2W9DH

Structure of fab fragment of the icsm 18 - anti-prp therapeutic antibody at 1.57 a resolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
b'EVQLQQSGPELVKPGSSVKISCKASRNTFTDYNLDWVKQSHGKTLEWIGNVYPNNGVTGYNQKFRGKATLTVDKSSSTAYMELHSLTSEDSAVYYCALYYYDVSYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQSVTCNVAHPASSTKVDKKITPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ICSM 18-ANTI-PRP THERAPEUTIC FAB HEAVY CHAIN
publication title Crystal Structure of Human Prion Protein Bound to a Therapeutic Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9dH02
4M48H 4WHDA 4YZFE 2MQ3A 2J88H 4LLYB 3LPWA 4QHUB 2L7JA 1LP9F 1BFSA 4H1LH 2R1XB 3C2SA 5I19L 5IW1B 5E8EB 2BNRB 5SWZE 4P5TA 5IGXH 3AGVA 4X4XB 5KSVA 1DBJH 1FZMB 5C0BA 4PJ5D 2AXGA 2C9AA 5F7UA 1AD9A 3EFDL 3U79A 2X4UA 1BIIB 5ADPL 4XCNA 3CXHK 3PL6D 4PR5A 4KROD 5MENB 3TZVD 2LABA 3LHPL 4JZOB 1DANU 2XZAH 4HWNA 4K23L 5I18L 1IBGL 4LGPB 1E28A 2I25N 1E6JH 1N3NB 1RMFL 2EYRA 1A6WH 4WUUE 1D5MA 3MA9L 1WITA 4NPYB 3VXSA 4WW2C 3NN8A 4YWGL 5GZOD 2CJUL 4YDJA 3VD9A 1TPXC 2VYRE 3D39E 1S9YA 1BD2E 1BOGA 4O2CA 2R2BB 2CSPA 4GMSL 1UB6B 3MJ8B 4PLOB 1F2XK 4S1QL 3OGOE 3OKLB 5CSZB 2VN7A 4MS8C 4PD4J 3GMLB 1ZXQA 3IFOB 5AG9A 2I9LB 3QDJA 1J1XL 4M43H 2GT9A 3EYQC 4QY8B 3DUHA 3QCUH 4P3CH 1RZGA 5E99L 3QEGL 5C9JB 1QYGH 1OGAB 2ZWLT 4YAQA 1HXMA 1I8IB 1KLGA 1KIPB 2DL2A 2GK0A 1GGUA 3U48A 1QFWM 4M7JL 4FP8L 1TQCB 1BQHA 4GAJL 1WZKA 2R8SH 1D9KA 4AL8H 3I50H 1BM3L 5ADOH 5DD0L 2EE3A 4L8SA 4PJ7A 2BSED 4PJXF 4XVTL 3ARDA 5LCVH 4ZFFB 4ETQA 1OP9A 4LIQE 4JHBA 2ZNXA 4ODHH 3TC9A 1F4WL 5T1MA 1BJ1H 2QSVA 2APXA 2VDML 1L7IL 1JFQH 5TJWK 2JJWA 2VXSH 4TYUA 2ZJSL 1IGMH 5AYUL 3P73A 2NXYC 5GGUA 2V9QA 4XCFH 1FIGL 4IJ3B 4Z6AT 4BZ1H 4PG2A 1GPOL 4Z0XA 4J1UA 1PEZA 3L3OA 3MRCA 4X7TA 1KFAH 4PJ5A 2JK5A 2NYYC 2OR9H 3QZWA 3MUJA 1DJSA 3GRWA 3REVB 2MNUA 1TQCC 3BJLA 2BVPB 1DE4A 1E4XH 1NMAH 1YNLH 1QTYT 2XQBH 4Z7VE 4YHKL 3FJTA 4IHOB 5IVNA 4LBEA 5CKAA 3WE6B 5HHVL 5I73B 4M7ZB 1BFOB 1INDL 4P2CG 4MQTB 3ALWA 2YPLA 1J1OL 1Z6JT 4JM2F 4D9QE 4L29A 4LLUA 3U2SA 3PHQA 2R0ZL 3VD4A 4R0LA 1BZ7B 4W4OA 1E0OB 3I6KA 2A77L 5IMLB 4X9HA 3KPLA 3QIWD 4ELMB 3TYGH 2GW5A 4XPBL 4NM4L 4IJ3C 3TNNB 1G7JA 1UCBL 3GK8H 3R4DA 5D7JD 2YS4A 5GHWL 1MJJA 4PY7A 5KVMC 2D31A 2FX7L 4MAYB 3BMWA 1C8PA 5IW6A 4Y5YB 3EO0B 2BFVH 5J12B 4KZEL 4Q9QH 2D4DA 5HHXH 4PG9A 5CP3H 1KGCD 4H25B 4PJIB 4LLDB 1PZ5B 2IPTH 4XPGL 1DP0A 4OZHF 4M7ZC 3KLDA 4Z7QF 5GGRB 2CKBB 4XH2A 5FHBH 2EKJA 4OJFH 4PRAA 2EIZA 3VWJB 3GB7A 4HUUB 1FZOA 5HBBA 2CR3A 1F97A 3JTSA 4OUOA 5T5NG 1VFOA 3KPSE 3MBED 3PWJB 3EO9H 2VLRD 3G5YB 3P4OA 4JDZB 2PKDA 1JRHL 1Q1JH 3VG0H 1OAKH 2WINB 3RUGA 2XN9E 5ELIA 2R4RH 1B0RA 1EEYB 4PREB 3AS1A 1FVCB 4XBGA 1AFVL 4MAYC 2QQKH 5I0ZA 2GUOA 2MMXA 4Y5YC 5E00A 3G6JF 4I5BA 4ZS6D 1FNFA 3A6CL 1SYVA 4JKLA 1K8DB 4MQSB 5E5MA 3ZKNC 3UC0L 1XZ0B 3BXNB 5TQ0H 3MUZ1 4LMQE 3MRKA 1GGTA 3LSOB 4C4KO 5L2KB 3UPRB 5DUMH 4LNRB 1IFHL 3TWCH 5KSBE 2C7UA 3QUZD 3ARRA 1OPGL 3C08H 4HFWB 4DK3A 5FDYA 4GJTB 3VWJC 4A6YH 1INQB 1HILB 1D5BB 5E5RB 1A7QH 4F7TB 1A7OL 3EOBA 1NC4D 3QIBB 5K33A 2BVQA 3INUL 3ULUD 2R56L 4OF6A 3IFNH 5TH2B 4MGXA 4QEGA 3FN3A 1D5XA 3PV7A 4N9GA 1FG9C 1JGVL 5D7JA 1UXWB 5JA9A 1S9KC 1INEH 3ARQA 2DLFH 1BFVL 3SGDH 1A9BB 3OTTA 4V1DD 5I1AA 4AMKL 1TZIA 4NNXA 1EBPA 4ODUA 4OLVL 1G0XA 1LO2L 4Y4FB 3RNKB 3LQZB 1QRNB 1MCIA 5E4EB 5JW3L 5LG1A 2UWEA 2IGFH 1G7MB 3BIKA 3KG5A 2E7MA 1OW0A 1AI1L 4NOBA 2VNCA 1DR9A 2EDBA 1CFSB 4LLQA 1TZGL 3MBEA 3WIIH 1P4LA 5C0GB 4M7KL 5HYJE 2P5WD 5FUZH 4LP5A 5DVNA 1C08B 3F7YB 4LHUD 1I9IH 4ZPVB 1GZQA 3G6AA 4HJGB 3VWKB 3RWHA 4KGLA 2VQ1A 4YDKH 1W0WA 4MA3B 5E7BA 1IEHA 1FYTD 1ULVA 2ICWA 2HWZL 3MRRB 5CIPA 5GSRA 5IFJA 5E4EC 3S3JA 3MRLB 1HYSC 4NO0D 5L6YL 1OD7A 3KDMB 3QUZA 5H37H 4KTDH 3ZYJA 1IAMA 3OB0H 1G7HB 3PUCA 1HSBB 2BJMH 2NX5B 1KJVB 3BPCB 3H8NA 5TDPB 5FHAH 5CZXD 3VRIA 4EUPA 3VFNA 3HG1E 3QNXB 4K3JH 3P11H 3JBG7 5FYLH 4MCYA 1KEGL 5FYKL 1HI6A 3QWQB 5EZIH 5AYQA 3EDEA 2F19H 4JY5H 4RWHA 3F5WA 3O2WL 3DX9B 5I9QB 1WC7A 3HZKB 3WDIA 5TE7L 1FBIL 3STLB 1T0NB 5SWSA 4LPVA 2YD7A 3T0VA 5KS9E 3PNWA 3UBXA 3Q0HA 1QR1B 1YMHA 1QFUL 4X4ME 4K7PY 5A2KH 2HTLD 4Z78B 1WAAA 4MA7L 3Q3GA 4ZOAA 4G9DA 3WFEH 3DHJA 4IDJH 3G9VA 3MREA 1B4RA 2WUCL 1JHTB 2P5WA 3FT4A 1J87A 3BPLB 2ZUQB 4LHUA 5E6ID 2KH2B 2Q7YB 2V7HA 5IBUB 3C09B 4ZFZA 4JEGB 2VSDA 1BF8A 1FYTA 1I7UB 3O45A 3QUYA 2N56A 2A6JB 5ICXB 1YUHA 2EECA 4X6CF 4P5KB 5I9QC 2DB8A 1J7VR 1YY8A 3SGEH 1YYLL 4XAKE 3SKOA 4MA1B 2F5BL 5ESQB 3V7AG 4L4TD 3M1BB 1FL5A 4JAMA 5IEHB 1KPRA 3WNMA 1DL7H 5DD1H 5D7IB 1TCMA 1ZTXH 2JJSC 2B2XL 2FJFA 2Z31A 1KF9B 2NPLX 4AG4H 4PGDA 1VGKA 2PTUA 1CG9A 4QOKD 3SE8L 3BPLC 2YBRB 2ZUQC 1XCTA 5E2VH 1BEYL 3RIFF 4LHJB 3C09C 2Q3ZA 4ZYKB 1KELH 4YIQA 2A1WH 1YDPB 1OAXL 4CU7A 3P9LB 1AC6A 1HHGA 2ADFH 4F7PB 1A7RH 4UOW1 1A21A 2YD9A 3R06A 3W0WE 4IOFC 3OKOA 4PJEE 1V3JA 3E6HA 2WQRA 3MO1A 3ES6B 4YHPB 4GH7B 3B4NA 4OZGE 1KN2H 3WJJC 3KNBB 4Y0GA 3BP6B 3MXWH 4OCRH 3BUTA 5J89A 2XWBB 4NQXA 4CADA 1RJZB 4FQJH 5DSCB 1CD1A 5EO1B 3FFCD 5HHQB 1LEKB 4HIHB 1ZGLP 2CK0H 3FQXB 4HCRL 5DS8A 5ERWB 1EO8H 2KQMA 1PY4A 1I7ZA 5HY9B 2JIXA 4HUWB 5J9PA 3OJMB 3QEUA 5JIIA 5E6IA 5F1OB 5EPMB 1F90L 2EICA 4YFLF 4X6DB 5GJSH 1T1ZA 4HIJA 3IKCB 4FMKA 4HX1B 3ARTA 1K4CA 3UTSD 2WIIA 5EZLA 3C5SB 5JW4R 3BGMB 2CK2A 3IB4A 5AG8A 1KCRH 4GG6B 4OGXH 4L4TA 4MAUH 3UDWC 4MZ2A 4BH8A 3JWOL 4DN4L 5I1HH 3O8XB 4OZFG 1J5OH 3VDBA 3L95B 2FB4H 2OXHA 1JI1A 2VLJE 4QHLA 2EO1A 5FOBB 2BOCA 2N7BA 1P7QA 2IALA 4JZNB 5K9JH 4U6VH 4YEFA 4QOKA 3HC0B 4GT7A 3QRGH 2CLVB 4PJFF 4WUKH 5DJ2A 5J13B 3EFFA 4FQIL 1RUAL 1TVHB 3GKZA 3DX8B 1C5CH 3SDDB 3ZTJH 1X5LA 2A6DB 5L7XH 1RZJH 1JWUA 4N1EA 5C3LD 3LOWA 5CS7A 4LLMB 4NUJA 4PLKC 2ATKB 2ZOKA 3TH4T 3NFNB 3VE0A 1JHLH 2XI9A 1TVBA 5CGTA 1AGCA 4TSAH 1SQ2N 5L2JA 3O8XC 4HK0B 3HI5H 2NLJA 3KPNB 1A9EA 1I9JH 1S7RA 2OSLA 3UTTB 4EDXB 1IM9D 4M7LH 5CD5D 3QPXH 5EORH 4XPTL 4ODVL 2IG2L 3CX2A 3DBXB 4EOWH 4Y16D 4NT6B 4OV5A 1U36A 2DWDA 1AKJD 1GGYA 4N68A 2UUDH 5K9QI 3FFCA 1JPFA 2H26A 4OAWB 1YPZE 5JZ7D 4F58L 5J13C 5L9DH 3RWIA 3ZDZE 2WUBL 5KTEL 2VXTL 3S3PA 4K9EL 5D5MB 3SDDC 4UIKH 5DTFA 1JZ5A 2EDQA 4P57B 5ID1B 4PLNC 3OXSA 2PW2A 3TCLA 3IXAB 1JGUH 3UTSA 2Q1EA 1BQLH 4HFUL 3J7HA 1RJLA 4ZUUA 4BQ6A 1MHPL 1FLRH 2PUQT 4BYHA 5A16B 4NZTH 2DDQH 3THML 4ISVA 4H0IA 5F89A 4N0UB 3GHEL 4LLWB 3D3VB 3RWFB 5D2LE 4OFIA 1ZMYA 3P4NA 1WIUA 5J6HB 1RU9H 2ED7A 2JELH 3OHXB 3X3GH 4CNIA 2XY2A 2DOCA 3NH7H 2WBWB 15C8L 3VXOB 1PYWA 1XGQA 5IESH 1R5IA 1FFNB 3OAUL 1I7TB 1J0HA 1MQKH 3OXRA 3VH8A 3VGHA 5CIPH 5ISZE 1UEYA 3GSUB 1TJGL 1YNKH 5I8CB 3QHTC 3RWDA 4B5EA 1SM3H 5I1KL 2H3NB 5LKNA 1FFOA 1HN1A 1WVZA 1QO3A 1T83C 5BS0D 4PV8B 1CDCA 4Z77A 3OGCB 2XIDA 1S7VB 3GMPB 4QXTB 3E8UH 3ZTNH 4MXWH 2BNRE 3ULUH 4YH6A 1ZS8A 1I8MB 4NRXB 3BX7C 5J57B 4N8VB 2DWEA 4EUPH 5FGCE 5MENE 4Y16A 5D7LA 1AKJA 4WHTB 3JUZA 2R2CA 2UVFA 5H2BB 2BSSA 3E6FB 4ESKA 2MHAB 4JN1L 1MHHB 4WWKB 1RHHB 4CMMA 2ZNWA 3D0VA 3FOMB 3LPGA 4JLRB 1UADC 1CWVA 2XTLA 3K2UH 3RGVD 3FO2A 3BI9X 5D9SB 2XQYG 4ODWA 4JVUA 2BP3A 5J1AB 3UO1H 1ZA6B 4QRRE 1HQ4A 1CIUA 2LAGB 1CCZA 3DGCR 1KCVL 4GOSA 3FZUC 3AS0A 2CQVA 3SPVA 3WS3B 1HYRC 2JCCB 3I6GA 2Y36H 3WIHL 5BRZD 4R7NB 5SX4I 1OGAE 1T22B 4L4JA 1KULA 1C12A 3ARYA 5I1GH 4KY1L 4G8FB 4LHQB 3JV6A 5EOCH 2ICCA 2WWMC 2X42A 2HKFL 4KWUA 2BHYA 4WWKC 1NLDL 3ULVL 4PGZA 2VDRL 1UJ3A 1ONQB 1FNSH 2X89D 4WFED 1FL3A 2D7QA 3CGTA 4I18B 3ZE2E 5IQ7L 3MGOB 4M1CC 1MAKA 3UP1A 2J6EH 3DROA 1PAMA 3MODL 1TMCB 3HHRB 3VFUA 4XPFL 3MRMA 4OCWL 2AQ3A 1HHIA 5BZDA 2BNQB 3CXDL 4X6BA 4G8GA 2I9TB 2YA1A 5HI5D 2MCG1 4FFZL 5I1CH 4B53A 2NY4D 3DMMB 3P9MA 2NY7H 1JTOA 1AQDB 1I85C 3AVEA 1WCBB 4PJAF 4U6TA 5SV4A 1NAKH 4OF5A 2B4CC 1MREH 3GSQA 1Q9KA 5JLZA 4S1SL 1N59A 1J8HA 2FNBA 3MROB 3CPLB 1IAII 4I18C 4QWWC 3IU3B 4K94H 1Q0YL 2AJVL 3X12A 2F53D 2HT2C 1XGPA 4JN2B 4RNRA 4YR6B 2OL3B 4U1SB 1V7MH 4DGYL 3V6OC 2CKBL 3RKPA 3TA3D 3VXQA 3T2OA 2FL5A 4FXGB 4D9LH 2I60H 2HFTA 2X70B 2ZCLH 5HGAA 3HNTH 5JQ6H 4PB0L 4PRIB 4WEBH 4YHOL 4J3XA 4ORGB 1U8MB 1QQDA 2WBJA 4JHAL 3IKKA 3LEVH 4J6RL 3MLRH 4U3HA 2A83B 5ESVA 2E6PA 3OL2A 3GGWB 3QG6B 3QCVH 4QRSA 3WJLC 4DEPB 3C5ZB 3O4LE 4NRZB 3PXHA 4JFQA 5MEOB 5BRZA 2VXVL 4GRMA 4APQD 4HMCA 4G80A 3SGJA 2V5SA 4PJIE 4TQEH 5C0BB 4R6UA 2IWGA 1A6TA 5GJTH 4OKVB 4XCNB 2X89A 5CJQH 1N5AB 4J8RB 5EOQH 1YEFL 5FOJA 3WXWH 4S2SB 4YNYA 1NFDF 5EU6A 3NCYS 1VEMA 5KW9L 2ZP0T 3LAFA 3IJSA 1OM3L 1D5MB 3D0LA 4O2FA 3IDUA 3SN6N 2V2XA 4FQLH 3PDGA 3NN8B 5EG6C 3TN0D 4M62L 5IIEA 4NFBA 2RFXA 2VMFA 4DEPC 3C5ZC 3HNSL 3I75A 3L5IA 4OLXL 2HMID 5IJVA 1J05B 1FZJA 4KAQL 1W72A 4KFZC 1FNEA 1MFDL 3D9AH 3HS0A 4OI9A 1RZKL 2I07B 4HIEA 4GKZB 1SJEA 4OZIB 1Z5LA 4JQVA 3N1MC 2XFXB 4YBLB 1LDPL 4JFHD 4O9HL 4K7FB 3VFVB 3TFKC 3SDAD 1RZGB 2MKWA 4XWGL 2QL1A 1X3DA 4YAQB 3BOVA 5AUMB 2WNGA 3RX7A 3NIDF 3FMGL 1RJYA 1R0AL 1D6VH 5EB9A 4GKNB 5MHSD 4PY8J 5CSGA 2NY1D 3S98A 3TA3A 4PJ7B 5EOTB 4FZEL 4Q9RL 2EIEA 2E27H 5DLMH 3ARDB 5JHDE 1NGZB 3N0PB 4KK5D 1TZHA 5T1MB 3O2VL 3ZKMC 2DICA 2VLME 3RNQA 1D5IH 4U49A 3UCRA 1R3JB 1T6WA 3BZFA 1JNLH 3CK0H 3FL7A 2MQ0A 5TGBB 4CGTA 5I16A 3P73B 5IQ9A 4APQA 5GGUB 2D4FA 1DBAL 3WMSA 5EFIB 2YEZB 1PGRB 3L3OB 5JDSB 4JJ5B 2G5RA 1QSEA 1QLEL 4LCYA 4BUGA 2NW3B 2IAMA 4WI9A 2AJZA 2MOVA 4QTHB 1DE4B 1I8LC 1YEDA 4L8SC 5DQDH 3NA4A 2AV7B 2X4OA 3ARDC 3MUGA 4HIXH 4DQOL 5DF0A 32C2A 3GSRA 3GJEB 1J8KA 5F96H 3NACH 3TN0A 3K0WA 3IFLL 3OQ3B 4LLUB 4LASL 3KXFD 3VMOA 3W9DB 2A73A 1DVFA 3NCFB 3T8XB 2WP3O 3I6KB 3O3EA 3SKJH 3TO2A 1JYVA 2VB5A 4NC1C 3KPOA 2HFFA 3MR9A 1ZANH 2W0FA 5E94A 2D31B 3QEQB 4X0KA 3HC4L 1U8LA 4NJAH 3SDAA 2R0LH 4NGHL 4HF5H 4Q2ZA 4XNZB 1D3CA 4QHNB 1AXIB 5GGQL 4PG9B 2NX5E 2FIKA 2VZSA 2Z92B 3CFJA 2GSIB 4JHZA 2EDNA 3KYOA 1YECL 4WENB 5C8JB 3ZKSD 3HRZA 4KPHH 5KAQF 3GB7B 4GS7B 4R0LC 4XP1L 1IKNC 4C56D 2NW2B 2XACC 4W4OC 4S0TD 1T2XA 4JANB 4BFIB 2VZOA 3IRZA 4QT5B 1A2YA 5FYJL 1JN6B 3RUGB 4MJ2A 1F5WA 3ESUF 3L5WA 5F7WC 5DUBA 3BEVA 1CXIA 4XBGB 2LU4A 4G5ZH 4K2UL 2GUOB 2E8ZA 5BQ7A 2YRPA 1CGUA 2APTA 4OB5H 5IVOA 4XNZC 4LARH 4JPWL 1HDMA 3RY6A 2FBJL 1AGDB 4GRWH 1BVLA 5E5MB 5C09B 4JRWA 1YQVL 4ZUWA 1FO0A 4LSTL 3MLXH 2BSTA 1P4BH 4N0FA 1LO4H 2WAHA 4U0RB 5E9DD 2EH8L 3OKNB 3NAAL 5FCSH 2Z8VC 3T1WA 4PGEA 4GS7C 5HD8C 5BO1H 4AQ1B 3DNKA 1MJ7L 4MDIB 4WIQA 3KLHD 4V2BA 5F1IB 3ULUF 3SDCA 4AYFA 1BQSA 1CXEA 3CFEA 3KXFA 1A1NA 4U2ZA 3VFRB 4TULH 1BGXH 5CZVL 5HYEA 4JRXE 3LH2L 5C08E 4UILL 5ALBH 1NCUA 4KV5F 1JMZA 2IPUG 3RRQA 3HR5A 5DK0B 4XC1H 2WM0A 3RWEA 3EW3B 1P7KA 3EOAA 2QBWA 5D7IE 3U6RB 4ODUB 4FQPA 3TPKA 2HVKA 1SY6L 3LD8B 3L3HA 3UPAA 1X6NA 3PWLB 1MCWM 1NLBH 2W9EL 5CLTA 4F7EA 3UMTA 1X5FA 4ONGL 4WO4B 2GCYA 5DK2B 2ENSA 4GMTH 4OLWL 5JIPA 1DTUA 43C9B 2O61A 1U8OA 2ITCB 2ZG1A 4LLQB 3N1GC 1NBZA 4LF3B 1T0MB 4RGND 5IMOB 2OK0H 3RVWD 5DMJB 4XBPA 4JFED 4Q0XL 4P2YA 4HUKB 1FV1B 1G6RA 1WZMA 4O5LH 3NMEA 2VXQH 4XMLL 2QKIB 1KIQA 5IT2H 1GZQB 3D25B 1HIML 3CFDB 1BJ8A 4MSWB 1AIFA 4M6NH 4TSCH 3OR6A 1YEHH 1B0GA 2ICWB 3KHOA 3GM0A 2AKRB 3U4BL 2CO7B 3VRJA 3U0TA 3LD8C 1CE6B 2VISA 2GFBA 5T1DH 4JQIL 4ERSH 4WO4C 3K2MC 3VFGL 5DDHA 5E9DA 1V5JA 1A7NL 1DQTA 1F2QA 2APVA 5T1LD 2EDWA 3BH8B 2Z35B 3FN0H 4P59L 4HS6A 3S6CA 1T7WA 5GS2D 1NDMA 2P8MB 3CDGB 3H7BA 3VXUE 1SYSA 3VGEA 5GS3A 3DX6B 1ADQL 5D1ZD 2RIKA 2FR4A 1IZKA 5ICYA 5DRXA 4JFDA 2IBZX 1IAIL 5HGHB 1NCBH 4X9IA 1FZKA 4QXGL 4K71B 4E42A 4GG6E 2P47B 1IQDB 3C2AL 4CJ0A 1OGTA 2YR3A 3CDCA 2BXYA 1GIGL 3MNWB 4O02H 4BFEA 3C6LD 2QHRL 2A0LC 5E8PB 4KMTL 4JR9H 4GG8A 5LBSH 4KMLB 5DFVC 2BHZA 1EZVY 4KC3B 2R1YA 2NR6C 2ITDA 1UKTA 5SWSB 1W72H 1LP9B 4G7VL 3BZEA 1GJIA 2VKWA 1YYMH 5SWZD 3UPCA 3F7PC 1P2CA 1PLGL 25C8L 2OTPA 2W9DH 4O58H 4DZBB 3Q3GB 4G9DB 4JPIA 5LGJA 1S5HB 3BUYB 3DUUB 1NAMA 1KC5L 3MREB 4JFEA 3CSYA 3FT4B 1HE7A 2ATPA 2BRRH 1M71A 4KHXH 2BVYA 4CU6A 2QJDA 4K71C 4HJJL 4XPHL 1AD0B 2X4RA 3MGTB 1A6AA 2RJMA 4ZXBD 4ZTOL 3T65A 4GLRI 4WUUD 3O45B 4X80H 4EIZC 5FKAA 1MCQA 4U1IA 3WUWA 1S8DA 1F58L 5DJZA 5B39A 4HBQA 2K7QA 1NCWH 3D39D 3SKOB 3TBTA 3V52H 1BD2D 4EVNB 1TTFA 4ZNCD 3C8KA 4U7MA 4JAMB 4PRPD 3QH3A 4I0CC 3Q6FA 3VW3H 5EU7C 4NQCB 3TBYA 4D8PA 3FHQA 4KK9D 2Z31B 4UT6L 4YHLL 1NSNH 2EC9T 5J11B 4JG0H 5A2FA 1Z0NA 4B7IA 1EHAA 2D7OA 5BJTA 5D1ZA 4M7LT 2AJXH 2X4TA 3TVMD 5EBGA 1SEQL 3SDXF 4JDVB 5J6GB 4FFVD 1UYWL 4KUZH 4JO4L 4HS8L 3QUYC 4LEOA 3H9SB 5INCA 3L3GA 2DBJA 1VFAB 3CCHB 4O4YH 1V7NH 4K3DL 4PPTA 4QRUA 4TOYL 4GW4A 1RZIB 2LV4A 4WFGE 1M1SA 2Y6SC 3D3VE 2H8PB 3NCYP 4U7SA 3C6LA 4TTDD 3I6LE 4GUPB 3BQUD 5GZNC 4UTBL 1J18A 3ESVF 4Q6IA 3L7EA 1X44A 3QIUB 3D85D 3EDKA 4LDEB 3MRQA 4XVSH 5KSAB 3D18A 1O0VA 2Z31C 1TDQA 3QBTB 2W0LA 5J11C 2V17L 2XRAL 4PB9L 2QADD 2FDBP 5SWZA 4NKQB 1JGEB 1TETL 4MQXD 4HG4J 4BKLA 4CVZA 1MCJA 2D03H 2ZSVB 1A1MB 4XNMB 1RSFA 1UC6A 2DQEL 3OPZL 3NCCB 5JW4M 1FGNL 2JIXB 1E27B 1G9MC 4XP9H 5J9PB 4HWUA 1FG2A 5C0CB 3H3KA 3KVQA 1IARB 1CZ8H 3RVUD 5EZJA 1GOFA 4WUUA 1RJCA 3QUXD 1I3UA 5IR1B 2FECI 1FH5H 2DM7A 1VEPA 4JM2B 2AK4B 3NFSL 3JUYA 5H94A 3UTOA 3BAEL 3P4MB 3MLWH 3QIUC 3HLAB 4G9FB 35C8H 1BD2A 1NL0L 1JPST 2OR7A 5AZEL 5KSAC 3NIGE 4PRPA 4HZAA 3F7QA 4JG1H 3REWB 3VXMA 3VU2A 4WI4A 1A7BA 5DT1H 3QI9A 2ADIB 2BSRB 3BPOB 3DOSA 2AABH 4N0YL 4IRSA 1DBKH 2HTLC 3L1OL 3H3PH 2GTWB 2CDFA 2Z4QA 1WQVT 4RMWA 3MRJB 4R4BB 3C60B 5BVPH 4HPYH 3PWNA 5DJ2B 4B7LA 2ADJB 3EFFB 2WK2A 1LILA 2XKSA 2P8LB 5DWUL 4M8VA 1FORH 1FO0H 3VMNA 4NM8H 1HINH 4J7RA 4WVRA 3S96B 3HCVA 4UIMB 5B3JF 2DQHL 1KXTB 4JM2C 1C16B 2JCCE 1XIWB 4NKMA 1X5KA 5HSFA 2NXZD 1T89A 1N5YL 5KVEH 1CU4H 3VE0B 3KPSD 2YC1B 1TVBB 1AGCB 3BQUA 4QXUL 4Z5RA 3TT3H 2NLJB 4WJ5A 5TF0A 1OTTC 3BPOC 3EJJX 1S7RB 2OSLB 5CEZL 3SGKC 4LP4A 4LCIH 2XN9D 4ODTH 2JF1A 1X6LA 4LCUB 4YXLH 5HI4D 1A02N 3QT2A 2WWKO 1IM3B 3E2HC 1JPFB 4HXAH 1DN0A 2H26B 1U9KA 5CJXA 3MMEA 4HSQA 3V6OE 3Q2CA 4AEIH 5HPMA 5D1XD 4HKJB 1DUZB 5C2BH 4RFEA 2B5IC 1OTUD 3MRDB 1LK3H 4OGAD 4Z7VA 4WW1A 5JNYA 1XIWC 3OXSB 2PW2B 1HHHA 5ACZA 3ARGB 4OLEA 2OLDA 5E1HB 4G6KL 3QUXA 4GRWF 4G6ML 2FSEB 3DV6B 2X1XR 4ZUVB 3QQ9C 4YQXL 2D3VA 2R0KH 4H0HB 5A2LH 5HPOA 3GI9L 2WP3T 1ZHNA 4ISVB 1LWRA 3GBLA 1YY9D 1CDHA 1G6RH 1G7IB 5E08H 1JYWA 3TLRA 3QDGA 1I1YB 1PFCA 4MXVE 4FXLA 1PYWB 3E1F1 2DYPB 1QSFB 4U3XA 3IDXH 2XWTA 3MLTB 3AM8A 2VDNL 4MCZA 4UINH 3ARED 1DLHB 1XF5B 2H32H 2P49B 1PX4A 4PRIE 2EKSA 4XBEH 2MPAH 4Z7WF 2EC9U 5GS1B 1ZT1B 5AWNL 1IKFL 4RISH 3F7VB 2X41A 1J0JA 4Y5XA 1FFOB 2NY3D 4JGUA 4RMSA 3H9HA 4JY6B 4Z77B 1ROWA 3GMNA 1H5BA 3HI6H 4YHIA 3PGCB 3LS5H 4RAVB 3MX0A 3LKOA 5JORA 5F9JA 2P46B 5HYJD 1ES0A 2WBKA 2DLGA 4N90E 4JB9H 3WBDA 3GMMB 5EU3B 1R24A 5C0BE 3VFSA 2HFEA 4P2OB 5IG7A 3LS4H 3FONA 4PJHA 1CFTB 1T7YA 1BX2B 1U6AH 1C5BL 3RVVD 5D7LB 4YGAB 5F6HJ 5TDOA 1QBML 2OZ4L 1SVZA 1NMCB 4JREB 1MNUL 2IANB 3FB6A 4QYOB 3IDNA 1Y0LA 3PF2A 1Q9OA 4CMMB 5GS1C 5D1XA 1CDBA 3D0VB 3CVIL 3VXSE 3DVNA 3MOQA 1QFOA 1NC2B 4JFFA 2VERN 4F57H 5KSBA 12E8L 1F13A 2XWJA 4ODWB 4JRYB 3TESA 2BDNH 4IDLA 2APBA 4L4VB 1TJHH 4XWOC 4F15B 1FE8L 1SEBA 3ZT5A 3KR3L 4FQXA 4G8IA 5DJCB 1Q72H 2F54A 4CU8A 1IAKA 2YOCA 3UTZA 4OZIE 3O11B 2R2HA 2V7NA 1H3PH 3QDJE 4Z7OE 3EDDA 3BKYL 1NAMH 1MCHA 4KRLB 3I6GB 3LKSA 3QHZH 3KYMA 4AEHH 3HG1D 4QHMA 4R3SA 4Y16C 2WQ8A 1TTGA 1IC5L 3TT1L 1HKFA 4J3OC 4FQCL 2ZKHH 3JV6B 1NMCC 4JREC 5DQ9A 1KLUB 3BKMH 4KK8D 4Y8DC 3FQRA 1F11A 2GJ6A 3NIFF 4DVRH 5E2TH 4PJ7E 5GPRA 4KZDL 1ETZA 1L4IA 5K9QG 5FO7A 3A67L 4NBZB 1P1ZB 2XICA 5DURD 1EFXD 4M9OA 3VFUB 3RWGB 3TBWB 3M8OL 5D93B 4NQSA 3QDMB 1J0YA 4OM1L 2ZUWA 1B9ZA 3R0NA 5E2UL 4NC1E 4OZFH 5GS2H 4G8GB 5I2IA 1JZ3A 1EX0A 1C5DB 5GGSB 5DI8A 4YFDB 1DFBH 3UAJD 5FYKD 3RI5K 4PJ5E 4NN7B 2CLZB 3KS0J 2R2EB 4FQ1L 4F33B 4MA8L 3KPQA 1K8IA 2N7AA 1I1FB 1YEKL 4HJ0D 1XGRA 1A4JB 4OLUH 4OCYH 3LV3B 5I1EL 3VDAA 3PDDA 4Y4HD 5KVFH 3BEWA 1UJ3C 5JLZB 3G04A 1J8HB 4X6CB 4ODBD 4RWYH 1GOHA 2DMCA 4UV7H 4X4YA 5CILL 3KJ6H 4XAKD 3ZE0F 4NYLA 2UV3A 3MV8D 4UQ3A 2YK1L 1QEWA 2YPLE 1XGPB 4RNRB 5IBUG 1U93B 4LFHG 2OJZH 4NKIL 1RUPL 3VXQB 2XQYK 1FYHB 2FL5B 5D93C 3S36X 3U36B 5HGAB 4OIIL 1CT8B 4PY8I 5F72S 1KB5B 2WBJB 3SCMB 4QF1B 3KPPB 4G6FB 5DMIH 2DQDL 1JGLL 3QEQE 3BESR 5A43C 4NN7C 3M17A 3GMRA 3G6DL 3FQWB 4U1GB 5JPNB 1F6AA 2R69H 3DVGA 1NUGA 5HGBA 1S9VA 5CP7A 1KENL 3B3IB 4M6OL 1FFRA 2AJSH 2Y07L 3O4OB 3WFHA 5D72H 4AH2A 5IVXA 4XP5L 1LO0H 5LJYH 4LU5L 3MOAH 2ZCKL 2FATL 2R0WH 2VAAA 1Y18B 2EZ0D 2YUVA 1P69B 5BW7A 1WIPA 5EU6B 5KS9A 1FN4A 5GRYA 4RMRA 1IEBA 1XR8A 3EYFB 4X4MA 4OI7A 2UZIL 5DFWH 2VZVA 3TYFB 2WBJC 3O41B 1I7RB 3EFDH 3GSNB 2A6KA 5EUOA 3RUGE 3ZT6A 1KB9K 4TUJA 4MNQB 1WGOA 3DURB 3LHPH 1NBVL 1IBGH 1KG0B 4U1GC 2Y06L 1FZJB 1HHJA 2JJUA 2OJEB 3QQ3B 4JHWL 1RMFH 1D5ZA 3RL1B 1NGQL 3MA9H 5C09E 1SJEB 4KI5F 4YGVA 3UZEA 1ZHBA 2RCSL 2X9XA 2CJUH 3QP3A 4JPVH 5EBMB 4JO3L 1EJ6A 5HDQH 2W9LA 1NGWA 1CTOA 1MWAB 4JZJB 3RL2A 4LIQH 4GMSH 3MV8A 2FECL 1GZPB 3WNNA 2DI7A 4S1QH 5C9KA 5EUKB 3WHXA 3HC3L 1XH3A 1OAZH 3O3AB 1J1XH 3U1SL 3P30H 5KZCD 2VLJD 3V0WH 5E99H 3QEGH 5KG9A 1GHFH 3FO1B 1U91A 2EDFA 2LFGA 2VN4A 4LSQH 3O0RL 1QVOB 2XZCL 8CGTA 5C0ND 2NY4C 4M7JH 3DJ9A 5EC2B 3JTTB 3ARVA 1CQYA 3W39A 3BZFB 1T5WB 4GXVL 1BM3H 4GFTB 1Y6KR 2MCPL 5KOMC 1DBBL 4XVTH 3C5JA 3RIAF 3OX8A 2EDXA 3TNMA 8FABA 2CRYA 4JZJC 1R3HA 4PJEA 4J4PD 2UVEA 4TSBL 1F3JA 4NWUL 3TBSB 1L7IH 4AQOA 5CWSA 1WFOA 2IAMB 4LSSL 4H8WL 3SQOL 4OD1H 4OZGA 3TA3C 2IADA 3VXRB 3KPTA 2HRPH 1QPXA 1WK0A 1AY1H 1GPOH 3O6LL 2NY6D 5DRWA 2AXFA 4R96B 2F15A 3ILQD 2EXWD 3RTQD 3AXLB 3NPZB 4NRYA 3PP4H 3ARFD 4KXZH 1K4DB 4NN5B 1N7ML 1DVFB 2XPGA 2HYMA 4S1DC 1R3IL 4RFOL 4P49A 3SKNA 1EFQA 5C0RH 4APQC 1ZSDA 2DQJH 2AGJL 4ZDHB 3UZQA 3MR9B 1J1OH 2EDLA 4NDMA 4M1GL 5E94B 4WHCA 4X0KB 2VC2L 3FQTA 3O9WD 2R0ZH 2VR9A 4YHYB 3U9UA 4DVBA 1LE5A 2PYEB 3QDHA 2IAMC 2A77H 1YN6A 4PJCF 3S35X 5IF0A 1BP3B 1HQRB 3VFPA 4NM4H 2FIKB 2HJFA 3CSPA 1UCBH 5C0JA 1DQQB 3CFJB 2V6HA 4P2RA 4HCRA 5EOCJ 2FX7H 3VI3F 3KYOB 3VRLF 2VLJA 3HRZB 1JZ6A 5FYKU 3I02B 3UTPE 4NN5C 4KZEH 1DVFC 1U3JA 3MA7B 4X5XA 3BN9C 1CFQA 1RI8A 5ISZD 4XCEA 4UV4H 4HH9B 1U3HA 4WNQA 1UH2A 4H20L 5ID0A 4KJWC 3WNLA 4OD3L 2APWA 2AEPH 2APFA 1XF3B 1EDQA 3LKPB 1AGEB 4YHYC 5SWSE 4E5XA 4LCWA 3QXDB 1Z3GL 5CBAB 1BVLB 4J4PA 4PJBF 1JRHH 4KHTH 5EU7E 2BNRD 3JWDL 3QISA 1S9XA 1DDHA 1WAAE 1HEZB 4N0FB 4OI8A 3EYQD 5JPMB 4KUCD 4X98B 3IU4L 2VOTA 5MEND 4OLYL 2VIRB 3B2VH 2WWKT 4GRLA 3JVGA 1CGVA 3VGAB 4YHNB 3UC0H 1QA9A 4Q9CA 3DI3B 3SDCB 3B9DA 1A4KA 4Z8FL 3BIAX 1A1NB 1ORQA 1KUMA 1B6DA 3HI1A 1CL7H 2CR6A 2X4PB 4TRPH 3WL9B 4LSUL 4EQ3A 1OPGH 4N8VG 4U1NA 3IJHB 4RGOL 3UJJL 2H9GA 4HKZA 1IL1A 3O3BB 2WLZA 3GNML 2AXHA 3ZDXF 2C26A 3O9WA 1WEJL 3DPBA 3O6ML 3LRGA 3INUH 3CX5K 1HZHL 2R56H 4NQCE 3WV0A 1G9NC 4LAJH 5HGGS 3ULSA 1CXFA 5A2JH 2HVKB 3N1FC 3PGFH 5GSVB 2NXYD 3QULB 1OGAD 1CTNA 3MC0A 4TNWF 1BFVH 2AJYL 4LQFL 3C6SB 2NYYD 2X7LB 3VGAC 1NCAL 2BNUB 5E0QA 3SDYL 1MCOL 4AMKH 1QHPA 4FFYL 2R29L 3SDCC 1ZVYA 3K81A 3QNZA 2DM3A 1LO2H 3UZVB 5B22A 1M7DB 4LL9A 4XBPB 1RUKL 4Z95L 4C83A 1P7HL 1H3WM 5ILTH 1GGIH 1CE1L 4U6HA 5IB1B 1CGYA 1AXTH 1UVQA 3X11B 4F3FB 4KK6C 4HKXA 3WO4B 1JF1B 2DS4A 3WHE0 1OLLA 2QQLH 4I0KA 1TZGH 3VJ6B 4EDWH 3MFGB 5JO5A 4LLYA 4X7SL 3BDYL 1U95B 4WGWB 1I9RL 3N06B 5IW1A 1LEIA 2Z0BA 2AI0H 4X4XA 3I85A 3B9EA 1FZMA 4TNVK 4DGVL 5D70L 2YHGA 4R4FH 1EO7A 5JUEL 1TVDA 3LEYL 3X3FL 5FUCC 4PJAB 2W60B 2HWZH 4ZSOB 5C0CE 1NDMB 3H7BB 3P0VH 5KN5B 5L6YH 2GIYA 4JFDB 4M93B 3WO4C 2AK4E 2IFFL 1CDGA 4F7MA 1FZKB 4G9FE 3BT2L 2IPUK 5CCKL 1MCPH 4F8QA 3CVHH 2R2BA 1DQMH 1UB6A 1MVFA 5TE6L 1MY5A 3GMLA 3IFOA 3CFKB 2I9LA 1T7ZA 1MCRA 3BP7B 3U30B 2HKHL 4MAYD 1MIML 4QY8A 4YZFF 3ZHKA 5D6CA 1REIA 2B1AL 5C9JA 3FT2B 1OGAA 3LKNB 4L1HA 1I8IA 4LSPL 1KIPA 5FYKH 1C1EL 4IBLT 2O5XL 3ZKND 2OS7A 4FXKA 1BBJB 3MV7A 1X7QB 3O2WH 4G8EB 2J8UF 2CPCA 3H7LA 1X5IA 2B0SL 5TE7H 5LGJB 3PL6B 1FBIH 3TZVB 3WFCL 4Z7QE 1VCAA 1NGPL 3CSYB 1LD9B 1M71B 2G75B 2XZZA 3HN3A 3VWJD 4ZFFA 1NGXB 1NFDB 1A6AB 1W8OA 5GRJL 2SEBA 3T65B 2HT4C 3FB8B 5FCUL 1S9WB 4MA7H 1UM5H 1YEIL 4U1IB 3WUWB 4HMDA 3RHWF 5DJZB 1T2JA 5B39B 4OQTL 3U30C 1EV2E 3WIHA 3TBTB 1OQXA 3T3MF 3WFBL 3C8KB 5ALCL 1GH7A 5DRZB 1MJ8L 3Q6FB 1W0VA 4D8PB 1JPTL 2DQIH 3ME0A 5L2KD 5CEYB 4XVUC 2BVPA 4R26L 5FM4A 2CLRA 3BVNA 5KBNC 3RY5A 4IHOA 1FFQA 5BJTB 4YXHL 2VDKL 3B6SB 3WE6A 2CXGA 3LEXA 2VLKB 3UTSE 5DHVH 4ETYA 1CI5A 2VLLB 4GXUN 5INCB 3L3GB 4OTXH 5FM8A 3MRBA 1MFEL 3UYRL 1RUML 4ELMA 3SE8H 3LIZL 3TNNA 4LPCA 3AMKA 4WDIA 2VLMD 1XGTA 2XZQL 1VACB 4YHML 1QSFE 3T2QA 9CGTA 1OAXH 4Y5YA 3EO0A 3QQ4B 3QSKB 5E8DL 1MRFL 3D18B 5CEXB 1E6OL 1MCFA 1I1AA 1QRND 4H25A 3R0MA 1HYSD 1PZ5A 1BLNA 4RMTA 1DUYA 2X4SB 5L8LB 1FAKT 4BZ2L 4K8RC 1QACA 5GGRA 3VG9C 2CKBA 1UH3A 3VFOB 3QNYB 3VWJA 4GKSB 4HUUA 4KKCC 4JM4L 3U4EA 3BH9A 1FG2B 3PWJA 1YEGH 1NBYB 4GSDL 5EZJB 2H1PL 3IAQA 2YRLA 3VFMA 2FO4B 4HCRH 1N4XL 2WINA 3CMOL 3VWKD 1EEYA 3IAPA 4PREA 1FVCA 4Q6IC 3T0DA 5D7LE 1WBZB 1F90H 3VXMB 4H88L 2F5AL 3H9YA 1K8DA 2IANE 3I9GH 3QI9B 3NA9L 1XZ0A 3BXNA 1IE5A 1FPTL 5C92A 5F44A 4IRSB 5DJYB 1OLZA 4ZUSA 5L2KA 4FG6C 3CLFL 4LNRA 4BELD 4D0DB 5KVGL 2C1OB 2Z4QB 4JRYE 3QXAB 5M7QA 1TQBB 3GI8L 4HFWA 4J3WA 3DSFL 4MJ5B 4DN4H 1NMBL 3PWNB 1K3ZA 2NX5D 5TDNB 4HPOL 4OM0H 4F7TA 4NC0B 3QIBA 4Z7NF 3MXVL 3MRHB 2A9MH 5TH2A 2QSTA 4D3CH 2FBOJ 4UTAL 4F9LA 1UXWA 2EDEA 4FQIH 3RWCA 3MYJB 4Z5RB 3D69A 3EDJA 1A9BA 5IGXL 3QI9C 1CXLA 3FFDB 4IRSC 4Y4FA 3RNKA 1S7UB 1MQ8A 3LQZA 2C4FU 1QRNA 3AY4A 1G7MA 4NQUA 1TQBC 1BVKB 1D6EA 1DN0B 1V3KA 2XZAL 3BD3A 3JSSA 2OP4L 1ED3B 5F6HI 1AHWB 1E6JL 1A6WL 1JGDA 3SGEI 4WU7B 4C54A 4FS0A 3LPFA 3F6LA 3WIFB 4XPTH 4PUBL 4ODVH 2IG2H 2MWCA 3U0WL 1KTKE 2J3SA 5C0GA 4G8GE 1KB5L 3P4LA 1C08A 4F58H 1YMMA 3F7YA 3S37X 1NC4B 5F6IB 2RGSA 2WUBH 2VXTH 3RP1A 3VWKA 4LFHD 1FJ1B 2A9NL 3DARA 1ZE3C 2QEJA 5LGKA 3RPIA 1MFAL 1J8HE 3MRRA 3CJJA 3QCUL 4I4WB 4P3CL 3TV3L 4P4KA 5MP6H 5D7SL 5HDLA 4IOFD 5CD3A 3MRLA 3QDGB 4HFUH 3DYPA 4AJ0A 1AHWC 5F71A 2XWTB 3DXAA 3KDMA 5DJ0A 2AEIT 4AL8L 1G0DA 1G7HA 5ADOL 3BW9B 4MB5A 4WI6A 2NX5A 1DBMH 3GFUA 1KJVA 2DI9A 4X5WB 5TDPA 4Y5XB 15C8H 2OR8A 3GSNL 3OAUH 2Z8WC 4PYGA 5F6IC 2BOBA 3U83A 3GMNB 4YHIB 1H5BB 5HVHB 3QNXA 1JFQL 3MJ9H 2VXSL 4HGKC 3V8CA 5JORB 4MWFB 5DXWA 4PJDF 3CMGA 4HHAA 5I1KH 1R24B 2HFEB 2YPKB 3DO7B 1KFAL 3HMXA 3MLZL 4M61B 1OTSC 2OR9L 1E4JA 2VTFA 3DX9A 3WD5H 4DFHA 3ZYIA 4BQ9A 3BPNB 2LQRA 3PE9A 1NBQA 2LTQB 5TDOB 3AM8C 2C1PB 1MWAL 1QR4A 4KVCL 5EU6E 1YNLL 1NMAL 3KYAA 1J9CT 4RGMB 2XQBL 1QR1A 1YQ2A 4MXQC 3DVNB 4JFFB 4Z78A 1IJ9A 4Y5XC 5BVJB 3BP4B 4MNQE 3KYKL 3JV0A 5E8OA 5HVHC 1H5BC 4PRDB 1JZ2A 1SEBB 4FQXB 4ZO6A 5GGVY 4JVPA 2Q7YA 4DAGL 1SJHB 4TVPE 1WUNT 2A6JA 1NANI 4ZFOL 4J3VA 5ICXA 3FAWA 4U6YA 4P5KA 1KBGL 1X4ZA 4LPWA 4R3SB 3N85H 4PLKD 3BPNC 2BFVL 2Y5TB 4O00A 1I3RB 3BSZL 2LTQC 5ESQA 3M1BA 1KCVH 1EUTA 5TQ2H 3O8XD 3MLUH 4TUOB 4RGMC 5DFTA 4FQHB 3B5GA 5D7IA 4H26A 2HJLA 2DJ4A 2IPTL 1A0QH 2GJ6B 5D1XC 3WJJA 5C86A 1H9VA 3WIHH 2NNAA 1KJ2B 4XP4H 5HHPB 3LVEA 2YBRA 5J3HC 4FQXC 1ERNA 5IBTL 3RKDC 3V0VB 1NLDH 4PTTB 2VDRH 4NUGH 1Q1JL 5EIIB 3VG0L 4OIBA 3SDDD 2R4RL 3CNKA 3GO1H 5I1IL 1KIRB 4JCMA 3RWJA 4AIXA 2QQKL 5DI8B 4DW2L 4POUB 3MODH 4G6AD 4G3YL 5DMYA 1QSEE 4L8BB 1XGRB 5E6YA 5TQ0L 4OCWH 3NFPA 3CFBB 3ES6A 4YHPA 5AZ2L 5CBEB 3DRTB 1SY6A 1U8HB 5DUML 3G04B 3VXRE 3UTTD 3KNBA 4CN4A 2YSSB 3BP6A 2DTSA 5HVWA 3Q1SH 2VDPH 4FFZH 2EYSB 3QO0B 3C08L 2XWBA 1RJZA 3T08A 5DSCA 5EO1A 4JFOB 2NY0B 1M7IB 2PO6A 2QLVB 1LEKA 2H2PC 2NY3C 2O5YL 5ERWA 1I9EA 1TFHA 3P77B 4PBVC 1OHQA 1KTLB 5T3XL 3JV4B 3MNVA 5F7YC 4PJGA 3IFNL 4HUWA 1N2RA 4MX7B 5EPMA 2AJVH 3G08B 4X6DA 4JDTL 2GITA 3IKCA 1BVZA 2DLFL 4WI8A 3M17B 3H42L 2CKBH 4RAUB 3C5SA 1KPVB 3SDXB 5IWLC 4NZUL 5IJKA 2DD8H 3BGMA 3BWAB 2PYEE 4HUVB 3B43A 4GAFB 4YHOH 4M6MH 5GS0C 3M45A 4DTGH 3O8XA 3DIFB 3D3VD 4CKVX 2FGZA 2IGFL 3WFHB 5MHSE 3V4UH 1G9NL 3QFJA 1AQKH 5IVXB 2DKUA 2NY0C 3I6LD 3PQYB 2Q8AH 3SY0B 1CICA 5D6DC 5FYJU 1VB9A 1PKQA 3HC0A 2V2WB 3WIIL 2CLVA 1IEBB 3PWVA 3EBAA 2B39A 2YKLH 3LN4B 2ICEA 1ADQA 3HPJA 4MD4B 5CKGA 2L4OA 2AK1H 5ECJE 1JNNH 3CIQA 1HKLL 3DLQR 3SDDA 2A6DA 2NZ9D 3GDBA 4XRCB 4YDKL 5JXAL 4D94A 1MI5A 2A2QT 5DZNA 5KW9H 5B4MC 2ATKA 3IETB 2Q6WB 1D5ZB 3NFNA 1LE9A 3FZUD 3OF6D 5FV1L 4M62H 3KPNA 4DJMA 1ZHBB 1QOKA 5IFHH 3BZ4B 3UTTA 3HNSH 2VO5A 3N1PC 2V5YA 2MSPA 4Z0BL 2A74B 1YEJL 3DBXA 4KAQH 1PJ9A 3RL2B 4YX2H 3U0PB 1MFDH 2BJML 3ZKXB 1VESA 1RZKH 1N64L 5EIVA 5IHBA 4OAWA 3WHXB 2WWMD 4WWKD 2D0HA 3KXFE 5F9OH 1MLBB 2ESVB 5FHAL 4MZ3A 5ENWB 1N26A 1IGJB 3IGAB 3F7RA 5KG9B 3MBXH 4M1CD 5D5MA 2RB8A 4IRJA 4TVSa 1H8SA 4K3JL 4P57A 5ID1A 3WLBB 3IXAA 4EN3A 1EHLL 1R0AH 1T83A 1Q0XL 2XTJB 3NBNA 4FZEH 1E4WH 1H15A 4MJ4A 3W5NA 4PJ9B 3C5JB 3OX8B 3MNZA 2F9BT 4N0UA 4DKFH 1UJTA 4LLWA 2GAZA 3D3VA 3RWFA 4EEEA 4HAGA 5J6HA 3ZKXC 4UUJB 3VXOA 4NQVB 5CWSB 1FFNA 5CMAB 5DJXB 1I7TA 1PEWA 3IJYA 4KRNA 3ZYOA 1DBAH 5AD0B 5FO9A 4TUKL 5LGHL 4NZRL 3DYOA 3DRQB 1JMXA 5C70A 1IAIM 4QWWD 5DEFA 1UWEL 5FA4A 3GSUA 5HVGB 3RBGA 4ZUTA 5I8CA 1YPZF 1V05A 4QRQB 1QLEH 2HT2D 3ZDZF 2WLYA 4RMUA 1ZV5A 2XPGB 2XTJC 3OGCA 4QXTA 4PJ9C 4NHCL 1S3KH 4ONFL 5GRUH 2BNQD 3LZFL 1YC8A 4ZFGL 3MUHL 3DMMD 4AZ8A 1I8MA 5F97E 4NRXA 1DL7L 5DD1L 5HDBE 4N8VA 4DVBB 5IF0B 1K5NA 1ZEAL 4WHTA 3GBNH 2YD3A 1BHGA 1QBBA 5H2BA 5JOEA 3E6FA 5D2LF 3IDYB 2MHAA 3EOTL 4AG4L 3R1GH 2G2RB 4LSRH 1MHHA 3RU8H 4WWKA 5KANI 4HBCL 3HC4H 3HMXH 3FOMA 4JLRA 5D4QA 4JFDE 1OP5H 3L3KB 4NN6B 3W81A 5D9SA 4HXBL 1A6UL 3UJIL 5HHNA 1RPQA 3ZKQD 5GGQH 5J1AA 1ZA6A 1P4IH 1CFQB 4PRID 5IMKB 4Z7WB 5JQHC 2ADFL 4GBXB 4WW2F 1U3HB 3KHQA 1CK0H 1YECH 5GQBA 3WS3A 1X5AA 4WU5B 4NSKA 4WHYG 3T4YB 3C5ZD 3PABB 2JCCA 4X5LA 1RK1A 1LDSA 4E5XB 4R7NA 4LCWB 1T22A 1I85A 3MXWL 3D1MC 2Q3AA 4KKNA 3IDYC 4G8FA 4FQJL 1S9XB 4N90D 1RURL 1DDHB 5C0BD 3L5HA 1ONQA 4ONOA 4PD4K 2CK0L 3BRFA 4K2UH 43CAB 1A3QA 4I18A 3MGOA 4M4RA 4GRLB 5DJAB 3U7YH 5CAYB 4NJ9L 3ARXA 4YXKH 4EIGB 2PETA 4OF7A 4U1LA 1YQVH 5JMOC 4RRPG 3V6OA 1ORQB 1ITBB 4GBXC 4LSTH 3TO4B 1U3HC 1EH9A 1ZLVK 3HI1B 5E4IA 4LGSB 3PV6B 3NAAH 4XNQB 1G7PA 2BNQA 1UWXK 4HKZB 1IL1B 1KCRL 4P3WA 4OGXL 4MAUL 2HG5B 3DMMA 3ZKMD 3JWOC 4CVXB 1H3VA 1VSCA 1AQDA 5F7DA 5GRVL 3WJLA 5I1HL 1WCBA 4E41B 1G1CA 3ULSB 2A6IA 1J10A 2ZSWB 5L8KB 1ODAA 2FB4L 4UILH 1JUFB 2IBGA 1BREA 3L9RB 2YUXA 2B1HL 3MROA 5K9JL 4U6VL 2NY6C 3IU3A 5FFLA 2GKIA 4GRLC 3JVGC 4UBDC 4KKAC 3QRGL 3FN9A 4QRTB 3SEPA 4JN2A 4YR6A 4U1SA 4GAGL 1FDLH 2X05A 2IMMA 1SY6H 4FXGA 4G42A 5C0DA 2X70A 4ZO7A 1C5CL 3ZE2F 3LN5B 4M3KB 5L7XL 3GMQB 4UT7L 3T4AB 4JE4B 3ARDD 4POYA 3BRDA 2W9EH 4U6HB 4ORGA 1KTDB 1U8MA 3V8OA 4OLWH 1A8JH 1Y6NR 2A83A 1WZ1H 1JHLL 2UY7A 3OKKA 3GGWA 4OBRA 3T0WA 3C5ZA 5SX4H 5D2NA 4NRZA 1FRGH 2FD6H 4HS3B 1RD6A 5I30L 3GIZH 5JO5B 5MEOA 2KBGA 4M7LL 3BIBX 3QPXL 4Q0XH 4EOWL 5CGYC 4XVJL 1LEIB 1IAOB 4RZCA 3MRGB 4AIZA 1PG7W 4OKVA 3MSPA 1GGBH 1RFDL 5L9DL 4F8TA 4XP6L 1N5AA 2KQNA 1KNOA 4J8RA 1T1XB 1HCVA 4Y7MA 1JF6A 4K9EC 2W1NA 4S2SA 5DD3L 3WFZA 3VFTA 5FKPB 4Q97A 1CF8L 4AIOA 1JGUL 3VFGH 4Y5VA 2YPLD 1BQLL 4F7MB 1A7NH 4P23A 1OARH 4KTYA 2E8YA 1J05A 4LRIA 4PRPE 3VXME 2E6JA 4EI5B 3DYMA 4BSJA 1ADQH 1LVEA 1MFNA 2I07A 4GKZA 4OZIA 3BE1H 1PVHA 5GRZA 2JELL 3X3GL 2XFXA 3QEQD 1XF2B 3VFVA 4K7FA 5MI0B 1HNGA 1AXSB 5D6CB 3H9ZA 4QXGH 5I71B 4P4RA 2OZ4A 2YD1A 5AUMA 1MQKL 4PJIF 5TE4L 2P7TB 4FXKB 1A6VL 1YNKL 4ZO8A 3MV7B 5CJ8A 1OP3H 4GKNA 4CN6A 4KMTH 1SM3L 1I8LA 3MV11 3OKMB 1JPSL 2K9UA 1ZWIA 1UWXH 5EOTA 2FHCA 2E7BA 4LEXH 4PBXA 3LN9A 5HD8D 4PIRF 3B5TA 1F4XL 2FJGB 1NGZA 4G7VH 4UB0L 1S7TB 2BY3A 2C3XA 5I66B 2SEBB 1PLGH 25C8H 7CGTA 1R3JA 2JB6B 3ULUL 1G1YA 2YUWA 2H6PA 5GRXG 4KJPC 2DBLH 3LB6C 5TGBA 2RAMA 2AXJA 4Z7UF 5HYQB 4WTXA 5MI0C 5I71C 3NTCL 5EFIA 2P5EB 1NH6A 2YEZA 4K3EH 3GBML 5C0IB 1IGFH 5JDSA 4ZTOH 4JJ5A 1QBLL 4WFHD 4PP1C 5C09D 3EO1B 1W0VB 4IMLB 1OWWA 2NW3A 1XCQB 1F58H 4KKLC 3OKYA 3QA3B 4QTHA 3K2UL 1BZQK 1FVDB 2CLRB 5DMKA 3ZYZA 2V2TB 3ARZA 3BVNB 4P9HC 5HI3C 4RQQB 2AV7A 5DHYB 2EDRA 1K2DB 1G9EA 5EWIL 3LEXB 1ZK9A 3GJEA 2ARJB 1BBDL 4V2CB 1MF2L 3WCYA 5C71A 3W9DA 1ORSA 1JI2A 1QBAA 2JB5H 1IKNA 2LVCA 3T8XA 1A6ZB 3MRBB 4ZD3L 3WNPA 4NCC2 4P5MA 4KV5E 3LRSA 2Y5EA 1SEQH 4WDIB 3QDGE 1X5ZA 1FFPA 1XGTB 3QEQA 4NBXB 3QHFL 1NJ9B 5EOCL 4JO4H 3W82A 1GVIA 5AEAA 3ULVC 4KI5C 1QLFB 4QHNA 1B4JH 1I1AB 1I75A 4IEFB 4MB4A 1S7QB 4PJ8B 3L5XH 1UM4L 2GTZB 1BLNB 1DUYB 2Z92A 2GSIA 5I73C 4UTBH 4F37K 2J6EL 2W65A 4WO4D 5ICZB 5C8JA 3BMVA 4M00A 4CVWA 2F58H 2BX5A 4NC2B 3U4EB 2E7CA 4U0QB 3BH9B 2VL5B 1T4KB 2NW2A 1VKXB 2V17H 1ACYH 2XRAH 4NKDA 4PB9H 1Y6MR 4Q7DA 4JANA 4BFIA 3VFMB 3VXTA 4QT5A 1JN6A 4PJHE 2NY7L 1F6FB 3U9PL 2K3TA 2DQEH 3OPZH 3IXTA 1VDGA 5FXCH 2D7PA 3PWUB 4OD2B 2JJTA 4JFZH 3P0YH 5J12C 1AGDA 1I1AC 2AV1A 5C09A 4PJ8C 5HYSB 4K94L 5EO9B 1DEEB 3OZ9H 4NNYB 1NKRA 2A0LD 3GJFB 4JFFE 1JV5A 4L3EB 4ZTPL 4ZUSB 5DFVD 1P5VA 2W0KA 3GHBH 2NR6D 4AM0A 3OKNA 1F3RB 4G43B 1KJ2L 2ZCLL 4PJCB 3HNTL 1OAQH 4MDIA 3ECBA 1RAMA 2F54E 5F1IA 4N0YH 2BY1A 2B4CH 3VFRA 4YDVB 4XMPH 1RQ5A 4OKDA 2PCPB 3QCVL 5C0AB 3UTPD 4WY7L 2P24A 1BIHA 3H0TB 2R9HC 1KOAA 3RWCB 3S8WA 3C8DA 4LLVB 1FGVL 5DWUH 2EEDA 1UM6H 4ODSL 5DK0A 3D69B 3MCLL 2NMSA 3LKQB 1EO5A 4TQEL 2R1WB 3U6RA 2FRGP 2GJ6E 1ZT4A 2DQHH 5GJTL 1ITCA 5GS0L 5CJQL 4N8PA 1FLTX 3C8HA 5EOQL 5SWSD 1D6EB 3Q48A 3PWLA 3WXWL 3K4AA 4QXUH 3PXJA 4WO4A 5DK2A 4PJBB 1KLFA 3M07A 1JGDB 1RIVL 43C9A 1BOYA 5FO8A 1K3IA 2ITCA 3QIBC 4FQLL 2LAAA 3UJTH 5I8OL 4LF3A 1T0MA 5IMOA 4KGJA 1FV1A 4F9LC 1VFUA 4L5FH 2Q7NA 5E8NA 1YMMB 2QKIA 3D9AL 3D25A 3CFDA 1RZKC 3ARBB 2OL3H 3NZ8A 1HHKB 5C07B 3QXTA 4EJ1C 4MSWA 3QUYD 3I3DA 2D7TH 2Q87A 1QFWH 3RPIB 2J4WL 2AKRA 4Y4FC 4P4KB 1G7LA 2Y6SD 3DGGA 1CLZL 1T80A 2CGRL 4YBHA 1CE6A 4G6MH 5CD3B 3AY4C 3BD5A 1X5GA 2VZ1A 1I1RA 2F74B 4LOUC 2VABA 5GZND 4YQXH 3LQAC 3U7AA 4YHZL 3DXAB 1PQZA 3GI9H 4HH8A 4NQCD 5DJ0B 3CC5B 4L1DA 2Z31D 3BH8A 2Z35A 4DZ8A 2OMBA 2ZG2A 1GC1L 2P8MA 3CDGA 5B38B 3RVTC 5I76A 3DX6A 1A3LH 1WFNA 2E6QA 2EYTB 5E1AB 1P9MA 1D5IL 1MCBA 2VDNH 2BOBB 3ARBC 3SDXE 3VWKC 1JNLL 5HGHA 1AR2A 2VUOA 2VWEC 3H9SD 3PGDB 4CUCA 4HGWB 2E7LC 3B9KB 4JJHA 5AWNH 1IQDA 1IKFH 4HHAB 4P4KC 1NGYA 3BN3B 1F4HA 2VXUH 4I9WE 2YWYA 3MNWA 5IVXE 5E8PA 1UB5B 5F7KC 3ZE1E 4BJLA 2DL9A 3QIUD 1FP5A 3NABL 4IOIB 5FM5O 4QNPE 1CGSL 5KSAD 3ISWA 1LP9A 1T2QH 5EO0B 1CDYA 5F3BB 1RZ7H 4HIXL 1DQLL 5ITFB 4D2NA 2E9BA 3JXAA 3MJ7A 5EUOE 1C5BH 4DZBA 1EERB 3NACL 4HEPG 5IFAL 1OSZA 1RUQL 1S5HA 3BUYA 3DUUA 4L9LA 1LO3H 2V5TA 5E8OB 1QBMH 4JGJA 1U8IA 5DQJB 2ZUYA 3PWPB 4HAFA 2JIXD 5FYKE 1AD0A 3GSOB 4OLZH 3MGTA 5C0CD 3B9KC 5DMGC 4MD5B 1JNJA 3VD5A 3V9FA 1II4E 12E8H 4JM2D 2AK4D 4U6YB 2DKSA 4NJAL 4GG6F 1UQSA 5IEKB 4S1RL 3ORJA 5AAWA 1QG3A 3ILPA 4G9FD 1U2HA 3MV8E 4EVNA 3V79C 3I2CH 1QP1A 3EAKA 1HH9B 3V4VH 2HLAB 4BFGA 4H26B 2HJLB 4EZMA 4NQCA 3TEUA 1OTTD 2ESVE 1UZ8B 3BKYH 1XGYL 3P2TA 1CGWA 2BZDA 2NNAB 4RA3A 1P7QD 3O3UN 1IC5H 3TT1H 3C60D 4FQCH 4EBQH 2VUYA 2AEQL 1IQWH 1KPUB 1P84J 3HE6B 3GRWH 3RX8A 2XTJE 4KRPB 4JDVA 3SKUD 5J6GA 2X9YA 2J8UB 4KZDH 3H9SA 3CCHA 1VFAA 5B3JE 4X7FC 3RWJB 1XIWD 3KLAB 4Z18A 1RZIA 3A67H 5F1NB 2H8PA 3HUJB 4OB5L 4MA1C 1CD9B 5C3TA 4GUPA 3M8OH 1WV7T 3NFPB 2E7HA 3QQ9D 3QIUA 4OM1H 1KEML 5E2UH 5KSAA 4PTUA 4GO6B 3T1FB 2XV6B 1LO4L 3D39B 3QB7C 1CQKA 1KCSH 2X4NA 4FTVB 4XMKL 1O5DT 1FHGA 3VXNB 5BO1L 1JGEA 2PO6B 2XA8H 1YEKH 1T03L 1MFCH 4OFPA 4QO1A 1CDJA 2ZSVA 1A1MA 4YPGA 2DN7A 3HE6C 4N5EC 4XNMA 3MNVB 4KRPC 4PJGB 3WUWG 1E27A 1EXUA 4JKKA 4X6EA 5FDWA 4GLRH 5C0CA 5B39G 1N2RB 5CILH 2GITB 2YK1H 5IR1A 1FSKB 3QO1B 4XC1L 3QUKB 4JM2A 2AK4A 3IFPB 1M4KA 5IHUH 5HVFB 3MJ6A 3P4MA 3HLAA 4G9FA 3ZDYE 3REWA 3S5LB 4XXDA 2EDYA 1AR1C 2ADIA 3QFJB 1NLBL 1JGLH 2BSRA 2DQDH 4P2RE 1F3DH 3SGKA 1R3KB 4JKWA 3BGAA 3G6DH 2PO6C 4YUEH 1NKOA 2DYPD 1QSFD 2GTWA 1CICB 5GGVH 1Q94A 1A14H 3MRJA 1PKQB 4R4BA 3C60A 1Q9LA 2OK0L 4M6OH 3PWVB 3FOLB 3MRNB 2Y07H 2ADJA 4YE4L 4HC1A 2ICEB 3KWWB 3HPJB 2P8LA 1T20B 2FHBA 4MJ6B 5IT2L 4OZHA 3RZCA 3S96A 4K3HA 4XAWL 2FATH 1FSKC 2DMBA 4UIMA 1FCGA 2AQ1A 1C16A 5LQBL 1XIWA 5IJKC 4M6NL 1NEZB 4XWOD 1MI5B 5SX5K 1YEHL 4LCWE 1O7VA 1RIUL 4U6XB 2YC1A 1LE9B 5J56B 2NZIA 3OKDA 4UU9B 5C2UB 2JKXA 4X6FA 3OKEB 1X5JA 3ZSTA 3QXWA 2Y25A 4P2OD 5T1DL 4ERSL 1NBVH 3S36H 6CGTA 4NNPL 3HPLB 5IBLD 1J12A 4LCUA 5D7LD 1CICC 3KPMA 3NIGF 3DX7A 4M9PA 1AO7A 1IM3A 5DUPL 1DQJA 4WFFE 2IAND 2ZCHL 3OG6B 4HKJA 1DUZA 5DR5L 4JO3H 3T2NH 3W2DH 1NC2D 3EYVB 4B41A 1KYOJ 2ADGB 1CR9H 3BGFB 3F58L 3MRDA 3FB5B 4IRJB 4JRYD 4L4VD 3SKMB 1NCBL 1VEOA 3ARGA 4EN3B 3HKFA 1LQSR 4G6AC 2FSEA 3DV6A 4E41E 4ZUVA 3U1SH 5HHOB 2XKNB 5T33L 4IRZL 1H15B 4I2XB 3CFCH 4X99A 2CDEB 1W0YT 4JR9L 5LBSL 4BQBA 3MNZB 4NCC1 4OQTA 3O0RH 2GAZB 2JE8A 1G7IA 5E56A 2PXYB 1I1YA 2MQCA 4GXVH 4KTEH 1YYML 2DYPA 1QSFA 4JKPL 4O58L 3MLTA 2W9DL 5K93A 3IJYB 3ZMRA 3MACL 5FO9B 1DLHA 1UWGL 1XF5A 2Q76A 4FQ2H 7FABH 5DEFB 5FA4B 3BGFC 5GS1A 4IRJC 4ZUTB 1ZT1A 4TSBH 3F7VA 2VRAA 1RZFL 4NWUH 4Q6YA 1PSKL 4EN3C 2XKUA 1B3JA 4LSSH 3GIVB 4JY6A 3HAEB 5LXGL 3QDMD 1S7XB 3PGCA 4K55A 3R8QA 2IH1A 3K8MA 4RAVA 4W6XB 4BQ8A 3IDGB 4G8GD 1WZLA 1F02I 1DSFL 4RRPA 1NCWL 3V52L 3GMMA 3QDAA 5EU3A 1IGCL 4P2OA 1JWSA 2AEWA 1CFTA 1N7MH 1BX2A 4RFOH 3ZSSA 5EU4A 1K5NB 1QHOA 1M7XA 2AGJH 5FB8A 1J8HD 5F93C 1BWWA 2IANA 1J0ZA 4QYOA 2YWZA 4MXVF 2VC2H 3ZE0E 4C4KT 5B8CB 1NC2A 2GYSA 2HVJA 1N6QH 5SX5H 4XPAL 5HHNB 4JRYA 2NZ9C 4P9HL 4L4VA 2VDOL 4KUZL 1MJUH 5I15L 1JZ4A 4K7PX 1V7NL 1ZHKB 3NZHH 4F37F 5DJCA 4I3RH 1MELA 3ARSA 1LEGA 2WBJD 4WTWA 2DQUH 4ELKB 4G6FD 2FH6A 3O11A 4ZO9A 1AGFB 3SQBA 4NSKB 1VPOH 5ANMA 2EC8A 1PG7X 4CW1B 2HTKC 4PRNB 4LPXA 1RK1B 5F7EL 4XVSL 4EKXA 3KLSA 1OAYH 5IV2B 3CD4A 4PJDB 3D2UB 4JGMA 3MV7E 1KLUA 4OD3H 4M5ZH 1M6OA 1QFPA 2K1MA 5B8CC 2D03L 3WSQH 1RZ8B 1AE6H 5DA0B 5JXED 5BCAA 5KJRH 5EC1A 4QGTA 1Z3GH 1P1ZA 4U1LB 3BHBB 2I5YH 4LAQL 5EU6D 3V7MA 1CZ8L 4PS4L 1ZGLB 3RWGA 3TBWA 1XEDA 3VI4F 2J8OA 3QDMA 3BYYA 4M3JA 4MNQD 1G7PB 1S7WA 4HLJA 2EDDA 1UKSA 3S35H 1C5DA 4RCAA 5TPWL 1XFPA 5GGSA 1I1CA 2P5EE 35C8L 4K7PL 3UTQA 2XXMB 5F7DB 4Z8FH 3HZVB 2CLZA 2GQHA 2R2EA 4F33A 5JW4N 5DVOA 4DN3L 1I1FA 5DT1L 2A6IB 4KI5E 3ULVE 1A4JA 4Z7OF 4OF0A 3LV3A 1G9MH 4KVNL 4LSUH 4TVPD 4JFYB 3EKCA 4ONHB 1OL0A 1PG7L 1QLRA 2AERT 3NCBB 2IFGA 4TN9A 3VCLA 4X6CA 3RDTB 1QZ1A 3GNMH 1ZLUK 1CLOH 5BVPL 1GL4B 4HPYL 3CU1A 1WEJH 4I3SH 1SJXA 3MZGB 1CVSC 4NQDB 1U93A 1FO0L 4PJ7F 3CZFA 3E0GA 3MLPA 4G42B 3U36A 5C0DB 1CT8A 3QXUA 1S78C 1XAUA 4JVWA 4ELME 4LVNB 1KB5A 4LQFH 3UROR 2XNAB 3SCMA 4DKEH 4QF1A 3CVHB 3KPPA 4NO3A 1MCOH 1CXKA 4Y4KB 1F00I 3DMMC 3SO5A 4FFYH 4OFVA 3OKKB 1K6QL 2R29H 1G84A 3TT3L 5JTWA 5D2NB 3FQWA 4S1DD 3X13B 3MLYL 4A2MA 2NY2B 5JPNA 1RVFH 3NVQA 2XOTA 1KCUL 4LCIL 4ODTL 3S88L 4Z95H 4KXZI 4P46B 4TTGA 3B3IA 2DIJA 4YXLL 3RDTC 4RZCB 1P5UA 1IRAY 5LWYH 4HXAL 4AIZB 1QSED 1RULH 5FAAA 5CUSL 5EN2B 3MCG1 2DKMA 1KNOB 5JXEA 5E7FA 4X7SH 2IAMD 5D71L 3CLEH 1MCSA 1Y18A 3VXRD 1H3UA 2VE6A 4OCMC 3VFTB 4OCXH 1LK3L 5KANG 5IB4A 2D0GA 3EYFA 4LVNC 4ZAKB 3TYFA 5D70H 3O41A 1I7RA 3GSNA 4Y5VB 4HDIB 3LEYH 4Y4KC 4P23B 4MD0A 4MNQA 3DURA 2E9JA 3VGFA 4XHJC 2R0KL 1DVFD 5D2NC 4LRNH 1Z9MA 1KG0A 5TFSH 2NY2C 2OJEA 3QQ3A 1L6XA 1XR9A 3BN9D 4A2LA 4HC1H 4P46C 3RL1A 2HN7B 4AEFA 5E08L 5EIQA 4KJWD 3EJYC 4L3EE 5L2KE 5DVLA 5EBMA 1T5XB 2FO1A 1EMTL 3IDXL 4P4RB 3BT2H 2PYED 1FNAA 1MWAA 2YXFA 3DWTA 4JZJA 5M95B 4O2EB 4M5YH 1GZPA 5TE6H 3W0WB 5EUKA 5JR1L 4R4NC 3LQAL 4F80A 4YK4B 5MEPB 2AW2A 4NKOB 5DHVB 3O3AA 4ZAKC 1CD8A 1ZWIB 2HKHH 3ZLQC 4Y5VC 1MCDA 5C1MB 2B1AH 1YEEL 4P23C 5T3XD 5MERB 3FO1A 1DANT 5C0AE 1C1EH 1FC2D 1QVOA 2O5XH 5D1QB 3T3PE 4LRIC 1U0QA 5C7XH 5EC2A 3JTTA 5J4MA 3RUGF 1T5WA 2B0SH 2P45B 2H6PB 1NUDA 3LS4L 1U8NB 4ZFOA 2X4QB 3TJHC 1NGPH 4YBLC 1U6AL 4HD9A 1QRNE 1FQ9C 3AS2A 3BJ91 1CL7I 2DTML 2ICES 2FCBA 4Y19A 4NFDA 2DLHA 5FCUH 4PJBE 3VA2C 1VA9A 2BCKA 3TBSA 4KJYA 4YK4C 3T0BA 3IS0X 2Y23A 3VXRA 4F2MA 3KPRA 5DMKB 2BDNL 3EHBC 2NY5C 4GXUM 3HFML 4RDQG 4U2YA 3TJEH 3WFBH 1TJHL 5F1SA 4R96A 5ALCH 4B50A 3B5HA 1MJ8H 3AXLA 5DD5H 2OCFD 1YMME 2X9WA 3EZJB 2YD5A 4WHYH 5D1QC 1L0XA 1JPTH 3SDCD 1K4DA 3MPCA 3S34L 1ORSB 2VWEE 1BAFL 3EZ8A 1H3PL 1RIHL 3TPUB 4MLSA 4L8CB 1NAML 4YC2B 1E4KC 4P5MB 3QHZL 3AU1A 5IW3A 2OYPA 3LRSB 4AEHL 3AC0A 4YXHH 2ZUXA 4ZDHA 5SWQB 2PTVA 5JOFB 3WHE1 4L3CB 4KK6D 4IMKC 5F3HB 1FFPB 3ZDXE 4W4NA 2GY5A 5GRWA 3DXAE 2R4SL 2PYEA 4DVRL 4HUNB 3UYRH 5E2TL 1RUMH 2UWEF 4UQ2B 1HQRA 2ZPKL 3LIZH 3BO8B 4X8JA 1MH5B 4HWEL 2GJZA 1DQQA 3FTGB 4WCYH 5FEBA 2W65B 4RX4A 4HZLB 3GKWL 1MHCB 4AENB 3PDOA 2CUMA 5DD6B 4R2GB 3I02A 5IOPB 5CINL 5E8DH 3RIFK 5I1LA 4M1DL 1E6OH 1HOCA 3MA7A 4HWZB 1XMWA 2UYLB 4NKDB 3VXTB 1BZ9B 4HH9A 4OSUL 3SOBH 1P6FA 1YPZB 1TNMA 1DFBL 4FNLL 1FNLA 1A5FH 1MHEB 3U7WL 3IXTB 1XF3A 2M2DA 4OCYL 3LKPA 1AGEA 4JM4H 5FK9A 1B2WH 4GSDH 4IM8A 3WS6C 2H1PH 3QXDA 3V6FB 5CBAA 2AV1B 3HMWH 2COQA 1CDUA 4RWYL 5BZWB 4UV7L 3KJ6L 4WEMB 3CMOH 3HB3C 5DZLA 2Z91A 1JV5B 1HEZA 4ZNEA 5JPMA 4X98A 4AM0B 1RK0A 2OJZL 1WCQA 2VIRA 1YJDC 4H88H 4N0CC 2F5AH 4YHNA 4P0DA 3WFDL 5EBWA 2Q20A 3ECBB 3NA9H 5D2LB 4RMQA 3FRUA 1OWRM 5FYJE 3MV9B 1AGBB 3S4SB 2X4PA 4JFDD 4JO1L 3H2WA 4PRBB 3WL9A 1NEUA 1U58B 3DVIA 3IJHA 3GI8H 3MYZA 3QWRA 2P24B 1NMBH 3O3BA 1KSRA 1MEXL 3CH8A 4ALAH 4HPOH 2JJTC 2HT4D 1B6UA 3T0EB 4OF3A 1ZT4B 4R90L 5GSVA 4L3AA 4I48B 4QRPA 4UTAH 3MOAL 1L0QA 4U0RC 3QULA 4OCNC 2R0WL 4HW6A 3C6SA 5DA4A 2X7LA 2BNUA 1WAAF 5FO8B 1F4YL 1EEZB 5DYOA 3WKML 2Q8BL 2J8UE 4XVUD 4YJZL 5FGCB 3IAGC 1M7DA 3MOBL 5JHLH 4UDTB 2EDTA 4F9PC 2OP4H 2HP4A 3HUJE 3DTXA 4OGZA 4TPRL 5IB1A 4Y88A 5E8NB 3PJSA 3X11A 2VH5L 4XTRC 4F3FA 1EIBA 1JF1A 3NZ8B 3C87A 4NQTA 4KH2A 4OGYH 4PUBH 3T0EC 3U0WH 3VJ6A 5BMFH 1BMGA 4W68A 4JPVL 2IQ9L 5HDQL 1G7LB 1U95A 3DGGB 4JFXA 3SE4A 1KB5H 2CRZA 4QRRB 4FTVE 2I26N 5I8EB 4LIQL 3T3ME 4MQ7B 1F4AA 3CZJA 2FIRT 2VABB 2PF6A 2A9NH 4ACPA 1PQZB 1MCEA 1OAZL 2NXYB 2W59A 4NQEA 4PJAA 4PJGE 2W60A 5FIEA 1MFAH 3P30L 4M6AA 3TV3H 4M8QB 1G7QB 3V0WL 5D7SH 5C6TL 4DZ8B 4XCYB 4ZSOA 1GHFL 2Z8RA 5J1SC 4LSQL 2EDKA 4X6DE 5KN5A 3AUVA 5I76B 2PN5A 4K8RD 2VLKD 4UDUB 4HG4K 1KV3A 5IM7B 4KKCD 3ZL4L 1MCCA 4FFWC 1KN4L 3EGSB 1NGYB 4PRHB 3SJVA 3OR7B 3QFJE 3GSNH 4X7CC 1BJ1J 2X40A 3CFKA 5F9DC 3BP7A 2RBLA 4H8WC 4OD1L 3FT2A 1PKQE 3LKNA 5I17B 4UNUA 2HRPL 1AY1L 3NCMA 3F12B 1BBJA 1X7QA 3MJ7B 1ZOXA 3MLZH 2B8OT 2YMXL 4G8EA 4TVPH 3S37H 4FG6D 1S5IH 3HNVH 3PP4L 1OSZB 3PL6A 4P9ML 4L9LB 1P9MC 2QSQA 3TZVA 1MWAH 1U8IB 4KVCH 1LD9A 4GAYB 1MI5E 2G75A 3ARPA 1NCCL 4KI1A 5EBLA 5C0RL 1NGXA 1KJMA 1NFDA 2DQJL 5D8JH 3O3DB 3FB8A 1MPAL 1S9WA 1U42A 3KYKH 5IB2B 3UTTE 3VXPA 3HTLX 1P6AB 1UQSB 3H3BC 4H5SA 1SBBA 3K80A 3ILPB 3TIEB 3WXVH 1DLFL 2B7DT 1DN2A 3VXMD 4DAGH 5DRZA 5L88H 3QI9D 1MIEL 3CXHJ 5DHXB 4IRSD 1NFKA 3O4LB 5ITBH 5CEYA 2OTUA 1KBGH 5B21A 1YN7A 5D5ME 4L9LC 3BSZH 3K1DA 2BVOA 2FYYB 4M02A 2PR4L 1B0WA 3QG7L 3J8F7 3B6SA 4P2QB 2VLKA 1XGUB 2VLLA 4J12A 4UV4L 5DJ8A 2D2OA 5HHOE 1QUNA 3V4PH 1Q38A 4Z7NE 4I2XE 3U82B 2AEPL 1U3YA 4N0UE 4PJXB 2P8PA 3OB0K 4G7YH 5IBTH 2J5LB 3RGHA 4N8CL 5K59F 1L7TH 3PIQB 4KHTL 5IB3B 3JWDC 1GGCL 1VACA 1R5VB 3MV01 3UX9B 3BZDA 3QQ4A 5I1IH 4PTUB 5CEXA 3UXFA 3RY4A 4Z7UB 4DW2H 1MCKA 1KXVC 2X4NB 4HWBL 4O51A 3B2VL 2DQGH 4G3YH 3SHSA 4HUXB 4R8WL 2X4SA 4U7KA 2J7LA 5AZ2H 4YPGB 3RZWA 5KSUB 3VFOA 2C3HA 3QNYA 1CL7L 4GKSA 1B88A 1EXUB 4X6EB 4TRPL 5HYFA 5FDWB 3TGXA 3CAFA 1NBYA 4KQ3H 2WV3A 4HIIB 5FUOL 1EJOL 4WTZG 3FO9B 2FO4A 2O5YH 4I1NB 4Y1AB 2J5LC 2YN5A 5T3XH 1BPVA 4PGJA 4UT9L 1JYXA 1WBZA 3PGFL 2OTWB 2YN3A 4AT6B 3QIWA 5C0EB 1T04B 3H6JA 1MUJA 5JHDB 4XXDB 2CIIA 4JDTH 1WF5A 2YPVH 3QDGD 3H42H 5DJYA 1OTSD 4NZUH 4D0DA 2C1OA 3QUMB 4OCSL 2MJWA 1Q94B 2QQNL 3QXAA 4JQXC 1BECA 4X4ZA 2HJKB 1Q9LB 4L8DB 4MJ5A 5BV7B 2DM4A 4YDIL 4BSWB 5TDNA 4MXQD 5A1AA 5ILTL 1G9NH 1GGIL 1AXTL 4Y8AA 1MAMH 1ZLWK 2Z9TA 4OZHB 3MRHA 3RZCB 5I1JH 1YNTA 1LK2A 3DHMA 2DQFB 2QQLL 3V5DB 4EDWL 1DEDA 5C0FA 5K9KB 2VLRA 5TF1L 1J0KA 1JK8B 3OKDB 3MYJA 5EA0H 4PJDE 4X6FB 3EYUL 2AI0L 3GSVB 3MLSH 1U8QB 2KZWA 1HKLH 5LAXB 3FFDA 4R4FL 1EAJA 5JXAH 1S7UA 4PLJC 4U1KA 3MCKA 3CSGA 3KPMB 3DX7B 1MRCL 1AO7B 1BVKA 2DQCL 3C60C 3G6JB 1DQJB 1ED3A 5CHNB 4LPTA 5T5FH 1AHWA 5BV7C 3P0VL 4WU7A 3WIFA 3CH1B 1VHPA 4JFFD 5CJBA 3RZCC 2WSKA 3QCTL 3DI2B 4Z0BH 1YEJH 2BNQE 3IDMB 2KDGA 3OJDB 1N64H 1CFVL 3RA7H 5J3HD 4FQXD 4I0PB 1MCPL 3RKDD 4JCLA 3CVHL 1NC4A 1DQML 2F54D 5HYSG 3TF7C 4MDJA 2XY1A 4X99B 5CEZE 1FJ1A 1HSAA 4C58B 2QR0B 4I4WA 1WBYB 1EHLH 4NWTL 4KRMB 5F88A 1Q0XH 2CMRL 4V1DA 2O5ZL 3B9AA 2IJ0C 4NQDE 5CGMA 3ROLB 2GJ6D 2Q76B 3BW9A 2DQTH 3T77B 2PTTB 3TBVB 4XX1E 2DF3A 4X5WA 1R5WB 1GXEA 3ARGC 3SBWC 2H2PD 1NFIB 5GRVK 4I0PC 2VDLL 1GAFH 3D5OF 5D2NE 3CDFA 3O6FB 1UM5L 5LGHH 4TUKH 4NZRH 3RJQB 4EXPX 2CO6B 2IH1B 5BOPA 1UWEH 2ZOLB 4MWFA 2M8XA 1HK6A 4WRLA 1JWSB 2YPKA 3DO7A 2ORBL 4M61A 1SBSH 4JRXB 5T1KB 5F9AC 2DQIL 5C08B 5EU4B 4GQ9L 4NHCH 2C1PA 5GS0D 5IP4A 4ONFH 5GGRY 1FNHA 5FB8B 3LZFH 3NGBB 4X7DC 4ZFGH 5A3IC 1A3RL 2AJ3B 1ZLWH 4NO0A 2HA1A 1EZVX 2J6EA 2NY0D 4DKDC 2HVJB 2VR5A 4PBWD 5BVJA 3A6BH 3BP4A 3FO0L 4MJIB 2NY5L 1ZEAH 3P0GB 3O6FC 4PRDA 4OTXL 3EOTH 1JTPA 4POZC 2FGWH 4HBCH 1LEGB 5ESAB 2UUDK 1SJHA 4CMHB 5DJ6B 4P2OC 5ANMB 4OIAA 4HXBH 1A6UH 3UJIH 2PYFB 4W81A 1OCWH 4XT1C 5IBLC 3MFFA 3MZTA 5B4MD 1OB1B 2Y5TA 1I3RA 1EHXA 1Q8MA 4LSDA 4MNGB 2QSCH 1WBXA 3NGBC 5J1TC 2DLTA 4TUOA 3X14B 5F70A 4FQHA 3O6KL 5B38G 4I9WD 1M6OB 1LO5B 3PQYD 1OT1A 2HRLA 3K4DA 4QHKJ 4X9BA 1SVCP 4OFYD 3FQNB 3EJZC 5EC1B 2GK2A 1KJ2A 3MLVH 5HHPA 2FJHB 3RJDA 4F15C 5F1KC 2ARJQ 2FX9L 1CFNA 1YEGL 1RURH 3V0VA 4PTTA 1CFBA 3IDIB 1VGEL 4Y2DB 5DZOA 2AJUH 5EIIA 5IROA 5INDB 4CMHC 1SJVA 3V6ZB 1ZHLB 1S7WB