5JW4R

Structure of medi8852 fab fragment in complex with h5 ha
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
199
structure length
148
Chain Sequence
MTQSPSSLSASVGDRVTITCRTSQSLSSYTHWYQQKPGKAPKLLIYAASSRGSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIKRTVAAPSVFICLLNNFYPREAKVESVTEQDSKDSTYSLSCEVTHQGVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Structure and Function Analysis of an Antibody Recognizing All Influenza A Subtypes.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Immune system
total genus 29
structure length 148
sequence length 199
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4R02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4R01
4WJ5A 3UTOA 2CK0H 4ZDHB 4I3GA 3IS1X 4HBCH 5CILH 4R7DA 4YO0B 4D3CL 1U8NB 5FYLD 1WISA 4GSDH 5JPMB 4XCNA 4LU5L 3C5JB 1MUJB 4PYGA 1PJ9A 4D8PB 3TH2T 2W92A 4PG2C 3F7YA 5E4EC 4KMTL 1I9EA 1KCSH 2GITB 3RWCB 3F65A 4MLIA 1ZMYA 5DD5L 1S78C 5I73B 4R8WH 2L7JA 3PNWB 4OM0L 5H35A 1CVSC 5EU6D 2DM7A 3HE6B 3HFMH 1DQJB 3RU8H 5DS8B 4D9RE 5BVJA 4QRTB 3RHWF 1HHKA 3MBXL 3FMGH 3ESVF 1EX0A 4KDVA 3TA3D 4Z8FH 3IDIA 1ZLVK 4CRPA 3EO0B 2GQHA 4GRMB 2VE6A 1TTGA 5E70A 1GHFL 4S1QL 2EKJA 1KBGH 1X4ZA 3OQ3B 5I66A 1TITA 3P30L 5ANMA 3PUCA 5D71L 4GRWF 3TPUA 1S5HA 3L3OB 3KJ6H 1GGUA 2G5RA 1S9VB 43C9B 3O8XC 1KB5L 2G60H 2EDWA 1M05B 3DI3B 5IFJB 1XF1A 4JQIL 4ZMAT 4H0GA 5AYUL 1QFWM 5F93C 1SM3H 3LVEA 3D0VB 3BAEL 4NHUA 1UM5L 3I02B 4MGXA 4ODHH 4C54A 1I1AD 4QRRD 1MCRA 1R3IL 2IANA 2MSPA 4JY6A 5IW1B 4PGJA 3VXRD 1K2DA 5F7NC 1CBVL 4JFYB 1YUHB 4ZXBB 4J3UA 5K9OA 2XY1A 2V2WB 3ARDB 2IC2A 4LLVB 3IDXH 4C83B 4HDIB 3QIUA 2DQHL 2XWBB 2GIYA 1N7MH 2IGFH 5E8NA 4GG8B 2V9TA 3RKDD 4FABH 2FX7H 4KKNA 4FG6D 1KPRA 2Q8BH 1RFDL 4I13B 3LKPA 5BXFA 2ESVB 3BJ91 5C08D 5DJAA 3GSOA 4JRYD 2NY6D 4UILH 1QKZH 3NZ8B 4GKNB 2FIKA 1V8HA 3NAAH 1KTRL 2P45B 2XA3A 4K23H 2EECA 1ADQH 3IDUA 4PJCF 5IQ9A 2W60B 1H3VA 3NCYP 5I1KL 1CDGA 4P23D 5ESVB 4OZIB 1CCZA 1JZ3A 1YEHL 3QHZL 2JB6B 5EUOA 3EUUA 4M1CC 4GXVH 3GEWB 1T21B 1BX2B 4GW5A 4PP1D 4OUUA 4XRCB 5MI0C 1N2RB 5TDOA 1I3GL 2H6PB 1CK0H 1X5YA 3KS0J 1TVBB 3MRDB 3UC0H 4YWGL 4HPYL 3WV0A 4Y19D 5GZND 4Q74A 5I73C 3DRQB 4EVNB 3QDMA 5TGBB 4Y5VC 4PGCB 4K71B 1MCHA 1NLBH 3OXSB 2BNQD 3NPZB 5IBLC 2O5ZL 5JZ7D 3BPOC 4KAQL 5I1EH 1J0HA 1CL7I 1U6AH 1PFCA 1ZHLA 1RIVL 1F3RB 4LSRH 5GGVL 4JHBA 4JQVA 5SWZE 5KSAB 5L6YH 4R9HA 4ZFOA 3PXHA 3PP3H 4MD4A 3VXMA 1NJ9A 3F58L 4QO1A 1J5OL 4R2GB 4P2RD 1KJ3L 2X9WA 3LSOB 1KIPA 4XP9H 1HSAB 4X4ME 5JQHC 2YPVH 1PG7L 4EXKA 1J8HB 1ZLVH 2R9HC 1RV6X 4C59B 4GBXB 4NRZA 4JFFA 1D5ZA 1XR9A 5ICZA 2CLRB 1CQKA 4MAYB 2X70A 1QR1A 5GS0H 2DKMA 1UA6H 1HKFA 3K80A 3KJ4B 4AIOA 3ZKMD 1HWHB 3MOQA 4L29B 2PCPB 2EEDA 1G7IB 5IFHH 3VE0B 3W9EB 3MZTA 5D6DA 4BSWB 2BJML 3TJEH 3VFRB 4K8RD 3HPJA 5F1NA 1S7SA 2R56L 2DYPD 3ARDC 1AKJA 4OCYL 5D7LB 4HBQA 3V6ZB 1IGTB 4TRPH 4QRQB 4YHIB 2E6PA 1X6NA 3QWRA 2RFXB 3OZ9H 4Z7OE 4ETQB 1RZ8A 1X5HA 1XIWC 4J8RA 2VLMD 3EZ8A 4Y2DB 4G8IA 1NLDL 4UUJB 4JKMA 2IQAA 4K7FB 3ARGA 4M7ZC 1IGJB 5FIEA 43CAB 4HIEA 4BQCA 4OZHA 4M6NH 1DR9A 4K2UL 3VMNA 1S7UA 5ERWA 5EU3A 1A6WH 4KTDL 4OF0A 2WV3A 5LGJA 3QDGB 3EJYC 5CD5C 4E41A 4M48H 3EOAB 5HBBA 5B3JF 1M7DB 5DMIH 3P4NA 1A02N 4CMMA 5T1MB 1F8TH 4QRPB 3T04D 4JHWH 4UDTA 3PE9A 3L1OH 4FRWA 4OIAA 2H9GA 1EBPA 2G75B 4X4XA 1HK6A 4NWTL 2PO6D 5SX5H 4XNXH 4F3FB 5E9DE 2CDGA 1Z6JT 5CEZL 1DANT 3SDDD 4K7PL 2XQYG 2AJVL 2NYYD 5FCUL 3QUXA 1OARH 1NBZA 4JJ5A 3HMWL 1P4BL 4L8CA 2IALA 3LS5H 3W0WD 4D9QE 2VWEC 1FL6A 3QQ4B 5SX4I 3O2DL 2Q20A 1P4IL 4LLUB 1KG0A 4JM4H 4YXKL 2DI9A 3KWWB 1QSFE 4NT6A 1T4KB 3CC5A 5BRZD 2R2HA 3I3DA 2A9ML 4R26H 1I3RA 1OHQA 1ORSB 4QXGH 1YNTA 3I50H 4MHHG 4XI5C 1JUFB 2P8PA 5F89B 3RTQA 4D0BA 1AHWA 4KTYA 3D69B 5C70A 5EU7C 4GKOA 5HDBE 2QEJA 1FAIH 1UXWB 3NACH 4PRHB 4E42B 1LO0L 4M9OA 3DROB 3BOVA 3U9UA 5DMKB 4R2GC 1I8LC 2AXFA 2OXHA 3BPLC 3DARA 5DRWB 3V5HB 2Z8WC 5GGSA 1WBYA 5KSUA 4N1HB 1CR9H 4YFDB 1M1SA 4ZS6C 5IK3B 3TBTA 4BSVB 3MOBH 1OTUC 5IB3A 4LMQE 4KK5C 4WU7A 4OD3L 3BN9D 1NUFA 1OPGH 3PGFH 4WWKD 1NFKA 4XXDB 4NPYA 1LO2H 3CAFA 4XHJD 5C9JA 1UH4A 3EKCA 2YSSA 3EW3B 2X1XR 2HJKA 5TDNB 1ED3B 3KPPB 2F53A 3G04A 1UZ6F 3O6MH 1JTPA 1CVRA 3TV3L 2ADIA 2BVUA 1RPQA 3MTRA 4NQEA 3B43A 5C09D 5ISZE 4QTIH 3PDOA 4FQ1H 2IQ9H 1LE9B 1NANH 5HD8D 3GO1H 3O9WA 4UTAL 2P5WA 5IMMA 5L9DH 1NCDL 5GIRA 3CCHB 1RZIA 4I5BB 1IQWH 3S35H 1OP5K 3TBWB 5T1KD 4L4VE 3MGOB 1HQRB 1VFMA 4K3EH 3WIHL 4NNXA 4N8PA 1BQLL 2J8UE 1X5FA 4WJ5B 4GG6B 2NY5H 4MB5A 2ZSVA 4IJ3B 1YPZA 4R7DB 3WSQH 1VADB 1JWMB 3BWAA 3NABH 4PYHA 1RU9H 5JIHA 3QIBC 5JXEC 1ZLWH 1YN7B 2YZ1A 5CJXA 4JRWA 1DQTA 3KPNA 4G7YL 4IOIA 3IJHB 4IHOB 2J8OA 2X2YA 3RX5A 4CU7A 5KG9A 5D1ZD 2BNRA 3GHBH 4I3RH 5I30L 1EMTL 1QR4A 2C7UA 3LEXB 4H88L 3Q2CA 5MERB 3G9AB 3ALXA 1BFOA 4HUKB 4OCMC 1XCTA 4NKIH 1OOAA 5CJOH 5BVJB 1JWUA 3LDBB 3N9GH 3UPAA 4DN3L 1TZGH 4K9EH 5EZOH 4XP4L 4UTBH 4MJIE 1FNEB 1T7WA 4HGMA 1G7LA 2VLLA 4IRJC 4UIMB 1E27A 3GJEA 1KN4H 5JW4Q 4X4YB 3VMPA 4HMEA 1N59A 2CDFB 3ETBF 3MR9A 3BGAA 4XP1H 3VFGH 1UCBL 4X7CC 5ANMB 2E6QA 1DVFD 2BOCA 3TPUB 3MA9H 1C5DA 1S5HB 3VGHA 5IV2A 1QLEL 4U3CA 3WLWD 3ZTJH 4Y4KA 4FTVD 2P7TA 1XGTA 3V4VH 2FR4B 12E8H 3DPBA 4MJ6A 4NHUB 2FGZA 3T4YA 4N8VG 4K94H 4QRUA 1WICA 2ITCA 2OTWA 4MB3A 4KUZH 1A8JH 1SMAA 1EEUA 2VXUH 4J1UB 5A3IC 4UDUA 3DYOA 1BBJA 2DS4A 4IS6B 1WEJH 1BQSA 2HVKA 5JW3L 1KELL 4UZGA 5K9OB 1NSNH 4S10A 1R0AL 3BHBA 3MGAA 3Q5OA 3LY6A 1NCCH 2JF1A 3QIUB 2MNUA 4AT6A 5EFIA 5K59E 2APFA 3S9DB 5J1AA 1T0MA 3CMGA 5E8NB 3M8OL 5JHDD 4HHAA 4D3CH 3VD9A 4LU5H 3UTSA 4LEOA 2XKUA 1KPRB 4YHYB 4WV1B 1UB5A 3UP1A 4JFOA 1XCQB 3WFDL 2CD0A 5HGBB 4UV4L 5BXFB 1LP9F 4KMTH 5DJAB 5C0BB 4W70A 2FIKB 4LIQL 3MRMB 2NY1B 2WWKT 5DD5H 4OM0H 3SE8L 2PYEA 5C8JA 3VXSD 1KIUA 2CR3A 1G9MC 5IQ9B 3WL9B 5DJ6A 3OR6A 4H25A 3RFZC 2AQ2A 4W4OA 4YJZL 4Z78A 3MBXH 4U6HA 3RVUC 3MNWA 1JIBA 4ZNEA 4IJ3C 3BD5A 3U4BL 3TZVC 1VEMA 4GW5B 3C8KB 5TDOB 2Y36L 4YLQT 1LD9A 3X11A 2EE6A 1GHFH 4S1QH 2D7TH 5HDQL 4IOFD 3EOTL 4JPKL 2P8MA 1MY7A 1U3HD 4G42B 4OLXL 4N0RA 5FYJU 3P30H 4OLVL 2AABL 1F4YL 5D71H 2EDLA 3L3GA 5E5RB 3B9KD 3HG1E 3U9PH 1L9MA 1KB5H 1G6VK 4JQIH 3KYOA 5AYUH 5KW9L 3BDXA 4NM4L 4X7FC 1ZHLB 3BAEH 1UM5H 1HHJA 3F5WA 1Q9LB 3VFMA 4JM2D 3EJJX 3E3QE 4ZFOB 3DXAE 1UZ8A 4ZD3L 1R3IH 4MD4B 3VXMB 4OIIL 1NJ9B 3DSFL 4F7MA 4LVHB 2EZ0D 3CPLA 4HH9A 4UAOC 5JW5A 1CBVH 2B8OT 3UROR 3KHQA 1OGAA 4TNWK 2JCCE 5AWNL 5GS0C 1T1ZA 2DQHH 3G6JA 4NRZB 2KBGA 1D5ZB 1XR9B 5ICZB 2X70B 1IEAA 4NZUL 4BK4A 4TYUA 4P46B 4HXAL 4EN3D 3B3IA 1QO3A 4FMKA 3QO0A 4ZYKA 2QTEA 1DFBL 5J3HC 4U1NA 4QY8A 1E0OB 1RFDH 2ZUVA 1OM3L 1BQUA 3SCMC 3HAEB 5I15L 2XPGA 4G6AC 5E8OB 2X4UB 4RDQF 1UWXK 1AKJB 4ZPTB 4NFCA 1QRNE 4MJ2A 3CVHL 4AIZA 3VXUD 4WW1A 3G5VA 3IFLL 1RURL 4PJ5A 1ZGLP 1LK2A 2IADB 1JCKA 1T03L 5I1KH 4YGVA 1DP0A 1RZ8B 1YEHH 3QHZH 3OKDA 2IQAB 3RX7A 2P5EA 1I3GH 2PUQT 4HIEB 3SQOL 1MHCB 2HAZA 4OZHB 5C07D 4BK5A 4YHYC 5DVOA 2IBZY 1S7UB 5ERWB 5EU3B 5HVFB 4PJ8A 2A2QT 3REWA 5LGJB 2FH6A 3C87A 4YWGH 4E41B 4HPYH 1NPUA 3H7BA 2R15A 2GT9A 2NY1C 5EWIL 4OZFG 3L5WB 4CNIB 1JZ6A 4JRXA 4ONGL 4PFEA 4UDTB 1V05A 3I75A 3BDBA 1XAUA 2ICWJ 1NEZG 2O5ZH 2NY4C 4KAQH 1AI1H 4XP6L 3NZHH 3MREB 1D5IH 1RIVH 5GGVH 3JV6A 2W65B 5I19L 3IDYB 5IMLA 3QUXB 3F58H 1NBZB 4JJ5B 1J5OH 3GIZL 5D2LE 1PYWB 4L8CB 3RPIA 2IALB 2W0PA 2EDYA 1HQ4B 5L2KA 3MUHL 1FL6B 1AGCA 2VC2L 3E8UL 4PJEE 1X7QA 1KG0B 1PG7H 2ZG2A 4MJ5A 2O61A 4WEUD 5CP3A 1P9MA 1UQSB 3CC5B 3MJ7A 2R2HB 3QNXA 5HVHB 1I3RB 1Z9SA 5CHNB 4YHKL 2P8PB 1NFDE 4D0BB 3EGSA 3DRTB 4NQCE 5C92A 2CUMA 1B3JA 4JQVC 3SQBA 3K2UL 4P4KD 3BDYL 5B22A 5HPMB 4DKFL 3U9UB 1LE5A 5MHSE 2AXFB 2BJMH 2B0SL 3UJIL 3ALPA 2NPLX 1HINL 3WYRA 3BEVA 2R56H 3VGEA 5KSUB 5DHYA 3R06A 4OCYH 5I6XC 5EO9A 1T1YA 3EYQD 1J9CT 3C5ZA 5DDHA 4YC2C 5I0ZA 4N0FA 3WIHA 3MV7D 3T4AA 4WU7B 5CZVL 2AJZA 3BWUC 4JDZA 4OSUL 1A6ZA 3CIQA 1T83C 3WD5L 3SJVE 4OJFL 5C9JB 1NLDH 1VGKA 2HJKB 1PEWA 3FO9A 3V0WL 3CFDA 4K2UH 3VXNA 2AV1A 1UKQA 2EIZA 3BT2L 4KTDH 4KFZC 4OGXL 2ADIB 5D6DC 1X5ZA 3S37L 4KUCD 4U6VL 35C8H 4G9FD 3PDOB 5BMFL 1WIUA 4B5EA 1R6VA 2XG4A 5IMMB 4Y0GA 4HW6A 5GIRB 4EI5B 3MRFA 4TVPD 4P9HL 5DC4B 1ZA3B 1KYOK 2HFFA 4NWTH 5MEND 4LCIL 3RRQA 1T04B 4JHZA 5CEZH 3ARGC 4OF3A 4K7PH 4NUJA 1F58L 1RJCA 2AJVH 2ZSVB 3GMQA 3PWJA 1YPZB 4OD2A 5FCUH 1QFOA 2FDBP 3FKUS 3BWAB 3HMWH 4OCWL 1P4BH 4HKBA 4FQCL 1IAIL 3IF1B 2BC4B 3T1FA 3ZKQD 3O2DH 1P4IH 1WAAE 3KPNB 4IOIB 3UTTD 3LRHA 4YXKH 3HR6A 3S3SA 5EUOF 4ELME 4KROC 3V4PL 2BNRB 3KPQA 2A9MH 3FN0L 4D0CA 1FYTD 1MJ8L 3NFPB 2C7UB 4K9EC 4PGEA 1MJJA 1KCRL 1BFOB 5ADPL 4RFOL 3B83A 1BVZA 3QNYB 4Z7WB 1YC8A 2BXYA 5HYSA 3KLDA 5BV7B 4L8DB 1LO0H 4HIJB 3QUXC 4FP8L 3RGVA 2VLLB 1E27B 3TGXA 1LWRA 2BOBB 1CICC 1A3LL 2VLRE 1N59B 5F96L 3CDYA 1NGQL 5AUMA 4E0RA 2N4IA 2C3XA 3W81A 2BOCB 4OD3H 2R4RL 1C5DB 1T1XA 3RTQC 1AHWC 5IV2B 1KNOA 4Y4KB 4WO4A 1YZZA 4N1CA 1G7MB 3TEUA 1MCWW 3TV3H 4P5MA 3T2NL 2ITCB 2OTWB 1Y6MR 3OKNA 1S9XA 1AR2A 1TIUA 2GUOA 4OUOA 4WHDA 1A1MB 4UDUB 1JFQL 1M7XA 2HT2D 3GSUB 4LAJH 4UTAH 3TNNA 1DQML 1NCDH 5IHZA 4NN6C 1RK0A 1U9KA 2VITA 4XNUL 2ITDB 5EU6E 5EO1A 1PZ5B 2COQA 3T1WA 3WIHH 1NDMA 1BQLH 3DHMA 3TP4A 1T0MB 3U6RB 4B0MM 3DV6A 2OX5A 4HHAB 2Z31A 4GW4A 4L4TD 4XBPB 5HI4C 2MWCA 1UB5B 4JFOB 3QFJD 1KJ2B 3H42L 4G7YH 2F54D 1AR1C 3R1GH 3HUJB 1BAFL 3O9WC 5C6TL 4JO1L 2OTUA 3W39A 5I30H 1EMTH 1YNKL 2AGJL 3NPSC 1VFOA 4H88H 2DF3A 1CS6A 2PYEB 5I2IB 5J56B 1WZ1L 3OR6B 1X5LA 4DN3H 4U6HB 1JPST 4PGZA 3BZ4A 5F71A 3ARTA 3NCCB 4XP4H 3J8F7 3K2MC 4QRRE 1D9KD 4CVWA 1LD9B 3IJYA 1T2XA 5DUPL 3T0EA 5CJXC 5FM5M 4ODBD 3VXRE 4GKZA 3BPNC 1RHFA 3GNML 4BH7A 4PG9A 1UCBH 3LKSB 3UAJC 3MJGX 3U7YL 1ZWIA 1CTNA 2XTJC 3PL6A 4OZGE 3SO3B 1QLEH 5JQ6L 2CR6A 5K9QI 2JJWA 2VDRL 2EYSB 3GGWA 3F5WB 4GLRI 1HHJB 1XGPB 3VFMB 4PREA 4OI9A 3HZYB 4OCSL 4F7MB 2DTML 5C08E 2BZDA 2HFGL 4JRYE 1FO0L 3CPLB 3CVHA 1A6TB 4HH9B 3ARYA 3RY6A 3AY4A 4O51A 1KELH 4JQXA 1GGCL 1OGAB 2E9WA 1R0AH 5HYEA 3X14A 3MUZ1 1T1ZB 1LEIB 2X1OA 4NM8L 1GRWA 1O7VA 1U8OA 5BS0A 2AV7A 1N6UA 3BH9A 1IEAB 4PJHE 3M8OH 2YUVA 2OYPA 1EEYA 1R24B 4GAFB 4E5XA 5K9KA 4U1NB 4MA3A 1YDPA 1WC7A 5JOFA 2VRAA 1ZV5A 3WFDH 2G9HB 4UV4H 4QXTA 1G7QB 4Y19E 3ECBA 1XF4A 2MKLC 4LIQH 4BH8A 3C60D 2YC1A 4AIZB 3HE6D 3SE8H 5J12C 1K9TA 4PJ5B 1LK2B 3UYRL 2BNQE 1ES0B 2B39A 4YGVB 3V2AR 1PD6A 2IBGA 1UWEL 2WWMD 2EXYD 3U4BH 3OKDB 2I26N 1WLHA 2Y36H 3MLRL 5FEBA 5HDQH 1CDYA 3EOTH 4P2RE 4JPKH 1WVZA 3O3BA 3REWB 1A22B 1GZPA 4GUPA 1JGVL 3H7BB 4LLYB 4EI6A 2GT9B 2AABH 1F4YH 4OLVH 5J6HA 1OD9A 5LGHL 3HE7B 4Q9QL 4IOSD 1UADC 1YPZF 1UJTA 1EEZB 4DCQB 1D3CA 1JN6A 4W4OC 3MO1A 4LNVA 5JDJA 5KW9H 1QVOB 1UEMA 4NM4H 2ZPKL 2FZ3B 4Q9BA 1V7ML 2D7OA 3R4DA 5IVOA 5J0BA 2OBGA 3VD3A 4ZD3H 3ILQD 4XCFL 4OIIH 1CFSA 3DSFH 1SEBA 3RPIB 1KTLA 5D7IE 4ZXBD 2BSED 1LEKA 4LHUA 3GJFA 1EJ6A 5A2IH 5CBAA 1WITA 4NCDA 1X7QB 2VZOA 1H3PL 5AWNH 5FF6A 4MJ5B 3SO3C 2O61B 1FN4A 1N64L 4AG4L 4U1KA 1F45A 3B8SA 4NZUH 1SJEB 4HXAH 4Q2ZA 2VLME 3EGSB 3TESA 1F6AA 1AGEA 1DFBH 4FQXA 4WHTA 1Q1JL 2DMKA 3CZFA 3N0PB 2NLJB 3P11L 2VKXA 5B38B 3S88L 2DBJA 1JV5A 4MNQA 2LFGA 3FO1A 5I15H 2JJSA 4PJIE 4LRNL 3BEVB 2BK8A 5DHYB 1OLZA 4C57C 1TLKA 5EO9B 3LOWA 1T1YB 3CVHH 4HK3N 3C5ZB 5DDHB 3R0NA 4N0FB 3AS0A 3IFLH 1RURH 4JFPA 5F3HA 3T4AB 4CU8A 2GJ6A 1T03H 2AJZB 4LDEB 5MEPB 5EO0B 3HNTL 3CFCL 3QRGL 4JDZB 4YZFF 1A6ZB 4KV5E 2LVCA 2BY1A 4YHPA 4G6KL 2DM4A 1JZ7A 1SHMA 5F1IB 1VGKB 2H2SD 4PRID 3SQOH 4XNZB 3FO9B 3CFDB 3HZMA 2AV1B 1HI6B 2EIZB 5DMGC 4N0UA 3W0WE 4P3DB 4BQBA 3GMMB 2X44D 4OGYL 3B6SA 5EWIH 5IBTL 1Y18A 3ARBA 3PG2A 4MNGA 4POUB 3OB8A 4FNLL 1ZLSL 4ONGH 4PJAA 5BRZE 3MRFB 3AREA 1OY3B 3AC0A 3MRCB 1IM9B 4XP6H 2DMCA 3CFIC 5D96C 1Q9KA 1UKSA 5KSAD 5BW7A 3GK8L 4WEMB 1XF3A 5JNYA 3FT3A 3PWJB 3GMQB 1GAFL 3MRGA 5I19H 2UUDK 1R5VA 5CJQL 4XPFH 3GIZH 1C7TA 4DQOL 4PJ8C 1MH5A 1UH2A 3T1FB 2VC2H 3E8UH 3B2UD 4GW1A 1EGJA 2J2ZA 1J8HD 2H32A 2V7NA 3QULA 1TFHA 2CUIA 4GBXD 2ZZUT 4M93C 4MAYD 4P2YA 4YHKH 4PGEB 1MJJB 1OP9A 3TO4B 2A83A 3I2CL 1TJIL 1A3QA 1WCQA 3K2UH 1Y6NR 5AYQA 3BDYH 1I1CA 4DKFH 3RGVB 5D72L 3PGDA 1YEDB 1YMHA 5C09E 2B0SH 3UJIH 2EE9A 1IGYA 1HINH 3BJLA 3VH8G 4URTB 3HNVL 5D7LD 2FBJL 3RZCA 2NX5A 1WFNA 1P9MC 4JZJB 4W6WB 5EU5B 4WGWB 1ZT7B 1BFTA 2FD6L 1P53A 3GJFH 4M7JL 5F1KC 3WE6A 5CZVH 5J57B 3GMPA 4XMKL 3P9MA 5HI5D 1UJ3C 4C56A 4JVPA 4OSUH 1T1XB 4ZAKA 4Y2DD 2JKXA 4OJFH 3PHOA 3G5ZA 1NCAL 2CLVB 5K93A 2Y9RT 4L3EA 3V0WH 4JFXA 1B4JH 3ZTJG 3BT2H 1A3RL 5IB4A 3FHQA 3H9HA 4OGXH 4P5MB 5IIEB 5JDSB 3QDGD 3S37H 3BO8B 4U6VH 3G6JF 3OKNB 1IGFL 1ZKAA 3GHEL 3FB8A 1S9XB 3S4SA 4N0CC 3B9EA 5BMFH 4LCUA 4Z7VE 4PJXE 4QRPD 3TNNB 1W0VB 1RK0B 5FDYA 4OLUL 4P9HH 2VABA 2VITB 3DX9A 5EO1B 2EYRA 5CAYB 1W72L 1A6AA 4LCIH 1HKLL 2YN3A 1F58H 1AJ7L 1V3LA 3DV6B 4XNZC 5F6IB 4S1DD 4OCWH 2VAAB 4XNYL 2Z31B 4GW4B 3QQ9C 4FQCH 4HUWB 1IAIH 3QAZC 3UBXA 1CF8L 2HTLD 2XN9A 1U8PA 3EYFB 3ZHDA 3D85D 4YEEA 3V4PH 4UQ2A 2XFXA 2OTUB 32C2A 3W39B 3FN0H 2GTWA 1MJ8H 1QFPA 4KDWA 1FRGL 2AJYL 3RWGA 4KKAD 1KCRH 2PW1A 5ADPH 4RFOH 5C71A 2HRPL 3NIGF 4FTVE 1RMFL 4PRHD 3VFVA 1JF1A 5I8EA 1LNUA 4Y1AD 2X4OA 3BZ4B 4Y5XA 1MCPL 4O5LL 2D3VA 4FP8H 1DUZB 1SMOA 3Q5TA 1NCNA 4ZUWB 1A7BA 3CMOL 4JB9L 3GIVA 3IJYB 5DJDA 2GKIA 5IB2A 3T0EB 2NXZB 5ESAB 1A3LH 2E3VA 5KSBF 4YXHL 5F96H 3UEZA 1FL5B 3EDDA 3OGCA 1NGQH 1TQCB 4Z7QF 4PG9B 3T2PA 1INQB 2XNAA 4RX4D 2F58L 1HHHB 2R4RH 3QUZA 1ZWIB 2AJ3B 3PL6B 3DUSB 4M43L 2YKLL 3FOLA 5C0CB 1JHTB 1U95A 2X4TA 3GUTA 4BYHA 5FV2A 5ADOL 3O2WL 4HS3A 1FC1A 4JO2L 5JHDE 1LQSR 2EDJA 3ZE1F 4TTDD 1T66C 3GGWB 1F90L 1T6VN 3RGVC 3IDMA 4PREB 3U30C 3T2NH 3H9SA 1GC1L 4HG4J 1HH6B 3DURA 3K4AA 3PWPB 4Q9CA 4LSDA 5EIQA 4G6FB 4KKLD 3OSKA 9CGTA 3MLVL 1JFQH 4P4RA 2VDLL 3QWOB 4NWUL 1FZMA 2AXGA 3QEQA 1DQMH 4O51B 5MEQA 2MKWA 2RGSA 4XNUH 3FQNA 2FGWL 3X14B 3VXSE 1MWAB 4TNVK 5HVGB 5HHOA 5IESL 4WO4C 2VLJA 5BS0B 3BH9B 2NR6D 5I71C 4F7TA 4U6XA 1PEZA 4NO0A 4X80L 3GSQA 1EEYB 4LARL 1ZTXL 2GTZA 5D5MA 1RZJL 1NMAL 2XKSA 2AK4B 3DSNA 1A6PA 5JOFB 3H42H 2X4PA 4CN1A 1BAFH 3DJ9A 5C6TH 4JO1H 1YMMB 4BH8B 5B4MC 5J7CC 5FK9B 1YNKH 1JNLL 4YNYA 2AGJH 1VESA 1FFRA 2D03L 3J7HA 1ZHKB 3WDIA 2Y5TA 1WZ1H 1XGRB 4MDIB 5A2KH 3LN5A 3SKUD 4P0DA 2FEDD 4Z18A 3ABZA 1WZMA 1FGNL 1K4DA 1JGUL 3WDHA 2YEZA 4NC1E 3E0GA 5E2JA 2HJLA 4KRPC 2IBZX 2Z31C 3PJSA 4Q0XL 5DUPH 4MLSA 3EOYG 3O3BB 3GNMH 4JFDA 4H1LB 1GZPB 2DI8A 1RUKL 1WT5C 1G7JA 3RWFB 2X4SA 3U7YH 2BFVL 2OL3L 4FZEL 2MCG1 1JTTA 2QADD 3W11D 2VERN 3QWQB 4PBVC 5HGDA 5JQ6H 4QHKI 5DJ2A 3MO1B 2W9LA 3U0TA 4OIBA 2K3TA 2VDRH 2FX8L 1AXIB 2YPKA 3HAEH 2NY3B 1B2WL 2YD8A 2BVYA 4PY8I 1A7OL 3MROB 2D7PA 3T0EC 4OCSH 1CFSB 3ZT6A 2DTMH 2HFGH 1O5DT 3EHBD 1FO0H 4M61A 1XZ0A 1TQCC 3KPRB 4X5XA 4X98A 5E8EA 2UY6A 4LHUB 3ULVD 4L3CA 3SHSA 1GGCH 5CBAB 3VXUE 5FF6B 3PL6C 3QIUD 2X5PA 5FUCC 1NH6A 4HS8L 4R90L 4NM8H 1JPSH 4U1KB 2HTKD 1DE4A 2VLKA 3B5TA 4JHAL 5TFSL 2R2CA 5DO2C 4Q2ZB 4OM1L 5IP4A 1ZHBB 5I1LB 3C9NB 3MLPA 1F6AB 1WBZA 2YPLA 5GGRA 2H26B 2XZCL 4OV5A 5C07E 1OTSC 4WHTB 3CZFB 1ZK9A 2ADGA 2HVJA 4MXVE 4PPTA 5C0BD 7FABL 3V9FA 3S8WA 5GSRA 1BGXL 3RY6C 1DL7L 3AY4C 4JQXC 3BYYA 5B39A 3TT1L 3WHE0 3CNKA 2X40A 1ACYL 1SVCP 4MXQD 1JNHA 5F3HB 5DTFA 3UYRH 4F37F 4HWBL 2ZUTA 2GJ6B 5D7JA 1UWEH 3KVQA 4DUXA 3ARRA 4YHPB 4O58L 1VA9A 3OKKB 3MLRH 4X9BA 1FNLA 3OF6D 2VDML 1U58B 1TNMA 4LOUC 2IAMA 3VFOA 4U31A 1KLUA 1QTYT 1MAKA 4NNPL 5E8DH 3ZDZF 1JGVH 5LJYH 3N50A 4NQVA 5KSVB 2H2PC 5C0AD 5LGHH 4Q9QH 4MNGB 3O3AB 1CQYA 2DKSA 3AREB 4NKDA 3V0AC 4POZC 1EAPA 5DQJB 2ZPKH 1Q9KB 1V7MH 4V1DA 4KKBC 1I8MA 1CXFA 4CKVX 3QI9A 4HIXL 4K3HA 4JVUA 3FT3B 4U1JA 4XCFH 1R5VB 1KXTB 3MXWL 4TVSa 3PP4L 1NEUA 3BQUD 1MH5B 4JVWA 1BD2D 4HUXB 4EUPH 3C08L 2ZWLT 3C5SA 4GW1B 1MJUH 3BZFA 1H3PH 2YN5A 3MV7E 1TDQA 4U0QB 3U83A 1SY6A 1XH3A 1N64H 1BVKA 2KPNA 4AG4H 2O5XL 2ZUXA 2R1YA 2A6JA 1ULVA 3BPCA 4P46D 3FRUB 4RCAA 4Z0XA 3WO4C 1KJMB 3MFFA 2A83B 5JIPA 1VFBA 2AK1L 4KK9D 1Q1JH 1OP3K 3P11H 3GRWL 2DTSA 4YHOL 3S88H 2R29L 4QHUA 1T5WB 1YMHB 2DL9A 1H0DA 1P7QD 4G9FE 2K1MA 2LAGB 1IGYB 1JPGA 4ENED 4LRNH 3T8XB 3IFNL 4GXUM 4JFEB 3RZCB 3ESUF 2NX5B 2N1KA 3QWRD 4TVPE 4ELKA 3I6LD 5EZLA 1P84J 3P9MB 3FJTA 3HNTH 3CFCH 3QRGH 5MENE 4QHNB 2WSKA 4ZAKB 1PKQE 3PHOB 4IIQA 2ARJQ 4G6KH 1M7IA 2R2EB 5CD3A 5IT2L 1RJYA 4FQXC 4JFXB 1QBAA 2HMIC 4NZRL 2Z9TA 1OQXA 5IB4B 1U92B 3H9HB 3RL2B 1U8LA 5HHPA 4PJGA 4E41D 4OGYH 3AB0B 1L0QA 3UTTE 3FB8B 3S4SB 4P9HC 4LCUB 3WJLC 2QHRL 3UZEA 4FNLH 1ZLSH 1FYTE 2VABB 3DX9B 1K5NA 1YQVL 5KTEL 3IJSA 3SE3A 2DICA 1WWWX 2EYRB 3OB0K 5F1OB 4ODXB 3RVTD 1A6AB 3Q0HA 3PWUB 4U1LA 2CQVA 4WFED 3GK8H 2FEEI 4IRZH 5F8QC 1IC1A 1GAFH 3PABA 2FH8A 5CJQH 4DQOH 1N6QL 1S7XA 3UBXB 3BMWA 4F33A 1YA5A 2DQIL 2XN9B 3STLB 5IB1A 4PGDB 3ARBC 2H8PA 2C3WA 5D7KD 1HYSC 5HSFA 2EO1A 2XFXB 32C2B 5DD0L 3V8OA 3AREC 4ZTOL 2GTWB 1B0RA 3C8DA 3KPOA 4FFWC 2D9QB 4CDHA 2PW1B 4HGWA 2PTUA 4ODTL 3JV4A 1J7VR 3ZMRA 3I2CH 1TJIH 5CUSL 4UIKL 1JF1B 1BF8A 5E4IA 1LNUB 4BUHA 2X4OB 3VRLF 4PRBB 4NQTA 1HIML 1IKNA 5D72H 3O3UN 4ZO7A 4X6CE 1SJHB 1FZJA 2OI9C 5IB2B 5F6HI 5GS1A 3ARXA 3HNVH 4X6EB 5F9DC 1AD0B 1P7KA 2B7DT 2FBJH 1MWAL 1MCOL 3OGCB 3RBSA 1TPXC 3RNKA 3DO7A 4Z7UB 2FD6H 2HFEA 4M7JH 5IVXA 2F19L 4XMKH 2DIJA 1ZSDB 3AM8A 5HGHA 3FOLB 1U95B 1OVZA 2X4TB 3CX5J 3O3EB 4MJ4A 1NCAH 3GBNL 4HS3B 2F74B 1SVZA 2IH3B 2ICCA 2VXTL 1A3RH 1FPTL 2C3VB 3IDMB 4L4TE 3VXTA 1DN2A 3DURB 3KS0H 4TUOA 5FM5O 3DMMA 3QFJE 4YDJA 1IGFH 3GHEH 2F54E 4TSAL 2XTLA 1U8KB 5IEHA 3C6LB 4P4RB 5HYSG 1FZMB 3IETA 3QEQB 4EI5D 3WFHA 3QDJA 4OLUH 1W2KT 1HSBA 3E6FB 2P1YA 4WHCA 4I0PD 5D9SA 4EQ3A 1W72H 4R4FL 4ZAKC 3P9LA 2D0GA 4OF8A 1DSFL 5HHOB 1HKLH 4F7TB 4U6XB 1C16B 4NO0B 1AJ7H 2V9QA 3RVXC 3O2VL 1X5XA 2GTZB 5D5MB 3IAPA 4XNYH 3D1MC 1KGCD 5LVEA 1S8DB 3ARUA 1CF8H 3EJZD 5SWZA 1J11A 3AB0C 1BBDL 2X4PB 4G8FA 1X5IA 3KLHD 5FO8A 3VFTB 1WFOA 2BNRD 4RNRA 2UWEB 4Y5YB 3JWDC 4YNYB 4G3YL 4X4MA 1FRGH 2AJYH 4YPJA 5E7BA 4HZAA 1A1OA 3A6CL 3RX8A 2B1AL 3MLSL 2HRPH 2KZ1B 3N06B 1RMFH 4U4BA 4U1GB 2R1WA 1MCKA 1CDUA 5TH2A 4GXUN 1K4DB 1MCPH 2YEZB 1KJVA 4O5LH 5IBUG 2RBLA 4GJTB 2P8LA 5CEXB 3CMOH 2YK1L 4JB9H 3PJSB 4PJAF 4JLRB 2HKHL 1BZ9A 4HH8A 4PRNB 2WUCL 4YXHH 2X1WL 3U2SB 3T0BA 4YK4C 2NW2A 1VKXA 1J8KA 1JWSA 1G7JB 2F58H 4M7LL 3KPSB 4WU5B 3T3PF 4FQLL 4M43H 2YKLH 2NXYB 3MYJA 1RI8A 3IAGC 4LCCA 5I75C 4Y4KD 2YUXA 1YEEL 4M03A 1OAXL 5ADOH 3O2WH 2A0LC 1MHPL 1ZT4B 4JO2H 2A73A 4RGMC 3U0TB 4HK3J 3D2UD 4Y5XC 3AROA 2J6EL 1F90H 3LN9A 2EDTA 1PX4A 4DGIL 1GC1H 1OAKL 5IJVA 2GFBA 3VMOA 3RVWD 3L3KA 2GSGB 3MLVH 4N68A 1XZ0B 2VDLH 5SWSE 3STZA 4NWUH 4Y4FA 1CT8A 4L3CB 5J13B 1MQKL 5KVMC 2FGWH 3BFOA 3QUZC 4EBQL 1FFNA 1ODAA 2EKSB 3HLAA 2IBBA 4XX1E 4AZ8A 5IESH 2VLKB 2IPTL 4YFLI 5EB9A 1FH5L 4KMLB 4X80H 5HGAA 1R5WA 4L9LA 2X10A 4LARH 1OT1A 1WBZB 1ZTXH 2Y6SC 2YPLB 5DGRA 5GGRB 4OV5B 1TTFA 3MCKA 5E9DA 4K07A 5D1XA 3M07A 2ADGB 2YD6A 3MMEA 3VI3F 2HVJB 5E6ID 4ZOCA 4JY5L 5GSRB 4HFWA 1WFTA 1A7NL 4YR6A 4M3KB 4HX1A 1JNLH 4LSQL 2D03H 4PLKD 2CSPA 5I74C 1WWAX 1JNHB 4MCZA 3GSNL 8CGTA 1QSFA 4TN9A 5GISL 4NRXA 4PJBE 5D7JB 3ZKSD 1NFIA 2R2BB 1A64A 1FGNH 1JGUH 4UNUA 1YY8A 4FQ2L 3BEWA 3M45A 4FS0A 3ARPA 4P49A 3QO1B 4Q0XH 5EOTA 2IAMB 4WI5A 3WNPA 3SGKA 1P4LA 4YEFA 1RUKH 4PJ9A 3MJ9A 4LSSL 1MSPA 1NUDA 2J5LB 2GY7B 2BFVH 2OL3H 1AXSA 4FZEH 1IZJA 2DD8L 2JJTA 3LB6D 2DQFA 4NKDB 1MPAL 5FGCB 4I4WB 4U1GC 1FSKB 4GRLA 5HHVL 2FX8H 1EAPB 3BIKB 1F3JA 4V1DB 1IAKB 1I8MB 1B2WH 3QI9B 5H8DA 2UVEA 4S1SL 1A7OH 4U1JB 4L3AA 5IFAL 1MCEA 1Z3GL 2HT4D 4PUBL 4G80B 2M26A 3C5SB 4U7KA 3RIFF 1K8IA 3BZFB 4BQ6A 4WWID 4IBLT 5ISZA 4F7PB 1TVHA 5CJ5A 3QZWA 4U1SB 3GM8A 4LPXA 2NXYC 4HS8H 4R90H 2BVOA 3MX0A 3ARVA 3ZHKA 4OZIE 2WBJD 2R1YB 2A6JB 3BPCB 4JHAH 3BKJL 4OM1H 3VG9B 4L4VA 5F44A 2B4CL 4QOKB 1NMBL 2XZCH 2V17L 4PRIE 1FZKA 3D18B 2J8UA 3AMLA 2ZUQB 25C8L 4MB4A 5M94B 4QNPE 4QHUB 5IEKB 2QBWA 1BGXH 1DL7H 2E9JA 5DD6B 2EYTA 5I9QB 1JPGB 5J13C 1Q0XL 5KOMC 4HCRA 4RAVA 3TT1H 3DO3A 5LQBL 5T5FL 2YD4A 1A9EA 2OQJA 1EHLL 1ACYH 4LP4A 1QSEB 4ZO9A 4ELKB 4HWBH 4HPOL 4UBDC 5DK3A 3E6HA 4IIQB 4O58H 3CVIL 3FB6B 1EFXB 3VFNA 4NGHL 5CD3B 5HYIA 1RJYB 2YWZA 2GSIA 4JREC 1I4FB 2VDMH 1I7UA 2BSTA 3G9VA 5FOBA 3LRSB 5FB8A 4J7RA 4LLQA 3IU3A 5HHPB 4NNPH 4PJGB 4UB0L 1OAUL 3RDTB 1CLCA 3OPZL 3GSVA 2W0FA 3O0RL 4RIRA 2XWJA 3ORJA 3HE7D 4X7SL 1J8HE 3D39A 5CGYC 4ZOEA 4BJLA 1BLNA 5B8CA 4ORGA 2GK2A 3MRHA 3NFSL 1V7NH 1VB9A 4X6DF 5D5MF 1K5NB 3LPFA 5D7JC 3IJSB 3O45A 3DV4B 4YIQB 3H9ZA 1P2CA 4WDIA 4KK6D 4O02L 4U1LB 2PN5A 4HIXH 2ZNXA 4JGJA 4XMPL 5A43C 1CL7L 4X4ZA 4PTUA 2A6KA 3MXWH 4ODUB 3QISA 3AS1A 3PP4H 5GRVL 3MA7A 4L1HA 4DKEL 4PLJC 3C08H 5D7LE 4Y4HA 4F33B 5CP7A 4OZ4B 3HR5A 3VI4F 2Q87A 2O5XH 1HEZA 5FGSA 3KPOB 4ALAL 3QIWA 4LSTL 1A7RL 3JVGA 1CXIA 3OAUL 4FFZL 4I0CC 3JV4B 2ENYA 5CZXD 3QI9C 3Q6FA 2AK1H 2CLZB 3P77A 3CSPA 5ID0B 3BW9A 3GRWH 4YHOH 1OWWA 1MLCB 3QDGE 1FZJB 4HFUL 4AIXA 2ZSWA 4YBQD 2FJFB 1I1YA 3IFNH 3PDDA 3C5ZD 4F7CB 5AAMA 2AVGA 4QRPE 4J4PA 3QCVL 5FYLL 3R8QA 1XF5A 3U46B 3RNKB 2MFNA 5IVXB 2ILLA 3RPKA 5A2JH 4ZQKB 3FFDA 3K8KA 3O6FB 4YPGB 5HGHB 4L8SA 3ZDXF 1NDGA 2ZP0T 3ZDYF 3FB7A 4QGYA 5IT2H 2SEBA 2ZUQC 3CSYB 4Q97A 4NZRH 5DK2B 1HOCB 4NKMA 2DM3A 1K4CA 3KXFB 5JA9A 3VXTB 1MEXL 3RWDB 2XYCA 2GJZB 1BM3L 1AD9A 1CD0A 1G7HB 1H15B 3DMMB 4GO6B 5DRNA 5JOEA 4YDJB 2IPKA 2GCYB 1C8PA 4R6UA 1GZQB 4RFNB 1QFHA 3A0OA 4F7EB 2QHRH 3BISA 5J6GA 4YDLC 3QDJB 4MCYB 1N0XL 2ARJB 4PJ7F 1HSBB 5KTEH 1YQVH 4ZUTA 1IM9D 3IXAB 3IXTA 2JIXA 3EO1A 4IIQC 5DVLA 2CPCA 3G6AB 5C0RL 3HG1A 4Y1AE 3WFCL 1W0YT 3HHRB 5SV4A 2FLBT 1F4WL 5F8RC 1N6QH 2P43B 5F21B 4N9GA 1QLRA 3OAYK 2AXJA 2DDQL 1SBSL 1TZIB 3DXAA 3LH2L 2DQIH 4G8FB 5EZIL 3P3YA 4Y8DC 4KJPC 1TJGL 3V4UL 5DD0H 4ZTOH 1U2HA 1U3ZA 3QSKB 4PGBA 3C2SA 1JNJA 1OW0A 3SPVA 3SE3C 2FO4B 3TO4D 1A1OB 4Y16A 2J6EA 3NFNB 2JCCA 4ODTH 1G0DA 1EJOL 5CUSH 1TMCB 4UIKH 5CFHA 1OTTD 5HHQA 4QWWC 1M4KA 3DETC 5E2UL 4WFGD 3AVEA 1KJVB 2BNUA 1HIMH 3RIAF 2P8LB 3B9VA 5JMOC 2CIIB 3OKEB 3KGRA 1U8HA 5IJKA 1VCAA 4NZTL 1MWAH 1MCOH 3MCG1 2NW2B 1JWSB 4LAQL 2F19H 1H3WM 3QXWA 4QXUL 2YD7A 2VB5A 4GG6E 3MYJB 1ORQA 5ITFA 1QRNA 3AXLA 1T89C 3GBNH 4ZUSB 4J3SA 4QHMA 1ZHNA 5F7YC 5JW4N 2VXTH 1FPTH 2V9RA 3T0VA 3TYGL 1G6RA 1IKNC 2BMKB 5C0IA 2AI0L 2WP3T 4OCRL 5GHWL 1UM4L 1LO4L 3L3KB 4XB8A 5GS1C 3UTPD 4TSAH 1B4RA 3ZYOA 3IKKA 3STZB 3U0PA 4Y4FB 4WTXA 4KRNA 2WAHA 3MUJA 2A1WL 5ALBL 4MXWL 5FGBA 5GSVA 1T1WA 3V95A 3AM8C 4U0RB 2VDKL 3HLAB 4R4FH 5H94A 3P73A 4XHQA 1DSFH 1EA9C 3ES6A 1RZJC 3ZHLA 3NGBB 5HGAB 5E8PB 4E9LA 1R5WB 4L9LB 2G5BB 3O2VH 2VR9A 4P2OA 4H1LH 3CK0L 4UT7L 4PRPB 3MCKB 5E9DB 3JWOL 2Q1EA 5D1XB 2NW3B 3DMMC 4N8VA 4J2XA 3MMEB 2EXWD 4NYLA 5DJCB 1BBDH 2PXYA 1MF2L 1A4KB 3ROOB 2I9LA 1KXVC 4TUJA 5I8OL 4RFNC 1IAOA 2DQUL 4YR6B 2IJ0C 5D2LA 1TETL 3RNQA 4OQTL 4HX1B 4X8XA 2JELL 4PTTA 4G3YH 4LPWA 2YZ8A 3LKRB 3AFLA 4PJEA 3A6CH 4MCZB 4NBXB 4NP4L 2B1AH 3MLSH 4PJGF 5GJSL 3QH3B 2KQMA 4TOYL 1G84A 1CXKA 2OCFD 4HWEL 1NFDA 4NQCA 2NXZD 2HKHH 4HUNB 1AO7A 2EC9T 2FL5A 5EOTB 1NAMB 2WUCH 3SDAB 2DOCA 4BFIA 4YE4L 1P4LB 2IPUK 3BIBX 3MBEC 3ULVE 4D2NA 4PJ9B 1FORL 3OAZK 3KLAB 4M7LH 1AXSB 1BECA 3TVMA 4FQLH 5C0CD 4UU9A 5JORA 2DQFB 4K8RL 3OAYH 1YEEH 3H0TA 4PY7B 1OAXH 1MHPH 4HJ0D 1C5CL 2OR7A 5LWYL 4LGRB 3BKYL 3UPCA 3HB3D 2UV3A 1IT9L 5DFVC 4KJQD 3TCLA 4DGIH 3TO2B 1OAKH 3PWPD 3SJVA 3TT3H 2ICEB 2XZZA 1I75A 5ETUB 5D4QA 5IM7A 1UKTA 1A7QL 5E94B 5C0BE 3MLYL 1U3YA 5FO9B 3ZE0E 4NJ9L 1AGFA 1MQKH 5EIVA 1K8IB 2XKNA 5ILTL 4GOSA 5ISZB 1TVHB 4EBQH 4EUPG 5DEFA 3MLUL 2AQ1A 3VXPA 4LCCC 5BS0D 5CIPA 1HDMB 2IPTH 1A9BB 1FH5H 5INDA 1MVUA 5DC0A 1L6XA 1LMKA 2QKIB 3DGGA 2AK4D 2J8UB 1IZKA 2VZ3A 4A6YL 2OK0L 1CFVL 1I8IA 4APQB 1WZKA 5L0QC 3OG6B 3MXVL 4JY5H 1HH9A 1RUQL 4IMLA 1YMMD 3WS3A 2EYTB 1AGBA 5C0JA 2P47B 3EOBA 5C0AE 4LSQH 5HVWA 2BCKA 3IFOA 4QXWA 4KZDL 1A9EB 2OQJB 1WAAA 4JG0L 2NZ9D 3LKQA 3GSNH 4IRSB 4X9FA 5GISH 4ELMA 4I18A 3SDXB 2XA8L 2Q6WA 3E6HB 2XRAL 4FQ2H 1Q38A 4L9LC 4FXGA 4O2EA 3VFNB 3MRBA 3FAWA 2GSIB 2WLYA 2GEEA 5D1XC 3P4OB 4G8GB 5FB8B 2X4NA 4MQTB 4F80A 1BD2E 5D2NB 1NLBL 3ZE2E 3GSVB 2W0FB 4RIRB 2XWJB 4LSSH 3ZKXC 3D39B 1CGYA 1MFNA 1RHHA 2VLRA 1BLNB 4Y89A 5IHLB 2DD8H 3MRHB 4XWOD 3ZKNC 1R3LA 1MPAH 1QBBA 4JAMA 3JTSB 5HHVH 4MVBD 5A2LH 5B39G 5CMAA 2ZOLB 2NY3D 5IMOA 3WFBL 1RZFL 3LEYL 1ZLUK 4S1SH 2B1HH 3A6BL 3QUYC 3RUGB 4LEXL 4WENB 4KDTA 2A6KB 3GI8L 3H8NA 1WIPA 1Z3GH 4PUBH 4FZ8L 1DQDL 3KPRD 2CRZA 1EVTC 4LHUD 4PJDE 1AXTL 3CLFL 4PJ9C 5DF0A 3VFSB 3K4DA 2X4RA 3THML 1CZ8L 3S97C 3HR5B 5ACZB 1YEKL 3BZEA 2YUWA 3I6LE 2ADFL 5I17B 2JJTC 4OZFA 5AG8A 3TFKC 1HEZB 3FOMA 5TQ0L 3QIWB 3SO5A 3FZUD 4XH2A 3BKJH 5KAQG 3VXOA 4Q6IA 4GRLC 1XF2A 1EHNA 5EU6A 2B4CH 4HK0A 1NMBH 4OZHE 4YDIL 2V17H 3Q6FB 25C8H 4V2CB 2HLFC 3BW9B 4HJJL 4CW1B 1GOHA 3TA3A 4E41E 5I8KL 2Y5EA 3OZ9L 4PS4L 2ZSWB 1Q0XH 1I1YB 3QUML 5FKPB 1CG9A 5DJ8A 3DYPA 5LQBH 5T5FH 1NGXB 1S9YA 1XF5B 4Z7OF 1EHLH 2ZCKL 2GJ6D 4LVOB 3V6OE 5JTWA 4HPOH 4XCEA 5C0ND 3FFDB 2AERT 3S98A 4R97C 1QP1A 2MQ0A 3QFDA 4L8SB 5EPMA 4WFEE 3CVIH 3FB7B 4NGHH 2SEBB 2NY2D 5CJBA 2DKUA 3QJHA 4HSQA 4WI3A 4NKMB 1K4CB 1BIIA 4GAJL 1NCUA 4UB0H 1OAUH 3CDCA 1N5YL 3OPZH 1I1AA 3O0RH 4AM0B 4QRRA 1T20A 3UO1L 3WUWG 4X7SH 5D7KE 4JZNB 3LKOB 3G08A 3NFSH 3VXRA 1RZKL 3L6FB 4GRWB 5IOPA 5BVPL 3EDEA 1I7ZB 4FXKB 4ZUTB 3IXTB 1M6OB 2HJFA 1YYML 2Q8AL 3K8LA 4G7VL 4OZGA 3NCJL 3L95A 4O02H 4LVEA 2X42A 3TBYB 4YDKL 4XMPH 4BELD 1R5IA 1CL7H 3NCEB 4JJHA 3CU7A 3HC0B 5GRJH 3P0GB 4DKEH 2A74A 2KL6A 3HZVA 4OBSA 2YA0A 3DXAB 2YR3A 1DDHB 1ZGLA 4XP5H 5B8CC 2APWA 2DJSA 4JGUA 2FWOB 3FAXA 4JRYA 2CH8A 2O5YL 2FHCA 4V2BA 4ALAH 4LSTH 3SPVB 4P5TB 1A7RH 1RZ7L 5HDBF 4Y16B 3OAUH 4FFZH 2JCCB 5HYJB 3O4OB 4NQXA 1AGDB 4H8WL 3HS0A 3MRLA 2X4QA 3JXAA 4KK8C 1EXUA 4P23A 5F7DA 4PV9A 4PJHA 1F6FB 1WIOA 3RI5F 3FTGA 4OFYD 3N1FC 4Y4HC 4AY0A 5CSZA 4JFED 1HNGA 3RZCD 2NX5D 5FYLH 2E7HA 3QCVH 1QG3A 1Z9OA 3U4EA 2BVPA 1W8NA 2DLHA 4P59L 1TQBC 1ORQB 2EO9A 2P24A 1QRNB 3F62A 2Q7NA 2I24N 3QEGL 4QTIL 4QT5A 2A77L 2BNQA 1ZHNB 5E4EB 1A7PL 1C5BL 2W0LA 4AYFA 1MI5B 1KGCE 1MEXH 4KXZI 5C0IB 1BM3H 1OCWL 3OG4B 1CDBA 3QEUA 5FA4A 4OFPA 4FXLA 5FV1L 1U2CA 4J4PC 5CBEA 4P2RA 1N0XH 3F12A 2J8UF 5DRZB 2DLEA 5GSVB 2C9AA 5F88A 2CKBL 3MV9D 2ZJSL 3VW3L 4EKXA 4L8SC 4Z7WE 3P73B 5EIIA 1U8QA 3B9AA 5C0RH 3WFCH 1F4WH 4QKXB 5ICXA 1FE8L 3OTTA 3QPXL 4OKDA 3IKCA 4N8VB 2DDQH 1SBSH 1OT2A 2XN9D 1IM3A 3LH2H 5EZIH 2I9LB 2Z93B 1IKFL 1QPPA 4ZUVA 1SYVA 1TJGH 4HUUA 2XXMB 4LFHD 5SX4H 2Y4SA 3RNQB 3V4UH 5D7IA 4F15C 4PTTB 1UG9A 1P1ZA 2DYPA 1EDQA 2MMXA 4PJEB 5FKAA 5IUSA 2BVTA 1G9EA 1CIDA 1IGIL 4MMZC 1EJOH 1YNLL 2EDHA 3SDCA 5E2UH 1DANU 4EDXA 3MRJA 2VUOA 1MRDL 1EV2E 3X12A 1CD1A 1NFDB 4Y7MA 1Y0LA 3LMJL 3I3BA 4NQCB 1ZA6B 1AO7B 3E3QC 2FL5B 3G6DL 4XVUD 2P46B 5GZOC 1F97A 4BFIB 4NZTH 4OF7A 4POYA 4LAQH 5DVKA 4QEGA 4MYWB 1OW0C 4QXUH 4PJIA 3VRJA 1W0WA 4Z77A 2VDNL 5D6CA 4UU9B 5JORB 4MZ2A 4JGMA 2HT3D 5KS9E 5IR1A 3H0TB 2BY2A 3RWEB 4A6YA 3QA3A 3SKMA 3SDYL 1ADQA 4TULL 2WQRA 2CKNA 2PO6A 5E1AA 3TYGH 1YYLL 2AI0H 2JK5A 4OCRH 5GHWH 1UM4H 1LO4H 3SDDA 3HUJE 1JGDA 1A0QL 3C6LD 5JOPD 1YN6A 4KJWD 3HI1B 3QEQD 4QTHA 1URLA 4R96A 4WNQA 4NJAL 5EN2B 4NFDA 4P57A 1FVEA 1AGFB 2MTPA 3W0WA 2A1WH 4W4NA 5ALBH 4MXWH 2Y06L 3ZO0A 4HV8A 2HRLA 5DEFB 5EU4A 3TZVA 5K59F 5MI0B 2VDKH 3VXPB 2Z8SA 2AXHA 5CIPB 4RAUA 5BRZA 1RJZA 4DTGL 3LZFL 1MVUB 1U91A 4MDJA 2LVEA 2JE8A 3TJHC 3CK0H 4UT7H 3DGGB 1IC7L 2QR0A 3JWOH 3T3ME 2Q7YA 3BRFA 1I8IB 1NGYA 3WNOA 4X9HA 1MF2H 1A4JA 1EO5A 1AIFA 4Y5VB 1JK8A 5IW6A 1DEEA 5I8OH 2DQUH 3WS3B 1AGBB 1TETH 2ARWA 2XV6B 3BPOB 3EOBB 4OQTH 5E5MB 1FNAA 4F58L 4HG4K 2JELH 1OF2A 5FGBC 4P3CL 2HG5A 1OSZB 1I8KA 5ALCL 4NP4H 3LKQB 1SEQL 2UZIL 4I18B 1EH9A 2D7TL 5GJSH 1YY9D 4TOYH 3HNSL 2EDFA 2Q6WB 1Q0YL 4WWKA 4WUUB 2GY5A 4HIHB 4HWEH 4FXGB 4O2EB 5ACLA 4P2OC 4MQXC 3TH3T 2EIEA 4LSVL 5CWSA 4S2SA 5F97E 2ATPA 1BOGB 1HXMA 2PXYC 3U9PL 4YE4H 1H8SA 1PGRB 4DFHA 2XWTA 4LRIA 4QCIA 1FORH 5C09A 3KPSD 4X0KB 1RHHB 3CUPA 2IG2L 1KFAL 3DI2B 2HH0L 3IVKA 4LPVA 4K8RH 2D7NA 5D1QC 5JO5A 1R3LB 4XPBL 4JAMB 1C5CH 5LWYH 1MJ7L 1UB6A 4GH7B 1MOEA 2R1XA 3BKYH 4PRDA 3SCMA 2AAVA 2RHEA 3EYVA 1IT9H 5CMAB 4LQFL 4PP2A 5IMOB 3RJQB 3ILPB 5DVNA 4UINL 1JJUA 1A7QH 3IFPA 3VWKD 3MLYH 5EBWA 4KHTL 1IJ9A 3KNBA 3OX8A 2NY0B 4HKZA 1DLHA 1M71A 2JCCF 4NJ9H 2HYMA 2X4RB 1XIWB 3QCTL 3REVB 5ILTH 1KTDA 2I9TA 4RGND 3T65A 3TVMC 3MLUH 4P2QB 2N7AA 3L5JA 4OCXL 4M7ZB 4Z7VA 1TNNA 2B4CC 4OZFB 4PJXA 5DYOB 1F11A 4Q6IB 2BSSA 2Q86A 1HNFA 2YPLD 5DVMA 1NEZB 3WHE1 3Q6GL 4MMXC 1CD9B 2BSRA 4TVPL 3VJ6A 4A6YH 2OK0H 1CFVH 1I9IL 3MJ8A 4R3SA 3OR7A 1DEDA 2VH5L 3TF7C 3MXVH 1G7PB 1RUQH 5F9WB 5EC1A 1NC4B 3UBXI 3RVVD 1CG9B 5DJ8B 3X17A 2ZOKA 3K1DA 5J9PB 4U1HB 4XXCA 1E28B 4KZDH 1S9YB 2Y7QA 1J88A 4JG0H 3STBA 5D7JD 3MRKB 5LAXA 1DVFA 3IU4L 2XA8H 1GGIL 3G5XB 4RMRA 1FV1A 2XRAH 5EPMB 2VL5B 4CAGA 2VTFA 3RL1B 5IGXL 3QZWG 3PF2A 4JFQA 2GI7A 4FTVA 3QJHB 4CADA 5KANI 2IAMD 3O11B 3CFBA 4HWZB 3LQMA 5EC2B 4WI6A 1I9RH 3OWEA 2HWZL 5BJTA 5ESQB 3GMOA 1P5VA 3CXDL 1AI1L 3NZHL 3V0VA 1D5IL 4S0SD 3VXRB 4IDLA 3DX8A 4X83A 5ACMA 5IOPB 5BZDB 1U3JA 2DAVA 4R4BB 5DEGB 4I18C 1OAZL 2J4WL 3BXNB 1FZOA 3V8CA 2HJFB 3BPLB 4OZGB 5EUKA 3L95B 3OJ2C 3R0MA 3WFBH 1RZFH 3UPRB 3LEYH 5FDWA 5D2LF 3A6BH 5T1LB 5C6PB 1R5IB 4LEXH 4MNHA 1QFWI 5JA8B 3GI8H 5JHDA 3S3JA 4FZ8H 1DQDH 4PJEF 4N5UA 2HLAA 4PV8B 5F70A 1AXTH 2EIBA 2A74B 3CLFH 3HZVB 3THMH 1CZ8H 4KI5D 1WF5A 1T83A 3SGEI 1YEKH 3MRNA 2ADFH 5DHVB 1Z0MA 4JRYB 1NFDF 3V6FA 5TQ0H 3BMVA 1D5XA 5GXBB 3P4MB 4QOKD 2VDQL 4OFKA 3MACL 3VXSA 4YDIH 3MRLB 2KQNA 4JY4B 2X4QB 3JTTA 2Z35A 1E4XI 4HJJH 4KDTC 1V3JA 5HI3D 4RMWA 3CFKA 2WNGA 5I8KH 2NY0C 5IVZB 3FTGB 2OM5A 4PS4H 2FJHB 1LP9B 4BSJA 3PQYB 3QUMH 5CSZB 3WBDA 3ZTNH 2CKBA 1QSED 5LXGL 2ZCKH 2BVPB 5HTSA 3UCRA 1EUUA 2ADJA 4LCYA 1T7YA 4Q6IC 3B9KA 3N1PC 2P24B 3QIBB 1EFXD 35C8L 3MGTA 4LLWA 1I3UA 1TJHL 5DSCB 2BNQB 4A2LA 3WLBA 3K74B 3JBG7 4GAJH 3RDTD 3TA3C 1F4XL 4JM2A 1N5YH 3FQUB 3VRIA 1MCSA 5F9WC 1GGBL 5FA4B 3VGBA 1EZVX 2F5BL 4NSKB 3UO1H 4LLMA 4P2CG 1QOKA 3VH8A 5CBEB 3BKML 1RZKH 3EBAA 5BVPH 3F12B 1F2XK 1PSKL 2BP3A 5F88B 4BZ2L 1KLGA 4B7LA 1OB1A 4IRJB 1YYMH 5FM8A 2Q8AH 4KHXL 1U93A 4G7VH 4JKPL 5EIIB 3NCJH 1U8QB 1CICA 1KPUB 4BFBD 5HDOA 4WFGE 3S37X 1FP5A 4YDKH 3E1F1 1P84K 2EDBA 5I1IL 1WAAF 4HC1L 1I1AC 1VFAA 2CUHA 4ELMF 3TIEA 3GSRA 4NO2B 3HMXL 3UX9B 4DGVL 3W9DA 4ZG1A 4ZUVB 2A9NL 1SYVB 4GAGL 4HUUB 2O5YH 3FQRB 2GHWB 1P1ZB 2VZTA 3B9DA 3U0WH 2VUYA 3PHSA 1RZ7H 2OMBA 4H8WH 3K0WA 4WI8A 1C7SA 3SDCB 4LHQB 4Z0BL 4Q7DA 4EDXB 4G43B 3GM0A 4UV7L 3Q3GB 3X12B 1K8DA 3IDNA 1Y0LB 3RKDC 4ORZC 1BOYA 4FG6C 3UTPE 5C07A 1R3HA 4ZPVB 3TIDA 1CXEA 4G8EA 5FCSH 1CN4A 5TE4L 1FNHA 3PDGA 1FG2B 3MRQB 1BQHA 4G5ZL 3O6FD 4M4RA 4XTRC 5GJTL 4P59H 2IWGA 4PRAA 5D6CB 5AAWA 2WINA 4QGTA 1DQQB 2D0HA 3QEGH 2LAAA 2A77H 4CBPA 1A7PH 1C5BH 4P23C 3ARZA 3IGAB 3KXFD 2PO6B 3TCXA 1HHGB 2JTDA 2JK5B 3DMMD 4PP1C 1OCWH 1BZ7A 3SDDB 2EH8L 2DLFL 1AH1A 4B50A 3L5XL 1GIGL 2IF7A 4QTHB 5JHLL 3QDJD 4R96B 1IVLA 4WNQB 4P57B 1FVEB 4Z95L 3LPWA 3W0WB 4XC3L 5INCA 5DD1L 3NVQA 4EJ1C 1X3DA 4FFVD 4HV8B 3TZVB 5GZNC 2CKBH 3CSGA 2ZJSH 4XCNB 2AS5M 4NRYA 3VW3H 3T0DA 4RMQA 2W1NA 3NTCL 3BP6A 4N5ED 1YJDL 3PWNA 3JWOC 1B0GA 2EEBA 2VQ1A 1IFHL 3F7YB 5DQ9A 3R1GL 1UT9A 1U91B 4MDJB 3HI5L 5JZ7C 5CS7A 4PJFE 1KB5A 1FE8H 1JMZA 2QR0B 3QPXH 1C08A 1NGYB 3CX5K 5H35B 1NBVL 4P4KA 4JDVA 1AIFB 3BUYA 5HY9A 1JK8B 1IKFH 2VZ1A 2XQYK 5I1CL 1X44A 1HHKB 3AS3A 3V7MA 2V5YA 4I48A 1OF2B 1KCUL 3N1MC 5DA4A 5C0CE 3D3VD 4OB5L 1FIEA 1I8KB 3IDIB 4UT9L 1IGIH 4ODWA 4U1MA 1FHGA 3VDAA 4YQXL 2VE6B 3W2DL 1YNLH 1LDSA 3QCUL 3V79C 4JO4L 4RZCA 1MHEA 2ZUWA 4WWKB 3T0XA 3GB7A 4UAOB 1MRDH 5I66B 4WFHD 4G6ML 4YH6A 3PWPE 3RHWK 4DOHB 4I1NB 3LMJH 3NN8A 2EDKA 3ZKMC 1EPFA 4YBLC 5CWSB 2VDPL 3G6DH 2FECI 4FN0A 1FDLL 2I07A 3V7AE 4MAUL 4KTEL 2XWTB 5E00A 4K8RC 4OZGF 4WFFD 4YHML 3GDBA 2APTA 3CUPB 2VDNH 5J4MA 4JR9L 3IVKB 5BS0E 4ODSL 4AL8L 3SE9L 2GYSA 5GPRA 2IANB 3SDCC 4JY6B 3VU2A 3RZWA 1UB6B 1GCFA 2R1XB 3IYLW 3SCMB 2NZIA 3EYVB 1K2DB 3SDYH 1H5BC 4TULH 3WXVL 5MENA 2AK4E 5FFLA 1YYLH 1PKQA 1TTUA 4G6JL 4L4JA 4JCLA 1T7ZA 5IG7A 3IFPB 1A0QH 4PLOB 4Y4FD 3WIIL 3KNBB 1YMME 2D7QA 3OX8B 4HKZB 1DLHB 4NJAH 2XZAL 1MFDL 2A6DA 2Y06H 1ETZA 2OZ4L 4PJHF 1A2YA 3ULUD 2FSEA 4DW2L 3LKPB 1FYTA 4DTGH 3LZFH 2Q86B 4NQDA 5GS2H 3VGGA 3TBVA 3GSOB 5DZNA 2PO6C 4PRPD 3SGDI 5E9DD 3ARQA 2BSRB 3C09B 1IC7H 3MJ8B 4R3SB 3SDDC 5I18L 5KVDL 2NYYC 5D8JL 5GGUA 3BP5A 3O4LE 2CRIA 3ALWA 2NY4B 4F58H 3FFCA 5EUOB 4P3CH 2DL2A 2C1PA 2YA2A 1I7RA 1X5JA 2Y7QB 4HEME 3MOAL 5EBMA 2BXZA 4OUUB 5CLTA 5ALCH 2GK0A 4YHLL 1SEQH 3QPQD 2UZIH 1OP5H 5JR1L 1NGWA 2Z8VC 3LQZA 4R4ND 2FATL 1UENA 15C8L 1ZE3C 3HNSH 1Q0YH 1FV1B 4LCWA 3ZSTA 1T0NA 2FHBA 4FTVB 2FX9L 4LSVH 3WDJA 3SDAD 4KVNL 3KPRE 5L2JA 3QDMB 1A1NA 4XZUA 1YEFL 5BJTB 3QDAA 4X6CA 3GMOB 3CFEA 1T22A 5CZKA 3LCYA 2NQCA 2IG2H 1KFAH 2HH0H 3DX8B 3D25A 2AJSL 4XPBH 3BN9C 1MJ7H 4WWKC 3KPMA 2YMXL 3WS6C 4LQFH 2J1KA 3FL7A 5EUKB 1KIPB 4XHJC 5I6XB 4YDVA 4UINH 5D7IF 4GLRH 1N26A 5JHDB 4YC2B 3ARFA 2V5RA 4KHTH 2AJXL 3DVGA 4RQQA 4KQ3L 3V6BR 2HLAB 4L1DA 4JFFB 4LRIC 4NDMA 3VWJA 1QR1B 3QCTH 3QFJA 4H0HB 2F54A 2YBRA 3MRNB 4OCXH 5HD8C 4Z7NE 4P9ML 3V6FB 3TBSA 2LV4A 1D5XB 2C5DC 3L7EA 3HPJB 3QRFM 3Q6GH 5F1NB 4TVPH 5HHMB 1S7SB 5JLZA 4FHBD 1I9IH 4APQD 5IHBA 1R3KA 2Z35B 1FL3A 2I5YL 2VH5H 5AZEL 4PJIF 2NTFA 3TN0D 2R69L 1AC6A 2HA1A 3U7AA 1O0VA 1D9KA 4OTXL 2YD3A 1RVFL 5ENWA 3TYFA 3QUKA 3ROLA 4J8RB 4BZ1L 2DIBA 4G8IB 3DLQR 4IRSD 3ARGB 5E6YA 3OJMB 5IMKA 1K85A 5F3BA 3MLZL 4KV5F 5D1ZC 4BKLA 4XC1L 3O2DA 2K9UA 3IU4H 1GGIH 3EYUH 4M6ML 1BVLA 3MLXL 1MFAL 2X1PA 5IGXH 3C09C 3WLBB 5GS2D 1VEPA 4G8GD 3P4NB 1FLTX 4DN4L 4KROB 4CMMB 1Z5LA 4JM2B 2WBWB 3VRIB 1RZKC 5KSBA 2H9GB 2HWZH 4X4XB 1ZVSA 5EBGA 3D39D 4LLMB 3CXDH 2GJJA 3T77A 2V2XA 4XXCC 5DJYA 3VH8B 2CDGB 1KTKE 1OAZH 2J4WH 1DVFC 2OLDA 5HGGS 5ITBH 4XPFL 5DUBA 1OB1B 4RMSA 3M17A 1CICB 1BWWA 4O2CA 3WLWC 4LLAA 4WW2C 5DFTA 2HP4A 4YO0A 1CGXA 2DLGA 3MYZA 1KPVA 5JPMA 4NT6B 4RISL 1VFAB 1UJ3A 1YNTB 5CCKL 4JFEE 4D8PA 3GSRB 4JN1L 2NX5E 3RTQB 1AHWB 1WWCA 5T3ZD 4KH2A 5DC9B 4DJMA 2QL1A 2GITA 5SWSA 3HRZA 3QIWD 2QQKL 3C60A 5T5NF 2VYRE 2VDQH 3HE6A 3MACH 1KSRA 1DQJA 1T3FA 5GGSB 1WBYB 5MP6L 3X3FL 3TBTB 4DZ8A 1G9ML 5IB3B 4NN6B 1A21A 3SKJL 3QT2A 3ELAT 2W38A 3INUL 2NNAA 5FYKL 1WJ3A 1R3HB 3TIDB 4NPYB 3HC4L 4X99A 4JKWA 3SBWA 5LXGH 2YSSB 2W9EL 2UVFA 4U49A 4IEFB 1B4JL 2F53B 3G04B 4RA3A 3MV9E 4PD4J 3L3OA 4NQEB 2WINB 2M8XA 3MC0A 1TJHH 2XZQL 4PJBA 3D0VA 3O9WB 1KOAA 2P5WB 3IS0X 3QHFL 1F4XH 1RZIB 2NY5C 2DQTL 4Z7VF 4HT1L 1GGBH 3NPSB 4PJXF 2F5BH 4RSVA 5JPNA 1I9JL 3MUY1 1IGML 4IOFC 4NNXB 5IW1A 4NC0B 4CJ0A 3BKMH 3UMTA 1U3HC 1UWXH 4JFYA 1ACZA 1YUHA 4OBRA 4ZXBA 5INCB 1ZOXA 2K7PA 1PSKH 5F7UA 4LLVA 1FBIL 4BZ2H 3F8UB 1F6LL 4C83A 4HDIA 4NRYB 3B9KC 4KHXH 2MOVA 4JKPH 2XWBA 3BP6B 1E6JL 2XQBL 3HI6L 3PWNB 1B0GB 2VQ1B 3BPNB 5KG9B 2BDNL 4NC1C 1KB5B 2FEEL 1DUYA 5I1IH 4JM2C 3ZL4L 4HC1H 1C08B 1A14L 2XTJB 3NIFE 4P4KB 4JDVB 2K7QA 2ED9A 3HMXH 1PX3A 5HY9B 3KYAA 4Z7UE 3BRDA 4DGVH 1XCTB 2EZ0C 1JWUB 2A9NH 3NZ8A 4GAGH 4GKNA 4P5TD 4WW2F 4Y16D 1G7LB 5HYJD 1BFVL 3GJEB 4ODWB 4U1MB 3ULVL 1QD0A 5ESVA 4OZIA 4RZCB 1MHEB 4Z0BH 4UV7H 1MELA 3MR9B 4JPWL 3RP1A 3MV01 1L4IA 2ZG3A 3BYTA 4O2FA 4PRIA 2VQTA 5JOPE 2Z4QA 4J6RL 3QEQE 4HF5L 2FLRT 2MHAA 4K94C 5E00B 5TE4H 2D9CA 2P7TB 1XGTB 4LVNC 1KUMA 1HN1A 4G5ZH 4MJ6B 2DQDL 5FYLE 5GJTH 3T4YB 3DRQA 4QRUB 1RAMA 4PGCA 4CL7A 3OXSA 1JGLL 1LGVA 5EA0L 5HHXL 1BBJB 1NC2D 1MI5D 4D9LL 2HVKB 1GJIA 4ISVA 1S78D 3BHBB 2EH8H 2DLFH 5IG7B 5J12B 3LHPL 3L5XH 1GIGH 4AT6B 5GRUL 5EFIB 5JHLH 4NFBA 2UWEE 3LSOA 4Z95H 5J1AB 3DHJA 1HSAA 4XC3H 5DD1H 4J23A 1IAMA 2A6DB 3M1BA 1KEML 1J8HA 3PV6A 3UTSB 4LEOB 1A2YB 2EC8A 4J3XA 2XACC 3NTCH 4FMFA 1YJDH 2CLRA 4GQPH 4MAYA 4LPUA 1IFHH 2W59A 4NQDB 1SJVA 3HI5H 3TBVB 1JP5A 1WT5A 3FCTA 1OD7A 5I1HL 4X6BA 1AC0A 5C0EA 4L29A 2PCPA 1NBVH 4XVSL 3K81A 5C8JB 5GGUB 3BP5B 3O8XD 4Y2OA 3VE0A 5FAAA 5DJ6B 4H25B 3VFRA 3CXHJ 4ZFOL 5I1CH 2CXGA 4Z78B 3KPSE 3MNWB 1J87A 3FFCB 1KCUH 5D7LA 3FONA 1I7RB 4OB5H 1IGTA 4LPTA 4UT9H 1MCLA 4YQXH 3X11B 5MEOA 3LQZB 3W2DH 4N8CL 4JM2F 3QCUH 4FQJL 4JO4H 2P8MB 4HMCA 5LGKA 4LCWB 1OGTA 4G6MH 4U6YA 4Y2DA 4UUJA 4NQCD 2ZCLL 43CAA 1IGJA 2E27L 1AO7D 2X05A 2E7CA 2VDPH 3L3GB 1N3NA 4P4KC 2V2TA 1FDLH 5L2JB 4I0KA 4XBGA 3IRPX 5CJ8A 2QSQA 4MAUH 3D6GA 1A1NB 4XZUB 3FN3A 3QDGA 4KTEH 2DJ4A 4I8DA 4EOWL 4KGLA 3KYOB 4YHMH 3EOAA 1RSFA 3CFEB 1WFUA 4RGNE 1M7DA 3DBXA 3AUVA 3SE4C 4JR9H 3EYQC 1J0IA 5T1MA 1FAKT 4QRPA 2MCPL 1UZ8B 3DVNA 4ODSH 1OLLA 3S5LG 4AL8H 3SE9H 4OT1L 3KPMB 2KH2B 4CVXA 3WXVH 4L8BA 4F3FA 5JW5B 3S3PA 4MHHI 2WUBL 4G6JH 4NO5A 4M8VA 3ARFB 3WEXA 3WIIH 3DVGB 4RQQB 3G6JB 1JPSL 1J12A 4YHZL 2XZAH 1MFDH 3VWJB 4M1CD 1H3XA 2F15A 3QFJB 1B6UA 3B3IB 1QO3B 3QJFA 3QO0B 4ZYKB 2OZ4H 3D85A 5T5NG 1T4KA 3C6SA 1T80A 4QY8B 4DW2H 1BJ1H 1CD8A 4EQ2A 1JUFA 5BCAA 5F89A 2VSCA 2XPGB 2V7HA 1NAKL 4OI8A 4FOMA 4MXVF 5JLZB 1UXWA 1R3KB 1H3GA 4XAKD 1OL0A 1FL3B 5I18H 2YWYA 4Y1AA 4WW1B 5KVDH 1N4XL 3G5VB 5D8JH 1RUML 5DMKA 5IBLD 4F8QA 3V5HA 1D9KB 4U2YA 5ENWB 4JPIA 3TYFB 3QUKB 3ROLB 5D96B 5IK3A 3FQXA 3MOAH 4BSVA 2P5EB 3MSPA 5FGCE 4YHLH 5F3BB 5JR1H 1CDIA 1X4YA 4RX4A 4BKLB 2FATH 15C8H 4DK3A 4WUUD 4PJ8B 1BVLB 4N90D 5E8DL 4JDTL 2FX9H 4LBEA 3N1QC 2DQEL 2R9HD 5IF0A 4KVNH 4KKCC 1VENA 4JRXB 5DHVH 4M93B 1MRCL 3FRPA 3I75B 5KSBB 1YEFH 1ZVSB 4KI5E 1JZ2A 3WJJA 1K3ZA 3T77B 2LQRA 1LE9A 5DJYB 4DGYL 3JV6B 5DZOA 4JZOA 4I5BA 2AJSH 4U2ZA 3TBWA 5IMLB 3ZZ1A 5DUBB 4QOKE 4I9WD 1MHHA 2E8ZA 2YMXH 5DA0B 3RQ3A 3M17B 5L2KB 4GG6A 4O2CB 3ARDD 5BO1L 1AGCB 1MJUL 4NBYB 1LEGA 3P0VL 1VADA 4WVRA 1JWMA 1KPVB 2NY0D 2AJXH 4KQ3H 3MJ7B 3QNXB 1L7TL 1YN7A 1UJ3B 1XIWD 4RMTA 3NIDE 3WCYA 1QSEE 3IJHA 4P2QD 4B7IA 4IHOA 5IKCA 5J89A 3CGTA 2HT2C 3B5GA 5SWSB 3HRZB 4P9MH 4XBEL 3C60B 2ESVD 3PP3K 3LEXA 5MERA 1LE5B 5F7FA 5EDXA 1CTOA 3EJYD 5CD5D 2VOTA 1T3FB 1KC5L 3R06B 4KUCF 3EDFA 3T0WA 3WJLA 2I5YH 5FO7A 4DZ8B 4PJGE 3GKWL 5AZEH 1G0YR 1FNEA 1H8NA 3ARFC 3BESR 4J3WA 2R69H 4UIMA 1NC4D 2NNAB 4X4YA 4OTXH 3VWJC 3TH4T 1RVFH 2CDFA 4H5SA 4ZSOA 4X99B 2CRYA 5LBSL 3P0YL 4BZ1H 1NUGA 4X5LA 1MCWM 3MLZH 5DMJB 3HA0A 4XC1H 3VXNB 2Y72A 2J88L 1V5JA 4X5WA 4M6MH 3MLXH 1MFAH 3QAZB 3A67L 5E2WL 4CU6A 1NMCC 3KYNA 1E4WL 2FR4A 1NBYA 1KCVL 4PJBB 4DN4H 3ZYZA 3JUYA 5CSBA 4X9IA 4XI5D 1D9KC 1DBJL 4HLZH 3AAZA 5BV7L 1Z2KA 5JPNB 3GFUA 2HFFB 4J1UA 3N1GC 4UQ3A 3EZJB 3WNNA 3CLEL 4IS6A 1F2QA 4IRZL 1J10A 2J12B 1A6VL 2F8OA 1NCBL 4NUJB 4OD2B 1YEGL 5DJXA 4R2GD 4HKBB 3GMRA 1G1CA 2VN7A 5T1LD 1T2JA 1IBGL 1CGTA 4ZS6D 1I1RA 1JTOA 5I76A 1OTUD 2ZG1A 2VR4A 6CGTA 4KK5D 1DUYB 4RISH 3KPQB 4D0CB 2VO5A 2DB8A 4F9PA 4WV1A 5CCKH 1XCQA 2F8VA 4JN1H 5HGBA 5DMYA 5IVXE 5C0BA 5SX5K 3IRZA 1IRAY 4XTRD 5HYSB 2QQKH 3MRMA 4RBPK 4MQ7A 3U30B 1DN0A 3FO0L 3WL9A 3D87B 5MP6H 3DX6A 3X3FH 2CK2A 3CH8A 3KXFE 4X6CF 2I27N 2VR5A 1G9MH 3Q48A 5AUMB 4E0RB 3C8KA 1II4E 1ZEAL 3MZGB 3SKJH 3QQ3A 2APVA 4AK1A 3INUH 3PQYD 5FYKH 4O2FB 4PRIB 2Z4QB 3OF6A 5GRYA 4AEFA 1ND0A 3HC4H 3QDJE 2DLIA 1KNOB 2EDDA 2MHAB 4WO4B 4G42A 2W9EH 5I71B 1KJ2L 2DWEA 3C60C 5C0AA 3QIBD 5JXED 3B4NA 3LS4L 3HE6C 4YBHA 1LDPL 3OXRA 2D7MA 1QRKA 3CZJA 1JRHI 2AEQL 4ONHA 1R3JA 4NKOA 2XZQH 1SJXA 2GUOB 2ID5A 1CLYL 4TNWF 1PY9A 2WWMC 4ISVB 2EXYC 3A6OA 1Q9LA 5L7XL 3QHFH 5IHZB 3VG0L 1FFPA 1GPOL 5IBUB 2DQTH 1MRFL 4HT1H 1MLBA 2R23A 3T09A 1I9JH 1NDMB 1IGMH 2X09A 1S9KC 2UZYB 3JUZA 3PXJA 4XCYA 3SBWC 3BQUA 1BD2A 1KACB 1DBKH 1YJDC 3D3VE 5AD0A 4IRJD 3M1BB 1FBIH 5GRXG 5E08L 1I7TA 3PV6B 4KRPB 3FQWA 1E6JH 2XQBH 3HI6H 3WXWL 1UC6A 2A38A 1ZGLM 3O3DA 4P46A 4WFHE 1BQHG 3FCTB 5H37H 2BDNH 4X6BB 4KQ4L 4LQ1A 2C4FU 3ZL4H 5C0EB 1ITCA 4JFZL 4NN7B 1A14H 1V3KA 1VERA 3ILQC 1AE6L 1S5IL 3HAEA 4U7MA 3FN9A 4WFFE 2YXFA 1S9WA 2E5EA 5E8OA 1P7QA 4ZXBC 2X4UA 1XGUA 1JNNL 4PJDA 3BIAX 4AENA 2AEPL 3FONB 4ZPTA 4MA8L 3HZKA 1FO0A 1BFVH 4RRPA 2CGRH 3KPTA 3HN3A 5MEOB 3ULVH 4WHYH 2IADA 1OAQL 3SDCD 5J8OA 1ZLWK 3D5OF 3FT4A 3WKNA 5A3ID 4GKZB 1HZHL 4BH7B 1OGTB 4JPWH 3C8HA 4U6YB 1C1EL 4D0DA 4NCC2 1T7XA 1MHCA 2UUDH 5J11B 4LGPB 1N3NB 1E4JA 2V2TB 4DK6A 4J6RH 4HF5H 4H26A 1FYHB 4XBGB 1JF6A 5IHUL 4I77L 4I2XE 1MFCL 4WI4A 5A1AA 2DQDH 4QHLA 3L5WA 4CNIA 3O81A 4M4PA 3DBXB 1ZANL 3ULUE 2VXQL 3DVNB 5F9JA 1YECL 2WIMA 2N56A 1JGLH 1CWVA 3V6OA 5EA0H 5K9JL 3CVHB 5HHXH 4PRPE 4CVXB 1MAML 3MREA 4L8BB 1TZHA 4D9LH 1U8JA 4I3SL 1IE5A 4X9GA 2W65A 4RBPH 4NO5B 2H2SC 1E6OL 4KPHL 1TCMA 5JW4R 3LHPH 1CXHA 5K9QG 5GRUH 3WEXB 1PYWA 2FYYA 3VA6A 1U8OB 1HQ4A 3RVUD 2AV7B 5FYKD 5ID1A 3TZVD 4NKQB 3U4AA 1KEMH 3QJFB 1A6UL 1UQSA 3D85B 4X6DA 4E5XB 3C6SB 5K9KB 4K71C 4LNRA 4ZUUA 2YUZA 1YDPB 4MA3B 2OXGA 1BIHA 1WC7B 5CHNA 4QXTB 5A40E 3DRTA 4M1DL 5I1HH 2V7HB 3ECBB 1XF4B 5DUML 3P9WB 5KSAC 2YC1B 5HPMA 4Y1AB 4XVSH 4H20L 4J3TA 5IVNA 4GT7A 1F02I 4JPIB 3B2UC 2KDGA 4OLZL 3FQXB 4PJBF 1QHPA 2ENSA 4J3VA 1YEJL 3L3IA 4EUPA 4N8CH 4GBXC 1F4AA 1BF2A 4FQJH 4MAYC 4MSWA 4S1RL 4MS8C 2R0ZL 4GUPB 3KJ4C 1HXYA 2ZCLH 3QXAA 4EI6B 2E27H 4LBEB 5J6HB 1BJMA 4NN7C 5GS0D 5L8LB 5IF0B 1JN6B 4EOWH 3DNKA 3AU1A 1T0PB 1KULA 3WO4B 2H41A 3H3PL 5J3HD 5FM4A 2MCPH 4EI5A 4JZOB 2IAND 2DLTA 4OT1H 5I1AA 3NBNA 1ZA3A 5DJ0A 3SCMD 5HI5C 1SEBB 4I0PA 1MHHB 4G6AD 1Q94A 1KTLB 1LEKB 4Y2DC 1T04A 3GJFB 2WUBH 3HTLX 1DBBL 5J11C 1LEGB 3D9AL 3KG5A 1FN4B 4YHNA 4YHZH 3IF1A 4DEPB 2BC4A 4U6TA 2PR4L 4OZIF 5IKCB 2NY7L 3KLSA 1X4XA 3MV8A 3OL2A 4OFVA 1AGEB 4PJ7A 1WTGT 3SDXE 2IH1A 4FQXB 1QHOA 3NFPA 3BGMA 1JV5B 2VZUA 4MNQB 5DLML 3CH1A 5DFWH 3FO1B 3BRGC 4UT6L 4QNPF 4AEHL 1CE6A 1NAKH 2NY1D 3QNYA 4Z7WA 5E56A 4NOBA 1BP3B