5LXGL

Revised crystal structure of the human adiponectin receptor 1 in an open conformation
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNFLAWYQQKQGKSPQVLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQQFWSTPYTFGGGTKLEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Adiponectin receptor protein 1
publication title Structural insights into adiponectin receptors suggest ceramidase activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lxgL00
1LVEA 1A1OA 3T4YB 3MCLH 4NHUA 3UC0H 4NCC1 1JGUH 1MQ8A 1MFCL 3L5XL 5AAMA 3BD5A 3PQYD 1F6LL 5I8EA 1QLFB 2RR3A 1AGDB 3GMRB 4QLRA 1CLCA 4GXUN 3RHWK 4TVPL 1QA9A 1OSPL 4HV8B 4ZODA 5T1DL 3CDGA 5BQ7B 4EJ1C 4OI7A 1HYSD 1CFVH 3CDFA 3E8UH 2NY3B 3ROOA 3S5LB 2VXVL 3IDYC 4APQA 2J8UE 2BJMH 5C0CE 1DFBH 1RZKC 2F5AH 3TPUB 1CWVA 2DQUH 4LFHD 2IBZY 1G7LA 3C8DA 5GRWA 3WHXA 4IRJD 1F4AA 3QUZD 1JYXA 3PE9A 4E42A 5E5MB 1UWEH 5CCKL 5IB2A 3CMGA 4QRTB 3SO3C 1GYAA 4GRLB 4GRWB 3HHRB 3LKQA 4ELKA 2C4XA 4HS6B 1YNTB 2C7UA 4MNGB 1LO0L 1UXWB 4JM2A 4NDMA 3TJEL 1RAMA 3O6KL 4RWHA 5T3XH 5BZDB 4LOUC 3BDYL 2ZPKH 2ICWI 4U6TA 5C6PB 3MRMB 3ES6B 4NZTL 3V0VB 4IBLT 3MPCA 4J23A 4U05A 3U0TA 4PRBA 1LEKB 4OSUL 2GT9B 1ZA3B 3HNSH 2ZP0T 5FGCE 4KGJA 3V5HA 3KXFE 4QTIL 1XGTB 4R6UA 2FSEA 3Q6FB 3TT3H 3AMKA 5D1QA 1K4CB 2UZXB 3DX6A 2IANA 4PJEB 5GZOD 4Z7VF 5TF0A 3SE8L 2ICES 5I17A 4MAYB 4HAFA 4GXVH 3VFWA 1JGDA 1AC0A 3B43A 3B2UC 1JPTL 1BQHG 3JV4B 3KPRB 3C60D 5KSBE 2HKFH 4XP4H 2EH7H 4PRHA 3QG6A 3Q3GA 5HHQA 4JN1L 1DUYA 5FF6A 2A38A 3AB0B 3BPOB 3GHBH 3QDGD 3GMNB 1CLYL 1J0ZA 3UJIH 4JQXA 3A6BL 4RFEA 3SGDI 5TE7H 4M5YL 5TQ0L 1PSKH 4TQEL 2J6EA 1UA6H 1XCQA 3V52L 5SWZA 5D7LA 4HHAA 4CVXA 4WJ5B 3VD9A 3GSNA 3OF6D 1S7XA 4NFBA 2FJGB 4ISVB 1DANT 1YEIL 4OGXL 3JTSA 4F57L 1M6OB 3WE6B 5JOEA 3WIIH 1M7XA 3A6CL 2ITDA 1E4XL 4LIQE 4WUUA 1U8LB 3SGJA 4IHOB 2QADC 3NPSC 1Q9LB 1PBYA 3VCLA 1KTRL 2DQIL 4L5FH 4UV7L 3TNMA 4Y7MA 1S8DB 1V8HA 4NO2B 2MHAB 5CIPB 3QZWB 4OIIL 2GK2A 3JWOH 2HH0L 3MGTA 4YEEA 4MQSB 2XWTA 1MHEA 2XN9B 4OD2A 5HD8D 1E28B 1RJZA 1TJGL 5GJTH 4P3DB 3C6SA 3TBWB 1UKSA 5HVHC 2WP3O 4NKIH 3W5MA 3LY6A 4XBGA 5IG7A 1FJ1A 4XWOC 3L95A 1ZA6A 1FC2D 4F9PC 4U1HB 5JTWA 2E9WA 3WLBB 2DS4A 4P5KA 1AI1H 4H25A 3RWGB 1G7IB 5JA8B 4BH7B 4TUJB 3T09A 3WJJA 4OJFL 1QVOA 1DLFL 5F88B 4IEFB 1MQKH 1NKOA 1CN4A 1KXVC 2HLFD 1MRDH 2RHEA 3RL1B 4YEFA 1EVUA 1RJLB 1CLOL 3HZYA 5L8JB 4JO1H 4MD5A 1HKLL 4OM1L 3TN0B 3WS3A 4FHBD 4ALAH 1HHKA 4HLJA 1UB5B 1T5WB 4PLJD 3UTSE 1LNUA 5GS3A 4ZUSB 4JRYE 1N7ML 5ADOL 1U8HB 3BQUB 4LPWA 1AR1D 4NUJB 5EFIB 3VXMD 3HG1D 4LSRH 4MLSA 2CIKB 3ZKND 1IRAY 1ZV5A 1JL8A 1NFDA 3QNYA 4PJ9C 5HY9B 5E6ID 2M1KA 4NWTL 3I3BA 1F45A 1QSFA 4HSQA 1ZHLA 5DI8B 4P5TC 2HN7B 4DAGL 3O9WB 5CD5C 5I8CB 3NCEB 3VRLF 1IGFH 3F12A 3EBAA 3EYVB 2YXMA 3RIAF 3GIZL 5EOTA 5DD0H 5JDJA 3LRSA 1KB5L 2F53B 5DEGB 5E1AA 4WNQB 1GGUA 4M1DL 2EDXA 4P4KD 5JORA 7FABH 2JJWA 4UILL 3I85A 5I1JH 5F71A 3RNQA 5ITBL 4Y5YB 4YPGB 2EDYA 4Z7VB 3OKKB 5C6TL 2X9YA 4KK5C 1T1YA 3J8F7 5HHOA 1TZHB 2Q8AH 2EIEA 3FFDA 2F54B 1WBYB 4MNGE 4ODXA 5E9DB 3PWNA 4R9HA 1R0AL 5J0BA 5F9AC 5FUOH 4YIQB 3QI9A 1KB5A 2Z93A 1CICC 4UB0H 3RWDA 4LMQE 4N0YL 2N7AA 3VG0H 4Z77B 3JUZA 3QWOA 1VPOH 1LP9A 3WDHA 4I0KA 2IADB 1DBBL 2XRAH 3OV6A 3RWIB 3T8XB 3ZDYE 2ICWB 4W68A 2PXYB 4LNVA 4M3KB 1XR8A 2DQTL 5LXGH 2IJ0C 4HMDA 1YJDC 4PGBB 2IBBA 1U8JA 3OR7A 1CQYA 2VITA 1TTUA 3BD4A 2RCSL 3CU7A 3MBEC 4F7TB 2AXFB 3DV4B 4MS8C 4PJEE 4OV6F 3KLDA 3K1DA 1I9JH 3IU4L 1UWXH 1R5WA 2R8SH 4LCUB 1L7IH 2VJXA 5HVGB 2BP3A 2D03H 2H2SD 4JG1H 1LEIA 1JUFB 5DMIL 5FO7B 5AD0A 4I77H 4OZHA 4XWGL 4QNPE 2IG2L 2IH3A 4KK6C 3RDTA 3UXFA 3ILPA 3RVVC 4OM0H 1ZT4B 4EN3A 4LLVB 5TGBA 3NZHH 2IPUG 3KPRE 5CZVL 2CLVB 4UINL 2BY2A 1HH6A 5CKGA 3VFVB 3NOIA 4NQCB 1OPGL 1BAFH 1MI5B 1SEBB 4XVTH 2FR4A 2VLJD 5FYLL 1QNZL 3LQAC 4JO4H 2F58H 4CW1B 1WBZB 5I18H 5GGSB 3WV0A 3GRWH 3SDAA 4K7FB 3RVUC 1HHGB 1ZHBB 2AKRB 3VFNB 1RZGB 3QP3A 1QBBA 4JPKL 4Q6YA 2GUOB 4F7EB 4NUGH 4LARL 2LVCA 5IMOB 1PVHA 1Z5LA 3KHOA 3CVHL 4Z7NF 4EI6B 4X7TA 5EPMB 4IOIB 2OR9L 3FQUB 3KPSA 5AEAA 4LHJB 4ZPVA 1H3TA 5I76A 5L6YL 5BJTB 3NFNA 2FGZA 4L8SA 1R5IB 3HAEA 4NPYB 1H3VA 1WISA 4QCIA 1ZLUH 3VXOA 3RGVB 2R0ZH 3GMLA 3DXAD 3TCLB 4Y5VC 3CVHA 2V2WB 2P1YA 4PRIA 3TNNB 1B4JH 4H88H 2XN9E 1RU9H 5BVPH 4U2YA 5F3HB 1MJ7L 5D7KE 4MDJB 1WWWX 3L7FA 4I2XB 2GYSA 4O2CA 1ORSA 3PP4L 4L9LC 1YNLL 1T2QL 1N3NA 2YPVH 5LCVL 3GSRB 3X12A 4DZBA 3GB7A 1XZ0B 2P24A 3JBG7 3IAGC 1T21A 2EKJA 3UTZB 2KZWA 2PR4H 1IZJA 2XT1B 1XCTA 3EZ8A 1UXSB 5CEZL 1D5IL 3EO1B 4Y4FC 2X4UA 1Z9OA 5MP6L 2OXHA 1A3RH 3P2TA 4YHKL 4R2GC 3CLEL 5TDPA 5I15H 4G8FA 3BIAX 5JOPD 1ZEAH 1PFCA 2NY1D 5EO1A 1OF2A 2NY5H 5F6IC 5ISZA 1J8HE 3CK0L 1UM5L 1U3HA 1I7UB 4S1SH 1KEMH 3QNZB 3WFHB 5C07A 3EFDH 1Q0XH 1DP0A 4Q2ZA 3NZ8B 4RMUA 5DA0B 1GL4B 2R0LH 1E27A 1N5AB 3HMXH 1XIWB 5GZND 1WEJL 2HTKC 1RZJH 5ESAB 3BZEA 4P9HL 4L3EB 3FTGB 4YDJA 3SDCC 3MR9A 1GZQB 5IT2L 5D1ZC 5E8OB 3HMWH 5GIRB 3D69A 3PHQA 4UUJA 5L2KB 3VXSB 1H8NA 4WEBH 5GRJL 2F53E 2XQYK 3SKOA 2BK8A 4D9RD 5C7XL 5DK2B 2FWOA 4PJCF 1DQDL 1IC1A 1FCCA 2NXZB 1NL0H 5I66B 4WEUD 2QQLH 5I1GH 1H3PH 4CJ0A 3QBTB 1I7RB 5IW1B 4Z7VE 1I7TA 2Y72A 5I1CH 2VL4A 3MCG1 4NO5B 4TNVK 1U36A 3LKSB 1N5YL 3MLVL 4U0RB 2OZ4H 5E9DE 1S5IH 3VRJB 1INDH 1C7TA 4XNMB 4MCYB 5DMGC 4P46B 2W59A 2CPCA 3TBTA 2FX9L 4OZGA 4H26B 2HVKB 1MY7A 5I1DB 1SY6H 5CBAB 5KN5B 1KLUA 2B4CH 4XXCC 3WKMH 1AXTH 3GBMH 3S35L 5FKPB 3HNVH 4JFHD 4RGOL 4KC3B 1MWAH 3VFOB 5BV7C 3NH7H 3HPLA 1IGCH 2O5YH 4NQED 5FB8A 1HI6B 3ZHDA 5A16A 5CP7A 1F11A 1A02N 1T83A 3D0LA 1H3GA 4WO4C 4MA7H 2ZCLH 1FIEA 5D96C 5INCA 1ND0A 1RK1B 3V4PH 12E8H 5FYJE 4DVBB 4FABL 3R0MA 2PYEA 4G42B 2YHGA 5JHDB 2VLLB 4MD0B 3FQXA 1KENH 4Z8FL 1HHJA 2CLRB 3IVKA 2D31B 4KAQL 1YEKL 4X8JA 3EYFA 2NMSA 2JLLA 4I9WE 1ITBB 3L9RB 5FCSH 3KPLA 1INEH 3BE1L 5DC0A 1P7QB 3HE6A 5L7XH 2R2BA 3UYRL 3NABL 2DLGA 3ZKMD 1PG7L 4PUBH 2XKNA 4G43B 3HFML 4KHXH 1KJMA 4C56B 3PWJB 1BGXH 4Q6IC 2X89D 4Z0BL 1N0XH 1K4DB 2BY1A 5GS2D 4NQCE 2JJTA 1MI5E 3MREA 5C3TA 5ID1A 2EKSA 3PGDB 1NGXB 2XWBA 4F7MA 5MERA 3LPGA 5CINL 1TVHB 3VXTB 5BW7C 3EOTL 3QUXD 3LQMA 1MJUH 1FRGL 2HFFA 3SY0B 2BZDA 4Z95H 3W39A 4ZFFA 4QRSA 4X6BA 5SWSA 3MJ8B 3KYNB 4HZLB 4E41B 1P4BL 1FNFA 2AJ3A 2G2RB 4XP1H 5IEKA 1LO3H 4G6JL 4K8RC 5I75B 1TCMA 1JZ3A 5F7EL 1YMMB 4K7PY 3SQOH 3TYFA 2IBZX 1UACH 1XF5B 3JWDC 4PV8B 4WFHE 3AREB 1YQVH 5KVEH 1U6AL 5A40E 1A9BA 3OBAA 4OKDA 4F7CA 1RIHL 2Q8BH 4MSWB 4HS3A 4LPCA 1FZMB 3T1FB 3QDGE 2FRGP 4JZJA 4I3SH 1FNEA 4DKFL 5J8OA 5ACMA 3SE4C 4UOW1 4PRPA 2FECI 1DTUA 1RUKH 2I5YH 2YUVA 5JO5A 2JELH 1QR4A 3B9AA 2L0DA 3L3GB 2EYTB 4I2XE 4KUCD 4XPGL 3DUUB 3TJHC 1CBVH 1RPQA 4IMLB 3BRGC 4N0RA 2ITCB 1HHIB 4PY7A 3VRLE 4L4TA 2PO6B 3ARFA 1QTYT 4L8CA 4LLMB 4KRPB 1G84A 3Q5YA 2VR9A 2OTWB 5DLMH 4LDLB 3HAEG 4PJCB 3CFKB 4UU9A 4GSDL 1JGLL 3ZKXC 2NW2B 2Z8VC 4AEIH 5EO9A 4PBXA 4N90D 1YPZA 3D6GA 4DQOL 4KVNH 2CQVA 4R4NC 3VMOA 2AQ3A 5HI3D 2UZIL 5D93B 1PD6A 1NCUA 2J8OA 3SBWA 1NCWL 5CZKA 3MUHL 3NACH 5B4MC 1CE1L 3EJJX 2DWEB 1OB1B 1FL3B 5DRXA 4Z6AT 3P4OB 5DRWA 3T0VA 1R3KB 3T65B 2DQCL 4ZXBD 3TGXA 4PGDB 2Z31B 3IETA 5FUCE 2P8MB 5DJCB 3QJHB 1OQXA 1KG0A 4L3EE 2ENSA 4OZIF 9CGTA 3I6GB 3L5IA 5IIEB 5L2KE 3VXSE 1BZ9A 4ORZC 4WHTA 1ADQH 2I60L 3BH8B 4YO0A 4EVNA 3QCTH 2JK5B 3L3OB 3O2VH 3LKPA 2EDWA 1IFHL 3VFGH 3E2HC 4DGYH 2WBWB 5IVXA 3HE7B 1DR9A 4NQTA 3K8MA 4JY6B 4JQIL 3KJ6H 4OV5B 3WFDH 3KPTA 1G6VK 4U6YA 4R3SB 4BFIB 3BPNB 4UAOB 4YHNB 1IT9L 2P5EB 3TBVB 5KJRH 4CDGC 3MV8B 5DTFB 2NLJB 5CGTA 1FPTH 4GG8A 4NO0B 3TBYB 5CD3A 3LKNB 4HIXL 4HPYL 1NCAH 1P2CA 3CSGA 4RDQG 4YHMH 4HG4K 4PJAF 4U1IB 2X40A 5HDQL 1CXIA 3H3KA 3C5SA 5GGRY 4HG4J 1H15A 4DEPB 2GTZB 2BNRA 2EO9A 5D6CB 3REWB 4ZDHB 4F58L 2DKMA 1B6UA 3PIQB 4Z7NE 5J89A 1XEDA 2E27H 5JHDE 3RVWD 2OQJA 5IHUH 4Y16C 2G75B 3DOSA 1BP3B 3PDOA 1ZS8B 4MJ6B 4ZAKA 4JY4B 5LBSL 2XY2A 1ZE3C 3VXRB 5BVJA 1SEQH 3VFSA 3E3QE 1U95B 4KMTL 4LBEA 4KJYB 2MQ0A 1U3JA 3D9AL 1EBAA 3K0WA 4U1SB 3MRHB 3MRIA 3BH9B 4HWBL 2CDEA 1BJ8A 5E03A 4G9FA 3O41A 1GHFL 4AH2A 3WBDA 1QFWH 3AC0A 5IWLA 4XHQA 3BHBA 2YD4A 4RQQB 3M17A 4M48L 1FZKB 1SJXA 3PG2A 1R5VA 1RK0A 5DSCA 5CGMA 1GGBL 3GSQB 2Y5TA 4QYOA 4XMLH 1WZ1H 1G7MA 2JB6A 1EO8H 1TCRB 4ERSH 5IUSA 4P23A 3ULVD 4ZUWB 1U9KA 4KKNA 1AD0B 2YD2A 2QSTA 1VFAB 2V6HA 2O26U 2Y7QB 2F9BT 2L7JA 4MXQC 4PG2A 4WGWB 1MJ8L 4IM8A 3B2VL 4O5LH 3RRQA 1WCBA 4HWBA 3QRGH 2K7PA 4OCRL 1C1EL 5I1KH 2EXYD 2VABA 3BP6B 3EO0B 4M1CC 4WW1B 4Z7OF 4I0PC 3MLWH 4E41E 1QQDA 1RUQH 3CXHJ 1A3LH 4ODHL 5DRNB 5EC1A 5IR1A 1RHHA 3KYOA 4JAMB 3TF7C 1N0LA 5EN2B 8CGTA 4EDWH 1HEZA 1YMME 4U7KA 5JW4N 2X1QA 1EAPB 3KPMA 3VXNB 4JY5H 4P57A 3OMZA 4LP5A 4LSVL 3EKCA 5F1IB 1E4WH 3QISA 1JFQL 2WBKA 5ILTH 2WUBH 4XPBL 2IFFL 4LEXH 4FQQB 3C8HA 1DLHB 3EYOB 4JKPH 1WWBX 1UADC 4XNQB 1JHLH 5TF1L 4YBQC 5I1LA 3DVGB 3G5ZB 1FNLA 4M43L 3V0WH 2EH8H 1AHWB 2J8UA 5C0CA 3F6IA 5J9PB 3FB8A 4KDVA 3BVNB 4ONOA 2A83A 4CADB 4RFNB 4X9GA 4Y4HC 4OZIB 5J11B 2F15A 3VJ6B 1MRFH 3ULUH 4HPOL 4K7PH 4FQXA 4HWUA 2Q1EA 2EDNA 2YD5A 4JO2H 4PJCE 4TSCH 4YNYB 4M93B 2Z8SA 4JRXD 3BP7B 1JRHL 2V7NB 3DNKA 1A7NH 1IQDB 4JJ5B 4XRCA 2X4QB 5E99L 1AGCA 1DVFC 1M7DB 5DRZA 1YN7A 4O2FA 4XCFH 2NY2C 2NNAB 3UDWC 1TNNA 1LO2H 2H9GA 2JJUA 3RFZC 1K6QL 3DTXB 4QGTA 3SJVD 1IC7H 1P1ZA 4M03A 4QRUA 4WWKC 2MTPA 1D5ZB 4ZO7A 5K33A 2FX8H 1T4KA 3FCTA 2CUHA 3GKWH 4KK8C 5FGBA 4PB9H 1FN4A 1DE4A 3OHXA 2YA2A 3O45A 4BZ1H 1Q9KB 3MRKA 4KROD 1S7RB 2EDDA 4KDTC 2ZG3A 3KPOB 4LHUD 4ZYKB 5HBBA 4JFDD 4PJ5B 5JPNA 2I24N 4PJAB 2VE6A 3I50H 1G6RL 4YX2L 5GS0C 5E56A 1FSKC 2V2XA 3BEWA 3WNKA 3QULA 5F89A 1DEEB 2A77H 3TO4A 1MEXL 5JOPE 4LVNC 5CJQH 5J6GA 3EO9L 5DD3L 2VLKB 5C09B 3VDAA 2R56H 4JFYB 4OLEA 1OM3H 1U8IB 5K9JH 3SGJC 3FB5A 2HT3C 3MGOB 2VC2H 5D2NA 3X11B 5ENWA 1YY8A 1OAKH 2DLFH 1OGTB 3QO0B 3U30B 1JHKL 5KSBA 1G6RA 1G7PA 3D18A 2VH5H 2P5EE 3BXNA 4S1QL 5F7DB 3MV8E 3CUPA 3O11B 3FFCB 3X3GH 3K2UH 4J12A 4UTAH 3OKEB 3NGBB 4YUEL 4LIQL 1A6ZB 1BM3H 4FZEH 3S37L 3QUYB 4D9RE 1KB9J 1KCUL 4NZUL 2BXYA 1U8NB 4TULL 4AQOA 3FN3A 3C6LC 5DFVD 1KTLB 3L5WB 4D0DA 3FKUS 5DVNA 1M1SA 4TVPH 1M71A 3WYRA 2EEBA 3I3DA 1LHZA 2SEBA 1OSPH 4WI2A 1H5BC 3G08B 4YC2C 2NR6D 1VERA 3VXRE 4X5LA 3C5ZD 4NN7C 3BDXA 5GSVA 2Z9TA 5BXFB 2MOVA 1TMCB 3O2WL 2VXVH 5FDWA 3LB6D 3ARDA 4PJ8D 4NRZA 1OTUC 4S11A 1CDGA 4R96B 4IS6A 2VUOA 5TE6L 4GXUM 2JIXA 5K9OB 4KI5D 1A2YA 4AENB 3KR3L 2APBA 3EOAB 3NCBB 1ZKAA 3IAQA 3BT2L 4QRQA 1S9WB 2G60L 3AY4C 2XQYG 5CCKH 2R4SL 1NCCL 3RWHA 4JFOA 4UT7H 1BLNB 1A7BA 1NMBL 4B0MM 4DCQA 4QRPD 1MCBA 5T1MA 3NMEA 3MZTA 4EI5B 3GK8L 4GW5B 1I8LA 5EUKA 3QFJD 3T4YA 2DQDL 3BDYH 4LRIA 3ROLB 1MCOH 2FH8A 4Z7QF 5FGRA 4OSUH 1QLFA 1YYLH 1AGDA 5JW4Q 3RTQC 4QY8B 5JR1L 4CL7A 4PJGF 3HUJF 4HV8A 1EEUA 3QI9C 4KQ3H 5J12C 2HJLB 2XXMB 4JRYA 1RZFH 1ZLVK 1OWRM 3EHBD 4IRJC 1H3WM 1OTSD 3QUZC 2P42B 5BQ7A 2NX5D 1WVZA 3THML 3ALXA 1MIMH 4HIJB 3S5LA 2Q6WB 3H7BA 3PV7A 5F1KC 3WD5L 2C26A 4QKXB 3TPUA 3QUML 3HI6L 1TQCB 3VFPB 2ICWJ 3T2NL 4XX1E 3SE8H 4OZIE 3AM8C 5F7WC 4ZUUB 2OBGA 1G9MH 3MRDA 4JHZA 1A21A 5E5MA 4HWZA 3S36H 4QRTA 1T7ZA 2OCFD 1BFOB 3DROA 4WY7H 4GRLA 2YOCA 2YN3A 3TP4A 3MLPA 4HS6A 4OF8A 5EZOL 4M7LL 4F9LA 4JN1H 1YNTA 4RAUB 4MNGA 1EZVY 3C08L 4RMSA 3H42L 2XZAL 4EN3C 3BKCL 2AJUH 5BZDA 1CLYH 3MJ6A 1CFSB 5HHMD 3MRMA 4AIOA 3ES6A 3V0VA 1N59B 1BMGA 3RPKA 4FA8A 4Y2DD 4F33B 1LEKA 2GT9A 5F44A 4HX1B 1ZA3A 4RGND 4TQEH 4XBEL 1WK0A 3LVEA 2VDOL 2WSKA 3RY5A 1YUHB 3IDXL 4ZQKB 4GAJL 2EYSB 1XGTA 4PJ5E 3Q6FA 4PJAE 1K2DB 3JV5A 1YEIH 2VL5B 3ARUA 1A14L 4OGXH 2Q7YB 5JQHC 1QRND 2XTJD 3BZFB 1K4CA 3RKPA 2EXWD 1E4XH 1WFTA 3C60C 1AD9B 5DK3A 2DQIH 2E7LA 4PJEA 5HDOA 1NMAL 3MRBB 3MNVB 1CR9H 1U58B 4MAYA 2VLKE 1IGIL 5C09E 3SJVB 2HH0H 4XP5L 2UWEF 3ESUF 3S88H 3I9GH 4U6VH 1TJGH 3PWLB 3JV4A 4NRYB 1QBML 1OD9A 1ED3B 2M26A 3KPRA 5F7MC 3UTTD 4KROB 3TH3T 4XAWH 4GAGL 1FGNL 1INQB 4LHUB 2ZG1A 3HR5B 5MENB 3FFCE 1BX2B 1ZK9A 3HRPA 7CGTA 1TLKA 4LDEB 2DBJA 2E9BA 4K7PX 5DMKB 3GMNA 5HDLA 5DURD 5D4QA 1Z6JT 1LGVA 4NWUL 4OJFH 2FBOJ 2G9HA 3RIAK 2IBGA 2BSTB 1GPOL 3QEHB 3Q6GL 5GJSL 5F1OB 1VACB 5FKAB 1NKRA 4KH2A 3WJLA 2DYPA 4OM1H 4WJ5A 4J4PD 2FJGA 4ISVA 4Z7OE 2QQQA 2WBJD 4DGVL 1NFKA 1IZKA 5HD8C 3BYTA 1M6OA 3WE6A 5CJBA 1KCRL 1N7MH 5DVMA 3R8BB 3FQTA 3G6DL 3QA3B 1U8LA 1VADB 2VKWA 4IHOA 1N64H 1Q9LA 4Y8DC 1J0IA 2ARJQ 4NSKB 1MWAB 1I3UA 4IIQC 2AW2A 3BP4B 4KXZI 1S8DA 1CTOA 2MHAA 2ICEA 3IJSB 3QZWA 4PJGB 3HUJB 3FN0H 4PYHA 3RZCB 1K8DB 1KF9B 2XN9A 3QEUB 5EBMB 4P3DA 3TBWA 1KB5H 4V1DD 1ORQB 4N5EC 4ONGL 5BOPA 1KC5L 4PYGA 1EMTH 4TSAL 4JQVC 2HLFC 1MHPH 4U1HA 5KVGL 3WLBA 4XMKH 5D70L 1QRKA 1FYTD 1VSCA 5C6TH 3VDCA 5B8CB 4PLJC 3RWGA 1AGFB 1G7IA 4BH7A 1JPFB 1Q9WB 4TUJA 4LLDA 2WW8A 5AZ2L 2ZUYA 5F88A 1R0AH 1AR1C 5AWNL 2Q20A 3ZKNC 4KRMB 3BX7C 1X3DA 1RJLA 5E6IC 3WKNA 4KQ4L 1RMFL 3TN0A 4PJ8B 3S4SB 4FXKB 4C59B 1UB5A 1T5WA 2AXJA 4OIAA 4ZUSA 3K81A 1DBBH 5HPMB 3TYGL 1URLA 1U8HA 1U91B 3BQUA 4NUJA 3OXRB 2YRPA 1W0WB 2DQTH 1UH3A 2CIKA 3FQNB 4P4KC 1A1MA 1MFAL 5HY9A 3DX8B 4EOWL 3WDIA 1JPST 1LK2B 2P46B 4O58L 3N1MC 5DI8A 4JKWA 2HN7A 2RCSH 3O9WA 5I8CA 3EYVA 1HZHL 3CSPA 1IQWL 2ZUTA 2PUQT 5B22A 2F53A 3OB8A 5DEGA 2MSPA 3QFJB 4WNQA 3QAZC 1OTTD 3ZE1E 3GNML 5ABDE 3ESVF 4XWGH 2HG5B 3N1GC 1CCZA 2IG2H 4U7MA 3FRUB 4B41A 3NIFF 2IMMA 4Y5YA 4YPGA 3NCJL 2QL1A 5DJXB 4Z7VA 5E8DH 3OKKA 5CZVH 4UINH 3V6OC 4KJWC 1FBIL 4PD4K 1TZHA 1OPGH 2F54A 2UWEB 1WBYA 5E9DA 4F8TA 5C1MB 1QNZH 1JF1B 1HQ4B 3S5LG 4NFDA 4U1KB 4LKXB 1FL6B 4K23L 4K3JH 5I74C 3MRLB 3WIFB 1KN4H 2ARJB 4POZC 2D7QA 4LARH 2IADA 2BY0A 4NZRH 3RWIA 3T8XA 1Q0YL 3RVXD 3V5KB 2ICWA 4NIKB 1J0KA 2OR9H 2PXYA 1HKFA 4PJHF 2IQ9H 3OB0H 3KDMB 4XHJD 1OSZB 4PREB 4M7ZC 4PGBA 4XPAL 3DHJA 5L6YH 3S3PA 1MCJA 3SCMB 2FD6H 3RWEA 4GS7B 4BSWB 1GVIA 2AXFA 2X4RA 3DV4A 4F7TA 4D94A 3L1OL 4IJ3C 3W0WD 2VDLL 4LCUA 5IQ7L 1P84K 3SJVE 3LEYH 4KV5F 1JUFA 5FO7A 5HYJB 2ADGB 3WFZA 1MJ7H 3BSZH 1ZT4A 1P84J 4F80A 4LLVA 1BFVL 4NQSB 5HGGS 1GGTA 3PP4H 3VFVA 1YNLH 4NQCA 1T2QH 4OT1L 3ARBD 5MENE 3MTRA 5GRYA 1MI5A 1SEBA 3BKMH 3U9UB 4JFDE 3U9PL 4UNUA 4CW1A 4HK3J 3S36X 1WBZA 1IGJB 2Z91B 2Y07H 4HGMA 5GGSA 4WTWA 3AXLB 4XPHL 4K7FA 3VMPA 5CEZH 1HHGA 1ZHBA 2AKRA 3VFNA 2GFBB 1RZGA 4LGPB 5HGAB 5MP6H 3VG9B 4F7EA 2GUOA 3QH3B 1T22B 5IMOA 4PFEA 4YHKH 3CLEH 4U1GC 4EI6A 5EPMA 1F2QA 4IOIA 3FQUA 1D5XB 1YA5A 3ARQA 5BMFL 4MB4A 3CK0H 1UM5H 3N0PB 4AIZB 3HZKB 2G5RA 1G9NC 2A2QT 4YBLC 2PTTB 2H8PB 1R5IA 4NPYA 5ANMB 4Z7QE 5JXEA 3CLFL 4X6CE 4ORGB 3RGVA 1WEJH 3TCLA 3HN3A 4P9HH 2V2WA 2GY5A 4PJGE 3TNNA 3L3DB 5FHBH 1C08B 1D9KD 3MCKA 3MRGB 4QWWC 2OR8A 1EGJL 3C87A 2VR5A 3WHE0 5F3HA 1AIFB 4MDJA 5ETUB 4FFZH 5GRJH 3T3PE 3SGEH 5C7XH 2W1NA 4KY1L 4I2XA 3QDHA 3SKNB 4YHZL 2YWZA 4YHLH 4P3CL 4EQ3A 4B7IA 1DQDH 4MA1C 1T6VN 1XZ0A 3PL6B 1UB6B 3UTPE 4KRNA 3CMOH 1BQLL 3VFMB 2WBJB 2OMNA 2D7TL 3UTZA 2PW1B 2IPKB 5IHBA 1DSFH 1N5YH 3MLVH 5FGSA 2Q76B 1UXSA 2MKWA 1EAJA 3EO1A 2BX5A 2HVJB 3WS6A 4L4JA 1EGJA 3O6FB 5GGVY 5A3IC 3QZWG 1JHTA 1QHOA 2FX9H 3PUCA 3MJ9H 4FXGB 2OJZH 5GZNC 4ZFOB 1ZXQA 1YEGL 1NGYB 3KPQB 4IMKA 3S3JA 5DEZA 1I7UA 1AJ7L 2VDNL 2DL9A 4KI5E 4KKBD 3QNZA 3BOVA 4JFEB 3WFHA 2X1PA 3NZ8A 5DF0A 1OT1A 5SX5K 4K71C 2BHYA 2UV3A 1N5AA 4XPTL 3QPXL 1MSPA 4U6HB 5CJXC 3UJTH 1D6VH 4S2SB 4D8PA 2F8XC 5ESAA 2JCCF 4L3EA 3FTGA 2WIMA 5HHVL 1EERB 5E8OA 5GIRA 5FV2A 1RHFA 2NCMA 1CXEA 1TJIL 3VXSA 5L2KA 3WL9B 4QHLA 5ID0A 1YEKH 3QFJE 4QXGL 4QOKB 5DK2A 1B3JA 1WFOA 1DN0B 2HYMA 3B9KC 2PYFB 3UYRH 5I66A 1NSNL 3AU1A 4Q58C 5IW1A 1I7RA 5HI4D 3OXSB 1UYWL 3MJ7B 1RIUL 2WWMC 3BUTA 3MV9B 4NO5A 3IDGA 4ZTOH 4QHKI 2LU4A 3VRJA 4JHAH 1EUTA 4CU6A 4XNMA 1JZ5A 4MCYA 1WC7B 4UNTA 4P46A 5CINH 5I9QC 4H26A 4PJIF 2HVKA 3U1SH 5I1DA 4G6KL 3EOTH 3QPQD 1QBLL 5E8NA 5CBAA 5LQBH 3EOBB 1FRGH 2D7OA 4Q0XL 5KN5A 3G6JB 3MRRB 4HJ0D 2XICA 5FKPA 4OCYL 4WI6A 5D7JC 4XTRC 3VFOA 4P23C 1HI6A 3SHSA 4X9FA 3JXAA 1T0PB 2VDPL 4G6JH 4W6XB 3EFFB 5A2LH 3P73B 4PG2C 5T1LD 3ZKMC 1RK1A 2AQ1A 4GBXD 4DVBA 4F15B 4P2OB 3V6ZA 5CUSH 4G42A 2XG5A 2VLLA 5J06A 5JHDA 5C0AB 4MD0A 3G04B 3VXUD 1U6AH 3DX9B 4X7FC 3AROA 2I26N 1RIHH 3O6LL 2D31A 2WWKT 4IDLA 5B3JF 5HHME 4DKFH 3L9RA 1E4XI 1N4XL 1P7QA 4K9EL 5IB1B 5HYJE 4LFHG 3QYCA 4G43A 5E95B 4C56A 3PWJA 3EDEA 4RGNE 3F7YB 1K4DA 1NGPL 2YPKB 1HIML 3K1KC 2D2OA 2AQ2A 2FEDD 4LRNL 1K9TA 5ACZB 1NANH 1NGXA 1TTGA 2I9TB 3WO3B 1QRNE 3O8XD 1QFOA 4NCC2 1TVHA 1CFNB 1XF3B 4GSDH 1JGLH 3SY0A 1PG7W 3SDDB 5MEOB 5CFHA 2Y6SC 1JTPA 3MJ8A 3KYNA 4FQXC 4HZLA 4E41A 4X9HA 4PRAB 2G2RA 4UNVA 3DSFL 4KJPC 1NCWH 2X1WL 3T2QA 3D39D 4I18C 1YMMA 1A22B 5J1AB 1CE1H 1XF5A 3DIFB 4PV8A 5EB9A 1GSMA 5KAQF 3AREA 1ONQA 3PWPB 5ANME 1CXKA 3FT4B 1AFVH 2IF7A 4OCWL 2DQCH 4ZFGL 4MSWA 3IS0X 2AERT 3SDXF 4RMWA 1T1ZB 4R97B 1FZMA 3T1FA 4YXHL 3VMNA 2MPAH 5FGBC 2W9DL 4M4RA 2I60H 4JREC 2EYTA 3L3GA 3UZVB 1EZVX 1IFHH 2JCCB 3DUUA 4OZ4B 4IMLA 2ITCA 2AJYH 1HHIA 5E8PB 3VI4F 5KSVB 4BSJA 2F74B 2X44D 1ES0B 5HI3C 2A0LD 4LLMA 2R4RH 2EE6A 4JLRA 3FO1A 3OKDA 3P11L 4PJCA 3KLAB 3EDFA 4DUVA 3CFKA 3ULSB 1G0YR 2NW2A 3GIVB 1IT9H 4G8GD 4J1UB 3NIFE 1I3RB 5E1HB 4LSQL 4ZXBC 3OKNB 5F7YC 3NFPB 4YBHA 5GGRB 4DKAA 4RCAA 5D2NC 3U0TB 2BVQB 1D9KB 1CGSH 1R3LB 4HIXH 3T4AB 3ARXA 3R0NA 4HPYH 4V1DE 1VA9A 4ENED 1P4IL 5HDQH 2NZ9C 3ARGD 2DWEA 5C0NC 4PJIB 4YR6B 5I16B 1OB1A 1FL3A 3V5HB 3P4OA 3MROB 2DTML 1AXSA 1FORH 4LOUD 1B6DA 1R3KA 4DTGL 3T65A 3BO8B 1CFVL 4UZGA 4PGDA 1JYWA 2Z31A 4J3VA 2P8MA 3BJLA 5DJCA 3QJHA 3OR6B 4P2QD 3KPPB 2DDQL 4F58H 3KPNB 2BJML 2F5AL 3I6GA 4PJHE 5IIEA 1A6WH 2C4FT 4OLZL 3BH8A 5LBSH 4QOKE 3ZYOA 2JK5A 3M8OH 3L3OA 2C1PA 3N50A 5FECB 1LMKA 3EZJB 5IFJB 4HUWB 5MI0C 4FQ1L 1IBGL 2WANA 5BV7H 3HE7A 3OKOB 1GH7A 4HWBH 2RQ8A 5CWSB 1GHFH 3MV9E 1MFDL 2F8VA 4OV5A 4KV5E 1C5DB 3OG6B 4R3SA 4HQQL 1GGBH 4BFIA 4ZUVB 3JV6B 4YHNA 2P5EA 3TBVA 1MCSA 4W6WB 2ZPKL 4X98B 3MV8A 4LP4A 5DTFA 3IFLH 1SJVA 2NLJA 4DKEH 3F7VB 2VERN 4NO0A 4KVCL 3TBYA 3QT2A 3LKNA 1NLBL 1MJ8H 3B2VH 5DR5H 3HNSL 1BQUA 4OCRH 1C1EH 1EFXD 3P0VH 4X5XB 1JNNL 4U1IA 1WT5C 3IXAA 5D7LB 2X1XR 2NY6B 3TT3L 5KZCD 1QFPA 2GTZA 4OLYL 2VXTH 3REWA 2X4NB 5EC2A 4ZDHA 3PIQA 4NQDD 2V7HB 5C0AE 3JVGA 2G75A 2VWEE 2XIDA 4FQJL 5EU5B 1JFQH 1ZS8A 4MJ6A 4XPBH 3QQ4B 4EUPA 1L6XA 2JE8A 4JY4A 5F9OH 2EYRB 3T2PA 4EIZC 3VD4A 3CFEA 2P5WD 3VXRA 3RX8A 1U95A 3P4NB 3DVNB 4KJYA 3E6HA 4U1SA 2D4FA 4UQ3A 3MRHA 3BH9A 4M43H 3FT2B 5JW4M 4QXTB 3SDXB 3QDMB 2QADD 4D2NA 3LEXA 4XBGB 1EV2E 3NIGF 4OGYL 3MXWL 4UI2A 5GSRB 4RQQA 1FZKA 5IGXH 1I7ZB 4O51B 4KMQA 3GSQA 3R8QA 3KYAA 1UEMA 3KWWB 3CU1A 1SVCP 1MCQA 1TCRA 5E00B 4ZUWA 1AD0A 2BFVL 1VFAA 2DJ4A 2DTSA 1QVOB 2Y7QA 5HYIA 4CDHA 1BBJB 1HSBB 4WI7A 5H2BB 1DQTA 5M95B 3IF1B 4TOYH 3BP6A 3EO0A 4WW1A 2YD3A 2ZKHL 1BBDL 5CZXC 4Y1AB 4XT1C 1K6QH 5DRNA 4OFYA 4JAMA 2F5BH 5EN2A 2MCG1 1NUDA 1LNUB 4F9LC 1EAPA 1X5KA 1NCDH 3PWPE 2BRQA 5F1IA 5ALCL 4L5FL 3QNYB 4LHQB 3BDBA 3O0RH 4BQCA 4FQQA 4Y4KB 1QSFB 1DLHA 3EYOA 3O4LD 2B5IC 2M8XA 1PGRB 3QSKB 3QUXA 1G6RH 4M02A 4S0SD 4B50A 1FC1A 1H8SA 5GJTL 4TUKL 1ZMYA 3LRSB 3TO2B 5E1AB 5J9PA 2JCCE 4M6MH 1KYOK 3BVNA 3N9GL 4CADA 2ID5A 4OZIA 2EZ0C 3EO9H 4OQ1A 3P30H 1KYOJ 2A6DB 4LASL 3SGEI 3VJ6A 5CD5D 1SMAA 5C0FB 1KBGH 2IC2A 1UCBL 5D1XD 4YNYA 3MUGB 2P43B 2D4DA 3BP7A 1JHKH 1MQKL 1IQDA 4JJ5A 4MAYC 5FO9B 4ZOEA 2X4QA 1MRDL 1HWGB 5C0GB 1M7DA 4OAWB 2NNAA 4X4ZA 3T0EB 5IV2B 4ALAL 5EUOF 1YEHH 3DTXA 4ZUTB 3D85D 4YUEH 2LVEA 3QIUB 4KK5D 4LIQH 4M9PA 1LP9B 4LCWD 3S37H 3MMEB 5DGRA 1CD8A 4AK1A 2A6KB 2AABH 4PJIE 2BSED 2B2XL 2E7HA 4M61B 4LSRL 1VKXB 4TULH 1Q9KA 4JPIA 1S7RA 1CICD 1BWWA 4ZYKA 3KPOA 3OL2A 4FG6D 4PY8I 1U8JB 2VITB 1RUPH 4PJ5A 4U0QB 2ERJB 1GXEA 4PJAA 2ESVB 4Q7DA 5C0BD 2FIKA 1IGFL 3HZVB 3MZGB 1KJ2L 4JG0L 4HC1L 4ZOAA 4G8IB 1T7XA 1DEEA 3DRQB 3SO3B 7FABL 5AD0B 3J7HA 5AAWA 4DWHA 2VLKA 4F2MB 5C09A 4JFYA 3C2AL 1TZGL 3OKLB 1U8IA 5B3JE 4J8RB 3VU2A 5TE6H 3MGOA 3RQ3A 4MS8D 3X11A 5TFSH 2Q8AL 1OGTA 3QO0A 5D72L 2CRIA 1DBJH 2UVFA 5F96H 2CO6B 2G60H 4RA0C 5FUOL 5F7DA 2YD6A 3QUKB 3O11A 4KK6D 3FFCA 2R4SH 3TVMD 5C2UB 3SDAB 3RVVD 2FNBA 1NEUA 4L8BB 4CMHC 3OKEA 4CGTA 1FCGA 5DFVC 4GMTH 4JFFD 1A6ZA 2R29L 5I30H 1Z5LB 3GK8H 1OAQL 2XRAL 3QUYA 1TZIB 3MACL 4X7TB 3DI2B 2BNQB 1RUML 2NR6C 5EU7C 5JQ6L 2HRLA 2XWJB 3H6JA 3C5ZC 1U8NA 2DQDH 1H0DA 3TA3C 3BWAB 4NHCL 4XB7A 1BFTA 4MNQD 3DYOA 5T3ZD 1I1YA 2IMNA 4WU7B 3LB6C 3RVUD 1KTLA 3L5WA 2CKBH 4X7CC 2QSQA 1LQSR 5JR1H 1FLRH 4PJXE 2QHRL 4YZFE 2KH2B 1A47A 1AGBB 1I9JL 3LH2L 1L7IL 3ZTNL 3TN0C 4PRIB 3THMH 5BXFA 2D03L 4HIEB 4HBCL 4I77L 1T6WA 1NUNB 3WD5H 4OM0L 1U8PB 3NZHL 1NC4B 3QDME 3SDXE 3QUMH 2VDRH 4R96A 5C0DB 3ZT5A 2J1KA 4O2CB 4ACPA 3T2NH 3IFNL 4DZBB 5CJ5A 4AENA 4XVTL 1MLBB 3EOAA 1R6VA 5EZJB 1S9WA 2J8HA 2VOTA 3BRFA 1X5FA 1T21B 5I18L 4RX4D 3BUYB 1HCVA 3KAAA 1BLNA 4EUPG 4TTDC 3VI4E 1UT9A 5EZOH 3EJYD 5IVNA 4OFKA 4M7LH 3FB6B 4EI5A 2O93L 4GW5A 3ULVL 2CRZA 1UH2A 3C08H 3EHBC 1OTSC 4B7LA 1A4KB 4Y1AE 25C8L 3H42H 2XZAH 3ZO0A 3BKCH 4OCSH 3ROLA 4Z78B 2X41A 1GIGH 3OX8B 4FN0A 3OGCB 2QADB 3NPSB 2XV6B 4JHWL 4QY8A 1AC6A 4XBEH 2UYLB 4R2GD 2DMCA 3U79A 5LVEA 5C0EB 2VDOH 1AKJD 3IDXH 1RVFH 4M5ZH 4R0LC 4N9OB 4P2RD 2Y23A 2BDNL 1B4JL 2JJSC 1A14H 4H88L 4HIJA 2Q6WA 3D5OF 2V17H 2FEEL 4X7DC 1CGWA 2AS5M 4RZCB 3VFPA 3GO1H 3LDBC 1N6QH 2DQJL 3F58L 3LOWA 3WO4C 5CLTA 1IGIH 5H94B 4ZUUA 3SDCD 2COQA 4XP5H 3X14B 1WAAF 1QFWM 4ODWB 5KW9H 2GIYA 5F97E 1SQ2N 4R7NB 1BFOA 2DJSA 1B90A 3NCYS 4LCIH 4NKOB 2CXGA 2OSLB 4NNYB 4TUOB 4Y2DC 5F9WB 4HFWB 1IGYB 1GJIA 1OAUH 1A3RL 2ZJSL 2ZNXA 5DJ0B 3BPLC 4YFDB 3MXVL 4GAGH 1I9RH 4Z9KB 4I13B 4XC3L 4LPVA 4RAUA 3RPIB 3H9HA 3DMMC 2VB5A 1QLEL 1LDPL 2NY5L 1J1OL 5J1SC 5DT1L 2IGFL 4OF5A 1CFSA 4UT9L 1N59A 4E9LA 3D87B 4F33A 1UM6L 3QNXB 2EXWC 3EFDL 5C0RH 4XX1G 2GJ6B 3MLSL 4HX1A 3Q6GH 5JIPA 5GJSH 1JTOA 2R0LL 4PJ9B 5DMGD 4MQXD 4PJ7E 5DJ6B 1OL0A 1F90L 3HMXL 1YUHA 4ZQKA 5HTSA 4P5TB 4JFPB 1IM9D 2EYSA 4EEEA 5IROC 4WFED 1K2DA 3GEWB 2VL5A 4DGVH 3HMWL 4L1DA 4ODBD 2N4IA 3BZFA 2WQRA 4U1MB 1UGNA 1WFUA 2IH1B 1BPVA 3BKYL 3G6DH 1Q94A 5E5RB 2UY7A 4HAGA 1AD9A 4RIRB 3MRBA 1TNMA 4J3TA 3MNVA 1SMOA 1U58A 2QQLL 2OTUB 1CGVA 3SJVA 2G5BB 3HMXA 3V4VL 4MA3A 3N1PC 1XR9B 1S9XB 3PWLA 1OGAD 1A6VL 2C3WA 1TPXB 4NRYA 3RX5A 1ED3A 1S5IL 2WK2A 4ONGH 3IDMB 1INQA 2NY4C 4Z18A 4LHUA 1MNUL 1AO7B 3HR5A 5MENA 1BX2A 5KVGH 3HKFA 3NIGE 5D70H 5DMKA 2B4CL 4ODUB 3OAZH 1AXTL 32C2B 1OVZA 4LEOB 3HNVL 3QHZH 4QRSB 3L6FB 5EIVA 1CGYA 2A6JB 5AZ2H 4BQ9A 2ATPA 1IGCL 2BNQE 4PLOB 2GQHA 2BSTA 5AWNH 3QEHA 4WCYH 2R9HC 1VACA 5FKAA 1WTLA 3FO0L 2Z4QB 3W5NA 2PTVA 4JJHA 3V4PL 1BWMA 5IESH 2EC8A 3MBEB 3ILQD 3S37X 1BJ1J 2AJSH 1A8JH 3QCVL 4RMVA 2NXYD 3QA3A 1BREA 1VADA 4AMKH 3AS3A 5GGQH 1Q9OB 4NSKA 1MWAA 4ZNEE 3KLHD 3MYJB 1MFAH 2XPGB 1BVZA 1NAKL 3BP4A 4EOWH 1L0XA 2B1AH 3IJSA 4PUBL 4KHXL 4PJGA 1I3VA 2VXQL 1BGXL 4NOFA 5KSAC 3RZCA 1K8DA 3QEUA 1NH6A 1HZHH 5EBMA 1IQWH 1XIWC 1ORQA 3D3VD 1CDBA 3K4DA 3TPKA 4K94C 1IARB 4P49A 3TZVD 2E8YA 1MJUL 2AJVH 3NCJH 1ZANH 1BD2B 4OI8A 5B8CA 2CD0A 5LWYL 1AGFA 3TJHD 3GSXB 1Q9WA 5KS9F 1IEAB 1KCVL 2P5WE 4DGIL 3W82A 2CRMA 3DHMA 5J1TC 1CI5A 5I1IH 4K23H 4N8CL 2ZUQB 4D0CB 1M4KA 2K3TA 2A73B 2MKLC 3EJZC 3SQOL 2C3XA 4PJ8A 3S4SA 4FXKA 3RY4A 3V2AR 2X9WA 1S9VB 1MVUB 1YQVL 5KVEL 2XG4A 5HPMA 5EUOE 2A9ML 2Q8BL 4LLQB 3C09C 4LNRB 4R4ND 1U91A 1JMZA 2FIRT 3OXRA 1W0WA 1KG0B 2VYRE 4FFWC 3FQNA 4I3SL 2A6IA 2BOBB 3DX8A 1OLLA 1LK2A 4XPAH 5C08B 3WXVL 2BC4A 1MH5B 1CT8B 5D2LF 2W0PA 4R4BA 2KDGA 5K9KB 5GRZA 3S9DB 1FVCB 3L1OH 1CBVL 2NZIA 1RZ7L 4NKDB 4JCMA 2VDLH 3QFJA 3ZTJH 5IQ7H 4BK5A 1F4XL 2ZNWA 3ULUD 2BVTA 2HG5A 2R1YA 3DRTA 1ROWA 2OMBA 3FRUA 4XNYH 4Y4FB 5DLML 5ADPH 2AV1B 3G9VA 1BFVH 3N85H 1GGIL 4W4OC 5DJXA 5F7UA 5GXBB 2BY3A 4N5UA 2M2DA 3P40A 2O61B 5IJKC 3VWKC 1Y18B 2UWEA 3RVXC 4LLAA 1HQ4A 1JF1A 5F6IB 3GBNL 4YH6A 1V7ML 3L3IB 4U1KA 2GK0B 4XHJC 4LKXA 2HJFB 1FL6A 5LG1A 2Y36L 4HBQA 3MRLA 4QHUB 3WIFA 4QHMA 4XPHH 2ARJA 3NACL 4PLKD 2GJ6E 3H2WA 4JDZB 1I1AD 4ZO9A 2NY7L 1AQDB 3V5KA 1E4KC 4H8WL 3SDCB 1KCSL 3MFFA 5D1ZB 3KDMA 5BMFH 1OSZA 4PREA 5H37H 1W8OA 4ZOCA 5ERWB 2I9LB 3SCMA 2LE9A 3QCTL 3UROR 4BSWA 3O2VL 4J7RA 2BOCB 1NGWB 3ARBC 3VFGL 4G5ZH 2H2PD 3DUSB 3DWTA 4XXDB 3REVB 1EGJH 5HYJA 3KJ6L 3O3EB 2C9AA 4KY1H 4MJ5B 4NQSA 4YHZH 1ZOXA 3OTTA 4P3CH 4PJFF 5DUBB 2APVA 3CZJA 1IM9B 3U9UA 5DMJB 8FABB 4XCCL 1SM3L 5HJ3B 4LPXA 2W0LA 1IGJA 1QRNA 2Z91A 1S7TB 3R4DA 5BV7B 3TCXA 3AXLA 1JWUA 3SGKA 4YHML 4AG4L 2GFBA 5HGAA 3QH3A 1T22A 4WO4B 4APQD 5C71A 2PO6C 5IVOA 5D96B 5DUPL 4KRPC 1TQBB 1W0YT 1D5XA 1YEGH 4LPUA 5KS9B 3KPMB 2E27L 2YS4A 1AJ7H 2VDNH 5IHUL 4AIZA 3S7GA 3HZKA 1NEZB 3D2UB 2VR4A 2PTTA 4I0PD 4DFHA 4LHUG 2FO4B 4PJBF 5D7SL 2H8PA 4AT6B 1CD1B 4OF3A 5ANMA 4XPTH 1BFSA 4ORGA 3IFPB 4XI5D 2OL3B 3UPAA 4Q6IB 3BW9B 4L4VB 3L3DA 5FYJU 1C08A 5C0CB 1P7HL 3MRGA 4JM2D 5MHSD 3EDDA 1HQRB 3DVFA 3FB8B 3WHE1 3GM0A 3O3BB 1QFWL 2BSSB 4L29B 3VD3A 3V9FA 3G5XB 4PJDE 3SKNA 1T89C 4ZFOL 5IOPB 5F7NC 4XMLL 1WZ1L 4MJ4A 3ETBF 5D2LB 5T3ZE 1NSNH 3PL6A 1UB6A 5BS0B 1CE6B 3VFMA 2WBJA 2CGRL 1BD2E 1UYWH 1RIUH 2PW1A 1RURL 2IPKA 4O5LL 2V9RA 3RKDD 3M45A 4LMQI 3QRGL 2X70A 4KKBC 2Q76A 5D1QD 5HVWA 1YN7B 1WAAE 2OR7A 2HVJA 3M1BB 3O6FA 3FZUC 5FYKE 1SHMA 1A3LL 3SKUD 1KEGL 4FXGA 1J1PL 4Z7WF 2IAND 2YZ8A 4G6KH 4ZFOA 1QBLH 2AAVA 1NGYA 3CFIC 3KPQA 4Q0XH 4U1LB 4YK4B 1QPXA 3FCTB 4I3GA 4NJ9H 4UAOC 3LN4B 4AJ0A 4JFEA 2NY2D 2R0WH 4LVHB 5E7BA 2YN5A 5EU4B 5I6XC 2V9TA 3KXFB 4JKPL 4K3EL 4M9OA 2VDPH 4U6HA 2P49B 2VE6B 4QHKJ 4S2SA 5C08E 4QF1B 4WTZA 4PRHD 1U0QA 5TJWK 2W9EL 1EVTC 3V0WL 2CLZB 4KK8D 1FE8L 4PJHA 1YMHB 3ARVA 4JM4H 3WL9A 3O6LH 1KGCD 1UWGH 3VXQB 4DEPC 4QOKA 4NYLB 4K55A 3NCFB 1KPUB 1BEYH 1N4XH 3S4SG 1PX3A 2PYFA 4R7DB 4K7PL 1S78D 5AG9A 5GS0D 1CFTB 3NCCB 3ZKXB 4YAQB 1YY8B 3QPQC 4RGMB 5ENWB 4DN4L 5SWZD 3OXSA 5F7HA 1WF5A 4HJ0C 4FZ8H 3MV9A 1A7NL 1HIMH 2AJZA 4LRNH 4P2RE 2QQNL 1W2KT 1Z9LA 1WC7A 3QIWB 4KRLB 3OWEA 4M6NL 3M07A 4WUUD 3T3MF 1IC7L 4MAUH 4NM8L 4PJFB 3EOBA 1CFQB 4GBXC 4WGVB 3UBXI 3MRRA 4IRSB 2C3HA 4PB9L 4KJQC 1QSEB 4U1NB 2GEEA 5F72S 3LKOB 3OG4B 4N8VB 3IFOB 1EEQA 4U2ZA 1P9MC 4UIMB 4J3OC 1JGEB 3FHQA 5I1EL 4D0DB 3ELAT 3EFFA 3P73A 4OCXL 3Q2CA 1F58L 3IJYA 2ZSWB 4NKMB 2VLRB 4P2OA 2B7DT 2H1PH 5C0AA 3G04A 1GCFA 4FQPA 2ADFH 4RWYL 3E2HB 2VQUA 4OCWH 4ZFGH 4OF0A 1ZT7A 3C6LD 4YFEA 2YUWA 1RFDL 5CJQL 2VXSL 4HCRL 2X2YA 4N1EA 4G6FD 4RRPA 4JR9H 5IB1A 4NRZB 5K9JL 4PJBB 2W9DH 4IS6B 4QXUH 2DLFL 4P0DA 1KT2B 4M7KL 3F7YA 4XH2B 1H8OA 2YPKA 3SQBA 2VH5L 1IAKB 4I8DA 1G9NH 3X3GL 2RFXB 4WFEE 4F37K 4LSPL 5ACZA 3RWHB 2I9TA 1I1FB 3BIBX 4WFGD 1AHWC 1XGPB 4AEHL 1CFNA 3NVQA 3P11H 1BM3L 1XF3A 4Q9RH 4HCRA 4KFZC 1NUFA 2DLEA 2VZOA 4MGXA 5DWUL 1LDSA 4RFNC 5I73C 5DHXB 3SDDA 1LEGB 2X9XA 1J9CT 5MEOA 3QIBC 4LSQH 3UZQA 4ODSL 2AK4B 4PRAA 5DZLA 5KS9E 3JWOC 4Y16B 1XF4B 1X5LA 5I8OH 3UTSB 1DJSA 4KTDL 5L8LB 2YWYA 4D3CH 1F4YL 5J1AA 1FV1A 1P4IH 3DIFA 4JRYB 5IBTL 4NN6C 1IILE 4Z7WB 3PWPA 1TTFA 2DTMH 3FT4A 4DTGH 2ILLA 4UDTB 3WDJA 1T1ZA 3I6LD 5HHOD 1IKNC 3H7BB 2DDQH 1QSVA 3DETC 4L4VE 3VFRB 3U82B 2A0LC 3RTQD 2K1MA 3QI9D 4OLZH 3CFCL 5AUMB 3RU8H 1MAMH 2CKBB 2YZ1A 4HKZA 5INDB 2FLBT 2CK2A 2JCCA 3GI8L 4OZ4A 3QQ3B 5D2LE 2VDQL 3MRDB 1DQLL 2D9CA 5FAAA 5SX5H 4FQ1H 4HWZB 3H9ZA 5BS0E 1IBGH 5E8PA 4P5MB 5KSVA 3DROB 2F74A 1ES0A 5KBNC 4UT7L 2E6JA 4KPHL 2PW2B 3TWCL 1XGYL 1KLGB 1MFDH 4PB0L 2FB4H 3KLAA 3ULSA 4ENEC 2IFGA 1R3IL 3GIVA 3ARGC 3QUMB 4HQQH 5JPMB 1OQOA 3L7EB 5IMMB 1NC2B 2R69H 3BGFC 4J1UA 5IKCB 3S3SA 1I3RA 4AM0B 3OKNA 3NFPA 5GGRA 3MV7B 1MCOL 4KVCH 2BVQA 3CD4A 4EUPH 1D9KA 1X9QA 3U30C 3U0PB 1NLBH 1R3LA 3T4AA 1YYLL 2XQBH 4GT7A 4R26L 1JNNH 4KQ3L 1X5JA 1RZFL 4PJIA 4YR6A 5I16A 1BIIB 3RDTD 3D25B 1F3JA 4I3RH 2UUDK 2BSRB 4EN3D 3MROA 2HAZA 3BO8A 1ZVHA 1MIML 2VXUL 4OLYH 4FQIL 4RMTA 4FP8L 2YPLB 3OR6A 3WEXA 2O5ZL 3KPPA 2NQCA 3BIKB 3QUYC 3A0OA 3KPNA 4I48B 3FMGH 2D3VA 1HXMB 4FQJH 1IGTB 4GQ9H 2DKSA 1P5UA 4GKNB 4NBZB 4Y4HB 4YDKL 3CVIL 2AVGA 3WSQH 3CSYB 1J0HA 2DBLL 2Q87A 2E9IA 3DJ9A 4G8EB 5FECA 1I8MB 1L7TL 5HGDB 1G9ML 5IFJA 3CJJA 3VGBA 4HUWA 3S36L 3DYMA 4KZEH 3HC3L 3VFUA 3OKOA 4WY7L 5D6DC 4YHPA 5DD6B 5CWSA 1DVFB 4PGZA 1GC1L 1JPSH 4OGYH 2NY2B 1CF8L 3MXWH 3OB0K 2VKXA 5FYLD 1C5DA 5F93C 4ZUVA 3JV6A 1TJHH 4WTZG 3RY6A 3W11C 2AJUL 3K74B 3G9AB 1HOCB 3OJDA 4X98A 1G7JB 2EDOA 4WWKB 5GS2H 2BFVH 4PJFE 3R1GL 3F7VA 3S8WA 4OUUB 1T7YA 1I4FA 2G9HB 2CDGA 1KELH 2W9LA 1QSEE 4X5XA 4MVBC 2ZKHH 1BBDH 5CSGA 2GTWB 2DYPB 4NM4H 1I9IL 2O5XL 4GJTB 5EZIL 5HHPB 4Z0XB 3QJFA 3UBXB 5C0JB 4E0RB 3UZEA 2X4NA 2VLRE 5CJOL 5D5ME 3FQTB 5FK9B 3O3AB 2V7HA 2DF3A 5EU5A 5ALCH 3WNLA 4X4YB 3QQ4A 2EYRA 4FTVB 1NBVL 2ICEB 1CR9L 1V05A 4TN9A 5FXCH 3P4NA 3DVNA 4PJBE 3S88L 3I9GL 4U6VL 2V5TA 4JVWA 4TUKH 2ZUUA 3FT2A 4QXTA 3SDXA 3QDMA 3V4UH 2P48B 3HR6A 3N9GH 4XAWL 5ISZD 5GSRA 3STLB 2VZ3A 1U3HD 1I7ZA 4O51A 4CU7A 3U48A 3BWUC 3KWWA 5C07D 1I1RA 3I02B 4LASH 3QHFL 5FA3A 5E00A 1UCBH 1U8QB 2A9NL 3UAJD 4LLDB 1PW3A 4UMGA 1DBMH 2EDHA 2FJHB 4N5ED 5HGHB 1BBJA 1HSBA 5H2BA 3SE9L 4MB5A 3IF1A 4RRPG 2AK4E 3U4AA 3QG7H 2XA8L 4Y1AA 1J0YA 1J8HB 5ALBL 3AUVA 5F1SA 4ZNCD 1H5BB 3MV01 3CAFA 4YC2B 4WU5B 2B2XH 3MLUH 4NN7B 4Z7WE 5H35B 1N64L 1HDMB 2P8PB 1A1MB 3LRGA 1A6TB 2GY7B 4C83B 3IT8D 4OLVL 3JWNC 1GOGA 3U6RB 4Y4KA 1OARL 1X5GA 1JIBA 3FN0L 5JHLL 3QEQD 4ZD3L 2H32B 3JSSA 2HA1A 4MD4B 5D1XC 1EJ6A 1KJ2H 4JG0H 4HC1H 3TO2A 4DUXA 1NDMB 3JV0A 1HINL 2HRPH 1EMTL 1AY1L 5CSBA 5JIIA 1MHPL 1T03L 3C2AH 3PQYB 2A6DA 5F7LB 1TZGH 1IAIH 4XMKL 4HUNB 1I3GL 4OGAC 5DVLA 5C0FA 5E8EA 5DQJB 3MUGA 5D72H 4FQLH 4FXLA 2YRZA 4PY8J 4RMRA 3QO1B 5DYOB 3WFBH 5FO9A 3BMVA 3VE0B 2PYED 1RZKL 2ZCKL 5C0GA 4UOJA 5DD1H 3O3DB 2XZQL 4OAWA 3MV7E 3HTLX 3T0EA 1RZJC 5IV2A 4FG6C 1PJ9A 4KGLA 4ZUTA 4LGRB 4LSSL 4KJWD 3IAPA 3QIUA 1FYHB 2R29H 5J12B 3MMEA 4N0CC 2DB8A 3F7RA 1OAQH 4IRJB 1CZ8L 3MACH 1WQVT 3HE6D 3QUZB 1T04B 2A6KA 3T3ME 3QCUH 1RUMH 4M61A 5JQ6H 1VKXA 4PJ7A 3GZKA 2LFGA 4NHCH 4QTHB 3WXWH 4H0IA 2YPLE 2Y5EA 2GJZB 4POZD 3CXDL 1KIPB 2ESVA 3RWEB 3ZKSD 1LWRA 3VGAC 2X4RB 5TDNB 4B53A 3HZVA 2QHRH 4HXAH 4LQ1A 2AV7B 3LH2H 4G8IA 3RWCB 1X5AA 3ZTNH 2E9JA 2DWDB 2X4TB 3DRQA 4MMZC 4HBCH 4MDIB 4QXWA 5JA9A 4IRZH 4PBWD 1S5HB 4X5WB 5IW3A 3V6BR 3TVMC 4F2MA 1NAMB 3MRNB 5AZEH 5SWSD 4PGJA 3H0TB 3OKLA 5E8DL 4J8RA 3W81A 3IFNH 4HH9B 4CN1A 1JYNA 1Z0NA 4K3GA 3T0AA 3QUKA 4K3JL 1FFRA 4L8BA 3DARA 2Z92B 1KN4L 4NP4L 4OTXL 1XGQB 3TV3L 1MCKA 1LK3L 1KGCE 4PRPD 4NZRL 2R39A 1TZIA 1WBXB 1P7KB 4W4NA 3ULVH 3GBLA 5LGHH 4NN5B 2BNQA 1L9NA 25C8H 2XWJA 3PV6B 2IQ9L 3BWAA 3ECBB 5GGUB 4WU7A 3SO5A 2DKUA 3C60B 1J11A 2FD6L 2BXZA 4JHWH 4L4TD 3OZ9H 1O5DT 1AGBA 4FTVE 1A7OL 3QDGB 4ZNEA 3LEYL 2BDNH 4HIEA 4HWNA 3MCKB 1F02I 1FP5A 3BSZL 1QBAA 4R4FL 4HDIB 4HKJB 1U8PA 5GS1C 1NC4A 4HT1H 1IC5L 1EPFA 1FQ9C 5K59F 5C0DA 5SX4H 3EJYC 3ZLQC 4BFGA 2E7BA 2DQJH 3F58H 1UZ8B 5EU3B 2YUZA 1MLBA 1PEZA 3BKML 4WW2C 4G9DB 5EZJA 5AYUL 4HD9A 3EYQD 4BELD 4QWWD 3BUYA 2Y07L 2WLYA 4HGWB 1UJ3C 3ZDZF 5M7QA 2ZJSH 3MXVH 4Y5XC 4XC3H 4PRNB 3FB6A 1JHTB 2V5MA 2C5DC 3V0AC 2P5WA 5KAQG 5TE4L 1CS6A 1KXQE 1QLEH 1A4KA 1LDPH 1VFBA 3GMOB 1J1OH 4MXWH 5DT1H 2IGFH 4UT9H 4U7SA 4Z78A 1SYVB 1E6OL 1S7QB 3OX8A 1U93B 4YDLC 3OGCA 1UM6H 5J4MA 5FOBB 4JKKA 3VA2C 3MLZH 4IIQB 5A3ID 3MLSH 3KGRA 1ZGLB 4ZSOB 4RAVB 2UYLA 2X42A 5EUOA 3ZHKA 1F90H 5C0EA 1OT2A 15C8H 4HF5L 4D8PB 4WFGE 2NY0C 3LZFL 5FHBL 1OOAA 3O2DL 1AP2B 1SYSB 4PBVC 4NCDA 1UEYA 43CAA 4EZMA 3BKYH 4QHLB 3QWRA 4FFZL 5ID0B 1YC7A 4O2EB 4RZCA 3BZ4A 4YHLL 4H20L 2DN7A 2OJEA 5B39B 1EHNA 4XZUA 4F9PA 4XP6H 3AU1B 1FFOB 1I8IB 3PQYE 5H94A 3CMOL 3UPCA 5E2TH 3V4VH 3X14A 4ODWA 4AZ8A 3Q5OA 1T3FB 1JBJA 1A6VH 1DSFL 1JK8B 3IDGB 4R7NA 1G0DA 4NNYA 4NKOA 2OSLA 4GOSA 4TUOA 5F70A 1T1WB 4HFWA 1IGYA 2BNRD 3VXMB 3O2DA 3HG1B 5DJ0A 1J18A 4UTBL 3B9KD 2FZ3B 2UY6A 4MQXC 5E6IB 1MNUH 3RPIA 5EIQA 3MJ9L 4YHYB 3PHOB 1FGVL 2OJZL 1Z3GH 5E8NB 1B4RA 4ZAKD 1C16B 3QEQB 5MEQB 2EICA 1KOAA 4YGAB 1ITCA 2WWMD 2J7LA 1A6UL 3ZHLA 1NUGA 3QNXA 5ECJE 2GJ6A 4P4KB 4PJ9A 5DJ6A 1R3JB 4G9FD 4A6YB 3FO0H 4MX7B 3UJTL 1D6VL 4P5TA 3LCYA 4JFPA 1A9EB 4GW4B 3FQRB 1U92B 5EBLB 3V6ZB 3MJ9A 2VAJA 2R2CA 5D7JD 2D0FA 3ABZA 4XTRD 4MHHG 4U1MA 2IH1A 3QCVH 5HI5D 3QAZB 4P23D 1FVEB 4MQ7B 1F4HA 4BK4A 5DHVH 4FMKA 2YR3A 1IL1A 4P59H 5FV1L 1NAKH 3V6FB 4RIRA 4XCYB 3A67L 1MFEL 4LVOC 2OTUA 1A6AB 1QEWB 2VXQH 1RJYB 2G5BA 3U2SB 1Z2KA 1XR9A 1S9XA 4ZTOL 1YJDL 3MRCB 1EEZB 3STZB 1T20B 4JHAL 3WN5C 3IDMA 1CICA 5I74B 1AO7A 1QSZA 4OQTH 3U1SL 4C4KT 3B9VA 1PKQB 1LE9B 5LQBL 4ODUA 6FABH 3ILQC 32C2A 1XGUB 4LEOA 5LWYH 2A1WL 2LQRA 1I1CA 3L6FA 1J87A 2A6JA 1KCVH 3MRFB 4DGIH 2NXYC 3Q5TA 2W38A 2EDBA 5JNYB 3I2CL 3H9SD 1Q8MA 3KLHC 4LSUH 4CVZB 4N8CH 2BVEA 2DLTA 1AH1A 2Z4QA 4LCYB 3MBEA 5CUSL 3LQAL 1ONQB 4IJ3B 1CL7L 3S97C 4K3HA 3ARYA 2Y6SD 5HGBB 2A9MH 2VLJB 4FQXD 4MCZB 5DS8B 5T3ZL 4M6OL 1Q9OA 5GRXG 4X7EC 3MYJA 1RV6X 2YXFA 3MRJB 2XPGA 4KJPD 3TBSB 3WLWD 3SDYH 5T1KD 5KSUB 3TZVC 3WXVH 1MY5A 1RQ5A 1AXIB 3INUL 3RWFB 4MJ2A 4FS0A 1VCAA 5FYKL 4U49A 2QR0B 1RZ7H 3LPWA 5EBWB 4IOFC 2YKLH 4NC2B 4WFFD 2EDRA 4LLUB 1F4XH 4FQHB 2BNUB 4P2YA 3B6SB 4JLRB 1EXUB 3FO1B 2AP2A 2WLZA 3S6CA 3OKDB 4XMPH 1CDUA 1GGIH 3IXTB 1BD2A 4Y19D 4BJLA 4U1JB 3GSXA 3PJSA 1IEAA 1MREL 1WAAA 3DXAB 2ENYA 4KKCD 1OLZA 1BOYA 4G7VL 4PGEB 3GBNH 3S98A 1V7MH 2D0GA 3SN6N 1BF2A 2AK1H 2Y36H 4D0CA 3P77B 1A6PA 2HFEB 4YBLB 3TO4D 3CIQA 2A73A 3F7PC 1S9VA 1MVUA 5FHAH 2Q3AA 4ZSOE 1F3RB 2NY7H 3CFJB 1AXSB 1AFVL 2JKXA 4J6RL 4LLQA 1P6AB 4LNRA 4H8WH 2VRAA 1KCSH 1OP3K 3DURB 2ARWA 4RX4A 2EDQA 1MLCB 2MPAL 3ULUC 2BOBA 5C08A 2KPNA 5CP3H 3ARTA 4WV1C 1MH5A 1CT8A 2NZ9D 5C0ND 1S7UB 5J56B 4L9LA 4MA1B 5K9KA 2C1PB 5KVMC 1FVCA 2DD8H 5JW5A 1F97A 2NY1B 4NKDA 2AJYL 4DW2H 4P2OC 5FM5O 2R4RL 4LQFL 4Y4FA 2YA1A 2AV1A 5IB4B 4GW1B 3UMTA 3VXME 3HG1E 4PLKC 3FT3B 3HLAA 5IEHA 1I1AC 1A0QH 3RZWA 2O61A 1NPUA 1IAII 4KUCF 1Y18A 2Y4SA 4YFLI 4P2RA 3SPVB 4XCCH 1SM3H 5CSZB 3L3IA 3QEQE 5GRUH 2GK0A 4K3DH 2HJFA 5DFWH 1E6JL 1CGSL 2X6MA 5FDYA 5CHNB 4QHUA 2LAAA 3CZFB 5EWIL 4AG4H 1OW0C 4U33A 4PP1D 4K71B 4JDZA 3IXAB 3VWJC 4OCLC 3IU3B 2IAMC 1KV3A 1FORL 3ARDD 3CSBA 2CJUH 5DUPH 1AQDA 2ZUSA 1S9YB 2H2PC 5DEFB 3SDCA 5EC2B 5D1ZA 4HEPG 3I3EA 4JRWA 2JTDA 4JPVH 1HH9B 3ZYIA 3SDDC 1A6WL 3SKMB 2B0SH 4EUPB 2APFA 5ERWA 5GGVL 2I9LA 2KKQA 1C7SA 5D7SH 5JW3L 3CFEB 3MLTB 3M8OL 4KMLB 4R8WL 2BOCA 1A7PL 1NGWA 1UKQA 2HMID 4NJAL 3L5JA 3DUSA 3E6HB 5BV7L 4UQ3B 3V6OE 4MJID 2FCBA 1BJ1H 4XXDA 3REVA 2Z35B 1YEJH 3LEXB 4YDIL 4NQEB 4Y88A 1FG2A 3O3EA 4MJ5A 4NGHL 5L0QB 4G80B 4R97C 3NTCL 3QHTC 1FL5B 4APQC 5DUBA 1V3JA 4YFLF 4ZPTB 2XKSA 5DDHB 1IM9A 1PKQE 1ULVA 3RVTD 3IFLL 8FABA 4XXCA 5K59E 1U8MB 1Z9SA 2DI9A 4DKEL 2YMXL 2CGRH 1T66C 5HJ3A 3DV6B 4YHOH 5A1AA 1S7TA 1F4WH 1RURH 5DR5L 5SWQB 1DBKL 3P0VL 1U3ZA 2NY3D 1QPPA 2OL3L 1QP1A 4WO4A 4DVRL 1ZSDB 1EEYA 1KEGH 4R90H 1J1PH 4XI5C 3ZDZE 1S7VB 4BKLB 2VXTL 3BGMB 3LKRB 5KS9A 4PG9B 4CNIA 4JM2C 2MCPL 1MCWW 1NEZA 2VLJE 3D2UA 5CZXD 1PZ5B 5F9OL 2FO4A 5DK0A 4AT6A 4GRLD 1CD1A 4K3EH 1CG9B 2R1XB 5IQ9B 3IFPA 1B0RB 2OI9C 2OL3A 3QUXB 1NCBL 2DM7A 4Q6IA 2W9EH 3QQ9C 3BW9A 4L4VA 1FE8H 4H1LH 5D9SA 1HQRA 3O3BA 3RKDC 4V2BA 2BSSA 4K8RL 4L29A 5LKNA 2IPUK 5D1QC 3G5XA 5IGXL 3H9SB 5IOPA 3JWDL 2GAZB 3KNBB 2FEEI 4TSBL 2HJKB 5D2LA 3HI1B 5BW7A 3GMMB 5BS0A 1CE6A 4DN4H 3Q1SL 4ZOBA 1U3YA 1GGCH 3MA9H 4FFVD 2NTFB 4LL9A 2VISB 3WUWB 3WFCL 1EA9C 5I8KH 5EU6D 4TOYL 2OLDA 3M1BA 3DXAE 2EZ0D 4GLRH 4FRWA 2QQNH 3QXWA 4M6NH 2F5BL 1VGKB 4I18B 5T1KB 1MPAL 2W07A 3MODL 2H26B 4LKCB 4NM8H 5L9DL 4U1LA 3ULVF 1GGYA 2GJJA 4MAYD 1ZLWK 2JB5H 3U36B 1NCDL 2R2EB 4EDXB 3B83A 1KPRB 3LN4A 1X44A 3MFGB 4JPIB 4Q74A 4ZS6D 3O0RL 5EU4A 3HI5H 4X4XB 4JQXC 3KXFA 2DQEL 5I1EH 3KPRD 2FIKB 2BVOB 4OCXH 3TIEB 1F58H 4QF1A 1S78C 4JREB 3ZE1F 5C3LD 1UCTA 1FNHA 4Y19B 2CLZA 1P4LB 4NQUA 4RWYH 1YMHA 4M6ML 4RA3A 4HUXB 2NY6C 3VXQA 1RFDH 1JYVA 2FGWH 1KTDB 2VXSH 4NYLA 4OLWL 2IPTH 2ED9A 3P30L 4HCRH 5GHWL 4N0UB 4OFPA 1KPUA 3IDJB 2EIZB 4R7DA 3C5JB 2CKNA 1KBGL 1CFTA 5GISL 4YAQA 4XNZB 3WNOA 1B88A 4M7KH 3OKYA 3L3JB 4ZXBB 4GAFB 3MQIA 1KJ2B 2DI7A 3GJFH 6CGTA 4LSPH 1BZQK 1ZT1A 4N68A 2CDFB 3QIWA 4KKAC 1YEHL 1FHGA 4AEHH 3KG5A 4X6EB 3NIDF 3HNTL 4PJFA 1C5CL 1CFQA 5DWUH 5F21B 2AXHA 2AABL 3I84A 4IRSA 3IGAA 3QFDB 3GMQB 5TPWL 1H0DB 1QSEA 3BISA 5DVOA 4ODSH 4U1NA 1M7IA 2LTQB 2XN9D 3LKOA 4NRXB 4N8VA 4HZAA 5L88L 3IFOA 3IDNB 1NBQA 1XAUA 4UIMA 1I1YB 5D7KD 3WJJC 3OJMB 1JGEA 1RUPL 2J5LC 2W92A 4EBQL 4WI8A 2VZSA 4KTDH 1F4YH 2ZSWA 4NKMA 2VLRA 2DQFB 5AG8A 4NNXB 5IBTH 3ARRA 4OLXH 3TA3D 3OAZK 2BCKB 4FQCL 4JB9L 3TIDB 2FJFB 4JFHE 1B0WA 2AGJL 4PJBA 1HNGA 4H5SB 1CVSC 4NQEE 3CFCH 3U7YH 5TFSL 4L3CB 1KT2A 1DBJL 1M05B 3C9NB 1JZ2A 4XH2A 5F96L 3TN0D 3MUZ1 3GI8H 3P9LB 4G9FE 3ZL4L 1IAKA 3K7UA 4C55A 2VDQH 1DQLH 2YBRB 4LCCB 4HJGB 3T1WA 2RFXA 1YEEL 5I1HL 1PKOA 5JDSB 1I1FA 5IBLD 4UDUB 3NBNA 5F1NB 1XGPA 4KPHH 3EAKA 4GMTL 3TWCH 1XGYH 1JZ4A 4PB0H 3EIFA 3GSWB 5I30L 4PPTA 1T2JA 1R3IH 5K93A 1S7WB 4JDTL 1LEGA 2VUYA 1F6AB 1CDHA 3EYUL 3AMLA 3FONB 2AK4A 3S34H 4P4RB 3CPLB 1N26A 2R0KH 5C9JB 1P69B 4FNLL 2WWKO 2F53D 4Y16A 2V2TB 4X6CF 1XF4A 4TTDD 2CKBL 2QSCH 3UTSA 4R26H 1FLRL 3T04D 1V3KA 1W72H 3IRZA 4Z7WA 5CEYB 3T0EC 2LU7A 4QGYA 4UDTA 3T3PF 4UV4L 4DFIA 2VXUH 4FQIH 4LLYA 1F5WA 3QIUC 4FP8H 3W9DB 2O5ZH 5F3BB 3GGWB 3VFRA 2F54D 5E9DD 2A74B 1QACA 2RGSA 2VDRL 1JN6B 4Q9QH 5AUMA 4YDKH 3CVIH 2CKBA 1IKFH 3H9SE 5INDA 2DBLH 3BEVB 3QQ3A 1L7TH 2ERJC 2Y9RT 3B5TA 4WI9A 3HC3H 4P5MA 3LV3B 1NEZG 3VH8B 2VN7A 4OLUH 4OFDA 2PXYD 2PW2A 1KLGA 1GC1H 4X83A 1CF8H 1MHCB 4I0PA 3K4ZA 1N6VA 3TM6A 2Z0BA 3H9HB 4JFQB 5DQ9B 5JPMA 3QUMA 1B2WL 3L7EA 3RDTC 5IMMA 1NC2A 5FYJD 4KI5F 5IKCA 1ZGLM 4OCSL 4AM0A 2NYYC 3MV7A 1GIGL 4DN3L 3R1GH 2XFXB 1OY3B 2EE9A 3U0PA 1BZ7B 5L2JB 4I9WD 5JW4R 1FNAA 4C58B 1KACB 3DMMD 4N1HB 1G7QB 3ARWA 4I1NB 1BIIA 3D25A 4WFFE 1J5OL 3SDAC 1RVFL 2B5IB 4M5ZL 1IMHC 1I9IH 2BSRA 2O5XH 5EZIH 3RIFF 2I07B 1BECA 3UO1H 2YPLA 4BQ6A 3RA7L 4NQCD 4JRXB 3BIKA 2V17L 4I48A 4Y19E 1MI5D 3MRPB 5CJOH 1Q94B 1HXMA 3FHAA 4N90E 1QFHA 1IGTA 4I0CC 3BZDA 4HUMB 3STBA 5EU6B 2R2HB 4GKNA 3GO1L 4Y4HA 1N6QL 5A2IH 1NBVH 3CSYA 3H3PL 4KDWA 3BAEL 4N0UE 4G8EA 3LAFA 1I8MA 3BN9C 4HFUL 4UBDC 5HGDA 1LD9B 5KW9L 4MA3B 4L8SC 5ICZB 2WIIB 4LCIL 4X6DF 4HUUB 5DD6A 1ZHNB 3AS2A 1VGEL 1DVFA 1KCLA 1OAUL 1PQZB 1X5XA 5E7FA 1I9RL 4NC1C 5D2NE 4C57C 3VW3H 5GS0L 1GRWA 3UDWA 2J6EL 4LSDA 4JFDB 3LS5L 4QHNB 1YQ2A 3BKJH 1HOCA 3QHFH 4WFHD 4URTB 1G7JA 5I0ZA 4E5XB 1K8IA 2XXCB 3GSNL 4WWKA 5JXED 2A9NH 2VZTA 4YDVB 5C0IB 5IP4A 4BFEA 4OUUA 2ATPB 4UQ2B 4GUPB 4YE4L 3RGVD 5C0RL 4MZ2A 1ZGLP 2WMPA 5T5FL 3SE9H 2NY4D 4KDTA 4ODTL 4P99A 2B20A 2GTWA 2QV2A 3DPBA 3V5DB 2XA8H 4XP9H 2WAHA 1RJCA 3HRZA 5HHPA 4Z0XA 2PCPB 5ALBH 3X3FL 3UBXA 5C0JA 4B5EA 4E0RA 2FHCA 35C8L 4WIQA 1UH4A 5FK9A 5C70A 3O3AA 4KK9D 1CU4L 2R9HD 4X4YA 2VN4A 2ZCHH 1E0OB 4X6CB 4OLVH 1U3HC 1LILA 4FTVA 1OARH 5EIIB 2CUIA 4LVEA 5JHLH 1IGMH 4ZD3H 3OJ2C 2FATL 1NLDL 1N8ZB 1T0NB 3UAJC 3X13B 1KUMA 1HINH 4N8VG 3W9EB 3CFDB 4YXKH 3EYSL 4JANB 3MC0A 1AY1H 3STLA 4CMHB 4G7YL 2X09A 1T03H 1QFWI 5DHVB 3RWJB 3I02A 2Y1VA 5KSAD 1I3GH 3IB4A 5IBUB 1HSAA 1U8QA 5E2JA 3QHZL 5E6ZA 1XIWD 1DBAL 5HSFA 2QLVB 3HA0A 4BSVB 2FJHA 3C5ZB 4GKZB 3TA3B 5HGHA 1AQKH 4L3ED 4WCYL 1RZKH 2ZCKH 3C6LA 2VDML 2XZQH 3VFTB 1KNOB 1F3DH 5L2KD 3VXSD 4MJIE 3ZE0F 4P9HC 4X9BA 4L8DB 3CFBB 3GMPA 5F9WC 5IESL 3K8LA 1PY4A 4LSSH 1J8HA 1JWSB 3MO1B 2AJSL 1H5BA 1OHQA 1CZ8H 3OAYH 2NXZD 1Z9MA 4WU5A 4YWGH 3W2DL 1IEHA 5H35A 2QJDA 4AMKL 3T0XA 4KZDL 2FHBA 1HDMA 3MBXL 1B0GA 2P8PA 1T7WA 1D5BB 5GGQL 4GQPH 1A6TA 4MA8L 3ULVE 2A6IB 4C83A 1LE5B 2B1AL 1EIBA 3U6RA 3EJZD 2BC4B 3CXDH 4R4BB 4QRPB 1QZ1A 1FVDB 2H32A 3TH4T 3LMJL 4MD4A 4P46D 1T83C 2W91A 3CGTA 5J3HC 1MCLA 1NDMA 3AY4A 1CK0H 3OAUL 4FFWD 1F8TL 3LQZB 5B38B 4M62L 2C1OB 1N2RB 2R1YB 2UUDH 3DRTB 4HUKB 1K85A 3VGHA 5LGKA 3RX7A 2BHZA 3PQYA 4CKVX 5HDBF 2AJVL 1CLZH 1ZANL 5I19H 3MA7B 5DQJA 1IE5A 1O7VA 4HK0B 3LN9A 3HE6C 4GRWE 3QO1A 1KFAL 2NX5B 5DYOA 4PD4J 3VE0A 5KVDL 2DJUA 3P9WB 4X6DB 2KZ1B 5JHDD 5I1IL 2VDKL 3O3DA 3QXVA 3HB3C 4HK3N 5DD5H 3FJTA 2P45B 5E08L 4D0BA 4QHMB 5EOQH 4NP4H 1TPXC 2HLAB 2LABA 4OTXH 2JJTC 3RTQA 4K2UH 3TV3H 4GLRI 1QFUH 3UJJL 5IFAH 1LK3H 4KI1A 3VWKD 4IRJA 3LRHA 4JKMA 1P7QD 3QUZA 1T04A 4R0LB 3T77B 1FFNB 5IB5A 4AEEA 3PGCA 1S3KL 4C56D 3MFFB 3NIDE 1NAML 4QTHA 2EDFA 2HT2C 3S96B 2GJZA 4JRXE 1KIPA 5KTEH 2E8ZA 1TFHA 1YEFL 3LDBB 5EU6E 5TDNA 1FG9C 1U41A 3UEZA 3WO4B 3UYPA 2AV7A 5TQ2L 2X4PB 3AM8A 2ZOKA 3B9EA 3RWCA 1A7OH 5FO8B 4LK4A 3NA9H 5HHMB 2Q7NA 5T33L 4KHTH 2DWDA 2X4TA 3PP3H 5EZLB 43C9B 1WUNT 4MDIA 3CH1B 5DJZB 1S5HA 4HIHB 4X5WA 2FL5A 4Y2DB 1MCNA 5M94B 4XNYL 4R4FH 5ADPL 1NAMA 3MRNA 2E5EA 3H0TA 4PRDB 4O4YL 3N85L 3BPLB 4E41D 4RGNB 1IC5H 1I85A 4JZJC 3DMMB 5E4EC 1A1NB 4HH9A 3OGOE 1JNLL 1YMMD 4NQXB 2DMBA 5AYUH 3C2SA 1QRNB 3ARED 2XTJB 5FA4B 2QEJA 1MCHA 2Z92A 1JWUB 2CK0L 5FM8A 2EECA 3MLXL 1XGQA 5FCUL 1A5FL 4O9HL 3ARFC 1WFNA 3IDIB 1WBXA 1P7KA 5TE4H 1DZBA 1SBSH 3PV6A 2MJWA 5DHYA 3HCVB 1E6OH 3PDDA 4HH8A 3LD8C 4LU5H 3ECBA 5GGUA 1TETL 4XNUL 3C60A 2CO7B 1FIGL 3UTTB 2PO6D 4X80L 1L0QA 3QEGL 3IS1X 5FM5M 4KRPD 4G5ZL 3SBWC 2ZUQC 4HF5H 1WLHA 4N0FA 1HYRC 3QDGA 3CC5B 3LZFH 3U4EB 2WV3A 3CX2A 4P48A 3LS4H 5DURB 3MRQB 4V2CB 5JZ7D 3EYQC 3O2DH 2D7NA 4I5BB 5D8JH 1YECH 4XAKD 3CNKA 3FRPA 4HDIA 4HKJA 2NY4B 4H20H 4D9LH 5E94A 2DIBA 4N1CA 4W81A 2Y06L 1UZ8A 5EU3A 3UBXG 1TDQA 3AS1A 1JPGB 1YC8A 3OF6A 4G9DA 4AL8L