JWSB 2OJEB 3FOLA 2EYTA 2AS5M 4YGAB 2A6KB 4PBXA 5E8NA 4KMLB 1DBML 3FB8B 1SM3L 1Q0YH 5JA9A 1IAIL 5A16B 1A21A 3VGHA 2A73B 1FVCA 2PXYC 1A7RL 3LB6D 3MCKB 4J4PA 2WWKO 3W9DB 1A3QA 4A6YH 2KZWA 1EGJL 2NY2B 2DQUH 4JE4B 2ZSVB 2V7NA 3D39D 1SJEA 3MBEC 2VABB 4ODUA 5DEGA 1ITBB 3CJJA 4F7EB 2A2QT 3PP4H 4ZPVB 2FEEL 2ZG3A 1S8DB 5GXBB 4PLOB 2BNQD 5GGUB 3DYPA 1WCBB 1P7KB 5DGRA 5TE6L 1D5XA 1H8NA 5KVMC 3QQ9C 1NJ9A 3DGCR 2PO6C 2YA2A 5LQBH 3CFBB 2YPLA 4P46A 2J3SA 5HVFB 4MB4A 4MS8D 3DXAE 1BFSA 3CLFL 5T3XH 4L4VA 2QV2A 4JPVH 3JTTB 5DRZA 4MJ6B 1OF2B 1IMHC 4O2EA 1OGTB 1VCAA 1QRNA 2FSEB 4JRWA 4IJ3B 3ZO0A 1FZOA 1MH5B 4APQC 1UKSA 4WHDA 4X8JB 1CD8A 1X5HA 1L7TH 5DMYA 2VQUA 3UZEA 1UM4H 3DBXB 3BI9X 4JFXA 4JY5H 3BN3B 4YZFE 3QCUH 1QPXA 5ADPH 4HMDA 1B0GA 4JY4A 4CVWA 2W9DL 4DUVA 4M1CC 3MOBH 1AH1A 1A1NB 2CLZB 5J1SC 3AY4C 4J2XA 2VITB 3TN0C 1E6JH 2XZAL 5C9JB 2VSCA 4AK1A 3PV7A 3KNBA 5F7EH 4RBPH 2VZVA 2BOBA 1TXKA 1R5WA 4P59H 4WUKL 3PQYA 4NRYB 3DXAD 1INEL 3E2HC 2O5YH 2VJXA 35C8L 1F3DJ 4OF5A 4G6AC 1DQLL 4MJ5A 5E5MA 4XVTH 4KJQC 2UWEE 5IHZA 3MLYH 2A0LC 2Q86A 4GG6F 2NTSP 4XPHH 1Y18A 1VHPA 3LPFA 3ROLA 3RIFK 2Y06H 1U8PB 4KKAC 4LKCA 3WN5A 1ZHLB 4PJHE 3P4OA 3AAZB 2VDOL 5IVZB 3RL1B 3VXUB 1X5IA 5C09A 4U1MA 4X7FC 5CJOL 4QRRB 4HS6B 3X3FH 2A1WL 5FO8A 4G9FB 1UH3A 3V6FA 3TCXA 1YZZA 4M5YL 4QRPB 2XWBB 1FNHA 4X7TB 3AM8C 2E8ZA 4GAGH 3FZUD 1CXKA 3UEZA 4B50A 5E2TL 2FZ3A 4YEEA 2XWJA 3LDBB 3ZYJA 5C1MB 2DWEA 4W70A 3U0PB 4FG6D 5SX5K 2VL4A 4Y4FD 3DROB 4HKBB 3IJYA 3D39A 4P2QB 3EAKA 2MMXA 2J4WL 2B5IC 1A9EB 5E6ID 5BZWA 3W9EB 4XNYH 4KTYA 3NCFB 2VDPH 4GMSH 3WDJA 1JHKH 4NQDA 2BNQA 1ERNA 1JMXA 2DI8A 5L9DL 1OAZH 4TSCH 5L8KB 4YXKL 1AO7D 4MJ4A 3B2VH 5CIPB 3J7HA 3QQ4B 3RWGA 1H3TA 1CU4L 5HXMA 4IRJD 1R3KA 3BP6A 1N0XH 2PUQT 4FZEH 3O11A 3CZFB 4X98A 3FFDB 4V2CB 1ZVSB 5AZEL 5L7XL 4KVNH 4MXVE 1RZGA 1MF2H 1FFRA 4RX4D 2QR0B 1XCQA 4XI5D 3C8KA 1DL7L 4BZ1L 5AG8A 4X9GA 4OLYH 2EDHA 1KPVA 2FJFA 2DWDB 4HIJA 5INCA 1MWAB 4C83B 3B5GA 3U4BH 3NABL 5BRZE 4GG8A 1KIUA 3GMMB 4JREC 5DZOA 2VUYA 1S7WA 2OTWA 1VADA 1R5IA 4RRPA 3R8BB 1NAMA 3PXJA 2G60H 5F89A 3HUJB 2GY7B 4JB9L 4U31A 5L2KA 1UZ8B 1SY6L 5AYUH 2IPTL 5CJXA 5EZIL 2XPGA 5KZCD 2CK0H 3SDXE 4LNRB 4DVBA 4QHNB 3FT3B 4WHYH 1OW0A 4N5ED 3EDJA 4WJ5A 1JHLL 5CEZE 5DJAB 1MFDL 1Z3GH 3K4AA 3SCMD 1ZT4A 2FWOA 3DXAA 5HGDA 5LG1A 4BA8A 3C5ZD 3U7YL 3IF1B 1AGBB 4AENA 3P4MB 3VU2A 3WEXA 2BOCB 3ARFD 1HQ4A 4XWOD 5ITFB 5I19L 3MRJA 3UZQA 4U7KA 3S37H 1RMFH 3AU1A 3UPRB 4WEBL 1CT8B 4ZUTA 1AE6L 2R29L 3RFZC 1WBXA 4AJ0A 2XN9B 3VXNA 2AJ3A 4IBLT 1UGNA 2Z93B 5BRZD 3WFDL 1GPOH 2XKNB 3D18A 5ERWA 1JIBA 3OKKA 3H9HB 2NXYC 3O9WC 5DC9B 5E08H 4O4YL 4NUJA 2WIIA 3IRPX 4OAWB 3E0GA 1XGYH 1KENL 4R90L 1NFDE 4Y4FA 5TPWL 1I8MB 2GEEA 1TZHB 2BCKB 1YPZE 4OLWH 4Z77A 1MJJA 5I66A 4OKDA 1OY3B 1XR8B 2MHAA 3MLRH 1KN4H 1NC2D 4M5ZL 3EYUL 1AO7A 1RJYA 4KXZH 2GFBA 2CDGA 3BFOA 3HB3D 3FCTA 5LGHH 3TZVC 4DGIH 3LMJH 2UWEA 4MQTB 1BOGA 2HTKC 3L3GB 2GKIA 2X6MA 1EO8H 2QSCL 5DK2B 3VWJD 2FGWL 3WIFB 3E3QE 4RX4A 3RJDA 4PIRF 4X4YA 4OCRL 3V6OA 1EXUB 3KYMA 2UY7A 3JUYA 1XH3B 3T1FA 3HS0A 1NGYA 1OGAE 1KN2L 1QSEA 1A4JA 3PL6D 3LQZA 4R6UA 5CGYD 3ROOA 4TVPH 2R2HB 4XH2A 2NY4B 4NKIL 3G5YB 2PETA 2VISB 4XZUA 1O0VA 3EKCA 1WFTA 1QLEH 4HWEH 5TF1H 2EXYC 2PW1B 3CXHK 4MD0B 2NXZC 5K9KB 1ZK9A 1Q1JL 1JZ3A 3ALWA 2QLVB 3IKKA 5LBSL 3NCYS 4YHNB 2ICWB 2C3WA 5JOFA 1A6VL 1I8KB 2CLVA 5EOTB 5K9OA 4OUUB 1IM9B 4FNLL 2O61B 2QHRH 5FGRA 4DK3A 3QG7L 3RU8H 2C3XA 4PG9B 1MFCL 3QI9D 3S37X 2YBRA 4OI9A 1ZHKA 1MWAH 2ARJQ 4ENEC 1BWMA 4ODXA 1FFOB 2OM5A 3MRPB 4KRPD 4P9HH 5T3XE 1JF1B 2PYEE 5JDSB 4ZFFB 4YHPA 1FG2B 1FC1A 2YD4A 4YUEH 3NFNB 1LO4L 3ARFA 5C7XL 4NFDA 5DZNA 5KG9B 4JAMA 5EOCH 5ITBH 1F4XH 1EMTL 1KCSH 4XVSL 1OGAD 3CZJA 4LPTA 1A8JH 3DVNA 5DD3H 4Z7WE 3QO0B 1FZKB 3DGGA 5BRZA 1NFKA 5F6IB 3EUUA 2ZNWA 5EZJB 4OIIH 1YC8A 1P53A 2V5TA 1PZUB 3WNLA 5BJTA 2ZG1A 3WFEL 1RU9H 2CK2A 4DGYH 4PRPE 5J9PB 5DUPH 1JPGA 3M1BA 3SDXA 1MEXH 1J8KA 1P7QB 5FOBA 4ZNEA 2DDQL 1YEFL 3OGCA 4HLZG 3C5SB 4LPYA 3TV3L 4HQQL 3FTGB 5DK0A 1N2RB 3SGJC 5D6CB 2IEPA 4XCYB 3SDYH 5I1LB 3LEVH 5T3XD 2PYED 2HJLA 1MUJA 5AZ2L 1YA5A 2CIIB 3ULVC 2DL2A 5FO7B 2P8MA 4LVHB 1FO0L 4Z78A 4HCRA 3QUZC 5BMFH 2A83A 2Q7YA 1XCTB 4MVBD 1V7NH 5DEFA 3FO1B 5DA0B 3QNZB 5C07B 5CEZL 3CSYA 1BQLL 4PJ7F 4R2GC 3VWJA 3ULUE 4I2XA 1MLCA 1AY1H 1HDMA 4PS4L 3OX8A 4OF3A 4QRQA 1BD2B 5J1AB 4PJGF 2VWEC 1TZGH 5DJ8A 1U36A 5EO0B 3RWHA 4YXHH 2H32B 1QP1A 2E27H 1A14L 1PKOA 1XF3B 4PRPD 3WKNA 3VGGA 5D4QA 3GO1L 1NFDA 4OV6F 2WP3T 4N8CL 2HLAA 2XWTB 4RFOL 5IB4B 4ZSOB 1NPUA 3TBYB 1YN6A 4JKKA 3FQNA 3MUZ1 3UPAA 4U0RC 3MR9A 4Q6IA 3MLWL 2X4NB 5CJ5A 4KTDH 2YC1A 2JIXA 4NQXB 1OP3H 2GHWB 3ZDXE 1D9KC 4HG4J 3ET9F 1K3ZA 4D0CA 1HHJA 3W11D 4U1JB 2VXUH 1CXHA 1NUNB 3WIHH 3OG4B 4XWGL 1MJUH 1N59B 5ID0A 5DTFB 3IJSA 3ZKXB 1EEYB 1N0LA 3DNKA 3TO4C 2X4RB 5MERA 3O6MH 3REWB 3ULUD 3KPOB 5C0RH 1JK8A 4HBCH 3X3GH 3QCTL 4K3GA 4I0CC 4Q9QH 2VXSL 1FIGH 4Z7QE 3QDAA 5HYQB 3KLDA 2NW2B 1OGAA 4EOWH 3HE7B 1KCRL 4ONHA 5GGRA 1IC4L 3M17B 3OJMB 1DQTA 4RFEA 3U48A 5JHLH 3D48R 1T04A 2JJTA 2O5ZH 3VE0A 3GHBL 1BQUA 1D5BA 1NSNH 2G2RB 1YJDL 3H7BB 4QTIL 4BUHA 1PX4A 3TA3C 4BM7A 5GS1B 5HI5D 3RKPA 2NZ9C 4ALAH 1FFNA 4FXKA 3EDEA 1WCQA 1DBAH 3MLTB 4PRDB 1DBKL 4XXDA 2ATKA 1Q0YL 3M07A 3ZE2F 1N64H 4PJAB 1LO0H 2XFXB 3QFDA 4A6YL 43CAA 2DQUL 3IDMA 1YEGL 4PP2A 5ACLA 5C70A 4W68A 2F5BH 3MUY1 5GS0C 4U1IB 3OZ9L 5I6XC 4AH2A 4ETQA 1RZ7H 5F88A 1T83C 2PYEA 2OR7A 1YY9D 4WO4B 3Q6FA 1T7VA 1U93A 3I2CH 5DWUH 3G6JF 4LF3A 2IANB 1I9IH 5I9QB 2HT4D 3TEUA 2Z0BA 3LKPB 5IB2B 5LQBL 4E5XB 3NACH 1DLFH 3FJTA 4OT1H 4BQBA 4Z7WA 5J3HD 3JTSA 4PREB 2ADFL 1TPXB 3EBAA 5T3XL 2YPKB 3EGSA 1PLGH 3NZ8A 4TUJB 5C0JB 4TSAH 1JYWA 3KPTA 3VXQA 5F7FA 5JUEL 4CVZA 1WFUA 3WNPA 1IVLA 4DZBA 2KL6A 1UB6A 2V7HA 4PRPA 1C5BH 4HJGB 4XNUH 2NZIA 5EDXA 5DRNA 1L7TL 3PDDA 5I1AA 5LJYH 2UY6A 5A40E 5DQJA 3H3KA 2GTWB 4JJHA 4EUPG 4F57H 1OOAA 3F7PC 2CRYA 4WEUD 1CFQA 1Y0LB 4JY5L 4ONGH 5IB1A 3TWCH 5J57B 1C12A 5ADPL 4HK3J 1DQMH 1CFBA 3PHOB 3WNOA 1CL7H 1AJ7L 1NEUA 3MOBL 1Z5LA 3O2VH 3D9AH 4LSSH 3VXUE 5A3ID 3LZFH 2ZJSL 5A2LH 1E6JL 1IAKA 2GI7A 4L3CA 4QRRE 1QBMH 5EWIH 4G9FE 1R6VA 4KROB 4PJ9B 2FJHB 1KJ2B 4LCUA 4RWYH 5HHNB 3MRHB 1FNSH 3LQAH 1U8JA 4P59L 1IGTA 1J1XH 3BPOC 1LDSA 1JZ8A 1GZQA 1F02I 3GSWB 1BF8A 1JGUH 3CSGA 5HGHA 4DOHE 2ESVB 4PGZA 2OTPA 1EVTC 1JTPA 1OTTC 3L3IA 4TVPE 4KRNA 5IV2B 2H26A 1FNEA 3SDCB 1U8QB 1RZKH 1A7NH 2G5RA 3MLYL 5TFSH 1WT5C 2APVA 2APXA 2Z35A 1T0NA 4XPHL 2VR5A 5FYLL 5E8PA 1QEWB 2Y06L 3MBXL 4YHML 3O2WH 5GGQH 5DQ9B 1JE6A 1P1ZB 5GZOC 2H3NA 1EA9C 3K80A 4LASL 4R3SB 4HIXH 3H9ZA 5JR1H 3X3FL 2G9HB 2H8PA 3WUWG 2QSVA 1RK0B 4NN7C 2M2DA 4H8WC 5EU4B 3VFPA 1JWSA 2W9EH 3VXUD 1URLA 2ZOKB 3ALXA 4NO0B 1A6UH 4QRRD 2A6KA 4XAKE 4G9FD 3S6CA 3FB8A 4LHJB 2EDYA 1YNLH 4XNYL 5A16A 1I3UA 4JKLA 2A73A 5EBMB 2VDPL 3MCKA 1FBIH 4GMSL 3W9DA 1JHKL 5CZXC 5HD8D 3C9NB 3Q1SH 2ZSVA 5IJKA 1OAZL 2VABA 4TSCL 4NBXB 4F7EA 3B2VL 4ZPVA 4Y5XB 4UTAH 1NL0H 1S8DA 3IFLL 4TVPD 4P23C 3JWDC 4OBRA 3AS1A 5CLWA 2C1OB 5GGUA 1WCBA 3JVGA 1P7KA 1J0ZA 2GK2A 4KVNL 2GTZB 3AGVA 4R9HA 5JW3H 1MF2L 3ARSA 3CFBA 4P5MB 4ZAKB 5KTEL 3TT3L 1XIWB 2AJUH 3RQ3A 4M7ZB 4RGMB 4Y88A 2BRRL 2NY3B 3CSBA 1HWHB 2HLFD 3PGDB 4LPUA 5GIRB 1VACB 3JTTA 1KLFA 4MJ6A 1OF2A 1QG3A 4YC2C 4XNQB 3FL7A 4FFWD 1KCUH 3VA6A 2GSGB 2WK2A 4I3SH 5B3NA 5ACMA 2Q1EA 1OGTA 1I8LC 1NMBH 2FSEA 4XAKD 4XMKH 1MH5A 2CR6A 2XN9E 1MCBA 4X8JA 2MTPA 3H9SE 1S5IH 3DBXA 3CPLB 1T80A 3P4NB 4Z7VE 2CK0L 3OKLB 3QQNA 3REVB 5IFAL 3BYTA 6CGTA 1IGIL 1HH6B 4LOUC 4JM2B 5D2LF 1GGCH 1EJOH 3QB7C 1JRHI 1Z3GL 1A1NA 2CLZA 3MODH 3GI8H 1IGFL 2VITA 1KTKE 2E7CA 1TLKA 2LFGA 2BVOB 4XBGB 2FATL 5C9JA 4PV8B 3K4ZA 4R4ND 4E42B 2P8PB 5DI8B 2VXQH 4NRYA 5JW4M 4S1DD 4W4OA 3B3IB 4UTBL 5DJXB 1PYWB 3EO9H 4BK4A 4YK4B 1ZLSH 2CXKA 3RGVC 4JQXC 1U2CA 5B8CC 5CP3A 1UA6H 1VEMA 1WWBX 4OZHE 2PTVA 4MXQD 3ARGB 4MB5A 2XN9D 5BXFB 5J12C 1NGQH 5AD0B 5E08L 4NBZB 3H9SD 4K94H 1U8PA 1ZHLA 4FTVE 4LVOC 3MJ6A 3AAZA 5IVZA 3C8DA 3RL1A 4F8TA 3VXUA 2PN5A 4E41B 4YX2H 2ILLA 3SKJH 4HS6A 4QRRA 4G9FA 3WJLC 3RWIB 4WGVB 4QRPA 2XWBA 4X7TA 1E4WH 1NANI 4NZUH 3BQUB 1FCGA 4HEME 3CFCL 4OLWL 4XHJC 5IFHH 3U0PA 4HUWB 4TNWF 3DROA 3MLRL 4HKBA 1RJZB 4P2QA 5A2IH 1CE6B 1A9EA 2ZUWA 3W9EA 1UXSB 2DRUA 2A38A 4GBXB 5LGHL 2XKSA 4DGIL 2M26A 3V79C 4F9LA 2DTSA 3WV0A 1BEYH 5K33A 4Y5YC 1EO8L 3U4AA 3SGEI 5CIPA 3QQ4A 3LKRB 2W92A 3H42H 3CU1A 4X6FB 4H1LG 3CZFA 4JQVC 5A43C 1X4XA 5H8DA 2VLJB 3FFDA 1ZVSA 2JJSC 5I1JH 5TE4L 1ZHNB 3TVMD 4TVPL 4H5SB 4UNVA 5GGSB 3FN0H 5D2NE 1T4KB 1MJ7L 4KK8C 2QR0A 2FR4B 1G84A 1G9EA 4FTVD 4Y2DC 4HWEL 1NCAH 5TF1L 1QFWH 4OF0A 4WUUB 2DWDA 3UJJL 4CAGA 1MWAA 4C83A 1AGFB 1UACH 1H3VA 2KBGA 2NY4D 4FQLH 1E4XI 1VESA 3GMMA 3HUJF 2R15A 4TNVF 5E0QA 3NGBB 1JN6B 1AI1H 2QHRL 3RU8L 3HUJA 2RBLA 1UZ8A 4JDTH 4JFOB 1U2HA 2JELH 3ZHLA 2RAMA 2CDFB 1LE5B 1KEML 4LNRA 1T66C 4IMKA 4QHNA 1IM9D 3FT3A 1PQZB 3LKQB 1WEJH 4YHLL 4YUEL 4X6EA 3SHSA 5CKGA 5DJAA 5FHAL 1U41A 5EOCL 3CK0H 5ITBL 1F4XL 1KCSL 3NCCB 1N6UA 4LHUB 4CN6A 1B3JA 2V5MA 3L1OH 4OUOA 3IF1A 1AGBA 3OHXB 3P4MA 2IBGA 1IEAB 2BOCA 5DD3L 2J12B 5ITFA 3TPUB 2ERJB 4BZYA 5M95B 1CS6A 4OIIL 1GHFH 3UPRA 4RMSA 2X1WL 5T5FH 1CT8A 1GAFH 5C07E 3NN8B 2R69H 3EIFA 1W2KT 4WEMB 3LAFA 5KS9F 1BFOB 1EAPB 1WTGT 2XN9A 2H6PA 5J56B 2Z93A 3H9SA 1RU9L 2XKNA 1PY4A 4DGYL 2EIBA 5I8KH 1BD2E 4JZJC 1KYOJ 3H9HA 4KMTH 2HRPH 1MEXL 3SE4A 4ZTPL 5GS0H 4NJAH 2V5YA 3RVWD 1V3LA 4OAWA 4YWGH 3Q48A 4G8FB 3S96B 4NYLB 4DN3H 2B1HH 2NY6D