3JT0A

Crystal structure of the c-terminal fragment (426-558) lamin-b1 from homo sapiens, northeast structural genomics consortium target hr5546a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
TGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Lamin-B1
publication title Northeast Structural Genomics Consortium Target HR5546A
rcsb
source organism Homo sapiens
total genus 15
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00932 LTD Lamin Tail Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1260 Mainly Beta Sandwich Immunoglobulin-like Lamin Tail domain 3jt0A00
3JT0A 3UMNA 1IVTA 2KPWA 2LLLA 1UFGA 1IFRA 3GEFA
chains in the Genus database with same CATH superfamily
1E9PB 4LOUC 5L9DL 4WTWA 4BFFA 4FQPA 5AW8B 1VERA 5C0JB 4YHMH 4WW2A 3GXPA 4NX0A 3KBFA 2L4OA 2L7QA 2R0KL 5J56B 4O2EB 1PYWA 1N68A 2WBJC 4L05A 4L1TA 5DHDA 4L4TA 5J1AB 1XT5A 4W93A 5E8PB 5AVSB 2DL9A 1BLIA 4AJYV 4Z7NE 4FNSA 4JFYA 4M93B 4KNUA 3HNSL 3LRLA 5JHLA 3JSSA 3VXMD 4AEIL 3PV6A 4BFOA 2HFTA 3ZOAA 4OLVH 2X9XA 5C9KA 5CP7B 4DH2A 2WBKA 2EDFA 4ZOCA 2BNRE 5F1IB 5HHQB 4L3CB 1FV1A 4IM8A 1Q9WA 3K80A 4PWHA 3CFNA 4U1NA 4WFHE 5DHMC 2YUWA 2WQWA 1FL3A 2QDWA 2VDNH 2GTQA 5G4MA 1NMBL 3SDXA 4J5VA 5CWSB 3VXMB 1QFWM 4DPAX 1CICA 2K6WA 3D0VB 1U92A 5I18H 2ARJA 1GHFL 5F44A 4I9XA 4I88A 1DQMH 3QEQA 5IESH 3CWGA 2BIIA 4BJLA 1HXYB 2OTUB 1EANA 3BEWA 2A83A 1PNCA 2QVFB 2YK1L 4YK4B 4IBQA 3KLSA 1AS7A 4U1KB 4YGVA 1D2PA 1LMKA 1ZA6B 4FNUA 4PBXA 3X1FA 4HXBL 3MJ7A 1H5BA 1ZANL 2V4LA 5CZXD 3VFUB 4C4BA 5HYQB 1NUDA 1INDH 3DJZA 5I0XA 4AK1A 2QQKL 2FR4A 2AEQH 3MOBL 5CBEA 1G7HA 2WC7A 3K81A 4JFED 4YE4L 1I3RA 3C5JA 5CZKA 1W8EA 4ZFOL 4WFED 1FIEA 2JIXD 4L5FH 3ZHKA 3OZ9H 4GXUN 2WV3A 3ZE0F 3T2PA 3AS0A 4JPSA 1AQKH 4HQQL 4N2GA 4LRIA 1IGYB 5LN4A 4C83B 4HDIB 4LPTA 5C0CA 5IFJB 5FKAB 5B22A 1KZQA 4K7FA 1HH6A 1E4JA 4TPRL 1MRDL 1TIUA 1E50A 3BZ4A 4NKIH 2DQTL 2JIXB 4Z9KB 2PCFA 4H5SB 5IT2L 3X1NA 2W1NA 2HTLD 1JFQH 3FCSA 1BQ5A 1E7VA 1TZGL 4NM4L 1UCBH 4ES9A 1LL1A 2QTEA 3BVTA 4JM2C 4Z76A 4YDJA 3EG9A 2Y2YA 2XNAA 4EN2A 1XXFC 2M8XA 3B8YA 4OLYL 6PCYA 4OCRL 1OTUC 3RWDA 2MTAA 2ZUUA 1KYAA 2BVTA 1LO0L 3O4LE 4I4WA 2MOQA 5C3IA 1L6PA 4XNXL 3CZLA 4GAJL 5D7JA 5SWSD 3KWUA 3LS4H 2W5PA 4XBPA 3KJ6H 3ARDB 1I1FB 3P2TA 3S2AA 2BOBA 1FNFA 1A9BA 2EVHA 3VW3L 2A9BA 4OGAD 4DP1X 1JVOA 1MUJA 2E75C 2B77A 4OZGB 4X6DE 4OV5B 4JN2A 2B5IC 1E27A 2NY0C 3FN0H 2H2SC 2ESVD 3MC0A 4ZQKB 5C0AA 3T8XA 4K3JH 5SWSB 4EJ1C 5EEVA 3O0RH 2YD8A 2CLVA 5FO8A 1U36A 3CBKB 2JKIS 4WHYH 5F89A 1A21A 3V5HA 3Q8BA 1CGVA 5KS9B 4XE0A 5AWNL 3V9EA 4F7KA 3NA9H 1KELH 1W8NA 4OJEH 4W68A 3SO3C 3UC0L 4NYLB 1KLGB 1OCWH 1E30A 5ESAB 3W9DB 2ZCKH 2NY4C 5IVZB 3KLAA 5GZNC 3BRGC 1BQKA 1AZVA 2YFNA 3MBEC 1EEYA 1BZ9A 3DECA 5L2KA 1GYCA 2ZXCA 2A4CA 3LIUA 4XP4H 1QAWA 3RTQD 1S9VA 5TE6L 1QNIA 1VFAB 3KD4A 1MJ7L 4LHJB 1Z9OA 2KZWA 5ITFA 2D3JA 2NX5E 3PFUA 1Q0XH 2VH5H 3OAZH 5ISZE 1FO0H 1KF9B 3P2BA 1BJ1J 1U8MB 3IJEB 1B4TA 1MAMH 2V33A 1Z5LB 3ISRA 3ZDZF 4M93C 5JQ6H 4LCYB 4EIUA 4U7KA 2CK2A 3HR5A 3PHOA 1U93B 1G9MC 5FO9B 4X80L 1J87A 4NUJA 1UZ8B 1NWPA 2WLYA 4HISA 2Q3ZA 1T22B 4HIHA 5B8CB 1KYFA 4X7EC 5FHBL 3HVNA 3P9LB 2ZUVA 4PV9A 3K71A 1LXMA 2H3NA 5SX4H 4IBVA 3W1ZA 1MCKA 2XWJB 1CLCA 2OULB 3IPFA 4U6TA 5DHVA 3DV4A 1N6VA 1TNNA 5IM7A 1TMQA 5FYLE 3HNVL 2WYTA 4M6MH 5GGSA 3L5XL 1JK9B 1F18A 1DQQA 4AGMA 2XU9A 4YK4C 2Y5TB 5K69A 3L9RB 1JPFB 4Z7IA 5D93B 3ELQA 4YSSA 4HH9B 5E8NA 3O2DA 3TTYA 4BYHA 4LNRB 5A16B 3NN8B 1YMME 2K9FB 4QXGL 5JUEL 1QFWI 3FONA 3FUEA 1WF5A 4AG4H 4LCCB 1G7PB 3Q48A 2BFGA 1KC5L 3BUIA 5AVZB 2J2ZA 2QGEA 5IB4A 1RUQH 3I3DA 3N91A 2YD4A 4ZTPH 4HCIA 2HFEA 5CZXC 5ALCH 4GO9A 4YO0B 4FFYA 3V0JA 4PVBA 4DKAA 1KCRH 3MCLL 4ORGB 5JOPE 4LSPH 5IFAL 1N5AB 5JORB 5LXVA 4ZNEA 4WZ9A 4AGQA 3MV8A 2W07B 4KPHH 4HUXA 2JKXA 4HZAA 4IBLT 4NZDA 5ALBL 1UM4H 3VB9A 1M6OA 1UGKA 1TQVA 4FNPA 3N85H 1BD2A 3WSQH 5IKCA 3VGGA 3WUWA 1QWUA 3KPLA 4OAWA 3WFZA 4B6ZA 4IRJB 4ATTA 5KTEH 3HZYB 1CD0A 2AW2A 3RVVD 4W9IC 4F58L 4FNLL 2ZKHL 3ZTJG 1WAEA 1NEUA 2YA1A 2Q76A 5KYYB 1I1AA 2ZUXA 3IMSA 2HTLC 1A5FL 4H8UA 2AZUA 3CC5A 4JFDD 4PJ5E 4UUJA 5FFOA 5B1CA 1TZHB 3HKZA 4XO5A 5T1MA 1NLBL 4G6MH 2AVGA 1F4YL 1IGCL 1OAXL 4HYTB 4U3XA 4XRCA 1ZK5A 2V3EA 5F7DB 3ARDC 5T1DL 2PXYA 4O00A 3N5AA 2P43B 3WN6A 4R97B 3V4VL 5JLZA 2YAFA 3MA9L 1E3FA 1FH2A 4Z7VE 2C3VA 3H3KA 3NZUA 1MFBH 5FX3A 4NZJA 4X4XA 1CFVH 3QCVL 4G6KL 5IW6B 1ESOA 1FAIL 4OGAC 4TVSa 4HG4K 3HPJA 5C2BH 1H8LA 1H3UA 3BDYL 5DEFA 5L8LB 1F41A 2ZICA 4NUGL 5H4ZA 1DVXA 1XQ4A 3HI6H 4N2NA 3S36L 3Q43A 4GW4B 5GZOD 1KJMB 3PQYB 5AVVB 3NPZB 1Z1WA 5AB9A 2R15A 1CCZA 5GHWH 3BRFA 1HU8A 2DBLL 3AWFA 2AJVL 5AOZA 3DUUA 1LE5B 3DI2B 2XX1A 2HZHA 3OAYH 4LLAA 2ATKA 4NIKB 5HHPB 5DMIH 4UBDC 2Y7QB 3NJFA 3DTXB 3EH4B 5F6HJ 4HSAC 3IJHB 5HSFA 2IO5A 2WXQA 1HNYA 4LKCA 1L0XA 1DCEA 2HG5B 3MXWL 5KSUA 1WAPA 3K8LA 4DKTA 4L4VA 5HJBA 1Q1JH 1HINH 4YHKH 2FECL 4RWYH 1HL9A 1YJDL 3W56A 3OLIA 2HT4D 2VWEC 5FYKU 5CD5D 4JFPB 4KV5F 4G9FA 1PD6A 3PDDA 3CVDA 5F97E 1F13A 3QUXD 2VISA 2Y3NA 3VXSA 5DA4A 1JMZA 1JZ7A 4XC1H 2WUCL 1P1ZB 4HCRA 5B8CC 3QJZA 2VMJA 4DFIA 5IOKA 3S4SG 4GUCA 3KYMB 2KS0A 3AQYA 4F2MB 5IGXH 4EOWH 3IXTA 1E4HA 1CB4A 1V5JA 1S9WB 3QUXB 5AW7B 1YUHB 4KUCD 5MEOB 1K2DB 2HMID 1O6VA 3UBXB 5FEBA 3CDCA 1ZGLP 5FW8A 5BMFH 2R7EA 1W80A 2WIIB 3VG9B 3B6SB 5DCCA 4ZXBD 4WUUB 5AAWA 1NIFA 4XPGH 3CHPA 3EF4A 5DD1H 5E6IA 3MFFB 3RKPA 3S35H 3E7JA 1HCVA 4NDMA 5AYUL 1G7LB 2VDQB 5FV1L 1D7DA 1URIA 4JANA 2WM0A 4J3TA 2YS4A 4E2OA 1ZEAH 1M71A 4RLDA 3TZVA 2NW3B 4N8UA 4BDVB 4LCCC 2YFOA 2VMFA 1AGCA 2IQAB 3SE9L 5C0RH 3GB7A 2OAAA 3A24A 4WFGE 2ZXEB 2EEBA 1KJ3H 2ZOKA 3IDUA 4P04A 3UADA 3DOSB 2XN1A 1NDGB 2Y1AA 3QZWA 4MCMA 3VFWA 1CLYL 4X5WB 4P3CH 3S3JA 1UFUA 2B1OA 4YSCA 3REVA 1ADQL 1W2KT 5GJTL 3HPLB 4GG8A 1I7ZB 1RUAH 3IJSA 4KZEH 4JDVA 4KKCD 1IKFH 1CXLA 1JHTA 5DZPA 3RG1C 5JR1L 1FFOA 1OAQL 5AZUA 4KXDA 4HLJA 1A4KB 4IRZA 5CHNB 5KJRH 2ZKMX 3MLYH 3FSAA 3PAUA 1MNUH 2XDHA 3T71A 5I5MA 2P8PB 3GBMH 1PS3A 5KS9F 1MCQA 4CU8A 2CO3A 2YA2A 5CD3A 5I1KL 4DPRA 4OFKA 1A6UH 3F01A 2HJLB 3INUL 2XPGA 2EINB 2MCPH 5A6IA 4CNIA 3VG0H 4L8SA 1P5UC 5EC2B 2GT9A 4N1EA 1XXDC 2K45A 3EOYG 1QMUA 3TL5A 3KPRE 4G3YH 3GS7A 4GUPA 3RVVC 3MV9B 3DBSA 3IVKB 1ZY9A 3EIFA 4UTBA 4EPSA 1GR7A 1P4IH 4ZMVA 2PYED 5EU4A 3FU6A 2CM6A 5D7SL 2NDGA 3ZE0E 1ZT1A 3G6JB 3VWKA 5LAXB 3HG1E 2ZOTA 1P9MA 5GRJH 2VN7A 4WI0A 4XMPL 3II2A 3LEYL 1EDQA 3ABMB 2Y3AA 1LHZA 4JO1H 4LSSL 3FUKA 5CSZA 1HQ4B 3CVHL 2AV1B 3X13B 5AALA 3PGCA 2R2BB 3BD3A 4BK4A 2HXAA 4PJXF 3D6GA 4XB3A 1V7NL 4Y5VB 2B3IA 5CEXA 4NNYB 4YXKH 4JFQA 3L16A 3O6ML 4JO4H 3L3OB 5C0BE 5DJZB 1VFOA 2OMWA 5T1KB 4NWUH 3RVXD 5FPIA 2XZAL 2BS8A 5GZOC 1IEAA 2G30A 5DD5L 1WYJA 4XCCH 1WBYB 2IXQB 4MJ5A 4NOFA 1FJ1A 2BVPB 4QHNB 1PKOA 1H15B 1RZJC 4GFTB 1AXTL 3MRQA 3QO0A 4DP6X 3QZPA 3OAUH 1AOHA 4NHUB 4O9HH 3IKCB 4OZHF 1BV8A 1R3JB 1DQLH 5J5EA 2ZJSH 4D7BA 2CO1A 3D4CA 3W0WA 2Z3FA 4O4YL 5GRVK 3AREB 3QJHB 4GAGH 3I3BA 4ANXA 1LO3L 4MDIB 3TBTB 1P6AB 3MLUL 3O4OB 4JPKH 3HNTL 3B9AA 3HAEH 5HD8C 1NFIB 4R4NC 1WCBB 4DGWC 1PTZA 3CHRA 5CD5C 3LH8A 1RHHA 5DUMH 1XSJA 2GCYB 4XXCA 5CUSL 1IBZA 3QUXC 2C9XA 4UT6A 1N7MH 1FCGA 4HJJH 3BFQG 2BSTB 4Y4KB 2BIQA 3VG9C 3IDNB 2RGSA 2YLKA 2EYRB 5EZIH 3KPPB 3N6YA 2MCMA 4PB9H 4LVEA 5CIPA 2F15A 1OO2A 2DM2A 4GJTB 4FABH 4PJIF 5ELIA 4I3GA 1C1EH 1CLVA 2OV0A 4JMXA 4ZK8A 3R18A 3MJ9H 3RILA 5F7EL 4WO4A 1A8JH 1G6RL 4PFEA 4AVKA 5A2BA 5ADOL 3OKLA 1P2CB 5LJYH 1JZDC 3DETC 1I3GL 3DMMA 3NJNA 3ZDZE 4CN1A 3T3MF 1EZLA 3FF7A 5HHOD 1PCSA 4YHLH 1M1XB 5E1AA 4CL7A 3QQDA 3DK0A 3HC0B 4RAUB 2ZKYA 2VDLL 4MAYA 4WU7A 2OYLA 1Q90A 3K0WA 4NWTH 5B38B 1Z9SB 3EFDL 3LNDA 2W91A 4BZ1H 5H4YA 1Z2KA 4Z0BH 1VESA 4G8GA 4KXZI 1DUZB 1L7TH 3B2UC 1OGSA 5AYTA 3OKDA 1A47A 1IBYA 3MN8A 3QJVB 4IKLA 3FQRB 1DJIA 4ODXA 1OVZA 2X09A 4LGRB 2H0PA 2M2DA 4J3BA 4X4YA 3NJVA 4J4PD 5EF3A 1E4XI 5TF1H 5HHXH 4AZ8A 1WFTA 1GIGH 4O5LL 1MQKL 2IC2A 1Q4NX 4NQDE 2VSMB 3T6XA 3J8F7 5IEHB 2OL3H 4JB9L 1I53A 1FL5A 1SUHA 3LS5L 3I6GA 2BP8A 4FG0A 2IDQA 2OP4L 4HWZB 4PGDB 5CEYA 4BGDA 3ALWA 3PWVA 5FGSA 3MLSL 4ZSOE 2NW2A 2ROXA 5H37H 3SGJC 2F54B 5K9JH 1JNJA 5FXCH 1NCWL 5CLXA 3S9DB 1FGNL 3I9GH 4RETB 4DAGH 2KUTA 3PABB 2QSCL 4HT1H 3AITA 3IKKA 3EO9L 1B0WA 3RY4A 4NBXB 1N26A 1JF5A 5IHUL 3IFOA 4AYFB 5C08D 3VGDA 4WIQA 3DSNB 1HIML 3POCA 2IWFA 3QIUB 5GGQL 1V8HA 8PAZA 1HL5A 3ZKSD 1COBA 1PZSA 2OJ1A 4FNQA 5C71A 2HFGL 5I6PA 3SKJH 5DJ8B 3ZKND 1ET7A 4HAFA 4OQTH 3KYNB 2R56H 1MVYA 1GZHA 3HHSA 3HTLX 3FFCE 4JFUA 1IGFH 4OT1L 2I9TB 2CJ3A 3WE6A 1CXKA 3ZSTA 1UD4A 4Y5VC 3BUBA 1BQLL 1TQUA 4DP0X 4POYA 3FFOA 2DL2A 2Q8BH 3TNMB 5AOKA 5I0ZA 4KTDH 1FORH 2BWIA 1RSFA 5E6YA 3LXCA 1C8QA 2O5YL 3L95A 3BH8A 4UOW1 3CLFL 3LKSB 4JG9A 2PCXA 2DJ4A 4NRZA 5DJAA 5K9KB 2R51A 1LQBC 3HG4A 3GMPA 1VACA 2QGCA 4RA0C 4AQEB 1M7IB 1NFDF 2NRDA 4KK6D 1MCPH 4F93B 2ZXDA 4ADJA 1DFBH 1IQWL 3L9EA 5T8IA 1JZ8A 1I3UA 1HZHH 2J8OA 2VQ1B 2CBTA 5D7KE 4MJ6B 3NCFB 3AREC 4X5QA 4JGMA 2IBBA 3LNHA 4PJ9D 1MWAB 3MAWA 4M8QB 1KCVL 4PQXA 2VLKB 3O4OC 2V2TB 3N1GC 3QIBB 3ZDXB 1SFHA 4QAMB 5C0EB 4E42B 5G55A 5F1NB 3WY1A 1CE6B 2DH2A 5DI8A 1KULA 1I85A 5C3TA 2JFCA 1UTDA 1NCCH 3KXFB 4PJ9B 3BP6B 2BWDA 3NZHH 1N2RA 3TCTA 4Y4KC 4KJYB 5KW9H 4C56E 3FBKA 2NNXA 2YAOA 3M17B 4XPTH 1JP5A 1JYVA 4KOBA 3G6DL 1JN6A 5E1QA 3UXFA 3REWA 3MNWB 2FYYA 5AQ0A 2YD3A 5F0MB 3ZE2E 3TH2T 1VPOL 4QDGA 2DDQH 3OXSA 3KM2A 5CFHA 5HXMA 1XH0A 2OKMA 2KZ1B 3ZTCC 1RFDL 4S2SA 3GTVA 4UT7H 5AZ2H 1T7XA 1T1WA 1I9JH 1I1YB 2FBOJ 4KV5E 3VQMA 3EBAA 4HPHA 4ODSL 3RNQA 2EDQA 3RGVA 1N5YL 3WY4A 4ZUWA 3GSNA 1LE9B 4JZOA 1JI2A 2WLLA 3LKRA 1QI3A 5ACMA 3GXMA 4OD3H 3G6JF 2HAZA 4ZUVB 1OANA 5AW6B 3QFJD 3LHPL 1I4FB 2H32H 4PJCA 3ZO0A 1T7YA 2WLKA 3NTCL 5FV2A 4WWKB 3PJNA 1XGYH 4KDVA 3TCXA 1CL7L 2PTUA 2QZQA 2VDRB 4CJ0A 3GBLA 5I5JA 1JD9A 1R3KA 1YNKH 4R3SA 4W81A 3BSZH 4BA0A 1N0LA 1WWWX 3L6FA 4L4TD 5AB2A 2CSPA 2WYZA 2EDJA 2MCAA 4BXVA 1CFQA 3FQTA 4WW2B 4IYKA 4J4PC 1TJIL 1MKFA 2APWA 4I9WD 1SLUA 5I19H 3KYOB 2DD8L 3WEMA 3UPRB 3FT2B 4F5CA 3T09A 5EB9A 1UH3A 4GPVA 3I6KA 2AQ1A 3T2NL 3MLVL 4G7VH 1CICD 1OM9A 2EVJA 3E0GA 1ORSB 1L5GA 4MS8C 3RWIB 5I74B 1GYAA 5CBAB 4TS6A 3VWJB 1LEIA 1QBLL 4JCLA 5CN3A 2FRGP 1UM5H 4U1NB 4N90D 2X38A 4X4ME 1QRNE 3EJQA 3MKGA 4WI3A 3DUHA 2UZXA 4ZMTA 5ABDE 2VLJE 1U92B 3BQUD 3FFDB 3QUYB 4A67A 5JW3H 2CUIA 5KEZA 3QEQB 3J27A 3A6CH 5LCVL 3PPEA 5EO0B 4JFZH 2G2RA 3EHBB 3BEWB 2A83B 1TLMA 4YLCA 2FD6L 4RESB 3P54A 4YGVB 3PGFH 3ZKNC 2VQUA 3LSOA 4Z5RA 1JWUB 4KKLC 5DA0B 3GMMB 1UGNA 4GP4B 4B50A 1JF1A 2EDXA 1H5BB 1TSRA 1FG2A 1I9RL 4H8PA 1EMTH 1UVQA 4K0OA 2FR4B 1KCKA 2MIZA 4KWUA 4R4FL 4HA1A 1OP5K 4EEEA 1YLBB 1MRCH 3LIZL 5C0DA 1I3RB 3C5JB 2VDPH 3AGWA 3MRNA 4PJ7B 4R7NB 2J88H 1FLTX 1FYTA 1A8ZA 3S5LA 4MJIA 3NZSA 4WO0A 4N20A 5C0CB 1RCYA 4MD0A 5I1JH 4K7FB 1HH6B 4KK6C 4LP5A 4WI2A 3WJMB 3FQUB 2CG9X 4U1GB 2PCFB 4ZI8A 2AQNA 4N8VG 4JFTA 2H0EA 3UG3A 2BFVL 4OSUH 5GIRA 3VXTB 4PJXE 4Z76B 3EG9B 3HRZC 5D2NE 3ATEA 1JK8A 1JHLL 3VRIA 5D7JD 4ZOEA 4PJ9C 1AOZA 1YY8A 1OAJA 4R7XA 1G9EA 1JZJA 3RWDB 5BO1H 1NCDH 3LVTA 5FGBC 3HG0A 1WZ1L 3MR9A 3F7YB 3QI9A 1W0VB 2GHZA 1YN6A 1IX2A 2IALA 4BKSC 4U1SA 3DXAD 1SXNA 2E86A 4MD5B 1P6WA 4YEFA 5CZVL 1J5OH 1OK0A 2P7TB 2BOBB 5I66B 3EYVB 5BZDA 5EF0A 1U8LA 1DJXA 1OSEA 4KNTA 4OZHE 1MUJB 1SYSA 2YRPA 4NO0A 5DJDB 1HEZA 1WEJL 4KRPD 4XN5A 4Z3FA 1E27B 4S1QL 3GNMH 5C0AB 1KN2H 1CF8H 2CLVB 5FO8B 4OTXL 5F89B 3B37A 4N26A 3VXPA 2DTSA 3F6LA 2LOEA 1HH9A 3PHQB 4YC2B 5L2KD 2BVYA 4KRPB 3B56A 2J43A 3NIDB 1CE1L 4G80A 4A2FA 3MODH 1HESA 1PLGL 5B3NA 3F05A 4R26L 3ZL4L 4WWKC 1KV3A 4LAQL 2J4WL 3D2TA 1YNTA 5KYUA 1EEYB 1BZ9B 3GSXA 4YH6A 3X12A 2X9YA 2WXHA 2NLJA 5F2FA 2Z8WC 5AL0A 5IR1A 4YHML 1GW0A 4ZPTB 4BIKA 1WFMA 4GRLA 4PJIE 4WW2C 3MO1B 5CLYA 6FABH 5H2BA 1IAOA 3LCYA 4DUXA 4PPTA 4QHKJ 4HMDA 2I32A 2B1HH 3T3ME 5B4MC 1JTOA 2KDGA 1UQSA 3R1GH 3TJPA 4JHUA 3A6OA 2PO6A 3CFBA 3AMKA 4DUVA 3QUGA 3NFSH 4HEME 5HDLA 5I74C 2N01B 4PRBA 1OAKH 2L8AA 3VWJC 5FAAA 5HGGS 2VDNL 4XWGH 4ZZFA 4HIHB 3CK0L 3QYCA 2ED6A 3PREA 2MSPA 5I18L 1LLAA 3K71B 5LWYH 5DFWH 1JHKH 3T0EA 1DVFA 2PETA 2C3XA 1O6TA 2KQMA 5SX5H 5GGSB 5D4QA 3EHBC 3ZDXF 4U6YB 4HEPA 4NC0B 4K71C 4PJFA 1XD1A 2WGNB 4JFHD 3SYOA 5E8NB 1H5BC 4B0MM 4KI5E 5DEGB 3IGKA 3EADA 3BAKA 3SKNB 4PWKA 4LEXH 3FONB 3TJHD 4L5FL 4NO5A 1G43A 4JPQA 3RPIA 2VDKH 1I8KA 3OZ9L 2X4OA 4H2CA 4PVNA 2X3CA 2DI9A 2BNQB 3PUCA 2W60A 1DANU 1BD2D 1U8CB 5FLVA 2Z4QA 1X7TA 4EIZC 4YR6A 1H3XA 3H55A 4E68A 2CNYA 5DGRA 2DWYA 1UA6H 5BJTA 4L18A 1JFQL 1SQ2N 1XGQA 1DTUA 3HFML 3MV8B 3QPQC 4HUXB 2JQZA 4MJ2A 4U1GC 1I1AD 4GKNA 4F57H 3FOMB 1GYUA 4U1JA 4B41A 5IKCB 4PJHB 3KJ4B 4FC3E 1KJVA 4Y9EA 4OAWB 1M3JA 4JHAL 2Z1PA 2B08A 4GKSB 5AZEH 3ZR5A 3NGBB 4U31A 1GA2A 2Q76B 3FQYA 4KUZL 1I1AB 2PXYD 4UUJB 4LCWE 4NLAA 2ZWNA 3VI3E 4J8QA 4ZNCD 3KL0A 1HEJC 5C9JA 2CD0A 3CX2A 1ZLEA 1XCWA 3LS4L 4JDZA 4OQ1A 5E6SB 5T1MB 1G5AA 4X6FA 3KJ6L 1FVDA 1TTFA 5D7JC 4WUUE 3BSGA 4XRCB 1NFDE 4YAQA 1F58H 1KGYE 3L5WA 3BZ5A 3DPBB 4ANVA 4FX5A 4XCEA 1CI5A 3I50H 3L4XA 5JLZB 1B6UA 3FN0L 3KH4A 4ZDHA 4M6AA 2VXQL 3VFGH 2AXJA 2C3VB 5IJKA 3MOQA 3CFKA 2EXYD 3JT0A 4V1DA 2B59A 3FB8A 3IDIA 4H26A 2NNRA 4X4XB 1UACL 3CMGA 3NA9L 1RK1A 1G9MH 2DRUA 2OX5B 5EO9A 1N3NA 4MXWH 4QF1A 4XPFH 5TQ0H 3T3PF 2FUQA 1OCWL 2R9HD 4YC2C 3CXFA 3L7EA 1P4BL 4Z8FL 3GRBA 3BYYA 3JYBA 3AUWB 5GS0L 4KRPC 3A6BH 5DK2B 5FWRA 2IOOA 3FU3A 4JREB 1JTTA 3H9YA 3PP3H 4NXSA 4EBQL 4P57A 5C7ZA 3QNZB 1AY1H 4XI5C 5CKGA 1XDTT 4FNRA 2VZTA 4PU2A 4F3FA 4LFHG 5E6RB 3G04A 4L4VD 4LSUH 1J5HA 2F2HA 3DUUB 2AERT 4FI8A 2ICEA 4F1SA 1NFKA 2CH8A 5CS7A 1QFWL 3C60A 2EDTA 3MRCA 4G9FD 4M5ZH 5DD0H 1Q0XL 2VH5L 4WF7A 3AROA 1FO0L 2XQYA 2XG5A 2D4FA 4LKCB 5IROC 4DGVL 1FDLH 3DX7B 4LIQE 2LLGA 3ZKMD 5K1JA 5KSUB 1MAML 2B9AA 3NCXA 4UDUA 1XBDA 5JQ6L 3C6LD 4OCSH 3EYFA 4NP4H 1Q8MA 1ZVHA 3VTTA 1BLNB 4DK3A 3MV9E 1KIRA 1ETZA 4KTYA 3BSHA 4Q9CA 2ZCZA 1I3VA 4PSPA 4D9QD 1HWWA 4F37K 2VISB 4C58B 5EBLA 3SDCB 3VDBA 1EDYA 3VXSB 5FGCE 4FYSA 4PJ7F 3UTSB 1DQVA 3G6JE 5IMOB 3FB5B 4TV3A 4YFLI 4B60A 1FNLA 4P49A 3V9FA 5E6ID 4ETYA 3IXTB 2GJ6B 3AW5A 3T6ZA 2XWDA 5T1LA 4U3SB 5KZCD 1FNAA 1MCJA 2GFBA 4M6ML 4GINA 3LN5A 3Q2NA 3QISA 4GLRI 4RMRA 1YECH 4IOIA 4CBZA 2R7EB 1I8IA 4F15B 2X4TA 3O3BA 5C0GA 3FT4A 4D9RE 5E6IB 3DVGA 4JKWA 1LILA 2FTAA 2HG0A 3UGXA 1NC4D 5KZCB 4NDMB 4BH8A 2W95A 5D1QE 1EHLL 4KKBD 4JANB 2GJRA 2VIRA 1B9KA 4N86A 1N59A 5L0QB 1R47A 3SJVA 1M71B 2NY7H 3TZVB 3Q2CA 5KSVA 4UQ9A 1RUQL 4ZTPL 4Q89A 2BM3A 3KPNB 2KC0A 1N10A 3WDJA 4HBCL 5JO5A 5ALCL 4N0FA 4HWBH 5MI0B 2WAHA 2ZOKB 4IJ3C 4ZO6A 4ZZKA 3F7LA 3ULVD 4CVUA 1PY0A 3QZWB 2R23B 4LSPL 1RPQA 3VFWB 5GXBB 3WOVA 2ZG1A 1OD7A 4KROB 3REVB 2EDYA 3TJHC 4M5YH 4NQCB 4E5XA 4GG8B 4MSWA 4KPHL 1UM4L 4JDVB 2AK4E 5KSAA 3PCYA 4A6YA 1X6LA 3WSQL 1FFOB 4S0TD 3TWYA 3V0DA 5J89A 3HI5L 3V5DA 1PPIA 5KTEL 1WZKA 4IBYA 3VFMA 2MMXA 2JNZA 3CSFA 2NYYC 4IDLA 5JW5B 3OB8A 1KACB 4MCNA 1SQMA 3NGBC 1GS6X 1I1AC 4NQVA 2XPGB 3X3FH 3V6FA 2EQDA 4Z7WE 4G6ML 4L8SB 3UZVB 4EN3A 4DZ8A 1IEHA 2GT9B 2NY2B 3VWKD 1HWHB 4I87A 2FLMA 2AJYH 3RKDC 3SKOA 4GUPB 4MASA 3EJTA 4M5SA 3D50A 2PXYC 3VM5A 1A6TA 4HX1A 4MRBA 4PJ8A 5SWZE 5CJ8A 5A2KH 4IDJH 1MFBL 4D9LL 3LMJH 4WI0B 3CFJA 1JNHB 5C2BL 3PP4L 3OC8A 1WC7A 3HZMA 4ZJ9A 1L9NA 2ZCLH 3P0YL 3G5VA 3ASNB 3VXUB 3IRZA 3UJIL 3HI6L 3GXTA 3T0XA 3PGCB 1F4HA 2B15A 5G2NA 2Y24A 1MFVA 3DKHA 5HHVH 2GTZA 2V7HA 4JFQB 5IJDC 4PGZA 2VITB 4QRPE 3WO3B 4OFYA 4OJFH 2OMWB 3C09B 2R9HC 1KYDA 3PIQB 2GITA 4ICWA 5DMIL 5BXFA 1LP9F 3P4MB 2QQLH 4WKZB 3ROLA 3ISYA 4XO3A 3BUPA 3W0WD 1IEAB 4ZFZA 4F8NA 2D7QA 3VFRA 4A2LA 4MJ5B 5FO7A 2PWGA 1Q1JL 1T4KB 4RWYL 5I26A 3MRQB 1ULVA 3P11H 3QO0B 4NO2A 4NRXA 2LQRA 3MROA 1NEZG 2YPLB 3Q5TA 3O9WA 2HYMA 5LBSH 3SHSA 3V6OC 3B1UA 5FCUH 1LJMA 4RGNB 4OZ4A 1T1ZA 4G5ZL 4L1SA 3VMOA 5E2VH 1QEXA 3QUZA 2BS9A 3CVIH 4KMTH 3O6FA 1OF2A 5JZ7D 2J1YA 3N41F 3ZX1A 2YBGA 3MLRL 4EOWL 4ZX3A 3UYPA 3VNYA 5HI5D 3K74B 4PGEB 5ICYB 1MEXL 1MCHA 3DJRA 4PG2A 2G3MA 4S1SL 4UIKL 5BMFL 3G5YA 1R5IA 1TFPA 2G0LA 1BAFL 4MVBC 4BQBA 1BF8A 3VQ2C 4XPGL 5DD1L 1G4RA 2CCLA 4RZCB 5I1CL 2EIBA 4DEUA 1FPTL 4WO4D 3NJIA 2IF7A 5AAWC 4F15C 5HVHB 3S35L 3AY2A 4PJHF 3DMMD 5E6IC 4NC1E 4ZMYA 4P2RA 1X6NA 3QRGL 2UUDK 1IKNA 5CIPB 1AANA 1C7TA 5CNHA 1OE2A 1AZZC 5L0QC 3TZVC 4O58H 4PTUB 1S7WB 4P23A 2CO7A 4MAYD 4LSQH 3UTQA 4A39A 4EIBA 1KJ3L 3BT2H 1AQ8A 4F7PA 5FYJD 3VD9A 5D7HA 5MI0C 3AG1B 3IU4H 4FN0A 1VHPA 3MRLA 4X9GA 5JW4N 4G8GD 4P3CL 4KKBC 5E1AB 1MJJA 2VUKA 2P46B 1DEDA 1CZ8H 3QQDB 4U1HA 4R7VA 1RUAL 3WN5A 4KROC 2YZ8A 4KZEL 1JGLH 4WU7B 1IKFL 4LAJH 2FNWA 3VI4B 3LQMA 3LKQA 1M4KA 1FC1A 1J0JA 5KJRL 1WQVT 3MLYL 5KJ7E 3ULVC 1MNUL 1IGJB 3T5WA 2E7CA 2KZKA 1YNLL 2EDWA 4FZEH 4NPYA 4ODXB 2CXKA 1RUPH 2V37A 2VLKE 4X4YB 5DHEA 1HYSD 3QULB 5CLWA 2N7SA 4JDEA 3VSTA 1SOQA 3VDAA 2EKJA 2EUWA 4AZ8B 3FRUA 1KBGL 5JIKA 2MCPL 1CURA 3TYGH 5DEZA 3DVFA 2VLMD 4YSOA 1G5GA 2TRHA 3HUJB 4G3YL 2Q86B 4L8SC 3HBGA 3WS3A 3I6GB 5CEYB 5C8JA 1HCZA 1DLHA 2UY6A 3PWVB 4JPIA 1NCGA 2YPVA 5TQ2H 4KJQD 1S7VB 3TO4B 4CC1A 4FQIH 4DZBB 5JYMA 1L7IH 1OTTD 3FQWB 1C5CH 3BESR 1CGTA 1RZJH 2FNBA 1J8HA 5GRJL 3IF1B 2EIJB 2F6AA 3VWKC 3CPLA 4MAZA 3IFOB 4MMXA 4CDHA 3FCUB 2IFFH 3BVVA 1JV2A 2VQ4A 4D94A 1I7RB 2PR4L 5F9OH 3U25A 1RK0B 3P69A 4UIMA 1KB9J 5KN5A 4U49A 3OGCA 1ACCA 1F86A 3IFPB 1WVZA 2PTVA 4ZPVA 1NGQH 3LN9A 4HULB 1B2WL 1SXSA 1YAIA 2YJQA 3LZNA 2RCSH 4LLUB 2EDDA 5E4OA 1KWKA 1PVHA 2XUWA 1HHGB 1QATA 4YXKL 4DVBA 5IVXF 3MOAH 4JO4L 3WE6B 3K6IA 5E00A 4RNRA 4KKAC 1TQBB 2VR8A 4NWUL 4XN7A 4JN1H 3GXDA 4MS6A 2XV2A 4LASH 3C09C 3IGUA 2NY3B 2N1KA 5AVXB 1JWSA 3M1CA 1CG9A 3L95B 4GB9A 3BH8B 4I0PA 4L8DA 2JELH 4XCCL 1O9ZA 3D2UA 4NRZB 2EO1A 4JJ5A 4A37A 3TN0B 1VACB 3OAUL 1ZGLM 1MDTA 2PLTA 1V3KA 4X98B 2P5EB 5BRZE 1DQLL 2ZJSL 5DYFA 5L7XH 1Y18B 2I07A 3K2IA 1T0MB 3ARXA 4ANWA 1B3IA 4DP4X 4JZNB 4JX0A 3PWJB 4JBSA 4OZFA 3GF8A 5GRYA 3ZMNA 1OTSD 2DQGH 3UTTA 3T3PE 5EH1A 3L08A 4QKXB 3U0PA 5J11B 4FA7B 2GAZA 3U2SA 1HNFA 1QSFB 4GAYB 3E6HA 5AKTA 3RWGA 4ZG1A 4XXCC 1N7ML 4AI7A 1KYOJ 4TQEL 4HJJL 5CJOH 4J3OF 6PAZA 3QPXH 1PW3A 1L9SA 1GY2A 4M6OH 4JGNA 4K9EC 2C9UA 4NQXA 2CMRL 5JZ7C 1N2RB 5I8CA 5EZIL 5HVHC 3DSFL 4MX7A 3EFOB 4BHUA 5IB2A 5I0DA 2YEQA 3U36B 2CKBL 2ZWLT 3V4PL 1J86A 1F2QA 3REWB 2YRZA 4X5PA 2FYYB 2I27N 3MJ9L 3TCLB 3OZKA 1QFHA 5J57B 1UEYA 1QKZH 3RGVD 4UM9A 1SF5A 3P77B 3UERA 1GSMA 4WO4C 1VFMA 1T5XA 3DMMC 4FQCH 4S2SB 4FKHA 5KVFE 3ULUD 1T1WB 3FSOA 1D7CA 1TKWA 4XOCA 1NICA 3FO2A 5EZJA 3WUZA 4P9HC 2WXMA 5IJCC 2HLAB 5E6UB 3RGVB 4NWTL 2FO1A 2KQNA 4MAYC 4QRRA 1R0AH 3GGWA 1YC8A 4JZOB 4ZBJA 4LLDB 4UILL 3K2MC 4W9CC 4Z0BL 4OLZH 2VW7A 5E8OB 1OD9A 4JY4A 3LB6D 4QNPE 3UYOD 4PJCB 5FS5A 4EMZA 3US1A 3HN5A 1KG0A 2X4SB 4GSUA 2VT0A 3ARGA 2XY2A 3ARYA 4IS6B 4PP2A 1XB8A 3LV3A 1GIGL 1OIOA 2GK0B 5C07A 1QPPA 5I1GH 4AUYA 1R3KB 2H0FA 1N0LB 4YFLF 3L6FB 1QHPA 3GJFK 4H0IA 4YBQD 1FFTB 4UTAA 4P2CG 3H42H 4F1ZA 1CFQB 2OSLA 3FQTB 2DYRB 2FX7H 3MTRA 4LEOA 5K9JL 1HYSC 1CDGA 3GZKA 1PLAA 1WAAF 1E8YA 3QNFA 3I9GL 4Y1AB 1T2QH 4R8WL 4DAGL 1RURH 2E9GA 2MQCA 4HT1L 5A6LA 2J6EA 1KGCE 1T5WA 1JJUA 2X7LB 1A6ZA 3IWVA 3I6KB 3E3QE 2JCWA 2WXRA 4YHNA 1BVNT 1WBZB 1L5GB 1WSST 1ND0A 1PZ3A 2WNGA 3H7BA 1ITBB 2WLIB 4FAAB 4KJQC 3L48A 4QKTA 2WKOF 4WEEA 4Y2NA 5CP3A 3RPBA 4HKZB 1T0NB 3F2LA 1LEIB 1IAMA 1OTTC 3U4KA 1OP3K 2A6IA 2C3HA 4NPKA 4OQTL 2MPAL 2R56L 2KBGA 1TU2B 2JI1A 3K7UA 3P30L 1IGFL 4M7JH 2UY7A 5DLMH 1UH2A 1PGRB 3TC9A 2WXGA 4GSXA 5DR5H 5L2JA 2G2RB 4KTDL 1TQBC 4RBPK 2HTKD 1BXUA 4JEGB 3GEWB 4AM0A 5E5UB 25C8L 1YAZA 4YOKA 1XIWA 3LSOB 2DTMH 4P2OA 5I82A 3LQZA 2R59A 1FG2B 2W9DH 1FYTD 3L7FA 1ZTMA 4MJID 1VSCA 3ZKXB 1KTBA 5C0ND 4OGYL 5T3ZD 1MCPL 5FW7A 4LO9A 5C0DB 4GQRA 4TRPH 4X6BA 4E41A 5LNDA 2BSBA 1DL7L 1AR2A 3C12A 1FYTB 3VX1A 3HZ3A 3S5LB 2AQQA 2X1WL 3VH8A 2H2PD 3QEUA 3IMVA 4A38A 4MD0B 4XNAA 3KLKA 4XMWA 4ETQA 4W6YB 1GH7A 3K8KA 1OT1A 1WT5C 4YNYB 4QOKE 4YPJA 2FBRA 1SDDA 5J11C 3QI9D 4FLQA 1M05A 4HK0B 1NCCL 1P4UA 4WUKH 4HLEA 1I85C 1OW0A 3OBAA 4FHJA 3LH2H 3M6DA 3Q7JA 3O6KH 3L3DA 2CU9A 3VI4F 3VRIB 1CR9H 1P0SE 2J1XA 2X28A 5ANHA 2R1XB 1O5DT 3K46A 1W6WA 3ECUA 2BOLA 4XPTL 4QHMB 1LP9E 3QI9B 2YKKA 4FQXB 4G7QB 3RZCA 4PG9A 3QUMA 3VDCA 1L9TA 2DDQL 4U1SB 1U8OA 2XC8A 5EOCJ 2X5PA 4KZCA 5F71A 5EO1A 4MB5A 5BPPA 3OXRA 2ADJB 4X0KB 5AZ2L 3RNKA 2AJXH 1Y6NR 5BZDB 3EGSA 4XNQB 1U8LB 4HFWA 4XVSL 3HUJF 2OPCA 1SYSB 3P3RA 4NO0B 2ATPA 5CR8A 1WCQA 1M7DA 1QFPA 5KVEH 4FLSA 4KK5D 2CHDA 2GJPA 3QJSB 3RGVC 2FLBT 4JE0A 4OD3L 3BH4A 2FT6A 1DQTA 2ZAIA 3FDWA 4O2FA 3VXPB 2BNQE 1LM8V 1GYVA 5JQHC 1GJIA 3AMLA 3Q06A 3ECBA 3GDCA 3KPOA 3UPAA 1ZS8A 3RI5F 2UVEA 3U2IA 1AP2A 1XGYL 2PP7A 3W39A 1ZHLA 4GRLD 1NMCB 1IUZA 1YNKL 1YNTB 2BNRA 4K7PX 5KYUB 4KO6A 3GSXB 3X12B 3UL4A 3TBBA 2J8UE 4PJHE 2BPBA 3GM0A 3K2UH 3D69A 5GS1A 2EUXA 5I1EH 1KJ2L 1FN4A 2DWTA 3WNNA 1E5UI 3NJJA 2PO6D 2FBJH 4Q6IA 4I77L 3F64A 3UYRL 2HWZH 5I19L 1J1OL 1X5ZA 5DVOA 4ZFQA 1IAOB 2IDTA 5E7FA 3ESOA 5E9DE 3WD5H 4UQEA 4X9YA 1KLFB 5DJYB 1J5DA 2GSGA 1HILA 3ES6A 4YBQC 1ML0A 1UQSB 3I85A 4LEBA 3TF4A 1V7MH 4JRYD 2CDFB 1RUML 3FB6B 1MCBA 2PO6B 3CFBB 5M94B 5ECJE 4HUVA 3RVWD 2WVVA 2GTWB 1DVFD 2EDMA 1UM5L 5E4AA 4KHXL 4TUOA 2AITA 3KLLA 3WIHA 1GGTA 2XN0A 3AS1A 1DCLA 5ETUA 2IPUG 5HI3D 2Z35B 4DFHA 1TUPA 1JF6A 2APBA 3MNZA 1RZFH 1EPFA 5GRUH 2Q10A 3BIAX 1MWAH 1Z9LA 2NNCA 1RJZB 2APXA 1ZLUK 5JW3L 5C09A 4HOXA 4AYGA 4UV7L 3EO1B 5CEZD 1URZA 1OZTG 3T0EB 3BI9X 1U0QA 5A3IC 3QJRB 2AKRA 1QNZH 5EIIG 4R90H 3SD2A 3WMSA 3HAEG 3BLKA 4PJFB 2IADA 4B7LA 4UOW0 3VXNA 3WNPA 2Z7ZA 3N40P 3C8HA 3IJ8A 2H8PB 2DEWX 2R39A 4MXVF 1PEWA 1MRCL 3ZKXC 5HGDB 3MGTA 1C9SA 2VDPL 1OQOA 2HTKC 1MVFA 3WIIL 3MYZA 1ZXKA 3QIWA 5F7YC 1FZKB 3UZQA 1BFOB 3B3IA 5EU5A 2BJML 2XJKA 3LHAA 1U2CA 1DHKA 2W60B 1Z7JA 3T6QC 4IHOA 4ZUSA 3S37X 2QFPA 1RERA 1X3DA 5I1JL 1U91B 1DFXA 1LNUA 1VADA 1IM3B 3F5WA 3VU2A 3JQOB 1OF0A 5C0NC 5HY9A 5CGMA 4PGJA 1XF2A 2JQMA 3KE0A 5BJTB 1XGQB 3T0BA 1RL1A 1PZ5A 3RVUD 2B39A 4TF4A 4HWUA 1MFCH 1Q9KA 4GQ9L 4RISL 1KIPA 4X6DA 5C6TL 7FABH 4NHCH 2H2PC 1EZVY 5IVXE 1T03H 3GD1C 5D6DC 1RV6X 2OZ4L 4K5OA 3H53A 5TH2A 3OSKA 3LPFA 1NUGA 3IJYA 4ZT1A 2GJ6E 3D8MA 1P4LA 3HC3H 2ITFA 2DM3A 3QXVA 4PP1D 2VDRH 3GXNA 3QI9C 5DQ9A 5B7FA 1D5BA 1EA9C 5C9JB 1RZQA 2AXGA 4JDZB 4LT7A 4X6FB 3T8MA 4MQTB 2DM4A 4GAAA 3OAZK 1DQJB 4NZTH 1T7WA 5HHMB 5I8KH 1J5OL 4V1DD 2VXUH 1MXDA 3KCPA 4YIQA 4XCEB 2O72A 1BQSA 3ZRFC 1T1YA 3VCLA 3H0TA 2GEEA 3GBEA 5EOQH 1KN2L 1Q94B 5F9DC 4ZDHB 1P1VA 1J5CA 4N6QA 4XCNA 3CFKB 5A2AA 1QA9A 2B59B 3FB8B 5GRXG 5SV4A 3IDIB 3DIVA 5CJQL 5H37G 2EKSB 1AS8A 4OM0L 3TT3L 1RK1B 1Z3RA 5ISZA 5EO9B 1KIQA 1ES0A 1N3NB 1P7QA 4QF1B 5F1OB 3U46A 43C9A 4C47A 3ML9A 1FAKT 3MODL 3L7EB 4IU3A 4ZW7A 1H8OA 4YS4A 1IFGA 4KK5C 1NMAH 4Z0XA 4P57B 2DEXX 1NMCC 5LG6A 3BT0A 5AEAA 3GSQB 4M5TA 4OIBA 2G60L 3DX9A 4QLRA 3G04B 1USZA 1RJYA 1KTKE 1R4XA 1CT8A 4UT9A 1ANUA 5I16A 1GSKA 5E4EC 3L3HB 1V55B 3V4VA 4BZ1A 3OG6B 6FABL 4W9ZA 3C60B 4GRLC 1NCIA 4TL4A 3MRCB 3R7RA 1ID5I 2XG5B 5IVNA 2D7PA 3VFPA 4ZS6D 5EV7A 3G5ZA 3KH3A 4UDUB 4ZMWA 4PJEB 2ITCA 3EYFB 1KENH 4HS8H 1E90A 1DN0A 1O9WA 2PCYA 5AKRA 3O81A 3BPNB 3EJSA 3IDGA 2QVMA 1KIRB 2PO6C 4IRSB 3WNMA 1YMMA 1JWMA 5T1LD 5TF0A 3CDZA 4BSVA 4XWGL 2UWEB 5EBLB 4FTVE 3VE0A 5HYJE 4XBEH 1Q1PA 2D0HA 2A0LD 3D0LA 3I6LD 3VFNB 2LW3A 2QLYA 2LU5A 3UAEA 1W0WB 4EI6A 4FCHA 4P9MH 1RP8A 4Y2OA 3FF8A 3RVWC 5KBPA 2BSCA 2GFBB 3T0EC 2NMSA 5BVPH 3S3CB 2XLLA 5B7EA 3QZLA 4C59B 1HHKA 4QJ3B 1TTBA 1A7PH 4P07A 2G4EA 3KEHA 3SJVD 3NJMA 2NXZD 1I8IB 5FOBA 5HI3C 3O3BB 4LLQB 3THMH 3FT4B 3OKKB 1QSEA 3VGAB 2VAAB 1CFTA 4GP8B 1F5WA 4BH8B 1B0RB 3EYUL 2Y5EA 3MREA 4X7SL 4G8AC 2VIRB 3RDTA 1EFQA 1A22B 1N59B 1IEBA 1WAAE 3L3KA 4LKXA 5D1ZB 2KI6A 3ZUNC 1BVOA 4AYDC 3QYNA 5KSAD 3F7QA 2RALA 4PJ5A 3S0PA 2F0CA 3NK3A 2NUTA 2CLRA 1I75A 1GRWA 3UC2A 2VZ3A 3QC6X 4EI0A 4X99B 3BUTA 3CSTA 4DPBX 4K5LA 2XPZA 2CQVA 3COOA 3PV7A 1KDJA 1Z32X 4YHZH 2J1KA 1GGIH 4IK7A 1UA6L 1PMYA 1ZVYA 1AZCA 3MQIA 4MSWB 3TJEH 1A7NL 4F57L 1ZLSL 1YEKH 4A6YB 4QYAA 2XXMB 3T0WA 1X9UA 3NQIA 4L48A 2DYPD 1KXTA 4W9HC 4APXB 1A7RH 3IM1A 3WTWA 3V5DB 4Z7VA 4EN3D 1XGPA 4FRWA 4WJG3 3H85A 5AZEL 2A7BA 2O5ZH 2APTA 3SBWA 3BXNB 4ZMXA 3NJGA 4OD1H 5DJXA 3IB4A 2NT0A 2H41A 3QWOB 3ZHNA 1GPOL 4NQVB 3OAYK 1S7RA 3V6FB 4JFEE 4PJ8D 1ID2A 3ESVF 3V0HA 4NZRH 2B1AH 4LF3A 4WFEE 4EN3B 3C5SA 4PWJA 3G3LA 4LOEA 4RRPM 2YAMA 3ILQD 4HD9A 1F58L 5EWIL 3SKOB 2AQRA 5I1HL 4Z3EA 3I50L 1EAQA 4GO6B 3CSGA 4PP1C 4HX1B 4PJ8B 2ZYIA 4XOBA 3VFGL 4FZ8L 4N0RA 2PPEA 3CU1A 4NKOA 4PHXA 4BA8A 3CZSA 3BKMH 3CSBA 1MHHA 1VGEH 3WFEH 2P8LA 1G7IA 3VD2A 1TITA 3SZ6A 1YYCA 3UTZA 5IJKC 4XVTH 1G9ML 4MXWL 4K4KA 4XPFL 1QZ1A 5TQ0L 4U1LB 2A73A 1PIGA 5I0YA 3A6BL 4LBEA 1N0XH 2J7LA 5ES4B 4QHUB 2UXVA 3GO1H 3P4NB 4FI7A 5JHDB 1XEDA 1NGWA 3MRMA 4F27A 1ZSHA 1S7SA 2JTDA 4C57C 1LVEA 5FYKD 2F53B 4Z95H 4KY2A 3VQLA 3DRQA 1CXIA 4LSUL 1QUNA 4MXQD 5IQMA 3UABA 2EO7A 4PRDA 2Y1ZA 4HKXA 2GITB 1ETB1 4LDLB 4LP8A 4QWWC 5BXFB 4YSUA 1NAMA 1KZYA 1KB9K 1QFUL 3O9WD 4M5ZL 5DD0L 3ROLB 2VXVH 3C60C 1BFSA 2WP3O 3VFOA 1FDLL 4HGKC 1OAUH 2ZXQA 4AL8C 3F85A 2ICES 1PNDA 4Y5YA 4GG6F 2XACC 5FO7B 3PJSA 1UWXH 3O2DH 2ESVE 4PJBB 4OCSL 4DUWA 4NP4L 3O6FD 4NRXB 4QRUA 3MROB 2A3TA 5AOLA 5IOPA 5KSBF 2WXNA 2Y06L 3QO1A 3APMA 3S48A 2QSVA 4IRSC 4OZ4B 1T1ZB 2Z64C 5HI4D 3K6NA 1H8NA 5DVNA 1AGBA 1CDJA 2DQ6A 1AGEA 4AMKH 4DGYH 5E56A 3ZL2A 3QUZB 4ZS6C 3QVAA 4FFYH 4PVLA 5CU9A 4ERSL 3QHZH 1D3CA 4FYQA 3UGEA 5FDWA 1S7QA 3CJJA 2QEJA 1GC1C 3UYPB 4I1PA 3WHE1 3N2JA 2WB1A 1KMGA 3V0VA 1HL8A 4C4UA 2ZCHL 4AXWA 3QG7H 5DRXB 4DEWA 2ICWI 5DFVD 3VD1A 1R5IB 4A2HA 1ZS2A 2Y6TE 4N2AA 4P23D 2IFGA 4R2GD 1NCTA 2A0LC 3E38A 4M7ZB 4B9YA 3EOAA 2QV2A 4TLUA 4PW9A 2VCOA 3VGAC 2ROYA 2TSAA 4G1EA 4P2RB 1CD1A 1SJXA 2D31A 3QEHA 1GGBH 1G9NL 1MF2L 4R7LA 4UDTA 4PRPA 1OAZH 5I0WA 4P23B 4HWBL 5DO2D 5F9JA 1MCWM 1F11A 1QTSA 2LLNA 3G9VA 2CUHA 3MRLB 4Y7OC 4EDXA 4RQQA 1MJJB 1HAUA 3KPRA 2EO9A 3MBWB 3NT0A 4U1HB 2P5EE 1UADC 3IJ7A 4XAKE 4UZSA 4N2BA 5DJCB 1X4XA 4YZFF 1NANI 4QRQA 3KDMA 1T66D 3JWDC 3AAZA 1F4XH 1WLHA 5KUMA 5CFAA 1S7TA 2C1OA 2P8MB 4N0UE 4BBWA 1YRKA 4QT5A 2EH8H 3HG1A 4NPYB 4WI9A 3VXOA 4TSBL 5E2UH 3AT9A 4JDEB 1NCBL 1PZAA 3FRUB 1DJZA 2WD0A 4J28A 3Q01A 4ZRGA 3X3FL 4EF3A 5AKSA 2QHLA 3FO9A 3G08A 5A2LH 4N8VA 3FH7A 5BUGA 4Q9RH 2W0FA 3DOIA 1J8HD 3ZTNH 4EN3C 1QACA 1M1SA 1UM6H 5ANMB 1OKEA 2XTJB 3ATDA 4WQOA 2H4EA 1SRDA 4NKMA 5C8JB 3U83A 1DLHB 3VGFA 2XFXA 3V6ZB 2BW5A 1IC5H 2NQCA 5CINH 3X2QB 3LZLA 3IDXH 2C5DC 3T65B 3QCTH 1UH4A 3FT1A 2VN3A 4PJ8C 2CHNA 3FUJA 3M86A 1TEGA 3LMJL 3CPLB 3VD0A 2YEZA 4MMXB 5AB1A 4X9HA 3ILQC 2W81C 1XBRA 1JV2B 1F4AA 3AVEA 4U6XA 1EUUA 2ZCLL 4PJEF 1E3XA 4ZOBA 5DT1H 3OGCB 2CBOA 3MLXH 2RQ8A 3LPOA 4JFXB 2F58H 2FX8H 4DQOH 8FABA 5IJVB 2DM7A 4PLKD 1K72A 2AANA 5HHVL 1D9KA 5ESQA 2UWEF 1RZ7H 4JFDE 4HCRH 4DVBB 4I0KA 3D2UD 1A9EB 4OJFL 1J12A 4RNRB 2IANB 3D12B 1XSIA 1JWSB 2QQLL 2Z92B 2APVA 4I0PB 2UX7A 1UWEH 3MRIA 2N59A 4MJJA 1N19A 1S3RA 2DIEA 3D2UB 4G9DB 4GRWB 4JJ5B 1PY4A 4S0SD 4M7LT 1BQHA 3TH4T 3ZDYB 4MXQC 1Q72L 1WD9A 5LBSL 4W9GC 1AFVH 5DEJA 3UTTD 2B4CC 4W6WB 2I07B 2L3BA 4TLSA 3O9WC 2WTOA 3NRFA 5FM4A 1KXQE 2BVEA 4XB7A 3FTUA 5E2VL 3NSFA 3CVIL 2XICA 3JV4A 4JLRA 4LCVA 2IDSA 1BIHA 4X2UA 4OZFB 4RAVB 4XMZA 4ADGA 5C0IA 3QUZC 4FXTA 3U0PB 1J9QA 3RUGE 1IZKA 1INEL 2XVLA 4KMQA 2I85A 3FTSA 3GIVB 2GAZB 5HPMA 3U2SB 3OM3B 4XBMA 3E6HB 3RWGB 1K8IA 3F58H 3ULVH 2O5NA 3CIAA 4NQXB 1IVTA 2IH9A 2ID5A 4UM9D 4YSDA 5I8CB 1XGRB 1LTXA 4M7ZC 4XNYH 5HGAA 4IOFC 4EVNA 1U6AL 3DX8B 4GMSH 2QQNH 1IKNC 4HOWA 1IBGH 1IIKA 3GS4A 4O58L 3D52A 5BRPA 1F90L 1MREH 5DFVC 3RWHA 2B0SH 3BT2L 4UM9B 3FN9A 4FJ6A 4P23C 3SKMA 4R2GC 4ODVH 1HYRC 2QT6A 4QRRD 4AIZA 2C9AA 4BWUA 4WNQA 2DMHA 2B2XH 2Z31A 5EBWA 1CZ8L 1TKWB 1XF4A 3JTTB 4UTBH 1MJ8L 3ARTA 3MU3A 3FO2B 3NEOA 4MZ2A 1EO8H 5EZJB 2VMDA 2EXTA 4WLCA 4YDVA 4FFWC 3ZMEA 4FEIA 1CTMA 1Y6KR 3ARGD 3WNOA 1WISA 4ZSOA 2OLDA 2YD0A 3O2VH 4E9XA 3ME0A 2CO2A 4J3WA 4R0LA 1FNSL 3TV3L 4JDTL 2E8YA 4JY4B 2X4NB 4KVPA 2R4RH 1A2YA 3LDBC 4FZEL 1RUPL 2AXWA 3D51A 4PP2B 3WKYA 3EBHA 4OKDA 4FERA 5IMKB 1T66C 1WFJA 5C07B 3BAJA 4JM4H 4A2GA 5KYWA 3VXQB 2ADFH 4JKPL 5EUOB 5IB5B 1CVRA 3ILEA 4K3DH 5EZOH 1A7BA 1EHNA 5GGUA 4H13C 1DE4A 2G3NA 2X6UA 4PJDB 3CVCA 2OSLB 4M61B 2GUOA 2VB5A 3FFCA 3GUTA 2XTJC 2YGOA 1IFHH 3MRGA 3X11A 4MQSB 2X6BA 5TQ2L 3BO8B 4FQIL 1TZAA 4S1RL 4E9YA 1L7IL 4K7PH 2KPWA 2CA3A 3O2WH 1C5CL 2VYRE 4EKJA 5I6NA 3CLWA 4H8HA 3LN4A 1ZHKA 5BS0E 1T5WB 2ZTBA 1A6ZB 1G1OA 1EH9A 5GZNA 3SY0A 1N4XL 2IFFL 5KBNC 4YHNB 2ZPKH 3CV5A 3MBEA 3AUVA 4MMXC 4QYOA 2BDNH 4PJBF 1LD9B 5F9OL 4Q7DA 1ND0B 1A6WH 5E24E 3H7BB 1E9PA 3LKPA 4YX2H 5L88H 1IAIH 1X5KA 3DGGA 5BCAA 2A6IB 4M7LH 1YO4A 1TO5A 2RCSL 3I74A 5D8JH 1CTNA 2VLLB 3C2AL 3VMNA 4WAFA 4P2OD 4O2EA 1L4IA 3F00A 4WV1B 3G5WA 4JN1L 2D9CA 4DKFL 3NJXA 4QXTA 4XPBH 4LASL 5E8PA 5L2JB 2CR0A 4ISVB 4L1HA 1OXYA 2FJFB 3IMWA 5EEUA 1BW8A 5D4JA 4AM0B 2D7MA 2JELL 4K9EH 1XIWB 1UD2A 2W59A 2J44A 3KW8A 4KK9C 4PLKC 2ZONA 4I0PC 4P2OB 4PYHA 5CP7A 5CZRA 3TPKA 1QW8A 3GSVA 2HH0H 2PYEE 3L7FB 1Q0EA 2WYHA 4L3CA 4XNUH 5CJBA 1JZHA 3HZVA 4BE5A 5HGBA 4EAEA 1AIZA 3J7HA 2AJZA 3QXDA 4WNSA 1IM9B 2BRRH 3P4LA 1EAOA 4DN3L 5CIPH 5CWSA 4N1CA 1SJEB 4X6BB 4E41B 4NJAH 1J11A 4K3EH 1UT9A 1NCOA 5H94B 1HXYA 4N25A 1PX3A 2OTUA 1V54B 4IU2B 1H19A 4OFDA 1ZK9A 5DVLA 1FZJB 3RRQA 2Q1EA 2DQGL 1DVZA 5C7XH 3WTYA 1BGXL 1ZA6A 4ETQB 3H4HA 5B39G 5KG9A 1BYNA 4P9HH 5D1XD 3T1WA 3VFUA 1ZRUA 4YHYB 1BWWA 1DBAL 5HYIA 5K59F 5BVJA 1SDDB 4F91B 3WTVA 4QJ5B 2PWDA 2AK1L 3QPXL 4IEFB 4M6OL 1W15A 4YDIH 3S37H 2F8OA 3RZCD 3JV0A 1RQ5A 2H47C 4LGPB 4EI5A 1K8DA 3APCA 4I3RL 3SOTA 3QDGD 5T3XD 4XH2A 5MHSE 2OMXA 5KVGH 1HOEA 1NLDL 4CVWA 5IB3B 3CXHK 1EIBA 4DO5A 2QL1A 4G8IA 3S4SB 4H1LA 1IGYA 3RPKA 4C83A 4ZFOB 1SOSA 5M7QA 4PHZA 4Y9FA 1IC0A 4PG9B 3QUMB 4B3VA 2XBTA 4GNKB 4K55A 4NN5B 1QKZL 3S96A 5JHBA 1U8OB 4GG6E 1T0PB 3D18B 5EO1B 3BC9A 2XI9A 3IFNH 2FB4L 3H3BC 3RNKB 3PWPE 3EGSB 5KSBE 5EFIB 2WQSA 3NSXA 4KQ3H 3EH3B 4NGHH 3U9PL 3DX3A 1G0DA 2WAQA 1XD0A 3GMOB 4M3KB 1M7DB 3WNIA 3EBIA 5EEYA 4CSPA 2IBZX 4FXLA 4KVCH 1VA9A 4C4KO 4OLZL 1GVIA 4JO3L 4O2FB 3PJLA 2BNRD 3DX1A 4DVRH 5F9WB 2M26A 5HVFB 2JKLA 3PWLB 4WFHD 3KPOB 2BO0A 4Z7NB 5HVGB 3GSUA 1ZS8B 1AP2B 2HVKA 4TLTA 3G6AA 3WMPA 3ARDA 4MHHG 3ARGC 4BEIA 4KITB 4JO2H 4RH4A 5I1GL 4PY7A 1W72A 3GT6A 2BNRB 4BQ9A 4OV5A 5L6YH 4X4MA 5GS1B 1QRNA 2R0LH 3D69B 3PXJA 4MFHA 1ED3B 4PLNC 4AYSA 2FX7L 2WSKA 1U3HA 1FN4B 3L45A 2VLJA 4HPYL 2LAAA 5HJ3B 3LQAC 2FGWH 4Q6IB 1OCZB 5HHOE 5KS9A 1T2QL 2D2CC 1RURL 4X5LA 3RA7L 1BREA 3IXAB 4NYLA 1KLGA 1JPTL 4QLWA 5IB1B 1NIAA 2GSGB 2YA0A 4GI8A 1HILB 4N0YH 5B3JF 2NUPA 1T3FB 2K4AA 5HHME 1MCNA 5IQ7H 3U7AA 3U30B 3VTMA 5C09D 3ZDYF 2GJZB 1JZEA 4NS0A 3RTLA 3ZYOA 4BZ2L 4HUVB 4EXKA 4A7SA 4Y19B 2ZKWA 3L4YA 1PG7X 5D5MF 3TEYA 4M7JL 5ETUB 5D4IA 5DLML 2NYZA 4XPHH 3MNZB 4ZYKB 1JYWA 1W16A 1NDTA 5DR5L 2H1XA 2CJUL 2VTFA 4N0CD 4WV1C 3VGBA 4OJDH 1RZKC 1U8MA 3IJEA 4X8XA 2NT1A 5LB1A 2AKRB 5F7HA 2DTML 3W82A 1HOCA 3QIWD 2IADB 1AS6A 1X5HA 1XIWC 2W9DL 3QQ4B 4XAWH 5FHAH 3VXNB 4P2OC 1UZ8A 4ZTOH 2XKSA 2F5AL 4PJXA 4YHIB 3GSWB 1S3KH 3ATFA 4M1CD 4YVUA 3STBA 5IFHH 5JXAH 5D2NA 2YD2A 3MGTB 5DD3H 1BG1A 4PW4A 1D7FA 3P9LA 1PKQB 1DQDH 3V0AC 2QLVB 5C08E 4HOMA 3BVXA 4DP5X 2ZSVB 3QIWB 3SQBA 3UZQB 3IMUA 4LDCA 2ZP8A 5EU5B 3O4LB 2JI3A 2Y7SA 3IGLA 4ZUSB 1CD8A 1TO4A 4TVPE 5IBUG 1VADB 1LNUB 3EDJA 5FDYA 3F5WB 1RJLB 5A2CA 3L9RA 2BVOA 1JPFA 3UPCA 1IRAY 4AQ1A 2PWEA 5I5RA 1XF2B 1YN7A 2E27H 4YHYC 1R3HA 1PZ5B 4LNRA 4OZHA 5A16A 1E6OL 2VDML 2FEJA 3GSNH 2XG4A 2XQBL 4X6DB 3DHMA 3ZGHA 2V6HA 3O6KL 4L37A 3QCUH 1OW0C 5FOJA 2R69L 1HDMB 5IBTH 3T4AA 2L7EA 4HIPA 2FECI 2E7MA 3IJYB 4JG0H 3UAJC 1P4LB 3VFTA 4HF5H 4HUUB 1N5AA 5DQ9B 3DWTA 3FCBA 4PI0A 3TT1H 2AXGB 2WGXA 2DWDB 1BMWA 4N9GA 3G7TA 3KCPB 1SJMA 2EXWD 2E6QA 5ISZD 1P7QD 3FTXA 3UO1H 3S2CA 4GT0A 2IPTL 4HJ1A 5E9NA 3VCLB 5TDOA 3H0TB 5L8KB 5KVEL 1PZBA 1WICA 4IRJA 1LEKA 3HZYA 1RY7B 3VSUA 3KAAA 4PJIA 4XCNB 4JG1H 1NEPA 4Q6YA 2ZF8A 3TO2B 1JDDA 1SF3A 2NX5B 3MLPA 2BY1A 5ISZB 1CGUA 1ES0B 1KIQB 1P7QB 5C70A 4HKBB 4LCIH 1I9IH 4IU3B 5BQ7B 5F1KC 5EU7E 1WUNT 5SX5K 2XIBA 3WEOA 3MMEB 4HEMA 3P9MA 3ZMRA 5KVDE 5FYLD 3CFCH 2WBWB 3HMXL 3K2UL 4JFFB 3DX9B 4XMTA 4CVXB 1AXSB 3U4AA 5GS1C 1CT8B 5DVMA 1P7HL 1JNNH 4NBZB 5I16B 1VGKA 1CDIA 3V4VB 2OXHA 3CXDH 5DJ0A 3DPDA 2Y1VA 5JMOC 2EJ1A 4HV8A 4Q6IC 1YMMD 3F7RA 3WD5L 3UCRA 3BQVA 1YDPB 1JRHH 4YUEH 2BNUA 2VM4A 1H6TA 2ITCB 3UBXG 1DN0B 4LCUB 4DSYA 2ZYSA 3HE7A 4BFJA 3IDGB 3EYSH 1Y07A 1KJMA 3PQYA 4HJIA 4QRBA 2DV6A 3SGDH 3U30C 4EO5A 2VDOH 1N64H 4TULH 4B95C 4LSVH 4BSVB 5EN3A 2AQTA 3VE0B 1LE5A 4JHBA 2V17H 5GRUL 1DQIA 2Z7WA 4XE5B 5DK3A 5BNXD 4FHKA 1MWAL 5T3ZH 3IJHA 5FCSH 1EJ8A 1QSED 4EI6B 3KGRA 4L4TE 5DK0A 2BIPA 3UH8A 1J9TA 2BP0B 3ZQ9A 3RDTD 2FQEA 3QDJB 4L3AA 4MAUH 1CDBA 2BINA 4H2AA 1FLRL 4Z23A 4JFPA 3SDYH 1IMHC 1CLOH 4I9WE 1U8HA 5IUSA 1CFTB 4PJ5D 4I85A 3AQXA 2IH3A 4N0CC 4HAKA 5AVYB 1WFOA 3MREB 1AYRA 1V3LA 3SDXE 3RDTB 1HWGB 3Q8EA 2ITDB 4LKXB 3KMDA 3KYMA 1TEFA 3QIWC 5IMLA 1DEEA 1WITA 2DWXA 1S9WA 4PJ5B 2FL5A 4B96A 5I6LA 2CLRB 3P1VA 3PS6A 4D2NA 5MEOA 1K2DA 2E46A 4OF8A 3IEAA 4M1CC 2DMGA 4PJBE 3GRWH 2YZ1A 3SQOH 1H9DA 2WIIA 2KLTA 5KJ4A 4CVZB 4WUUA 5HTSA 3RL1A 2GI0A 2R29A 5CMAA 4K23L 1NFDA 3JXAA 3MFFA 3WNLA 4LPYA 4MA8L 2Y22A 7FABL 1G7LA 3LZFH 4QRTB 2CBQA 1JOIA 4KXBA 4NHCL 4QTIL 3ZKQD 4MCZA 1KXTB 1T03L 2VLRE 1FSKB 3U2JA 2NW3A 4RFEA 1NIDA 4KRLB 4V2CB 4OBRA 2LTQB 1JYNA 2CUAA 3GHPA 4P0DA 5E1IA 3LNEA 4Q4IA 2ENJA 3HC3L 4Q14A 1DSWA 1QLRA 2VDRL 1NDGA 1B4LA 1UJ3A 5AVRB 5I6XC 1S7RB 2R0ZH 2DLGA 2ZOUA 5K5YA 1AHMA 4K8RD 1CDUA 2WVTA 5IQNA 5D7EA 3C5SB 3BGAA 4NZTL 3HPLA 5F1SA 2N0KA 1HJBC 2VUYA 1I7ZA 1NC2A 2ORBH 2VXUL 4Z18A 1TTCA 1CGSH 1J1XH 3EOTH 5IQLA 2W94A 3OJMB 5CHNA 4MA7H 2G9KA 4RSVA 1GKOA 4H25B 4JL2A 3IDJA 3HB3B 2X1XR 4NKOB 4Z7UF 3ZZQA 1MHHB 4MDJB 3MNMA 4RMWA 5ABAA 4H8WL 3T0VA 2P8LB 1G7IB 4HHAB 1AGDA 3RHWK 3EJYD 3FSVA 3UTZB 5JHLL 5C2UB 1DSFH 3VSQA 4YE0A 3AADB 2Y36H 3L2MA 5GS3A 5ID1B 2EXWC 3BE1L 4GP5B 1JMXA 2A73B 4MD4A 5K59E 4JUSA 1VB9A 5GGVH 1O7SA 1JE6A 2AAAA 3KR3L 4LBEB 2RR3A 3IMTA 3WBDA 4HG4J 2B20A 2ZG3A 3MV9A 3BLBA 3IVKA 1NFAA 3WLBB 1NGWB 3MRMB 4FCAA 1S7SB 2EIMB 5EC1B 3JWOC 3DHJA 3FK3A 3UAFA 4AV5A 1MHPL 3DRQB 4RGOL 4AX3A 3G6JA 5LAXA 3DXAE 4FKEA 4PRDB 4HKXB 1L0YA 1RZPA 2DMBA 1PDKA 2BWQA 2Q9OA 3FTVA 4BZYA 5FC9A 3PJSB 3X13A 1C16A 5GSRA 4HS8L 2TAAA 2ZX9A 1FIGH 4QRUB 3P73A 2G2NA 5IOPB 5ANME 1MLBA 3TBVB 1WP6A 4QEGA 4N3TA 4Y5VA 3B3BA 1FBIH 1UWFA 3CVHB 3QO1B 1AQMA 2V8MA 4PTTA 5L2KE 2PTTA 3L3OA 4TUKL 1MFMA 5T1KA 1AGEB 3V0GA 4DGIH 4XBEL 4E9RA 4NZFA 4ZO7A 4MLIA 5FDWB 1S7QB 1U3JA 4X5XA 1EVTC 4XP5H 2EIEA 3AS2A 1SBSL 3GBNH 3Q1SL 5GS2H 3D0AA 1WGOA 1ZDQA 4QHNA 1H15A 1SMAA 4AXWB 1A7PL 1JPEA 3DTUB 4X5RA 4CMMB 5JDJA 3IBEA 4NHUA 1OZUA 3IKCA 2D7OA 4PRPD 3THML 1R3JA 2AK4A 4EUPA 2Z8SA 1A7QH 4QO1B 5I8EB 5K33A 2QVTA 1MCWW 1UD6A 1ZDSA 3FTGA 3SY6A 3AREA 4JNXA 2YKLL 3HLAA 4G1EB 4KU1A 2D31B 4TXVB 5I75B 5L4MA 3TURA 2IANE 3KPRD 4UDTB 3RDTC 3WKMH 1PSKH 1T7VA 1NFIA 3F83A 1YA5A 4JFSA 3I9AA 4TSCL 1F6AB 1EXGA 2GCYA 4NPJA 4WTZA 4DK6A 4GI6A 1XCTA 1F11B 1UJTA 2F19H 3KS0J 1OE1A 2NNAB 1LO4L 2IQ9L 4RQQB 1IGTA 4YHZL 1JYXA 4FP8H 1GGIL 2BSTA 3KPRB 3TA3D 4Y4KA 4ZMZA 2WWMD 1LWHA 3TJEL 1JGEA 3QC5X 4F7EB 5AW0B 3WI9A 2BIMA 4LQ1A 2OCCB 5D5ME 4QRQB 3V5KA 4RIRA 1YEKL 3S3DB 5AW5B 3AAZB 2WSDA 2C1OB 1A3LL 1UC6A 2NSMA 3POHA 2EILB 4XX1G 3ZE0B 1WZMA 3DNKA 4QT5B 1FFNB 4BKTC 3HG1B 3FT0A 5BZZA 2O5ZL 1F8TL 1RAMA 4JFHE 2LTQC 4UV4H 4Y2LA 2A77L 4OD1L 2F1AA 3FRPG 3SBWC 3TP4A 3FO0L 4WEMB 2DQIL 1J10A 4Q2ZA 3NFNA 2B1AL 5DU7A 3JZ7A 4N8VB 4GSDH 3HC0A 3BP7B 2A99A 3KPSE 1T4WA 2W0FB 2X44D 2IEPA 1UASA 3DHUA 4FXKA 4GKOA 3SQRA 2ZSWB 2OFQA 3NFPB 4BFRA 1SYVA 1YQVL 1ZVSA 4S11A 3NH7H 5B38A 4ODWA 3WFBL 1BD2E 4QRPA 1NWOA 5C0BB 1DUZA 1EO5A 2VDLB 3CHSA 3D3VD 3BKML 4JRXD 4AL8H 1VGEL 2YC1A 3ABZA 4K8RC 3WFEL 3M8OH 1IE5A 1P6FA 3DJTA 5KAQG 1QQDB 2YEZB 4XVTL 1D9KD 3OKOA 1SXAA 4U6XB 1NZRA 3PFQA 5AUMA 2MNJB 3CMOL 4B9GA 3QJXA 4HWZA 3CH8A 5ESQB 4Z95L 2F54A 3EJYC 4YDLB 3SOBH 2WKLA 1GC1H 2ZG2A 4MA1B 5CGYC 2R1WA 2MTPA 4UOJA 3ZBMA 2P42B 4UTCA 1OGAD 4LDEB 2FEDD 3GPEA 1TTAA 5CN2A 4G8FA 4AMXA 1X5YA 4DTGH 1Y7VA 4LSRH 2VXVL 4PAZA 3MRIB 3U4EA 2FK9A 3QIUA 5GPRA 5CU5A 2HUHA 2MCG1 3O2DL 3CSPA 1TFHA 4H4NA 4Y5YC 4W9FC 4JFOA 3T2OA 3UMNA 3KYNA 1NJ9A 3BWSA 2WP3T 1FZMA 1SBBA 3GSRB 3SDAB 1QBMH 4MA3A 4URKA 4AMKL 2LGNA 3Q8AA 3QZNA 1K4CB 4DGYL 1E28A 5JIPA 3HE6A 1CL7I 3JV4B 4FFYL 4BCYA 2QELA 3DJ9A 3QHZL 2K9UA 5C0IB 3UO8B 5JW4M 4DN4H 4JR9H 5TGBB 2N3JA 1OLZA 2G3ZA 4L3FA 5K9KA 5HPMB 3R4RA 5TE7H 2IPKA 3BP5B 3JWDH 1X5AA 3ASWA 3QG7L 4L4VE 2LHAA 3ESPA 4EKXA 4AQEA 4A6YH 1M7IA 2BSRB 3ARZA 1PFCA 2AGJL 2PN5A 4OF0A 2C9SA 3FU0A 1N6UA 1OPGH 4G9FE 4BUQA 3OMAB 1UFGA 1E4WL 1MELA 5HGAB 4MJ6A 4EVNB 4JM2D 1GGBL 4FTDA 3I2CH 2IAMB 3M46A 5T5FA 5AFAA 1KTRL 5I75C 1RIVH 4YGAB 1OAZL 2OJEB 4NRYA 2VLKA 2V2TA 3ULUF 3UMTA 3RWHB 2P80A 4QMEA 3QIBA 2SEBA 5AYQA 4D0DB 4E42A 4AIZB 5F1NA 4D9QE 4WNQB 1MFAH 1YPZB 2ICWJ 4NQDB 2Z31B 3KPTA 4PREA 4MBRA 3W11D 5LGHL 1MIEL 1LO5B 1UXSB 4JPWH 1SEBB 4P5TB 4XOAA 1MJUH 4KBPA 4WW1A 4Q0XL 4YDVB 3R0MA 4F37F 3QEGL 1F4XL 4GXFA 3VD5A 4ZSOB 3S34H 3ZQXA 3B9KA 2HB0A 3ME0B 3FUMA 5T33H 4R0LB 3FH5A 1MXGA 2KH2B 2EH8L 5L4JA 3T77A 1A2YB 2YN5A 1D6EA 1RUKH 1XF5A 1PJWA 3GIZH 2YLHA 5E2UL 5I28A 4CUCA 1L9PA 2OYPA 2WWMC 1KY6A 3FFCD 2H6UA 4PBVC 4UNUA 5I76B 3DBXB 2Y2WA 5MP6H 5EBMB 5B1KA 3NPSB 4HIJA 1KFGA 3NIGF 3BKJH 3OSVA 1YCSA 1I1YA 1K4DB 3LRSB 4M62H 5KYWB 4I1NB 4HUNB 2H9GB 2PW1A 3V52H 2HP4A 2NY4D 1UM6L 5GGUB 1DE4B 5GZND 3GUTB 1PD0A 3FFCB 7PAZA 5MERA 1LE9A 3MBED 2DY2A 1ZCRA 3IDXL 2Z7YA 4ZUVA 5E1HB 1RZGB 2VRAA 3QCTL 3X17A 5FYKH 4R84A 3OHMB 2DLFL 3WFCH 1DVQA 3LN4B 1OPOA 1WIOA 1EEZA 1I7UA 2WNKA 3PDOB 2V0AA 4PB0H 3S36X 3ZHLA 1TVDA 3QWNA 3SY0B 1SVZA 1Q9LB 3C6SB 2O61B 1ZTXE 5EG6C 1CIDA 2B4CH 5D7KD 5DRNB 2AQPA 3JZYA 3MLXL 1GAFH 3LKPB 2F58L 3UG4A 3CNKA 4GSQA 4MB1A 4Z3GA 3DGGB 4WI6A 3KHOA 1RZ7L 3NDYE 4LHUA 5IHZB 1D9KC 1FVEB 3ZYZA 2P52A 3CHXA 3CFEA 4YDLC 1CFSB 4XP6L 3UPRA 3KYOA 3FT2A 1QLFB 2FCBA 2KT6A 4QXTB 3F7VB 2J5WA 1PG7H 1HKLH 4YL9A 3NABL 1TTRA 2G5UA 1UWEL 4YXLL 2D7TH 2P5PA 3C75A 3P3YA 1ORSA 3S88H 4R4BA 2N56A 2VZUA 3FU9A 2IAAC 3RWIA 5CBAA 3GSVB 3VWJA 2BLFA 4QPEA 4P2AA 1C5DB 4LOVA 2WN2A 1SHSA 3HZVB 5HGBB 3I02A 2FEDC 2VNCA 2AJZB 1SY6A 3QJFA 3QXDB 2EDHA 3GBDA 1AFVL 2HJKA 4J2XA 4LL4A 4OGXH 4PJGF 3X1EA 2EADA 5I8OH 3MRRA 2PW2A 3FFDA 3QUYA 4Z7UE 4C56B 5L4FA 4ONGH 3SDAC 4CJ1A 4WEBH 1FA4A 2H1PH 1VEMA 4TM9A 5EO0A 1J1PL 2J3SA 4ANKA 3OR6A 5ACLA 1NGXA 4Z3JA 1Q0YL 1BQUA 3ZE2B 3KM1A 1SN0A 1YEGH 5SWQB 3RZWA 3QNXA 1JWUA 3GMMA 5KG9B 1MFDL 2EECA 1F3DJ 3T4YB 2EE9A 3NSYA 3IGAA 5BVJB 2UZIH 1NPUA 1OOAA 3U48A 2DF3A 3F58L 3GJFB 3NSCA 4Y19E 2VMEA 3QUKA 3FTZA 3ULVL 4IRZL 2EIKB 4YPGA 4EI5B 2XV6B 1K8DB 1JV5B 4XH2B 1NDMB 2VRQA 4PJ7A 4CMHB 5JNYA 4R7NA 1KNOA 4XNYL 2OMXB 4BWTA 5INCA 3DGCR 2MQ0A 1BZEA 5EA0H 2I5YH 4G8IB 5IIEB 1U30A 4H1LB 3MV7E 1ZTXL 4GMSL 2O6FA 3FQ4A 1ZPLA 2VL4A 2IAMC 1MREL 2B0SL 1I8MA 3S96B 3WJMA 5DF0A 3FQUA 4TQ8A 2QZ5A 3RWJB 4AIOA 2F18A 3OX8A 5HDQH 5I6MA 2B2XL 2JLPA 5FM8A 2VN5A 2X88A 4UTBL 1U2HA 3K6FA 5EIVA 3VXTA 3JWNE 1JGUL 1EO8L 2Z31C 2YPVH 2SODB 4FFTA 3VXRE 3W2DH 3RAJH 2E9JA 2V7NB 1PKQE 2C7UB 1M6UA 3ARDD 1W0YT 3QK0A 4P2QE 4KDWA 4J7RA 3F7YA 1O7DE 4HJGA 2R4RL 3B2XA 1HI6A 3MV11 3NCJL 1W0VA 1GGYA 2AXHA 4R0LC 2EE2A 4JMNA 5J4MA 3TS8A 2Y0SA 3W11C 3GSUB 1QRND 2O4EA 5I9QB 3FBQA 2ADGA 2HVKB 2YR3A 2MEJB 4MD5A 1U3HD 1CXFA 2VLJD 3B2VL 3G6AB 5I66A 2P7TA 3EYVA 1BEYH 1ZIBA 4PY7B 1W72B 3WTUA 2ADFL 2Y72A 4R9HA 4ZW5A 5DJDA 1AHKA 4K3DL 1EQWA 3TIDA 1QRNB 1TMCB 5E2WH 4HWNA 1BF5A 5I2IA 1IFHL 1U3HB 5FYJE 2VLJB 4Z78B 3QRFM 5FW6A 2COVD 4K7PL 1Q9OA 1OARH 3O2WL 5F8RC 4G8GE 3PHQA 1MH5A 5AAPA 1RVFH 4OI8A 4OLXH 3ZT7A 2Q5BA 1KBVA 4RFOH 4GRWH 5AAMA 1TJMA 1D7BA 5HDOA 5J13B 2GK2A 2NUPB 4UBDD 2ZPKL 4XOEA 1DO5A 2BDNL 1A6WL 3C08L 4F9LA 5L88L 3RU8L 4OLWH 3O41A 4KQ4H 4M7LL 3ZK0A 3ZXAC 5D8JL 4EZJA 1HQRA 4FNTA 4ZPTA 1KGJA 4OGZA 3AS3A 4U3CA 2Q20A 4OZFH 2OJZH 4IIQB 3MO1A 5C0FA 5IROA 1U8IA 4XPBL 1KJ2A 2VLME 2VXSH 4EQ3A 5I24A 3QWRD 3MA7B 4F80A 4BXSV 2HKAA 5IW1B 3V4LA 4D3CH 3CN0A 4K9EL 4UT6L 3VJ6A 1CIUA 4QOKA 4LVHB 1HOCB 1IC7L 3D33A 5KBDA 3GWJA 4K07A 3ETBF 3M1BB 4PJXB 4WI4A 4NQEE 4XZUB 4J1UB 4JFFE 2BRRL 3FUIA 5D2NB 1QVOA 2HVJB 3LPPA 3QARA 3EZ8A 1P53A 1XGZA 3WKPA 2BOCA 3DDFA 2FWUA 3LH9A 2XX0A 4OCXL 3SQBB 3WUWG 1AZNA 2VDNB 4LRNH 3K1KC 1BM3L 1LP9A 1L9MA 1RIUL 2ZP0T 1GL4B 5IHBA 2W0PA 4XNZB 5C7XL 3NG5A 4U6YA 3KG5A 3TONA 2FHBA 2BVOB 2ARJQ 3SE3C 1YPZF 4AQ1B 2JB6A 4Z6AT 1YN7B 1KBBA 1R3HB 4OZHB 2Q8AH 3HHRB 5FYJL 4WFFD 5DEGA 4YDIL 1NPJA 2NCMA 4LU5H 4LARH 3SKNA 1YYLH 2XG4B 3PF2A 2FWOA 4JGUA 3B2PA 3IAQA 4WCYH 1WA2X 3B5GA 4L37B 3ATAA 5FUOH 5JIHA 2NR6A 4P48A 2PABA 4EI5C 5KVGL 2Z1KA 2BS71 2D3LA 3H2PA 3T4AB 1FL6B 4RRPG 2BNQA 4JJHA 4ZFGL 5D2LB 5ILTL 3S8GB 1U8CA 1BBJB 3AC0A 2CK0H 3VFTB 1GOGA 2EYSA 3D4GA 2R4SH 3F62A 2XVBA 1O5PA 5CJ5A 1TSHA 4IRJD 3QDJE 2JF1A 3T2QA 4FEMA 1U8NA 3IFNL 4BHUI 1AQDB 1VLXA 4UTAH 4IOSA 4OBSA 4GH7B 4KQ3L 4N9GB 3LQAH 1CBVH 2RACA 5SX4I 3FOMA 4HIXL 3Q44A 3QQ9D 4U3HA 4PJHA 1UWGH 1MIML 1UKTA 3CE1A 4MJHA 5TDOB 3MLZH 1RU9L 4GW1A 1LEKB 4FKKA 3FU5A 4GKSA 3P3UA 4KVCL 4PJIB 2J6EH 3IPEA 3BD4A 3EO0B 4XMKH 2AMUA 4P3DB 1T6WA 1H8SA 4DVRL 2X4RB 3WTXA 2FT7A 3L9BA