5JW4R

Structure of medi8852 fab fragment in complex with h5 ha
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
199
structure length
148
Chain Sequence
MTQSPSSLSASVGDRVTITCRTSQSLSSYTHWYQQKPGKAPKLLIYAASSRGSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSRTFGQGTKVEIKRTVAAPSVFICLLNNFYPREAKVESVTEQDSKDSTYSLSCEVTHQGVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Hemagglutinin
publication title Structure and Function Analysis of an Antibody Recognizing All Influenza A Subtypes.
pubmed doi rcsb
source organism Influenza a virus
total genus 29
structure length 148
sequence length 199
ec nomenclature
pdb deposition date 2016-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4R02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jw4R01
2NZ9D 1JWUB 1YMMD 5CSZA 5DHYB 1KSRA 1AJ7L 5BRZE 2K7PA 4JY5L 1UWGH 5GGTH 2V5SA 3VXSB 1I1AB 1JN6A 5DHXB 1S7SB 2GT9B 4EN3B 1WVZA 3T2NL 2QSTA 1IAIH 4J23A 3TA3A 3VGEA 2W0LA 5B8CB 4NYLA 2OP4H 3IFPB 1A6VL 4WHTA 1CICB 3GB7A 3ULUD 5CD5D 4PG2A 5LBSL 3LS5L 3VE0A 1SEBB 4QRUB 1LDPL 5CSGA 3V6ZB 2E27H 4CRPA 4ZUVA 2AXJA 3MBXH 2OXHA 3D9AL 1KN2H 1KTLB 1U58A 4NFDA 2VN7A 1A9EA 4HWBA 4JRYD 3T0EB 2V7HA 3G6JB 4X8JA 5D7LA 5DMIL 1OY3B 3MROA 4LLWA 1QYGH 1IQWH 1GOHA 3GMRA 3PNWB 4GKOA 2BVUA 4J3SA 1RY7B 4RAHA 4XNUH 2J4WH 3H9YA 4BZ2H 2YXMA 5AZ2H 3MV7D 3WDJA 4UDTA 3LRGA 4PRNA 4YPJA 4HUWB 25C8H 4PG9A 3VI4E 3GIZH 1S7XA 3L3IA 4UNVA 5KZCB 3CSYA 2NY1C 5DS8B 3FO2B 4KJQC 1FHGA 3L3OA 5EOQL 4Q6IC 5DQ9A 5JPMA 2ICWI 1CS6A 3HZKA 2CJUL 4LSTL 5DEFB 2C5DC 3C08L 4HXAL 5LGHH 4PJEF 3R0NA 4NN5C 1N0XH 2VKXA 2IANB 3CXDH 4CVXA 1GOGA 4CADB 5J0BA 3PHSA 4MX7A 5L88L 1GYAA 3I02B 4YXHL 3TH3T 3HRZA 4KK6C 1BD2B 1U93A 3RDTD 1B3JA 2Q86A 2P5EE 5F9WC 5AUMA 3GHEL 5HD8D 5JOFB 3DETD 5FHBH 2VZTA 5FCSH 3L7FA 5HDQL 1EZVX 4NRZA 3HS0A 2X44D 4PYHA 3OF6D 1LE5A 4L9LA 2R0LH 1JWSA 2WWKO 3MZTA 4O4YH 4XCNA 1HHGA 1T4KB 4YDKH 4NNXB 4L1HA 1DBMH 2HKHH 2LVCA 5DRZA 4M7ZB 2GSIB 1FL6A 4K3GA 5FA4B 3RVTD 1J0IA 4QXTB 1L7IH 5FDWB 1QR1B 1G6RH 4AIXA 1AGCB 4Z7VF 4JFYA 4P3DB 5C07A 1MFEH 5FUZL 3BKJL 3W39B 2I07B 2KDGA 3WKNA 3NTCH 1HXMA 4S2SA 3TO2A 5TH2A 4KJWD 4C59B 1WT5A 4HIJA 2DKMA 3F8UB 4FP8L 4DKEH 1RZFL 4S0SD 1G0XA 1FN4B 4HGKC 5EA0H 1HQ4A 2ZSVA 3I9GH 3SDCA 5AG8A 4MJIA 4K9EH 5C9KA 3BD4A 4G42B 4HIXH 1IGCL 2AJ3B 3TIDB 4NWUH 1IC5H 1CWVA 1I1FB 2VDML 3BUYA 4NO0B 4YXLH 2GSGA 3N1MC 3F12A 3LOWA 4M8QB 5DJDA 4K94C 3MRJB 1S7WB 3QO0B 4JPIA 4JZJB 4OCSH 1PYWA 5DRWA 1U8JB 3MNWA 1YY9D 4MXWH 1CL7H 5D2LF 3J7HA 2PO6B 3PV6A 4KVNL 3FB8A 2LU3A 1YMMA 2E8ZA 2V9QA 5D9SA 2IQAB 1MVFA 4QXWA 4LEOA 1F3DJ 2GJ6B 4NSKB 3WFDH 3TBSB 2HH0H 4HXBH 2IH1A 3P9LB 2QSQA 2V2TA 1A6AB 2Q6WB 3HE7D 1MJ7L 3T0AA 3PQYD 2AERT 1CN4A 5ADPH 5L8JB 1CF8H 4MLSA 4JM2C 5I1EH 3W0WE 2BX5A 3OV6A 4HS6A 4YBQC 1A1OA 5CBEA 3LKQB 2AXFA 2P8MA 3QUXA 2DQEL 5FYJD 2AK4E 5FYKL 5T1KB 1WTGT 3GSUA 4G8IA 1DQDH 1L7TH 2X7LB 3GSXB 3QDGB 4JRYA 5I74B 4EI5A 5IFAL 2DQIH 4RA0C 3S88H 5DYOB 1NCDH 2UZYB 3UTQB 1L0XA 4Z0XA 2XWBB 1JNHA 1CT8A 1QFHA 1NBVH 2D7TL 3STZB 1N59B 5JDSB 1I7ZA 1JGEA 3NZ8A 3GBNH 1BQHB 1FYTA 5B4MD 5C8JB 3TBWA 2BNUA 5E94A 3BE1H 3LZFL 5MEOB 3QWQB 3TC9A 1OOAA 1TNNA 3SKMA 2QV2A 3VFNA 4YFDB 2HN7A 5JTWA 4ZG1A 1TCRA 2X4SA 4Y5XB 1BOYA 3RWEA 3S35X 4MD5B 5EORL 3FO9B 4JFFB 3U9UB 4U1KB 1NBQA 4XMKL 1RD6A 1JIBA 5J11B 5BW7C 1PX4A 1QQDA 4KZDH 3REWA 4AT6A 3EOYG 2D2OA 5DDHA 3VXUE 4KFZC 1OTTC 1F4YH 4PRDB 3RDTA 3NIFF 4X6EB 2P5ED 5FYJU 3AXLA 1H8NA 2XZQH 4X6CF 5F9DC 4JHAL 1SY6H 4G9FD 4N8PA 4NHCL 1DJSA 4PJGA 5TF1H 2ZNWA 2D7QA 3OF6A 1UACH 2A6DB 2M1KA 2NY4D 4BSWB 5F3HA 1C1EH 4YFLI 3BP7B 3TBTB 4OLXL 3QIBD 2IMMA 4QOKE 5JHLH 3ARPA 3NGBC 1KB9K 4YHKL 3AAZA 3BP4A 4QHLA 3A6BH 4XMLL 1NAKL 1IQDA 5FO8A 2GY7B 4WGVB 4F8TA 4LVHC 3K1DA 5L2JA 1JCKA 1YEIH 1N5AB 1BQLL 5DUBA 3ROOA 3MBED 2XZAL 4JPVH 1V3JA 5C08A 3GBLA 1NKOA 2PW2B 3QAZC 1NBZB 2HVKA 4OF8A 4V1DB 4L3AA 5LVEA 3FAXA 1IC4L 4E42B 3HNSH 4DJMA 1M4KA 2VXTL 1NEZA 3P40A 3F65A 1GGBH 1FNSL 2JJSA 4KKCD 2A6IB 5EH1A 2Q7YA 2Y07L 1LNUB 3X17A 1G9NL 4H20L 1F58L 4WO4C 1EFQA 3WFHB 2XKUA 2OLDA 1PVHA 4YHPA 3RZCC 3E8UL 3VFSB 3CFCL 4X4MA 2O61B 4FZEL 1T80A 1XIWA 3MRQA 4FQLL 4J1UA 1KC5L 2Z92A 5BJTA 2WUCL 3I50H 1VPOH 3MLWL 1FSKC 5F1IB 3ARTA 4Y4HB 1HKLL 1MJ8L 3IVKA 4NRYB 5FIEA 1UKSA 1NLDH 4RFOL 1BQUA 1V7ML 1V3KA 1QHPA 3DUSA 1LEKA 3HE6D 4PGEA 3MJ7A 3SE9L 1U41A 2EDQA 3TJEL 3U1SH 1FDLH 2EIZB 2ENYA 4LIQE 1PKQB 4HWZB 1NGWB 5SV4A 3MR9B 1NSNH 1JTOA 4K3DL 4YDVA 2YUWA 5EBMA 3WJLA 1EFXD 4IMLB 1F5WA 1OPGL 4L8DB 5IVZA 1FFPB 5J56B 2NCMA 2O93L 1PJ9A 5E1AA 3QXTA 2X09A 3CH8A 3BFOA 3F62A 3GFUA 1RZIA 1U92A 3QG7L 4LCWB 3MJGX 2ATKB 1MQKH 5HPMB 4F8QA 3E6HB 2VWEE 3T77A 1UXSA 2HT4C 4JJHA 3DO3A 1B2WL 3EKCA 3GK8H 5TE6L 4HH9A 4ZO7A 1S5HA 3K2UH 4X7FC 1I3GH 5EU6E 3VG0H 5CUSH 2YK1H 1JGDB 2ZUYA 2XXMB 1T89C 4NDMB 2DICA 3TZVC 3BKYL 3BEVA 2X05A 2ZCHL 1BOGB 1ED3A 5I1LB 4BZ1H 2BERA 1F42A 1MCOH 4NJ9L 5SWSB 4HUUB 4YHOL 5D72L 3MO1A 4ZSOB 5FOBA 4JKPL 1TJIH 3FN0L 3RGVB 4YR6A 4P23A 5IEHA 1T6VN 4ERSH 1WFUA 4HH8A 4F58H 3PE9A 4ONFH 1BVLA 4JO1L 1RZKL 1KJVA 2ADIA 4XWGH 5T33L 5JPNB 4Y19E 1G7IA 3HB3D 4KUCD 5ALBH 1EJOL 5A2JH 5JIHA 3PDDA 4GG6E 4LPYA 4LSQL 5C0BE 1U0QA 2XN9E 3BX7C 3JV6A 5I75C 2MHAB 4G9FA 4OB5L 5A40E 2MCPL 1TDQA 1NC4D 4PB0L 5DJ2B 5IM7B 4X5WB 1OAYL 1J87A 3NH7H 1MREH 5DJZA 1CI5A 3OHXB 1I1YB 3QIBA 5KTEL 5HHPB 4BH8A 4G8FA 4HC1H 5ADOH 1DN2A 4QY8A 1YQVL 4K2UH 1ETZA 2IPUG 5DMGD 3V7AG 2EXWC 2X4TB 1UM5H 3ARED 3DO7B 4TSBH 3ZDXF 1UJ3C 3TVMC 1MCQA 3MGOA 2P43B 1NGYA 4NIKB 3ULSA 3RIFK 1KCUH 1T1YA 5K93A 1CVSC 4OZ4B 4ZUWB 3RWFA 1JNNL 3I6KB 5EBWB 3MLXL 4B7LA 2WWKT 3QEQB 4G6FB 5K9KA 5T3XH 3G6JF 5DK3A 2ZOKA 4L3EE 2R2BB 5LKNA 3JXAA 1J86A 4PP2B 2ZNXA 4M1CC 4MNGE 5KSUA 1BAFL 3PJSA 1BF2A 3MLVH 5C70A 3A6CL 4MNHA 1RUML 1NGPL 1KCSL 2OTUA 4HPYL 1RZJH 1CD0A 1QKZH 4JO3L 1LDSA 15C8H 3PWVB 4MJ4A 4P4RB 5GRUL 3CUPB 4TVPE 5GPRA 4FXKA 3GSRB 1FFRA 1YECL 4GAYA 1VADA 3NFNB 1O5DT 1FGVH 5JXEA 3HKFA 1MVUA 4LQFH 5E2UH 3PHQB 5DR5H 1Z9LA 3HE6A 4PRHE 5I17A 2AV7A 1NDGA 1XH3B 2ID5A 3EW3B 3NCMA 4PLOB 3PWLA 1S9KC 4CNIA 4O5LL 3SN6N 4XCFH 2V9RA 1A6WL 1BJ8A 4YWGL 3N0PB 3EOTL 1DQLH 2YUXA 2E7LA 3L3GB 4Y5VC 2NY5L 2KKQA 3JTSB 1EFXA 3V79C 3FQXB 3MV01 1BX2A 4J3XA 3HC3H 2VLKD 1T03L 5IF0A 1T21B 2WQRA 3VXRE 2VR9A 2W92A 1H5BA 2P8PB 3ZHKA 5DJXA 3VRLF 1HILA 3SDAC 1C5CL 2WM0A 3GJFK 2VXSH 1T22A 3SKNA 3BGFB 5KS9B 2DLFH 1P6AB 4U6YA 2VQ1A 5F89A 1J8HE 4CN4A 2AJUH 1UCTA 4G6KH 4UIKL 5J3HC 4U1HB 3V4UL 5E6YA 4DGIL 1KTDB 5J12C 3DV6A 3HUJA 1IKFL 1P7KA 1SEQL 3T1WA 3BZEB 4GG8B 1NKRA 3OWEA 4HHAB 1OF2B 3O4LB 1O7SA 2C3XA 2MMXA 3C5JB 3H7LA 4NCDA 4NP4H 3WFCL 1OAZH 3BAEH 4F9PC 4YHML 4G6AC 5H2BA 3KPLA 5JW4R 4UQ2B 3EOBA 1LO3L 3KLAB 2UY7A 4KI5E 4O02L 2YMXH 3GSQB 2AVGA 3O3DA 4NQED 3P0VH 1G7LB 4U1MA 2XA3A 3OAZH 4PJAA 3QWRD 2VL4A 2XN9D 4XVJH 2BOCB 4PGCB 4YHNB 3SDXA 2KH2B 3T2NH 4OZIF 4PJ7B 5INDA 1QACA 1FIEA 1XGPB 3EOAB 1PG7W 3I85A 3QT2A 2G9HB 3C6LC 4UBDC 2ICWA 5D93B 1UM4H 1Q1JH 3LS5H 5LBSH 2CK2A 3PXJA 3HAEB 1E4XL 1LO4H 5IVXE 3QXAA 1HH9A 1JGUH 1HEZB 4HQQH 4Y16D 5MP6L 1CGXA 2YWYA 2GITB 4X7DC 1B9ZA 5ERWB 3AREA 1WC7A 1UJTA 3ZE2E 1M7IA 1D7FA 3VMPA 5ECJE 2J8UE 5IT2L 3EFDH 3C8KA 5D96C 1MCBA 3VFGL 4GMSH 4L8SC 2EDNA 2QQNL 4OTXH 5C09B 2JCCB 5TQ2L 4DN4L 3EYUL 5C6TH 4HKZB 4D9LL 5GGVY 2AJZA 2VZ1A 3NCFB 3D0VB 2CDEB 1LHZA 3WL9A 4A6YL 5EDXA 4LAQL 5JO5B 3S3JA 4UT6H 1DSFH 1U3HD 1MCJA 4CJ1A 2YWZA 4QF1B 1PSKL 4JPKL 4Z7UE 3WNLA 4G3YH 5E8DH 3FZUC 4PRPB 4PP1D 1I1AC 1IL1B 4EN3C 3UDWA 2YN3A 3C60D 1R5VB 2IEPA 2EXYD 3R0MA 5B8CC 1QSFA 1ZT1A 2H2PD 4UT7L 3DUUB 1EGJA 1BQHG 1CICC 1CGWA 4Y5YA 3P77B 5L88H 4YXHH 4CVZA 2RAMA 1AKJD 3TNNA 3MUGB 5MEQB 2IFFL 4FFWC 3WS3A 2MTPA 2VZ3A 3RWHA 1MUJB 1JPGB 3S37H 5FUCC 4TNVF 1BGXH 4TTDD 3T0EC 1GZQA 4JG1L 2QSVA 3QDMA 4WFGE 4K3JL 4NQSA 5GSVA 1SYSA 5HHOB 1Q72H 2R1YB 5TE7H 3UTSD 5EU5B 2BFVL 1C5DA 4IHOB 1RK0B 2YSSB 4Y4FD 5FF6A 5ANMB 4ZFOL 2Y5EA 2J5LB 4Z18A 1L0QA 2CLRB 2VLKA 1S8DB 4R2GD 2VDNH 3WKMH 3D0LB 1T0MA 4GRWB 4IS6B 4DK6A 1RSFA 2F9BT 3ARGD 2WZPD 3O6KL 3CPLB 1RZ8B 3CFJA 5T1LB 3QHTC 1QHOA 5F9OL 3GSWA 3CX5K 3G04A 4NO2A 4XXDB 3MJ8B 1M05B 4IM8A 4FABL 2A9NL 1U91B 5EUKB 1QLRA 4HWEL 5IBTH 1FVCB 3QQ9D 4DN3L 1PQZB 2IAMD 5SWZB 3UTZA 5GJSL 4GAFB 2J8HA 5GRWA 3W2DL 4P46B 4Y2DD 5D7LE 5DZNA 1XZ0A 2HLAB 4FFVD 1KYOK 4OM0H 1AE6L 3EFFB 1A7PH 3O3EA 1YPZB 3EYSH 3WUZA 4KI5D 4LBEB 1QFUL 4NQEA 2GAZB 4M7ZC 1BFOB 4IOIB 2BNQB 1N4XL 3IDJB 3RKDC 3HAEH 4OUOA 2QKIB 2IJ0C 3OGCA 4GKNA 2VQTA 4DAGL 4Q9QL 2A9ML 2HVJB 3GSVA 4QRQB 4KPHL 1KOAA 2JJUA 4OD3H 3KPSD 4WUUE 3W82A 3QQ3B 3CAFA 1QRNB 3Q48A 2OYPA 5E7FA 5CAYB 2WNGA 3QO1B 1OGAB 4P5TD 5FOJA 1G7QA 1K3ZA 4OQTH 1GXEA 3FCTB 3QA3A 4X6DA 2WW8A 3L3HB 2DQEH 1UEMA 4RISH 3F7QA 2HTLD 5FYKH 4Y16A 1Y0LB 4GUPB 4H1LA 3HI6H 4LLYB 3FQNA 3LKSB 1MCHA 4YQXL 1XGYL 1S78C 3GUTA 4U1JA 2UWEA 1RHHB 3PL6C 4DKAA 3QEGL 2NX5D 1LP9A 4JKWA 1IGMH 1WICA 4GO6B 4CDHA 4APQB 3LAFA 3QDAA 5CEZD 1ZE3C 4QHMB 2D7TH 1UM6L 4BQBA 2Y4SA 3JTTA 1FFOB 1LK3L 2PCPB 2Z93A 4JZJC 2VTFA 3QHZL 1EBAA 1HYRC 4ALAL 1T83C 2WUBH 2PO6C 2Z4QB 4YZFF 3B8YA 2CK0L 1U3HA 2FIKB 2P24B 4LMQE 1CD8A 5FUOL 5DD0L 2XFXB 1E28B 4ZD3H 2WBJD 2Y6SD 1MCIA 4C4KO 4TRPH 1F4XL 1H3PL 4MVBD 4J8RA 4LSSL 3C60A 2HMID 4GLRH 4P4KA 5EORH 4LSUH 1ORSB 4KQ4H 3QIWD 4XMKH 1UZ8A 2FJGB 3ROLB 1JI2A 1SHMA 2OL3A 4PJIF 1OP5K 2BRRH 4I48B 4XHJD 1EVUA 3NABL 1AKJA 1A0QL 2Q3ZA 3QG6B 1EHLH 3GEWB 5L8KB 5EUOF 1I75A 3VXNB 4LEXH 4OGXH 1NFDE 1EO7A 4JHAH 2NXYD 3C6SB 4OQ1A 5IB5B 5I74C 4OI7A 1P2CA 5D2NC 5BCAA 4Z0BL 1UYWL 2VXUL 3QJFA 4GRWH 2DYPA 1DDHA 1R5WA 2YPLD 3UTSA 1XF3B 2SEBA 1I1CA 4OLXH 1PG7L 5IK3B 4YHKH 4FXGA 4P5KA 2DQFA 3GSNL 4Y4FA 3D48R 5JUEL 2ADGA 5D1QB 4XMLH 5HGBA 1EHAA 4ZDHB 4CMMA 1WZ1L 1B6DA 1RAMA 4F9LC 5D5ME 5IG7A 4ODHH 5C0CE 2XZAH 2Z8WC 3OZ9H 1FYHB 5HHNB 1H0DB 3LIZL 2VXQL 3IDNA 4Y5XC 4OGAD 5GS1B 1C8PA 2R56L 3ARQA 3CVHB 5ISZE 1RJYA 1I9IH 2AGJL 3LN5B 4S10A 5CGTA 5J11C 3GMMA 3PWPA 3N9GL 1E4JA 4ZNCD 2EDDA 4PLNC 5HI4C 1GZPB 1G84A 3BQUB 4OBSA 2VDOH 1PY9A 3C9NA 1R5IB 5E4EB 1G9NH 5GS0H 1AIFA 4JFDB 4Y2DA 3WMSA 3MV7B 4KUZH 1MFDL 4Q0XL 1CGUA 3SOBL 4O2EA 4ZXBB 2VERN 4NQXB 1QRKA 3CLEH 4FQLH 1DQQB 2X41A 4XHQA 1U42A 4QYOB 4ZOBA 2NY6B 4MCYA 4R4FL 4N0YH 3MLWH 4F3FA 5GSRB 1R3JA 5E6IB 3Q1SL 3U2SA 2PYEB 4K7FA 4EZMA 4RFOH 5IGXL 5CBAB 5C0EA 3MNVB 1D5MA 1JZ2A 1U8MA 1KTKE 4WVRA 4D9QE 5LWYL 3KPSA 3Q3GA 4ODUA 1X5IA 3SE9H 5DVOA 3CVIL 2WWMC 3I3EA 4I2XB 2DI8A 3CLFL 2OQJA 4X4YB 5JIIA 5TDPA 3QFJE 3X14A 5FXCH 3FB7A 3KXFB 3GBML 4MCZB 5DGQA 2BNRB 1AO7B 5B3JE 1OPGH 2XWTB 2EDBA 3WN5B 3KJ6L 2RCSH 3O6ML 1E6OH 4KAQL 2BP3A 2H9GB 1KCLA 5DEZA 3H9SE 4N90E 2ESVB 1OVZA 4PR5B 4PGJA 2YRLA 4QHNB 1M7DB 4I0PC 3WXVH 5HYSG 1I3UA 2HT3C 4WEBH 1QFWI 3C09C 4GS7B 3IU4L 1IM9B 1IEHA 3MOQA 3LCYA 2XYCA 3VFWB 3HLAB 2DS4A 5D7IB 4H25B 1KCVL 1TZIB 2EDWA 3X12B 2AABL 4NJ9H 4I4WB 5D72H 2C3HA 3DBXB 4JKPH 2DN7A 3FN0H 3MUY1 2JJWA 1RZJC 5C08E 1MHCA 1F4AA 3QIWA 5I1JL 4H26A 1HI6A 3KS0H 5KSAD 2F8OA 1RZKH 3P4NB 4FQXC 5EFIB 3SCMC 4L4TD 5T33H 4CJ0A 4E41B 1A64A 3L5WB 4XCYA 3IDMA 5D7SL 1T7VA 3CK0L 2EDKA 5HDBF 4JVWA 2CGRH 4RGNE 1DUYB 3V52L 2FO4A 4LSQH 1IGIL 4PJHE 2FYYA 1NUNB 4F15B 4M00A 2AEIT 1CFBA 1RFDH 2Q8BH 1R3KA 3UYPA 4PREA 1QD0A 1MCSA 5DQJA 2JTDA 3VGFA 1UH3A 2YPLA 5GZNC 3FQUB 5EO1A 5EBLB 4X9BA 4NNYA 5EPMA 1R24B 2FGWL 3U36A 3CVHH 3RNQA 5BRZB 4XP5H 5JZ7C 5IOPA 3FONA 4KC3B 4M62H 3SE4C 4KRPC 1EXUB 1ZHNA 1F45A 1YQVH 5E99L 3PUCA 1JTTA 4JEGB 3OKEA 4QRRE 3WSQL 3HE7B 3G6AB 4PJ7F 1JPFA 2FJHA 3KJ4C 1FFQA 3TT3H 4P2QA 4M6NH 3LB6C 3QNXB 4MXQC 5DJ6B 3IDGA 1ZVHA 1V3MA 4Q7DA 1NCCL 4D0CA 2D7PA 4S1SL 2XZCL 3GJFB 3RGVC 1NFIA 5E8OB 5B38B 4WI5A 1JHLH 2GK2A 2X4OA 3HCVA 3OMZA 1T2QL 3HAEG 3GMOA 3MLXH 4K8RD 5E95B 1VKXA 4JN1L 4UINL 2JLLA 2PTUA 4R26L 4RMSA 4PJ9C 3FO0L 2H6PB 4PJ8B 2D7NA 2N1KA 4N1CA 1LK2B 1MPAL 3RAJL 5BVJA 2IADB 3QR2A 4AEIL 2JCCF 2R0KL 5EC1A 1IC7L 4HPYH 3QPXH 4ZPVA 5I9QB 1TVBA 3DMMA 5A2LH 5DD1L 2DJSA 3HHRB 4MA7L 4WFFD 3QISA 1YEJL 2DLTA 1CBVH 3DJ9A 2RQ8A 5JORA 2OBGA 3QI9B 3JWDH 4KRMB 4XNMB 1HZHL 1X4XA 2VLRD 4RAVA 1PGRB 3ZTJH 4HKBA 2APWA 5MHSE 5EOTB 4FQHB 4MQ7B 3Q0HA 2CUHA 5F93C 2A0LC 3P9WB 3OKDB 3QUKA 1VACA 2C3VA 2CR6A 4Z7QF 2NLJA 4X80L 1FIGL 4N8VA 1B4RA 2PW1B 5EB9A 4TUKH 2P5EB 2XPGB 4UDUA 1T0PB 4RIRB 3JBG7 4ZYKB 5BOZG 1KJ2B 3B3IB 4PJBA 2DQTH 1BVKA 1G7MA 4HCRA 4KKLD 3MV9A 1T03H 1MWAL 4V2CB 4D9RE 5IFJB 5BVPL 2I27N 4X5XB 3WNKA 5F97E 3VXQB 1LGVA 4FZ8L 2WINB 3OR7B 3T3ME 4ZFOB 3BZ4B 4UIKH 3RPIA 3MBEB 5CSBA 4GRWF 1AH1A 1IKFH 2DQJL 4Z7NE 1KLGB 4KY1L 5IHLB 2HJKB 1MCFA 2FGZA 4JJ5A 1TITA 5CP7B 4YHMH 1B0GB 3MRKB 2F53E 3PDGA 4LVEA 2XKSA 1DN0B 1LO3H 5I1KL 3PWUB 3EJZC 3OJMB 1SM3H 1J1XH 4JZNB 4LRNH 1XCQB 4R8WL 2VZOA 2D0HA 2XG5A 3R1GL 5MERB 1KPUB 2NY1D 4YIQA 3RPKA 5K9OB 3QUMA 3VFRA 1UH2A 5ESAA 1YPZF 5TQ0L 3WNPA 1K3IA 3T4YA 4FTVD 4C4KT 3O3AA 4QXGL 1J18A 2V5YA 3GJFH 1CFQA 5TPWL 4G7VH 4IIQA 4U7KA 5CWSA 5FM8A 3UTTD 4Y4KC 4PTUB 1E4XH 5IMMA 3O11A 3FKUS 1DFBL 5IMOB 1ZGLB 1NUFA 3ARWA 5ITFB 2R1XA 3MLRH 3L3DB 4OCYH 5DJCB 3S3PA 2NXZD 2ZUQB 5CGYD 3W0WB 1CXKA 5IIEA 4N8CL 2QQNH 1ZA6A 3AM8C 5TQ2H 3EYUH 3TO4A 2AK4B 2DD8H 3BWAB 3HPLB 3BP5A 4Q6YA 1AGDA 2HKFL 4NQDD 2Z8RA 1S7VB 1MELA 1EAJA 4HS3B 1UZ6F 3SDYL 5DD5H 5DK2A 3RVUD 1FL5B 5IBUB 2NTFB 1YEKL 4JG0H 3VI3F 3UPCA 1LQSR 3LEYL 5GRJL 2J6EA 5E9DD 4WNQA 5HYJA 3MRCA 1LO5A 5D93C 4XNQB 3U79A 2B7DT 3BIKB 3ALXA 1GPOH 3UBXB 3TM6A 3D3VA 5I8CB 4WWID 4GMTL 2KPNA 1IAII 3HUJE 2HFEA 3INUL 3MREA 4W68A 5JLZB 1UA6H 1IEBB 2DOCA 4U1GC 4JG1H 4MQTB 4NN6B 5F21B 5SX4H 5T1DL 5L8LB 2H1PH 2B2XL 2XTJC 5ICXA 1MFAL 3F5WA 3LDBB 1KNOA 3C5ZB 1KEML 1HWHB 2C26A 3WIHL 2FECL 1YEHL 4NM4H 4OF6A 1NGZA 3MODL 3QUYC 4ODXA 3G5YB 3O2DH 2VIRB 3O4OB 3IKKA 3SDXE 5F7HA 4GW4A 1CU4H 4MJ6A 2BSED 4QOKB 4S1QL 5GIRA 4Z8FL 5ACZA 5F9OH 1N2RA 5F88B 4JO2L 4C83B 2DJ4A 1HSBB 4I77H 3RVVD 3QH3A 3DSNA 4BFBD 2X4PB 3R8BB 1IARB 5J9PB 1MFNA 1KLFA 3O3BB 2V2WA 4U1NA 1D5ZB 2C7UA 4HWEH 2YKLH 4KDTC 2D0FA 3ULUF 4HWBL 2F54E 3W2DH 2VLJE 3IJSA 4XVSL 4NT6B 5EC2A 2CXKA 3LN9A 1U8OA 2BHZA 4M6OL 4CDGC 4P5MB 1I7UB 2ADJB 3FFCD 4OT1L 2AXHA 2C3GA 3P9MA 4NKIL 3ME0A 4FQJH 5L7XL 3LSOA 3ILQD 1QFUH 4YHLH 3EZJB 4R97B 1X6NA 4ZUSB 1N4XH 4HX1B 4IRSB 5JQ6L 2NW3A 2O5ZH 4Z7WB 1RURH 3RL2A 4NQCD 2J5LC 4NFCA 1W0VB 1A3RL 2DTML 2YPKB 4IBLT 1OSPL 3CCHA 1QVOA 3PV7A 3B9KD 4JFZL 1FORL 4LLDB 1QSFE 2G60L 3L3JA 2OTWB 4ZPTA 3DRTA 1IAKA 5HGDA 3KPPA 3VA6A 2X6MA 2F5AL 3MRPA 3PP4H 5EBGA 1T7XA 3FB5B 4WW2B 4AIZB 2C1PB 2ITDA 4M03A 4P9ML 3TT1L 4X99B 5E2WL 1WBZB 2FSEA 3VG9B 3ZKMD 2YPVH 4CU6A 3QIUB 1XGRB 3EO9L 1UVQB 3ZMRA 4I3SL 3HG1D 3O8XC 1DEDA 2A77L 2FX9H 3BWUC 3ZTJG 4NQDA 4ALAH 1I8IA 4PIRF 1UG9A 3RVWC 1CIUA 1FZKB 2EYRB 5TJWK 4NWTH 2EEDA 2XICA 1CXFA 3G5VB 3RIFF 4ZFGL 2B1AL 3IXAB 1EA9C 3EDJA 1JUFA 2ZG3A 4JN2A 1BLNA 4PJ5A 3ES6B 1CFVH 5DI8A 3UCRA 3KPNA 1AGBB 5DURB 4NPYA 5E9DA 2DQCL 5EU6B 1D5XB 3SKJH 2FEDC 4XH2A 4D8PA 4HFWA 1Y18A 3FMGL 3FRUA 4Z78B 3T4AB 2IPKB 1A9BA 1OCWL 2CO7B 3BDYH 4N68A 1DTUA 1QPXA 1OGTA 2YA2A 1N6VA 4LOUD 3I6GA 3MRIA 4PY7A 4JRXD 3K7UA 1UYWH 1VFUA 2C4FT 3SPVB 1JGLH 1U8IA 1I8LC 4G8GA 4WO4D 4DOHB 5FO9A 4G6MH 3G6DH 5BO1H 3PP3K 4Y19B 3MFGB 4ONHA 2CKBB 4P2RA 5EO0B 4GG6B 2AV1B 1T2JA 2I9TA 2YD8A 3BPCA 4RGMB 5F7FA 5JUEH 2XN9B 3QHFL 3P4OB 3ZE0F 3QP3A 3SHSA 5HYIA 1WZ1H 3IRPX 3L3KB 5L6YL 1ZHKA 4XP4H 5DUML 3JV4B 3PWNB 4HUXA 2N56A 4YO0A 4KGJA 4PJDE 2G5BA 3BESR 3LIZH 1CG9A 3S9DB 2R56H 4PJXA 5IB3B 1MI5D 4JM2A 3ZT5A 4EIGB 4HBQA 4KTDL 4ODWA 1OP5H 2YEZA 2HT2D 4FQPA 1S9YA 3SDCC 1KPRA 1CDHA 4ELKB 5BXFA 1EAPA 1CE1L 2BOBB 3HMWL 3VXPB 2BVPB 3O45A 4XPBH 2YD2A 3EGSA 2UWEE 2PTVA 4Q0XH 3QQNA 1LP9E 1CXIA 1TVDA 3SOBH 5B38G 4DVBA 1FO0A 1T5XA 5DRNA 2PUQT 3FFCA 1IKNA 2GW5A 5B22A 2QQKL 2CSPA 2NZ9C 4P2OD 2VDRL 4L3EB 3ZDZE 4KKNA 4MNGB 1OT1A 1CK0L 2BDNL 3DROB 3VWKD 1DBKH 2W1NA 1ZHBA 3G5ZA 2AKRA 5GHWL 4DCQA 3BYTA 3VWJD 2UZXB 1IAOB 3EHBD 4CUCA 3AUVA 5LWYH 1MCWM 2PTTA 4KJPD 3VI4F 2Y5TA 5MI0B 5JXAL 4JQXC 4R3SA 3V6OC 5L0QB 3ULUC 3BJLA 4LIQH 5TDNA 2QQLL 1A1NA 2R69H 4F7EA 2FJFA 3MOBL 2IALA 4L3CA 3L7EB 2ZOLA 5BW7A 3MGTA 3S3SA 3QPQC 5I16A 4PRHB 3MYZA 3OX8A 1AQKL 1FAKT 2A74A 3KJ6H 3LN4A 1G9MH 2H8PB 4KK9D 5EU3B 5KSVA 3F7VA 5H94A 4BQ6A 4JPWL 3HG1A 5CLTA 4LHUB 4U6TA 1OAXH 3F7PC 4PS4L 5J6GB 2DLHA 2FBJH 3I75A 4HLJA 3VXOB 3WFEL 1M6OA 4ZXBC 4ELMB 3HFML 2YA0A 1D9KD 3BPNB 3WEXA 1MEXL 5DC4B 4M4RA 4LF3B 5HHQA 3IU4H 4UTAL 2IH3A 2VABA 4PJEA 4LSVL 5D7JB 1ONQA 1R3LB 2VZVA 3VXRB 5CD3B 4PRIA 5E2VH 5EZJB 1D6VL 2Y06L 1J1OH 5ILTH 4ZO6A 3OR6B 5IBLD 1K9TA 3QULA 4DZBB 5CIPA 5ESVA 1EBPA 1I7RB 3NA4A 1PFCA 1J8HB 2X4QA 3FQTB 4YXKL 3O41B 1WZMA 2QLVB 4GT7A 2CKBH 5D7SH 3PWPE 3VFMA 3CK0H 2J1KA 3RDTC 2IAMB 4IRJB 2XG4A 1FL3A 1SBSL 3V52H 3DETC 4X6FB 1AHWB 1RMFL 4JM4L 3KPQA 3TNMA 3WN5C 4RA3A 4JRXA 4TSCH 4MA1B 1TVHB 4WUKH 2KBGA 3GMPB 4WO4A 1F90L 1RULH 2WIIB 2FD6L 1KLUA 3KNBA 2PYFB 1S9WB 4QRPA 1ZMYA 3BN3B 4RNRB 2O5XL 4PGBA 3NA9L 4Z7VA 2GUOA 2R0WL 3RVTC 1C08B 4XNYH 5C0FB 5DJAA 3TPUA 1I7TA 1T04B 4GS7C 3X11A 4MD0B 3WSQH 5F3BA 3BH9B 5F44A 1N8ZB 1ZEAL 4R90H 1F6AA 4B41A 3OKKA 1WEJL 1F8TL 1NCCH 5CFHA 1YY8B 3ILPA 4KJWC 3D39E 4WJ5B 2B0SH 4J12A 1MI5A 4U1IA 3MMEB 3S8WA 2CIKA 4M6AA 5C0GB 3PDOA 4J3TA 1MAKA 1I4FA 1U8NA 4PBVC 2C1OA 4WV1B 3FO0H 1ODAA 5KVGL 1FJ1A 1JWMB 1FZJB 2RGSA 3LKPA 4WIQA 2A73B 5DD6A 4AEIH 1Z5LB 5D2LA 3KPMB 6FABH 3ZHLA 4JFHD 2VLLA 2EKSB 3KLDA 1YY9C 2I5YL 4LSPH 2YZ8A 4HEME 2VJXA 4TVPH 4G7YL 3PGDA 1P7QD 1VFBB 3OKMA 4NRXA 1VEMA 3QFDB 4ZAKB 5J13B 5C9JB 4ZOEA 2BK8A 1HDMA 5E5UB 2WBJB 4Z7UB 3T65A 1Q9KA 3TESA 1T89A 5B21A 3TZVA 5IBUG 2OSLB 3HE7C 2VMFA 1IGJB 1F6LL 4WW1B 3WE6B 3KPRD 2CMRL 1MCCA 4AJ0A 2Q20A 2QHRL 1FVEB 3MOAH 4XZUB 3BDXA 1OW0C 2X4NA 3UBXG 5I19L 1Q0XH 4KXZH 4GSDH 2BSSB 5I1CL 5I18H 3AS3A 1BEYL 4YHIA 5DMYA 3ULVE 2QSCL 4KDWA 5BVPH 1A2YA 3KAAA 2P5WD 3NIDF 1ZLSL 5IMLA 4P2CG 5CSZB 3LHPL 4TYUA 4UBDD 3VW3H 3NCYP 5E56A 2F19H 2X40A 4N0UE 3QI9C 1CGSH 1XCTA 3RY4A 1F4HA 3BXNA 4M1GL 1A3QA 2AJXL 2DQJH 2CLVA 2EE9A 1XF5A 1A4KA 3TA3B 5GJTH 4WCYL 1PG7X 4U1SB 1FG9C 5BZWB 1UJ3A 3BISA 2ATPB 4HW6A 4R7NB 3TVMA 5ID0A 4HWNA 5IHUL 3WHXB 1KIPA 4MDJB 4ZUVB 1KXQE 2F74B 3ARBD 4LU5L 4RZCA 2NW2B 1U58B 3L1OL 2A6JB 2XXCB 1A9EB 3A67L 3VJ6A 5BQ7A 4ETQA 2HTKD 4JDVA 4E5XB 4LSRH 3W9DB 1U6AL 3TBYA 2R9HD 3BRFA 3QEHA 4RGOH 3AMKA 5DEGB 4MWFB 4KROB 3ZHDA 2NY4C 3E3QE 4UDTB 5TQ0H 1ERNA 4ZUUB 4PRNB 3ZSTA 5IJVB 3FZUD 3VXSD 1I1AD 4W4OC 4QXGH 4EN3D 5TPWH 4BA8A 2XIDA 4Z7WF 2AQ3A 4JY6B 5T5FL 5IQ9A 1HWGB 2DAVA 1TTGA 3MZGB 4HZLB 4M43H 4WUUB 1Y6MR 3MBEC 3EAKA 3V6FA 1UXWA 4GAGH 3HMXH 5GGTA 2OJEA 3UJTL 4N8CH 4CVXB 1YNTA 3ZO0A 3T0ED 1QZ1A 2P44B 2XKNB 5CHNA 5LGJB 1ZAGA 3LEXB 3HRPA 4OCMC 4Z95H 1A5FL 1OB1B 3HRZB 2ITCA 2A6KB 4J4PD 5I1GH 3FQRA 4P3WA 1V7NH 4WW2F 4KKCC 3NAAL 5GGRY 4UTBL 3SDYH 2RBLA 4Y5VA 4ODVH 1RUKH 4NZTL 4X4XB 3O2WL 1GC1H 5F1NA 4ZOCA 5EN2B 1QNZH 5KZCD 3MRDA 1LE5B 4EOWL 1QO3B 3MV9E 2CIIA 4OI9A 1KULA 1N6QL 4U0QB 3H9ZA 1S9VB 4L5FH 3JWOH 5LG1A 5FFLA 1A3LL 1P7QA 3EDKA 3SDAA 1AD9A 1NC2A 3MC0A 1P7HL 1HSAA 3LMJH 1LE9B 5F70A 2VDLL 1A1MA 2JB5L 3HTLX 4PBXA 2IAND 4XMPL 2R2HB 3FT3A 1LD9A 3MA9L 4YDIL 4PYGA 3INUH 3HE6C 2W07A 4URTB 4FXLA 1T5WB 4G43A 4S2SB 2EDFA 4U6HA 5KSAB 1X9QA 3QCUL 5T1DH 2ZUQC 4L4TB 1HHIA 2OJZL 1VFAA 1AGEA 4QRSA 4F9PA 3MLUL 2I60L 2COQA 4HUMB 5ENWA 1KENH 1QFWM 1KEMH 2ZSVB 3RVXC 3FOLB 3B6SB 3H3PH 3OKLA 1YEHH 1DEEB 1NFDB 4LNRA 2EDHA 3ARDB 3MODH 3RKDD 1FQ9C 5DJDB 5F72S 1PBYA 2AEPH 3M8OL 4JPIB 5GGRA 1Q94B 4WI3A 4WFHE 3EDEA 4S1QH 5EIQA 4KHTL 2P5WA 4GG6F 1VA9A 8FABB 3ESUF 5E8EA 3PV6B 4XNXH 4YHZH 4GQPH 4AMKH 1DP0A 1RV6X 3C6LA 1DUZB 4KHXH 5MENA 4NBXB 3O2VL 2DQUH 5D5MB 1NCBL 2W65A 5C0CB 1U8KA 5DJYA 2W0FB 3D6GA 4Z5RB 4NZRL 1W0WB 2H41A 5C0RL 5JA8B 5ISZB 1HHHA 1K5NA 4XBGB 2FEEI 4NN6C 3V6BR 5SWQA 1U3ZA 1A1OB 1SYVA 3QUXB 4NO0D 4XPAL 1JF1A 5CMAA 3HB3C 5L7XH 3LDBC 1U8LA 4NJAL 4P2YA 4ODTH 3D85B 5FKAB 4NQVA 2ZKHL 3C5ZC 5AEAA 5TE4L 5IW1A 35C8H 4DUVA 2D7OA 4ZS6D 3BDBA 1NL0L 3HI1B 1JWUA 5DHYA 5INCB 3SGDI 5M7QA 1IBGH 2HJLB 2GJ6D 5EU4B 1UT9A 3B5GA 3O4OC 1OSPH 3VXSA 2QL1A 1I1AA 1JGEB 1S7SA 2GT9A 4EN3A 5B39B 1A7NL 1FORH 2H26B 2VLRB 3V5HB 1EGJL 4PB9L 4WI7A 3MTRA 5B8CA 2O5YL 4NOBA 3TCXA 3IFPA 5E8NB 3TWCH 1CICA 4ENEC 3RBSA 2W9EH 5DMGC 5ICZA 2DWEA 4QRUA 3AREC 1BPVA 1DL7L 2CRMA 4KZEL 4P9MH 3TT1H 5DA0B 1I8MB 4OZGE 5T1KD 5IHZB 4LDEB 3EO9H 3QDGD 4OSUL 3T0EA 4Q2ZB 1RU9L 3G6JA 4I13B 3QFJB 3LRHA 1QQDB 2GQHA 5I1HL 3LQAL 5C0ND 3HZMB 4GJTB 3P3YA 1IGTA 4R6UA 4R97C 1AP2A 1DQJB 3T1FB 1K4DA 4QCIB 4IRSC 1NANH 3K8KA 4JKLA 5GGVL 2VYRE 4DWHA 2CXGA 3H9SB 3CH1A 4FQ2L 3FO2A 1ADQA 3GO1L 4LHUG 4ELMF 4P9HC 2DQCH 1FFNA 3MUZ1 3LKNB 4DUXA 2WBKA 1WBXB 3AAZB 3FMGH 3BP4B 1OAQH 4QHLB 2AJVL 2IANA 5ETUB 1EJ6A 2NMSA 5KVMC 3ROOB 3I02A 3NBNA 1UQSB 1J0JA 2Z35B 2YBRB 1BD2A 4WW2C 4P49A 3RIAK 3MFFB 2HVKB 3B5TA 2VC2H 4OIBA 4PD4J 3VGAB 3VG9C 5JOFA 3IAGC 3QIUC 1T1ZB 1GIGL 3WJJC 4RGNB 4X0KA 1MOEA 4TQEL 2AS5M 4YH6A 4PJHB 5J57B 5IW3A 1T4KA 4JDTL 3UX9B 1KUMA 2UZIL 3AY4A 2AJSH 3QHFH 4NNXA 5BOPA 5IEKB 4AH2B 1W72B 2GSIA 4K3HA 2JK5B 5GZOC 5L6YH 2BXZA 1G9MC 3ZTNH 5DUMH 4KI5F 5FA4A 4W4NA 1RIHL 2R0ZL 4QXTA 3X3GL 1MAML 2VWEC 1AFVL 5FDWA 1QR1A 1AGCA 1SY6A 4ZNEA 3QNYB 1XIWB 1UH4A 4P3DA 5HHXL 3B9DA 3UTTB 5KG9B 1K2DB 1NPUA 2DIJA 5IQ7L 1OAKL 2WWMD 3W39A 4KJYB 2I07A 1M1SA 4KTDH 5J1TC 4QRRB 2DDQH 4V1DD 4M7JL 2PR4L 4LP5A 2JELL 3GNMH 2NXZB 3HMWH 1LEKB 2FO1A 1FN4A 3O9WD 5K33A 2PETA 3JV0A 1NGQL 4KK8D 4FNLL 1JVKA 4G42A 3MRMB 4OIAA 2AJ3A 3TIDA 3PP3H 1I1FA 5DZLA 2QQKH 4M8QA 3U7YL 4DTGL 3MRJA 1S7WA 4RX4A 4X6BB 3QO0A 5IWLC 1URLA 1CQYA 2VDQL 4JZJA 3SGKC 4XTRD 2BDNH 1I9JL 4CN1A 2EH7L 1T83A 1ZANL 2PO6A 3U30B 5T3XD 2IQAA 4Y4HD 5BV7L 4ETYA 1EIBA 4RMQA 2ZPKH 4OGZA 2WIMA 4NSKA 3S34L 5E24E 2H45A 1C16B 3TBSA 3P9LA 1R0AH 1S5HB 5HSFA 1A6AA 2Q6WA 4CVWA 1CLOL 3WCYA 7CGTA 2OL3L 1DBAL 4Z7UF 2DQHL 3BGMB 3ZYIA 1MF2L 1J7VR 4LCCB 5E08H 3G08A 4Y16C 2HRPH 3AC0A 3NCCB 3LKQA 3NACL 4J3UA 1AQKH 3MO1B 3FTGB 5FOBB 5I8EB 5T1KA 1VSCA 5I73B 3GSXA 2X7LA 3QDGA 5D2NA 3VXME 1UWEL 5F7UA 5DYOA 3VMOA 4PS4H 4LCWD 1G7IB 3UTQA 2XWBA 5JMRA 1GGYA 3HFMH 4I0CC 2YD6A 5GZND 4JRWA 3PIQA 4P3CH 4RSVA 1U3HC 3STZA 1GGUA 4WFEE 4BYHA 3SQOL 4KMLB 1N59A 5JZ7D 4ONGH 1BQHA 5C8JA 4S1DC 2ENSA 3BKCH 5FK9A 4OUUB 4PP1C 5MEOA 5KSBE 4F9LA 5EWIH 3ARRA 5DJZB 3D5OF 5MI0C 2H2PC 5LXGH 4BH8B 2KUTA 1PZ5B 4Y5XA 3RGVD 4MD5A 3FO9A 4JFFA 3U9UA 3SO5A 4MQSB 2NY0B 2FHCA 5KANG 4TPRL 1T66D 4C56E 2P1YA 1A7OH 4JFQB 3MGOB 4PRDA 4JKKA 4RWYH 1EHXA 1K8IB 1W72H 2CDFB 2F53B 3IGAB 4QGTA 4X6EA 1Y6KR 3FT2B 1HN1A 2LABA 2FD6H 1IRAY 4ZTOH 1YUHB 5L9DH 3I6LE 4LQ1A 5KAQF 4QXUH 1S7RB 2A6DA 4BSWA 5DJ8B 2ZOKB 5KAQG 3BPNC 3BP7A 3TBTA 4KKAD 3F58H 5KSUB 3PJSB 4R2GC 4QHUB 3T0VA 5TDOB 3RU8H 3TH4T 2JJTC 4XAWL 4K3EH 1ZEAH 3DWTA 3ARGC 1YEDA 4TOYL 3B9KB 2CPCA 2A0LD 4UNUA 5CJOL 1N5AA 1S7QB 3GRWH 3UAJC 5CCKL 1C12A 1XGUB 2PW2A 1NBZA 1PZUB 4V1DA 4LNVA 1MVUB 5FM5M 3UO1L 4E42A 4HC1A 3QUZB 2M8XA 2IAMC 1NDGB 3HN3A 1ZTXL 3QEQD 4G6FD 4FFVC 1AHWC 2A6IA 4CNIB 5LQBL 1LNUA 1OARL 5F96L 4MA1C 2X42A 4U1LA 4YAQB 4CU8A 5FGBC 2I5YH 3WFHA 5FM5O 1HXYB 3QYCA 4KI5C 5D1XB 3K81A 3VFSA 2O61A 2K7QA 4I0PA 3OB0K 3TIEB 5JR1L 1XR8B 1PAMA 2B20A 2N7AA 2HFFB 2ERJC 3U7WH 5IF0B 3F7YB 4Y4HA 5F1IA 4PRIE 3KYMA 2IPTL 1D5IL 1F00I 2GTWB 4JFEE 4RBPK 4X98B 4P5TC 3SKNB 1A6UL 4U6YB 2EECA 4PV9A 5JDJA 5T1MB 1Q9OA 5I19H 4FQXA 3SCMA 3DV6B 3JSSA 3QWOB 4HMCA 4HWZA 1NGWA 4HS8L 1OD9A 5I1CH 1N7MH 3MR9A 1IGFL 2QHLA 3OKOA 4WU5B 5CKGA 2BHUA 2X4UB 3ULVL 4K23L 5DK0B 4DVRH 4X8XA 3BSZH 5H2BB 1FFPA 4BKLB 3EJYC 4LCWA 3LQMA 2ATKA 3IDXL 5HPMA 1MNUL 1NFDF 2V17H 3E6HA 4OKDA 1SJXA 2BY0A 2Q8AL 3RP1A 5DMJB 5AZEH 3H2WA 1FNGB 3B9VA 4HF5H 4ZAKC 5J13C 2DI7A 5DTFB 1TQCB 5ALCL 3SE4A 4M1GH 1GC1C 2WBJC 3SDXB 1I85C 2Y6SC 2AJXH 1WF5A 1JGDA 4NDMA 1Q0YL 4PJIA 4MB4A 4UNTA 1YNKH 4MVBC 2XY2A 1U8HB 2APFA 1BOGA 3QIWC 3WD5L 3JWOC 3X13A 5I1LA 5SWSA 4HUUA 4ZSOA 4JHBA 4FN0A 4XHJC 3O4LD 3JZ7A 5EUOA 3RGVA 3EUUA 3S5LB 1YN6A 4GQ9L 3QXAB 3QCVH 5FV1L 2F54B 2VLJB 4WI9A 5JPNA 1FH5L 4PJ9A 1BZQK 2EIBA 2NXYC 4YLQT 3KYOA 3UJJL 3DYOA 2E7CA 3OAUL 3U6RA 3PABA 4PJFE 3MLYL 4KRLB 4UOJA 2ZP0T 3VWKB 5IM7A 3X3FH 4X5WA 1S5IL 4H88L 2L7JA 4F33B 3OHXA 5T5FH 1I1YA 2FR4A 5HHPA 1WCBB 4FRWA 4H0HB 4NNPL 4M1DL 5E4IA 5D1ZB 4ZOAA 3P0YL 4BJLA 1UENA 4I5BB 3UJTH 4GXVH 4HPOL 4OGAC 4RDQF 1N0LA 2Q76A 5F7EH 2X4TA 5D71L 2BVEA 1ZT1B 3DO7A 5B39G 2CUIA 4Y5YB 3DUHA 4RDQG 1KPVB 4UQ3B 1A5FH 3B2UC 3TNNB 3ARXA 3K4AA 3OQ3B 3W9EA 3WS3B 3NFSL 3NAAH 1KIQB 4OZ4A 2EH8L 4M61A 5KW9H 4ZUWA 5EBWA 2B4CL 4M7KH 4OGYL 5FYKD 1FPTL 1GZQB 2P7TA 4HCRL 3S36L 4JREC 1E6JL 4LASL 4P59L 1FGNH 2P42B 4HJJL 4PP2A 5GSVB 4YFEA 1FNEB 1X5JA 3CZJA 4HBCL 3MLZH 5B3JF 4KROC 1D9KB 5J6HB 3TBVB 1A3LH 2WBWB 2OS7A 4PRPD 4XGZB 4GKZA 1NBYB 5EIVA 4XX1E 3MRNB 3PWVA 1TJHH 4LKCB 1AY1L 1H3TA 4P4RA 4XMPH 4L8BB 3KDMB 4HMEA 1ZLVK 3MA9H 2EC9T 3GSRA 5IB2B 1WBYA 3OB8A 4C54A 4U3HA 1UADC 3OXRB 3NFNA 4AIOA 4NUJB 5DQDH 1RUQH 3GSWB 1T20B 1VHPA 4N5ED 3PHQA 2FATL 1PLGH 3EYOB 5ACLA 5HTSA 3MLUH 5F7YC 2XQBH 3DPBA 1EEZB 1U36A 2DI9A 2VDKL 1KFAL 5DHVB 1VB9A 4X6CE 3OAYK 1CLZL 5HHOD 3O81A 5C0AD 3ECBB 3L3GA 5IKCB 4XC3L 4GBXD 5HYSA 1IILE 3JTSA 3CU1A 4ZS7L 4DKFL 3QUML 2V5MA 2DJUA 3FQXA 4AEEA 3O3EB 4KHTH 2A1WL 4BQ9A 4YDJB 1IMHC 2AI0H 4PJHF 1T21A 2X70A 1H15B 5K9QG 4G5ZH 2P8PA 4H8WL 3WIFB 1NMAH 5T1LD 2LFGA 2D03L 2VSDA 1JP5A 3M17B 4PJDB 4NZRH 5KN5A 4U1HA 1J5OL 1KTDA 2BHYA 2D0GA 2IGFL 3HZVB 4NN7C 4QTHA 1KF9B 2NZIA 3BZEA 3QEUA 1G7QB 5KSAC 3KR3L 4HHAA 3PG2A 5SWZD 1OF2A 5IB4B 5HHVH 5JW3H 1S9XB 3C5JA 3O4LA 3QCTH 4P46D 2DBLL 3AM8A 3MRRB 5FB8B 4K8RL 2ZKHH 4UQ2A 1P4BL 3WNNA 3BPLC 3KLAA 5I6XB 3G5XB 3GSQA 4AY0A 2UWEB 3FHAA 5SX4I 1G7LA 1JK8B 1LP9B 3ARDC 2VISB 2BNQD 1E4KC 4OCWL 2FHBA 4QNPE 5GS0D 3IF1B 3JUZA 2J6EL 2BOCA 4PGCA 4YHNA 3S4SB 1O0VA 1JF6A 4XP1L 4Q9BA 2ARJB 4PJ7A 1XGPA 2FEDD 1QRND 4NUGL 2G9HA 5JMOC 5F1OB 4D0DB 3N1FC 1OGAD 3DURB 1DLFH 2FB4L 3IDIA 2GIYA 1CE6B 1RUAL 1CDCA 3HAEA 4JGUA 3ZKXC 1ZT4B 4KZEH 4HAFA 4J8RB 1YJDH 4MXVF 1TENA 3HNVL 2GITA 4XCEB 5I66B 5ERWA 2DM4A 1RU9H 2BCKB 5F7MC 1NCNA 3TLRA 5I1HH 4I9WE 5C09A 4YUEH 4OQTA 4APQD 2X1OA 1A7RL 2JCCA 2R4SL 4GRLD 2GJZB 4HKZA 1CZ8L 4RAUB 4KVCL 2XI9A 3D0VA 2CDEA 3BP6B 4EBQL 4N0FB 3VGHA 5DFWH 1T1WB 5JO5A 2RFXB 1ORQB 3QUYA 5M94B 4WWKB 2P4AB 3EDFA 1DDHB 2SEBB 4QF1A 1AC6A 1Q38A 4PRPA 1IL1A 4A2LA 2ADGB 1R5VA 5MENE 3FN3A 2AJVH 1JHTB 2OR9L 2M2DA 2YD5A 5HGBB 5DHVH 43CAB 4PFEA 4OFVA 3F6IA 5IG7B 4OF3A 3DVIA 5EIIA 4JB9H 4KDTA 1IT9H 3MUGA 1WSST 4O2FB 5MEQA 3IDNB 4QEGA 2ZZUT 1A4JA 3D25B 3T3MF 3WHE0 3U0PB 1MUJA 3QJHB 1JPGA 1HKFA 1BBJB 2OMBA 2BSTB 4U0RB 1VGEH 3PWPB 1GIGH 3O6FB 3V8OA 4Z7NF 3TN0B 4MNQE 1CLYL 2D4DA 4TQEH 1ZVSB 4JDTH 5HHOA 2EC9U 4CMHC 2BC4B 2R1YA 2ZWLT 1UB6B 2EKJA 1RK0A 4KKLC 1BZ7A 4K7PL 4R9HA 3ZKSD 3SE8L 1RIHH 1J8KA 4XCCL 5D1QD 3O0RH 1MAMH 4O2EB 2F8XC 4OLVL 4DFIA 2CLRA 1RVFH 2WP3O 4HUVB 1EEYA 1OAKH 2EYSB 3D0LA 3OJ2C 4IS6A 4HT1H 2W9DL 4MDIB 4IJ3B 3CPLA 1JYVA 1RZ8A 5T1LA 4HGMA 4JANA 3K3QA 3ARSA 3U2SB 1ZWIB 3ZDXE 4XXDA 3MUJA 2PR4H 4M7JH 3MJ8A 1D5MB 1ZT7B 3DX8B 4HFUL 3KWWB 1BM3H 3QPQD 5TFSL 5GGUB 4LVNC 2AP2A 5EUKA 5F7NC 4JR9L 3ZDYF 3D39B 5E2TL 1HHJB 4FFZH 3UXFA 5FUCE 3BQUD 2L0DA 1FVCA 3VFOB 4ZQKA 2J88L 1TJGL 4LLMB 4EDWL 4L29B 1PQZA 4UIMA 5SWZA 4X9IA 4XRCB 2GKIA 3VGAC 5JOEA 4JFDD 1U8PB 4P46A 2HLAA 3DHJA 3O8XA 1J1PL 1J05B 5DJ0B 2VDQH 1F97A 1X5YA 3EFFA 4KV5E 5A2IH 2BVYA 2HJFB 3LRSA 4YNYB 4ZXBD 4WI8A 1YPZA 2YUZA 1KBGL 3B5HA 1ZANH 4LBEA 2NY6D 5C3TA 3GHBH 2DKSA 4PY8I 4DGVL 4U3XA 5D6CB 1BFOA 3AROA 4FQIL 5E6ID 3RTQD 1OTSC 3IDJA 2PYED 3S34H 2EO9A 5AYUH 3WIIL 3K46A 5DLMH 3P11L 2HVJA 5HGAB 3THML 3RBGA 3DGGA 1KCRL 4XP9L 2OL3H 1MQ8A 2DQHH 1QRNA 2NY7H 5GISL 3U0TA 4EUPB 5BMFH 3QDJE 3QO1A 1OGAA 3BRGC 1NUGA 3NACH 3FCTA 2HFGH 3KXFD 2NXZC 5CGYC 3D69A 4X83A 2BNRD 1AO7D 3ZL4H 1G1CA 1Y0LA 1DBBL 1HINH 4GUPA 4LLYA 1T3FB 1TTFA 4ORZC 1MIML 3LKSA 4OF7A 1SJEB 4K94L 1I8LA 3CGTA 4XCYB 3IDMB 4MJ2A 4I9WD 5CJ5A 2VLME 4K71B 1KJ3H 2ESVD 2DWDA 1FFOA 2PCPA 1GAFL 3RVUC 1QBLL 5BS0E 5C2BL 1CGYA 3VD4A 3VRLE 1IFHL 4KMTL 2Z4QA 1VCAA 3HI5H 5M95B 1IM9D 1CDJA 2FIKA 2P24A 1FE8H 2CKNA 3DXAE 2XFXA 4FQQB 3M45A 1E28A 4ZNEE 4XPTL 1F13A 5EPMB 4DW2L 3H42L 4RMRA 4B53A 1JPSL 4N0UB 2R4RL 3FONB 4XAKE 1ORSA 1Q9LB 2FJGA 5HHME 3ROLA 3K74B 5JOPE 4LCCC 4I48A 3SJVE 4E41D 5KVEL 3FOMB 3WO4B 3QG6A 1CD1B 3WV0A 5F6HI 2VXVL 2NY2B 2MKWA 5CEXB 4OKVB 1NCAL 3VXNA 3BGAA 5I73C 1V3LA 1FO0L 4PLJC 1A6ZA 4O58H 4YE4L 3S5LG 3NOIA 5HI5C 1AR2A 3O6LL 2VR4A 3V9FA 4OCXH 2V2XA 3FB6B 3LQZB 1XF3A 5I1AB 4OZIE 1MCPL 3SY0B 5IK3A 4L4VE 5BRZD 5EC1B 4M7LL 3UPRA 1ND0A 1QFWL 5D1QA 4ZDHA 1S3KL 4LKXB 4E9LA 4N1EA 2X9XA 1GGIH 3L5HA 3RVVC 5DZOA 4JQXA 3V6OA 2VAJA 3ZYOA 5HHNA 3MJ9A 5D7KE 3GI9L 3IDYC 3CVHA 2YR3A 5A16B 4HKBB 1X7QA 5H37H 4Y1AE 3LN5A 2NY0C 4YDLB 2C3VB 3OBAA 1H8SA 1GZPA 2P47B 2QBWA 3BQUA 4D0BB 5F96H 3UJIH 1R5IA 4PJ8D 4ODBD 5D2NE 1IKNC 4JFDA 4JHZA 3MV7A 2AEQL 3ILQC 4JHWL 4P99A 1RIVH 2FHFA 1G7PB 4ZXBA 1MAJA 2FWOB 4NQXA 1WAAA 2BVOB 1DQQA 1T1XB 4RQQB 4QYOA 4EUPH 3MV9B 3QI9D 5GSRA 2XRAL 3U4BL 2IPTH 4MLIA 5E6IA 2VKWA 3Q6FA 1MHPL 1D5IH 5DSCB 5I8OL 5I1IL 5CBAA 4XC1L 2D31A 3MNVA 1PDKA 3B9KC 5E00B 1ZLWH 2GTZA 3P73B 3NCJL 4I2XA 2X4RA 2K1MA 4JFFE 4F57H 2F5BL 4YBHA 4X4YA 1M71B 3L5XL 5AYQA 3GGWB 3MRFB 4MCZA 3ZKMC 3EDDA 3ULVH 4JJ5B 2BNRA 1AO7A 5EOCL 1MLBB 3V5KB 1XAUA 2XWTA 1YNLL 3WN5A 4HK3N 4U6VL 4PRAB 5E03A 2ORBL 5C0JA 4OFIA 3FL7A 2H9GA 5DC0A 1K4CB 3B9EA 5ICYB 4MGXA 1IVLA 3OB0H 4QHNA 1QBML 3FO1B 1M7DA 4RRPG 4TULH 5ALCH 5AD0B 3VFRB 3VGGA 3DX9B 3AB0B 3CFBA 1MRFH 1YEFL 3B43A 2OK0L 3VFWA 2V7NA 3HLAA 5D7IA 4H25A 2OI9B 2GJJA 4RBPH 4JAMB 1TZIA 3X12A 3T0DA 4I4WA 3UP1A 4IIQB 3N85H 2EE6A 2GY5A 2DQDL 1NDMB 2IC2A 2VO5A 4GQ9H 5K59F 4OJFL 1A14L 2VUYA 5JW4Q 5FV2A 3JV5A 3ARFB 3HR5A 3UYRL 3O9WB 4PJDF 2R1XB 5HHMD 3P4NA 3G9AB 5EFIA 3V4VH 1KV3A 1D6EB 3L5WA 1ZOXA 4LOUC 1NCWH 1N3NB 5A2FA 1ACYL 5C92A 2VITB 1Z6JT 3OAUH 2EZ0D 1E4WL 3H0TB 3MLYH 3AVEA 2AK1H 2YC1B 4KXZI 4MB5A 4OZHE 3K4ZA 4AZ8A 4TN9A 4U3CA 1HIMH 3FQUA 5EBLA 5H35B 2OM5A 3LS4H 5BRZA 1RZ7L 1QLFB 4NGHH 4NNPH 4AEHL 4DQOL 1EXUA 2DL9A 2X89D 3BZDA 3P0YH 3HE7A 4PD4K 5FHAL 3MGAA 3PQYA 5E8PB 3S4SG 2ZSWB 3QNXA 1LO5B 5DJ6A 4HIHA 1VDGA 1NGXB 5D8JL 4OD1H 3W0WD 4PGZA 2HT2C 4LCIH 5KVDL 1BZ9A 3GJFA 1I9EA 3MXWL 4HK3J 3NFSH 5E8OA 3D2UD 5B38A 5DWUH 3MREB 1OW0A 3RVXD 4BH7A 2AK4D 1GHFL 4CGTA 3KLHD 2B4CH 4OZGB 1HCFX 1Q8MA 4OGYH 4AM0B 3STLB 1QOKA 1DBJL 3V7MA 1RPQA 1E6JH 2H6PA 5F7WC 4PUBL 4LASH 1FNAA 4I3RL 1KIUA 4AG4L 1LK2A 3F5WB 5DRXB 2Y1VA 5I76B 4YZFE 4YPGB 4CKVX 4P2OC 3VCLB 3B83A 5CZXD 4Q9RH 2WP3T 2XNAB 3VWKC 1KN4H 3TGXA 3T2OA 3BJ91 3OL2A 3VWJC 3EHBC 3QI9A 4QRTB 1ZXQA 3SE3C 4GW4B 4KJPC 2BSRB 3S7GA 4PJIE 1JNLL 3QB7C 5D1ZC 5EOTA 4FQHA 4YGAB 4MQ7A 2XT1B 4NBYB 4LLVB 1JFQH 1MFBL 2W60B 1HK6A 3OKDA 3VFTB 2BVTA 2GI7A 2V2WB 2GK0A 2HG5B 3GIVB 5EUOE 4OCRL 1CDGA 1CIDA 4UZGA 4F7PB 4WI4A 2VH5L 1MFCL 3U82B 5DD3L 3VXUD 2DBJA 3BKML 3W11D 2PW1A 4E0RB 3C5ZD 2P5EA 4KK9C 2XPGA 4RIRA 4ZYKA 1SJVA 1YJDC 1KJ2A 3B3IA 4HD9A 3T2PA 5CINH 5LCVH 3DX7B 1NAMB 5ID1B 3PGCA 1FZOB 1D9KC 2DRUA 5IFJA 4W4OA 4QOKD 4X5XA 3RL2B 4PJCE 2DL2A 2WINA 3L9RB 1ZLVH 4ENED 3QZWB 3BZ4A 4Q6IB 4JFOB 2IG2H 5IBLC 3MBEA 1QLEL 1UWGL 2OCFD 1Y6NR 3OG4B 5GGTL 2F58H 3O2DA 3CCHB 4UV7H 4NN5B 1IAIL 5TGBA 5J06A 1QA9B 2HJKA 2OP4L 3IXTB 4M6MH 3MRKA 12E8H 1S7UB 5KJRH 2R8SH 3OAYH 1P4BH 1DN0A 2E27L 4HIIB 3MBXL 4J3WA 3PWUA 5F9WB 5BZDA 4JZNA 1KN2L 5DA4A 1MRCL 2FSEB 3H7BB 1XCQA 4ACPA 4EQ3A 3HC4H 2OTPA 1T7WA 4IRSD 1GGTA 3C8DA 5MERA 2DMBA 1H3XA 1QYGL 1K6QL 2J6EH 1IQWL 4XNUL 3TH2T 5K9OA 3QSKB 5I1DA 2J4WL 3VFPB 3MNZB 1WFTA 5DMKB 3E0GA 5AZ2L 4JO4H 3I3DA 5FECA 5ESQB 5JHDE 4JQIH 2VNCA 25C8L 3MCG1 3ARYA 5HXMA 4D3CH 4W70A 1JBJA 1JTPA 2RR3A 4RMUA 4YX2H 3KPNB 1ZGLA 5ITFA 1OAUH 4TUJA 1TPXC 3L3DA 1MCNA 3FJTA 1FG2A 1JZ5A 5LGHL 5DJCA 3W0WA 1JPTH 1X5KA 3CXDL 1A9BB 3QIUD 1F02I 4EUPG 3BMWA 2R4SH 1EMTH 2AK4A 2GCYB 4M5YL 4ZO8A 4UOW1 4EBQH 3BWAA 3HPLA 3T8XB 5HYQB 4PY7B 2LU4A 5IFHL 1S7VA 3VXMB 4HS3A 2KZWA 1R6VA 1U8IB 5FHBL 5GZOD 1FL5A 3BH8A 5AAWA 1P1ZA 2NTFA 3MUHL 1JZ8A 4FQCL 5DFTA 2R0LL 4O4YL 4YDKL 5DURD 4GW1A 5EU6D 5FO7A 4R0LB 3GI8H 4ZTPL 3W5MA 3IDUA 1ZHKB 5KVFH 2YRZA 2NPLX 4NZJA 4XNQA 3BIKA 5KSBB 2RB8A 2IF7A 1RJZA 1L7IL 3SGEI 5HJ3B 1A47A 5I8CA 3LPWA 1MFEL 2Z91A 5JLZA 3V0VB 4Q58C 4JM2B 3MLSH 2F15A 1L6XA 3E6FB 5HDBE 4F7CB 1NAMH 1LO0H 5HVFB 1BECA 1S9YB 3DRQB 4FQ1L 1BFVH 3NN8B 4Y7MA 4Q97A 4C56B 4DKEL 4Y19D 3ZE1F 1IEAB 5C86A 3OJDB 5KOMC 1WIUA 4MHHG 1AJ7H 4M8VA 1EEQA 3C5ZA 2XACC 2VB5A 3I9GL 5LGKA 3VD9A 4JY5H 3EGSB 5C0BD 4LCUA 3SE8H 3U0WL 4Q74A 2NY3B 4X9GA 5HVHC 1NC4A 4NWUL 1IC5L 1YYLL 3FQWA 4WWKC 4YXLL 5IROC 1YMHA 3G5YA 5D6DC 3BEWA 2VIRA 5DF0A 1A6VH 1MCWW 4OCSL 2W9DH 4LMQI 4QOKA 2YD3A 1LDPH 3EYVA 1D5BB 1NANI 1ZHBB 2ZUUA 5F88A 1KJMA 4C83A 2AKRB 3D9AH 3DI3B 1ZA3B 4HFUH 2X4PA 1UKTA 2OZ4A 1ZVYA 3BVNA 5J9PA 3T0XA 3GMLA 3O3BA 1XF4B 2JB6B 3ZSSA 3WFDL 1TFHA 2LVEA 2HH0L 3CXHJ 4HXBL 3MV8E 5DMIH 4RMWA 1KG0B 4U4BA 4NT6A 2FJFB 5ADPL 1CF8L 4M3JA 3ARBC 5I1EL 1QSEE 4EI6B 2XTJE 4P5MA 2DLGA 5C09E 4DEPC 3O6FC 1I7UA 2ADJA 4N9GB 5I16B 2HTKC 3TN0C 3FT4B 3OX8B 4LCYB 2R9HC 32C2B 3S96B 4K9EC 4L3ED 1JYNA 4DGVH 1DQDL 3F7VB 5H94B 4ZUSA 1AXTL 4IRSA 5EOQH 5GRVL 2DQIL 2CJUH 4LSTH 4S1DD 4Z7WA 1NCDL 1JZ6A 1ADQL 3I75B 3C08H 4HXAH 1KCKA 3THMH 1M6OB 1W0VA 1QPPA 1KCRH 1NBVL 4HIEB 1U8QB 1JV5B 3NGBB 5J4MA 2IH3B 4TVPD 5GISH 4R7DB 3S36X 4IJ3C 3GBNL 4U7MA 4LLDA 4PRIB 1EH9A 4Z7QE 4POZD 4JFEB 4X7TB 3GHEH 4PLKD 3Q5TA 3EO0B 5HDQH 4PRHD 5CIPB 4BSVB 4AIZA 4WW2A 2LU7A 2C1PA 4XPGL 4X99A 5CILL 5EZOL 3L6FB 3N1PC 1ZHLA 1L6ZA 3PF2A 5L2KE 4J4PC 3QIUA 4X9FA 1XGRA 1UVQA 4FFYL 1RJLB 4KMQA 5C0AB 4LHUD 3WJJA 43C9B 4KZDL 1EX0A 4GBXB 1GAFH 3U4AA 5C2BH 2VSCA 1XT5A 2EDLA 2JIXB 4C57C 3UTPE 1G1YA 3D1MC 1MHEB 2EYRA 1FZMB 2CUMA 1P5VA 2MQ3A 2XZQL 4WTZG 1KLUB 3G5VA 3RZCB 5FUZH 5D7JD 3BKJH 5A2KH 3IXAA 1SY6L 3VXRD 5TF1L 1DVFB 4XPTH 1UACL 3H42H 3ES6A 1C1EL 3BHBB 3UAJD 4B0MM 4FP8H 2PNDA 5EU6A 2KL6A 1FSKB 1RZFH 1D5XA 2Q87A 1J8HD 5F3BB 4FOMA 3T3PE 2IPKA 3A6BL 3OKKB 3FHQA 5I2IB 4IRJD 4V2BA 2VXVH 1IGCH 3BT2L 3VD7A 2VDMH 1NCAH 4JPVL 2FL5A 2Y7QB 3PDOB 4U05A 2R23B 3O6LH 2H2SD 3SPVA 3EZ8A 2Z31D 3HNSL 2IBBA 4Y19A 4D2NA 1F11B 4KVNH 3AY4C 5CP3A 1FJ1B 2CKBA 5EZIL 5IWLA 4K71C 3SGKA 3MYJB 5EO0A 4JDZB 4GG6A 3QWRA 5FYLE 4EVNB 1QFWH 2XN9A 3P4OA 2VAAB 3TYGL 1MHHB 4PJFB 1KGCE 3E2HB 5GS2H 1MJ7H 1KT2B 3DX6B 2ZUTA 1MY5A 3JV4A 3PWNA 2HLFD 1T6WA 3GI9H 5FKPA 5IB3A 3EYQC 1A7BA 3TZVB 1VPOL 5F7DB 3U4EB 3RL1B 1AR1C 4OLUL 3ETBF 2K3TA 4FA8A 3OKNB 5IFAH 4ELKA 2IMNA 3MCKA 4P0DA 3WO4C 3VXPA 1WTLA 2E8YA 4EDXB 4K55A 2NY2C 5GRYA 4GRLB 3U1SL 1EDQA 1FDLL 1BFTA 3EJYD 5K9QI 1QSED 4TSAL 4OZGF 4M02A 5CJXC 2E7MA 2UYLB 4YHIB 4ZS6C 3LZFH 2IFGA 4L3EA 4ZAKD 3U4BH 4Z76B 4WDIB 2G75B 3BW9A 3DROA 5B3NA 4IDLA 3RUGB 5DFVC 5C07E 3VFVB 1VGKA 3C5SB 1ULVA 5CIPH 2YOCA 5C6WH 1E0OB 3NCJH 1KB5A 3GK8L 1CFSB 1QBAA 3K2UL 4HKJA 1I3GL 3BXNB 1P6FA 5CUSL 2YK1L 3L5XH 4GOSA 1G7HB 4JY4B 3L7EA 4YJZL 4MJIE 1CR9L 4U33A 4NKQB 4JLRB 4BZ1L 1UJ3B 4PRHA 3SBWC 3TVMB 4MMXC 1MCOL 1YNLH 4OFYD 4NHCH 4BSJA 3TJHC 1WWBX 4NCC1 1INEL 2H8PA 4WFGD 4HUNB 4X6CB 1CFTA 5C0NC 4F58L 4OZFB 4AL8L 4NC0B 4XPFL 4JDVB 5JNYB 5J6GA 3TBYB 1QBMH 5T3ZE 5ALBL 1YMME 2XTLA 4ELMA 3TEUA 5JIPA 1CXEA 4ZUTB 1NAKH 4LF3A 1JRHI 1BQLH 1MLCB 1JHKL 5IP4A 2JJTA 5D7JA 1R3LA 3CX2A 3VXRA 5CD3A 3ARGA 5EZJA 4N0CD 2G2RA 4EJ1C 3KHOA 3TA3D 2X5PA 2ICWJ 3NH7L 2KQMA 1MREL 1IC4H 3OR6A 3ULUE 1A6PA 2VXTH 5AG9A 4DZBA 1YC8A 1DANU 4K7PX 1I7RA 1J8HA 3B2UD 3FQTA 3RWJB 4HC1L 5ADOL 3A0OA 1FBIL 4WRLA 1FNSH 3RQ3A 3QZWG 2Y07H 2OJEB 1G7JB 1A02N 2IAMA 4JRYE 4PV8B 1UM5L 4Z77B 2C4XA 4H20H 2EDYA 1F58H 4X6FA 1SVZA 5CHNB 4AEFA 1AHWA 1H3UA 5D7LD 4U2YA 3LPGA 3IJHB 3E8UH 3CFCH 3WYRA 1TVHA 3MV7E 4FZEH 1AD0B 3GMPA 4KROD 5FGBA 1OTUC 1KC5H 2WIIA 5CJ8A 2KQNA 2WUCH 1T0NA 2PYFA 1S9WA 1FYTE 4FG6C 4TVSa 1HKLH 1MJ8H 3RTQB 5T3XL 3MRDB 1RZ7H 1C08A 1NMBL 3P2TA 5C0FA 4U7SA 1V7MH 4WEUD 2ZUVA 1T04A 3MLVL 4JFXB 4MD0A 4NO3A 3AB0C 3BH9A 1MJUL 5FHAH 3CNKA 4WUUD 1N8ZA 3TJEH 4R4ND 1AD9B 1RZJL 1NC2B 4P5TA 1QKZL 15C8L 2CO6B 5KVDH 5IB1B 3PHOA 4WJ5A 3FT3B 4K3DH 1MH5B 1Z9OA 5C0DB 3QNZA 5E70A 1J0HA 5JW5B 1GHFH 3ARFC 5C0GA 3O9WC 3VFUB 1FGVL 4KK8C 4U6HB 4WV1A 4LQFL 4PUBH 5E2UL 4I3RH 2VE6A 1ZSDB 3P4MB 3QG7H 4AG4H 1JWMA 1AGEB 4QRSB 2NX5A 5E5RB 1FZJA 3HMXA 4PJGE 1X5GA 2A73A 5F8QC 3RX8A 1B2WH 1C5BL 3OXSA 1QFOA 3KPMA 2VL5B 5TE6H 4XCFL 4XTRC 2EKSA 2GYSA 1DQLL 3AFLA 2A38A 4KK5C 5I0ZA 3HC0B 1EUUA 4NHUB 4AQ1B 1VFBA 5HI3D 1HQRB 2CQVA 2E9WA 3BKYH 3EYFB 3QFDA 4ZAKA 3RWCB 4B50A 4Y4HC 3GMQB 2ZCHH 4OFDA 4GW5B 4MAUL 2WBJA 1I85A 4Z7UA 3HC3L 4YHOH 3JVGC 5C07D 4P57B 5KS9F 5MENB 1IGJA 4WW1A 4G9DB 3MRBA 4JO1H 4OCRH 2VXSL 3KPTA 4HAGA 5KSBF 2IBGA 1U8KB 1FVEA 1MFCH 3SDDB 1EJOH 4OZFH 1FV1B 5DJYB 4RMTA 4DFHA 4ISVB 2AJUL 1UB5B 3TFKC 1K5NB 1CDBA 4MJID 1SMOA 4HJGB 2BSSA 4OFYA 2D9CA 4OB5H 4LPXA 3WLBB 2MCPH 5D96B 4PB0H 4L8SB 3ARDD 3KPOB 4NP4L 4KWUA 1OAYH 4NO5A 1OAZL 2BMKB 4MNQB 3ZE0E 1U8LB 4X4ME 5KTEH 3VH8B 2YMXL 4M93B 3P0VL 3ARVA 4UAOB 3UZQA 5FDYA 4IDJL 4YEFA 1NJ9B 1QLEH 5C0CD 4XVJL 1NFKA 3L95A 5CS7A 3PQYE 2BVQB 4U1SA 5ISZD 5BZWA 2DQGL 4OF5A 3SKOB 2LTQB 4R7NA 1UM4L 2ATPA 1Q1JL 1JNNH 5ICZB 1K8DB 2DWEB 1T66C 3WHXA 4ONOA 3QUXD 4MDJA 1LO4L 5FYJE 2F74A 5DVNA 1JGUL 1MRCH 4HQQL 2NW2A 3D85D 2A6JA 1BAFH 3QRGL 4EI5D 2GFBB 4E5XA 3W9DA 1WV7T 4OLEA 3RWIB 3A6CH 1RUMH 3IS1X 1NGPH 1KCSH 3RZWA 1K6QH 3EFDL 2ZCLL 4GMSL 4OTXL 4C58B 1PX3A 4JO3H 4NKMA 2YZ1A 3FRPA 3GSOB 4MWFA 5DEGA 3HPJB 5GRUH 1EK3A 4ZUUA 5C6TL 4A6YB 1IGTB 5IJVA 3R06B 4KKAC 3MRHB 1AP2B 3FN9A 1YECH 3KVQA 1K4DB 1LEIB 1FYTD 3H3BC 3CH1B 3VU2A 4UT6L 1DSFL 4H0IA 2KZ1B 4JY6A 2EE2A 3WNOA 4HZLA 4G3YL 4D9QD 4WUUA 1FFNB 5E8DL 3MJ6A 3RWDB 1JZ7A 4O5LH 3QDJB 1A6WH 4YWGH 3EOTH 5CLWA 5LGJA 2XKNA 3W81A 3LEXA 2FEEL 3QFJD 2NY5H 4M5YH 5GGSB 1OB1A 2LAAA 1Z0MA 2A6KA 4UU9B 5IFHH 4HDIB 1NUDA 2CLZA 1HCVA 3S37L 4X4XA 1X44A 2XWJB 4G9FE 1BGXL 4FHBD 1LEGB 2Z8SA 5EN2A 3D18B 4FQCH 3H9SD 1A7QL 1QO3A 4TNWK 4X0KB 1C5CH 3ABZA 5GS3A 4N90D 3RNKB 1S9VA 5BS0B 1F6FB 1Q72L 5TE7L 4EKXA 2EYTB 4ZTPH 1FC1A 4XBEL 3V4UH 5D4QA 4DGIH 1LE9A 3DXAB 5C0IA 4MSWB 1SEQH 2R2HA 1QSZA 5K9JL 4LARL 2VDNL 3CSGA 3WKML 3WFCH 4M4PA 5C08D 1T5WA 3DYMA 5IW6B 5KSAA 5HHMB 3JWNC 4FQ1H 1IZJA 2AAVA 4L4TA 4O02H 3SJVB 2E9JA 1B90A 3NFPB 1JMXA 1CD9B 1KTRL 3ALWA 4RFEB 2I9LB 4RGND 3BO8A 3FOLA 3B6SA 5IBTL 3U0WH 1DEEA 1NFDA 1ZK9A 1TQBB 3PL6B 5I0DA 5FGRA 3ARDA 1YYLH 1OTSD 1G0YR 1JI1A 1E4KA 5JQHC 3CJJA 4BFIB 1TCMA 2Y36L 4OM0L 1BIIB 1Q94A 1A7PL 4OZIB 1OLLA 1IGYB 3EYSL 1XIWD 4L4VB 8FABA 4J3VA 4HKXB 4LK4A 4OD2B 3BGFC 1DUZA 5EO9A 4R0LC 1UWXK 4PJFF 2G5RA 5MP6H 4QRRD 1NCUA 5D5MA 4MAYB 5C0CA 2FH8A 3GMNB 1P4LA 2W0FA 4OD3L 5IT2H 4Z5RA 3VFGH 1ZS8B 1W0WA 3LH2L 4X7SL 1MCEA 5E7BA 5ISZA 1XFPA 4DN4H 3D2UB 4GKSB 4D9LH 4BZYA 3G08B 4O2CB 4XBGA 1AGFA 4Y1AB 2B39A 4OQTL 4QWWD 1FRGL 4Y8AA 3RWGB 5F7KC 3V5DB 4A6YH 1W8NA 4RISL 2Z9TA 4LAQH 1PY4A 1WIOA 3D85A 5FKAA 5HGHB 1CVRA 1WLHA 4KQ3L 3HI6L 2YUVA 1AXTH 1PSKH 4JPKH 5A43C 2VDPL 5D2NB 3UMTA 4NKDB 1UFUA 3U46B 1YA5A 3KYNB 3NZHL 1ADQH 1REIA 3HI1A 2NY3C 1YN7B 5INCA 1X5XA 1IGML 2QEJA 5EU4A 2HJLA 3PIQB 4UT7H 2VR5A 1XEDA 3J8F7 4NKOB 1PEWA 4QHKI 4LGRB 5B39A 3RKPA 3ORJA 4CW1A 2H26A 2LQRA 2VLRA 3V5HA 3DV4B 2WUBL 5FK9B 3RUGF 2UVEA 1JE6A 2IFFH 5E8NA 5MHSD 2ZUWA 4POUB 4ZD3L 4U6XB 1B0RB 4TRPL 1RZGB 4XPGH 4K3JH 4XX1G 1I8MA 1KIRB 1J88A 5CILH 3QXDA 1S7TA 5EZOH 5ELIA 1X5HA 4P23D 4LSUL 4KQ4L 5IHZA 3LD8B 4FFYH 2FZ3B 3VXUB 4PLJD 2ICES 4K7PY 4Q2ZA 2BFVH 4XI5D 3QFJA 5HI5D 2BRRL 4UUJA 1U95B 1R3HA 3TYFB 2N4IA 2Y72A 1EHLL 4PJAE 3HZMA 3NIDE 4LEXL 4OGXL 5IV2A 1IJ9A 1DQJA 4R96B 3T1FA 3Q5YA 1I3VA 3MACL 4QCIA 5A1AA 1L4IA 3H9SA 3O6KH 4D9RD 3IAQA 4L8CB 4F37K 4JVUA 4OZFG 4UMGA 1I3RA 1J0KA 2Y9RT 3GSNB 3LKNA 4MMZC 2J12B 4FABH 2A9NH 1WBXA 3ARUA 1YEDB 5LAXB 4GRMB 5EULV 5ETUA 4DN3H 1MJJB 2NY0D 5GJSH 4C55A 4N5EC 4ODHL 3BT2H 1HYSD 2EICA 1UQSA 2Z35A 3VMNA 3OZ9L 2YBRA 1C12B 3VRJB 3VGBA 1KELL 1AE6H 3MFFA 2F53D 2AXGB 2NNAB 1I9IL 1KXVC 1QEWB 1T1ZA 3DTXA 1E27B 5EZIH 4CAGA 5FYLL 2ICEB 4GBXC 3MCLL 4PJHA 3MRLB 2VDOL 3VRIB 1DZBA 3RX5A 4DAGH 4Q9QH 2A9MH 3EO1B 3TYGH 4MB3A 5GS0L 4MS8C 4KPHH 5IEKA 4U1LB 1H3VA 3GZKA 3TV3L 1W72A 4AH2A 4F7TB 2JK5A 4Z7WE 1WAAF 4KUZL 4OZHB 3NCYS 4FTVA 5IJKC 4Y88A 1DVFC 4ZFFB 1HHKA 5HDOA 4I0PB 1Z9MA 3CLEL 3QNYA 4MZ3A 5KG9A 3UTTA 1K2DA 4QNPF 3C09B 3DGCR 2FRGP 5J1AA 4N0YL 4KJYA 3AU1B 3KYMB 4OLUH 1KEGL 4QRRA 4HUKB 4I18B 5JXED 1OQXA 3WLWC 2EO1A 4HK0A 3QUZD 4YQXH 1XGYH 2Z0BA 1GL4B 3P30L 1Q9WB 3QEGH 2HAZA 1JYXA 4HJ0D 4PV9B 3QDME 4JZOA 4P46C 4ZFZA 3LKOB 4UI2A 1Q9OB 1N64L 3GRWA 1UM6H 4FQXB 3SCMB 4TSAH 1LK3H 1F3JB 1P9MC 2EDEA 2NR6D 3RA7L 2HP4A 3MRMA 3OKOB 3QHZH 1CFNA 5D1XD 2CK0H 4X6BA 3KYKL 1HOCB 4L4JA 4UB0L 5FUOH 5DD0H 2ED8A 1XF2B 2R2CA 1G9NC 5GS0C 3MRGB 2VLKE 1QUNA 2EDXA 2RCSL 1E6OL 1QFPA 5DT1L 1F4XH 1H3PH 4XXCA 4LSSH 1CL7I 3E2HC 5F7LB 3H9HA 4F2MB 2JJVA 1LWRA 1C16A 2DTSA 1WWAX 4MA3B 3M1BA 3NABH 3WXVL 5D7IF 4KRPB 1A0QH 4WEBL 1XGQB 3B2VL 3DIFB 3BGMA 4PJIB 4OLZL 3S97C 4YBLB 2DM2A 3KJ4B 4LCCA 1CR9H 5DO2D 2CDGB 3X13B 3TCLB 5F71A 1XGTB 4Z0BH 3FTGA 4QT5B 2VXUH 5EUOB 5I8EA 1INEH 1YN6B 4APQC 4GRLC 4AL8H 1PG7H 1TZHB 4XPFH 4DOHE 5ACMA 1I8KB 3U7AA 1G6VK 4OIIL 5T3ZL 5F9JB 4PJ9B 5HYEA 5C0BB 4NQEE 3GSNH 3KYOB 1A21A 2CGRL 1YDPA 2LE9A 4LLUB