3JT0A

Crystal structure of the c-terminal fragment (426-558) lamin-b1 from homo sapiens, northeast structural genomics consortium target hr5546a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
TGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target HR5546A
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Lamin-B1
total genus 15
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00932 LTD Lamin Tail Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1260 Mainly Beta Sandwich Immunoglobulin-like Lamin Tail domain 3jt0A00
3UMNA 1IVTA 2KPWA 1IFRA 1UFGA 2LLLA 3JT0A 3GEFA
chains in the Genus database with same CATH superfamily
4D9QD 3MOBH 2P48B 1XD1A 4P2RE 2XG5A 4F8QA 1E27B 5F9OL 5FO8A 1BVNP 1T03L 4YDLB 2AITA 4N8UA 5CGTA 1KYOJ 5T5NG 3B34A 3VXTA 4FLOA 2KBGA 3QIWC 1M9SA 2JIXA 1MY7A 3ARGD 4ELMB 2H1XA 1HXYB 3B37A 4XO3A 4PJFE 3FO0H 1NAMB 2HFGL 2B8OT 2FWOB 3OAUL 4EUPA 4P57B 3SKUD 4NJAL 1WQVT 1X9LA 3S5LA 2RFXA 2W9EL 3P73A 1UOWA 2ZPKL 5DMIH 1MCNA 4KQ3H 2OR7A 1CGXA 4PVLA 4W9FC 5DJAB 5FGSA 4DEUA 4WCYL 2E6QA 1CT8B 2X3AA 2CCLA 1BFOB 2CLVA 4LKCB 3OPZL 5C3TA 3FJTA 4ZPVA 2O5XL 3KCPB 1WC7A 1QUNA 1GIGH 2OMXB 3DV6B 3NJGA 2CNZA 1MXGA 5JOEA 2IFGA 1N8ZA 3S97C 1N6QL 3J8F7 4ODBD 2A6DA 2A4CA 5DEZA 2WXPA 3CFBB 2BSSA 4AYDC 5IKCA 1HZHH 1L4IA 2E6PA 1JYWA 2ZKXA 1DUYB 4Z7UF 2P5WB 1Q9KB 4KU1A 4NNXA 4L5FL 3FRUB 5D96B 2FJSA 1RZPA 3OGCB 5DD1L 5AZEH 2VUOA 1MWAH 3MV01 1ES0A 3ARBD 3QAQA 3KPOA 1HCFX 3CDZB 3N40P 4KHXL 3WE1A 1IGJA 2DQJH 4KAQL 4LARL 1E2ZA 4XOBA 3DDGA 4H25B 4MB3A 2VB5A 4ONFL 4XNXL 4IIQB 1JWMA 1MCFA 3WIIH 5CBAB 4L1DA 5DEJA 1QRNE 1F56A 1RP8A 2DTSA 4MD4A 3EDEA 3S5LG 2XKUA 1FVCA 5KN5B 3ULVE 2Y6TE 2J72A 4O9HL 1MCWM 4OD1H 1NOFA 3DOHA 3WFCH 2IAAC 3QQ9C 4WNQB 5E95B 4PJBA 3GZOA 4ZMXA 1KJ2B 2OULB 2RCSH 3QRLA 2Z8VC 1GSKA 4G8EA 4KXZH 4TSCL 4AIXA 1OAUL 2NQCA 5JA9A 2FHFA 4KDVA 3MSPA 3IFNL 2JB5L 2YKLL 5IVZB 2F7PA 3DIFB 4DZ8A 1LNUB 5A7EA 4MNGA 3OJDA 3GD1C 3JQOB 3V5KA 2GKIA 3SPCA 4WW1A 1NIAA 2GJZB 3TT3L 5HHXH 1U95B 3CN3A 2BMKB 5I1JH 1RXLA 1INQA 3VH8A 5GRZA 2IADA 4HH9B 5B8CC 1SXZA 2H32H 1FAIH 5ETUB 3WFEL 2XG4B 3I3DA 4FZEL 4N20A 4DGIL 4OZIE 4NC1E 2FTAA 3S3CB 3SD5A 3GB7B 3P9MB 3BUYA 4EVNB 4PW9A 2B3RA 3HE7C 5ILTL 4D9RD 3KGUA 1CE1H 5AAMC 2K8QA 1HHIA 4HIQA 1B2WL 2OJEB 5T1KB 3MO1A 3QORB 1E30A 2IMNA 3AS3A 5TQ2H 2FX9H 2R69H 3HAEB 3FB6A 4BJLA 4X7SH 5GHWL 4A2DA 1BWWA 5KYNA 1A4KB 1JZ6A 3QCTL 4ZQKB 1CFMA 2YPKA 4ZO7A 3TCXA 1EV2E 4MQXC 1ONQB 1X5MA 2MCG1 2W9DH 5HDQH 5T3XE 3IDYB 1MCSA 3RGVB 5J12B 4ADIA 2LFGA 2NXZC 3SGDH 1SN5A 5AUMA 1A6VH 1TSHA 3GIVB 4X5WA 3V52H 3T0AA 1UWGH 4HJSA 5D1XE 3WMQA 4C4KT 3WEAA 5CGYC 1XSKA 1JPGA 3BSHA 1MG2C 2WIIA 4OGYL 4PY7A 4H5SB 1E8XA 2GAZA 2IFFH 3CHPA 1TZIB 2Q3XA 4AVHA 1QI4A 4HK0B 3DETC 3U4KA 2CO3A 3MRMA 3H9HA 2UXGA 4CL7A 1N0LB 3UIZA 4PM1A 1WVZA 1LQSR 4KKBD 4MA7H 1G94A 1PZUB 4XMWA 2ZYIA 5SWZB 5AD0A 4KV5E 5IW1A 1CFQB 5KVFL 5GGVL 1YJDL 1TCRA 4DP2X 1R5IB 4BCXA 5BO0D 3TIDB 4F8LA 3TCLA 4X7SL 5GHWH 3VACA 4LKXB 4NC2B 1ZTXE 4XNQA 3VRIB 4UQ9A 3ULSB 1O0VA 2SEBB 1CLYL 4HUWA 4BSJA 1C5CH 5HD8C 2K6WA 1KEMH 3MRJB 1RIUH 4F7CA 5JPNA 2NYZA 1SF5A 4KTGA 5J8OA 2L04A 1ROWA 1R3HB 2AXHA 2GTQA 4JPQA 1D5IH 2UX7A 3VXRA 3FQ1A 2AQPA 1UVQB 3GSWA 4GP4B 4X8CA 5AVQB 3WEOA 4BWUA 4FG2A 1LMIA 1I8LA 3LN5B 3QZWB 5B7EA 5BVPH 1NCBL 1HNGA 4QGTA 5I15H 3K71A 2AV7B 3WHXB 1WWCA 2JELH 2O30A 3S48A 4URKA 5DMJB 1HEZA 2C1OB 3M1BB 3EJTA 5AVTB 3BLPX 3CLEL 3VSTA 3JV4A 5JR1H 1C8PA 3F12A 3NN8A 4KQ4L 3TV8A 4NHUB 1J10A 2YIHA 4IGBC 3T4YB 5HI5C 5F3BA 3ZDYB 5J4MA 4JDZA 4NQCD 1EHNA 1HE8A 1JFHA 2E74C 3ILDA 4H8PA 2CKBL 4L4VE 5EO9A 5EWIH 2E27L 3HG4A 2GK0A 5D4HA 1EEQA 1F1DA 3G5ZA 1R5WA 4PJCB 1N59B 4AYFA 4B60A 5DUBB 4DK3A 4HG4K 4YSDA 2FBJH 3ALWA 3E0GA 4XMLH 1EFXA 1NSNL 1U8HB 4IGBB 4FQIH 3C08H 2XICA 4UM8A 3FSAA 4HKBB 2JLPA 3OLDA 4CNIB 4AGLA 3QWQB 1ZS8A 1Q94A 5LGJA 4U1HA 4OQTA 3L6FB 2E7LC 3N40F 4Q9BA 4NKIL 2OTWB 1ADQL 1VEOA 2PPCA 3I6KA 3O9WA 3ZKSD 1G5GA 2FHBA 4PPTA 1VFOA 3SDDD 2HWZL 3ASOB 1SXCA 3HBQA 4TQEL 3VFGH 1ZS2A 2XFXB 3C09C 3THML 4B9KC 4EDXB 1WD8A 3VTAA 1DQJB 1EK3A 3VDAA 3DPBB 4R4NC 4GKNA 2NW3A 1JGVL 1EZVX 2VL5A 4E5XB 4DPAX 4F20A 2H45A 1SBSH 3P2DA 3I50H 4RGOL 2R23B 5EEYA 3CFIC 1T04B 4WTWA 2VZVA 3V8CA 3C60C 2A6DB 5FM5O 5IHLB 1R6VA 4QRUB 1XWVA 2EE0A 3RE0A 2AQRA 4JAMB 3P40A 3VW3H 3RI5K 3OHXA 3WIAA 5EOQL 1CL7I 4KMLB 4RNRB 1NUGA 4L8DA 5KG9A 3CPLA 2F7OA 3C2AL 3QZOA 5F6IC 4LVHB 2XX0A 1RSFA 2R0ZH 1R75A 3QI9A 2B1AH 4HW6A 5J11C 3TOPA 4MLSA 5DS8B 2EKSA 1BEYL 5CCKH 3ZOAA 3WIHA 1E90A 1VEMA 4PJXB 2J5LB 5DJCB 3TBYA 3UTTA 1F18A 3ULUC 1I9RL 3NCMA 2NY3B 3STZA 3MV8D 5DA0B 1XEDA 2X4RA 3FU8A 2FX7H 3VI3F 5CJOH 4DUVA 4G5ZL 2IC2A 4NQDB 1CICC 1E4WH 2QTEA 4M6ML 4YSSA 1AD9A 3MR9A 4BSWB 1KPRA 3UTZA 4AENA 1JV2A 2ARWA 4JW3A 3K80A 1HJCA 1KIUB 3WFEH 4Q52A 3N91A 5KW9L 2CKBA 4KY1H 3PGDB 4M61B 1U3HD 1SQ2N 4PJEE 1JXFA 2A74A 3BGFB 4G7SB 1CDYA 3DJZA 4P59H 3DURB 2YD3A 4XGZB 1AD0A 1HWWA 5IBLD 2IH9A 4PJ7B 5KJ4A 1NFAA 3DRTB 3MRNA 3G9VA 4OFYD 4LDEB 4M3JA 3BAEH 1TIUA 4HT1H 2VDPH 2CGZA 1LO2L 1KB5B 4ZFOB 2BVEA 5LBGA 4XN2A 3SDAD 2ZF9A 4AYMC 3W9DB 5TDPA 1IGYB 3H1ZA 1HHIB 4ZUWA 3GTVA 4C4KO 1FJ1A 4U6VL 1ZLEA 4APQD 2JCCF 3OAZH 2IH8A 3EYOB 1RHFA 5LVEA 2DS4A 3NZ8B 2ICWJ 4IS6B 3FU7A 5I5JA 3IF1B 2YPKB 4PWHA 1MW2A 1JNNH 2IGFL 2I07A 3N42B 2XWJA 3C8KA 3BGAA 3UPRB 4AENB 3DO7B 2VYRE 3BVWA 4G72B 3RNQB 4YZFF 1HKFA 3MN8A 3DSFL 4E36A 4JM2F 3D0AA 1CT8A 1N2RB 2GJ6B 1SEBB 4GMSL 2G4EA 3B3IA 3SPVA 1P9MC 3VD5A 3FT0A 2HVJA 2R56H 3W0WA 1KF9B 2OSLA 5EC2B 3T65A 1IC4H 2JB6A 1YRKA 4WJG3 1QSZA 1ZPLA 1JPTL 4J1UA 4EIBA 3TYFA 3FU5A 5JYLA 1G9MC 4XP1L 5HXMA 3ABLB 3U9PH 4UOW0 2VQ1B 5A2JH 5KVFH 1RHHB 2CLZB 2IDTA 5D1ZA 3MRLB 4G3YH 4AKOA 1VZGA 2Z7WA 2V2WA 3CQPA 1CF8H 3F3HA 3GSUB 3CMOH 3PIQB 3FZUD 1ZLUH 3CFJB 5EU4B 3LEYH 2A83A 9PCYA 3CXDH 3ZYOA 4OLZL 1UUNA 4RMUA 2E75C 1RJLB 1DFBL 3CAFA 3WIHL 4AQ1C 2CGRH 3AAZA 1OV8A 2NUTA 2VXQH 3QUMA 4LVNC 1GOGA 1GGIH 3IPBA 3QFJD 4Y0GA 2EEXA 1FNFA 4U7MA 3Q1SL 1SJEA 2EYSB 4IDJH 4KI5F 3QIUD 4MD4B 4CVUA 1NMAH 2CDGB 2P49B 2YD6A 2VR5A 3RWGB 3W2DL 3QRBA 2V9RA 5EU5B 3UBXG 1NA8A 1IC0A 2V9QA 3MRJA 3ECUA 4F7CB 5JPNB 1S9KC 4ONFH 3FTYA 3WJJC 3UZVA 3F7VA 4G1EB 2QFRA 4PRAB 3CX5J 3IXTA 3HZ3A 3FSZA 1UA7A 2C9RA 2YOCA 3GSWB 1CIUA 3LH8A 2H1PL 3V5KB 1IM3D 1FZOA 5I23A 1NFKA 3S8WA 3KLLA 3IU4L 2R9HD 1OM3L 3V0IA 4LLVB 5BZDA 3VH8B 2K7QA 3CX2A 1GHFL 4YXKL 4ABWA 2R2HA 3RFZB 2CDFA 4AYGA 5FYKH 3WFZA 1S4IA 4PRHA 3R8QA 4X4MA 5EV7A 3UTSD 3EGXB 1YN6B 1JV5A 3F84A 4F15C 2RQEA 2F58H 3DC0A 3FAWA 3IFNH 1KGUA 1RUAH 2XNAA 4PRIB 1J0YA 3FQ4A 3UC0L 5CXPA 3IJHB 4IMLB 4R8WL 4ZS6D 4FQJH 1N4XH 3EG9A 3ARYA 3FQWA 2EDHA 4TL5A 2ARJB 1QW8A 4MJ6A 1Z3GH 5KS9A 3RVVC 2DM2A 5KYYB 1D6EB 3FT3A 4OKDA 5D2LB 3KJ4B 1S7QB 2KERA 1IAII 2EDJA 3QUYB 2VERA 1OF0A 5LDSA 4ODSH 1E28A 3W2DH 2XG5B 3O45B 4R97C 2JLLA 4TVSa 4YHOL 4P9HL 3NSFA 3KBHE 1IGTB 3RB7A 5IREA 1AZRA 1QFUH 2OXHA 3BFOA 5LN8A 1KCSL 4LOFA 4XH2B 4F37K 4XVSL 3QDGE 2IPKA 1C5BL 4GKSA 3GIVA 4YHZL 2JKRM 2EE2A 3REVA 1IKNC 3HA0A 3VD3A 3GBDA 3OHXC 5FWQA 3IU4H 4JG1H 1JPFA 4NZUL 3F01A 5CLXA 2YJLA 4IRSD 4Y5VB 5AW5B 3T6XA 2B4CC 3HR5A 4EE2A 2RALA 4TVPD 1WC7B 2WBJD 3GS7A 2EXYD 4HCIA 3BW9A 3TBSB 1ZMYA 4WKZA 1HL9A 1EVUA 3P54A 2QZ5A 2BDNL 2VDLH 2DWTA 3TBWB 3BWUC 3MRKA 4MXQD 5CP7B 4PGEA 3HE6A 2Z0BA 4F93B 1JZFA 3W0WD 4MQ7B 3FB8A 4I0PD 1KV7A 2D4FA 1JPSH 3QUGA 3GI8H 1KWGA 2QQKL 3TWCL 4NT6B 5C0JA 2SEBA 4LCWD 1JZGA 4IBZA 4ZW5A 4Q7DA 4ZUSB 2ICWI 4PLJD 4IDLA 5TE4L 5JOPE 4OV5B 2IDSA 5F7DB 4YXLL 3OKYA 2PR4H 4L1TA 1MAML 1XSJA 3DMMD 3K1DA 3QNFA 4GO9A 4GW4A 1QR1B 1BD2B 2J88H 1FZKA 3ZN6A 1XCTA 4DWHA 1TJHH 5GJSL 2VT0A 3IBEA 4PJBF 3CCHB 1TEYA 3AB0C 5DQ9B 4AJYV 1PJ9A 1X5AA 5E1AB 1BIIA 2HWZH 1G9NC 3ML8A 1F6LL 4OD2B 3QJZA 1WFNA 2BCKB 3HB3C 1FN4A 1NGYA 2H32A 4PJBB 2W0PA 5D7HA 1U6AL 2OMYA 4XWGH 4EI0A 1JVLA 2Z91B 4IU3A 1CDJA 5IBUG 2J4WH 1VZIA 5DRWA 4AK2A 3NEXA 1IBZA 1E2VA 1EGJA 3F58L 3OKKA 5B8CB 3FB5A 4MQTB 4QOKE 1SXNA 2WCSA 3U7YH 2I25N 1IVTA 4K7PY 3RJDA 4NSKB 3BESR 1INQB 2XKNB 4L8BB 4QXGL 3HFMH 1XGYL 1TTUA 1A21A 2QZQA 1Y0LB 1TLMA 5D7LE 1A8ZA 1OLZA 2MPVA 2XY2A 3GSXA 1UQSB 1MNUL 2MCAA 3ZKMC 2R51A 2R2CA 4EI5A 5DRNB 1ZV2A 3EJCA 2OI9B 4PP1C 2P42B 4LLWB 5KSBA 3EYOA 4OZGE 2L7JA 4NPYB 5I1HL 4OCNC 1VADB 1JERA 5T3XD 1N5AA 1YN7B 2C3VB 4PCTA 1KJ2L 4DEPB 2OTUB 4HV8A 5KS9F 4ODVL 2PABA 1F58L 3D5OF 1KC5H 1NEUA 1FDLL 1P7HL 1CDGA 1N2RA 1KCLA 4MAYA 2JFCA 2IWKA 3QQ4A 5IROC 5LCVL 4WJ5B 4H4NA 2WBJB 1J8HD 3A21A 4X50A 4BFIB 4HX1A 4PY8I 2IEPA 5D71L 1E4KC 2V6HA 1WA2X 2NTFB 2UXVA 5JW4N 2KZWA 2LABA 1SLWA 4H1LH 5JORB 5ESAB 1ZXQA 5TF1L 4IIZA 4G8GA 2FGWH 5EBLB 5AZ2H 1X9QA 2UY7B 3D2UA 5TQ0L 1H15A 3DYMA 5HBBA 3FO9A 3RTQA 3OC8A 3WS3B 3MRLA 2KZBA 3EJYC 3FT2A 3MLWL 1J87A 4HQQL 1QPKA 3E2HB 4I5BA 1PKQA 1UA6L 2GVYA 4GRWE 5EUOE 2A83B 4FLRA 4G6KH 4S1RH 4LP8A 2XBZA 4MRCA 4FKEA 4OGZA 3TF7C 3D34A 3VRLE 3V0HA 1F4YH 4JG5A 2NY6C 4WNSA 2WLLB 3T3MB 1MHCA 1N26A 2H26B 3NPZB 3G5YA 1U93A 2G3NA 3VRLF 4JGNA 4WTQA 1ETZA 1T7VA 3RWGA 4YSPA 3ZE0B 2MIZA 1VHPA 4HG4J 2WMPA 4EF3A 3APCA 5DYOA 3MLSH 1TU2A 3TC9A 5F0PB 1TEGA 3UTZB 3QA3B 1VRSA 3ZT6A 1WFTA 1MFMA 4MB5A 2LU3A 3VFOB 2CA3A 3W56A 1KZQA 3HUJE 3DSFH 2E7BA 1J5DA 1MUJB 5I0DA 4Y4KC 5CJBA 1CGTA 5CZXD 4PJDE 3K0WA 4FI7A 4IEFA 4NQCA 4L4VD 3LNHA 4O9HH 1G9ML 3S3SA 1R24B 3IDIB 1S7SB 2ZOKB 3J07A 1BHGA 5DVMA 3RWDA 4KFMA 4R2GC 3WLWC 4PS7A 4WWKD 1BW8A 1KTLB 5E2WH 3UEZA 4N26A 4AYBA 3EH3B 4P9HH 2P43B 5DUML 4P46C 4IOIB 5FXCH 3WO3B 3LNIA 4XB8A 3OF6D 5K59E 15C8H 3DWTA 4LCIH 3GHEH 3VFPA 2W59A 1MSPA 1DBJL 1PQZB 1SJHB 3HUJB 4PR5A 3T0ED 1XGQB 3DYOA 4A38A 2VGLM 4N5UA 2NY4D 4MTMA 2VXSH 4IJ3C 3NABL 3QIWD 4XH2A 4AC2A 1O6SB 1J5HA 1JHKH 1DVSA 5FO2A 4YDIH 1DQMH 5AVWB 1VCAA 3PJLA 3L7FA 5CMAB 5CCJA 2ADJB 5F88B 2ZOLB 1T0OA 2WAQA 4NX0A 3D39B 1MJJB 3BQUC 1G7MB 3HZKB 2D7QA 3O6FA 2OA9A 1X7TA 1Y6NR 2IV9A 3GXMA 4R2GD 3VYOA 4QRRA 3H2WA 2Y06H 4PJ8D 2AANA 2XTLA 4OF5A 3JSSA 3MV9E 3MJ8A 3UO1L 1JPSL 1LO5A 2IDCA 2K70A 4KOCA 2GJ6E 2MSPA 2Z35A 3MLRH 3QWOA 4I2XA 2XN2A 3T0EA 2A9DA 3QUMB 5EIVA 4AG4H 1N9PA 1BQLH 2CALA 2VN4A 3O4OB 1MAMH 5EZJA 2Y5TB 4PFEA 2P44B 3O3UN 4XX1G 4L9LC 3L08A 4TOYL 4K07A 3QEHB 5KUKA 5EU5A 4Y88A 3VE0A 4GB9A 1JK8B 5KYWA 5EC1B 4MD5A 4MZRA 4LQ1A 2Q8AH 4YFLF 4J6IA 5EIIG 3L7EB 1G9NL 4RFEA 1F4AA 4PHZA 1SN0A 4MJ5A 4OZFB 4NO5B 5I76A 2DWSA 4ZT1A 4TUOB 1UWYA 1ZK9A 3LXBA 4MNHB 2RIKA 3VGGA 4ZYKA 3FQXA 1KCSH 1NMBH 5SWSA 1K72A 1IGCH 3EH5B 3KPRE 4EN2A 3B7UX 3WIIL 3NIFF 4E0RA 5KVEL 4IKKA 4HJ1A 3SYPA 2P1YA 4FFYL 1VDGA 2CK0H 1HYSC 3I3EA 2CIKA 4N2NA 3RZCB 1I1AD 3ATDA 4AQ1B 4XB3A 4R90H 3K6IA 3RL2B 5IMOB 2FIRT 4JN1L 2LU5A 2NNAB 1OE2A 2VERN 1NEZB 2R1WA 3VFSA 3D2UD 2OCCB 2ZNWA 1BAWA 2YFOA 3L5XH 5EBWA 4IKLA 2VM3A 3ZE1E 5D2LA 3ZL4L 2MCMA 3GPSA 3HRZC 4QRPB 3QQ3A 3RY5A 2ODHA 4ZFOA 2F58L 5I16A 5KSBE 2MNJB 2O5XH 4JZJC 3JTSB 2OMBA 4Y4FC 5G5DA 1EHLH 2FJGB 2Y7LA 3ZDZB 1IEHA 1KJ2A 4UTAH 2ZUVA 1OEZW 1CI5A 4WU5B 3INUH 2FB4L 5ESQB 1RLBA 3MLUH 1UZGA 2D31A 3X1GA 3B5TA 1NC2B 2XWBA 3BSZA 3F7YA 4IOFC 4NKDB 1LD9A 2QPEB 2DBLL 5F7KC 3REVB 1BMZA 4J3UA 3RUGB 4OQTH 3K8MA 2I9TA 2YXFA 3IDXH 2GIYA 2MOGA 4G9DB 3TJHC 2IADB 4RBPK 3RKDD 4KVNL 4MHHI 2MFNA 1D5MA 1J1XH 2BNUA 2ZTBA 4FL4B 1DQKA 2CJ3A 1EEZB 1IAKB 2UY7A 2EDWA 4XP6L 2DF3A 3W0WB 2YK1H 5J11B 5HYJD 1MVYA 3AU1A 3BPLB 5GGSB 3V4VB 1I7RB 1NAMH 5JUEH 2OJEA 4RFNC 3BVNB 5T1KA 3ELQA 3SD2A 43C9B 2XZQL 1I8AA 1QR4A 3TYFB 2BW5A 3BE1L 4LVOB 1TQTA 4B9YA 5JXAL 5FOJA 3GRBA 1YPZA 2BVOB 4Y4FD 5DD5H 3UTSB 4QNPE 2ICEC 2D3NA 4GUPA 4PJ9C 4G83A 3LD8B 3UIYA 3EBGA 3BGMB 1JYNA 5HVFB 1XMWA 3C6EA 1Q9WA 4ZBJA 2Y5EA 7FABL 1GA2A 5JHDB 3VVWA 5BMFL 1AKJB 3WKPA 1KTDB 3C9NB 5LQBL 3NFSH 4L9DA 1AYRA 3BN3B 1Q9LA 3NIDE 3JWNC 5TD4A 3SYOA 2VL4A 3V0DA 1U58B 4LIQE 5INCA 1M71B 3ZSSA 4LBAA 1TQBC 2YJQA 3C6SA 1BX2A 3ARGA 4Q8BA 3DGCR 2EQDA 3VWKC 4Y19B 2I7SA 4PS8A 1FYTB 1ED3B 1T0MB 2LTQC 4D9QE 1ROCA 5ESVA 1KCUL 3H7BA 4LAQL 4M1CC 1PD1A 2GTWA 3FBQA 4MA3A 1ZLWH 1C08B 3MKGA 1Q0EA 1VZHA 5DURB 1N0LA 4GMTL 5B8CA 3MLZL 3FB5B 4ZFGL 3QWRA 5E1QA 3I6LE 3FQUB 3WLBB 1AR1D 4KMTL 5KVGL 4O02H 3B8YA 5DJYB 3EOTL 2CHNA 1WHPA 3EYVB 3EH1A 3TNMB 2VDOL 3AXHA 2XZQH 3ARFC 4XODA 4IIQA 2CUHA 3O2WH 1RKRA 2B77A 3AS1A 2YD5A 5CCHE 3IEAA 2VIRA 3O2VL 5L9DH 1OF2A 3IGAB 3FYIB 2YRPA 5BW7A 1KB5H 4HUWB 2JNZA 1UXSA 5LO7A 4N2FA 2HKFL 1UATA 1T21B 3LYRA 4XMTA 5DJZB 3GI9H 1N5AB 2DKUA 3MCYA 5I28A 4U2YA 5I1AA 1MWAL 2C3HA 2CR0A 4L48A 4RBPH 4ZMAT 4DZBA 1B4JL 3NFSL 1PY4A 4CC1A 4FADA 3WNNA 5HJ3B 1GJIA 4IHOB 3RBGA 3WBDA 5I1KH 5I30L 1JNHA 4PN6A 4I85A 3D0LA 4HCGA 4KRPC 1UADC 2WBJA 3KM1A 4XPHL 3VRJB 1KB3A 2P8PA 4CVXB 3QORC 4HWZB 5FA4B 4GOSA 4YEFA 4KQ0A 2ZOLA 3HMXL 3LSOA 4M6OH 4WDIB 1QO3A 1YDPB 1P7BA 1YJDH 4DNLA 1PYWA 1IGMH 1URZA 4UI2A 3NBNA 2RBLA 3HZKA 5GQBA 1QEXA 3PL6A 4HEPG 3VI4A 1S9YB 1G7JB 4PJGE 2CUIA 5EEUA 3S35X 5INDB 2YGPA 5IW3A 4JRXD 1S7VA 3FO1B 1KGCE 1A47A 3BPLC 3KD4A 2VTFA 4M6AA 4MS8C 4YSCA 1XH2A 2Z35B 1I4FA 4PV1C 1T7XA 2VR4A 5DD6B 1AXTH 4OCYL 4OCMC 4FXGC 3II1A 2AJYL 4O4YL 4XN8A 4YR6A 2QSQA 4YDVA 1URIA 4NC0B 1N19A 3V0GA 2DYPD 4P3DB 1WCQA 4AW7A 1U8NB 4EI6A 3F7RA 5C09E 2PCXA 3PWVB 4ZD3H 4PYHA 2WVVA 3SCMC 1TU2B 4W4NA 3X1FA 3NA9L 2YUWA 3GK8H 4UT6A 3EYUH 5HTSA 1FAKT 2NW3B 4OCSL 1MF2H 4F1SA 4ZMPA 2N0KA 4ZK8A 1UEYA 3ZR5A 4U05A 1N64H 1T2QL 3SJVB 4F15B 4APQC 3IYLW 1JYVA 4DW2L 4Q4IA 3RIAF 1SJXA 4X5PA 4W1TA 4QRUA 4WFFE 5KEZA 3ULUE 3R1GH 4JJ5A 3A24A 4X99B 5CCKL 3CUPA 3BVDB 3CLFH 3E8UH 2R69A 2AQ1A 4KJQC 3SKNB 1IILE 3MXWH 4KX9A 4WV1A 1RURL 4WWKA 4MCZB 2JKTM 2VDQH 3T8XA 1PLAA 2Q5BA 3NFPA 3QO1A 1NC4D 1EEYA 3NT0A 3VXPB 1YEFH 1G6RB 3CSYA 3FONB 5E5MA 5IVXF 4K5LA 4ELDA 4KITB 5K9JH 4Q6IC 4Z7AA 1UCTA 2OMZB 4L9LA 3Q2CA 3W82A 5I74B 3F7KA 1ZEAL 2P5PA 2EKSB 5DF0A 3QHTC 1T80A 2FAUA 1HILB 4EMZA 4BWTA 3CZUB 2GW5A 4FXKB 4N6RB 2NLJB 5MERB 4O2FA 3EUDA 3MLUL 2HPTA 2WLZA 4P5TB 5D7SH 2BY3A 5G5DB 1H5BC 1GJWA 3PYCA 1X5GA 4G5AA 2EJ1A 2FNBA 3OVUB 2FCBA 2GQHA 3FRPB 3J7HA 2VLLA 3Q48A 3HHRB 4LRIC 2A9NL 2DRUA 3I85A 2ZCKL 1FO0A 4RZCB 3U2IA 2R2EB 3DHJA 2G75B 4F7PB 4NHUA 2OLDA 2W94A 3RUGA 4JZNB 4JQVA 3UC2A 5F3BB 4HJUA 5A1AA 1TQBB 5FYJD 1BBDH 1ZDSA 3QCUL 2YMOA 4Q74A 2QT6A 1NQBA 3V6ZB 2YOAA 3QZMA 4YX2H 3B6SA 2EDEA 3U6RA 1X5ZA 2NUPB 1YEHH 3ZO0A 2W9LA 4KDWA 2J44A 1WJ3A 4E9YA 1G7HB 3UTQB 1MCQA 2GUYA 4LSDA 5EHFA 4MJIB 4Y5XB 4HKJA 2XN1A 4PU2A 5TH2B 2CK0L 5GGRY 1ZGLA 3BVNA 1KPUB 5E8NA 1BPLB 1SMAA 5HHNB 3P0YH 4DO6A 2NX5D 3LKQA 5GZOD 4ZPTA 3C5SB 5LXVA 4ZI8A 2WXHA 5JR1L 5LGJB 1JRHH 3ZYJA 1BZ9A 4DP1X 4JFSA 2EAEA 4QTIL 4Y4FA 1S9VA 1G1CA 1OD7A 5HJDA 1E6JH 3FZUC 1E3XA 5AW7B 5JHDA 4MD5B 4BH7A 3SJVD 2YEVB 3TFBA 1E4JA 1HL8A 2A0LD 2Z93B 5GRXG 5JDJA 4RGNC 4RISH 2VCOA 3GQFA 1HJBC 4P2CG 1F8TH 3GKWH 2CO6A 5JDSA 1M7UA 3B2MA 4FGMA 5DC9B 3MA7A 3GXDA 4ZNCD 1YNTB 1N5YL 2P5ED 5CM1A 3LZRA 4TUOA 4G6AD 4PRID 4BE5A 4P3WA 4TOYH 3R19A 3IGUA 2YGNA 4OD3H 2X6CA 4WI6A 1QSEB 5DHEA 5FKPB 3ECQA 1PDKA 4MRBA 4L1SA 1OAXL 1YNTF 1BBDL 5KUMA 2CJTA 3QJFB 4XE0A 1HZLA 5EDSA 3GUTA 2PWDA 4DVBB 4IIQC 4Y4HD 1JPGB 3LS5L 1Z9LA 4D0DB 4G9FE 3G6JA 1KSRA 3T0XA 4AV4A 2CWRA 5IR1A 1W0YT 3MI6A 4Z7OB 4MS6A 2MWCA 1CGYA 4LK4A 4KK8C 1CQKA 5F7MC 1GGCH 5EBWB 1S5IH 1T83A 1BM3L 5LXGH 3UG4A 2NQDA 3UX9B 2CR3A 2UZPA 2GSGB 4BSVB 3IGAA 2ZSWA 3CVHL 3EYFB 3L5WA 1ZT4A 5E7FA 1ZLDA 4FEMA 1XF3B 3NZHH 4RGNE 3JTSA 1CD0A 3OKMA 5EOQH 2H0FA 2WWNA 2AQ2A 4J3TA 4GUQA 3CWGA 2FX8H 4IMKA 1Z1WA 4LSVL 1UT2A 3TONA 2ZUSA 1NCJA 2YPLE 3DTXB 1BVKB 3DV4A 4JO3L 4NHCH 2I27N 3I2CH 4Y16A 3UBFA 1JNHB 4OZIF 1X5FA 5E1IA 3LVEA 4JLRA 1N70A 4DT2A 2WINA 4PGBB 4U1MA 4CILA 3BUQA 3SKJL 1XGPB 2X1PA 3SZKC 4F2MB 3IJ7A 3LSOB 2D0FA 4N68A 3ZSTA 5A6IA 3PJSB 1HVXA 5E1GA 2I60H 1YUKB 2CHZA 2K45A 4TS6A 1DQQA 3CV5A 4AW4A 5GGVH 3GS0A 2K6ZA 3A6BH 5KBNC 1QFUL 2CBQA 2FJUB 1PLCA 4M6NH 4FYTA 4XXDA 3MRIB 5A2FA 2DYRB 1XZ0B 2JJSC 3ETSA 2C7UA 3MRGB 5CIPA 2GJRA 3S2CA 4S2SB 1KPVB 3SHSA 4LP4A 3ZHDA 1KTRL 3MCG1 1XH3A 2VXTL 3LX9A 3TO4A 5FB8A 4NZFA 3P9LB 4DKFL 1UKSA 4K94C 3WD5H 1E28B 1P53A 4XP6H 2WOYA 1KBGH 5ADPL 2NX5E 1W8EA 5ISZA 3KPLA 3BFQG 2WVSA 5DJXB 4JKKA 4HWNA 2MTPA 4Y19D 3SE3C 4X83A 3U1PA 1B90A 3X2QB 3L6FA 1K4DB 5INCB 3DUSB 1QX1A 3H0TA 4TSBL 2IJ0C 4HD9A 4IK6A 3F7LA 4MD0A 5EO0A 4F1ZA 3L17A 1AO7E 3VM5A 1DBBL 5DK3A 4AQ8A 1IC7H 1JK8A 5KYWB 5K39A 1TCMA 4JKNA 2YD8A 1JPFB 3GHBH 1BZQK 1YVLA 4PJEA 1F4YL 1W72L 5D1ZB 3VXRD 3LB6D 2WNKA 1MCWW 4CDHA 3SN6N 2KS0A 3KYNB 1U8IA 2IQAA 4LLYB 1J5CA 1JS4A 1JD7A 3BCFA 3IDMA 5KSUB 1DO5A 3C2SA 3RWHB 3QIUC 5E8PA 3J2PA 5GGUA 3QCVL 2BWIA 4PWKA 1BF5A 1QI3A 3RVWC 4WFGD 4E9LA 4JKWA 3HG1D 2JJSA 3EF4A 3UH8A 4V2CB 2A9CA 4BZ2A 1AACA 4LEXL 4TQ8A 1H8SA 5EUKA 4JM4L 3LHAA 3FONA 2BY2A 2RAMA 2AEOA 1T83C 1EJOH 4LLDB 2WYIA 1FL3B 3ILPA 4FYQA 5ANME 3JWOC 2NR6C 2O72A 3GFUA 4FFVC 4MGXA 5BOPA 5KSAD 5JMOC 5E4AA 1LE5A 3H9YA 3IDYC 1DBML 4KNSA 4YPGA 5J3HD 4PWGA 4P2OA 1KIQA 1CICA 3NIGB 1RI8A 3GJFH 4PJHA 1WS8A 4P2QD 1FZKB 3LPOA 4JQIH 3ATBA 5HYQA 1WA0X 1XF4B 2Z31C 2GHWB 3BZFB 1G87A 2Q76A 3PUUA 4QHMB 5FLUA 5C0AD 1A1NA 1ILSA 4F24A 4Q9QH 1JGVH 2CIIA 1JK9A 4LCUA 1EAJA 4YC2C 3FTVA 2X4RB 5IFAL 4K94H 5SV3A 1BQHG 1JZHA 1SDYA 2IH1B 3SDYL 2WKOF 4LLUB 1NWOA 3AG2B 5ABAA 2HT4D 4BZ2H 5AAWC 3MQIA 5KTEH 1NFDF 4MJ4A 3IDGB 4NC1C 1G84A 2AEWA 3KCWA 1JWUA 4O5LH 2VDLB 5I8KL 4M00A 4NZRL 5LB1A 3NJLA 2XWBB 3F7YB 1INEL 3FH8A 4H0IA 1BG9A 4NSKA 4RVBA 4MJ6B 1KULA 3AREC 3V0WH 4FFVD 3RVUD 2HJLB 3NAAH 1NAKL 3DRTA 3LNDA 3BN9D 2MHAB 3BD3A 3MRNB 1FA4A 1GPOL 2WYTA 5DK0A 5T3ZE 5D1QC 1I1FB 1CXHA 2ITDB 5KAQF 2XN9E 4L0YA 3QR1A 5FF6B 5JPNC 3GSVB 5CWSB 4QXVA 4CW1B 3WELA 2ICWB 4AY0A 3GM0A 4ZUWB 4NO0D 3CZGA 4YHMH 1COBA 1PMYA 5D7JB 1CGSL 2R59A 3KPSA 2DWYA 3U2SB 4AYEC 4LLMB 4PRDA 5IESL 4R8WH 2E9WA 4CADB 4GKSB 2J7LA 2QVFB 4OF8A 4HOWA 1BQHB 1ZVYA 1YSOA 5E6IB 1GTNA 3S36X 4WHYG 4M1GL 2LVCA 5FA3B 2IWEA 2W80C 5K9OA 1BM7A 2ZE0A 3B5HA 4NM4L 3B5GA 3BKJL 1ESOA 4L5FH 4H8WL 3V7AG 2F8XC 3BYYA 3AC0A 4G70B 1EVTC 3ULVL 5AENA 5IUCA 1H15B 2OJZL 3ARGB 3L4CA 2ZX7A 3CDGA 3WSQL 3O8XB 4M7ZB 3D25B 4O58H 4I0KA 3BYTA 2C7FA 1NCAH 3ESNA 3H6JA 2VITA 3MBEA 5DWUL 4XVUC 3ZE1F 5CBEB 1W2KT 2NY2B 3JV5A 4WTZG 1JMZA 2Q2LA 1IBGL 4HMCA 1OCWL 3SGJA 1RZ8B 5DFTA 1SRDA 1N6VA 5KSBF 3BKCH 4LQFL 4W9CC 3S0PA 2APWA 3WAJA 1ZLWK 5IQOA 3ZLQC 5H4ZA 4N8CL 3ZTJH 2WQRA 1BSIA 4O2FB 3LKSB 3QEUB 2HLFC 3U2JA 1NLDL 3L3HB 1M2VA 2DWDA 2ED8A 2NCMA 4UB0L 5CLYA 1F3DJ 3B43A 3OKLA 4AOFA 3WYRA 5F9WC 1AS6A 2GI7A 2O4EA 3BP7A 3H7LA 6PAZA 1RU9L 4N28A 4OCLC 1UFUA 3P3SA 4QHKJ 4JG9A 5E1AA 1XFPA 3C6LC 3BLKA 4MSWB 3TN0D 3UBXA 3W11D 4IBWA 1KT2A 1U9KA 1MCEA 1GMIA 4YBLB 2H32B 1FN4B 1NGYB 4IBQA 1MJUL 5HHPB 3D4CA 2F5BL 4P5MA 1X4ZA 1WITA 5F7LB 2G75A 2X12A 2Y36L 3KH3A 3C8DA 3IXTB 3OPZH 4FJ6A 2WV3A 5GGTL 1V7NL 2CBMA 3HI6H 3TT1H 2SODB 5FW8A 4ZXBD 2APBA 4R26H 3CFQA 2MJWA 1EJFA 4W6XB 5E99L 4BD4A 2C26A 3LEVL 1T2JA 4A39A 4LMQI 3NJNA 4OB5H 2DQFB 4KJYB 4RWYH 4U6XB 3DVNB 3GBMH 3ZTNH 2NY1B 2R2HB 1JGLH 1HH9B 3KLDA 4D0BA 4AGQA 2FO4A 3U7AA 4ENZA 3VXNB 3UGEA 3POHA 2GEQA 1KPUA 5E8NB 4A6YB 1W0VB 1ZHBA 2EP6A 4H1LA 3COOA 3F05A 5L2JA 3BEVA 4A37A 4IU2B 4Y1TA 2YARA 3AY4C 1B0GB 4YS4A 5SWSD 1LTXA 4IW4C 1A7QL 3IDXL 1MHHB 1UM4H 3O2DL 4OT1L 4NXKA 5ACMA 1DEEA 1OGSA 3V9FA 2DZEA 2XTSA 1CFVL 2FUQA 2GBAA 2K7PA 2F8IA 4RA0C 4KZDH 1UWGL 2J6EL 5I1CH 1OT1A 2BFVL 4MA8L 4XVOA 5HHMD 4JY6B 2I24N 4BGDA 3X13B 1U8JA 1O6SA 5FHAH 4KJPD 2ATKB 4OZFH 3TIEA 3EW3B 5E1HB 2YR3A 1O9WA 3LMJH 4NCC1 3O0RL 1ORQA 4IBTA 1XX9C 3BP5B 4N9GB 4XCNB 3RG1C 3WDHA 3RU8H 4QHNB 4JZOA 1FRGH 3ZUCA 1OOAA 4D7BA 1XQ4A 5CSBA 5DD3L 1HSAB 1D5XA 3QPXL 4ELKA 3FTGA 2A6IB 2VRQA 3RX9A 1T1ZB 5K9KA 2F74A 4Q6KA 5IQ9A 5BXFA 3W9EA 4LASL 3F85A 5MI0C 2HVBA 3QBTB 4ZJ9A 1ZIBA 4F80A 4BFEA 5IB5B 4FXTA 2DD8H 3VD4A 2CRIA 5DFVD 4AJWA 4GG6E 3ATFA 1A4BA 1E67A 1NPJA 3EFFB 4WO4C 3GSRB 2YUZA 2WO3B 3B9KA 5F6HJ 5DUPL 1ZT4B 4R84A 4GSQA 2IPUK 4IHBA 4LSRH 4ODSL 3S35H 4DIXA 2X4PB 4FNLL 1NMBL 1JPEA 3TJPA 4NO3A 1U92A 4PGCA 4YVNA 4OIIH 2W0FB 4U1JB 2DTMH 5HGAA 4NT6A 3GBNH 2VN6A 1IJ9A 4RFEB 4WQOA 4K94L 1Q1PA 5GPRA 3N44B 5D6DA 2E0PA 1T22A 3LQAH 4OI8A 2EYTA 3KYOA 2OJ1A 3CZFA 3MAWA 3EOTH 2QQLL 4NQXB 3MFFA 3PP3H 4KQ4H 4QUOA 4PSPA 4D9LL 2NLJA 5KVEE 5MERA 2PETA 4P2YA 1UOKA 2CR6A 5CS7A 3O3DA 5FHBH 1XCQB 4OM1L 1PPIA 3NZSA 1IX2A 3SE9L 5I1GL 1NCUA 4HKZB 3PDGA 5HVHC 3TJEH 4YQXH 4LSVH 1Q1JL 3HNSL 3KXFE 3RPBA 1JWUB 5EU7C 4EIZC 5KVFE 5DFVC 4P9ML 5C7ZA 3LQZA 1JHLL 2CXGA 3SPHA 4F33B 3HCVA 3S34H 1J0IA 2J43A 4N2HA 1USZA 1KN4H 1F2XK 1LQBC 3FUDA 4ATWA 1AHWA 4AEEA 4TTDD 2BIPA 2NW2A 3WS6C 1SVZA 3O8XC 3ARFA 4NKIH 4UNVA 2DEWX 3MRGA 5CJXA 4WFED 3U6RB 1MPAL 3HB3B 3IMTA 4L37A 2Z92B 3C5ZB 2EECA 5L2KE 3E38A 2XA3A 1SDDA 3GRWA 2DLIA 5T3ZH 5AYUL 4X8GA 3QNZA 2EDBA 4Y2OA 5BJTB 5HHNA 3JWOL 4WK4B 1DJGA 3PAYA 1HNFA 3CTTA 1FL6B 1H9DA 1K8IA 3MTRA 5F88A 5CF3A 2C8NA 3ARFD 5I1DB 1T1XA 3B9VA 4JFDA 2QADB 5ICXA 5IOKA 1SVBA 2WKGA 5A43C 1MJJA 2XQYA 3DX8A 3OAYH 4AMWA 1VFBA 1HQ4A 1ZANL 3IRZA 3N0AA 4L8SC 1NCBH 1EEZA 2VMEA 5CSZA 1EUTA 3L2MA 3Q8BA 3S4SB 4TTDC 4YDJB 1IIKA 1N8ZB 2YA2A 2IDUA 4PJGA 1LEGB 2XT1B 1CVRA 3GEWB 4JMXA 4MMXB 4HULB 3AACA 4RQQB 3ZYIA 5L6YH 3KGTA 4NQSA 5IIEB 2DQDL 3QGVA 4GUPB 3OG4B 4XO4A 3G6JB 2WQ8A 2FX7L 3OLEA 5IWLA 4NRZA 3FYEB 1Q9WB 1WZMA 4H25A 5TFSL 2JJWA 2NZ1A 3M8OL 4K8RC 4LPCA 3FN0H 1BFVL 3LKSA 4HIEB 4UDUA 4ZFZB 1JWMB 2BW4A 1QEWA 3M1OA 2FJFA 5H37G 2J8UF 3QIBD 5E8DL 2YMTA 3KS0H 1RZIA 4WI7A 1TTBA 4PI2A 1I9IH 4KJPC 3AFLA 4PVMA 3IN0A 1XMEB 2HJFA 2OL3A 4UYQA 3UROR 4NJ9H 4JKMA 4WO0A 4EI5D 2OS7A 3MX0A 5E9DD 5ID1B 4Z1PA 2VLKA 4Z95H 4ETYA 4I48B 5FCUL 5JMRA 4TVPH 1XF1A 4GYBA 3VGBA 5EZOL 4F5CA 4FZ8H 4HIJB 3DXAB 3K0YA 4YDKH 4ORGA 3GXUB 2BFGA 1SYVA 3EXLA 4PREA 4EUPH 3IDJB 4G1MB 2YPLB 3IWVA 1PIFA 3MPCA 1DDHB 4PJFF 3VTMA 3VFTA 3LRGA 5FDWA 4J8QA 1B9KA 3ZMNA 3S37L 5IJKC 1NCAL 3WOVA 3G04A 2VC2B 4QRTA 3QXDB 3UZEA 3D69B 4MXVF 2QKIC 4P2AA 4XPHH 2VXUL 4PJ7F 2XWZA 3QCTH 1RZFL 1S7WA 3H9SA 2RH0A 3OXSB 2G30A 4JJOA 4W9KC 1IBGH 1QSEE 1LYQA 1OAYH 3V0WL 3L3OA 2ZXEB 3P4NB 4LAQH 1YYMH 1A6UH 1NCCH 1WTLA 1BJ8A 4HSAC 5L4IA 1NDMA 1YEHL 4MLIA 5GISL 1DUZA 2AEIT 1H3GA 1VLXA 1LD9B 3K4AA 1FZJB 4RESB 2BNQE 4JFQB 3U46B 3ZUNC 1XH1A 4ONHA 4DP8X 3V52L 1ZCRA 3RGVA 2BXYA 3O4LB 5BJTA 1UWEL 2YAFA 4CN1A 4WDIA 2BNUB 5CU5A 4G6JH 2Y7SA 3QRFM 4NQEA 4NQVB 1ZHKB 3FAXA 4XBPA 2K78A 3HC2A 1O6TA 1MHPH 2IG2H 5I8OH 3EYQD 3LD8C 1WIPA 2Q7NA 4NUQA 4PW4A 5JNYB 1DVUA 5IVXB 3HE6D 4M93B 4WEEA 1KGJA 3TASA 5HHVH 1KCBA 4AZUA 3SOBL 2QKSA 2YUVA 5FUOL 5IY5B 4FZEH 4DGIH 1F00I 3N50A 4HK3N 4ZMOA 2HVKB 5AVRB 1MFEH 1G6RH 2BVQB 3MRMB 1I4FB 1UENA 2KMWA 1LL1A 4UQCA 1PLBA 2V7NB 1A5FH 4MWFA 5HGHA 3KBFA 1ZPUA 4OI9A 3HVNA 5CSGA 1HKLH 4TNWK 2IBZX 1DCEA 5DVKA 3LH2L 5EORL 4NPJA 4ZMZA 3OZKA 4KJQD 4YFLI 3KWWA 5I6XB 5IGXL 1NJ9B 5AW8B 1SM3L 5B1CA 4HPHA 4CDGC 1R5IA 4TUUA 3DSNA 2Q2EB 3L48A 4FNPA 4RAUA 4CKVX 5HGAB 4KH9A 4KUZH 2E46A 4PV9B 3QNXB 4L3AA 4NI6A 4WSJA 1O5PA 4LQFH 1S7UB 5E9AA 3EYQC 3F04A 3VD2A 1V3KA 4JPWL 2KQNA 3D18B 3NMEA 4MA3B 3ZXAC 1KDJA 1BEXA 1C08A 3MV7A 5F1IB 1PZCA 4GAGL 4BK4A 1R1CA 4LPUA 4L4TB 3GSQA 4JE4B 3MBWB 3HAEH 5GGQH 1IUZA 1DLFL 4K3HA 2F53A 4GBXD 3SBPA 1JXJA 2OCJA 5FO7B 1ZVHA 3EGDA 4HLZG 4DN4L 4KV5F 2CIKB 3T4YA 4I1NB 4APQB 1CF8L 2KZ1B 2XX1A 4X8JB 5T3ZD 2AK4E 1F3JB 5CHNB 4NRYA 2FEDD 1NCTA 3BEVB 4FXGA 5ALCH 1TQWA 2DYSB 1TPXB 3OJMB 4IKIA 5DGRA 1EDHA 1ZE3H 2R1YB 5C0BA 4RWYL 4N6RA 5AOZA 1VGEL 1PSKH 1K8DB 4Q9RH 1FPTH 4HGWB 1BQSA 3DLQR 3MOQA 3RBSA 3CZEA 4KMTH 1BVLA 4NO0A 3G5XB 1LILA 4ZOBA 4TRPL 2K6YA 3TCTA 3IAGC 3E7JA 4UT9A 4XNUH 5I6NA 1FFOB 2YSSB 3HPLB 4P2RA 4RGMC 3QDGA 5J5EA 1E5AA 5ELIA 1J18A 3UBHA 4BZ1L 3MV9B 1KJMB 4YNYB 5E94B 5ENWB 3SE8L 5AB0A 1HIMH 2VMCA 4ERSL 3APMA 4ANWA 4PJIB 4JPKH 4W93A 4TQIA 4NLAA 2AK4A 4F7PA 1DBAH 3CFEB 3C5ZC 5GZND 4KC3B 2AVGA 2D31B 1UJTA 2NT1A 1U8QA 3IMSA 2ORBH 5DD0H 1G7JA 1PZBA 2X9YA 4DKFH 5JOFB 4WO4B 5HDQL 4M9OA 1S7VB 4FG0A 4R90L 2R23A 5I1EH 3UAJD 5ABZA 2Z64C 1TYEB 3B9EA 1XH0A 3NOIA 5C8JA 3BIKB 3DECA 3I02B 1KIPB 1E9OA 4IRSC 3C87A 5KZCB 2CKBH 3OR6B 5MHSD 3ARRA 3L1FA 1FLRL 5L88H 5LHDA 2CLRB 3SGEH 1DVFB 5JIKA 1D3CA 4M5ZH 3NRFA 5T1JA 3EDFA 2AMUA 2BSSB 1YA5A 5GGSA 1RPQA 4I88A 1DBBH 1S9VB 3E1ZA 5I73C 3FQNB 1E6OL 1UURA 1WFIA 3G08B 3GHBL 5CBEA 1Q9KA 4NNXB 1MFAL 1L7IL 4FQHA 3ZTCC 1OW0C 4BK5C 1MFUA 3KYMB 1AO7B 2APXA 2P80D 1TUPA 4X5XA 1T1WA 2UZYB 1EJ8A 5KZCD 1A4JA 2KLRA 3GLEA 5LNGA 4LSQH 1YQVH 1CE6B 3RPIA 3OKLB 4HISA 5CP3H 3C6SB 3CUPB 4QRRE 2I32A 3GMOA 2OPCA 5IMMA 4LEEA 4DP9X 1KBPA 1A22B 1J8RA 1A65A 1KIUA 2ZP9A 3MV7D 1JVOA 2VDMH 4PGJA 1MRFL 3HB3D 3BPOB 4G7QB 5MEOB 3CVBA 4N0UA 5AQ0A 4DGWC 5A2LH 4B9GA 4RMVA 4H0GA 4E9SA 4Z7NF 3DVGB 2X4TB 2HYMA 4N0YL 3G5VA 1HCYA 4UZGA 3NCBB 5I6LA 2XKSA 4WCYH 3EYFA 5IFAH 4FXKA 5I0YA 5SWSE 1NDTA 1CK0H 1U30A 2JELL 4LO9A 1W8OA 3EHBD 5IMLB 2QADC 2WY3B 2X1XR 4LIQH 2QQKH 3OZ9H 3S34L 3PNWB 2W88A 2X44D 1VFAB 1UXSB 5JHLH 5GS0L 2WXLA 4ETQA 1F5WA 2ZOOA 4XZUB 2GSMB 4PP1D 4ZSOE 1TZHA 5I9QC 2A6JA 2PP9A 3MYJA 3FB6B 3KPMA 4U1GC 1QNIA 3L9EA 4GQZA 2DL9A 1S3KH 3KPQB 4UOW1 4HUCA 2CZNA 5IUSA 5JHAA 1KCRL 3BUBA 1EDQA 4JLRB 4LEBA 2R29A 1SPDA 1P9MA 5E2UH 5HHVL 4CU8A 3PL6C 5KSAC 3D0LB 3MLZH 3RNKA 4JY4B 1AY1H 4PWEA 4YZWA 4G3YL 1ORQB 1MFCL 4QNPF 2DM7A 1P7KA 3VFGL 4JQIA 3ZZ1A 1NINA 2KHAA 4ADJA 1AQMA 1E50A 5D2LE 2A3TA 3P4MB 5C3LD 1DFBH 3LEXB 4OCRL 4OVVA 4TUKH 5D1QB 2HLAB 2N56A 4Z0BH 4ODHL 3MV8A 1NBYB 2E86A 5D2NE 4G8GE 4G9FB 3SGKC 3O0LA 4LFHD 2YO3A 1KYDA 1FG2A 1MI5B 3O41B 5F8QC 4YSRA 3D06A 2O61A 3VX1A 4I87A 2IVFC 4M4PA 4L0ZA 3WNLA 4IRJD 1UC6A 3H54A 1KCVH 3KWWB 1ETB1 4HIXL 4DKEH 4FG6C 4KWUA 4KH2A 4FFZH 3NP4A 4DK5A 1JXGA 3Q8FA 4N25A 1P7QB 1IMHC 4TN9A 1SJEB 1N7ML 4NM8H 5BRZE 5DC0A 4N2IA 5LN4A 2N4IA 4NKMA 5I2IB 1HI6A 1G6VK 4XVJL 2I60L 4UF7C 1JRHL 2WVVB 4J7RA 2HJFB 3JWNH 4U0RB 2Q9OA 4R4FL 4ZZFA 3FN0L 3EO0A 5CUSL 1HCVA 2JCCA 3K6NA 1A6TA 1FL5A 4PVNA 2EYTB 4J3OD 3CZFB 3ARUA 3UXFA 1SHXA 5HI3C 5FKAB 2JK5B 2QVIA 2ZXAA 4HIJA 5IJBC 2X2UA 4RWHA 1T03H 1IBHA 2V5YA 4KKPA 2WXKA 4JO1H 3QDMA 4EZKA 4D8PA 3RFZA 1DDHA 4I4WA 4ZOCA 1I7TB 3AM8C 4HKZA 5ES4B 2IAMC 4JDTL 4YVUA 5I5IA 4NJ9L 3QIBA 2Q3ZA 1KOAA 2DQCL 4AKPA 2ZQKA 3G04B 4MNQB 1E5ZA 3SOBH 3SKMA 4JRXE 1PS3A 4RMBA 3QAZB 1BLNB 3IPEA 3IJHA 4IMLA 3MRQB 1UD4A 1VGKA 3RILA 1HZKA 1DJHA 2ARJA 3G5WA 2R1YA 3QRGL 1WT5A 4PIBA 3ZE1B 1S9WB 1V27A 5E8OA 3VWKA 1CXFA 2GK0B 1P5VA 4TXVB 4JPKL 4PJXE 4Z7OE 2Z7ZA 4JRYB 4XVUD 2F8VA 4LRIA 1MF2L 4ZDHB 5SWZD 4OI7A 1QYGL 5D7JC 1XCWA 4AX3A 2COQA 1AANA 1Q0YL 2WINB 1U8HA 4IGBA 4PGBA 4U1MB 2DQTH 4KUZL 2Z34A 5C0GA 4ODTL 2W07B 3FCGA 3ZRCC 4ES9A 4FF9A 4AMKH 4HZAA 4GO6B 3T3PF 1BJ1H 4ENEC 4PD4J 1K8IB 3V5HB 5A16B 3K6DA 3WUWA 5C07B 2MKWA 1NKGA 1B4LA 4S0TD 2UZXB 3RWIA 1FNGB 2XZAL 3DBXA 1OSYA 2VJ0A 3GGWA 3QUYC 2MTAA 1WBXA 5F1OB 4WFFD 1XB8A 3L3DA 4JO3H 5EZPA 3VXSE 5AG8A 3OJ2C 3A67H 2JV6A 1SBBA 1KFGA 1DLFH 3QUZA 1L0YA 3HR5B 3EYSL 2V5MA 4L18A 2DQCH 1NIEA 3BAWA 1A1MA 1S7TA 5K93A 4DO4A 4WKZB 1UGNA 1PG7H 5HYIA 4R96A 2P5WD 1WT5C 3U1QA 2FQGA 2ICWA 5FUZL 4OFPA 2NY2C 3MUZ1 1DQLH 1HHHB 4CJ1A 3LKNA 4PJ5D 2K1MA 1WFMA 5I15L 3OHXB 4ELMA 2FQFA 4JB9H 5IVXE 5BCAA 4CADA 4AMXA 2XC8A 1NEZG 3P1VA 5DRXA 4JO2L 2LE9A 4JFPB 4ANKA 2H41A 3QQDB 1D2OA 5FYLE 3SBQA 1BZ8A 2OMTB 1AO7A 4QR7A 5I19H 1A3RL 5IF0A 4JFEB 3UG3A 4DVRL 1BD2A 1QFWM 1DVFC 4JZJB 1ZT1B 1TO5A 4OKVA 1AJ7L 4GXUM 1UZ8A 1VCBC 2D03H 1WAAF 4MVBD 1KBGL 5C09B 3CDFA 5F72S 4JHAL 1Q38A 1YNTA 1Z9OA 2J1ZA 4NYLB 3VSVA 3WL9B 3QJQB 4YGVB 5IW6A 3ZTDC 1NGXB 4M8VA 3NCJL 4D94A 3PPSA 5EUOB 2XWCA 2AJ3B 1PDKB 3I74A 3HRZA 2GYSA 2EIZB 3MX0B 1GRWA 4N2CA 5L2KD 3FT9A 3ZKXC 4KZEL 5C97A 2Y06L 4X8JA 5EU6E 3VFWA 4I48A 2E8ZA 3ZKQD 4NFCA 3QDJB 3OBAA 3SBWC 4D9LH 2E47A 1TTFA 4PRBB 4JN2B 3ZGHA 5CEZE 3EOBA 4HAFA 4NZTL 4B7LA 3RA7H 5E9DB 2JE8A 1ITBB 1QNZH 5IFJA 4LPXA 3TWCH 4PTUA 4F27A 3APDA 2MPAL 4HBCH 3QUXB 3PNWA 3QC5X 1PZ3A 1Z9MA 3MGOA 3VG9B 2IPTH 4WZ9A 4G8FA 1FIEA 1IGYA 4YSOA 3DUUA 4AC4A 1ID5I 4OZFG 8FABB 1SVCP 3SSGA 1QMUA 2HPOA 4FQXB 1OSEA 4RSYA 5E4OA 3ARED 3IDGA 5IMKB 1FIGH 3RY6C 3K2UH 4OLWH 4WO4D 4KROD 2G0LA 3CIAA 3ZK0A 4P3CH 1BQKA 3OJDB 1IZKA 3FULA 4GRLA 4I77H 2XWJB 1J8KA 3QG7L 1A7QH 4JFFE 1N0XL 2H6OA 4RCAA 2VQTA 4X6BA 1RQ5A 4CMMA 1W72B 3NSCA 3FFCB 3D85D 3SGKA 3FPXA 2MHAA 2DQHL 4GINA 4G8IA 1U3YA 3AG4B 1GGCL 5FO9A 3PAUA 3SGJC 4E9VA 2CK2A 2BOCA 1NBCA 1LO0H 3VCLB 4XC1L 4CW1A 2QHLA 5GJTH 3O0RH 1WFJA 2E76C 1TQCB 5DS2A 1HTYA 3FL7A 1ZTXH 2UWEF 4PLOB 4C59B 4Y7OC 3FQRB 4PHXA 4AH2A 3CSGA 1UD2A 2JB5H 3CQFA 2P52A 1BQLL 2ZICA 3MRDA 5AB2A 1X9RA 1A4JB 4BA8A 3C08L 3MJ6A 2D0HA 5GS1A 1JJUA 1R19A 5IBTL 1KUMA 4IBUA 3CXHK 1OT2A 3KJ6H 4QYOA 4UV4L 1E6OH 1CD1B 3WENA 3ETBF 2ITEA 3FQYA 1TMCB 5DWPA 4XNZB 1CPUA 5GRUH 4Z6AT 1EIBA 5I1LA 1M7XA 4NENB 5AB9A 1KN2L 1FE8H 1H3TA 1S7UA 1CTMA 4LSRL 3S35L 2PR4L 2VWEE 1RZJC 4LOVA 1VENA 4MASA 4HK0A 2AJUH 2YZ8A 4NQED 3UZVB 1NICA 2ZKHL 3GNMH 1M7IA 1P4IL 3VFNA 3GSNL 1PY0A 2C4XA 3HZYA 4OAWB 5B1BB 2HFEA 1KLUB 5I18L 3S2AA 32C2B 3EJUA 3S8FB 1EHKB 4I4WB 2GBVA 3GI9L 4IEFB 4NQCB 3ARXA 5H37A 5IHHA 4RRPM 1CG9B 2MCPH 2X4NA 3T08A 1H3UA 1TTAA 2Y2TA 1MRCH 4K7PL 3ZT5A 1QRKA 1MCPH 3TEXA 4HZLB 4D8OA 5FWRA 3EGXA 1KIRB 4OLVH 1SOXA 2F1EA 3K8KA 4F91B 3MNVA 2YEZB 3NPSB 3FU6A 3PP4L 2M26A 4LBEA 2HXAA 3TU6A 1BGXL 3VGEA 2X6UA 1QKZL 1RULH 1PX8A 3DRQB 1FFRA 4PH8A 3ZZQA 3TV3L 4YPGB 4UQBA 1GYVA 2VM9A 2BIOA 1OCWH 5IOPB 3GC3A 3IJYA 1XGYH 4HS6B 3TN0A 2ATPB 3L9YA 3O3BB 4WUUB 1XGQA 2CUMA 4ZS7H 5HYJA 3V0AC 3QUYA 1I9RH 1WZAA 2PCPB 1FFOA 2YSSA 3O45A 2FD6L 4GW1B 4D9RE 3V6OE 1NBQA 4G8AC 3M1BA 1W15A 1XDTT 5B39A 5A6LA 4G9FD 4LHUD 3P69A 1YG9A 1G1YA 4HXAL 3AWGA 5GGRB 3EDDA 1R0AH 1XV8A 3ZX1A 3OPUA 1JZIA 1OAZH 2Q3AA 5D1QA 3L4VA 4X80L 5EO9B 2Y5QA 5C3IA 4A2EA 3REWB 5DJ2B 1PZ2A 4WO4A 2BVPA 3RWFB 3UJTH 3O41A 4PG2A 1RZ7H 3B9DA 4I18B 1SDDB 4R96B 3S6CA 2O61B 5PAZA 1KY6A 5E99H 4Y1AB 4JNXA 1OTSC 1MRDL 4P8QA 2OM5A 1KB5L 3BD5A 3BE1H 3GKZA 1DHKA 5F0MB 1P5UA 3ZJAA 1U8JB 2G0KA 2WVUA 5CWSA 4YIQA 4X0NA 2WSKA 1KNOA 5ANHA 4F58H 5FDYA 3BPNB 3LZQA 2DIJA 3HE6B 3OKEB 3S3DB 2BPBA 3B3BA 1DANU 4MAYC 4DAGL 1FGNL 1B3JA 4LDCA 1R5VA 2EABA 4Y4KA 1HQ4B 4I3RL 3K5RA 3SCMD 1J9TA 1D5XB 1PNCA 2DQDH 1A5FL 5FA3A 5CEZL 2FL5A 4M48H 4OGAD 4BRVA 1KN4L 3VXUE 1A3ZA 1HYSD 1B4TA 1DSFH 4OGQC 3W9EB 1FQ9C 3FSWA 4BQCA 4R5VA 4Z76A 4YGVA 1QBMH 4A7SA 3WTTA 4N2LA 2A9ML 3RPIB 4K7FB 2QSCL 4HXAH 3QPKA 1A9BA 3QUZC 4AMKL 4JAMA 3VG0L 4OFVA 3GSRA 5DMGD 4R83A 4F7KA 1QHQA 3RZCA 1XF5A 3AUWB 4NQEE 3VFWB 4EZJA 3QDJA 4OBSA 3VXMD 3OQ3B 3VD1A 1F6FB 4UBDC 1DR9A 1ECZA 2GT9B 3MUGB 1HHKB 3CMOL 4J4PC 4QRPE 4DKDC 3QI9B 1L5GA 2D73A 1FF5A 2ZCLH 1YEKL 3CXDL 4LCWB 1ZHNA 4Z95L 1NAMA 2FZ3B 1P4LA 3L95A 1N12A 2J2ZB 3NRQA 2WUBL 4OGXH 4UILH 4ZSOA 3U6XS 3V0VB 3BHBA 3MFFB 1O7DE 2X2YA 3P73B 2J8OA 2R4SH 3SDCA 4I0CC 2XQ0A 5E2VL 1LO3H 1KTBA 4N90D 1M2VB 2DWDB 4LSSL 4F8NA 3QCUH 1A7NH 2EYRA 1Z2KA 8FABA 4UDTA 3RDTB 1EHXA 5J6SA 5HGDB 2P9RA 5JA8B 2UV3A 3HS8A 1O7VA 4CGTA 3TX4A 2O5YH 3GLDA 2XQBL 3FT4A 4ANXA 3KPMB 4GRLB 4Y5XC 1OZTG 1NFDE 2IAMB 3WKYA 4AVJA 4M7LH 2P5WA 3N41F 4JHZA 4OCXH 4TKWA 2R0WL 4DZ8B 4XMPL 1CMOA 1QQDA 1Z9NA 1J7VR 3QXAA 2R4RH 4JFYB 1FFPB 1JZDC 4PJHF 5AOIA 5C7XL 3MRFB 5K5YA 2EZ0C 3QIWA 1KB5A 4DPRA 4FA6A 3FTWA 3N85H 4KK9D 2FLMA 2E9IA 3CZNA 5E23A 1JGIA 1RJCA 5ESAA 2FIKB 3HZVA 5CINH 3V4VA 3VXNA 4V11A 3VYPA 2RMNA 3MLYL 3BDXA 4G6JL 4K8RL 2C1PA 4P23C 1MFVA 3K2MC 5D7IA 3HS9A 3L4UA 2Y1AA 3LEXA 3WS3A 3P3TA 5JLZB 3AROA 3FU7B 1HL5A 4I5BB 4LNRB 5F7EH 4DETA 2CO2A 4E9TA 2NY0D 2OMTA 3AB0B 4PCKA 3F58H 4IGBD 3GMRA 4AXWA 3BSZL 3R4RA 2H1LM 1Y18B 4W9DC 2CJUL 2AFNA 1BZ7A 1MFEL 1T20B 2J55A 2WGXA 3OKNA 4HXBH 3FU0A 2XDHA 4WUKL 4AEHL 4PGDB 4AG4L 1F4WH 2H3XC 3UTPD 1P7QA 3OMNB 4BKSC 3QYNA 3CN2A 4UOQA 4PRHE 1IL1A 4KDTC 3CK0L 4P99A 5JYMA 2ADFL 2VAJA 1HI6B 2IANA 1TZ8A 2JB6B 1T6WA 1F2QA 4MA1C 5B7FA 4DP5X 2EZ0D 2JQAA 4LGRB 4NQDE 4FN0A 4M7LL 4WRLA 4ZOEA 1IM3B 4IBYA 1XAKA 4JFXA 4QAWA 2XXFA 3WIFA 4L3EA 1KV3A 1E4XI 4YHKL 4X98A 1VPOL 2K8MA 2WLKA 5IQ9B 1ZT7A 2YBGA 2VZSA 2VISB 3HTLX 1LWHA 1NAML 3GINA 3LPGA 3RFZC 1N8OE 3C5ZD 1MUJA 5GZNC 4PIRF 1PZAA 3AAZB 4HJGA 5G4OA 4C57C 5BO1H 1A4KA 1FC1A 1LEKB 5KYUA 2H6PA 2EDYA 3OKDA 5ECGA 4NDMA 3CFMA 2PYFB 1OTSD 1QA9A 4B97A 2E6JA 3A47A 5IK3B 2NZ9D 5HHOD 5BUAA 2X41A 4GQQA 3VW3L 1ACCA 4CKQA 2VXVH 2AJXL 3SPJA 2NSXA 5L4FA 2OMNA 1LP9B 4AV5A 2W0FA 3L2LA 5LQBH 1IQWL 1T3FB 3CVIL 4RISL 3D3VD 4NOBA 4MBOA 2ENPA 4M4RB 1THCA 1VB9A 1IQDA 3LRLA 1Z6JT 3HC4L 5FOBA 1MQ8A 1SDAB 2EUXA 5IBTH 4TTGA 3QZWG 3BDYL 2FO1A 1EANA 5D6CA 1ZGLP 4L29B 2X89D 1T7ZA 2E7HA 2O26U 2IAND 3CLWA 4LRNL 4GSDL 1AMYA 2RQ8A 5D70H 4ZUVB 2P5EA 5DZNA 3BAIA 4L3ED 4OJFL 5IEHA 1IC5L 4TULL 1C7SA 4WI8A 4Y7MA 2FE0A 1NMAL 3V0EA 1S3KL 3BP4A 3TCLB 2QMJA 4RMTA 1SEQH 3O2VH 2YD9A 1RIHL 1D6EA 3UAAA 4P23B 4GRWH 5IB2A 1X4XA 3BVUA 2B59A 4WI5A 4C55A 1TKWA 4N0UE 2Q86B 2GIMA 3CFUA 4AH2B 1J1OL 1S7TB 1G7LA 1U33A 3DK2A 4L4VB 1CFTB 1L9NA 1S9XA 4FNQA 5JIQA 1ZLUK 2V4LA 2FATH 4YO0B 4W9ZA 1KCWA 1PAMA 4X6EA 4XOAA 2X4QA 2ZPKH 3MHZA 2IO5A 4NNYA 4A7GA 1BAFH 2IGLA 1JBJA 1GGTA 4B9CA 4EZLA 1U8CA 2YWYA 1T66C 5IQ7L 1KXQE 3ESOA 3NN8B 1FDLH 4IQHA 3FH7A 4HIXH 4A6YH 1EJOL 2MOVA 3L9RA 1YY8A 3BAJA 5FEBA 5AW9B 1MG3C 4Z3IA 2MH4A 5C0FA 3T2NL 4QF1B 3ULUF 3QXVA 2NZIA 4PB0L 5JXEC 1DQVA 2HA1A 1TQVA 1X7QA 4WHDA 3W0WE 5C0RH 2X4UB 4XRCB 2WHVA 1KWKA 4FHJA 4YHIB 4RA3A 5FUCC 2PO6B 3FB8B 3MODL 2AV1B 3S36H 3KPSD 3SQRA 1XXFC 2A2QT 2K4WA 4FQHB 4JPIA 5C08E 1YMME 4JE0A 4U1HB 5D7SL 1XXDC 1AGCB 2FK9A 3DGGB 4WENB 1RZ7L 4I3SH 3LKOB 1I1YA 2YZ1A 4O51A 2FECI 3DIDA 1YPZE 1A4CA 2EKJA 1JGEB 1H5BA 4FLQA 2NY0C 1NC4A 3BI9X 2O1AA 4WY7H 3S88H 4XCYB 2M83A 3A5VA 4JK0D 3L45A 4PTUB 4U3CA 1S2EA 2EVGA 4KGLA 3RRQA 1KYOK 4HT1L 1D9KC 5TE6H 2YHGA 2H2PC 3B8SA 2P24A 3PHOA 4R4BA 1FNHA 3CH1A 1OAUH 4G71B 3S3PA 2QV2A 1KELH 1S7XB 4X4ZA 4XPFH 3VO0A 1A0QH 1DEDA 5FGBC 3NAAL 4IDJL 4NBYB 2UWEB 2OZ4A 1MI5D 1OP3H 1D5BB 1EPFA 2QGCA 3G3LA 4NOFA 1NGQL 1GVIA 5MEOA 4AM0B 4RSVA 4EXKA 5HHXL 1TNNA 3TT3H 3V0FA 5ESQA 3HG1E 4K9JA 4ZMQA 4GI9A 2ZWZA 3WE6A 3BH9A 3PDDA 4HUUB 5ALBL 4JY5L 4NRYB 3VWJD 1A7RL 2Y3NA 3TESA 5CKGA 2QPUA 1MW0A 4Y2DD 2D0GA 5DFAA 4WLCA 3T3MF 2WLYA 1OIOA 1YC8A 4PJ7A 2P4AB 3V95A 3CHOA 3DI2B 1G7IB 5JQ6H 1B2WH 1UHVA 3GTNA 4CGUB 1IGIL 3BN9C 3QDGD 5E56A 1ZEAH 2YPLD 5DS8A 5EOTA 3IWUA 1OTUC 1OW0A 4BK5A 1I8KA 3DHPA 5LGHH 3CZJA 2GG1A 4XNYL 1IV8A 1JTPA 1MQKL 2EH8L 1BXAA 4URTB 2AW2A 2IOIA 3P3UA 3WKQA 1PY9A 3ZDXF 1HYRC 1RK7A 1WAAE 2GITB 4FC3E 4G6AC 3CFEA 1H9VA 1HQRA 4JRXA 2W60B 1ORSA 4B95C 4NEHB 3SODB 2Z93A 4JANA 5CEYB 4GI8A 4TVPE 3OLGA 5GIRA 2BZ7A 2FL5B 2PP7A 4U1LB 4DF9A 5ERWB 2BNRB 4M61A 3TTYA 2VXQL 4X7TA 5C8JB 4YBQC 1V3JA 3DURA 4XHJC 3B3IB 5E4EB 5B1JC 2XACC 1KTJA 5DVLA 4YHYB 1F42A 2OL3H 3T0BA 1J9RA 4LB8A 5D8JL 2Y23A 2HLAA 2W0LA 5CEZD 4OF6A 2HRGA 5D7JD 1X5JA 2ZD0A 2AZUA 1QFHA 3Q43A 4YHPA 1M7DA 4ANVA 3GMLA 2WQVA 4S1DD 1CYXA 4S0SD 1KJ3H 2BVQA 2VSCA 1FFNA 3BZEB 1IGIH 5CR8A 3STBA 1CDBA 2EDNA 4LHUA 1ZLVH 4U6HA 3N55A 4KTYA 2FYYB 3ABGA 3BHBB 4JFWA 3PGCA 4MBRA 1RK1A 3ARDB 1QSFA 2VDQL 1A1OA 4K8RH 5FM8A 3IJ8A 2H9GB 2J5WA 3UO8B 2VIRB 2P8LA 2EYSA 2AAVA 1IZJA 4AQ8C 1OALA 3BDYH 3B7SA 1IFGA 3BZ4B 4Z7QE 3H55A 3AXIA 3GMNA 3T71A 1YEKH 1GIGL 4GJTB 5DI8B 2Z4TA 2HVJB 4OFDA 2ETWA 1N4XL 2XWEA 3AMKA 2EH7L 3GJFB 1T4KB 1TJGH 3UDWA 1EDYA 1UKTA 4ZW6A 2FVNA 4Y5YC 4G7VL 5IQMA 4WNJA 3OB0H 2H3KA 4KI1A 3VH8G 4UAHA 4GAFB 3EFDH 2WLIB 4NRXB 4LSQL 4AL8C 1SQMA 2VW4A 5FFOA 5DMKB 4UYPA 3CD4A 4XN4A 1KCVL 3LAFA 1SNRA 1YUHB 5L7XH 4CAGA 2XXCB 3N3EA 1R3IH 3CVHB 1QWNA 2CAKA 1QRNA 3U36B 6CGTA 4WI4A 2HG5A 3PWPD 1HXMA 2FIKA 3HZVB 2CDEA 4JREB 3BAYA 3SBWA 5ACLA 5EUOF 3WDIA 3WHE1 1E3ZA 3W5NA 2XCMC 3WEXB 1PX4A 3T4AB 1JI2A 2L7QA 2X9WA 1W0WB 2E4FA 4WK2B 3T0EE 1WK0A 2IDFA 4UINH 4N8CH 4AIZA 2BP0B 2FNWA 4UIKL 2WN3A 5DDHA 5FK9A 4OUOA 4ZW3A 2GIXA 1K8DA 1IE4A 4NZUH 5LLIC 4F7MB 2QELA 3ZL4H 1FVDA 2RCSL 5ISZB 3T09A 3HHSB 5F1SA 1LLAA 4NAQA 4TQEH 4BQ9A 4I9XA 2MRYA 2BZCA 3FOMA 4Z7WB 3ECBA 1ZSHA 3BPCB 3MZTA 2B0SH 1JMXA 3Q5YA 3D85A 2ADGB 5KJRL 4YL9A 1O5DT 4PB0H 2PN5A 4PJEB 1U8QB 3WIFB 4ZTEA 4YHYC 3G9AB 3P2TA 2DBLH 3UGUA 3KYNA 3QUZB 3QRGH 3UZEC 4BK8A 1WGVA 3FOLB 5C0FB 4X6DB 4BYHA 1A1MB 1KC5L 1KXTB 1P7QD 3RAJL 3CGTA 5TGBA 43CAA 2F08A 4FFWD 1WFOA 4JCLA 2C9VA 1XBDA 2CCWA 4FQ1L 5F9AC 3VXME 1OB0A 3X3GL 4DVRH 1CGVA 4W9HC 3GXNA 3VXUB 1PSKL 2DJUA 2VDNH 3RZCC 4JDVA 4QWWC 3X11A 2VLME 3FCUB 3QDHA 1AR2A 4TLSA 5EIQA 2VLKD 1MFCH 1AQKH 1I3RA 1QA9B 5C07E 3X1NA 5EU3B 1YQ2A 3UG5A 1J8HB 3NABH 1I7ZB 2R29H 5T1MB 5JW4R 2OSWA 3JZ7A 2ROXA 2YD4A 1WZLA 5DHYA 3WY4A 1DJZA 2XU9A 2OXHB 4MA8H 3AG3B 4OV5A 3DX2A 3Q7JA 1FH5H 2JXMA 2B39A 3GXPA 5SV4A 1SUJA 2J6WA 2L7UA 5DHVA 5MEQA 1OARL 5DJ8B 4YE0A 5HSFA 5B22A 1CUOA 1J5IA 2YMXL 3ORJA 3RQ3A 2F1BA 3D52A 2XA8L 4K7PH 5J06A 3ZGIA 4NM8L 1J05B 1HDMB 1W72H 4WWPA 1X6NA 2EEFA 1Y1UA 3CCHA 4LLUA 5HY9A 4HUVA 1EZSA 1KBWA 1A6ZB 3CXFA 3EH2A 4TSCH 5EBMA 5DD3H 2DWEB 3EADA 3ZDYF 5AW2B 2KH2B 3BH9B 5I1HH 3WFBH 2J1KA 3QCVH 4KZ0A 5JIMA 2C5DC 1G43A 2W1NA 1ZSDB 3MTXA 4NLHA 3BD4A 4W4OC 2BSRA 5FAAA 5IVOA 1TVDA 3O8XD 4Z18A 3ZDYE 1I1AA 1JXKA 5LCVA 4G82A 1QQDB 4KVCL 5E6YA 4YHML 3O9WD 5C0RL 1WLHA 2VLRE 1WYJA 3ILEA 4PB9L 2XKNA 3K3QA 4TLUA 3T4AC 5ICYB 2WN2A 1FVEB 1I8KB 4LPWA 4N0FA 2FQDA 4FNLH 5TE7H 5HD8D 3T9WA 3V2AR 4G8FB 3LY6A 5TDOB 2HKHL 4JQVC 1U8MA 2WGNB 4IRJB 5LWYL 1WBYA 4FTVA 2J8HA 5D7IB 1QLRA 3CNKA 1WAAA 3SZ6A 4TUJA 3QB7C 1JZ3A 4Y5VC 4WEUD 5GS2D 4FRWA 1TDQA 5DQ9A 4P2OD 3ARDC 3RWJA 4JANB 2H3NA 4XI5C 1MIEH 3US0A 2UZXA 3EJRA 3NCXA 4NBZB 3KPQA 4WWNA 5IT2L 5FW7A 1CD8A 2OL3L 3HZMB 3SYAA 1BVNT 2ENSA 4RIRA 2XIIA 4X6FB 4JMNA 4MXWL 4NQDD 3VA6A 1Q4NX 2B15A 3L16A 4GLRI 1GC1C 4FLHA 3V4PA 4BWWA 4ZX4A 4YQXL 2WTRA 4KOBA 1FSKB 3AY2A 2GCYA 2NY3D 4O2CA 1BXVA 2NY4C 3DJSA 3A6CH 5KOVC 2NXYD 2Y07H 1C12B 2C4FU 4M6OL 5A2BA 3MMEA 4EXPX 1HN1A 2VXSL 4LLAA 3H3KA 4XCCL 1OXYA 4PS4H 2CM5A 1M7DB 4CN6A 4UV4H 4WUUE 2YFNA 2XN0A 4JFXB 3E6FB 3F5WB 2BRRH 4FQIL 3FSVA 1ZLVK 2Z31A 4MVBC 1TJIL 4NP4L 4X0KA 2BP5M 3DGGA 4FL4C 2EILB 4Y9BA 3NCFB 3S8GB 1KACB 1YN7A 2C3VA 2XXGA 3LKPB 5F7NC 4F2EA 5JQ6L 3TBTA 3EHBB 4YHLL 1R4XA 4GKOA 2Q8BH 3CVDA 3VXSD 2F15A 5AAWA 3G5YB 2PYFA 1YYCA 2WOBA 5EZOH 3LHPL 3P9WB 5B1KA 1UJ3C 1BX2B 4NENA 5ISZD 1U95A 5FYJU 5BS0E 3OXRA 3QDMD 2ZWNA 4BIKA 1K3IA 3EFDL 3OKMB 1CFSA 2ITCB 4WWOA 1TTCA 3VXMB 5CN3A 3UBXI 3F6IA 1T3FA 1EQWA 2LU4A 3I6LD 4OCSH 5DZAA 4FQXD 2FSEA 1JD9A 4BQBA 2X1QA 4ZAKB 5EZIH 2Q8AL 1E65A 4OZGB 1PGRB 1MEXL 2WP3T 4NFDA 4Y16B 3WNJA 5B7MA 5J6HA 5E2VH 3ALXA 4OZ4B 5J89A 3L3GB 2B1OA 1CG9A 5HGBB 4JHAH 1KBVA 4XPFL 2YRLA 4XWOD 1RZKL 1ZKAA 1YYML 3O81A 2WXIA 1OF2B 1YEJL 1JHLH 1RURH 2BOBA 4KKRA 4PJAE 5JIHA 4A6YA 1AIFB 1FYHB 4FFZL 3MCKA 1J5OL 4KJWD 4Y16C 2JI2A 4KZDL 2QPDB 3T4AA 1B0GA 1VGKB 4XTRD 4PJAF 1DJSA 5F7BA 1I85C 3D30A 3JWNE 4E41D 4M1DH 2GITA 2VLRD 5CJOL 1I9JH 3FMGL 1IKOP 5HDRA 1MHPL 2R0WH 4LOEA 4F7MA 1XZ0A 3QDJE 5CIPB 4Z7WE 3TA3B 5HYEA 4HIHB 1HEHC 3R8BB 1SXAA 5C7XH 1T5WB 4MAUH 4AVIA 5SX5K 3VMPA 3DX0A 3FU9A 2D2OA 25C8H 4UQAA 3G6DH 5E9DE 3QWRD 3TIEB 3VRJA 2DW5A 1Q8MA 5ICZB 6FABH 2F5AH 4U1NA 1OP3K 4FMVA 4XPGL 5DJXA 4YO0A 4DQOL 1V7MH 5CJ8A 1O6VA 5F9JB 1YMMA 1K4DA 2OR9H 4WFEE 3U1SL 1OLLA 3NGBB 5BVJA 1UXLA 4MD0B 4R26L 3UJJL 4DHLA 3U9UA 3VI4B 2YGQA 3V5DB 3VCLA 1D7DA 1NGWA 1D9KB 4N3TA 2Y0SA 4AJ0A 5BXFB 3IM1A 3O6FB 4YSEA 3QG6B 1AQKL 1WWWX 3R18A 4GY4A 4W6WB 1YY8B 5AW3B 1ZWIB 3JVGC 1U8IB 2IQAB 4LLYA 4JKLA 5BOZG 1F4WL 1FORL 4QF1A 4JFFB 4X8XA 3AQYA 5B4MD 5HDWA 3VI3A 4YSUA 2VJXA 5F9OH 4F9LA 5GRWA 4K23H 4BGLA 1AP2A 3B9KB 3T0EB 1NFDB 4D3CH 2Z1PA 5E51A 4MYWB 5I6MA 2VSKB 2YEQA 1QYGH 2X4PA 3M88A 3OKOA 4WHYH 1UVQA 5DHYB 5I75B 3OSKA 2CO4A 5DHDA 2F19L 4QRSB 3ES6A 4TQHA 2J88L 4AEFA 4PBVC 2KLTA 3ARBA 3V4PH 5T1DL 1HK6A 1TNMA 5EU6B 3QJOA 2PO6D 4TF4A 2ESVB 4V1DA 3PWNB 1U0QA 1QSFD 1IC4L 1IAOB 3U4EA 2R83A 1U8LB 4XPGH 4DQOH 3VI3E 2VXTH 1BYPA 3VFNB 4J2XA 4ZUUA 3VSQA 3BZFA 5BMFH 1J05A 3U1SH 2YGVA 3GSNB 3QARA 4BEIA 5D2NA 4OGXL 1T7WA 4UILL 1M1XA 4JUSA 5E03A 4U1IB 5E6IC 1S7XA 1XF5B 5T1LD 3CVHA 1P69B 1MVUA 1CZ8L 1EEYB 1XEUA 3ZVVA 4PP2B 1S7RB 2G5RA 2OYMA 4Q58C 2BSEA 3LQZB 3QWOB 2BP8A 4AUYA 1GAFL 5FYLL 3WTYA 3VB8A 1DQLL 4XXCC 1UM6L 3N43B 3EF7A 4U1KA 2DIAA 4YDIL 1VF5C 2CGYA 1GY1A 4XP5L 2QLVB 3BWAA 3IAQA 5CGMA 3WNKA 4FQ1H 3GMMA 3BAEL 1OAQL 1YNKL 5BRZD 3MROA 4UZUA 4YHZH 3RY6A 2IQ9L 4JPSA 5CEXA 2DY2A 2Y69B 2JCCE 2AXJA 3MGOB 1JZ4A 2EC8A 4NFBA 5FYLD 3W3BA 4EJ1C 4FKHA 4QHLB 1INDH 3I6KB 2BINA 5D5MF 1PCSA 4IRSA 3T6ZA 3MXWL 1T1XB 2R2EA 4JRYE 4QTHA 5CINL 4OLYL 2Q87A 1HAUA 5LCVH 5T5FA 5DRZB 5F7FA 3SE9H 3R06A 2IAMA 2Y07L 3DX7A 1NLBH 1HOEA 1WDAA 3HI5H 1RJYB 1A64A 2JI3A 3DOSA 2VL5B 1SY6H 1Z66A 1T6VN 3QDAA 3V4PB 3REWA 3FUHA 1GKEA 3JWDH 1CS6A 2BVPB 3TURA 3RKPA 1M53A 3S4SA 1JZJA 2IG2L 5I8OL 4XO5A 4NKOB 5I30H 4J3SA 5C08D 1RMFL 4QJ3B 1OTTD 4HQQH 2IIJA 5D7LB 2RA1A 3EJZD 1RV6X 1NM9A 2Z31B 3HS0A 2IPTL 2B1HL 4EUPG 5I16B 4EN3B 2WLJA 4HZ1A 4QXTB 1EGJH 1UWFA 2I69A 4OJCA 1I8IA 4UANA 4MMZA 3Q2VA 3S37X 4P5RA 4BH7B 5TPWL 1FV1B 4JCWA 1ASOA 4KKAC 4JJHA 1E4KA 4PGDA 2ARJQ 2XI9A 2WXFA 2FJFB 2J12B 5CD5C 2CKBB 1NC2A 2YLKA 4MS8D 4P07A 5EOCH 2R4RL 2Y2YA 3WNPA 5D72H 1XGRA 3ZPDA 1R9FA 2R29L 4Z5RB 2OK0L 1ND0B 1SHWA 2O5ZL 4Z23A 4AQZA 1KXQA 2KL6A 3GBNL