2W9DH

Structure of fab fragment of the icsm 18 - anti-prp therapeutic antibody at 1.57 a resolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGPELVKPGSSVKISCKASRNTFTDYNLDWVKQSHGKTLEWIGNVYPNNGVTGYNQKFRGKATLTVDKSSSTAYMELHSLTSEDSAVYYCALYYYDVSYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQSVTCNVAHPASSTKVDKKITPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ICSM 18-ANTI-PRP THERAPEUTIC FAB HEAVY CHAIN
publication title Crystal Structure of Human Prion Protein Bound to a Therapeutic Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9dH02
5ICXB 4Y8AA 3WNOA 3CVHH 2VE6B 1LO3H 3LS4H 4I13B 4GAFB 1BOGA 1CF8L 4Q58C 3T0DA 5IJKC 1NFDE 3NA4A 4NBXB 5BRZA 2HG5B 3GIVB 1AY1L 4NPYA 4R3SA 2IAMC 1Z5LA 1DDHA 4KROB 4ZUSB 1IAIH 3CX5J 3H9SB 4AMKL 2BJMH 2UWEB 2ED7A 4U1KA 4HH8A 1TDQA 4P2CG 1DBBL 4XPTL 1K85A 3TYGH 1OSPH 1QLEL 4LEOB 5D7JC 3VWJB 3ULVF 4NUGL 4JRYA 1HOCB 4XAKE 4JM2D 2ATKB 5GSRB 1QHOA 2KQNA 1ES0A 4XPAL 2EYRB 2E7BA 3GI8L 5KJRH 1G7JA 2EDQA 2IG2H 2VSDA 4WV1B 4NZTL 1S5HA 4OZGB 4P59L 4XNUH 2YRPA 1JWUB 5C3LD 1UM4H 4YBLC 5A2KH 1K3ZA 1H3PL 4QGTA 5L2KE 1OW0A 4EI6A 3C8HA 3VFVB 2X7LB 5GRXG 3EBAA 3QDME 4K2UL 2F19H 3ZHLA 1WFUA 1XCTB 5HHME 2OZ4H 1J18A 2NY1C 1H3XA 5E6IC 3BUYA 3RJDA 4XBEH 2WV3A 1IC4L 5D2NA 3BVNB 3V4VH 4M6OH 5C0AD 3WSQH 4L3CB 2Z0BA 3ZTNH 4CBPA 4DN3H 2DYPA 1WBYB 1F6AA 4HUWA 4AZ8A 4IRSD 3U36B 1IC7H 5HHOA 4MMXC 5JXEC 3FFCA 3CFDA 1DVFB 1J05A 3CXDL 4HWBA 3QUZA 4KKAC 2VDLH 1A4KA 5HYQA 4XNMA 3T4AB 3CCHB 5AZ2H 5A16A 4J8RA 5EUOF 1BFVL 2YA0A 5CSZB 3BO8A 4KKCC 4Z7QF 3IXTB 1SEQL 3ELAT 3Q0HA 5T1LA 3MRGB 3KWWB 4C83B 3HE7B 4ALAH 2EH8L 4N0FA 1U8PA 3KPQB 4N0UB 5I1GL 2VAJA 3OPZL 1OAUL 2WP3T 1B0RA 2JCCF 1YEHL 4TVPL 4LNRB 3TIDA 1A7NL 1A9EB 3QG6A 1AGBA 3BPOC 4EQ2A 1DL7H 3TBSA 4MAUH 5GGQH 3BZEB 5CS7A 5JPNA 4M3JA 1KUMA 4WO4D 2ZOKB 2DWEB 3WUZA 8CGTA 4PP2B 1Z0NA 5JPMB 1CL7H 3QP3A 3AC0A 5C0BB 3FTGB 5L8LB 2X89A 5D7LE 2BVUA 5D96C 4CDHA 3CD4A 2B7DT 4Z78B 4RMSA 3SGKC 1TZGH 1X5IA 32C2A 2ZCLL 4FMFA 4WRLA 1IQWL 3KAAA 4BZ2H 5DA0B 5D5MB 4ODWB 4UIMA 3GKWL 4OB5L 1UM5L 4G43A 1HILB 3KXFD 4XNQB 5F9AC 5F1NA 1R3LA 2VLME 3DUUB 3LSOA 4KUCD 1UACL 1RZJL 2DM3A 2ZG3A 4YC2C 1G7PA 4LU5L 1UXWA 1RUMH 5GGRA 3AAZB 2R69L 5E2WL 1X9QA 3OKLA 5FGCB 1X5YA 1WV7T 2F74A 4HHAA 1JHTB 3HE6D 4M5YL 3VMNA 3MRFB 2HT3D 4MXQD 4F2MA 4ZS7H 1R5IB 1J0IA 2YRLA 3NPSC 3R06A 2QR0B 3T2QA 1PFCA 2EE2A 1MCIA 3I6LD 1IGMH 1QKZL 2FLBT 4FXGA 4DZBA 3GBLA 4HWBL 4U7SA 5CEXB 3RVWD 5DQJB 5EU4A 3MJ7A 4ZG1A 5DJAB 2KKQA 5C0RH 4L4VA 3UPRA 2DMKA 4O58L 4PTTA 1U8IA 4ELMB 2P42B 4JFDB 3NIDE 5IHZA 3DMMC 1YMMA 4FQJL 1PVHA 1NC4D 4IDLA 2FIKB 4OGXH 3BPCB 1Z0MA 2XA3A 3QIBB 3GDBA 1ZVSB 2NX5E 4WU7B 2HYMA 2M26A 5FGRA 1IILE 5T5FH 4WU5B 5J1AA 3G5YB 2P5WA 3O2VL 3X3FL 1FFOB 1A1NB 3FO9A 3GMPB 4OF5A 2ZNWA 2V5SA 1EA9C 5K9QI 1QOKA 4AIZB 1KCRH 5TE4L 1B2WH 1H3VA 3VFWB 3HUJE 3SKNB 1RZKL 1Q72L 4OKVA 2NNAA 2AXJA 4YGAB 3TN0C 2AEQH 4J12A 4EDXB 4X83A 5JW5B 1J1PL 3GSVB 5IJVB 4C55A 5HHXH 3IAQA 1NGZB 4NZUL 5GPRA 3TVMC 3ZE0E 2GKIA 4OM1H 2XV6B 1ONQB 3UJIH 1AIFA 1CG9A 3EOAA 5JHDD 4NP4L 4V1DD 4KK6C 3GJFK 3O6FD 5D1QD 5GGUB 1RUPH 4LVHB 5BO1H 5TQ0L 1UCBH 2CDFB 4IRJD 5JOPE 1JPTL 4HJJL 2V7HB 1CK0H 2VL4A 1WQVT 4ZAKA 1N6QH 3S5LA 5I15L 1A3LH 4APQD 4MJ6A 4BUHA 3TZVA 1MHCB 3OJDB 3ARTA 4PV9A 3QNXB 4XVJL 2APBA 1TNMA 3CSBA 1B6UA 3DIFB 4UB0H 5C0CA 5KSBA 5DURD 3PWPA 4QRPB 2X4SB 4P2QE 4ZS6D 3O9WC 1C7TA 5BRZD 1WAAF 1ZE3C 4GS7C 5IW1A 3L3HB 5L0QC 3HNVH 1A5FL 4NYLA 1BVKB 3IDUA 4ENED 4GBXA 4QRTA 2VLKB 4HX1B 5JO5A 3GMMA 1DUYA 4G7YL 4DQOL 3MUGB 4U3HA 4JRYD 4BQ6A 5LBSH 3RUGA 1SYSA 4ZOEA 2UWEE 1IFHL 1NPUA 3RX5A 5DO2C 5IQ9A 3L6FA 3JV0A 3S37X 4YDIH 3LEVH 3QRGH 1FE8L 3GSNA 4K3HA 4L3EE 3ARGC 4HKBB 1F3DJ 3Q1SH 1IAMA 3K8LA 1CI5A 3U30C 1WGOA 2EC8A 3GSXA 4TVSa 5SX5H 5H37H 2W9EH 3IKKA 4O02H 2VXQH 4XI5C 2E6JA 2WW8A 1DQJA 5KSVA 3T3PE 5KVGH 2H8PA 1W72H 2NZ9D 5KSAB 1NUNB 2A6IA 2I60L 4JHAL 4P46C 1CGYA 2BSTA 3P9WB 1X44A 5DJZB 2X70A 1EUUA 1MCEA 1NJ9A 4OFPA 3G5ZA 2DYPD 3AS3A 3LHPH 4AG4L 5HHOD 2NTFB 5EBLB 3EOBB 1BJ1J 1QA9B 1C5DA 1OAKH 4OLVH 3QUZD 1A7RL 4ZQKB 3BP7B 3MLWL 1FAKT 1N7MH 2R1WB 2YPKA 3LN5A 3CPLB 3PGCB 2F8XC 1KTKE 2EDTA 5JUEH 3CDCA 4AIOA 3IFNH 4HMDA 4NDMA 1GL4B 3IRPX 4N90E 5I1HH 3OTTA 3WN5A 2ZUSA 3WL9B 2ADFL 5T1LD 3FO0H 3MACH 1G9NL 3IFPA 5DJDA 1UZ8A 1EHAA 5D72L 3Q6GH 4JQXC 4M3KB 4P0DA 4U1MA 3MNZA 2OQJB 2XN9A 3ISWA 3VXNA 2HJLA 3QQ3B 4JPWL 1HHJA 3PL6C 3WEXA 1CT8B 2XWTB 2HA1A 1F45A 2XG4A 2BSSB 4JHZA 4G7VL 2P43B 3DNKA 1I9JL 3TA3B 1AO7E 1QYGL 1AGFB 2CUMA 4PJBF 1EHLH 1M4KA 1A6WH 5F89B 2DDQL 3KLHD 3SY0A 5C0GB 2IPKA 4HT1L 2AJUL 3VXMA 2CO6B 2KH2B 2X89D 3ZT5A 4ZDHA 4KQ3L 3UTTD 2CPCA 3ULUD 1DBJL 3ET9F 5F97E 3EO0A 3EYUH 5EZIH 1G9NC 4BQBA 3ZZ1A 3C5JB 4K7PL 4W4OA 4UINL 4HF5H 2O5ZL 3BP6B 3WNLA 1C16A 3V6OC 2FJFB 1Q0YL 2BNRB 5EU6A 2ITDB 3Q5OA 3U4BH 1E27B 1ZHBA 4TUKL 2JJTC 2K7PA 1HHKB 3DPBA 3HMWH 1BEYL 3DVFA 4PJCE 2Z91B 3OKNB 5ERWB 4E41B 1CFVH 2EIZB 1I4FB 4Y5YA 2CH8A 4UV7L 4NT6A 1T5WB 3O0RH 2AJZB 3C5SB 2M2DA 3GO1L 5ILTL 43CAB 4FQIL 5FDWB 1HH9B 2NY2C 2XQBH 5I18L 2MHAB 4ZODA 1X6NA 2NLJB 4FFWD 5IEKB 5E94A 1RK1A 1MEXH 4L4VD 3KHOA 1GGYA 3H3BC 5C0DB 1R24A 3H7BB 4JY4B 3OHXB 2YD4A 3O4LE 1KTLB 1FFRA 2GITA 1YMMD 4PG9A 1GZPA 5C7XH 3V7AG 4MAYB 1DQMH 3GB7B 1UJ3B 4GRLA 3S88L 4JO4L 1BZ7B 4JFDE 4NKDB 3RWGB 1EFQA 2WP3O 5JLZA 3WLBB 1LK3H 2EZ0D 3E0GA 4F58H 4JG1H 4NFCA 2BERA 2P5WD 4TRPH 1MVUB 3IFLL 3KG5A 4KRPC 3FT2A 1DZBA 4ODHH 4I77L 4HS6B 3WXVL 3RTQC 3QUMB 1ZANH 2A6KA 1WT5A 5B3NA 2H1PL 2CDEB 3BAEH 3KYKH 1QP1A 3V5HA 2R29L 1U8QB 3OR6B 4PS4L 1GGTA 3QEQB 1X5HA 1CLOL 3KPRE 1S9XB 3BXNA 4XMLL 2ARWA 5F7NC 3HI5H 3LKNB 1U91A 4RFEB 1JJUA 2P47B 2YKLH 4JAMA 3E8UH 2ZPKL 4FOMA 4HPOH 4JKPL 1U8KB 1F3RB 2BY1A 5FYJE 3BEVB 4FQXC 1JTPA 4LPWA 1A6AB 1V5JA 5DJYB 4JCMA 1UQSB 4Z5RA 3SGEI 5HY9B 5E8NB 4RMQA 4XNXH 3SQBA 4LLQB 4ZAKD 3CU7A 4PJIA 1D5ZA 1LP9F 3TZVD 3SO5A 4P9MH 1MHPL 5DD5L 1REIA 3L1OH 3WUWG 1LEIB 4QHUA 4R0LB 5C0CD 2FWOA 2Q7NA 3PWPD 1KENL 3O8XB 1TETH 3WLWC 1MCQA 2JKXA 2ATPB 4MJ4A 4XNYH 3VG9C 4PJEF 4NHUB 4DKAA 4Q9RH 4X4MA 5F1OB 5IK3A 3QDJB 4GBXD 4YHPA 5ID0B 1SBSH 1U3HA 1X4XA 4I18A 3VG0L 1D5MA 2ZCKH 1XCQB 3JV4B 2VH5H 5D6CA 5ANME 1MFCL 3JSSA 1FLRH 2GY7B 4UILH 4NRYB 2A9MH 2VLKE 2XYCA 4WWKA 4JDVA 2DIAA 4LASH 1EHNA 3NIGE 1F90L 3DMMB 2J12B 3D2UB 2B8OT 3Q3GB 2Y7QB 3BPNC 3RNKA 4BH7B 5FB8B 4N5UA 1YPZA 3NZ8B 5ITFB 3EZ8A 5ADPH 5L88L 2VDRH 4DEPC 3TO2B 3W9DA 1JGLH 5JZ7D 3STLA 3I3DA 5T1KB 2GEEA 4R2GC 1YZZA 1RIHH 1A7PH 2HTLD 1JRHH 4ZFGH 3C09C 3MGAA 2CMRH 4U1JA 3SGJC 1R3KA 2PKDA 2ZG1A 2ZUQB 1T21A 4X9IA 1DSFH 4I4WA 4I3RH 4NN6C 3L95A 3D85A 1RPQA 4HIIA 2GI7A 4LLUA 3QUKB 3EFFA 2JK5A 2M1KA 5DD0L 2B1AL 3DGGA 4OLXL 5BOPA 3KYOA 4QRQB 5HHPA 3OL2A 3P9MA 1CR9L 5CGYC 1OCWH 2UZYB 5J11C 4FQLH 2ZJSH 1S8DA 3MRJA 3T65A 4XCNB 3WUWB 3GSWB 4QOKB 4QTIL 2GK2A 1DJSA 4X6CF 4WW2B 4R97C 5F7DA 1F00I 4PRID 1FORH 3IFOB 4NFBA 1AKJB 4PB9H 3DX8A 4OCLC 4XP4L 1MJJB 5FM4A 3AY4A 2XKNB 1LE9A 4NQSA 1MJ8L 3L5JA 4WW1A 2XN9D 4WFFD 1S7QA 3PV6A 3B2UD 3MBXH 4JZOA 3UBXI 4I0CC 1FO0B 1A14H 2ICWA 5CBAB 5C2BH 4NBZB 5KVFH 4O2EB 1JK8B 2V5MA 5CD3A 4P5TC 3VXQA 1I7RB 5TQ2H 4Y16A 5HDLA 3QWOA 3VXMD 4RA3A 4NWTH 5F7FA 3HKFA 4ZO6A 4F9LC 5H35B 4GMSH 3ESUF 1U8MB 1YUHA 2VTFA 3AM8C 1M71A 2Z31B 3JXAA 4JPVL 4LLWA 2CO7B 4RX4A 4WFED 4Y2DB 2O5YH 1CF8H 2BVQA 1YECH 4J1UB 1A1OA 3FO1A 1NL0H 4FTVB 2N7AA 1RI8A 1TENA 4X0KB 1J0ZA 3MFFB 4RGNB 1AY1H 1PYWB 4NO0D 4MQ7B 4KH2A 5EU6D 5C0IA 1CDYA 5IM7A 4KZEL 2NY3D 4AMKH 3QNZA 3QCTH 3MRDB 4OIBA 3BQUC 4XPTH 2PTUA 1G9EA 3WO4C 4NUGH 3MYJB 3QG7L 5E1AB 3T3ME 4B50A 3WIFA 3CH1B 5DTFA 5EBWB 1U41A 5H94A 3GI8H 1WITA 4NZTH 3RBSA 2V17L 3WJJC 5EA0L 1F4XL 4PLOB 3W0WB 4P59H 1QFWL 3FRPA 1CFQB 1QBLL 3D39A 3D69B 4FQ2L 4EEEA 3LDBC 1H3PH 2ENYA 1NMBL 1CXLA 4CDGC 2KQMA 3DV4B 3EJZD 5CIPB 4Y5XC 5SWZB 4BJLA 2VQTA 3G5XA 4LDLB 5IQ7H 4YHOL 1HIMH 4G8EA 2PF6A 3VFTB 4TTGA 2BOCA 1FPTL 1WWAX 2GAZB 3LRGA 4GRLD 3QHZL 3GMRA 4JZNB 1U95A 1J88A 2VIRB 3PWJB 2H9GA 5I1KL 4YLQT 2XZCH 2BCKA 4KJPC 5DJXA 3JWOC 5B22A 4TUOA 1U3ZA 3CXDH 4Z7WA 1JF1B 4XXDA 3UTSD 2DI9A 2A6JA 2V7NA 3FQUB 3TPUA 1BFVH 4LSPH 1ITBB 3HMXH 2NR6D 5D6DA 4L9DA 2CR3A 1SEQH 3ARZA 2EO1A 1R5WB 3MA7A 4NQDD 5JDSB 3J8F7 4M61A 4X6DF 5GS2D 2EH8H 3QRFM 3QEQE 1IAKA 1OARL 1KB9K 5FF6B 1M1SA 3PWNA 3V4PL 5B8CA 4Y4KB 2A1WL 1D3CA 2K3TA 4PYGA 4TVPH 2NY4B 2IF7A 1OSZB 1A7NH 3T4YA 4WJ5A 2Q7YA 1M7DB 3G04A 1J5OH 4NUJA 3HLAB 1F11A 4MNQB 1R5VB 5F7MC 1MY5A 5C08A 4YHIA 3HZYB 5F6IB 3IVKA 3MV9A 1K8IB 4Z76B 1B6DA 4GRWH 3VCLB 1IQWH 3SCMB 1KPVA 1VACB 1J1XL 3GI9L 1P6AB 3DX7B 3SDYL 1WWWX 3BZ4A 5C8JA 3GKWH 4QRUB 5F9JB 2X9WA 2XPGA 4TSBL 4OB5H 1UM5H 3RDTA 4XWOD 1J10A 5DHVA 5H2BB 5DK2B 1UACH 2JJWA 1QLFA 4NQCB 2XICA 4LU5H 3I3BA 4QXWA 4XTRC 1DBML 3AREB 5E95B 2BY3A 3S3JA 2KZWA 2R69H 2HJKA 3BWAA 4IHOA 5E2WH 4JY5L 5E2VL 3FB5B 3HC3L 4LGSB 2VDOL 4WWKD 4HKXB 5JR1H 4D0BA 1UZ6F 5GJTL 4MSWB 1XF2B 4M5YH 1K5NB 1INEL 1L7IL 1SEBA 4MD5A 4GLRI 3MRCB 5L7XH 1NMCB 1QKZH 5E9DD 3SDAC 4HWBH 3GGWB 1DTUA 2Z93B 3DV6A 1RUKL 4LK4A 1IT9L 5E1HB 3V6FA 1MCSA 2YMXH 4C56A 3LN9A 4M00A 2HTKD 4LSSL 1I85A 4Z7UB 1JN6B 1B0GB 3RWIA 5IB1A 4UQ2B 2CRMA 3W9EB 4NO3B 3B3IB 5CGMA 1PY9A 5D1XB 3TESA 5BVJA 1MCWW 3DXAB 1I1AB 3GJEB 5B39G 1X4ZA 5EBMA 5DS8A 4I0PB 2HRPL 5ICYB 4RSVA 4JM2C 1MIML 1WIPA 3O2VH 3X3FH 2PO6C 4OF0A 3WNKA 2VL5A 4ONGH 3TGXA 1FVCA 4GRMA 4PJXB 5TE4H 1MY7A 3U82B 1C5CH 1TZIB 1S7RB 1RZKH 2EIDA 4C57C 1Q72H 2R39A 4KC3B 5FYLE 1T66D 5AG9A 1DANU 4KHTL 4HC1L 1OB1B 2PR4H 3HC4H 1P5VA 2QSQA 2BHUA 4PGBB 3SJVB 3HUJF 2J5LC 3DI3B 1NBVL 3MROA 3VD5A 3DTXA 5IB4A 2KUTA 2DWDB 3V6ZA 4NP4H 1QLRB 3DVIA 1ZLUK 1KCSL 5DR5L 2EECA 2VUOA 4P23A 5D7IE 4W6XB 4RWYH 1VGKB 1S3KL 2GY5A 4GMTL 2VLLB 1I7TA 3ZE0F 4ONHA 4AYFA 1EVUA 1YEGL 4IRSC 4RA0C 2P8LA 3QCUL 5I15H 4X8JB 3IF1B 1T22B 4OIIL 4XH2B 4JG0L 4I48B 2FEDD 3NCYS 1TTUA 4RX4D 3P0YL 3QUXC 3B5HA 3U0PB 5GIRA 2XNAA 5I1JH 2ICES 1A6ZB 2ADJA 1A5FH 3C8KB 1GZQB 1TPXB 3MV7D 1D5BA 5H37G 3BGMB 4JFOA 4DQOH 3NFPB 5B39B 4PJ8B 3RU8L 3E6FA 5DMKA 1ZT1B 2XWJB 3H3KA 2DLFL 5DC9B 5TE7L 1IFHH 1F4WL 4L4TA 5L8JB 4F7MA 5ADOL 4BK4A 3PNWA 4N0YL 4B53A 2R1XA 4CW1A 3VI3E 3CZJA 2KPNA 4PJGA 4K94C 5SWQA 1BZ9B 2A6DA 2J8UE 3D39D 5IBLD 2AJVL 2UWEF 4I2XB 4PJ7E 4AT6A 3EGSB 4Y19E 3BHBB 3WIIL 1VERA 4EN3D 4NRZA 4HGMA 1Q9LA 1A8JH 1CXKA 2HN7A 1ZA6B 2YUXA 5CWSB 1P7QA 1VFAB 3HFML 4HIXL 1NBYA 4WTXA 3SE3A 2IAND 4G6AC 3Q6FB 3BD5A 3GMQB 2DQEL 4OZGF 2EDRA 5A2FA 3PHQA 3CSGA 3X14B 3MTRA 3T2OA 2I60H 2XT1B 1HYSC 5F3BA 2MKLC 5GQBA 3T3PF 4CMHC 3ZYZA 4G9FE 3JTSA 5HYFA 4PRHB 4Z77A 1NCDL 1M05A 1E0OB 2YXFA 4AG4H 1XGUB 1OAQL 1GGIL 5IMLB 1QR1B 5BS0B 5SWSE 4HZLA 3UTOA 1ZOXA 4YBHA 4UOW0 1KPUA 3IDGB 3ULSB 3FO2B 2HKFL 1ERNA 4LLAA 4MA3B 4R4NC 2R2EB 3QQNA 3MRKA 2X9XA 4M7KL 4KAQL 3SPVA 1VSCA 4S10A 3B9EA 4LAQL 3LKSA 2AK4E 1RAMA 2ADFH 5IVZA 2ESVB 3UROR 1OQOA 1G9NH 3VXPA 1N64H 5T3ZE 1H8SA 3I75A 5D72H 5FKAB 4XMPL 1YEEH 1MPAL 2OJEA 1U8HB 4JPWH 3HG1A 1U8NA 1CIDA 4G6FB 1IL1A 4G7VH 3T8XA 5IB3A 4QTHB 4O2FA 4UNVA 4MJ2A 5K59F 4G8IA 4MA8L 4PGCB 1QFWM 2ED9A 4HT1H 2AJUH 4LARH 3OJ2C 5C08D 2WBJB 4XGZA 3RZWA 1EBPA 1S9WB 2FATL 4H8WL 1L0QA 5EOTB 1HSBA 1XT5A 2PXYB 3MV9D 2VQ1A 3V6OE 3GSRB 4KQ3H 3F7RA 1I9EA 2NY6B 2CIKB 4HK3N 1DBJH 4MS8D 1S7XA 5FHBL 1T3FA 5KN5B 1QVOB 3WFHB 4ZFFB 5E08L 3QAZB 5DK0A 5IMKB 3AS2A 1YEKL 4XBGB 1MFDL 5D93B 2AEIT 4K7PH 4RNRA 3LMJH 3OR7B 3RDTD 1TNNA 2DLEA 1WWCA 1YNTA 3VA6A 2AAVA 1Q0YH 1MHEB 3ABZA 1EK3A 4XZUA 5FO9B 4PD4J 3EKCA 5AYQA 3STZB 3DVGA 1QQDA 4TUKH 3QIUC 5CHNA 1PLGH 3DUSA 4LBEB 4ETQB 5JW3L 2IEPA 1C08B 2AI0H 1BEYH 4F3FA 2BP3A 1PEZA 5I76A 4IRJC 3TBWA 1CICC 1AXTL 1XF5A 4JO1H 1FDLL 2BDNH 5BJTB 1JNHA 5D5MF 1AGDA 4UV7H 2CLVB 4Y0GA 1UWXH 3BW9B 4ZNEA 2FDBP 4MDJA 4FQIH 3LN4A 1L9NA 2OTUB 3ARDA 4QLRA 2HH0H 2R2CA 1HQRA 3QFJA 5I18H 4X7TB 5C09B 1FNAA 5ESVA 5EIVA 4MNHB 4KK8D 4YK4C 3P4OB 4GAJL 4C4KT 1Q9WB 4C56D 4KMQA 5EUOA 4ZS6C 2NY0C 3CLFL 2BNUA 4YWGL 3EYFB 2A0LD 1W0VB 2PYFB 3EO1A 5I66A 4CNIB 1Q94B 1CGWA 3RZCD 5HGBB 3S88H 4JO4H 3ZDZE 4YH6A 5HHVH 5IIEB 4LCCA 5IMOB 1H5BB 5JW4R 4KI5C 5AYUH 1Z9OA 2R56L 4PRDA 3ULVL 5ELIA 4ZOBA 4LHUA 3IFLH 2QEJA 4PY8J 5IUSA 5MHSD 4J3OC 2VXTL 4OUUB 1BVLA 4JZJC 1CGTA 1BJMA 2JTDA 4I77H 4PGZA 2A77H 2P5EA 3WXVH 3RVUC 2DJ4A 2H1PH 2GUOA 5JA8B 1CDBA 1KC5H 2LVEA 3MGTB 2APFA 2UYLA 1OOAA 2BSED 3ARFA 4XMLH 5E8PB 1NGXA 4NOFA 2NZ9C 2ZPKH 4JKPH 3SJVE 1IRAY 3S35L 2X9YA 3LKOA 3TM6A 1NEZA 3WBDA 2O61A 1VENA 2MCPL 2VXSL 2GSGA 4PBWD 1XGQB 2R4RL 1F2QA 1FV1A 3MRBA 5C07A 2BVEA 5DEFB 3RWFA 5TDPA 1MHPH 5DD5H 5FO8B 1EXUB 3MV8A 2WZPD 4MGXA 3MJGX 1LDPL 3FT3B 1XIWA 4B7IA 1GGBL 5DMIH 3BDYL 3HPJB 2Y5EA 3QO0A 1ZHLB 3BIKB 4XCFL 1KENH 1QSFA 4L5FL 1D5XB 5D2LB 3ZSSA 3VFPA 3QUYA 2GW5A 2HFEA 5E8EB 4NQEE 4UT9L 5JIHA 4LCIL 3UXFA 1NC2B 4OZHB 4NHCH 4OJFL 2P8PB 3MLXL 3OAYH 2A9NL 2J88L 1F4YH 1MJUL 4K23L 3FT4B 3D48R 3QXAB 1MFCH 4GW4B 3TH4T 4P3DA 1AJ7H 4XP6L 1T83C 1IMHC 1K2DA 4L4TD 4WHTB 1F90H 3LPGA 4M7LT 1NFIA 1T7WA 1F3DH 2QADD 3QO1B 4J3VA 2F8OA 5I1EL 1QEWA 4ERSH 5ETUA 4U1LB 4B0MM 2R2BA 4PLKD 5JMRA 1MCCA 4TNWK 3DSNA 3ULUC 4JANB 1TZHB 1X7QB 4YDVB 5MP6L 4M6AA 1FG2B 4QY8A 2YPLB 1P7HL 2HJFA 4I2XE 1OVZA 1Q9OB 3GHEL 4OCSL 4EUPH 1JWMB 2X4UA 3QIWC 1FVDB 3BJLA 1MF2L 4Q6IA 5GGSY 3LD8B 1FNGA 1SQ2N 4DW2L 1GPOL 1D6EB 4R7NB 3IDMB 3TCLB 5BZDA 5J57B 2WBKA 4P9HL 1CXIA 5JOEA 2VOTA 3M1BB 1P4LB 4XVTH 3MRNB 2W0FB 1DUZB 4U0RB 3JTTA 3SDCC 3ZTJH 4YUEH 4P3WA 4OLXH 1BJ1H 5FM5M 1U2CA 4HUVA 3CSYA 1AFVL 5KANI 1Q9KA 3KJ6L 2IJ0C 1J8HA 2IFGA 5C0AB 3R1GH 3U2SA 3OKMB 2BOBB 3SGDI 1IM3A 5BS0E 1BOYA 5CBEA 3KPSE 2FR4A 3I85A 1A22B 2F53E 4JY6A 2ADGA 1XGRB 5DI8B 5HVWA 4PJHB 1H8NA 1WAAA 3MREB 4ZUUA 1X5AA 4B41A 4YGVB 1ZLVH 1KELH 1MJ8H 4P9HC 3RGVA 5IHBA 3FB8A 4EBQL 5EN2B 4G80A 1FH5H 3OBAA 1PQZB 4L9LB 5A3IC 1CE1L 2HVKA 5SV4A 2EZ0C 1AHWC 4JFXA 1MIEL 4WFHD 3HZVB 3MPCA 1ZXQA 1AP2B 2YEZB 5JORB 3MMEA 2CDGB 1E6JH 2AXFB 5DUBA 3MLTA 4FQHA 5ALCL 1QO3B 2I24N 2Q76A 4YFEA 4GKSB 5F7WC 1RZIB 4Y5VA 5E5MA 2YD2A 4X4XB 4IS6A 1T2QL 3BI9X 3NACL 1CD9B 3MRPA 4OIAA 1M7IA 4WO4B 5HDBE 4NBYB 3D18A 3ZYIA 1QRNA 3VRJB 4AQ1B 3VFRA 5GRZA 5BVPL 5C0EB 2VDQH 4DUXA 35C8L 1EUTA 1CS6A 3PGFL 3WMSA 1MCJA 4RGMC 4KZEH 3MGOA 4UIKL 4LRIA 3D3VD 4MDIB 4U05A 4GW1B 1HH6A 3T77B 1OLLA 5AD0B 1W2KT 1K8DB 2QSCH 4S1RL 1E6OH 4IOIA 4ZUWB 1XF1A 2W38A 5F6HJ 4NQXB 3HCVA 2IH3A 3WS3A 5HYEA 1OD9A 1AXSA 1P1ZA 1YEIL 3ZHKA 3C6LA 2V17H 3JWOH 3ARDD 3L3DA 5EA0H 1F4XH 3TF7C 3AB0B 3KPTA 3HE7D 3PWUB 1QFWH 3U9UA 1SJEB 4PLJC 1QBLH 1A7BA 3DGCR 3T3MF 3QFJD 2CUIA 4FQ2H 5DD1L 4XXCC 1NMBH 2G2RA 4MNGE 4L4JA 5CP7B 4OD2A 2NW2B 3HE6B 2VAAA 3EAKA 3OKKB 2AXGA 2DLGA 4PJFE 3ZE1E 2FO1A 3DX6A 3S4SG 2F8VA 2VZ3A 4YHOH 5GS1A 1FPTH 3QFDA 3QHZH 2B4CL 5DXWA 3C2AL 3EDDA 3IU4H 4EI5C 5I1KH 2WANA 4LHUD 3PG2A 4PRPA 1MWAH 1NC4B 4M7ZC 2DQDL 2P5ED 3GEWB 2ZUUA 1RJZB 3P73B 2MJWA 3N85H 1RSFA 1I7ZB 4CU7A 5JZ7C 4JN1L 2AP2A 5D71L 5DVOA 3KPPB 4OLYL 4OF7A 2ENSA 5F7EL 5J12C 1RURH 3L3IB 3ZT6A 3ARFD 1N0XH 5AAWA 3WIHA 3B2VH 1F4AA 4OI8A 4OD3H 4R96A 1OARH 5IFHH 3AMLA 4M4PA 4X9BA 5SX5K 3V4PH 1E28B 3IJYA 2MSPA 4OM0L 5IESH 2QQNL 3RWDB 4HWZB 5HVHB 3LH2H 3BESR 4U1NB 4GSDL 4HIJB 3TIEB 5LVEA 1L7TL 1MFAL 2E9IA 1CCZA 2UUDH 4A2LA 2DJUA 5I71C 4MD4B 1P5UA 4MZ3A 4NQVB 4UQ3B 5JHDB 3O6FB 5D1QB 4F9PA 2VISA 4H20L 3MV8D 4WUKL 1XIWD 3REVB 1LK2B 4GKZA 2ZSWA 3VE0B 1J1XH 3GI9H 2E3VA 2UVEA 4PRBA 4CMMA 3QIBD 1QSFD 3SDYH 3PXHA 3NTCL 4KTDL 3OX8A 1S7WB 4C4KO 2A83B 2DKSA 1KIRB 2FZ3B 4APQB 1JI2A 3QUYD 4TSBH 3UYRH 4OGYL 3S4SB 3HI6L 1C12A 4MJID 5DJ6A 3PGDA 1FSKC 4NNXA 3EZJB 5CZXC 2JLLA 5SV3A 3K2MC 5DURB 5LAXA 1BOGB 3AVEA 3GK8L 2IMNA 1DBMH 2EE6A 4R4FL 4WEBL 3QQ9C 3SO3C 3C9NA 4HKZA 5BRZB 4JY5H 5E2VH 4NPYB 3HC3H 4UU9A 1Z5LB 2D7TL 2VDOH 1DDHB 2ERJC 5GJTH 3THML 3DHJA 4HK0A 1PZUB 4DCQA 1INEH 4PG2A 3RPIA 4U1KB 4OT1L 4YE4L 5HDQH 3WO3B 4JRYB 4HDIB 3VWKA 4FA8A 3KDMB 4PJDE 1RUKH 1IT9H 1ES0B 1SBBA 1KGCE 1G7JB 4UTAL 3BP4A 1GIGL 1S5HB 2CLZB 4LSSH 5EC1A 2ZCHL 1NGYA 3WIHL 3L7FA 2OK0H 3ALPA 1UVQA 1S9KC 1DLFH 4EI6B 2HMID 4PJ9A 5TPWH 5ID1A 1MIMH 4UZGA 4ZXBA 4HFUL 1IKFL 5C9JA 1ADQA 3BUYB 5DRWA 4RZCA 2H3NA 4ZSOE 1AD0A 5D2NB 1C1EH 2AABH 2MPAL 3HR5A 4X98A 1MQKL 1CTNA 4JO2L 1ZVYA 2C4XA 4P4KA 4GG6E 4KHTH 4HC1H 2DYPB 1F6AB 5D7KE 4HUWB 5C0AE 5HHOB 5F1KC 3BSZH 3ARBA 3B9KA 3CFDB 1J05B 3S36X 4L29A 4LFHG 1NBVH 3Q2CA 1P4BL 4PJ5A 3QUZB 5DQ9A 1A4KB 5HYQB 4XNMB 5DHVH 3FAWA 4M93B 3RGVD 4U1HB 5A16B 4J8RB 1G6RA 2CXKA 4KVNL 1KSRA 1KCSH 2AKRA 4S1QH 5DR5H 3BO8B 4HMCA 1BREA 3KLDA 2LQRA 4GMTH 5T1LB 5J13C 4NZRL 2V2XB 5CP3A 1YEGH 1PG7L 1U8PB 3QCUH 4G5ZL 2PN5A 2CK2A 4EKXA 4OIIH 4QXUH 5HYSA 3T0EA 1B0RB 4PYHA 4TOYL 1CGUA 3QQ4A 3TIDB 5LJYH 4LCYA 1AGBB 3TBSB 3P0YH 5JPNB 2BHYA 2IBZX 4HJ0D 1QRND 1T03L 2E6QA 3UTPE 1WWBX 2FO4A 2EXYC 3SDDA 4YJZL 4KJQD 4WUUA 2HT4C 3SE9H 2L0DA 3NFNB 32C2B 1NGWA 4FHBD 1VGEH 1YN7A 2Y6SD 4UIMB 3RU8H 1DBKL 1KB5A 4G43B 4FNLL 1F4WH 5F1NB 1UYWL 3V8OA 1R3LB 1ZTXL 3LSOB 4Y4HA 5ADOH 3DETC 4N0YH 1R3JA 3RGHA 3QEHA 1ADQL 4M43L 2N56A 2IADA 1G7PB 5F7UA 5E2UL 1UXWB 3ROOA 2ICEA 1NAMH 5I74C 4C58B 3KXFE 2FCBA 2GK0A 2X41A 3E2HB 3ZMRA 5GGRB 2FX8L 1PEWA 4KTEH 3OKLB 3U79A 4LSVL 5F1SA 3WIIH 5JQHC 5BOZG 5MEOA 3N9GH 5IROC 2RB8A 2F74B 4HHAB 3VI3F 1BD2E 1QBML 3S5LG 3SE8L 4X4YA 3BGFC 5K9JL 4F2MB 4L8SC 4HIXH 3E1F1 3R06B 1OQXA 4PRNA 4XWOC 4DZBB 4FXGB 2PYEA 4FS0A 3BT2L 1VPOL 1HEZA 3KPOA 3ES6A 3LZFL 2AEPH 4F7PA 5EU4B 3MJ7B 2CKBH 2QKIA 2YN3A 1G6RL 3H7LA 2DI8A 4JFFA 5CEYA 3I6LE 1FFNA 3AFLA 4KZDL 1I7UA 4L4VB 5DLML 3UPRB 4PTTB 1U8IB 3TBYA 3FL7A 5MENA 1UB5A 5IHZB 4PRPD 1YMMB 5BMFH 3MRMA 1OTSC 3K1DA 4FQ1H 5IVOA 4Q0XH 1GGUA 1QTYT 3QNYA 5JTWA 2KL6A 4LLYA 5HD8D 2BNRD 2MMXA 1U92A 1CWVA 2XOTA 4TTDD 5EZOH 1EAPA 1U36A 4PY8I 2WWMD 4JRXE 1I75A 5I8CA 5J1AB 1UKSA 1GOGA 4KAQH 2P5WB 4M7KH 4LLVA 3FO9B 4LAQH 3BZFA 4S1SL 3IDYB 3B9KC 4E41D 3KJ4C 1MI5E 1MUJA 2GT9A 1YYLL 4WFGD 5B3JF 4OKVB 2NNAB 3UP1A 3VFUA 2WAHA 4XMPH 1MPAH 5T1MA 4RMUA 2CRYA 3QA3A 4IEFB 5EBGA 1NFDA 3AGVA 5JW4N 1NCBH 4YBQD 4NJAH 2Y36L 1KB5L 3NN8B 5GS0L 4MA8H 2JB6A 5TGBA 3KYMA 2AJXL 3MRHA 1AIFB 3EOAB 3T0EC 2FATH 1LD9A 5FOBA 2UY6A 5INDA 4NFDA 3CVHA 1OF2A 3VJ6A 5JHDE 4V1DE 5FHBH 4RBPH 3OMZA 1B4RA 1F97A 3QPQD 5A40E 5E2JA 4ZAKB 1YEKH 3S5LB 1JPFA 4MJ6B 3TZVB 3CLEL 2YA2A 4PV9B 3LRHA 3I50L 5C0CB 4MWFA 5KSBB 5JW3H 3PWPB 5L2KA 1EJ6A 1IBGL 1BGXL 1C5BL 4XPFL 1AXTH 5IVXA 1BQHA 3QDMA 3MBEA 1NDMA 4NYLB 2AV1A 3PJSA 5JOFB 4OCXH 4GBXB 5BRZE 4QRTB 1HXYA 4U6VL 4J7RA 5BZWA 1L6ZA 1ACYL 5JO5B 3GMMB 1DUYB 1CU4L 2HFTA 3W11D 1HKLL 3D6GA 1FNLA 3RUGB 2FEDC 1SYSB 2IC2A 3VWKD 5I9QC 4M8QA 4TUJA 4MD0A 4XP1L 3P77A 4POUB 5EO0A 5IQ9B 4JHWH 3L6FB 3BN3B 4GG8A 4IIQC 4QWWD 2XFXA 5B4MC 4IOFD 4KI5E 3GSNB 3PQYD 4LPCA 3CLFH 1A6VL 3NIFE 5FAAA 3KNBA 4UAOB 3GSXB 4W4NA 5E7BA 1DQJB 4JJ5A 2IH1A 3FONA 4PJ9D 5KSVB 2W1NA 3H9HA 4RMRA 4D9LL 5KS9A 2IPTL 5A43C 2H8PB 4ZXBD 1Z6JT 4FXLA 3ULVH 4D8PB 1B4JH 2WWKT 1T20A 3S9DB 4LSQL 4Z7UF 1YC7A 5MEPA 2A6IB 2N7BA 4LSTL 2BSTB 3QDJD 1BVZA 2X70B 4P4KD 1LO3L 3LS4L 1NJ9B 1DEEA 3G5ZB 4EN3C 5FFLA 2XG5A 3DRQA 1P7KA 1KG0A 3ARBD 5CKGA 4YXLL 5I6XC 4OCYL 1ZLWH 5D9SA 1C5DB 3KYNA 1IAIL 5D7LA 1FZOA 2E5EA 3QI9C 3BH8A 2YPKB 3LN5B 2BJML 4PJXF 2XTJB 3RWEA 1OSPL 3S35H 4NDMB 1FHGA 3L3KA 3WN5B 4QF1A 3UYOD 4NNYA 1S7TA 3IFPB 3RAJL 2MCPH 3CIQA 5KJRL 2R4RH 5DJDB 4YDLC 1UZ8B 1P53A 5D1ZC 4X7SL 4U1MB 3O41A 3FFDA 3MNZB 1RU9H 2XN9B 3DYMA 3VXNB 2HJLB 4J4PA 4XNUL 1HHJB 3WEXB 1LDPH 1BWWA 4I5BA 4KKLD 3BDYH 5T3XD 2EEBA 4KRNA 4XCFH 1Z9MA 2ERJB 4OI7A 3SY0B 3WHE1 4U1GC 3AU1A 3VXMB 2DS4A 4H0HB 1KIUA 2LFGA 3MRRA 1JWSA 2F19L 4ZDHB 2XIDA 1YY9D 1WJ3A 4UT9H 2DMCA 1GVIA 4LCIH 1NUFA 4OJFH 4KQ4L 3MLXH 3PP3K 2J88H 1MJUH 4TSAL 5FIEA 3V4VL 2G5BA 3L3JA 1JP5A 3EO0B 4GXVL 3UTTE 3T1FA 4ZUVA 1CBVL 1E4XI 4QOKD 5L9DH 3ULUE 3MBEC 1C16B 1HI6A 3BJ91 5EU6B 1RVFL 3PWVB 4KKBD 2NY5C 1FNHA 1IC7L 1ZHBB 4CL7A 1T6VN 2NY3B 2OP4L 4Z7QE 4WY7L 4N5EC 2YD5A 4HZAA 1T89A 4PBXA 3QDGE 5F6HI 2VDLL 1XGPA 1FL6A 2NYYD 1WBZA 4U6XA 3CUPA 1X5XA 5AZ2L 2NX5A 1BMGA 3OZ9H 3IS0X 4Y5YB 1EH9A 4NT6B 2JCCE 4HEME 4JGJA 4LDOB 1CLYH 4HH9A 4OCSH 4G8FA 5TE6L 2PYED 2BNQE 4D0DA 4DW2H 5C3TA 4JFFD 3LKRA 2XWBA 4P9HH 4NSKA 5E94B 1RK1B 4JFZL 4LF3A 1R24B 4V2CB 1DL7L 2YD3A 5GGQL 5MEND 5KVEH 2ADIA 5FECA 2GITB 1GZPB 5ICZB 1AFVH 4NRXA 5JIIA 3KJ6H 3LCYA 4GRLB 2NZIA 3IDIA 1LO4L 5KAQF 5JLZB 5AUMA 2MQ3A 1TZGL 1LEKA 4N1CA 3BD3A 4YR6A 4N1EA 1GHFH 5IT2H 1JYXA 3C5ZA 4KK5C 4FABH 3FT2B 3EIFA 4HAGA 4JFHD 1RZGA 1TJIL 5E0QA 1JNLH 5DSCA 2A6KB 4ZMAT 3T0VA 2VXVH 3MUY1 3UZQA 4P57A 1O0VA 4JQVC 3V5HB 2OCFD 3GMLA 5GRUH 3RZCC 3O6LL 3OB0K 1PDKA 4P2QA 1MFEH 3FHQA 4YZFF 5CEZH 1CE1H 3BXNB 1MIEH 1QD0A 3G6JA 2HWZL 1OD7A 1U91B 4OF6A 3PP4L 4JAMB 3JV6A 4ZS7L 3D9AL 1AGCA 1IGML 4K3EL 3JVGA 4Z5RB 5DRNA 2P1YA 2FGZA 1T2QH 4DGYL 4XAKD 3MOAH 3O4OC 5CEZE 3N1FC 2O5XL 1KV3A 3B9AA 2E7MA 4PJIB 4OZFA 1BQLL 1D5ZB 5J3HD 5BVPH 2EDWA 35C8H 3PGFH 2ATKA 4L3EA 1ZK9A 5A2IH 1TIUA 1BECA 7FABH 2EDDA 4QHUB 5IEHA 2CRIA 2FWOB 1BAFH 3VMOA 5L2KD 1VKXA 1U42A 1MCHA 4S1RH 4WI5A 3QDMD 2VWEC 5EFIA 4BFIA 2YHGA 1LO5A 5IK3B 4M8VA 5DHXB 4KJWD 4YHPB 4PTUB 2P24A 3TEUA 1UM6L 4FQPA 5F7KC 1U3HB 4I18B 3U7AA 1D5MB 1P9MC 5HI5C 1JGVH 1UADC 3FAXA 2E6PA 3SE4C 5D6CB 4XHJC 4CN4A 4MX7A 3HB3D 2AEQL 2EDJA 5DD1H 4LEXH 3EJJX 3K8KA 2F15A 4WWKB 4JDVB 2VLJE 3MLZL 2YOCA 2AJ3B 4KRLB 5HHXL 4JRWA 3RNKB 2IWGA 1YPZB 1W72A 5I1CL 1KIPB 1UEMA 4MNQD 3W9DB 3F62A 3RIAK 4YIQA 2X1QA 4MB5A 4YAQA 3STLB 4URTB 4CAGA 1EGJH 1ZHNA 3UJJL 2R9HD 2B4CH 1KEGH 2EE3A 3VGDA 2SEBA 1SMAA 4YEFA 2DQIH 4WI9A 1MCOL 1UCBL 5SX4H 1ZGLA 2WQRA 3ZE1F 3T4AA 1ROWA 3OKYA 4G42A 4U1JB 3TO4A 4S0TD 1FYHB 1OHQA 4NO5A 1N6QL 1FL3A 5FGBA 1T21B 4I4WB 2QADC 2Q8BL 3L95B 2BFVH 3D85B 4HGWA 3RQ3A 1CDGA 1EFXD 4AL8L 3IKCA 1G9ML 4PLKC 4UB0L 1QG3A 3EFFB 3KPQA 2R8SH 5ACMA 4M6MH 4JN1H 2JK5B 5I1AA 1AO7A 3DGGB 1IZJA 1JTTA 5EU5A 3AXLA 4XVSL 1V3JA 3KYOB 4G8GA 1A3QA 5CAYB 5HHPB 1IJ9A 4P2OA 2X4PA 3P9MB 1E4WH 3HNVL 1ORSA 5D7LD 3FRPG 4HK3J 3MRJB 1S8DB 2DL2A 3T65B 2DWEA 1T2XA 3P11H 1UJTA 3RKDC 1HKFA 4Q9QL 5B38A 3WYRA 5F7DB 3CVIH 4GSDH 1HZHH 4UTBL 1JV5A 3DX8B 1L7TH 1MFAH 4X5XA 4JGUA 4P2RE 4L8CA 4NQSB 3VXSE 3SKOA 4WW1B 4PRIE 1S7QB 4J4PD 3PV6B 2GTWA 4L8BA 4JZOB 4WUKH 1YNLH 4KROC 4N9GA 5ESAA 4XNQA 2D7OA 4F37K 1JBJA 2ICWB 1OL0A 5HGAA 4PJCA 4Q6YA 5CD3B 3JWDC 4U1SA 2XN9E 2VDNH 3VXQB 3LOWA 4HWEH 3IJHA 5F9WB 2VXQL 1PD6A 3C8DA 3QWOB 4Y16B 3VWJC 4DFHA 3NTCH 4OQTL 4OGYH 1BFSA 1CDHA 3HI6H 1YUHB 5CJXA 5GZNC 1M71B 2YK1L 3VXME 3CU1A 4LLWB 4WV1C 2YZ8A 3C60A 3A67H 2BVQB 3GK8H 1KLGA 4R4FH 1A1OB 3FO1B 3EYQD 4XX1G 3O4LA 1MRDH 4O5LL 5IM7B 5C0IB 3THMH 3LHPL 3NZHH 5D2LF 2VYRE 3QNZB 3FRUA 3LY6A 2WWKO 4OT1H 4YE4H 4K8RL 3OJMB 1OAKL 4OZHF 2ZUVA 5EU6E 1ZKAA 2NXYB 2BMKA 3QISA 5F7HA 4YHNA 3WIFB 1RIUL 5DTFB 5CMAB 5JUEL 1JCKA 4E5XA 3P30L 1OAYH 3I6KA 5H94B 1FYTE 3NGBB 1IAIM 3V79C 3MZGB 4UTAH 2FGWL 1GIGH 4GKNA 4ZPTB 1KB9J 3UCRA 4ZYKA 2KZ1B 3FO0L 3MACL 2ZCHH 4H88L 4WU5A 3WIHH 1D9KA 3D39B 3HS0A 4DVBA 1RHHA 3B6SA 3FQXA 3I84A 1DVFC 3IDJA 3VH8A 4XPBL 4S1DC 1SMOA 3G5XB 2X4NA 4JM2F 3KPRA 3W39A 5IVNA 4KMLB 1IGYA 4HFUH 1NGQL 2Z8RA 4AEIL 1IKFH 4G8EB 1WEJH 2BOCB 5IJVA 1UH4A 5I2IA 3FQRA 3GMRB 1WFTA 1MQKH 3X11A 4JO2H 3HE7C 2NW3A 1U95B 4D0CA 4GKOA 2BY2A 1KYOK 2BSRA 2BCKB 3BPLB 3C5ZD 5DJXB 4TUOB 5I75B 3NCJL 4O9HL 5BV7L 4F8TA 4Z7WB 3NVQA 5L2JA 4H5SA 3U4BL 4GG6F 3EJYC 4XXDB 4BFBD 4KVNH 2A6JB 4M1CC 3TPUB 3NBNA 1DQQA 3MQIA 5FCUL 3VFOA 5ENWA 4YHYB 4HXAH 1EO7A 2YSSA 4P2QD 1NCCH 2E7CA 2J2ZA 3DRTA 1CFVL 3UTSE 4NZRH 1KIQA 3MA7B 4BZYA 4M61B 1PG7H 3STBA 1IAKB 1YDPA 4YEEA 4G5ZH 4QHMA 3PWNB 1RZ8A 5B8CB 3X3GH 4PJHF 5EUKA 3L9RA 3LKPA 4Y4FA 4NQDE 4TOYH 1KTDA 1ZEAL 4Z7VA 2XQBL 5J4MA 5ANMA 2JIXA 3T4YB 4WJ5B 3B8YA 2FYYA 4QT5A 1CFSA 3ARSA 2Q7YB 1IEHA 3G04B 1E4KA 4NUJB 2OTWA 4ODVL 1L0XA 1F11B 3ZKNC 2QQKL 2YS4A 5DYOA 5C08B 2MWCA 1N8ZA 1TITA 4YHIB 2HLAA 4PRHD 1E4XH 5EC2A 4L3ED 5IW6A 3IVKB 3MV9B 3RX8A 2K9UA 5C0JA 5I1IL 5HYJE 3U9PL 3HI1A 1KPVB 1DQML 4AQOA 2DMBA 1LILA 5C8JB 3BZ4B 4QXTA 4KHXL 1BIHA 1LK3L 2XPGB 4JG1L 3RDTB 3QJFA 4JVWA 4FNLH 1WISA 5J6GA 5DHVB 2LV4A 4EQ3A 1ZTXH 5I17A 1QLFB 1ADQH 3V52L 1Y0LA 2QLVB 3WJLA 1RZFH 1QSEE 3B9VA 4IHOB 2HJKB 3BWAB 5FYJL 3BAEL 3KYKL 4LSVH 3PHOA 3L5WA 2LVCA 4D2NA 4D0BB 1A7OH 4P3CL 3BKCH 1KXQE 4ZTOL 3QIBC 4X5LA 3SE8H 3UDWC 2BY0A 5K9JH 1SEBB 4MD5B 1ZT4A 3HI5L 4KUCF 2FBOJ 3BT2H 1VPOH 4I3SH 4U3XA 3LZFH 3DV6B 3O6KL 3V6FB 1LP9E 4C56B 5E9DE 3DSFH 4ODTH 5DLMH 1JZ5A 2X09A 3TFKD 2Q86A 2Y25A 4M02A 3FZUC 3RWIB 4NC1C 5IB1B 3I9GH 3TO4D 3OAYK 1NCTA 3TBTA 4ZFOA 1ITCA 4AM0A 4UDUA 5BVJB 1E4JA 1BHGA 5EBMB 5DS8B 5FYKH 5GZOC 3L1OL 3SKJL 2JJSC 2DQFA 2UV3A 5FYJU 3F65A 3U7YL 1HXMA 4LVHC 3LEYL 4OAWA 4G8GD 2VL5B 4S1SH 4MQTB 1CT8A 5IJKA 3BGAA 4XNYL 4P2OD 1FVCB 2QBWA 4GRMB 1T7ZA 3VRIA 2IAMA 1YYLH 1NBQA 1CZ8L 2DQJL 2YXMA 5M95B 4X5WA 1MAKA 1SBSL 3WFDH 1RJLA 4F15B 3BWUC 3J7HA 5FYKE 3MODH 4B5EA 2JF1A 3LEXA 5D7JA 1N6VA 3IDXH 5C09D 1V8HA 2Y36H 1KB5H 5GS0H 3MROB 3DTXB 4LASL 4X4ZA 2AJXH 5A1AA 5IB4B 5M7QA 2DLTA 3RWHA 3V6ZB 5C6TL 2O93L 5CZVL 2VDRL 4K9EC 3TBVA 5JNYA 4P23B 5IMMA 5HI4D 3VFMB 1LVEA 1I7TB 1ZMYA 4ONHB 4L1DA 4RMTA 3WD5L 2C4FT 1VADA 2XA8H 2P8LB 4Q2ZA 1A7PL 3X17A 4ZFGL 3CLEH 3F12A 1UKTA 1T80A 5E6IA 3I50H 4BZ1L 3D0LA 3C60D 1T1WB 4NGHL 4DOHE 2KDGA 5GIRB 2XNAB 3GSQA 1T2JA 1IBGH 3GUTA 4KY1H 1BGXH 4ISVA 1JGEA 2ADJB 1ZLVK 3HZKA 5JHLL 2CIIA 4MLIA 1D5BB 4X6CE 4U6TA 4U6VH 5JXEA 4JFOB 4ZFOL 1ACYH 3WJLC 1EX0A 3E6FB 4BQ8A 3MV7E 2X1OA 5DMKB 5KSAC 3BRGC 3NCYP 4GQ9H 1GOHA 4XP1H 4L4TB 4F7MB 2YC1A 3PNWB 1JHLH 1U3JA 2R1XB 4CW1B 1BZ7A 2MKWA 4PJGB 5SWQB 1IKNC 1D9KD 2A6DB 1OTTC 4AT6B 5HJ3A 2C1OA 3S96A 4DKFL 1DR9A 1BQUA 4NRZB 1Q9LB 1UKQA 2HN7B 3MLUL 1NKOA 2PCPA 4N68A 3TLRA 3A6BL 3CZFA 5HYIA 3KPRD 1K9TA 1NBYB 3V5DB 4D9LH 2IPTH 5KVFL 1WBXA 1EEZA 3DVNA 1GGCL 1NSNH 2O26U 4NWTL 4F7CA 4JVUA 1OT2A 1S9XA 3PHQB 3S98A 4OUOA 5F3BB 1RHFA 3LIZH 5IGXH 2IANE 3DHMA 5DA4A 1CGXA 3JTSB 4HIEA 4KPHH 3SGKA 4RCAA 4Z77B 3RVXD 3HMXA 2H26A 4G6ML 2N4IA 2FHCA 1M05B 2O5YL 2E9WA 1U8KA 3GM0A 1YECL 1FZKA 1NL0L 4TQEL 1KNOA 2X4TA 4YXLH 4IMKC 1N2RA 4QEGA 1PKQE 3CSPA 3FOLA 3TA3C 2L7JA 4OCYH 1G0XA 1II4E 2UVFA 3WKMH 1CD0A 1KPUB 1ZGLM 2YD8A 4FP8H 4UBDC 3QCTL 3MRKB 1FC1A 4NNPL 4KJYA 3SPVB 1XZ0A 3LKSB 3S34L 2WIIA 5IVZB 1P84K 3UJTL 1BP3B 3MLRL 3RAJH 3VXPB 3VA2C 1NCAL 4JFPA 4DZ8A 2YPLD 3I75B 4X7SH 1W0WA 1T1YA 1A9BA 2NY5H 2OJEB 1GC1L 5TF1H 2E7HA 5E8DH 3HG1B 1U8NB 1EO8L 2JIXD 1FCGA 4QCIA 1IL1B 4FQCH 4XC1L 2VLRE 3T8XB 5IB3B 2WWMC 4U49A 4O2FB 2DBLH 2OMBA 3FB7A 1I8MA 4G8IB 3RVVD 3JV4A 4LHUG 1DFBL 4XGZB 3L3OA 3RY5A 3QEGL 5JDJA 3TYFA 1HSBB 3F7YA 2VQ1B 5IQ7L 1HIML 4IDJL 1PBYA 3RX7A 4KQ4H 5C08E 2VXUL 4WHYH 3GMNA 1L4IA 3ZKMD 3DMMA 4HG4J 4TSAH 1S7XB 1T3FB 5FB8A 4DUVA 4GXVH 1CBVH 1UCTA 4OFYA 4RNRB 2B0SL 2F54E 5CLWA 1YNTB 1UWEL 1RVFH 2XZCL 4XZUB 1R3HA 1GAFL 3DVGB 1AR1D 1GC1C 1QQDB 2OP4H 3L7EA 5CHNB 5C0NC 2C9AA 3D3VB 4WY7H 3DUSB 5KG9A 2IMMA 3P40A 4F3FB 1TJHH 5I76B 1MNUH 2FECI 3IU3A 5ISZE 4X6DE 3ULUF 3TBWB 3V0WL 2OJZH 1XF5B 4MAYC 3TN0A 5IOPA 1NEZG 2H41A 2EDOA 2ZP0T 2I5YL 1JNHB 1UJ3C 4LSPL 1AGDB 3HMXL 3RL2A 2JELL 3GJFH 1CFNA 4F7TA 1UG9A 4DJMA 4MDJB 3LN4B 1A4JA 3ARDB 5TE6H 3WFEH 5EOCJ 1YY8A 3TVMA 5AZEL 1HQRB 3ALWA 3OV6A 3QFJB 3LKQA 5F21B 4QRQA 5ESVB 3VXRD 2D9QB 2DM4A 4XWGL 3R8BB 5HGGS 5DK3A 3T2PA 2C5DC 1AXIB 5EUOB 4JFZH 2RGSA 3GSWA 1J5OL 4UT7L 3OQ3B 3RY4A 2Z4QA 5F88A 2A2QT 2BNUB 2K1MA 1EEQA 4U2YA 4Y1AE 1NEUA 5CZKA 3EO1B 5I66B 1KF9B 4EDWH 4OD1H 1YA5A 1QFUL 3K0WA 5DRZA 3RIAF 1LO4H 4K3DL 3MRIA 1AKJA 4PJAE 1ZVHA 1C8PA 4LCCB 5D7IA 2FHBA 2GJ6E 4GAYA 2FJHA 3CH8A 2Y9RT 5EIQA 4PRDB 1UT9A 3LV3A 5LGHL 1ACZA 3N1QC 1QRKA 4LHUB 2JE8A 3O9WA 4QWWC 1BVLB 4P99A 1A3RL 3BOVA 4NN5B 4MQSB 4OZIB 4H1LH 2P5EB 1TJIH 5DQDH 3BX7C 4NM4L 4PV8A 1UZ6E 2EIBA 2QJDA 2GUOB 4LIQE 3ZHDA 4CN6A 9CGTA 4JR9L 2IFFL 4MB4A 4BKLA 3CJJA 3IYLW 3O6LH 1EO5A 5D7JD 5DHYA 2UYLB 4P5KA 4HLZG 3ARFB 4R0LC 5INCA 5JR1L 2HWZH 2OMNA 1NGXB 2X1PA 3O8XC 3PP4H 3KPLA 4Y88A 1TVHA 3D9AH 1PSKL 2V9TA 5L7XL 3D25A 2GHWB 2RCSL 1OP9A 3ARGA 4K3EH 2IGFL 4JKKA 2FBJH 3TJHC 3LKOB 2WLYA 1EEYA 1OGAA 4DGYH 1NEZB 1NH6A 2O61B 2WUCL 2GSGB 1QUNA 2YMXL 2O5XH 3MRBB 3GRWL 5C07B 1BQLH 3RWFB 5TDPB 4YO0A 2VWEE 3MV8B 2NY1D 5E6ID 3FQWA 1XIWB 4G6JL 2LE9A 2J8UA 4PJ7A 1X5JA 2DLIA 4Y19A 4OCRH 3QO0B 1EDQA 5FYLL 2R23A 5FDYA 4F37F 1IGFL 1QSFB 4P46A 4AEHH 3U6RA 3M45A 1UFUA 3VFPB 2BVYA 1EZVX 3QUYB 4P5MB 1TCMA 2HFEB 5LG1A 3LRSA 2R0WH 1V3MA 4LQFL 4MJIB 1QSVA 1MLCA 5GGSA 3DV4A 3CMOL 2ITCA 1UM6H 2FHFA 2IBZY 4ONGL 1FL5A 3MOBL 1Q38A 5JXED 2WMPA 1C5CL 3WNPA 1ETZA 3O11A 4KKAD 3N1PC 4P3DB 5KSBF 2ZUQC 2M8XA 1YJDC 2BVPA 4G9FA 1EV2E 1K2DB 2PR4L 3HC4L 3GHBH 3MLZH 4I3GA 4KKCD 1EMTL 1NFIB 5GSVA 1I1FA 5I1CH 1QEWB 5ETUB 5SWSA 1YY9C 2R2BB 1I8KA 3EW3B 3L5HA 3UJJH 1AQDA 1ED3A 4JQXA 5I19H 3HRZA 5LCVL 1LMKA 1S7VA 3RUGF 1MCOH 4QY8B 3PL6A 4RWYL 5FUOH 2R1YA 5HGHA 2AK4A 3UTZA 2VN7A 2X4UB 25C8L 2I9TA 4Q6IB 2UZXB 1FNGB 1HWGB 2APXA 3QB7C 4HFWA 4WW2C 2Q8BH 4LSUH 5BZDB 3DI2B 3PDOA 4RDQG 1G7LA 1IC5L 3RVTD 2FX9L 4AL8H 4UOJA 1G9MH 3VGBA 4YPGA 3JTTB 5F9OH 1RY7B 2P8MA 3I6GA 3UBXA 4HWNA 1ZWIA 4XVSH 1QBBA 5I1JL 4HUVB 5KVMC 2PW1A 3CSYB 2ZUYA 1Q9KB 4OZFH 2JJVA 1JZ2A 1TQBB 3CAFA 3V6OA 3U2SB 5CD5D 4HMEA 1R5VA 2Z92A 1IM3B 4JO3H 4TVPD 5CBEB 5ACZA 2EYTA 2FR4B 2JJTA 3MC0A 4GW5A 4JY6B 4Q9QH 4FG6C 2ADGB 3H9SE 2CGRH 4F57L 2Z31C 3P2TA 3LQAL 4UTBH 4Y2DC 1T0MB 5L6YL 3VMPA 4ZUUB 4G6KH 5CCKL 4IRZL 4EXKA 3RGVB 2VZUA 3FB8B 4RGNC 5J06A 1FAIH 5T5NG 4G80B 1VFMA 4XNZB 5EWIL 3WHXA 2HVKB 2WIMA 4JFXB 4RFOL 4OZGE 4LVNB 3CXHK 1TLKA 1BIIA 3MMEB 4J23A 2VITA 1DEDA 2V9RA 4OQTH 3MLTB 5DUBB 4FQHB 4ORZC 1UEYA 4M62H 2Q76B 5IB5A 2YK1H 4Y5VB 5DFVC 5E5MB 1N5AA 4IS6B 4LKCA 1QFPA 1KLFA 1N3NA 2Q87A 3MRPB 2E7LC 1VDGA 4JKMA 1M7IB 3LQAC 3D18B 4LMQI 2Q6WA 1QRNB 3X12A 2FRGP 4OFYD 3VFRB 3BDXA 3BN9C 3P9LA 1T0PB 4O5LH 1RMFL 2AERT 5IF0A 3MGOB 3QPXL 1HH6B 3FFCD 5T3ZL 4K8RH 4QRRA 2B5IC 3BISA 3RTQA 4JE4B 2FD6L 3TN0D 3QHFL 3D3VE 1RIUH 3P30H 4MYWB 3HCVB 2IH3B 3WS3B 1TXKA 3O45A 4BFGA 1AXSB 1P1ZB 2VZVA 2FGWH 3C6LB 5EOCL 4NM8H 5IHUH 3ZYJA 3MJ8A 3L3DB 4Q97A 1YC8A 1BFTA 4H88H 2GIYA 2DTML 1N64L 5K59E 1YEEL 1HDMA 3E3QC 4KK6D 2G2RB 4OD2B 1JGUL 1JPST 4FQXA 4YHML 4XPBH 1TZIA 2VAAB 4N0UE 3G08A 3OKDA 1KJVA 1P2CA 3P3YA 1YYML 3DX6B 1NGQH 4AEIH 2GQHA 3MNVA 5GS1B 5DJ2A 4LARL 3S8WA 1KEMH 2IBGA 2ZUXA 5GRJL 4YPJA 3SJVA 3MCLL 3ILQC 1ZGLP 5F7LB 1I9RL 5C0BE 1ORQA 1CLCA 2NXZB 2Z8VC 4Y4KC 3UPCA 2N1KA 1OWRM 2NY4C 4YXKL 1UB6A 3LPFA 4PRPB 1NDGA 3NCJH 3UPAA 3LMJL 4O9HH 4OV5A 1R3IH 2AGJH 5BV7H 3SKMA 3UMTA 5D5ME 1CLZH 3IETA 4NC2B 4DTGH 3VGHA 1PLGL 3P4NA 2H45A 2H2PC 5FCUH 5F6IC 4OZIE 4BYHA 2AI0L 3K3QA 1GYAA 1H0DA 4A2MA 1SVCP 2C3XA 4JO1L 4OCNC 3SCMC 2BDNL 1TTGA 5HXMA 5DO2D 4NQEA 4R96B 3PV7A 4RMWA 4BUGA 2W9LA 3DO3A 5FGCE 3IJYB 5EULV 2QQQA 4LFHD 3ARGD 3ILPA 1CGSL 2VZTA 3S37L 1ZEAH 2HH0L 4ZUTB 3WCYA 5L8KB 2OR7A 1M6OA 1OGAD 3IGAA 2CRZA 1XF4A 1CYGA 3KPMA 1WCQA 4ODVH 1I8IA 5AAMA 4L8DA 2QQKH 3AREC 4XI5D 2R0ZH 4NKOA 3NFPA 4ZO9A 2XWJA 2VISB 2CK0L 1Y6MR 1A6PA 5I1IH 3SDXA 3SGJA 3VGEA 1VFUA 1FZMB 4GKZB 2ZSWB 4YNYA 3U46A 3U9PH 4Y19D 2BRQA 5IV2A 4ELME 4PRBB 3P0GB 4CMMB 1NMCC 3MV8E 5HHVL 4P46D 1L0YA 3OX8B 4KHXH 4KXZI 2AK1H 1YQVH 5AYUL 5DJ0A 3DARA 4TSCL 1C12B 5DJ6B 3PGDB 3MRLA 4NNXB 1JHKL 3V52H 3O3AA 5LAXB 4NOBA 2XACC 2A77L 2BVTA 4LVOB 4MJIE 5FYJH 3C9NB 4HKZB 4XPGL 3SBWC 4DK3A 7CGTA 4G9FD 4UU9B 5D1XC 3CFCL 1KC5L 1HWHB 4P3CH 4ZTOH 3X14A 1I1AC 4HK0B 1JMZA 4EJ1C 4I0PC 4DCQB 4EUPA 3RPIB 5HYSG 4GT7A 4NC1E 1G0YR 4HBCH 4ETYA 4DGIL 4PGJA 4ODSL 5DGQA 1B0WA 3OXSA 3VWKB 1LE5A 1XGUA 3H8NA 3O6KH 3KPNA 1CIUA 3KPSA 1CD1A 3PL6D 2F53A 3BP4B 4LOUD 2AK4D 5F7YC 2Z9TA 3IDGA 3PQYB 1A1MA 5EC1B 3G6DL 1NGYB 3C6SA 4P5TA 3L7FB 1WC7A 1UH2A 4A6YA 1HHHA 1UVQB 2C3WA 4F9LA 3DBXA 4PJ9B 3SKJH 5DMIL 4K9EH 3AM8A 3EYSL 5ID1B 4ZXBB 4MQXC 3U7YH 3QYCA 1MHHA 5C9JB 3LEYH 5DRWB 4RZCB 2H3NB 1AD0B 5HPMA 4FXKA 4MZ2A 3HR5B 4X98B 1MAML 2FB4H 2H32B 3DX9A 2DQJH 1CZ8H 4QRPE 2QHRL 4NHCL 3SOBH 1F4YL 4P4KB 5E5UB 3BQUA 5J1SC 5EOTA 1LDSA 4KDVA 1AC0A 1AJ7L 2PUQT 3ARBB 3NABL 2X4RA 4OQ1A 5IG7A 1OAXL 4L29B 4PJ5B 5DQ9B 1FN4A 5HVFB 4AENA 1IGJA 1HK6A 5C6TH 1G6RB 1S9VA 4W6YB 5CZVH 2AKRB 4ERSL 2C7UA 4JQIL 3WJJA 5M94B 2NY2D 3BP5A 3PABA 1TPXC 4OZ4B 1KCLA 4KDTC 5TH2A 3WD5H 1NCWH 3M8OH 4PJ8C 3F8UB 1QBAA 4Y5XA 4JLRA 1U58A 4XB7A 5HYSB 1SYVA 3QQ4B 3VXTA 5DJCA 4KUZL 1KJ2A 4LCYB 4BZ1H 3K46A 1U8JA 4GXUM 4NGHH 5LKNA 5EORL 4K3JL 1DE4A 5CILH 4MNGA 4N8CL 1X6LA 2FO4B 4XVTL 3SDDB 2J4WL 2XZAL 4BQ9A 5K9OA 3NFSH 1KCVL 4WUUB 4PJFA 4YUEL 4ESKA 3TNMA 1RJYA 2APTA 5JHLH 1NGWB 4JCLA 4KRPD 4A6YL 5E4IA 1TCRA 3U0WH 1YN7B 3R1GL 4QRRD 3VGFA 3RTQD 1XGTA 3ZSTA 2ZOLA 1KB5B 2PYFA 1BJ8A 2IQAA 2XTJD 1XFPA 3QDAA 2H2SD 2B39A 4YFLF 1I3RA 4Y4HB 1SJVA 1R3JB 4DKEL 3QEHB 4DUWA 3MCKA 4OLWL 4KK9C 2IADB 5FHAL 3TT1L 1JGDA 3ROOB 2ICEB 2GK0B 4J3UA 3F7VA 5E4EB 3M17A 4MHHG 1KELL 4IMLA 3FCTA 5MEOB 2HFFA 2LABA 3S7GA 4DKFH 2AJSL 4WCYH 3MLUH 4FQXD 4ZPVA 1FH5L 4X4YB 3A6BH 2FH8A 3UAJC 2WNGA 4PRNB 4JPIA 4PPTA 1LNUA 1T4KA 2PYEB 1HSAA 4N0CD 1HEZB 1GGCH 3KPOB 3MLSL 4XAWL 1MWAA 2E8ZA 3ES6B 1E6JL 4F7PB 3F6IA 2QKIB 2FLRT 4JFFB 5CEYB 2WQ8A 4OCWH 1FFNB 1I7UB 3ROLA 1P69B 3KGRA 2EDEA 3TBYB 4ELKA 1BQHG 5EIIA 4WIQA 1GCFA 3KHQA 4G6MH 4OV6F 3VFSA 5MENB 1A7QL 1PZ5A 1UB5B 3MA9H 5I1DA 1WIUA 3MRMB 4TQEH 3WLWD 4LCWA 3QNYB 2VDQL 1WSST 4LLYB 1U92B 5FUZL 1EAPB 4WI7A 1KJ2L 3V0VA 3VXOA 2WBJC 5I8CB 1KPRB 1IE5A 5KZCD 4NNPH 2PXYC 4J6RL 2BNRE 4LLVB 4QNPE 3UTQA 5FO8A 2W91A 2QSCL 3BZFB 4QRSA 3S34H 2NY6C 3OWEA 3FT3A 1VEOA 2OXGA 1E6OL 3UJTH 1MUJB 2GT9B 3MLRH 1NCAH 4WHYG 3QAZC 3SHSA 3X13A 5EZLA 3VFUB 5D93C 3GSUA 2VZOA 3JWOL 4E41E 4KV5E 5T1MB 1GC1H 4YDJA 3MCG1 3QA3B 2FSEA 4JPKH 1EO8H 4CVUA 3SDAA 4I9WE 6FABL 4XC1H 3EHBD 1NFDB 2VDPL 4TULL 3QXWA 2JB6B 1VB9A 5FM8A 1OPGL 3KYMB 1DFBH 1SY6A 3MRHB 1UC6A 3O3BA 4BK5A 1LD9B 3QEGH 1KT2B 5FOBB 2B5IB 4IDJH 3CVHB 1OF2B 3VJ6B 2VXUH 1YN6A 3QEUA 4PJDA 3QO1A 4KTYA 3RL1A 1CDIA 3IU4L 5I8EA 1JPFB 2GTZA 2ORBL 2B0SH 3TWCL 1X4YA 5HDOA 1UWEH 2VDMH 4JM2A 4LMQE 2VDKL 2PO6A 2D03L 1GAFH 1WZMA 5CJBA 5DJ8A 1D5IL 4MWFB 3RNQA 4AH2A 1MWAL 1I9IL 4LCUA 2XQYG 5CGYD 5L2KB 1JWMA 4DK6A 5I0ZA 3N85L 2BC4B 2XZQH 5ALBL 3VXUA 3V0WH 5IVXB 1BQHB 3QDMB 2I5YH 1NDMB 2AV1B 3PJSB 5DD3L 2JELH 4U2ZA 1RURL 5EO9A 3MUJA 1H5BC 1HXYB 1N0XL 4ZSOA 5BZWB 3B2VL 3TNNA 3GM8A 3MRNA 4OD3L 5DVMA 1NCUA 1NBZA 5AZEH 3I2CL 5IFHL 4M8QB 4TUJB 4MD0B 4R8WL 4XWGH 2I9LA 1FGNH 3P77B 5EO0B 5IESL 3KPSD 4GG6A 4PB0H 5E2TL 3CDGA 2F53D 4GG8B 3LH2L 4BA8A 2XFXB 3T08A 1IGIL 4UT7H 4K71B 3N1MC 3OSKA 1CE6A 3QZWA 2X10A 3K2UL 3KNBB 4IRSA 2GSIA 1KLUA 3B4NA 1QFUH 3PQYE 1BM3H 2CXGA 4K3DH 4PUBH 4DGVH 4JJ5B 2IH1B 3FONB 3ARYA 3H9HB 3JUYA 5KS9B 4HC1A 3QUXA 5LGHH 5JQ6L 4IJ3B 1QPXA 1T20B 2AXHA 4NQUA 1SY6L 3UYRL 1A3RH 5MEPB 4PJAF 3MR9A 4XC3L 4IBLT 3UEZA 4R6UA 2ICCA 4NM4H 2GJZA 1H3GA 2DOCA 1EFXB 1U3HD 5BCAA 3CFJA 1DEEB 3B83A 4JR9H 2IFFH 3BQUD 1PX3A 5I0DA 5MI0B 2Q20A 4EZMA 4XP5H 3DRQB 1P7KB 1AI1L 3QDJE 1KG0B 3V7AE 1W8NA 3QCVH 4OGZA 3D0VA 1QR4A 3KYNB 1H3UA 5D9SB 4NO2A 5D7LB 1FZOB 3IS1X 4GAGH 3H9ZA 3ZDXE 2ZSVA 3BH8B 1PSKH 3RWEB 4HIHA 1FZJA 5HDQL 2RCSH 5EZJB 5KBNC 2IGFH 4WEMB 3L3KB 4F33A 1VEMA 2J3SA 4QF1B 2GCYA 3UC0H 1JUFA 1S7TB 2MOVA 2WUCH 1RD6A 1O7VA 4FFVD 1YJDH 3GRWH 4OLZH 3O41B 3FFDB 5IWLC 3VGGA 2VABA 1I8LC 1KN4H 4KXZH 2OBGA 3KXFA 4I5BB 4G6JH 4R90H 4PGDA 3BMVA 2OK0L 5EO1A 5HSFA 1FLTX 1V7MH 2FH6A 2VZ1A 3D85D 5FYLH 1FQ9C 1DLFL 1MFNA 3AU1B 1IGFH 4WEUD 4F7EA 2X4OA 3F7PC 3O2DA 1BD2A 4EOWL 1JWSB 5TPWL 5T3XE 5JW4M 5T1DH 4LQFH 3GBML 4OSUL 4Y8DC 1OM3H 4KJPD 3R8QA 3WE6A 3CMOH 5HBBA 3MOBH 1NAMA 1C1EL 2AABL 2G5BB 3H9YA 3L3JB 3WS6C 1JTOA 3LD8C 4ZUVB 3T1FB 5BQ7A 3NA9L 1H3WM 1X5LA 4YX2H 2EDNA 2EEAA 1HI6B 3U4EA 3SQOL 1OAZH 4JFQA 3NOIA 1IM9A 4U6YA 3CFEA 1EMTH 4L1HA 4CU8A 5FOJA 1WUNT 3BSZL 3QH3A 4QOKE 4RAUA 5F96H 3SGEH 4U0RC 2W9DH 3OKEA 1XGPB 1FL6B 1WBZB 1ZT7A 4JREB 3ZKXB 4U6XB 1PAMA 2NX5B 1NANI 3ZKMC 2CKBA 4JRXA 3NPZB 4GQPH 4S1QL 1ZHKA 2DIBA 1CXFA 5LCVH 2DLHA 4OZFG 1BX2A 3QDHA 5I73B 4Z8FL 2HRLA 1I7ZA 1ZSDA 4HH9B 4G8FB 1MQ8A 5CJ5A 4R7DA 1KJMB 1MI5A 25C8H 2C4FU 4Y16D 1Z3GL 4D0DB 1F58H 5KSUA 2CR6A 4GFTB 4XBPA 4PJGF 2X5PA 1KBGH 4QXUL 5LXGH 3LKRB 2XWBB 4NSKB 2PYEE 3MLVH 4LF3B 1IC5H 4K94L 2FX9H 1MLBA 1NLDL 3R0MA 2ADIB 4X9HA 2CLRA 5FECB 5GGVY 5JIKA 4LCWD 1EJOH 4L9LC 4LPXA 4HPYL 4NRXB 3EYVA 3IDIB 1XF3A 3SE9L 3VD3A 3W82A 5AUMB 3GBNH 4FTVE 4YR6B 1FRGL 1WFOA 3QIUA 1ZLSL 1VGEL 4RGNE 3DROA 1OWWA 4UQ3A 4V1DA 4XTRD 1A6TA 3C5ZB 2NXYD 1U8OA 1FVEA 3T1WA 4F57H 4IRJA 2ZG2A 3LQAH 3O2DL 1CICA 5HPOA 5J0BA 1TMCB 2Q8AH 1RZGB 1JL8A 4WO4C 5L6YH 5DSCB 2DKUA 5CCKH 4IRZH 4N8PA 5ACLA 1UXSA 4P57B 1YMHA 1XH3A 1FFPA 1NAML 3GMLB 4MVBD 1EAJA 5EWIH 4NCC2 4P2QB 2X2YA 4KTEL 1WZ1L 4ODXA 3D5OF 3N9GL 3G6JB 4RFOH 5LGJA 2RIKA 3W0WE 3RWJA 4XCYA 3JV6B 1O7SA 1AGCB 1INQA 5DRNB 5SWZE 1PGRB 4LPVA 2AEPL 5E99L 3RY6C 5D70L 2DQTL 2CKBL 3D87B 2EDYA 3AB0C 4GUPA 4QYOA 1KGCD 3OXRA 2MTPA 3WKNA 1WCBA 4OZFB 4HDIA 4L3EB 1VESA 3KDMA 3G9VA 4HJGA 2R4SL 3DO7A 1RMFH 2PO6D 2Z8SA 5BMFL 3HE6C 4CVXA 5IEHB 4FQ1L 2HT3C 3QPXH 4MXQC 4Q0XL 2CLZA 5T3ZH 4JZJA 3PF2A 1VKXB 4BH8A 5EZOL 5B38G 3VXUD 5B3JE 2FD6H 3RVWC 3QHFH 3E3QE 5EFIB 3BRDA 4BFIB 2ARJA 2I07B 1MRFL 4HD9A 1LO5B 3IB4A 3BYTA 2YWZA 2P24B 5EOCH 3O2WL 1F13A 4CU6A 1A6UH 5IVXE 2ZNXA 2DTMH 1NQBA 2OI9B 4MX7B 1PJ9A 1VFOA 4XCCH 2V9QA 1IARB 4O4YH 1MRCL 1JGUH 4YHMH 5D7KD 5DRXA 3HPLB 5EOQL 4RISH 3T0XA 1EPFA 1W72B 1NCBL 1YYMH 4NJAL 2R0LL 5JMOC 4YIQB 3O6ML 3N1GC 5E8OA 4YAQB 5F8QC 2W65A 1G7QA 1ZHNB 4DN4H 5GRJH 3MJ9L 2LTQB 2SEBB 3MCLH 2HVJA 1ZGLB 4MNQE 3QJHA 2HFGL 2V2WA 1DP0A 1NUDA 1I9RH 5DDHA 3QUXD 4G42B 4U1HA 3TO4B 3JZ7A 3E6HA 4NO5B 2L4OA 4YXKH 1FL3B 2D7NA 5HVHC 5BW7C 1B90A 1IEBA 2X44D 5KS9E 2GFBA 1O5DT 2BZDA 4Z95L 4HGWB 2V2XA 5I16A 3LQZA 5J8OA 4NKMA 1WK0A 2Y06L 4NN7B 1UGNA 3IKCB 5FO7A 3OAZK 5I1AB 1MELA 1J0HA 4XRCA 5TDNA 3U0TA 5C71A 3O6FC 1AO7B 5D1QC 1BBJA 2DB8A 5EU5B 3AXLB 5HHNA 3VDAA 5BXFA 4HCRA 2VRAA 4G8GB 3ZT7A 4NQCE 3UTPD 1N4XL 4P2OB 2VN4A 2X4PB 3FQTA 1BLNB 1ORSB 2OS7A 1T83A 4RFNB 4OCXL 3VGAB 3KLAA 1WICA 4OZIF 4APQC 4D9RE 1CGSH 1MREL 3VH8G 3S37H 3GSOA 1JYWA 5B38B 4WDIA 3RVTC 3SN6N 1Z9SA 3UTTA 3NFNA 2QQLL 1JV5B 5EU7C 4Z0XA 2OTPA 4X5XB 4JHWL 4L8CB 2VC2L 3SKOB 2Z35A 1FC2D 3BEWA 5EU3A 2GTWB 2CK0H 4L8BB 3A6CL 1TVBA 4N9GB 5ESAB 3QIWA 3QDGA 4G6AD 5CD5C 5HGAB 5IKCA 4PJCB 4ENEC 3B9DA 4Z7UE 4U1SB 4HLJA 1OGTA 3IJHB 4OFKA 1HYSD 2K7QA 1N0LA 1BD2D 2JCCA 4WI3A 5BV7B 4U6HA 4D9QD 3OKOA 5DFWH 5HHQA 4TSCH 5ITBL 3DXAE 1B4JL 3SDCA 1JHKH 2BNQA 3L5XL 4QO1A 1RIVL 3C60B 4ELMF 4YHKH 3AUVA 1PY4A 1I3GL 2EXWD 4X9GA 3ME0A 1KYOJ 1KLGB 2IPUG 1HHIA 3CFBA 4XPGH 2FJGA 2HKHH 3CFCH 4R4ND 4PJXE 3O4LB 2YD1A 1IM9D 2EC9T 1OW0C 5IB2A 4K7FA 1BFOA 3R4DA 1VEPA 3FRUB 3EDFA 3MV01 2C3VA 3HZMA 2YZ1A 1FNSH 4DGIH 1RZJC 4ODSH 1MSPA 2BMKB 4NWUH 2G9HA 5I1LA 4ORGA 2P7TA 4YHNB 4JRXD 5D2NC 5DVNA 4E0RA 4E5XB 3I6KB 4P23D 1XMWA 3VFNA 2W60A 4Q9CA 4GKNB 1JRHI 4ZYKB 4HCRL 1SJHA 4BM7A 1AHWA 1MI5D 3G6DH 1TJGL 1DLHA 1D9KB 3HS0B 4DVBB 1RHHB 3B6SB 3FQXB 1RU9L 1MJ7L 2EE9A 3IDJB 3VH8B 3QUZC 3RBGA 2X4NB 4LSDA 3KPRB 4M93C 3EYSH 2LAGB 1IAOB 3W39B 4KMTL 1MCWM 3HNTH 1IGYB 4F8QA 3ULUL 2V2TA 5EPMA 5DEGA 1DQDH 5I2IB 3FQRB 1MAMH 5LWYH 3BIAX 3X11B 2QHRH 2NW3B 3NN8A 3U48A 3MYZA 4D0CB 3QIUD 4YDKL 2BSRB 2DI7A 1JF6A 4GLRH 2D0HA 1T0NA 2D7PA 3NABH 5L9DL 1CICD 5TF0A 1OAXH 3PWLA 1IQDA 3KLHC 5L2JB 1I1RA 3OGOE 4H5SB 3S3SA 5K9QG 5DD6A 4OLUL 1DQQB 5IP4A 3VFOB 1RZKC 2XQYK 4JQIH 5ENWB 5I8KL 2YSSB 4OF3A 4JGMA 5DZLA 1J87A 4PFEA 3DRTB 3H42H 3OZ9L 1KIQB 4K7PX 2AQ2A 4XXCA 5KTEL 1P7QD 1YDPB 4OLEA 4QHMB 4HW6A 1RZ8B 1CLYL 5EUKB 2NY0D 3L9RB 3G6JE 3LKPB 4Y4FB 1KTDB 4KUZH 2Y23A 3KS0H 4Z7VB 4X7DC 5IW3A 3U7WH 5ANMB 1FJ1A 2JIXB 2A74A 5JOFA 4QT5B 2FYYB 1CFSB 5EORH 4K3JH 2OTWB 2RFXA 3E2HC 5DYOB 2VLJA 4LHQB 4N8CH 3NH7H 1N8ZB 5KOVC 2J4WH 2HLAB 2XZAH 4XPHL 4KI5D 3S97C 5EC2B 4EI5A 1KCVH 4LSRL 4JKWA 4TNVK 5IW6B 5KVEL 5C0JB 1ZS8A 3ECBA 3HI1B 3EOTL 4A6YH 1HYRC 4PRHE 4MA1B 2ZKHH 4QXTB 1MCRA 3BDBA 2E27H 2D7MA 4BSWA 3RVUD 1U6AL 3U4AA 2CKNA 3QJFB 4FFYL 1OP3H 1MH5A 1NANH 5J6GB 1GHFL 5IT2L 4FFWC 3H3PL 5I17B 2DTSA 3REWA 3HAEA 4DKEH 4FABL 4HQQL 2H6PA 4OLWH 4UUJA 1Y0LB 4H25A 5FHAH 3TT1H 4YZFE 2BVOA 4LP4A 4QHLA 1EZVY 4X6FA 1JNLL 5FA4A 1T04A 1EGJA 4D8PA 1EVTC 2VXVL 4U1IA 4M1DH 3PHOB 3L5WB 2ESVE 4RDQF 1QFHA 2AJSH 5GRUL 4RRPA 3HG1D 3VW3L 2F5BH 1MFEL 4LGPB 5FM5O 5CEZL 3ULVD 4XVUD 1ZT4B 2R2HA 5E6YA 2BRRH 3MLSH 4XAWH 1TQCB 3EYOA 3IDYC 3VXRB 2A73A 5F1IA 1FBIL 1GJIA 3KYAA 1J7VR 2Q86B 1JPSL 1CFTA 3MOAL 1RUAH 4YXHL 1A7QH 3F6LA 3C08L 2W0KA 1JF5A 1IGTA 2DBJA 3TBTB 4ZFOB 4P2RA 4AM0B 1UWGL 4YHZL 4UDUB 3VXSA 3PIQA 4PRIA 2EKSA 4DFIA 2D2OA 2DQCL 5FUZH 7FABL 5LQBH 1KJ2H 2DQFB 5K9KA 3IAPA 2WSKA 2G60L 2DQUL 5T5NF 4OI9A 1BAFL 4W70A 1HXMB 4J6RH 4OAWB 4RIRA 5JW4Q 4LOUC 4X80H 4AY0A 2WLZA 3VRIB 2IAMB 3DWTA 4X5WB 4LKXA 4ZAKC 4G8GE 1RJLB 5C9KA 2PTTA 4HV8A 1JGVL 3TZVC 5DWUL 4QNPF 3LEXB 3GSNL 4GJTB 4WI4A 3FOMA 5D7JB 3BMWA 6FABH 2VDPH 1GH7A 4TULH 4LEXL 1BPVA 1BWMA 3M07A 1YEDA 3ARRA 1EBAA 1OPGH 1H3TA 3P4MA 3RWHB 1MOEA 4KV5F 4ZFZA 5C09E 3TBVB 5JNYB 4BSJA 3QIWD 5DT1H 4NO0A