3JT0A

Crystal structure of the c-terminal fragment (426-558) lamin-b1 from homo sapiens, northeast structural genomics consortium target hr5546a
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
TGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lamin-B1
publication title Northeast Structural Genomics Consortium Target HR5546A
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00932 LTD Lamin Tail Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1260 Mainly Beta Sandwich Immunoglobulin-like Lamin Tail domain 3jt0A00
2KPWA 1UFGA 1IFRA 3UMNA 3GEFA 3JT0A 1IVTA 2LLLA
chains in the Genus database with same CATH superfamily
5AVSB 2V3EA 2ZF8A 2DLHA 1JGEA 3VXRD 1A4JB 4BUQA 4B5ZA 2WYHA 4R5XA 4OI8A 2HFFB 3DX6B 5DFWH 2Q8BH 4ELKA 4QRSA 2BSRA 4YSEA 2F5AL 2MNUA 2KLSA 2VLKD 3BAWA 3KL5A 3QRBA 4AJVA 4YFDB 4IBQA 1TSRA 4O4YL 3G3LA 4Y1TA 2EC9U 4F3FA 2D0GA 4K3DL 2F0CA 3G6AB 1LEKB 3HRPA 2EZ0C 4I2XA 4R7XA 3T0EC 3T2NH 4B3VA 2VDOB 4ZYKB 2YRBA 2DTML 4DP4X 5C3LD 1MCEA 3CXFA 3U7AA 3QYMA 1M7IA 1H6FA 4PV1C 1RJZA 4J3BA 5E9DA 4JVWA 3ZDYE 3TNMB 5DHEA 1XCQA 1MF2L 3HNTL 1FLTX 4LHQB 5LAXA 1AP2B 3D87B 1T6WA 4BA0A 2F2HA 4JFHE 3QUKB 2YSSB 1XAUA 4N4YB 5CJBA 4O2CB 4XN5A 4FN0A 1CLYL 1CQKA 4L9LB 4UT6H 2CZNA 3CVDA 3DRTB 5F1IB 4Z7VA 3E2HB 1Z6JT 3QEQE 1GY1A 1VENA 1VCBC 3UEZA 2FR4B 2CR6A 1MHHB 4RFOH 4Y2DB 1GMEA 4NRXA 5L4JA 4XO4A 1L0QA 2Z92B 4XE5B 1A7RH 5CZRA 1NFKA 1DE4A 2QFRA 5KJRH 1BVOA 2JCCB 3SPJA 3SZKC 2BZCA 2W07B 2A9ML 5DHDA 2OP4H 4G6AD 4PS7A 3ARSA 7FABH 2X4NB 4EZMA 2PYFB 1HEJC 3C6LA 3MBEC 4G7VH 5GHWL 3QJHB 4PJIB 3G6JE 3D5OF 3P9LA 3M07A 4XHJC 2XZCH 3L1GA 1DUYA 4YHZL 2LABA 2NY5C 3N0PB 4AQEA 4HJ1A 3RWGA 3DDFA 2OI9B 4NZTH 4H88H 1NWPA 3HZYB 5D7SL 4JZNB 4Q52A 4Z77B 1HNYA 4Y1AA 3ZR6A 3EOTH 2ITDB 1Q0YH 3PHOA 3RY6C 1A9EB 4N6QA 3BCFA 4FQLH 1L3NA 4N0UE 5LBVA 3BLPX 2H6PA 3TO4B 3VXUE 1BZ9B 1UHVA 3HE6A 4M5YH 1JK9B 4X83A 1DVFA 5KG9A 1JRHL 3I2CL 4JE0A 4ETYA 8FABA 5SX4I 1FPTH 4A6YL 4A6YB 3NPZB 2FGZA 1UWXK 4U6YB 4ZW5A 1OCCB 5EOCH 4WI9A 4L48A 4GBXD 4NCC1 5DMJB 5MHSE 1F1AA 4F7MA 4AW4A 1KCKA 1SMDA 2B5IC 4PJXF 1F90L 8PAZA 1KWGA 3U79A 4OLYH 2A9DA 4EDWL 5I5JA 5F8RC 5MENB 2IH3A 3HLAB 1SBBA 1Z9PA 2I32A 1GJUA 1URLA 5DD5L 3DJ9A 2BY2A 3MREA 4FFYH 2FZ3B 5HYJD 4JFSA 4X8JB 1UA6L 3KGUA 1U8NB 2NUTA 4DEWA 1G0XA 4I77H 1IIKA 1JXJA 4LP4A 1XGYL 1CR9H 2ZAHA 3LD8C 2FX8H 3RWFA 4EI0A 4U6XB 4JO3H 4PTTB 4HIJB 2XWBA 1T7VA 5BS0B 4Z5RA 3F64A 4FQPA 1I8IB 2I5YL 2XYBA 2BW4A 1N2RA 1JGLL 2Q7NA 3FB6B 3QNFA 1HHIA 4FXKC 1KCRL 2IAMD 4MHHG 2Y2YA 2CUAA 1J0ZA 3GSRA 3WIHA 1KFGA 1R17A 3D51A 2DLFL 3QUZC 4JPIB 3O3AB 5GGUB 3WHXB 2RAMA 4X9YA 4G42B 3QJUB 5SWSA 2NY7H 3ZT6A 4WHTA 1WBXB 3ESNA 1LMKA 2CPUA 2RBLA 5C0DA 2CMRH 3CZFA 2W92A 1MN4A 4CVXA 3IJSA 1ZGLA 4FQQB 5LXVA 4L4TE 4TVPD 3VXNA 5E94A 4AEHL 3Q2LA 5H94B 1DVZA 3KH4A 3E6FA 2HKFH 1MI5D 1BX2A 4TUJA 3AAZB 43C9B 2BY0A 2WYZA 3CCHA 3P40A 5BMFH 1MSPA 2DWTA 5KW9L 4GIPD 5FO9A 4A63A 4WWKD 3T9WA 4RGMB 3FTGA 3LV3A 1M7DB 4MWFB 2FGWL 4XAKD 3MRJB 3BAJA 2AC0A 2ZX8A 3QR0A 5C6TL 1PQZB 3WSQH 1E4XH 3GMNA 2Z8SA 4PG2C 3ZHKA 5JHBA 4NXSA 1D6EB 5EEZA 5JPMA 1KNOA 1X4XA 3APNA 2FJFA 3SQBB 3M1BB 1ORQA 4RGOL 4DK5A 1IGYA 2F54E 2XFXA 1OE3A 2LLNA 3ARBB 3WJJC 5GZOC 3P73A 3X3FL 3PWVA 1NBZB 1XIWD 4GI9A 2FT7A 5A2LH 1NCCL 5GPRA 4Z3HA 2WQSA 3P3UA 1A4CA 3ZVVA 1S7VA 3AADB 2VW7A 3HR5B 4HWUA 3ZSSA 1DQLH 2ESVB 1PZUB 1ACYL 5F88A 1HE7A 1IAIM 3QIWB 5IB5A 1Q90A 4D0CB 1W72L 1W72B 3G08A 4NQQA 4WI8A 3AM8A 4PW9A 5D7LB 3OLDA 3VFWB 1RHHA 3UTTB 1NDGA 3HG2A 4G9FB 2OR7A 2Z64C 4XPFL 5GGSY 4Z7NB 2WIMA 2NXYC 1U93A 2H41A 4DGIL 4CSSA 3NDZE 4TLUA 3VW3H 3WE1A 4G1EA 2AK1H 2Z0UA 2C9QA 1PY9A 3Q9QA 4KTYA 1WZAA 2AAVA 2QQNL 1JSYA 3HS0A 1NKGA 2FEDD 1JFQL 4P2RD 1U6AL 3M86A 4A38A 4NP4L 4YGAB 2H32B 1LK3L 3FXIC 4PJ8D 4YZFE 5ANHA 2RD0A 4QRPD 2ZG3A 4Y7OC 2X4SB 2P5WD 4L4VB 3ZKQD 2MPAH 1TLKA 4XO8A 3ULVD 3T4AB 2DMKA 2Z31C 4HEPA 5AG9A 3VH8G 2BMKB 4EBQL 4DK6A 5J3HD 5I1DB 1H3PH 1J8HA 4TXVB 3W2DH 1DO6A 3QXTA 4JKKA 1RUML 3BJLA 4AZ8A 2NSQA 3AQYA 5JPNA 2COQA 5IW6A 2QQKH 3BH4A 3HI6L 3VG9B 5MEOA 3QHZH 5ICZA 1U8QA 1A6UL 3V4VH 4CU8A 5C2UB 1G6VK 3DVIA 4L8SB 4K71B 1GVIA 2WTOA 4TQIA 2OULB 4QKXB 4ONGH 4OY9A 1SDDB 5FW8A 4XTRD 4DKFH 5AAMC 2X4TA 4ZDHA 1XH2A 3WNKA 1PX3A 2A6KA 4H8VA 1RKRA 2GBVA 1N5YH 1U92B 4Z78A 3G5XB 5T3XL 4JFWA 2XZZA 1A02N 3WXWL 3R7QA 4R7NB 4R4ND 4FZEL 3TT3L 1AGFB 3VU1A 2OMXA 3WV0A 4G6AC 1L6XA 3QEHA 3NUKA 4OLUL 2ZOUA 5CHNB 3BZDA 3NP3A 4PV9A 3GJFH 4Y9GA 5DD3L 3C09C 4G6KL 4GEJA 2X70A 4BINA 1KJMB 1U8LB 3QZNA 3RI5K 4PGZA 5B38G 1IV8A 4HSCX 1TEFA 1MJJA 3IXAB 4NO0B 3BAIA 4X99A 2DM3A 1B2WH 2PXYB 2RIKA 3BZFA 3QQ3B 4U0RB 1CF8H 2AF2A 2B1HH 3LEXB 1GZPB 1V3LA 2HA1A 2PYEA 4X6CA 1E5BA 1CDJA 4XZUB 3BZEB 5J89A 1IRAY 2ERJC 5L7XL 4Y16A 1BP3B 1CPUA 1T0MA 4GBXC 3MACL 1TZIA 2WXFA 5DU7A 4GS7C 1R4XA 2FWUA 3S96B 4EE2A 2IVFC 3ARFA 4HXAH 4AGPA 2BSSA 3S8FB 5EUOB 3OKEB 5C0JB 4J3OC 3F7VA 3EUUA 1PZCA 1ZE3H 3DLQR 5T1LA 3S9DB 5BUPA 3F84A 4BFIA 4K3JL 4LEOB 4QGTA 2P4AB 2X1QA 3MPCA 1R24A 3UBFA 3GMOA 4KRLB 4Z3GA 1XD1A 1MH5B 2V4LA 4S1QH 4Q56A 5AOLA 2CHZA 4X7TB 3OB0K 5IQ9B 2B3IA 2MTAA 2DQDL 2IPKB 3NEEA 3O3DA 2IEPA 3OGCB 5IFJA 4FL4B 4R8WL 2CGZA 2Q8BL 3MLTA 1QWNA 4QHLB 3HRZA 5J8OA 4JN2B 4ALAC 2OL3B 3VFVB 4XNBA 2NDFA 4LSUH 5F0LB 3GGWA 3GRWA 4YSUA 5EBGA 3OTTA 3GXNA 1LO4L 4IU3A 4JX0A 1A6ZB 1LDPH 2JQAA 3KL0A 4RMWA 5GRXG 3RIAK 4BH7A 3IFPA 1WD9A 4NSKB 2IDCA 1SQMA 2NLJA 1JGDB 3QDJA 1JNLH 1OARH 1TENA 4TF4A 1KMGA 4HEME 3VI4B 5KSVA 2AEOA 4F20A 1HQ4B 3B6SA 1AGEB 5FF6B 5I9QB 3GHBH 4XNMA 1AGBB 5KSBE 2AV7B 4JHVA 4F27A 5KS9E 3KPRD 3MRNB 2GSIA 3O0LA 5I1HH 4GO6B 3M1OA 2GIXA 4FG4A 1AZUA 4MCYA 5GGVY 3QFJB 3QJFB 3UTQB 4KZDH 4YIQA 5EOQL 1GJWA 1QTSA 2HWZL 2WY3B 2AQQA 3TO2A 3ZKXC 4E0RB 3LMJL 4AM0Q 1CFTA 4ECNA 3US1A 4YL4A 2X42A 4UTBH 2ICEA 2UXGA 4XCNA 4WWKC 3RKPA 3KYOA 3NRQA 5DJ6A 1S7UA 1CBVL 3UC0H 1VFUA 3LN4B 3T8VA 5E8NA 4GG6B 4ZUUB 3WKMH 1RZFH 5JIMA 1IAOA 2ZZUT 4R0LB 4Z1PA 2K3HA 7FABL 5ETUB 1S9WB 5JQIB 1EFXB 3EOBA 3EOYG 4GT0A 4OZFG 5DVPA 5I1AA 3QUXB 4FMVA 5F7UA 1OTSC 1MZZA 5D7IE 1HHHA 3L7EB 2AXGB 1QLEH 3DXAD 3PE9A 3CH1A 4ZFGH 1SXBA 2IANA 4X80H 1F1GA 5IMMA 1XIWC 4ZFZA 1MCJA 1S7SB 1OOWA 4I4WB 4NOFA 5DXWA 1WFNA 1R5WB 5J7CC 3R8QA 1CXEA 5ITBH 4OJEH 3OC8A 4EO5A 4Y1AD 5HVHB 4FQLL 5TDOB 5SX5K 2GI7A 2EE0A 4M5YL 4OFQA 1MCNA 1QO3B 4NFBA 3HE6D 4QXVA 5I30H 4G6FD 1FPTL 2HT4D 2XV0A 3TVMA 4WUKH 5L9DL 3UMTA 2AK4B 3B9KD 3EHBD 4FG2A 4PRPA 4QYOA 2P49B 2VABA 1XSOA 4WTWA 4CGUB 2J56A 3MODH 4ZMYA 2WKOF 4FHBD 5BV7B 2WUCL 5BO1H 5GGRA 2FEDC 5BZDB 2XN9A 3S34L 1NDMB 1AJ7H 2ARWA 1ETJA 4N2KA 3TPUB 2VZOA 3KCPA 4PJ8C 3GWJA 5D1ZA 5D2NB 5E6IA 4PLNC 2YFOA 1QBLL 2XQBL 2QQQA 4UDTB 2NY0B 4EKXA 5HHOB 2VLRB 3SYCA 4FTVE 2CLRB 4N20A 4QT5B 5EC1B 3BVNA 3ULVC 1BEXA 4H1LB 4JDVB 4ICXA 4LVOC 5J3HC 3NRPA 3MCYA 5LNDA 1HEZB 3PWLB 2OXHA 1N70A 3RDTC 4GRLB 5C1MB 3M8OL 2VSMB 4LNRA 2J44A 2R7EA 2E47A 4TLKA 4ZMWA 2VN5A 1K4DA 2VW4A 2I7SA 3HG1A 3J7HA 5F0PB 1XQ4A 3RWJB 5ABDE 2X28A 4CJ0A 2IADA 3QHTC 3WFCL 5JHDA 1T5WA 4XTRC 2OKMA 5DK0B 5GIRA 4MAYD 4PN6A 3U4EB 3RVWD 1U3JA 2QSCH 3PAVA 3K71A 4L29A 2WQWA 4DZBA 2CJUH 3VI3E 3TT1H 2V9QA 2G9HB 2CMRL 3VJ6B 3C08H 1DL7H 3V0AC 4JB9L 3SGJA 4CADB 4DWHA 3B37A 4JM2F 4S2SB 1AD0A 5H35B 4HV8B 3DA0A 3QDGA 4G72B 4IRSA 1WFOA 4J2QA 2ZCKH 4TSBL 4IK7A 3T1FB 3SDYL 4GQZA 4GYBA 4XNUH 5BMFL 4PW3A 3WTUA 4RSVA 1BXAA 1BG9A 4JRXA 4OCRL 4UV7H 4Y2OA 4NHCH 3E6HA 1HILB 2EDWA 5I6MA 1J1OH 4WJKB 4FQXA 4PJDB 1KXVA 1N0XH 3BPLB 5FAAA 3KS0H 4DTGH 4LDCA 4YDJA 2ZSVA 1WAAA 4HXBH 3SYOA 1BD2B 1CIDA 5CSZA 5F1NB 1OCWL 3K6SB 1BQUA 1G6RA 1FFOA 1IQWL 3W0WE 2H2PD 3A6BL 5LHDA 3QZLA 3WTTA 1UZ8B 1UQSA 5ICXB 2Q8AL 5LNEA 3RPIA 3UABA 2FYVA 4LOVA 1A1MB 3L5JA 4NKQB 3EGSB 3KGTA 4D7PA 4PJ9B 2KI6A 4XCCH 5CINH 1BFOA 4FFWD 4OCSL 2AABH 2HG5B 4FKHA 1GSKA 1SJVA 1XF2A 1XF1A 1RCYA 4K5MA 3K8MA 3JYBA 4W9GC 1QRNA 1SNRA 1OAUH 1JHKH 1NGYB 1XO8A 5D9SA 4LCCB 2CGYA 1T04A 3VDBA 2AK1L 2DEYX 3RTQD 3T6VA 5EU7E 3GSXA 2IBBA 4JFDA 4S1SH 1KXQA 2GBAA 1KYOK 4G8FB 1AYOA 2CBQA 4OCMC 5J06A 4IMKA 2WVVB 4TQHA 1B6DA 4WW1B 1MCRA 5EZIH 2AJUL 2ZCLH 1CGSH 1ZDSA 3DV4A 3V5HA 1I1FA 1HINH 2XIBA 4FQ2H 3C2AL 1I9JH 3ARXA 1P9MA 2XG5B 4MNQB 5A3ID 4P2QB 3BN9D 1OGTB 4LCWE 4L8BB 4RRPM 5CLTA 1EXUB 4QHNA 5I66B 4JHBA 3RL2A 3CLFH 1E6OH 3FFCE 4KHTL 2DBLH 2UZPA 1H3PL 3MNWB 4LL9A 5D2LB 4KXBA 2F1AA 2RCSH 1TQCB 3IDGB 3VSUA 4PJXE 4Q9BA 2YPLD 3L4CA 3U36B 1NBVH 5F70A 4M4RA 1GKOA 4GRWB 3HJ0A 3I9PA 3BPNB 3MUZ1 3U9PH 3W39B 2WLLB 4ONGL 5KYUB 1CFBA 1CL7L 2D3VA 3FT9A 3WY3A 3N6YA 2X4OB 3BKCH 1OAKL 4N2LA 1DTUA 4UNIA 3H2PA 5E2VH 4I85A 1HYSD 4AE0A 1ASQA 3S88L 1R0AH 1JWMA 4TYUA 4XCEA 2VOTA 5E6ZA 4Y2NA 1SOXA 1X5JA 2BRQA 2YD0A 4KI1A 3W5MA 5JQ6H 4MTMA 4NO5A 1JPGA 4DKEH 1AZBA 1XF3B 3SE6A 2BNQA 1C16A 3BVWA 4K2UH 5I5MA 5KBKA 1OHQA 1RURL 4H8WC 3ZE1F 1RL1A 1X5HA 4PJ5D 4YK4B 5EC2B 1OP5H 3ZRFC 3WL9B 3BT0A 3BAXA 5E00B 4HWEH 4MMYA 2XXCB 4FQ1H 3OMIB 4XBGA 5DUBB 2XQYG 2CLZB 1IM3B 1MQ8A 1TFHA 1CD1A 1LWHA 4OSUH 2A2QT 3C8KB 3U82B 2DQMA 3GNMH 5I1IH 2ICCA 2BERA 4MCZA 6CGTA 2K6WA 4IRJD 1G5AA 1F97A 1YA5A 4W1TA 1UKQA 3EKCA 1B9ZA 3EYSL 4ZUSA 2B2XH 2FWLB 3UYRL 4PAZA 2PKDA 4JUTA 1ZMYA 3C6SA 3GI8L 3HE6C 4JCWA 3WUZA 1DVFC 3FB8B 4LBAA 4M7ZB 4ZTOL 5CU5A 2HT4C 2GG1A 4OZGF 2M26A 3KWWB 3EHBC 4RZCB 1TZOA 2CD0A 4JZOB 4MQXD 3UTOA 4NO2B 4LFHG 1KYAA 5D1QD 3ARFD 1CB4A 2IJ0C 3GXUB 4Q0XH 4JKWA 1ZLUH 1WH0A 3TV3L 2HN7B 3BVDB 4ES8A 1HXMA 1H8NA 1BFTA 5EEVA 2BOLA 1F58H 2PCFA 4NQDD 2I26N 3DGCR 4J2XA 4QRFA 4MJ2A 2C9PA 4ZS6D 4KQ4L 1SM3H 3WDHA 1OVZA 2AJ3A 2UXVA 4JMNA 1A3RH 1M1XB 3LKSB 5D7JB 3T0AA 4UIMB 4HFUL 5DYOA 5GJSH 1UM4L 5I8OH 2AQRA 4OLZH 2Y07H 5AKRA 5DSCA 3BT2L 4AQ1B 1MCWW 3FNKA 1SDYA 3VX0A 2BSED 2ZUQC 2A6IA 3K2UH 1E5AA 2BVPB 1U3HD 2JQZA 5EZJB 2Q0ZX 3TP4A 3WEOA 1DJSA 5DEGB 1LDPL 4W4OA 1MVUA 1KTDA 4H26B 4BHUA 4IOSA 5IR1B 1INQA 4MAYC 4CVWA 2YOAA 3CX5K 3BDBA 4RWYH 3RVWC 3QDJD 4X8GA 1QBML 2HRPL 5DLML 3RFZA 3U30C 1U2YA 3NCWA 1HEHC 4Y4KD 5IB1B 3RWIA 1BAFH 5JQHC 4W9CC 5I19L 4U7KA 1RUQH 2FATH 3VD1A 1JUFA 4YAQA 4OJDH 3SYAA 3GM8A 3U83A 5ANMA 4RA0C 5C86A 3NCYS 1IJNA 5F72S 4LARH 1EA9C 3VFMB 3OKNA 3WTYA 1UACL 3G5ZA 4AZUA 1IC5H 4LLMB 4W9LC 4HWZB 4YSAA 1M2OA 4EKJA 1N4XH 3UMNA 4M5ZH 3ZHNA 4OCYL 4XP5H 4OD3H 2XTJE 5AKTA 4NQSB 3UC0L 4M93B 4GKSB 1RZFL 4B9YA 5AUMB 2OFQA 1FP5A 4KI5D 1Z9SA 5CKAA 2OMWA 1V7MH 2L7JA 2D2CC 2XETA 5BRZE 3SDDD 2EH8H 5JPMC 3X17A 1ZXKA 4JBSA 3JUZA 4N2EA 4OFYA 1CFNB 1ZK9A 2JXMA 1UXWA 4ZFGL 2EXTA 4URKA 3V0WL 3S8GB 1N59B 3O4LE 4LK4A 5F21B 1R3IL 1DQMH 2H2PC 2IAND 5F7EH 3DO7A 2JTDA 2ZOLB 1MCLA 4MQSB 3DIDA 3SGDH 1CUOA 2R56H 3DX3A 5CFHA 3UYPB 2NT0A 4KZCA 4CC1A 2ZCZA 1AQKH 2QTVA 5B3SB 5HGHB 3I9IA 3RGVB 1X7TA 2NCEA 4X8CA 3F7YA 3HPLB 2XWJB 1ZLEA 2XWDA 3BGFC 4P5MA 5F1SA 1AXIB 3H4FA 3CFNA 5HHME 5HBBA 4FMKA 1UD8A 2Y7QB 4WNSA 4KZEL 2DKMA 1NICA 4KXZI 5FGRA 4U1JA 1IAMA 4P3DB 4F9LA 3DO4A 4MQTB 1DVXA 1EVUA 1ERNA 1N8OE 2VDOH 1DDTA 3Q6GH 4K55A 4PRPD 4PV8A 5ESQB 5C08A 3T8XB 4A37A 2EDNA 4XMWA 3TEYA 3RG1C 1Y18A 1EIBA 3OLEA 1TU2B 5DD0L 1FNHA 1KG0B 4L1BA 1G1YA 1AJ7L 3ZW3A 3C5XA 4L1DA 1ZXQA 4Q4EA 4DERA 2I9LB 4V2BA 2DQGL 4BCZA 1EMTL 4LAQL 4Y89A 5D1ZD 2EXYD 5A3IC 2D3JA 2R1WB 3BN9C 3QNXA 2X6AA 3SJVA 1HK6A 4FA6A 1KXTB 1RK7A 1OP4A 2XX1A 2Y25A 4K8RH 3B1TA 4QTIH 4M7JL 4ADGA 5IMOB 3OKOA 2YRZA 1VPOL 2OMTB 1IBGL 3OF6A 1FZMB 4DHLA 4KKZA 2YD4A 3HPJB 1H5BA 1IGML 4APXB 5F0JB 4E9RA 1M71B 1C5BL 5I2IB 3HG1D 5E4EB 2ZWSA 3KNBB 4C83A 3ARZA 5E1QA 1UT2A 3EDEA 1DANT 3RFRA 3AVEA 3PWUB 2E0PA 2GCYA 1C08B 2GJ6E 3GS0A 4MA7H 3S3SA 3HZKA 3SDXA 2CJUL 32C2A 3WEXB 4ZMNA 1C12B 5JW4Q 1HYSC 3CDZB 3TT1L 3HEIB 5CN1A 1E4WL 1WC7B 4JDTL 2JWYA 1AKJA 1DCEA 3OJDB 3U4AA 5I1KH 2G75B 5JXAL 1JF6A 3RVTD 1FCCA 5AVTB 1NL0H 2PWGA 2XNAB 3Q5YA 1KIRB 2AMGA 1FZJB 2DJUA 4LESA 5KYXA 4OBSA 2XC8A 4G8GE 1K85A 3ARDB 1WWCA 1DBJL 2CIIB 1Q8MA 5HVFB 3NZ8A 4UV7L 4NUGH 5CUSH 4NHCL 5LXGL 1I7UA 2DWDB 3VAEA 3CVIL 4ODTH 1RLWA 4YSRA 4P5KB 1J1OL 4XHQA 2X9ZA 1DZ0A 3CU1A 4X7EC 4ZUWA 3M1CA 5DEFB 3QDHA 3SZ6A 3CAFA 3P0YH 1K8DB 2Y72A 2ZNWA 4GQPH 2E7CA 4U4IA 5M94B 1YMME 3TF4A 2R8SL 1FDLH 2JKXA 1P4BH 2X0UA 2XVLA 1NMCB 2X2JA 4FE9A 1IEAA 1IFRA 4PEEA 3VXOA 4EJ1C 4XMTA 4MQXC 4JJHA 4Y19B 4NJ9H 3VXMA 3LQZB 1LP9F 1JE6A 5CBAA 3N42B 5D1QC 3ARFC 1F13A 1P2CA 2NTSP 1HXKA 5FIEA 2Q7YA 2ESVE 1QAWA 2NY4D 5CINL 3A23A 3PGFL 1UC6A 2F53B 1CD9B 3FU6A 4FQJH 1ND0A 3QCTH 2ZE0A 1R3JB 1SVBA 3VH8A 4G3YH 4ZS6C 3PJNA 4PJ7A 1NIAA 3UTTE 4TUKH 1MCOL 1RFDH 1WA2X 2ATPA 1QRND 1KB5L 5GRJH 3LRGA 2P5EB 4NHUA 4AVKA 4FHKA 1OAYH 3MRGA 3HAEH 4ZFOB 4QRRB 4GY4A 4MGXA 4LCUA 4AQOA 2EE3A 2IWGA 4Z0BL 1C8QA 1A0QH 4X5XB 4X9FA 2VN7A 5IVZA 4HSAC 3O4OC 1TQWA 3HRZC 4GKNA 2F08A 3RA7H 1I4FA 2BIMA 2ZCLL 1CGSL 5CS7A 2IBZX 1HINL 4HWBH 1U3HC 2BRRH 2X6UA 4PH8A 1JPFB 2FIKB 3BQVA 1U0QA 5HY9B 1V55B 3QEGL 3LAFA 5GGVH 3LPPA 1VEPA 5LCVL 1OHZA 3KDMA 5T33L 2EE2A 1AY1L 4PFEA 4G8EB 4R96B 3CLFL 3EYOB 2DBLL 1BPLB 3UC2A 4L1LA 1VDGA 1ZSDA 1U8HA 4ZG1A 2O61B 4Y4KC 3UTPD 1EXHA 1BW8A 4RAVA 4MA1C 3WUWB 1OF2B 3TBVA 1NBVL 3IMBA 2UY6A 3LXCA 1JPTL 5DUJA 4PRIB 4N9GB 3U9PL 4M1CD 2ADIA 3CBJB 35C8H 2PO6A 5B38A 1C5CH 1Q0EA 4P9HC 3U2JA 2FNWA 3IDJB 5F96H 5E08H 3WFBH 1UOVA 4C8XA 3WY1A 1DSWA 1YEGL 3UPRB 4D8PA 4OW6A 5CLYA 1KENH 1MXGA 4MQ7A 4JR9H 4BM7A 3UJJL 5HPMB 4ODUB 3CK0H 1ID2A 1WE5A 2KBGA 1U9KA 3QJSB 4OR1A 1LHZA 5BXFA 4WO4A 5FC9A 2DRUA 4JKLA 1TMQA 4P4KD 2VR6A 1JP5A 3PL6B 4DEPB 4ONFH 2YUVA 1NCAH 4KNTA 2BNQD 2C1PA 1NC4B 1M6OB 2MWCA 4UQEA 4DQOH 3HHSB 4O5LH 5ESVA 4DZ8B 4FQ1L 2HAZA 1N67A 4KY1L 3NZUA 2WQXA 4KKAD 4RGND 4M1GH 5DTFB 1IB5A 2FNBA 3GZQA 1IC4L 4WFGE 2H6OA 1X7SA 4OSUL 1G7JA 3RWDB 4MDJB 4UQAA 3KPNA 1HXYA 5KBDA 2Z35B 1NUFA 2DJSA 1I1AB 1IZKA 3QUMH 2VJXA 4LKCB 4UT7H 3H0TB 1W8EA 4Z7UA 1AMXA 3GDCA 1F4HA 1GRWA 4O2FA 3N2JA 5DJ8B 3DVNA 1YEEL 1F02I 3L3JB 4UT6A 5TE4L 3ECVA 3QG6B 2Q20A 3ZDZB 3W37A 5BZXA 1LDSA 1O9WA 2VC2B 2HVKB 4A7VA 5LNGA 1F4AA 4Q0XL 4MXVF 4X9BA 3MRQA 1VADB 5IFHH 1F6LL 1CF1A 3PQYA 4RIRB 4C59B 1E8WA 2DB8A 1MLBB 3UAJA 3OSKA 2BFGA 4KROD 3TEZA 5FECB 4FFZA 3VFUB 3BXNB 4WEBL 1CYXA 5D1ZC 2EXYC 3RX5A 1F11B 3V95A 1KLUA 3TA3B 1Z3GH 1INEL 5L4IA 1HSAA 5FOBB 5JW4N 4A2DA 3NZHH 3BIKB 3LH2H 3MJ9H 5C0BA 1BQKA 3P2BA 3CSYA 3WY2A 4HGWA 3RX9A 1TCRB 1EUUA 1JWSA 3RL1A 4KJPD 1CDCA 3SD2A 2V6HA 5GS2H 2EVFA 3VXQB 2EE9A 4OZIF 4MSWB 2D7MA 2FAUA 5AW3B 3QORB 3P54A 4MJIA 5IFAH 2P26A 4OIAA 4U3SA 3VB9A 5CJXA 4F92B 3U9UB 5F3HB 4J3OF 5AZ2L 1YUHB 3DMMA 5DJ2A 5ICYB 3MLSH 3U2SB 4XWGH 4B9CA 1SMAA 1R3HB 2EYRA 3MTXA 1EHKB 4IHOB 4UQDA 4W70A 4IOSD 4AMKH 2BOBB 1UZ6F 2Q7AA 2WWNA 4GW4A 3IBEA 2AAAA 3OXSA 2Y5QA 2FQDA 1BAFL 2XPZA 3D39A 4OZFA 4WDIA 1FHGA 2ZUUA 3TJEH 3R06A 2FATL 5FYJE 4BQ6A 4Z7WA 4FYTA 5HJBA 3SGJC 3HE7B 3RIFF 1IBDA 2D31B 2HZHA 4K0OA 3VI4E 4K73A 5BPPA 3KBHE 3QEQA 3RVTC 1HS6A 4PTUB 3EFDL 4HUXA 3QFJE 3K2KA 4QAMB 1XBDA 3HKZA 3S97C 3V4UH 4YO0B 2YEQA 3STZA 4M5ZL 3G9VA 1Z7JA 4OD3L 1X6LA 4QTHA 5I26A 1DVSA 2IH9A 2X6CA 3O2DA 4RFEB 3UDWC 5ITFA 2JIXA 3H54A 3N42F 3T09A 3MJ7A 4JFPA 4URTB 4AC2A 3PHAA 2WK2A 4FQXC 5JW5A 3SDCA 4GQ9H 1OSPH 1A4KB 3DX7B 2YXFA 4KOCA 3VMPA 1I3UA 3FTWA 3OQRA 1PFOA 3GPSA 2L4OA 4EVNA 2XBDA 4ZQKA 3UBXB 1JF5A 1M2VB 1TF4A 3KXFB 5DD6B 2DWEA 3Q8BA 3BKYL 4ODSL 2W5PA 5AW0B 2YPVH 1HIMH 5TE7L 2APWA 1NAMB 3QJXA 3I6LE 4B9GA 5I76B 4NFDA 4JRFA 1EAPA 3MRCB 3ZTNH 1AQKL 2FLBT 2EACA 1K72A 4N0UA 3HC0B 4RAUB 3CFKB 5F7BA 4KUZL 4BWWA 3KYKH 1WBZB 2NY4C 4E36A 3KAAA 5EF0A 3K1DA 4FXGA 2BNRA 1FVDB 3JTTB 4ZTPH 5CGTA 3CVHB 4MCNA 5IGXH 3LKNA 3ZE1E 4YEEA 1YEIL 3WFHB 1EJOL 5E9NA 3Q2VA 4GQQA 4XOAA 5T1DL 3NP4A 3TA4D 3RUGB 3TS8A 4O02A 1RIHH 4DJMA 5DJ0A 4JFEE 5ADPH 4J8QA 2J1KA 3OJVC 1J5IA 1L6ZA 2J6EA 1PG7W 5FYJH 5C08D 1ORSA 2EEBA 2J1WA 1MAML 2DL2A 3KVQA 3M46A 3OPZL 2XQYK 4X6FA 5EV7A 1HHKA 2LHAA 5AEAA 2B1OA 5I24A 5E2TH 2CXKA 4TUOA 3P3TA 4JFZL 4UTCA 4IMKC 2OTUB 2AW2A 1KIPB 4FGMA 2J57A 1QHOA 1OW0A 3K72A 2BJML 4B95C 3SN6N 3DYPA 3MLRL 1FFRA 4GI6A 4L4JA 4ZD3H 1P9MC 2C9VA 5D2NE 5D72L 3MMEB 4BV1A 1J9RA 3THML 4OZGE 1VFAA 4IEFB 3QDMD 3TBSB 5EZOL 3VFOA 3OF6D 5E8DL 2H6UA 1V27A 3II1A 4OF5A 3S3JA 3TX4A 4QNPF 1FFPA 1JL8A 3C5SB 5CLWA 2A6DA 1YJDL 3UBHA 3KPPB 4NZ8A 2A1WH 2K7QA 2OJEB 3OAZK 2D7TL 4RX4D 5GS1A 4M1CC 5E7BA 3CUPB 4HFWA 3FQWA 3IFLL 1I8AA 4EN2A 2CXGA 4TQ8A 5J6HB 4N9OB 3ULSB 2VR3A 3MV8E 2Z8RA 3OMAB 1WZKA 4MA7L 3MRLB 1P1VA 2J20A 3FTZA 4PGCA 5T5NG 3AU0A 5HJDA 1N7MH 1IAKA 2YHGA 1ZT4B 2OW6A 3NTCH 3OV6A 5EU6A 4ZAKB 3CPLA 2YARA 3BSHA 1WUZA 3UTSA 1SVCP 5J6SA 3H9SA 4G1MA 2WBWB 4L4TA 1UB6B 1TNMA 3K6NA 1KCWA 3ULVF 1OE1A 5I1LB 1AKJD 1PZSA 4JG9A 4KBPA 5J1TC 2J2ZB 4MJ5A 3TBCA 1AI1L 2IH1B 5EPMB 3ZDZF 3S35L 1P84K 3H55A 5JXEA 4KKAC 4RGNC 4Z95H 2VDMB 1PZ2A 3D4ZA 3NIGF 3VD5A 1Y7VA 2PPEA 3LYRA 5LBGA 2C1OA 3S36X 3VSTA 1CE1H 3D6GA 2JKNA 3CH8A 3V0JA 2I9TA 4YWGH 2EO1A 2ZKXA 4M6AA 3IGUA 2CO1A 1TTBA 2OQJA 1O6SA 1G9NH 1Z9OA 4FP8H 3MUHL 2AZUA 4WJG3 1R9FA 1Z5HA 2RQ8A 1ZTXL 1FDLL 1MDAA 3IJYA 5K9JH 4Z7OB 3I02A 1D9KA 5DA0B 3FO0H 1Q1JL 5FKPB 2K9FB 2AJZA 2WSDA 2B0SH 4JY4B 4ZO9A 3D3VD 2HKHL 1PJWA 2JJWA 1U36A 4HKJB 4XBPA 1FQ9C 5C0GB 2MOVA 1HQRB 4BQBA 2DH2A 1P5UA 4KROC 1FYTD 4RVBA 1YEFH 2V3DA 4ZMZA 4FQJL 4K9EL 1SRDA 3C8DA 4LXFA 4WW2B 1SBSL 3VX1A 1NBCA 3GJFA 2FBJH 5FFLA 4HHGA 1MFDH 1Y6KR 3OKKB 4L3CB 1NIFA 3MV7D 2X2YA 1DBKL 5GRJL 4QCIB 1CFQB 2BY3A 3S2AA 1OAYL 1UWGH 1CGXA 1XAKA 3O3EA 2ZKHH 3LQMA 5A16B 4GQRA 1E4JA 5E8OB 1A0QL 2Y36H 4KJPC 3NESA 2NX5E 3OR6A 3QFDB 3KW7A 2H3NB 3GXIA 4KKPA 4ELDA 1L9NA 3EH3B 4HWBL 2Y1AA 3K6FA 3C75A 4BH8A 5I6XB 3MI6A 3QB7C 1KEGL 2YRLA 5DDHA 5GGVL 1QSFB 3VA2C 1HU8A 1OCOB 1KNOB 5ID0A 2UWEF 5L2KE 2ZTBA 5IW3A 4EI6B 2RB8A 5IKCA 3CD4A 1QD0A 2R0ZH 3KYAA 3P02A 5I17B 3RFZC 3OAYH 3V5DB 4F15C 3KLQA 3SOTA 4FDWA 4EZLA 3ME0A 4BQ8A 5F6IB 3QEUB 2GTWA 5JOFA 1BAWA 4YPGB 4ELMB 2WNXA 2DJMA 5DRXB 5CGYD 5B7MA 4ZPTA 4U3XA 1JGUH 4PJAA 5LVEA 4JFFA 3ESVF 35C8L 3C5JB 2XQYA 1C5CL 4PLJD 5F89B 5F96L 2IBGA 4OZHB 3ZRCC 1F5WA 4H8QA 2KZBA 2ZOOA 3WO3B 1UEYA 4EI5B 1R75A 4R6UA 3N1MC 2CO6A 3OHXA 3Q1SH 1P6WA 3WIAA 2HUHA 4OF7A 2EXSA 2DWYA 1SYVA 2FT8A 2YEVB 3FT3B 3SPVB 3WKPA 4BCXA 2XPGB 3WFZA 2YA1A 1E3ZA 3KLSA 2APXA 4X5RA 3LQAC 2Y7LA 1JZIA 5IBTL 3FQ4A 1VGKB 1JERA 4KO6A 2ED7A 4JFQB 3HS0B 5DRNB 3WEMA 1RJLB 3QISA 4PGDA 2EIBA 2EDKA 4HSQA 4PP2A 3UFIA 4M1GL 1D5BB 5B8CA 5JOPD 1RVFL 2CGRL 4WFFE 3IMWA 3JZYA 3B5HA 4NQEB 1FZKA 4HIXH 3D06A 3WN5B 3O11A 1KPRB 3IGFA 2ODIA 2EO9A 3PP3K 4GJTB 4Z7VF 1XMEB 2CUHA 3QUML 1BZ7A 3MRHA 4YR6B 1RZKH 4UT7L 3EW3B 2ZPKL 4YQXH 2K0RA 1FHNA 3DECA 4U4BA 4XPHL 4KV5F 4ZS7H 3ZKND 2A83A 3AROA 3QIUA 4Z9KB 4G5ZH 5JPNB 3I6GA 1NC2A 3W9DA 5SWZB 4ZW3A 1Z5LA 3TCLB 3X11B 4P5TB 3GKZA 2JJTA 1AG0A 2VQ1B 2AXHA 2OS7A 1TKWB 3AITA 3BFQG 2E27L 3IU4L 4NKOA 2EYSA 1FLRH 15C8H 1ACCA 3NH7H 4CVUA 5CEZL 1EWHA 1C9SA 4ZUVB 2ENPA 4EQ3A 5IFHL 2NY5H 3DRQB 3IETA 3MV11 1KIQB 1GIGL 3UZVA 4WK2B 3LPGA 1ACXA 1XZ0B 3BFWA 3OXRB 2CHDA 4M7KH 4NQVA 2FB4H 2VXQL 2MPVA 1AO7A 4X4KA 3VM5A 2E7LA 3N1PC 4QRUB 4DN3L 5JIDA 1DLFH 4RLDA 3KHQA 4HS8H 3QT2A 3IMTA 2X53A 3MJ9L 3O6FD 1ICTA 4P99A 5D1XA 2AZAA 4F7PA 3LXUX 3ZDWA 5C0BD 2VSDA 1LP9E 4KVNH 4D0BB 5BOJA 2B4CC 1H5BC 5D6DA 2WZ0A 1M56B 4TPRH 4U3HA 4M61B 5J1AB 3W82A 1TFPA 1J12A 5LB1A 1UCBH 3WO4C 3MLSL 4OU3A 4XWGL 3DMMD 2OPCA 3FUIA 3C5ZB 2OSXA 1J5HA 1UD4A 4ERSL 3D0LB 3GI9H 1CE6B 4YSOA 4ZOEA 3MX0A 4YMPA 1HWHB 1SJEB 3FCTB 3F85A 2E75C 3L3IB 4N2CA 4IKNA 5EWIL 2VAJA 5LWYL 4QOKB 1IGJA 4JFHD 3FSVA 5FXCH 3V55A 1G7IB 3QNZA 1A2YB 2VGLM 2OR9H 1ZHKA 1JGVH 1CZ8H 1SUJA 2R23B 3QEQD 1CT8A 1DVUA 4WEUD 3MBXL 1PW3A 4GFXA 4LGPB 5C0AE 1KGCE 4JHAH 2YQ2A 1ZS8A 1A7QH 3W81A 3V4UL 4K3EH 1GYAA 3AT0A 3BQUA 5IBUB 1ZHBA 4HS3A 5DGQA 3P9MB 3GIVA 3A6CH 3TEXA 3MXVL 3SQOH 2R51A 1J1XL 1AS6A 1KFAL 4JFOB 4OD1H 3QUYA 2JIXD 4FNTA 5TF1H 4WUUA 1JCVA 2CM5A 1XGPA 1H6TA 2CA4A 1A64A 2WLJA 2BSDA 4YS4A 2WLIB 3FOMB 3FF7A 4LPWA 4TULH 3MO1B 3L1FA 4KAQH 1ZVSA 4I0PA 4OD2A 3D0AA 3C8HA 1UOKA 2CRMA 1BWMA 3ZL2A 2VE6A 3NGBC 1M9WA 1D3CA 5TDPA 4EXPX 1HCZA 2KZKA 1A65A 2XVGA 4OCWH 4R90H 3SCMA 4IU3B 4PRHE 3QI9B 4WV1B 1P6FA 3ZTNL 4X4YB 4YDLC 3TNNA 4GFTB 5B3NA 4P57A 1ROWA 3U6XA 2OX5A 3VXUD 4C56B 5JLZA 2HCZX 1DBBH 3KPLB 4R7LA 4G2AA 5HDBF 5LAPA 1L9PA 1W0VA 3T4YA 3D4GA 3K8KA 2IQAB 2XV3A 1A6PA 3TN0D 2YA2A 1GC1L 2UZIH 4YSPA 1QSEA 3FL7A 1FG9C 4QHUA 5EOTB 5MHSD 1OK0A 5IOPA 2DV6A 3R0MA 5AOJA 1I8KB 2VLJB 1VFBB 2EEFA 3TJPA 1A6AB 2PR4H 3G5VB 4XMPL 4BZ2A 3VFGH 2CKBA 4U2YA 2AJSH 1YN6A 2DYPB 1FG2B 1S9XA 5IMKB 4N2MA 4NWUL 3KMDA 3SE4A 5ADOH 2GTZA 2XTSA 2NZ9D 1TJGL 1UB5B 2QADB 3FQTB 4XOEA 4OQ1A 4RMQA 3ILQC 4IRZH 4NYLA 2BNUA 3WIIL 3N9GH 2QJDA 3P30L 2AJVL 3NSJA 2LVCA 3A4AA 3FT1A 5E2UH 1FNSH 1CGTA 1UYWH 4Y5VC 2AP2A 2K8QA 1MW3A 2D7QA 3LRSA 5DWPA 2ZOWA 4MXVE 4ZK8A 2QPUA 1A3LH 4O9HH 4LRNL 4HJGA 3LKPB 2A1WL 3NFPA 1K6QL 5FGCB 5AVVB 4UM9B 1E42A 3GHEL 3GMRB 2F7OA 1QUPA 4PLJC 2YXVA 3R19A 1DJGA 5D7KE 5KN5A 2ORBL 1EEZB 2PO6C 4Y5XA 3S8WA 4UDUA 2F8IA 4QRQB 3FFDB 1N7ML 2YN3A 2BVQA 3FJTA 2X38A 2VRAA 3A3YB 2VITB 2ZKYA 4NZRH 1TJMA 2TSBA 2TRYA 3L4WA 3CBRA 3UTSD 4TRPL 4BFRA 4L4TD 1RPUA 4H1LG 4FNLH 2J5WA 4HKBA 1MAJA 3MR9A 4FXTA 4OZIE 3MAWA 1XTMA 3PV6A 2Q10A 4DN4H 3BP7A 4TTGA 5C0EA 1J0KA 3MNVA 3GSNA 3U1QA 1FFTB 1WF5A 2P45B 1DQVA 2WQUA 4FKEA 4HUUA 3DSFH 4ODVH 1UWFA 5JXED 3D33A 3B9AA 4ODBD 1AANA 1AVAA 4P2CG 5E0QA 1UZ6E 2VDRB 2Z7UA 5CZVH 1KLGA 5AL0A 4YWGL 2A9NH 4KH2A 3IMUA 4HUVA 5DK3A 4KKCD 1PKQE 4CMMB 1FN4B 4KFMA 3MYJA 1FNGB 1KGXA 2XN0A 3QZWB 2QGEA 1QPPA 3N06B 4KRPC 2NTFB 2X4UB 2NYKA 2OXGB 3JQOB 3LHPH 3FO0L 4UT9A 4JPWH 5CR8A 1D9KD 4Q9RH 3L17A 2GUOA 4ZOCA 1QASA 2J43A 3DX8B 1ZLWK 4ZO7A 3UP6A 4PCSA 1M3JA 3EJZC 4U1IB 1SPDA 3X2QB 2WD0A 4J3XA 5SWQB 4DUWA 4KVCH 1U4FA 4KQ3H 3FCBA 1DZBA 2W91A 1NPJA 1FGVH 4TS6A 4XXDA 5AKSA 3NOIA 2HXAA 3UAJC 4QLWA 2WNGA 3MRPA 5F9JA 2JKJA 2COVD 5DURB 1IVTA 1A66A 3OHMB 4HISA 5D8JH 1U91B 4G59C 3OZLA 1I7TB 3JTBA 1SXZA 2IAAC 1JPSL 4GKZB 4RDQF 5FA4B 4NQCE 4TVPE 5ISZB 3RWCB 4DVBA 4X6CF 3O6FC 4M8QA 1SVZA 4JREC 5JR1L 2EICA 3ROOA 4KTDH 3QGVA 1VIWA 1K2DB 4L0ZA 1MHCA 3S5YA 3GXFA 4DOHE 1N8ZA 5DUPL 3T3PF 4F58H 1RHFA 4J3OH 2DQUL 5E5RB 3TBYB 4J8RA 4PWJA 5IVXB 5CJXC 1BOYA 4BSWB 2XRAL 2I25N 1C5DA 3DMMC 3EGDB 2VLLB 3EYFB 1FIGH 4JRYA 4MJ6A 4XMVA 3LZNA 4APQA 5K39B 4UINL 4GXVL 2BIPA 5I0DA 1GJIA 4PJXA 4ZBJA 2Y1VA 3C60B 2ROYA 3HA0A 4LQFH 3ZDXF 1LM8V 1F4WL 4HQQH 2Y7OA 5CKGA 4UTAL 1WISA 4K7PY 1URZA 1FGNL 1JGUL 5INCB 5FCUH 1JZGA 2BS8A 1HL4A 4OJFL 2V9TA 4JFFD 2F58L 3FBQA 2BWQA 3BW9B 1DBMH 3FAXA 3HS8A 4HAGA 4N2OA 3UXFA 2V5RA 4YDZA 2NY3D 2OSLA 2WJ7A 2YC1B 4MLIA 3F7RA 5DQ9A 1VACA 2VL5A 3NVQA 3PGCB 4Y9CA 3T0EB 1Z3RA 4CVZB 4AQAA 3TIDB 1OD9A 2Z4QB 3MRFB 3DKHA 1IL1B 2DWXA 4AUJA 3K0WA 4F7CA 5K1JA 4WWPA 4QNPE 1E28A 2E4TA 3SDCC 3QWRA 3BWAB 2UUDH 5CP7A 1MRFL 3F6IA 2FWOA 3NA9L 4XCFH 2XA8H 1JJUA 3WFDH 2ZWKA 3WNMA 2W81C 2UY7B 3LRKA 3DV4B 4WO0A 4HIXL 2XLLA 4P2RE 4Y5YA 5FWQA 4KVPA 3OKMA 4PJGB 3RDJA 1JMXA 1FVEB 1ZTMA 4GP8B 1PY0A 1UH4A 1V3KA 4QRPE 4ZXBD 4OJYA 3L5XL 1MCCA 1P4UA 2AANA 5EN3A 1AR2A 1OCRB 3IKCA 2R4RH 2JI2A 4JK0D 1BF2A 4ZS7L 3ULVE 2PNDA 4XVSH 5F9OL 4YX2L 1NMAH 4JG1L 1NC2D 3FUHA 4XNZB 3V6FB 1K9TA 1GZHA 3SHSA 3WLBB 2GSGB 3ZDZE 1OD7A 3H7BB 4AQ8C 1FSKC 1ID5I 3NIFF 5DJXB 15C8L 4DGVH 4ODXB 3NIGE 3GF8A 3I3BA 1HI6A 3D30A 2IF7A 2NY5L 2X0WA 4Q9CA 1XGTB 2G3NA 3SE8H 1UXLA 1DR9A 2L7EA 2EDQA 2WO2B 3T2PA 2VW6A 4LCYB 4ZMLA 4AV5A 2VIRB 2NZ9C 1JPGB 4OT1H 2VZUA 3M7FB 4XWOC 1OW0C 4ICWA 3WE6A 1DBAH 3QIBA 1DLFL 5EO9B 3MUUA 4NERA 1YQVH 2KKQA 3WEAA 4YDIH 1A4JA 1ILUA 2B16A 4N86A 5D1XD 2J72A 1KJ2H 5I1GH 1B0RB 1UWEL 2HFFA 2W0LA 3DX6A 1MIEH 3GSQB 5LGHH 1IEHA 4OZ4B 4UQ3B 4LHUB 2IGTA 1MEXH 1YPZB 3KJ6H 3L3KB 5IF0B 5CJ8A 1W15A 3G6AA 3ATAA 3HC4H 4KO9A 5GS1C 1LEKA 2DQCL 4J28A 3ZU8A 5HYFA 2WWKO 1VLXA 3LKQB 4ZYKA 3INUL 2P5PA 4X6DB 1AR1B 1Z9LA 5J12C 1DQDH 4YZWA 4EUPB 6PCYA 3CC5B 2A77L 3TNMA 3II2A 1EHAA 4P46B 4W9DC 1KY6A 2VDNB 1AP2A 3U48A 1MWOA 5C7XL 3QUKA 4J1UB 2YSSA 2C9SA 4I0KA 4O2CA 5B7EA 5KAQG 1DCLA 4L9LA 1NGWB 2NRDA 2X3AA 5FW7A 5GGRY 2R0WH 3DRTA 5F1IA 4JHAL 1T4KB 3OSVA 2W59A 5GISH 2YSTA 2YZ8A 1I3GL 2FR4A 3QHFH 2VC2H 2BDNH 4K3EL 4UZGA 3PWJB 1YN7B 3RGBA 3F65A 4B9JA 5JXEC 1MHHA 1PDKB 2X12A 3UJTH 4Y2DA 3BPOB 1HKLL 3BQUD 4J23A 3QUZB 3MVSA 4XAWL 4DP6X 4CMHB 3W11D 2ZXGA 2Z92A 1TZGL 2WB7A 4MB4A 4MBOA 3B7SA 4OD1L 2JCCA 1Z1WA 4KK8D 2W07A 2CO2A 3Q7JA 5CCJA 5IBLC 4KKCC 2QBWA 3DTUB 3FT4B 4TUUA 2X4NA 2C9RA 2PR9A 2PYFA 5FCSH 4KK9C 4TULL 1P53A 4HK3N 5IJDC 3K2IA 3QJHA 4PJIA 3OMNB 4U3CA 4PG9B 4MB5A 5I0VA 4I88A 4X9GA 4OGAD 4YUEL 4PJFB 4F9PA 1FO0L 1PZ3A 4GIOA 1D9KC 4MNGB 1WT5A 4M6OH 3E3QC 3SCMD 4WVRA 3KXFE 3Q2WA 1BVNP 3HZYA 2Y7NA 3NEOA 4EZKA 3MUGB 4MNHB 3F58L 1D7CA 4JZNA 4CDGC 1WGVA 5C6WH 1D6VH 4Z77A 1UD2A 3NPSC 5AWNH 5FO8B 1IM9B 2EDFA 2ITDA 3CX2A 4HKZB 1DBBL 4I2XE 3DTDA 1A9EA 4WY7H 5E2WH 3PDOB 3TO4A 2XBZA 1BZ9A 3K80A 4DO6A 1JK9A 1AHWB 3RIAF 4V1DB 3PREA 5E9DE 5AYUH 2LU3A 3OKDB 4A6YA 2BXZA 2K45A 2QVIA 1QSED 4U6YA 3EOAB 1IGFL 1WAAF 1U4EA 2I07B 2J8UB 1SN2A 2MEJB 1BGXL 2CIKB 5MEQA 4Z7VE 3F8UB 2NMSA 1JHLH 2AQ3A 1AQ8A 1C1EH 2R0KL 1NIDA 1RP9A 1HZHH 5MENA 4Z3EA 3HLAA 1RJYB 4X5PA 5ADOL 5AW6B 4G43B 4KV5E 5DK2B 2TSAA 1S78D 1LO3L 2PP8A 5BNXD 1PZDA 2Q6WB 4X8JA 4S0HA 1U8NA 3JWDH 1KJVB 1E2VA 3N9GL 3DPBB 4M6NH 1SY6H 3F04A 1FNSL 4AK1A 1NGZB 4U6XA 1QMUA 4PTTA 2NXYB 4ZNCD 4TSAH 3NBNA 2DIJA 2ITCB 2QV2A 4HIJA 3P2DA 3VXRB 3WNJA 4HJEA 1WCBB 3QK0A 5BS0A 4XVTH 1I8IA 5KVEE 4RQQB 4HULB 5ALBH 2VLKB 1L9TA 4NUQA 3RVVD 2F6AA 2W0FB 2WB1A 1KCBA 2J3SA 3ETSA 4JPIA 5GGUA 3WHXA 1WHPA 3O3AA 1L0PA 1QKZH 1JV2B 1NAMH 2NY3C 3QPKA 4G42A 3HHRB 1S9VB 3FRPB 1X6NA 4G11A 4NZRL 3JTSB 5HTSA 1MFBL 3QXWA 3NFNB 1WBXA 4FZ8L 4XNQB 5GQBA 3OHXC 4U1JB 4E5XB 1EO7A 3DUSB 1MJUH 1QEXA 1VA9A 4Q14A 2WZPD 5JW4M 1E5YA 1FL3B 4B7LA 3B2MA 4FQQA 1NLBL 3L4UA 3SD5A 5H94A 1NKOA 5EU4B 4DN4L 1EQWA 1Z9NA 2QSTA 3UG5A 4AENB 4J4PD 5DWUH 1QZNA 2O1AA 2QVTA 2SEBB 3AAZA 3QQNA 43C9A 4NBYB 3DSFL 4FFVD 5B8CC 1T21B 2WQ8A 2J6WA 3EJYD 4DW2L 2OTPA 4MKMA 5HVWA 2PP9A 5FM5M 4MWFA 1M7DA 4JGJA 4YXHL 3MRJA 2W94A 4ZXBC 1PQZA 1TJHH 4H2CA 3GLAA 5E1HB 3V9FA 1D6EA 1DN0B 1TYJA 3MLXH 1BJ1J 5AKVA 3KLAB 3SQBA 3M1BA 3Q48A 3W0WD 3ARBA 2D0FA 2YGVA 3NRFA 3DX9B 2LU7A 2UVFA 4JPWL 5JHLA 1LL1A 2GHWB 3NJJA 1NBZA 2JJTC 4DP5X 2Z7WA 3V0GA 3DTXB 4ACPA 3ABLB 2CE6A 4TMPA 3TEWA 3HR5A 2WVSA 2UV3A 1B6UA 2ESVA 5KZCB 1RUKH 4GAGH 5KVEH 3QIWA 4XVUD 1JZ6A 4D0CA 4GH7B 1W72A 1TJXA 5D7LA 1JNHB 1SZNA 4IDLA 1QR4A 3VFWA 1CICD 4MJJA 5SWSE 3UTTA 3GSVB 1FYHB 2DLTA 2WC7A 4G9FA 1TYRA 2E7LC 3IS1X 3WMPA 1ZSHA 2J5LB 1J88A 1FUNA 3IDMB 3NT0A 2YKLH 4KMLB 3VGEA 5E6RB 1PG7H 4HX1B 3L4YA 4DNLA 2DI9A 5D1XC 3P2TA 4G7SB 5D4HA 1AHKA 4HG4K 3VQMA 3MLUL 3LDBC 4XMZA 5D6DC 5D7HA 2H32A 2X5PA 4YHOH 1F3DH 5HDBE 3IF1B 5GSVB 1GOHA 4L4VA 4N2BA 3VXPB 3VQ1C 4KJQD 1W91A 1Q72L 4RSYA 1QSFE 3CN2A 3T4AA 5HYJB 2AGJH 2BMKA 1RSFA 2VL4A 1IKNA 5CEYB 5I1DA 5JORB 4L2YA 4PJEB 3R7RA 4JNXA 2ZWNA 2JI1A 1CXFA 5FCUL 2DZEA 4L8SA 4ALAL 3EBIA 5C07B 1PL3A 1SDDA 2WQAA 3BDYH 5FW6A 2WXQA 4PP1D 4AIEA 3LZFH 1DSFH 3AU1A 2IAMB 2WTRB 4LLDB 4GW5B 4LLYB 4UU9B 3VYNA 3ZE0B 3G04B 5JMRA 2DDQH 3BQUC 5HGBB 3W38A 4OTXL 3W11C 1U92A 4MZIA 5E56A 2MCPL 1JTTA 1JZ4A 5EEWA 1J8KA 4R7NA 4KK8C 2E74C 1AGFA 3VNYA 2VDPL 2VDPB 5GZND 4NM8H 1MWAB 1IGCL 2YJQA 5IHLB 3WUWG 3CDGB 4E41B 5DRZB 5CHNA 4UOQA 4I0PC 4W6XB 2P24B 4TVPL 2X05A 5AD0B 5IV2B 1WAPA 2WV3A 2V37A 5F7HA 4PYGA 1KJMA 1S8DB 2C3WA 1U8LA 3ULUH 3SGEH 3ZKXB 4U6TA 3SCMC 3TL5A 1S7TB 1EDHA 1PBYA 4D9QE 1Z2KA 2Z8WC 4NQEE 5EUKB 4PQXA 4AG4L 4HK0B 3IXAA 5FYLE 2R4RL 2KQMA 4NO0A 1NEPA 3IAGC 1I53A 2PXYA 4XVSL 4P05A 3QQ3A 2XXFA 2KPNA 3OR7B 1B0WA 1OE2A 3LEXA 3SKMA 3IMRA 4XZUA 1NMAL 3WD5H 3BZEA 1T1XB 2B14A 3MGAA 4IKLA 4XPAH 3B2DC 2DN7A 4R2GD 1J8HE 1U8JB 2VDLH 4IBTA 2OM5A 2QHRL 1E7UA 1F1DA 1W8OA 4BRVA 1HL8A 5MP6H 5JW3H 2H2SD 4DGVL 3S96A 5LLIC 1DSYA 5D93B 1NFIB 1XT5A 1ZIBA 2DM7A 1KB3A 5EUOA 2IOOA 3OKEA 5C0JA 1PFCA 4LSRL 3ZBMA 1XXDC 4LEOA 4E9WA 1OGAB 3VXSB 3I6KB 2R29L 1LE5B 2LE9A 1XFPA 1ZRUA 3HFFA 1U42A 1ZOXA 3IM1A 3SE4C 5E03A 1F4YH 2PTUA 1S78C 4BDVB 3NJGA 2YPVA 1MH5A 3QO1B 1ZWIB 4X7TA 1TEGA 1YQVL 4ODWB 3OC5A 5IQ9A 3CZEA 3SBRA 2IPKA 1GW6A 1KJ2L 2AEQH 3HNVL 4QHMB 5I1GL 1BVLB 3OGCA 2XFGB 4DPCX 4GUPB 2A9CA 4U1GC 5L0QB 2W38A 4QHLA 2XU9A 1TCMA 4KTGA 4JN2A 3BUYB 5LGHL 2OL3A 3VFVA 4LGSB 2B15A 1FC2D 2P46B 3PWNB 5J11C 2YD9A 1A6ZA 3NAAL 1YYLH 3KPSB 4F1ZA 1QR1B 3GBMH 4NSKA 3ZL1A 2D7NA 1JGDA 3IMVA 4ILDA 4Y5XC 4GP5B 1DUZB 2QQLH 3G5YB 4PREB 3QRFM 1ZCRA 2P5WB 1KULA 3O6MH 1DQDL 5FYLH 2EIZB 4N2HA 3VI4A 3I84A 5ALCH 4X6CE 1HQ4A 2R69H 4YE4H 2JF1A 1AGEA 2PYEE 3QNYB 5TE6L 5FF6A 3ULVL 3V0HA 1AGBA 3RB7A 2AV7A 4LVOB 3H2QA 4X5QA 1BAGA 3MRNA 3PXHA 2H0FA 5LG6A 3Q13A 3Q43A 3T3PE 2X09A 3QFJA 2R0WL 3QJFA 2VR5A 3UTQA 1UWXH 4PBVC 2RACA 3NCFB 2VXSH 3VWJB 1GGCH 4J4PC 4C54A 4TM9A 4E0RA 2PWDA 4OFVA 4CKQA 2X3CA 1X4ZA 3LRMA 4JO8A 5AG8A 4FFVC 4IMLB 5LN4A 5DZNA 2IOMA 4IOFC 4K8RD 1J5OH 3WCYA 3MKKA 3V0FA 3V7MA 1PJ9A 1NCWL 2EKSB 2G3ZA 3LN4A 4YLCA 4HF5L 4GG6A 4ZUUA 2VKWA 3ZDXE 4R0LA 1SHSA 4ZMPA 4Y4FB 5H37G 5ETUA 1S9WA 3SDXF 1EFXA 1TQBB 4M48L 3N40P 3GINA 4HGWB 4OF8A 3QUXA 4A2HA 1X9UA 5DZ9A 2VNCA 3VTAA 4MRCA 4JN1H 3L7EA 2AXGA 4DQAA 2XIDA 2DD8H 1XGRB 1MY7A 3HBQA 4F7TB 1U21A 4JO2L 1S7SA 5IQ7H 1LGVA 1MCPH 4I4WA 1R5WA 4CA4A 2O6DA 3ARGB 1IO4C 4JFVA 5AWNL 2CLVB 3NABH 1XH3B 3MLWH 3DJTA 4XVUC 1MFCH 1I9IL 3SKJH 5E2WL 5D1ZI 4Q97A 5TDOA 3QDJE 3VXTB 2QPSA 1CICC 1T22B 1QO3A 2MSPA 3TO4D 2C7UB 5AYUL 3CFEB 5C71A 1XR8B 2DLIA 5I18L 2E7BA 2IG2H 3BWZA 2VZ1A 2AK4A 5EG6C 1YNTB 3UBXG 3FN3A 4F7EB 1KOAA 1K8IB 2B08A 3BRGC 1JHLL 1XGUB 3JVFC 3O0RH 8CGTA 5I1CL 1A6VH 5BZDA 1NDMA 5C70A 3RZCD 3K6OA 1AXSB 3TPUA 4K7PH 2W0KA 5DVNA 1NCDL 1RZ7L 5D2NA 3VE0B 1JWUB 1AOHA 2ZWLT 2ENQA 1FFQA 4UDTA 3N3EA 1WLHA 4A7TA 1WEJL 5HHOA 2VLRA 1N5AB 5EZPA 3VA6A 4QT5A 2CLRA 2DQJH 4KJQC 4WU5B 3IDIB 5EC1A 5IESH 2VXUH 4M6NL 1SY6L 5HI5D 2XSKA 4APQC 4L3EB 4H1LA 4JDVA 2IH8A 4FAAB 3NIFE 3VD2A 4PGEB 3SE3A 3BGMB 1HEZA 3PWLA 4P59H 4WSGA 1T7YA 4GRLA 5D4JA 4PJ7F 2ZXAA 1IBFA 1KCSH 3DOHA 4KPHH 5HYIA 4K15A 4WU7B 1RV6X 2LAAA 4E2OA 5FB8A 5ALBL 5HYSB 4GT7A 3JSSA 1G5GA 4G7YL 5E5LA 4GRMB 4LPCA 3FZUD 3NIDB 2Y1ZA 2GJ6D 2ZKMX 1CLOL 4A1RA 4YDVB 2H0EA 4YHYB 4PP1C 5DK0A 4X4ZA 1KV7A 3SOBL 1QKZL 3U4EA 3GRWH 1GZQB 2DLEA 1X5XA 3WMQA 2IPUK 1BJ1H 3FONB 4IJTA 1Y0LB 2G9HA 3VJ6A 2V8LA 5KVFE 4CADA 4N85A 2MOQA 2B20A 4S2SA 4BKSC 5H35A 4HV8A 1JHTB 1AS7A 4N0RA 2EXWD 3VFSB 5GZNC 4PRPE 4LVNC 3AB0B 4WK4B 1LK2B 3KPRB 3T1FA 4M1DH 4IGBB 3TYGH 4HBCH 4ADJA 2OR8A 2EIDA 4NPYB 4KX8A 2YFNA 2C4FU 2ED9A 1WA1X 3HUJB 4P9HH 4Y5YC 2XN9E 3MOBH 5I75C 1OZUA 4UOZA 3EYUL 4IQHA 4WKXA 1HILA 1TJHL 2YUWA 2OCCB 2HFGL 4PJDA 1OP3K 3ORJA 3O3UN 1OPGL 4XP1L 2E46A 2V2XB 1YMMD 1KCLA 3VQLA 3K7UA 1BD2A 3X1GA 3FSZA 4TV3A 3L4ZA 2W65B 2JQMA 5F1NA 3K6SA 4P2OB 1XD0A 1T66D 3HZMB 1JDAA 4H8WL 3ARBD 4R2GC 3CFCH 4N8VB 3ZTJH 3U46B 3Q5TA 4LPTA 1GGIH 3L1EA 2XOTA 1GZHC 4FNPA 1DFBL 4BE6A 2H2SC 1UZ8A 3KWUA 3DHMA 4DETA 5ICXA 1GH7A 2K3TA 4AMXA 2WXMA 1K4CB 4GAGL 3EJPA 5K9KB 2ESVD 5JHDE 2CCVA 1A1MA 3CGTA 5LDUA 4PRBB 1AYRA 3ZHDA 1MUJB 1PEWA 3QIWD 3EGSA 4K5NA 4QRTB 5KBPA 4PJ9A 2GK0B 1EDQA 2GFBB 1H8LA 1MJ7L 2W80C 2NY2C 4LLUB 2HG5A 5DI8B 3ARUA 3UTTD 1MY5A 2WWMD 2BO0A 3MZTA 4Z7UF 1YY8B 3EJSA 2WXKA 2YKLL 1OM3H 1K5WA 2H0JA 5C6PB 4BFKA 2DKSA 5KVFH 2UX6A 3QDGE 1NH6A 4QY8B 3KDPB 4J6RH 1MCIA 3IRPX 5IG7B 3B9KB 3EHBB 3MRDB 3T04D 4CU6A 4OM0H 1PGRB 4J27A 4XC3H 2LU5A 4G8FA 4P9MH 2PCYA 2WVVA 5TFSH 4WW1A 4M43H 1A7NH 4FNSA 4N8CH 2D3LA 3ZL4L 4JRXE 3FQ2A 4H0IA 4N26A 2XG5A 4U1NB 3N5AA 4MNQA 4P2QA 4XGZB 3DI3B 1ESOA 4R5VA 4BFNA 1OGTA 4L4VD 2PCXA 4L8BA 3A67L 1EXUA 1QUNB 5I66A 2YAFA 4NCC2 1FRGH 1WAAE 2QEJA 2VDRH 3MNWA 3K6DA 1CG9B 5D2LA 3PGDB 2P1YA 3IDGA 3OB8A 1AMYA 3V2AR 3N1FC 3U36A 3FB5B 3SDAA 4DSYA 3HI1B 5EORH 3RZWA 1OAZL 3QARA 2BCMA 4LASL 3W39A 2WLLA 5KYUA 1O5PA 5IW1B 3BDYL 5CM1A 1G7MB 2X4OA 3E2HC 3LZFL 3V6OA 3TWCH 2Y3NA 3KPOB 4F8QA 2JKLA 2XT1B 1QFWI 4M3HA 2DDQL 4K8RC 4C4KO 4H0LC 3C9NB 4MAYB 3WIHL 2E56A 4B53A 4R4FH 4F8OA 3MXWH 3ZDYF 1S7WB 2K78A 3UEQA 4NPKA 3CV5A 1XF3A 5GS2D 4NM8L 3BUPA 2VN6A 1A6TB 1FNLA 4JDZB 5CP3A 3IN2A 4AVHA 3UX9B 1S9KC 4ZMQA 5E00A 3UL4A 1X3DA 1E65A 25C8H 4EZJA 2K4AA 4Z7WF 5ILTH 4WFGD 1T7XA 1IAIL 3ENEA 3OB0H 4IM8A 4JFDE 4F9PC 1KXQE 5DUBA 4TSCH 2FQGA 2CLZA 1IM3A 3QR2A 5E9AA 1WT5C 1FC1A 4H20L 2OI9C 3C8KA 1YNKL 3D34A 1CDYA 3EH2A 1S7QB 1MCKA 1DHKA 5D70H 1D5IL 4YBQC 1BCIA 3WU1A 4IKJA 4AEEA 1COBA 2Z65C 4H0GA 3UGEA 3WD5L 3X3GL 3TO4C 3UTPE 3FB8A 3KCWA 2XKNB 2GPZA 2ZWZA 5L2JB 1RERA 4WLCA 1O9ZA 2WN3A 3KWWA 3ET9F 4RZCA 2E5EA 4JZOA 3CLEH 2JV6A 5LGJB 4NO2A 4Y9BA 5TF0A 4K23H 1G6RH 4NN5B 2F19H 1J8SA 1CGVA 4KMQA 2DIBA 2HN7A 3KPMB 1F4XL 4J3TA 3ELAT 1CCZA 1PAMA 3D9AH 3W9EB 2M83A 3GXPA 2DW5A 1CLZH 3RZCC 4D2NA 4BHUI 3CJJA 1SYVB 4NI3A 1F4YL 3S3CB 2JLPA 3DGDA 4F2MA 3BKMH 1EJFA 3AT9A 3FU8A 4U1KB 3CC1A 2P8LB 4AKOA 4G5AA 1VZHA 2E9GA 3GZPA 1YRKA 1BYPA 2J71A 1NFDB 2IGFL 5AW4B 3B2PA 4OCXL 1M1XA 1D5ZB 5D7JA 4YHIB 5HI5C 5B22A 2BNQE 3FYIB 3HMWL 3HN3A 4UIMA 5KYYB 2FECI 3WXVL 2F5BL 3MLZH 4AQ1A 4N2NA 3CQPA 5EULV 3N44B 4N8UA 4ANUA 3RTQB 4HLZG 3MN8A 1NAKH 3HIZA 1HN1A 1KN2L 2BVPA 1TVDA 5PAZA 5DEGA 4GO8A 2B1AH 3NFSL 3B3IB 4WRLA 3I50H 2J25A 3FZUC 4H26A 3T77B 1Q0XH 3OWRA 4Y0GA 5IR1A 2EDDA 3FB7B 3VU2A 1J10A 1ETB1 4HHAB 5FYLL 3C6EA 1DYZA 4G6MH 5IB1A 5ALCL 2FLRT 5FYJD 4QKTA 5AW5B 3PFQA 4DGUA 4OLVL 3PNRB 3IDUA 3NCJH 4NQTA 5SX5H 2YQGA 4LCIH 2Y22A 3DX4A 5TQ0H 3JWOL 3U0PB 1J9CT 4BFBD 2EXWC 3GK8H 1YVLA 2YPLB 1L6PA 3JT2A 2GBUA 4I9WD 3QFJD 2VXSL 4AGLA 4IRZA 4FXLA 4I48B 4LLMA 3MZGB 4HWZA 5B1KA 5T5FA 5AW1B 1G7PB 1E8ZA 4NQSA 4GP4B 4N24A 4RGMC 2CAKA 4BSVB 4GKSA 1THAA 4NKIH 4V11A 4A7GA 5MERB 2YBGA 4OGXH 2R39A 5AUMA 1QYGL 3Q01A 4WF7A 4JGNA 2CG9X 3KYMB 1P7QD 4XPGH 4JN1L 1CFNA 1T66C 2DD8L 3EDKA 3I6LD 4OI9A 2R2CA 3ARBC 3CU7A 2ZUVA 1N59A 2DAVA 4PJ5B 4NN7C 3LEVH 5IQ7L 3DIFB 2ZOLA 4JRLA 3EH1A 3GKWL 4PJFE 2WO3B 2QGBA 4KDWA 4L3FA 1UUSA 4XXCA 4LSSL 3UYPA 1BBDL 4MHHI 4OV5B 3N43F 2BSCA 5IBUG 1MFCL 2DMHA 3BESR 5HGHA 3Q2NA 3RGVA 4DGYH 3SKJL 3QIWC 1IKFH 2C34A 3HPLA 2XWJA 1PLGL 2H3XC 4GI8A 2WWOA 2YXMA 4WI2A 1IIIA 4BZ1L 3MCLH 2FO4B 4IRJB 2BC4B 5I8CB 2WWMC 2Y7QA 3P69A 2I60H 4M62L 4JE4B 3WTSA 3B43A 5C0CB 1ZV9A 4P3DA 2W88A 3RWHA 1QLRB 3BE1H 3DX2A 2IWFA 2AK4D 3FCSB 5ESQA 3T8XA 4ETQB 2DQIH 1RMFH 3EBAA 5ANME 4OCLC 4PJBB 4FJZA 4X9HA 3P77A 1R3KB 2PN5A 3O0RL 4ODHH 1TU2A 3AWFA 4ONOA 1I31A 1KG0A 3LH8A 4FABL 3PXLA 5EBMB 3ZUNC 4JS7A 3GUTB 1WJ3A 2I9LA 4K7PL 1NZRA 2BP0B 1RLBA 1YEJL 1IGIL 3VFRB 4CDHA 2ZXBA 3BKJH 4H8HA 4ZX4A 4WI3A 4NQDB 1NPNA 4ZODA 4UILL 2VLRD 5EU3B 1KXTA 4N1CA 1QI4A 1ZVSB 3V4PB 1I9RH 3GMQB 4JFXB 4HLJA 4P3CH 3WNPA 4N0YH 5IMOA 1C7SA 2EVJA 4OLXH 2OMTA 1FZMA 4P59L 1OP5K 4HS6B 3S37L 5TJWK 5JDSB 2VZVA 3HPJA 4CNIB 2DH3A 1OK8A 4APXA 2P9RA 3QC6X 4FEIA 1M71A 3TNNB 2MCMA 2H3KA 5I2IA 3VG9C 4P57B 1GAFL 5CFAA 1AHMA 4L8SC 4K71C 2ZICA 4OJCA 1MW2A 2VKXA 3KNBA 4XNYH 2IFFH 5EH1A 2Z7YA 4YZFF 3PWUA 1C08A 4QGYA 3MCG1 3WEXA 4ZX6A 1C12A 3B34A 5IP4A 3U7WL 5KYWB 3CDZA 5GGQH 1FZOB 4GLRI 3QS2A 3STBA 2GKIA 1WC7A 1A22B 4PBWD 3LKOB 4MD0B 4NCDA 3EH5B 3OJDA 1KELH 4Y4KB 1XV8A 1Y1DA 2G75A 2YO3A 4Z0XB 4OFKA 4S1DD 4N2DA 2K6ZA 4HPHA 2XNAA 3FTUA 3MV9B 1KIRA 4FFTA 5DT1L 1H3WM 5C08E 1FZJA 1NGQL 1SQ2N 2OYKA 3TYGL 5J5EA 1QFUH 3LSOB 1NM4A 1ZLUK 5AZEH 2X4QB 2RHEA 5E5MB 4MX7B 2F7PA 4P9HL 5D5MB 2CIIA 3MOBL 4PJAF 3CDFA 2WIIB 3L95B 7TAAA 4YHLH 4RMSA 5BZWB 2DWDA 1KTLB 2ITEA 2XWXA 4P5KA 3LNFA 3PHQA 1NSNH 1XF5B 2IIJA 2PPDA 4IHBA 4M03A 3SJVE 2JK5B 2IDFA 5DEFA 1VGEH 3QJTB 1CO1A 1K8DA 1YEWA 3U1SH 5B39B 4U0RC 2NZ1A 5EOCJ 4A7QA 3CE1A 3SDDB 3EH4B 2EIEA 1AZCA 4HT1H 3PU7A 4YH6A 3GEFA 4Y19A 2ODHA 3V9CA 2I24N 5D96B 3LQZA 1XL6A 4MXQD 4HIHB 4XB7A 1BREA 3ARYA 4OGZA 3GSWB 1OT1A 4PY8J 4XBEH 2XG4B 5C0FB 3DX1A 1MRDH 2AJXH 2Z1KA 4PJ9D 3SDXE 4O58H 5JDJA 3ES6B 1GGYA 2F53A 1R3LB 4JQXA 4BCYA 4GSUA 4LLQB 5H4ZA 1R3JA 4M3JA 3ZUCA 4B9FA 3GO1L 1ACZA 1YNLL 2IPTL 1NCBH 5DVLA 3QZWG 5GRUH 4YOKA 4ZPVB 4N90E 2P5EA 4J6RL 1JV5B 1LQSR 4UIKH 2NX5D 4I8DA 4ZFOA 2HJKB 4HUUB 4QRRA 5IWLA 3LS5H 2RFXB 4X5XA 4XC3L 2QR0B 2R1YB 1G7QB 3JVGA 3TBTB 3UO1L 1A7NL 5B4MD 4N8CL 2K7PA 4KNSA 3FQXB 1JPFA 2FIKA 5DJCB 1IFHL 1UXMA 5HY9A 4AV4A 5L2KD 5LCVA 1L9SA 1KC5H 5M95B 4G8EA 4R96A 4MZ3A 3EYOA 1IKOP 1SF5A 2O61A 2P8PB 4TTDD 5CCGE 3B9EA 2XYCA 3WUWA 2OMUB 5I9QC 2NSMA 4PRIA 4I3SH 3U9WA 1KCUL 2N01B 4N9GA 3MRKB 5FUOL 3VXME 1MXDA 1LD9B 1RIVH 3IDJA 3IDYB 3TWCL 5F7FA 4LSQL 1R6VA 5FFGA 5JYMA 3UPRA 3MSPA 4HKXB 1ECZA 1RZJH 2Y7MA 1NGXB 4JDEB 3JV6B 3US9A 3NACH 3H42H 1ZLVK 5HPMA 4ODUA 2X6VA 4OQTH 4R4FL 1OPOA 3EDFA 4P2YA 3MCKB 1QVOB 4XC1L 3PL6A 4O2EB 1GPOH 2VXTH 4R0LC 3Q05A 4X2UA 3IDXL 5HHXH 1NC4A 1M6OA 2KZWA 3B2UC 5FUZL 3HHSA 2WZ6A 1MREL 4WFFD 1DLHB 25C8L 1MOEA 4Q6YA 5ILTL 4PM1A 5DTFA 3JV4B 2Y24A 5IJCC 1R1CA 2HLFC 2VMCA 1RZPA 4BKLB 2GYSA 3RWDA 1NPUA 4MDJA 3QCVH 3QH3B 3AREB 5FHBH 2Z35A 3LS4H 4JRYB 1I1AA 4PSPA 4LKCA 3L9EA 1D5XB 4NZDA 2EC9T 3H0TA 3TIEB 5IQLA 4KKQA 3UOAB 5HVHC 3K3QA 2YD3A 1H3UA 3L3JA 4AYFB 5HP5A 3QG6A 1LWRA 2WKGA 4M8UA 1E6JL 2ID5A 3DVFA 4GLRH 5HYQB 5ECGA 4QWWC 2PW2B 2HVKA 4LE8A 4Y2LA 2VDKH 3VVWA 5BOZG 1G6RL 2AXJA 2X7LA 2Y06H 3QYCA 1OALA 1VKXB 4PWKA 4X4MA 1A14H 1VADA 5C2BH 2OMBA 2VERA 3TCTA 3T3MB 4RIRA 5BV7C 1MLBA 4NO3B 1PYWB 3ZKMD 5C92A 5MEPB 1G9NC 2CM6A 2OZ4L 3P4MB 5FECA 4FI8A 3VFUA 3BXNA 3F7KA 2WYTA 3H9HB 2VRKA 2EILB 2NY4B 5D2NC 1KTRL 1F11A 1OGAE 4N2AA 5DC0A 3VXSE 4W93A 3TA3A 2Y7SA 2NY0C 5FOBA 5K1VA 4E9LA 3GB7B 2FWOB 2BSBA 1N12A 3BIKA 4ZMOA 2AKRB 5D7JD 5AAWC 1E9OB 4U0QB 3QZMA 5DCCA 1TCRA 2CKNA 5J6GB 4U7MA 3OG6B 3SE3C 3RKDD 1UGKA 4PY8I 5GGTH 2WXHA 4GRLC 2ICWJ 5T1KD 3VXQA 5FOJA 4OIIL 1HESA 4MSWA 4U1MB 3QORA 5KWYC 4PCKA 4Z7QB 1MWAH 4UANA 3U9UA 3AXLB 5F3HA 5DUMH 1DJHA 1YUHA 4WI6A 1XF4B 5ICYA 4NXKA 3U2SA 4JHWH 1R3HA 2NUPB 4N6RB 4IHOA 1LYQA 1I7ZB 1T0NB 2X0VA 3IXTB 2BOBA 3HMXA 1FE8H 4Z7UE 3GTVA 4B7IA 2RR3A 3GBDA 3KPSE 5C3IA 1L3WA 2VH5H 5H37A 2FD6H 1AIFB 2XKUA 3UIYA 4JO1L 5KTEL 1F45A 1GGUA 3NCJL 4LCIL 1JAEA 2KH2B 4AXWB 3HE7A 2D31A 4M7LH 4GUOA 1UXSB 3GK8L 4AEFA 1KGCD 1I7RB 4S1DC 4ZSOB 1RP8A 2JELH 4RFNC 3NJVA 1ET8A 4PTUA 5D4IA 3S2CA 4LHUG 3PQYE 4YO0A 3DHPA 3FU7B 5KVDE 1ZT7B 2CRZA 4AYEC 1YYCA 4NKIL 3ZZQA 4RFEA 4TLSA 3ZY7A 1QOKA 2DEXX 3Q06A 3FW6A 1IC7L 4ZX3A 1AFVH 1A4KA 2WO4A 2HH0H 3BPLC 3D2TA 3DX7A 3EO9L 4X9IA 5KANG 4DK3A 2XBTA 3TCXA 4P4KB 2JI3A 5C0BE 4NGHL 3UBXA 1JVKA 1M2VA 1SF3A 4XP6H 3KXFA 4UV4H 5DD6A 5L6YL 4PRHD 3LEVL 1NAMA 1A1NB 2ATKA 2QLYA 4M4PA 5I76A 2ZXEB 4AW7A 4NI6A 1E4XI 3MRCA 4MJIE 4RGNB 2CNYA 2AVGA 5CR1A 4L8DB 4MXQC 3L81A 2J12B 4DGYL 3HC0A 4RAUA 2Z31D 4I5BB 4J3WA 3CFKA 4GSDL 1IKFL 1L7IH 1RPKA 3RGVD 3D85B 4AL8H 1S3KH 1QFWL 1WBZA 2IDUA 1SLVA 1ZEAH 1FVDA 3JTTA 4PJ9C 3MCLL 3CVHA 5FYKU 1AQHA 3D39E 3WFHA 4QXUH 4G83A 1CDUA 1PZ5B 1UJ3B 3RUGA 1MFEH 3BE1L 4L0YA 4BK8A 4Z7WE 1J9TA 5EIIB 2DQIL 4AYBA 4J3UA 4EN3D 4YXLL 4LCCC 2R4SL 3LN5B 3EF7A 3VD0A 3SGKC 1X7QB 1LXMA 1RZKC 2EDHA 2ZX9A 3KLKA 4FI7A 3H4HA 4ODHL 1WZ1L 1UZGA 3ASWA 4B41A 3NJHA 5B4MC 2EAEA 4MS8C 5A7BA 2OTUA 4MXWH 1KIPA 3EJUA 2E8ZA 1DQKA 4B97A 3IJ8A 1MNUH 1HYRC 4NZUH 4R83A 4NLHA 1R46A 4LQ1A 5KVDH 4MAZA 1BM7A 3IFNH 3MMEA 3Q8FA 4FFZH 3S48A 4P3CL 3L3GB 3FF8A 4OLXL 3NDYE 4IEFA 4TTDC 3TBSA 1TJIL 3BP6B 1WS7A 4DUXA 4L3EE 1TQCC 4LT7A 2GIYA 3C5SA 1K3ZA 4KXAA 2O26U 3KPPA 3WKNA 5D7KD 2OJEA 1VFOA 4UAHA 3LIZH 5DEJA 1ONQB 3BPNC 3CUPA 2P28B 4XNYL 1N6QL 2IFFL 3KWXA 3O6KH 5J6HA 3AY2A 3EJJX 4R84A 3ULSA 4TNEA 2AEPL 2VN3A 3MRLA 4NNPH 3V6OC 2Q3ZA 1I8LA 3DDGA 5C9JB 4JRWA 4ZAKA 1ZT4A 1OKEA 3IS0X 1J48A 5IM7B 1HOEA 2EVIA 3I9GH 4HZAA 5GSRB 2BNRE 3P0VL 4WHYG 3RJDA 3S4SB 1UB6A 2C3HA 3K81A 4JO4H 2ICWI 2V2TB 4IKKA 5I1LA 1ZA6B 1WFJA 2O93L 3FN0H 4LLVB 2I27N 1DO5A 1KBKA 4OZFH 2J2ZA 5MEQB 5I1JH 4J3OD 1B4JL 1AE6H 1F3JB 1WZLA 1KTBA 1QNZH 2IH1A 4HIIB 4YK4C 5EPMA 2YLKA 2X6MA 3BUTA 1VERA 3LB6C 2IC2A 4XP9H 1PEZA 3Q5OA 4HPYL 4ZI8A 4CGTA 2IFGA 3H3PH 4WTQA 3ARDD 4YHLL 1JVOA 1YECH 1SDAB 2E86A 4NENB 3DETD 1IBHA 1X4YA 1KTJA 1NSNL 1ZDQA 1Y6MR 3FRPG 1ADQA 4EIBA 3GMLB 3BZ5A 1SXSA 1OQOA 3V8OA 1VGEL 3IJHB 4E5XG 5L88L 1ZKAA 3O2DH 3U1SL 2R0LL 3LQAL 3L7FB 4GG8B 4FRWA 3APMA 1F8TH 4M5TA 2HP4A 4G6JL 5FKPA 4HOXA 4HT1L 2RA1A 4M7LT 5IQMA 1VZGA 2K6YA 4RDBA 2D0HA 4JY4A 4YDKL 3CXDL 1E9QB 1VF5C 4Y19D 5C09B 2Y9RT 1MIMH 5C0RL 1A6WH 4HKJA 1BMZA 5ERWB 3U7YL 1FORL 4FYQA 5C0GA 2HLAA 3CFBA 1HH6B 1HQRA 4JPKL 4YVNA 3W56A 1HVXA 5BRPA 1Q9WB 3SO3B 2AJXL 3ZKMC 1PLBA 2B39A 4WW2A 1ZV5A 3BUQA 4Z7QF 5DC9B 5EU6E 5EF3A 1T2JA 4U6HB 2AI0H 3UTSE 3A22A 3ZO0A 3H9SE 2GJZB 4NQCD 4Y4HD 1BVZA 3OKKA 4L3CA 43CAB 5IHUH 4QCIA 5DZPA 1CFQA 2VM3A 2HJFB 2FX9L 4QJ5B 4BZYA 2P5ED 3R1GH 5D7JC 1N26A 4AEIH 3LS5L 1S5IH 3CZNA 5E8OA 5A16A 2PABA 1BQLH 3V52L 4AQ1C 4L05A 3RKDC 4LIQE 4O02H 3DURB 1KBGL 3ZYOA 4B5EA 3QFDA 2H3NA 4G8IB 3ZE2F 4EPSA 4KH9A 2J6EH 4NJAL 1E43A 3TWYA 1HDMB 4DIXA 1N0LB 4GO9A 3MLVH 1QSFA 3HG3A 1S7XB 4JANB 2ARJB 1OTSD 2LLLA 2R2BB 1A5FH 2EDEA 1YYMH 4EI6A 3PPEA 5DQDH 1IBBA 2KDYA 5JHMA 3QO0B 3FKUS 3EZJB 2MKWA 5I17A 3V5DA 4FX5A 4AMWA 5DHVB 4XX1G 3GXMA 4F8LA 3BN3B 2PMZA 3QEUA 4Q7DA 5TH2B 1FVCB 4YPGA 4ELMA 1ZGLM 5DRXA 3QDMB 3E3QE 5DR5H 4JPQA 2FL5B 4H40A <