2W9DH

Structure of fab fragment of the icsm 18 - anti-prp therapeutic antibody at 1.57 a resolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGPELVKPGSSVKISCKASRNTFTDYNLDWVKQSHGKTLEWIGNVYPNNGVTGYNQKFRGKATLTVDKSSSTAYMELHSLTSEDSAVYYCALYYYDVSYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQSVTCNVAHPASSTKVDKKITPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ICSM 18-ANTI-PRP THERAPEUTIC FAB HEAVY CHAIN
publication title Crystal Structure of Human Prion Protein Bound to a Therapeutic Antibody.
pubmed doi rcsb
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9dH02
1S9KC 4PGDA 3GBNH 3I75A 1PVHA 4AK1A 3SKJH 5BS0E 4WW1B 2F19L 3VFWB 1NUFA 2HT2C 2NX5A 3BPNC 3TH3T 4JREB 1DN0A 5IWLA 4PPTA 2IMMA 2AK4E 1NCTA 3BIAX 4V1DA 4R0LC 4QY8B 1W72B 4NQXA 4HH9A 2R2CA 4HJGA 4U1LB 4LKCB 4YBLC 4DFIA 2E7BA 3FQRB 4K07A 2CO7B 1AFVL 3DETD 4YUEH 4R8WL 3ELAT 2ESVD 4OLZH 1RJCA 1Z9OA 3PE9A 1N64L 1NUNB 2ADGA 4NNXB 3V6OA 1UWEL 4G9FB 5INDB 3H9SB 3QCUH 4CW1A 3AREC 3ARYA 1OPGL 1BWWA 4XCYB 3GM8A 4KVNH 5DQDL 2NX5E 5DD3H 4JFFB 1NFDA 5ISZB 3AM8C 3UPCA 1DBAL 5C0ND 4V1DE 1KSRA 3WDJA 2PYFB 1X44A 1DBKL 3WLWD 5JW3H 5E95B 1BFOA 1RZGB 3OR7B 1A7PL 1IQWL 4D9RE 4OCWL 3L3GB 3Q6GL 4GKSA 4M62H 5HY9B 3V6OE 1JNJA 1Z3GL 3QDJB 1HKLH 3UBXA 1QSZA 4HKZB 1G7LB 3ILPB 4E0RB 2NY4C 3LDBB 4JEGB 1AKJB 4MD5B 1XFPA 2R39A 2J2ZA 3OKNB 1NFDE 2CJUH 5HGBA 2AGJH 1HINH 1KLFA 3LCYA 4U1IA 3KYMA 4G8IB 1ZA3A 3F6IA 5C09A 4LLQB 2ZUWA 3M07A 4Z18A 1ADQL 2VSDA 3HE7C 1DQML 5CEYB 5C0JB 1NANI 1BIIA 5EZLA 4JPWH 1UFUA 2GAZA 4BZ1L 5TH2A 3VFMA 3C60B 3T1WA 1ZKAA 1QKZH 1A3QA 1XF2B 5C0FB 3ARDA 1WC7A 2AEPH 4OZHA 2V2WB 5DURD 5IQ7H 1LO5A 3QUYD 1OGAD 5K9KA 4PLJD 5C09E 4KKBC 5I15L 2HFEB 2IBZX 4U6YA 1IM9D 1QA9B 3OX8A 5HHNB 5A40E 3SDYL 3KPSD 3L5XL 1WK0A 3L7FB 5IHBA 2BY2A 3C9NB 1GH7A 5MEOA 3HFML 1NGWA 2R8SH 3P77A 1NEZG 3V6FB 1LNUA 4M93B 1YEEL 2KBGA 1MWAA 5D7KD 4YR6A 4HF5H 2EKJA 4TUJB 5C7XH 1OLZA 2EICA 4LLVB 4HAGA 1F58L 4WW1A 3VFWA 1VCAA 2E5EA 2NXYD 3FTGB 3P4OB 3VFTB 2GUOB 3WIFA 1JNNH 5DEGB 3K81A 3WFEL 4WHTB 5E7BA 4O02L 4QY8A 1W72A 5CS7A 4U1LA 1EFXB 1RZKC 5ACZB 4NQTA 2H26B 2EDQA 4LKCA 3T1FB 3IDMB 3U79A 1BFSA 4X9FA 3FQRA 5IWLC 3NMEA 3WYRA 4Q7DA 1UXWA 2CR6A 4YNYB 1JP5A 1ZXQA 4NNXA 4ONGH 3L95A 3JWDL 4G9FA 2EC8A 5INDA 3H9SA 3SDCD 5M94B 2ADFL 4YBQC 5C0CD 1CFBA 1CGSL 4XCYA 2IFFL 5EOCH 3VI3F 2UZYB 3RIFK 4JFFA 2DM4A 5ICYB 5ISZA 3OJDB 4M4RA 5IV2B 3V6OC 3X3FL 3QO0B 4X0KB 2HVJA 4GMTH 2H8PB 3KR3H 2PYFA 1LP9F 4OIIH 3MV7B 4Y4KD 1I9RL 1RZGA 3OR7A 4XX1G 1KPVB 4RWYL 4WI8A 5J8OA 2F58H 4OCRH 3ARGB 3H2WA 3O45B 3WXVL 2HKFH 4AEIL 4KROB 4LHUB 1GGBL 4UV7L 5HY9A 3QDJA 4G9FE 3H9SE 4HKZA 1G7LA 3ILPA 15C8H 1AKJA 4MD5A 3D9AH 2C4FU 2QV2A 4NKDB 4Y5VC 5HYSB 1T5XB 3LOWA 5I19L 3BZEB 4XP5H 3QPXH 4JFFE 5KVDH 5ISZE 5DQ9B 1UJ3B 3L5IA 3FO2B 4G7YH 3HG1D 4G8IA 1C5CH 1QTYT 5GHWH 2N7AA 1JZ4A 4JG1L 2E8YA 4LLQA 2LU7A 4KUCF 2ICWA 5DK0B 2ZUXA 4OCXL 3MROA 4NKMB 4P3CH 5CEYA 5C0JA 4AYFA 2W65B 3OAUH 1UM5H 1Q38A 2FX9H 4OZ4B 3JZ7A 3QDJE 1U3YA 1M7DB 3LEYL 5KVGL 3C60A 2O5YH 3L3OB 2EYRB 4PJGF 5EUOB 4JY6A 1XF2A 4H1LG 5C0FA 1R3JB 4K3EL 2V2WA 1U8OB 2Y72A 4HUWB 3QPQD 1KEGH 4DQOH 1E4WH 1I7ZB 1NC2D 4P48A 3FHAA 2HFEA 3BISA 4EVNB 1G7PB 1QA9A 2GHWB 4N0RA 1IZJA 5FGSA 1TZIB 3ARDC 3R0MA 5HHNA 1XGRB 5C6TL 4FQ1L 4GT7A 1MCEA 3L7FA 1B4JH 4UQ3B 4KY1H 5DDHB 2BOCB 3C9NA 2JB6A 5E8DH 5HGAB 1NCUA 3V6FA 1ZWIA 4U49A 2NTFB 4P0DA 2HH0L 5HHOD 4XP9H 4JHWH 4OM0L 4Y88A 2H1PH 4TUJA 3DXAD 3LB6C 3GI8H 2IPTH 4LLVA 2JF1A 2UWEF 4WFEE 5L0QB 5JXAL 1D6VL 1RUKH 5T1KB 3VFTA 2GUOA 3IDJB 1DSFH 5DEGA 2KZWA 3P30L 3FN0L 4WHTA 4FG6D 4U1KB 4KI5E 1EFXA 5ACZA 4Y16B 2H26A 3DX9A 4N90E 3S88H 1DQJB 1J8HB 3IDMA 2H32B 4WI4A 4H0GA 4JREC 4FMKA 3FKUS 4FQ2L 4YNYA 1W0VB 5FUZH 3C8HA 2K3TA 3IXAB 3RVVD 3P40A 4P2OD 4LGSB 2ZUSA 5DHXB 2B20A 3QO1A 1AQKH 5CFHA 2VDOL 1HH9B 4L4VB 1CFQB 4OCSH 3F65A 3MV9B 5L2KB 2C9AA 5IV2A 4C59B 3BIKA 3QO0A 1V7MH 4X0KA 3BSZL 2H8PA 3MLTB 4ONOA 1JWSA 3NCMA 4OT1L 2HRPL 1IFHL 4PJFB 1KPVA 2ZUTA 1Q72L 2DDQL 5IMOB 1KJ3H 3D1MC 3ARGA 3WFBH 2DM3A 5FV1L 5H2BA 5LAXB 1EHXA 1XCQA 1NMBH 3QXAA 2V9QA 2BRRH 4LDLB 4RMWA 4LSPH 4X6FB 4FXGB 4NKDA 1T1YB 5HYSA 3BZEA 1T5XA 2GCYB 4K23L 3HC4L 1ZGLP 4QRRA 4LVHB 1BJMA 1F3RB 4NKIH 4KC3B 4LVNC 5DQ9A 1UJ3A 3KS0H 3L5HA 4LEXL 2AV1B 5J11B 3R1GH 2YD1A 2YS4A 2R1XB 3LDBC 3QIWB 4XNMB 1S5HB 3MV7E 3OKLB 3VXUB 1RK0B 1MFDL 2QQLL 1MCFA 1DANT 4XVTH 4NKMA 5E6ZA 5FDWB 3B83A 1PKOA 3GMRA 3JTTB 2W65A 5I1IH 1B90A 4LARH 1SJXA 4OZ4A 1M7DA 1KCRL 1MI5B 1XZ0B 2Z91B 4CJ1A 3IRPX 6FABH 3NTCH 3RGVD 4JM2D 3L3OA 2VZOA 2GY5A 5EUOA 4HHAA 1R3JA 2P47B 4ODBD 1O7VA 5E08H 3P9LA 3VWJD 2A0LD 1U8OA 4HUWA 1RZKH 1S7VB 4U3CA 1I7ZA 3QXWA 3C60C 1G7HB 3H7BB 1A6VL 4WHYH 1ZEAL 4MQSB 4EVNA 5TQ2L 1G7PA 1KTDB 2COQA 3FO9B 1DQDL 4TQEH 3GUTB 1TZIA 3TN0B 5B38G 1GJIA 2RAMA 1XGRA 1ZLWK 2H2SD 1NBZB 1FCGA 2P8PB 4NT6B 5DR5L 3U83A 3W5MA 4UQ3A 3DSFL 5CEZL 1MPAL 4YX2H 3PXJA 5DDHA 2BOCA 1FVEB 3I6LE 4W81A 5HGAA 4PJ5B 1F4XL 4TSBH 5T5FL 1MJ8H 4UV4L 4Y4FB 2Z35A 5IGXL 5GS1B 5IESL 4G6MH 5EUOE 1TETH 5J89A 4O00A 4KI5C 5JUEH 1HXYB 1L7IH 2Y5TB 3QUML 4EQ3A 5DUML 4M93C 2IF7A 1CL7H 3DMMB 4PJEA 4GXVH 5T1KA 1D5BB 3IDJA 4TVPD 3NH7H 3OMZA 2M8XA 5EG6C 1IGIL 4AG4H 4KUZL 2DQDL 5F96H 5E03A 5GS2D 1A7QL 4U1KA 2W0PA 1CFNB 3WLBB 4Y16A 1J8HA 4WU7B 2H32A 4AL8H 4KRPD 4O4YL 4FFZH 1QBLH 4JPVL 5EBWB 1P84J 3LRHA 1CN4A 5EOCJ 1FNFA 1W0VA 1YC8A 3SGDI 3MXWL 4Z0XB 3IXAA 2YZ1A 3O3AB 3P9MB 4M48H 1PZ5B 1CXHA 4QRPD 2AJXL 1E4JA 2HT4C 4L4VA 2BNUB 3V4PL 5CKAA 1HQRB 2CR3A 3MV9A 5F97E 5L2KA 1XGYL 4ZYKB 4UT7H 2EE3A 3CMOL 1AR1C 4K3DL 5HVWA 2YC1B 1VSCA 1NC4B 3O2VH 1Q9KB 3MLTA 5E9DD 4JN2B 4XBGB 4WCYL 5DWUL 1T7WA 4TNWK 4PJFA 4WHDA 3WFCH 4ZO7A 5IMOA 2CGRH 1PG7W 3GIZH 4DN4H 5LAXA 4JPKL 4YH6A 4LK4A 3T0EB 4X6FA 4FXGA 4YPGB 4O5LL 4JRXB 1GHFH 4L4VE 4M6OH 3UTTD 5KSUB 2GCYA 4JDZB 3ARGC 1N5AB 1DUZB 3MV9E 2YD7A 5IBUG 5L2KE 2OBGA 3A6BL 4KROC 2AV1A 1DN2A 5L88L 2QR0B 4JRYA 2R1XA 4KTEL 3TFKD 4M1DH 3QIWA 2FSEB 2A77L 1FLRL 2J6EA 4ONHB 3OKLA 2Y25A 3B6SB 3VXUA 2YZ8A 1RK0A 1FIGL 1UH3A 3QWQB 4PJFE 3UJJH 2Q7YB 1KEMH 1IKNC 5FDWA 1UJ3C 3T2NL 3VW3H 3JTTA 5E24E 1VA9A 2QL1A 5TDOB 1KLGB 1EEYB 4NZTH 1XZ0A 2Z91A 1AGDB 4ZD3H 3FO0L 3BKCH 3UJIH 1MWAH 1TTGA 2NR6C 1Q9LB 4NNYB 2W59A 3C6LB 1U8MB 4LSSH 2AP2A 3X13B 1S7VA 3EO0B 1MHCA 1G7HA 3H7BA 3P0VL 3LEXB 3VXUE 1J0KA 4I77H 1KTDA 1MCHA 3GUTA 1W72H 2P8PA 1NBZA 3O6ML 1NMCC 3QUZB 4NT6A 4OD2B 4NO0B 1X4YA 4UIMB 5E8PB 4JRWA 3EO9L 1I9EA 4GW1B 1C1EL 5C0RL 3WFZA 1FVEA 1MI5E 1T2QH 4KK6D 2YA0A 1ZK9A 4JPIB 4OIBA 4Y4FA 4ZNEA 1SBSL 5H37H 5GS1A 4YAQB 1QNZL 4J3SA 4LIQL 2BNQD 2W9EH 5I76B 1MELA 4LASH 4HC1H 4LSTL 1KCUH 1HXYA 2JELH 5CP7B 4F7EA 2Y5TA 2ZNWA 2ZUUA 3E8UH 3SCMB 1U95A 1AXTL 3HAEB 4N0CC 1VERA 5HHQA 1XIWD 2APVA 4Z7NE 4J4PC 4H88L 4TTDC 5JOEA 2VLLB 1VEOA 2Z8RA 2F8VA 1CFNA 3WLBA 5L0QC 5LGHL 4PJ5E 1OAQH 4WU7A 4YXKL 5EA0L 1CDHA 5EBWA 5T5NG 1UA6L 2Q76B 1NL0L 4LCWB 3T4YB 5GS0H 1X7QB 4R9HA 3N0PB 2PR4H 1CICD 3O3AA 3P9MA 3MZGB 4Y16C 2L0DA 3HS0B 5LGJA 3BZDA 2BNUA 1AE6L 1ZANL 3TZVD 3UTPD 1D3CA 5DHYB 4ENEC 5GJTL 4JVUA 3RVTC 4EN3B 2ZKHH 2YC1A 3V0WL 1KULA 2JK5B 4JN2A 4XBGA 4H26A 5TDNB 4NFBA 3ARZA 2OTPA 4P4KB 1JGEB 1PY9A 3C87A 3ZL4H 1CFVL 2XQBH 4LNVA 5IW3A 3BZFB 3T0EA 3S5LG 5K59E 4HG4J 1J0HA 4KI5F 5KSUA 4JDZA 5JZ7D 1N5AA 2BVQB 5FEBA 5B8CB 5BMFH 4XPAL 1HKFA 1HDMB 1HILB 1KFAH 1DFBL 2QR0A 4N0YL 3VRJB 3WHXB 4PD4J 3G6AB 3UTSD 1TVBB 2FSEA 3U48A 2YD9A 1RQ5A 5TF1H 4ONHA 1CDYA 3TO2B 3VRLE 3OG4B 1HSBB 4RMVA 4KTYA 4I9WE 3MZTA 4MJ5A 2Q7YA 4JVWA 1FJ1B 2BSSA 3BJ91 3QQNA 5JDJA 4LHJB 5J11C 4KDTA 5C2BL 2BK8A 3FFCA 3QIWC 2GI7A 1OW0A 1EEYA 4HJ0D 1JGVH 3T0EE 2OTUB 4ODXA 4NM8L 1AGDA 5B4MC 4JRXE 3HMWL 2IQAA 3IDNA 4NYLA 2QEJA 2IAND 4M7LT 5J1TC 2DWDB 1Q9LA 4NNYA 3C6LA 5I73B 3O3BB 5IIEB 3PQYB 5IFJB 4NZRH 3X13A 3EO0A 2WINB 4L9LB 3R06B 2F15A 3LKOB 1Q1JL 4KUCD 1JIBA 2Q8AL 3UO1L 5ALCL 4OD2A 3QUZA 4Z5RB 4KHTL 1AIFB 3MQIA 4RBPH 4UIMA 5E8PA 4OF5A 3UJTL 5EO1B 3G5XB 4GW1A 4R4BB 3VGDA 1I85A 1LO0H 3QIUB 2WBKA 3JV0A 3SQOH 4EI5A 3TN0C 3ARED 4BFEA 4YAQA 1KB5B 1IGYB 5I76A 3W0WD 4LSQL 5TE7H 5FYJE 2GJJA 2P5ED 5CP7A 4HT1H 1MFBL 3RIAK 1ACYL 2LQRA 1FE8H 4G9DB 4Y4FC 3DVIA 4X7TB 4HIIB 1P2CB 3O41B 4RAHA 3SCMA 3A6OA 2WLYA 4HUKB 3UP1A 1KPUA 4CU6A 4FQIH 3NGBB 2VLLA 4RWHA 2BRQA 1BQSA 3ET9F 5A2KH 3O9WB 3DMMC 3S34H 2APWA 5CIPB 3QQ3A 4ODSL 1J10A 1J1PL 5GRVL 4OCLC 1HZHL 5BZDB 4OTXH 3ULVH 3T4YA 3VH8G 1X7QA 5E8EB 4TSCL 4HUNB 2VOTA 1A3LH 3HS0A 2YPVH 4LFHD 5BV7H 3KPPB 3S8WA 2PTUA 3O4OB 4UBDC 1F4YL 2KPNA 1P69B 1BREA 1YN7A 3TBWB 1D5IL 5DHYA 1CGVA 2AQ3A 5CILH 3FCTA 3DUUA 1URLA 3HE7D 5EUOF 1VB9A 1P4IH 5F9DC 5E2UL 3OKEB 4X8XA 2ITCB 2JK5A 1RZ8B 1PLGL 5TDNA 4K55A 3BX7C 5I1KL 4LCWE 4P4KA 2MWCA 1JGEA 3ARWA 5SX4I 3QDGB 4S11A 3STBA 3V95A 5JIKA 4MAYD 4AJ0A 1A6UL 3BZFA 2JJWA 4MB3A 2VDKL 4KGLA 1MJ7L 4M7KH 1P6AB 1UJTA 3C6SB 4ZUVA 4LP4A 1LMKA 4BJLA 2ZCKH 4Z0BL 4KKBD 1HDMA 5D6CB 3IJHB 3VRJA 4XH2B 3P73A 2B5IB 3G6AA 4OB5L 3T0EC 1TVBA 1I1AA 3MLUL 2VXUL 3QRGH 3TO2A 1HSBA 1HSAB 3U7WL 4BSWB 1X5GA 3UCRA 1FJ1A 4XVJH 5IW1B 4HWZB 5BS0D 2CIIB 3THMH 5A2LH 1R0AL 2AK4D 3LEVL 1T6VN 5LWYH 2NY6C 3PHQB 2Y23A 4UDTB 2DWDA 5I1CL 3DGCR 3V6ZA 3O3BA 1HI6B 3DVGA 3PQYA 5IIEA 3NZ8B 4JFZL 5IFJA 3T65B 4GG6B 4JY4B 4ZTPH 2WINA 3BEVB 4L9LA 3R06A 1ORQB 3LKOA 4HUXA 4JE4B 3LN9A 2XWJB 2VDML 3C6LC 3U7YH 3RZCA 2OK0L 5DJDA 2V7HB 3V5HB 4Z5RA 2NX5D 4PB9H 2KH2B 1AIFA 2Z4QB 3U0WH 5EO1A 5T3ZL 3G5XA 4QTIH 3MOQA 2H32H 4R4BA 1OQXA 4V1DD 2PTVA 3QIUA 2DLGA 2WUCL 4DFHA 2QQNH 4DGIH 5D4QA 5GGRB 1ZHLB 4IHOA 3QUZC 1FFRA 1KB5A 4HXBH 4PJFF 1IGYA 3MRIB 1ODAA 3PQYE 3VD7A 5I2IB 4J12A 5E7FA 4D9RD 3REVA 4ZMAT 1I85C 4G9DA 4HKBB 1KCVL 4QRQB 4X7TA 1P2CA 1IILE 4MHHI 1JGLH 2FX7L 5EOTB 1YNLL 3EYFB 2OR8A 2EXYD 4LGPB 3OKMB 4TULH 5IFHL 5GIRB 3O9WA 4K3JL 1GPOH 3TIEB 3SCMC 4HD9A 5CIPA 4FQHB 2AXFB 5MP6L 5BZDA 2CRIA 3K3QA 4WI7A 5E8EA 1TJGL 2YMXH 1MFAH 3T04D 3EYSH 4G43B 3KPPA 2AJVL 1K6QH 5JIPA 4R2GB 3GSNA 1BGXL 1FNSL 2DQUH 2ICWJ 3U1SH 4CKVX 4OCYH 3TBWA 5FA3A 3VXOB 2EH7L 3GJEB 3SQBA 1GGCH 1CCZA 1HN1A 2FLRT 2J6EH 4K7PY 2DQGL 2DF3A 2A1WL 3OKEA 4YPJA 3B5GA 2ITCA 1SQ2N 2Y6SC 3RVWC 4F57L 1N2RB 4I3SH 1RZ8A 2MHAB 1RULL 1RSFA 3CFCL 5C09D 1RZJC 1MAKA 4EN3C 4YXLH 3QDGA 2P44B 2XYCA 4Z7NF 3I3EA 4TRPL 2MQCA 2DQJH 3C6SA 5J12C 4P4KC 4BQ9A 1NAML 5D6CA 3IJHA 4XH2A 3NIDF 2G60L 3AUVA 4ZG1A 5D5MB 3ARDD 5EIVA 3OHXB 3PP4H 4DTGL 2B1HL 4K9EC 4P3WA 3QULB 4BSWA 3MNVB 1MREH 3B9KB 4HWZA 5IW1A 4ODUB 1ZTXL 5B8CC 1I9IH 1NBVH 2VZ3A 2DBLH 1B88A 5KOMC 2CUIA 1U0QA 2KQMA 4JKPL 3QDGE 4F3FB 2LVCA 4UNUA 1UG9A 2DMKA 1NCNA 5EUKB 2WBJB 3A6CH 2ZCLL 2C3HA 4PJXA 3LB6D 1VESA 3PHQA 4UDTA 1T66C 5CJQL 3CGTA 3P0YH 4GAGH 4E41B 1G9EA 4JKMA 4GG6A 4JY4A 3BEVA 2Q8BL 4QKXB 2XA8L 3TNMB 1BJ1J 3DO3A 1RMFH 2XWJA 3EKCA 1GVIA 1FH5H 1XCTA 2ZCHL 4JG0L 5DD5L 5I73C 5E2WH 5K59F 2V7HA 3V5HA 1YNTB 1EV2E 1MCWM 1QVOB 2MPAL 4LHQB 5T1LB 2Z4QA 4JO1H 4L9LC 6CGTA 3BAEL 5HYIA 2YKLL 4U1MB 1P1ZB 2NNAB 1NGQH 5D1QB 4LSUL 1HXMB 3SGEI 4F8QA 3VRLF 4M7JL 4RBPK 2W9DL 3MRIA 5I2IA 1TXKA 4XX1E 3VD5A 1H3TA 4GG6E 3QIUC 2BXYA 2EDTA 4G9FD 3HMXA 3H9SD 4HKBA 4QRQA 3LQZA 3HI5H 4QHKJ 1LEIB 4I3RH 2PTTB 1T89C 32C2B 5EOTA 4ZOCA 5TFSH 4JFFD 3EYFA 3MBEB 5ISZD 5EO9B 5GISL 1NSNL 1N0LA 2NY5L 3OKMA 5GIRA 1IAKB 3FJTA 1NCCL 4FQHA 2AXFA 4OFDA 3QNYB 5JHDA 1MF2H 1JN6A 3BN9D 4G43A 5EN2A 3O9WC 5KSBA 3U4EB 2X9WA 3QDJD 3SDXF 3ARRA 1EMTH 2A83A 4YLQT 4GQPH 3DO7B 2R4RL 1FZOB 3C09B 1AKJD 2NMSA 3VXOA 3BWUC 4XC1L 1IL1B 3FAXA 2A2QT 1YEIL 2W38A 4OSUH 1N2RA 2W0KA 2MHAA 1RI8A 3MXVH 4HMEA 1MHHA 4PJBB 4ZFZB 1UM6L 1UXSB 4M6NL 4JR9H 1AHWB 3SE8L 4QRTB 4JKLA 4NQVA 3VXMB 3WIHL 4XP4L 4FP8H 4PJ7B 4JAMB 5F9WB 5I1HH 3FQNB 5DC4B 3C60D 5FYJH 4XXDA 5IOPB 1OAUH 3CVHH 3MGAA 1KYOJ 1U41A 5D5MA 2XTJB 4EJ1C 3OHXA 3GO1L 1KC5L 4WWID 4XMLH 1A6PA 3QULA 4IRZL 4G8GB 1X5AA 4XPTL 2HJFB 3OXRB 4WFED 3B9KA 3MNVA 3QFJB 4ODUA 4YK4B 1QFOA 1KJVB 1QD0A 3KVQA 2B5IC 4JDTH 3MO1B 4NSKA 4F3FA 4J2XA 1DBBL 3QHFL 2FD6L 3V4UH 4WRLA 5EUKA 2WBJA 4OF8A 4JHAL 4KI5D 4BK4A 1B0RB 4GLRI 5I1JL 5I0DA 1FDLL 1P5UA 4X5LA 5FM5O 2OR9L 3HC3H 3GJFH 2JE8A 5L9DH 1OSZB 3N9GH 5D5ME 5C0EB 5ENWB 5I1EH 1DLFL 4OV6F 3HAEH 4X99B 3TNMA 3EOBB 4Z77A 1D5XB 2FEDC 1F42A 1YNTA 4F37K 3RAJH 1QVOA 1KCSL 1RPQA 5T1LA 4HQQH 2FATL 3S4SG 3F7VB 2AEQH 2GQHA 5IBUB 2BHYA 3QEQB 1TIUA 4U1MA 1P1ZA 1EFXD 1QFWM 5D1QA 4JHZA 1HXMA 2X4NB 5DT1L 5FV2A 1BD2A 1VGEH 3MUZ1 2HT4D 4ZS6D 4E41E 1OAXL 2YRPA 3GMPB 4NHCL 3CXHK 1VEMA 4X7SL 1AR1D 1X6LA 1A3RL 3ZYOA 5L2JB 1RZ7L 4Q58C 5GRUL 1QLRB 4OLVL 2BSTA 4YHPB 5C0GB 2PTTA 4M3JA 1U8NB 32C2A 5ADOL 3PDGA 3MBEA 4UI2A 3OZ9L 12E8H 4XNUH 5EO9A 3GSXB 1IAKA 1RFDH 3CD4A 1KIQB 5GQBA 2X09A 1OM3H 4WY7H 3MV7D 4KQ4L 3QNYA 2VR4A 4A6YB 1H3UA 1R3LB 4AIOA 1NFIB 3ARGD 4K9EH 1KELL 4MLSA 1I9JL 3MSPA 3AY4A 4LHUD 3U4EA 4P9HH 3DO7A 1IGCL 1AD9A 1FZOA 3GMMA 4N0FB 1IL1A 2FGZA 4XPFL 3JV4B 4HUUB 3NACL 3VXSB 2R56L 3KLHD 2MCG1 1YEFL 4R2GC 1A6WH 1INDL 2H41A 3UPRB 2NZIA 2AK1L 1UXSA 4Q97A 1UCBH 2AKRB 3Q2CA 2OR7A 3N1MC 1AHWA 3K2UH 4N8PA 2NLJB 2YD2A 4QRTA 2I5YL 2NR6D 1ZSDB 3SDDC 3QDAA 3VXMA 4PJ7A 4JAMA 3I6LD 2DIBA 2ZUYA 3T0DA 2FIRT 3VGAB 1DANU 3KPOB 4MAUH 4ZFFA 2ARWA 1MCQA 4LRNH 5E6IB 2FYYB 4LCIL 3IFOB 5JPNB 3NAAH 3OXRA 4PJBE 1KBGH 4NZUH 2CPCA 3QFJA 5CUSH 4KGJA 1KJVA 3HZKA 3MUJA 3S9DB 4QCIB 3ME0A 4YHMH 5F7YC 3B4NA 4DGYH 3VXME 1SJHB 1Y6KR 4HBCH 4LSVL 4U1NB 2R0LH 4OD3H 4PJ7E 3T2PA 1B0RA 1KB5H 2I9LB 3UC0L 1VEPA 4IS6B 1U93B 4YHLL 5DMYA 3HNSL 4N0CD 1OSZA 4H8WL 2X4UB 2XTJE 5KTEH 2R0WL 5ENWA 4J4PD 2WBJC 3U4BH 4TTDD 4ZDHB 4HWNA 3EOBA 4G8GE 4KHXH 2PNDA 5TE4L 1S9VA 1JI2A 3IJYB 3QFJE 4J3XA 1D5XA 4XC3L 3WFDL 5DI8A 5T1KD 3S5LB 1FRGL 1FZKB 5F1OB 1EGJL 1ZAGA 1IT9L 2BVYA 4D9QE 1I3GH 1QQDA 4WTWA 1EEUA 4Y16D 5DFVC 2X4NA 3A67L 1J8HD 4KPHL 1M71B 1FNGB 4BQBA 1A6ZB 3D39B 1F3JB 1SEQL 2JB5H 3GMPA 5C0DB 2J3SA 5CMAB 1RUAL 4ENED 1XAUA 3RVTD 5KAQF 1TTUA 5J56B 5D1QC 2IPUK 3HZMA 2D0HA 5L2JA 3T0WA 2RQ8A 3JV5A 4L4VD 1QLRA 5C0GA 4YHPA 3WNNA 1XF4B 1U8NA 3K8KA 3PWUA 2XZCH 2GEEA 3BUYA 3CC5B 1RAMA 1RIUH 3MV9D 4NFCA 5EH1A 5L2KD 3GSXA 3P11H 3QJFB 3QEQE 3LPWA 3MR9A 2LAAA 3SEPA 3ARQA 3BYYA 4NOFA 5F9OL 4V2BA 2F53B 3BPCB 3WDIA 4PV8B 3MBEC 1MFNA 4P5MB 3HNTL 4YHOL 4A6YA 3GMOA 2D7PA 1R3LA 4IOIB 1C5DB 4HIHB 3QUMB 4KVCL 2APFA 3CK0L 1JRHL 4N0FA 2QADB 3FB7B 3QNZB 1J9CT 5I8OH 3MRCB 5A2JH 1KN2H 1NCWH 2HP4A 2R15A 3VXSA 4RFOL 3GEWB 3V7MA 3B43A 3DHMA 4JRYD 4U1GB 5HYQA 3UPRA 4Z8FH 3HI6H 3C09C 3QIWD 4Y19B 1ZVHA 4JANB 3ZKXB 3CZFB 3VXUD 5B4MD 4LAQH 5KVFH 1IC7H 5HYJA 2AKRA 4OLXL 3JV6B 2NLJA 5LXGL 1ZSDA 1CK0H 1H3PH 5I8EB 5IW6B 4ALAH 4JB9L 2B4CC 4OLWH 4MB4A 4JY5H 1HYSC 1IGMH 1MCRA 4AEFA 5EC1A 3C2AL 2D7TH 1AHWC 2MQ3A 3GKZA 2VDLL 2CH8A 3JWDC 4WVRA 3VXSE 3KPOA 1VFMA 1U8KB 5EZIH 2XWBA 5E6IA 1TQBB 2OP4L 3TESA 3VH8B 4GSDL 3IFOA 5JPNA 1MRFL 2CKBL 4XRCB 3IKKA 4PRIB 2JTDA 1J0JA 5FK9B 3MCLL 4P57A 4QCIA 4D0CA 3TN0D 2XTJC 3GK8L 5LCVL 3EZ8A 1SJHA 4U1NA 5DC0A 2VXVH 2GJZA 3Q48A 4RFNB 4PJIB 4YK4C 4Z78B 2I9LA 3L1OL 4PJCA 3VGBA 4IS6A 1U93A 2G5BB 2BNRA 4MXWH 4Y4FD 1QG3A 1CVRA 2X4UA 4FMFA 3MA9L 3TPKA 3EOTH 1QFUL 3IAQA 4C54A 4ZDHA 1MFEH 5JDSA 5GSVB 3IJYA 5LG1A 1RY7B 3GJFK 1X6NA 3ZYZA 3MRMB 3DMMD 1YJDL 1PYWB 3S5LA 3BGAA 1RUPL 5HDQH 4Q0XH 2R2EB 4U33A 1FZKA 5CINL 4LLUB 4WO4A 4Q9QL 4IMLB 4WV1B 3EHBD 2NTSP 1A6AB 4Q6YA 1S7QB 1I1RA 2DQHH 1GXEA 4OLYL 5BVJA 5DF0A 3H3PH 1DBML 2IALB 1T04B 1CDCA 1FNGA 1M71A 2VXQH 1A6ZA 3QWOB 4UBDD 5TQ0H 3D39A 1F3JA 3ESUF 5C0DA 5CMAA 1WQVT 1BOGB 4HLJA 1LD9B 1KJMB 5AAMA 1FBIL 1XF4A 2P24B 3GM0A 3CC5A 2BVOB 2R0KL 5DUPH 2DLFL 5I18H 3CDFA 3QJFA 2EECA 3DX7B 5EIQA 1NC4D 5HVHB 1UGNA 5D5MF 1WZ1L 1RU9L 5FGCB 1FYHB 5GGQL 1TJIH 5HI4C 5MEQB 3BPCA 1IC5H 2NZ9C 1N64H 4CGTA 4M1CD 4GS7C 4P5MA 3D39E 4HX1A 1BEYL 4OLUH 4UNTA 2ZP0T 4RSVA 4IOIA 5DJXB 4HIHA 3BE1H 3QUMA 4B41A 4XCFH 5M95B 2W60B 4Y89A 2FEEI 4PBWD 3T0ED 3T2OA 4YDIH 4JRXD 2L7JA 3C08H 3M8OH 3FB7A 3QNZA 1DBAH 1DQTA 3MRCA 3ZLQC 3QZWB 2X42A 5CEZE 4CNIA 4JN1H 4DKDC 4JO4L 3RWHA 5HDLA 4I2XB 4MXQC 4Y19A 1A47A 4ZUTA 3O6KL 4JANA 1IQWH 2F53E 3CZFA 1L4IA 5BCAA 3JV6A 2CRMA 4L4JA 1YC7A 3AMLA 1Z9LA 5I8EA 2OYPA 3CMGA 3TLRA 3OAYH 3NCYP 5FCUL 3CLFH 3AMKA 4UMGA 1Q94A 2J88L 4F33B 2DTML 4KXZH 2NQCA 4XAWH 4DUWA 3C6LD 2PXYB 4QXWA 3V9FA 1U8KA 4DKFH 5FYJD 2FNBA 2A73B 3VH8A 4Y19E 4CRPA 3STZB 3OGOE 1DQQB 1IEBB 2V5YA 3RP1A 1WIPA 4PRIA 2OL3L 3VGAC 5FK9A 3U9PH 4U2ZA 3VJ6B 4CVUA 5IMLB 4K2UH 3QUZD 3VE0A 5E6IC 4NO0D 4JO3H 2E9IA 3N1PC 5E70A 4PJIA 1A7BA 2ATKB 3FQUB 4Z78A 3DVFA 4NCDA 4EI5D 1BZ7A 1KG0B 2XN9B 2KDGA 2YA2A 3MRNB 5GSVA 5ACLA 3F7QA 1CF8L 1E4XH 5JOFB 4WUKL 4K8RC 3L5XH 4PRIE 1JF1B 3SCMD 1N7ML 4BFIB 1CIUA 2R2EA 2HKHL 3LH2L 2EDOA 4LLUA 1C7TA 2Q1EA 1JZ8A 1KCLA 4IMLA 4WV1A 3I84A 4X80L 5IB5B 4LVOB 1S7QA 3C8KB 5ITBH 3O3DA 1NMAL 2EIBA 1U91B 4N1CA 3QCTL 3VMPA 5D2LB 1MJUL 2B1AH 4KZDH 1T04A 4JFDB 4PJBF 1QHOA 1EPFA 3OKYA 5DVNA 2H2PD 4JFEB 3ULSB 4D3CH 4LCWD 3O6LL 2FJGB 5FYKE 4S1QL 1F58H 3DARA 4LPTA 1BOGA 3PWJB 1KJMA 3NCBB 2Y6SD 5FYLL 4PJ7F 3RVWD 3WFEH 5F93C 1CLOH 1Z0NA 3TA3B 1XT5A 3TV3L 2BVOA 4OLEA 1U3HB 1FNLA 1SVCP 2IGFL 2B4CH 3DX7A 3GHBL 2IAMB 4P2RB 3KPTA 5MEQA 1A5FL 1CT8B 5DRNB 3JWDH 1A1OB 1HHGB 4P4KD 4U4BA 5HVGB 2FB4L 2QQQA 5DJXA 1CGSH 2IFFH 5DD1H 2W60A 2Y4SA 5EB9A 1SY6L 1OHQA 5AUMB 3FZUC 3R8QA 3BT2H 1OQOA 4WUUB 1A7OH 2E7HA 1AD0B 2E9JA 1UKTA 5ERWB 5FM8A 2CRZA 2GYSA 4I2XA 3Q1SH 2BFVL 5FGCE 1I1AD 4Z6AT 1PFCA 2QADC 4ZPVB 4O58L 1Q0XL 4AEIH 1G9MC 1GGBH 4UV7H 4LIQE 5KS9B 4YHZH 1VDGA 1CZ8L 5HPOA 1T66D 4DAGH 3WCYA 4U1GC 4JO2H 1QR1B 1RIHH 2FR4A 3ZKXC 2FX8H 1OAKH 3QJHB 4C56B 1CL7I 25C8H 4PJAB 1UH2A 4OF6A 4RA3A 5CJOH 3D2UB 4DEPB 4PB0L 3VFOB 3PQYD 4XNXL 4KRMB 2A73A 1RZFL 3GKWL 4ZFGL 4I2XE 4MZ2A 4OCXH 1IEBA 5E6YA 3TPUB 1E6JH 2O61B 3O4LA 4LQFH 4R4FL 4EDWH 4FNLL 3ARBB 1FGVL 3BKYH 1KT2B 1VACB 4LBEA 3RZCD 3VJ6A 3UBXI 5IMLA 2FO1A 3S35X 2VRAA 4PY8I 1TQBC 4RDQG 2WV3A 2EO9A 2ATKA 3FQUA 3NCCB 1M05B 3BP6B 3QIUD 2W0LA 1YMHA 5C07A 1KG0A 4MYWB 2XN9A 3WIIL 2YXMA 4RFNC 3IU4L 2VC2H 3MRNA 3RNQB 3H9ZA 5EDXA 1JMZA 4X7CC 1JF1A 4XHJC 4BFIA 4ZUWB 4Y4KB 2X6MA 3KYNB 4ELKB 3BQUB 1BLNA 2ENSA 4D0BB 5IB5A 1E0OB 4M43H 1GAFL 3C8KA 4HWEL 3O9WD 1U91A 1WVZA 4NO2B 4A6YH 2DOCA 4JFDA 4JFEA 3ULSA 3ZYJA 3MFFB 2XN9E 1AH1A 1CGYA 2FJGA 4RISL 4WV1C 4F58L 1D6VH 4BFBD 5DHVB 3PWJA 4NBYB 4Q9RH 2ARJB 3VDAA 3FN0H 3TA3A 2ZPKL 1R24B 4JQIL 2VXTL 3D0LB 4TPRH 1YQVH 1CFSB 4H5SB 2H9GA 5KJRH 1U3HA 4WENB 2WIMA 2IAMA 4P2RA 1YEGL 1OP5H 3EDFA 2XZQH 2BJML 5D2LE 5DRNA 1K4DB 1A1OA 4JFDE 1HHGA 3H42L 4JFEE 2FRGP 2X1XR 3QCVH 1F6FB 1MHPL 2WM0A 3QDGD 5HHVH 5HVHC 4OZGB 5CD5C 4LU5L 1WF5A 3WNKA 4NQCA 5AUMA 1N0XL 1EAJA 2EE6A 2ZJSH 4YE4L 4WUUA 5JHLH 1WITA 2HWZL 2B2XL 3IDXL 4P2RE 4UT6H 4NNPH 4UOW0 4E9LA 1UACL 1SEBB 5KS9A 1OGTB 4CMHB 3ZKQD 3QEUB 5HSFA 2DQTL 1GGYA 1N6VA 5CJBA 3RA7H 3UDWA 1QR1A 4K23H 4N9OB 4K8RH 3QJHA 3DXAB 2ZSWB 4LEXH 4PJAA 1R3HB 5FHBL 1FYTA 1QEWB 4WUUE 2YK1L 4NM4H 1JF6A 3NZHH 3D2UA 2QQKH 1NLBL 5FF6B 3OAYK 1NGPL 4QRUA 3MREB 1OSPH 3NPZB 1RVFL 5ACMA 2F5AL 3TPUA 5GGVL 2ZUQB 1MCNA 3ARBA 4FQXB 4WI2A 2UZIL 1KT2A 5KS9E 2PXYC 3SE9H 3DLQR 4CVZB 1JV5B 3LRGA 2JCCB 4XWGL 43CAB 3NCJH 5JMOC 3I3BA 4C56E 2OX5A 1M05A 4P2OB 3BP6A 3W82A 2EKSA 4PJAE 2X4RB 4OZIB 1KENH 5D7SL 5KW9H 3S36H 3ZSSA 3N85L 2Z31B 3DETC 4DOHB 2WWKT 1FSKB 1PJ9A 1ZEAH 3RNQA 3GSUB 4GOSA 4EXPX 2ILLA 4XBEL 1AGBB 5LBSL 4EI6B 3I50H 5GRYA 5CEZH 3HUJB 4P9MH 5IVZB 2BVUA 3JUZA 3BQUA 2X70B 3K0WA 4D0BA 3HZYB 3KJ6H 5IGXH 4U1JB 2AW2A 2OM5A 3T0BA 4Z76B 2HFGL 5ID0B 1AY1H 4NO2A 2X40A 1T20A 3HR6A 3O2DH 3LQAL 1YECL 1RZIB 5DEFA 3MFFA 4LMQE 3VG9B 4LVOC 4YXHL 1CBVH 3DPBA 2ARJA 3MGOB 5DVKA 5C9JB 1GGTA 1T7XA 3FT3B 1G9MH 3K2MC 4R2GD 1PSKL 4KUZH 5IHLB 1ES0B 1R24A 3D0LA 1CFSA 5IB1A 4H5SA 3MLSH 3V52L 4L8DB 3S35L 2MJWA 1BZQK 1LO2H 3AS3A 1WEJH 5C6WH 3OL2A 1AR2A 4M9OA 3MJ7B 3TA3C 1OTUC 1EO5A 3CVIL 1U3HC 5BVPL 3SKOB 1K85A 2OI9B 1GYAA 1I75A 4OZGA 3MRLA 1T83C 4ONFL 1KIUA 2IAMC 1TJHH 3VWJB 3S4SA 1CLCA 4BK5A 5JQ6H 3SJVB 5CBEA 1I7RB 2Q86A 1QSEB 2OJZL 1MY5A 1IGFH 2EEDA 3IDYB 3MCKB 5T3ZE 4UT9H 1D9KA 3OGCB 1XGTB 3PGFL 3W11C 3RX7A 1S3KL 4WI9A 4G6FB 3GI9L 4TVSa 4ZPTB 1C8PA 1EHAA 1FORL 3B9KD 1SEBA 1OGTA 5C0AB 1V7NH 3QEUA 5FAAA 5C8JB 2PYEB 2GJ6A 1B6DA 4O5LH 3GSWB 3O0RH 3MX0A 4OZGE 4ZTOH 3PGCB 5L7XH 1A1MB 4IRSB 3VFGL 1NPUA 5C3TA 4HIEB 35C8H 2WBJD 5E4EB 5E5MA 1YYLL 3GMQB 5SWQB 1R3HA 1QEWA 3PDDA 5FYKH 2A77H 5FF6A 1D6EA 1UT9A 4E41D 4PLOB 4OM1L 4OQTL 1CDIA 1YY8B 4MHHG 4YDVB 4PG9B 5JLZA 5TJWK 4HXAH 5D96B 1BAFL 4ODTL 3QXTA 4DEPC 4FQXA 5BO1H 5DFVD 2P5WB 4CVZA 1J1OL 1JV5A 1Q9OB 2JCCA 5T1LD 3IDGB 1CR9H 43CAA 4I0KA 3NABH 3V4VL 5FHAH 4Y5XB 1CXIA 8FABB 3DXAE 4XCEB 2AXGA 3ARBC 4NHUB 2X4RA 5D1QD 1EJOL 1NAMA 1BD2D 2Z31A 1CE1L 1C16B 1IGJB 4TOYL 2IBBA 3GSUA 2DB8A 1IBGH 3O6MH 1FFQA 2NPLX 1U8PB 1AGBA 4EI6A 1F4HA 2R0ZL 4H25A 1A1NB 4KMTL 4P5TA 1FFPB 1JZ7A 3IKCB 5LQBH 5T1DL 3ABZA 4GRWB 4NQUA 3MBED 3LMJH 2JCCE 3P4NB 3REWB 4M61B 1BQHG 3KJ4B 3JUYA 4P2CG 5D72H 1SBSH 2HVKB 4IDLA 4U1JA 4Z76A 4PV9B 5ID0A 4KV5E 5DLML 5ADPL 5I17B 1EZVX 2YN5A 4LSTH 4OZIE 4Y4KC 1RZIA 3BQUC 4DOHE 3TM6A 4ZOAA 3GBML 1PG7H 4FABL 3G6JB 4EOWL 1AXTH 3BWAB 3MGOA 5C9JA 3NBNA 3FT3A 4KKNA 3JTSB 4N1EA 1JJUA 3HUJE 3TJEH 1ES0A 4DZBB 1EHLH 1KXVC 5AZ2L 1VKXB 5D70L 4L8DA 1SYSB 2VH5H 1A6TB 1RJLB 1D7FA 3MA7B 3LHPH 3ZDXE 3O2WH 1NL0H 1C12B 2QJDA 3HRPA 3GBNL 5J6GB 4OUUA 1JVKA 2V2XB 3MJ7A 5FOBB 3S97C 3QFDA 1CG9B 1HYSD 3SKOA 3NFSH 1KTLB 3HE6B 1QOKA 4HH8A 4GXUM 4I5BB 1AE6H 3MBXL 1OP5K 4HIJB 3VXMD 2P46B 3MV8B 3S3PA 4QHNB 3LPFA 1IJ9A 5HBBA 4M5YH 2OQJB 5C0IB 2GK0B 1I7RA 3L5WB 3BFOA 1QSEA 4BH7B 1GZQA 4EBQH 3U36B 2WQRA 3D18B 3MCKA 4OLZL 4XPGH 4ZS7H 5FGRA 1CD1B 5IEKB 2XTJD 3D85B 3OGCA 1XGTA 3ZKND 4CN1A 4MQ7B 5HHPB 1CLZH 3QCUL 3WUZA 1CS6A 3V0VB 4V2CB 1RHHA 4OBSA 5JO5A 4KVNL 3QFJD 1CFVH 5DD3L 3HRZB 4WU5B 5C8JA 5B22A 2PYEA 3C5JB 3K74B 3O3UN 3T77B 3ZTJH 5IHZB 3PGCA 1A1MA 4IRSA 1AGEB 4D9QD 3J8F7 3SJVE 4JKKA 1U92B 4S1RH 3SE4A 5SWQA 1R5VB 5JIHA 1DFBH 5JW3L 2XG5A 1INQB 4AEEA 4CMHC 3H0TB 3ZKSD 1JK8A 3H3KA 1DLHB 5D2LF 3GMNB 4GJTB 4X4MA 3TH2T 1RJYB 4M62L 1YY8A 4YDVA 1HKLL 4N5UA 4PG9A 3VI4E 4B53A 3BHBB 1QLEH 5JOPE 3HPJB 5DK2B 5C0AE 2P5WA 3CXHJ 1Y18B 2CJUL 2PYEE 1HINL 1Q9OA 2RBLA 3SKNA 4LL9A 3IDGA 3WIHA 4R3SB 1S7SB 4Y5XA 4YHNA 3QEQD 1NCBH 8FABA 4P99A 2ZUQC 4KMLB 4NP4H 4XCEA 4YZFE 4R90L 4QTHB 4FQXC 3QNXA 1GGIL 2R1YB 2AJSH 2OLDA 2UYLB 4NRYB 4NWUH 4WEBH 1IGJA 4TVPE 4A2MA 1Q1JH 4PGZA 4JPWL 2W1NA 3M1BB 3GZKA 3RUGF 2EZ0C 3RVVC 4P2OC 3UO1H 4XBPB 4CVWA 1U8PA 1TNNA 2Z31C 3UJTH 1QKZL 2Z8SA 1R3KB 3IKCA 2P5WE 5HI4D 4BQ8A 4LF3B 5I71B 2NZ9D 1AO7A 3P4NA 4Q6IB 2P49B 2AEPL 5TDPB 3REWA 4M61A 4NGHH 5IQ7L 4OCNC 5DJYA 2HVKA 3I02B 4PV9A 3BPOB 3H8NA 4ZSOA 2CLRB 5HVFB 4J3VA 3KLSA 4Y8DC 1MFBH 2DLIA 3HN3A 5HHMB 5KS9F 4Y2OA 3PHSA 3G6JA 4Y1AB 4YDKH 1T21B 3BWAA 4RAUA 3JTSA 1E28B 2R8SL 4MXQD 1J5OH 1SMOA 4DZBA 3VG9C 3CFBB 5JA9A 5F44A 2DBJA 4PJAF 4GRWE 1VKXA 3DNKA 3D25B 1SYSA 1A6TA 4HF5L 3VXSD 1RJLA 4HAFA 1J1PH 4CJ0A 2VYRE 3MA7A 4O9HH 5KN5B 1C12A 2I60H 5J6GA 4HBQA 4EUPG 2V2XA 5FOBA 4LP5A 4I13B 1CG9A 1UWXH 1OP9A 5HYJD 1JNNL 1QHPA 3HE6A 3BOVA 4I5BA 2Q20A 3Q5TA 1AGFB 3G6JE 3X11B 3I6GB 4QHMB 1D5IH 4QHNA 4B50A 3TH4T 4QGTA 5BJTB 2OQJA 2VLJB 5C0IA 2GK0A 3MRJB 1QRNB 4NUJB 2D9QB 4BH7A 4JM2C 3U36A 2OI9C 3D18A 4ONGL 1CD1A 1TDQA 3D85A 3VWJC 1H5BB 4MQ7A 5HHPA 5E6ID 5I1KH 3E6HB 2GT9B 3V0VA 4MWFA 2V9RA 4WU5A 3C5JA 4WFFE 3IDYC 1D5ZA 1OD7A 3T77A 3B9DA 3EOAB 2E3VA 2DICA 5IHZA 4GMTL 2P7TB 3EAKA 3MV8E 2UUDH 1AGEA 2HLAB 1FC1A 2GTZB 3KR3L 4R96B 4OIIL 1U92A 2RCSH 1R5VA 4OFIA 1INQA 2DQCL 3H0TA 4XNYL 1X5XA 2SEBB 4O2CB 2BNRD 1DLHA 2A9NL 4K8RD 2F58L 2XICA 4OCRL 3GMNA 2R29H 1YPZB 4N68A 1RJYA 1ZLVH 1R3IH 5DA0B 1VADB 3RL1B 1XH3B 3ALPA 2XZZA 15C8L 5E4EC 3BHBA 1I3UA 3D9AL 3HPJA 1GGUA 4J7RA 1I8LA 1R0AH 1XMWA 3QPXL 2IFGA 5KVDL 5GGTH 4KKCC 4J6RH 4G7YL 4P2QB 4R3SA 1S7SA 4CVXB 1T3FB 4FXKB 5GHWL 1P4BH 4KJQC 5I1CH 1F00I 3CSPA 3M17B 5D96C 5SWSB 3CDYA 1CQYA 4QTHA 4DKEL 4JFZH 3QP3A 5HGGS 2R1YA 4NQEB 5DHVH 3SKUD 2UYLA 4NRYA 3OAUL 3D39D 1U58A 1UM5L 3MGTB 2FX9L 2VZUA 3T3PE 1F45A 3M1BA 3WFHB 4Y5XC 4NFDA 2VDMH 1MJJB 4D8PB 4I0PB 2CKBB 2YHGA 4OZGF 5I0ZA 1PX3A 4XBPA 2O5YL 5HD8C 1R3KA 4U3HA 2IBGA 5CWSB 2NW3B 4Q6IA 5TDPA 2D2OA 5CEZD 5JA8B 1KEGL 3I02A 1E4WL 4KJWC 4XP6H 3OB0K 4MAYB 2FEEL 5DUBA 4R97B 4ETQB 2CLRA 3R8BB 3INUH 3VXRB 3FZUD 5I8CB 4HKXA 4NIKB 3BVNB 3KJ4C 1KCVH 5D1XB 1KACB 1B4JL 1JGDA 1U8HB 4Y1AA 5IG7B 5BOZG 1T21A 4KY1L 5GSRB 3KNBB 5DRZA 2FX7H 2OMBA 5E8DL 2BC4B 1YNLH 1E28A 5ESVB 3CFBA 2QADD 1KOAA 3VMOA 3HNVL 5IFHH 3OAZH 1WBYB 5LVEA 3WO4B 3D25A 4XP9L 5CGMA 4JHWL 3WE6B 2H1PL 5J6HB 5KN5A 2IPTL 1T7VA 5F9JB 1J8KA 4Y19D 1RUKL 4RX4D 4KZEL 1DSFL 1WFTA 2CDGB 5E8NB 3VD9A 1FNSH 1JHKH 1AGFA 2WNGA 4Y1AE 3X11A 3I6GA 4QHMA 4UB0H 2JCCF 5BJTA 2VLJA 3S88L 3MRJA 1QRNA 2HAZA 5I66A 4NUJA 2XA3A 4KV5F 1MCJA 3HE6C 4JZOB 1BQLH 3I75B 4OZIF 5FUZL 4F57H 4J3OC 1RULH 4X9BA 1F2XK 1H5BA 2XXCB 3EYQC 1MFCH 2VR9A 3F58L 4MCYB 4YIQB 1AQKL 3E6HA 4GFTB 1MCBA 2GT9A 2VSCA 1JYWA 1K8IA 2JJTA 4LSRL 2PW2A 2VDNH 4OCSL 4AY0A 4PRID 3LD8B 4HJGB 4YJZL 4CL7A 3EOAA 3HUJF 1OB1B 1CU4H 4TRPH 5J57B 3U30B 5DTFB 2C1PB 2P7TA 4BZ2H 4XVSH 3MLZL 2GTZA 4R96A 3BIBX 4XPHH 5BOPA 2VLJE 3ZDXF 1QRNE 3CXDH 2SEBA 4O2CA 1IEAB 4PRHB 1KJ3L 3WFBL 1YPZA 5A16B 4MB5A 3WUWG 1NMBL 3KHQA 3VGHA 5JW5B 3RL1A 1XH3A 2QSVA 5FYKD 3RKPA 2BRRL 4LSPL 5IK3B 3FT2B 3KDMB 5E2TH 5JIIA 1MAMH 4BUGA 5DZLA 4NKIL 1B0GA 1Y6NR 3P4MB 2CKNA 1PX4A 3R1GL 4JLRB 4CVXA 1T3FA 4FXKA 1Z9SA 4OGXH 3M17A 4LLAA 5SWSA 3ZKMC 4J3WA 3F8UB 2A38A 4XVTL 2VN4A 5J1AB 5I1IL 5HDBE 1FO0H 1YPZE 2XA8H 1MRCH 2CK2A 3MGTA 4LARL 2VQUA 4YGAB 5FO7B 3WFHA 2EYSB 4QXGH 4JM2F 1MJJA 4D8PA 4I0PA 4JG0H 2CKBA 1TITA 4M6ML 2ED9A 4DCQB 5CKGA 4MA7H 4POYA 3PXHA 2Y1VA 5CWSA 2NW3A 3DURB 5JTWA 5E08L 4NO5B 4P2QE 4S1DC 1RZKL 2P4AB 3TT3H 2EDYA 5CD5D 5SWSE 5F72S 4ETQA 3VI4F 2GAZB 3VXRA 1RUMH 2N7BA 5I71C 5I8CA 3MLVL 4NQEE 4Q6IC 3BVNA 3OJ2C 5D1ZB 5D1XA 3ALWA 5MEPB 5GZOC 1VGKB 3MNZB 4YX2L 4D9LL 1I4FB 1NCAH 5GSRA 4P46B 3KNBA 3BPOC 2BC4A 4YDLB 5ESVA 4U7KA 5JW4Q 3ULUE 1LO5B 5GISH 5ICXB 3C5SA 3QXUA 3PGDB 1NSNH 4YZFF 4H8WC 3U6RB 4CDHA 1WBYA 3BKJL 3LS5H 3G08B 3WE6A 2XWTB 1OTSC 4JFHE 5JUEL 5J6HA 2VDRH 1L7IL 4FRWA 5F9JA 5E4IA 5HI3C 1CL7L 3VXRE 4GXVL 2KQNA 3NH7L 4BELD 2CDGA 5E8NA 4AG4L 2YUVA 5F96L 1L0YA 1LNUB 1Z2KA 1MIEH 2J12B 3GIVB 4XC1H 4APQA 1UWXK 3G5ZA 2VDQH 4DN3L 4FFZL 1QBLL 4TVPH 5C86A 2OMNA 1QFPA 4JZOA 1F6AB 5ESAA 2HMIC 2A6JB 2NY2B 2AABH 2PXYD 5GS2H 4XNQB 4NKQB 4LDEB 4MCYA 4M48L 4YIQA 1KTKE 3UXFA 4ODHH 3WIFB 1YEHH 2DLHA 3V7AG 3G9AB 3QT2A 4LLYA 3T3ME 4N5EC 5DSCA 5K33A 3WIHH 5A43C 4PS4H 1J7VR 1OB1A 4UT7L 1PGRB 5DTFA 2C1PA 4GRWF 1LO4H 3O2VL 43C9B 1YEJL 1UXWB 4JFQB 5CZVH 3RY6C 4HPYH 3SPVB 1T1ZB 3L95B 2ID5A 3WFCL 3QUXA 1IEAA 2CGRL 4PRHA 5ILTH 5M7QA 5I1LA 3GIZL 5A16A 4G8EB 1J05A 4XPTH 2UUDK 2XN9D 2V5TA 5JW5A 1G6RL 2Y06H 5IFAH 4PYHA 5T33H 5IK3A 1GHFL 3FT2A 3KDMA 4M6OL 4RGOH 4GRWH 4DZ8B 2HVJB 5MENB 3HR5B 4LLWB 1HHHB 4QF1B 3P4MA 1BX2B 1WAAA 4JHAH 1WT5A 4JLRA 3DTXA 5CZXC 3EDKA 4FFWC 4LQ1A 1IEHA 4HPOL 3D0VB 4JCMA 1AI1H 3UJJL 4PRHE 5J1AA 1A9BB 4JFDD 1X5JA 1SMAA 4IJ3C 4JFED 3PWPB 2B0SH 5FO7A 1K2DB 2EYSA 2IADB 5CCKL 1QPXA 2B8OT 2DLTA 3MRPB 5EORH 4ZD3L 2FH6A 2OL3A 3BKCL 1RIVH 3UJIL 4DCQA 3EDDA 4HZLB 2E6JA 2OXGA 3EW3B 3TA3D 3DURA 5C08B 4LSSL 4NO5A 1OTUD 2ICWB 4I0PC 1A4KB 1U3HD 3MROB 2YD5A 4ZXBB 4HDIB 2IAMD 3ULUC 4P2RD 3B9AA 3RY4A 1W72L 5D1ZA 2XKUA 5MEPA 1VGKA 3H3BC 3MNZA 4YEEA 1I4FA 1RZ7H 4P46A 4MAYC 4OLVH 2ZSVB 4JY6B 4R97C 1JPST 3ECBB 5FCSH 3OZ9H 4X9GA 3ZDZE 4UTAH 2O5ZH 3W11D 5ICXA 3PGDA 3U6RA 1E27A 4WUUD 5D1XC 2W9EL 4RCAA 1CD9B 3G08A 4HC1L 4WEMB 2XWTA 1KCUL 3V5KB 3ES6B 3SY0B 1JNLH 3MRDB 4LFHG 4PY7B 3WKNA 4NJ9H 1SHMA 3B5HA 3BEWB 3E8UL 3HTLX 3WO4C 5SV4A 2JB6B 2MFNA 1PAMA 3RQ3A 3E0GA 1ZWIB 3GIVA 3ARTA 1CXFA 3TVMB 4FQLH 3JWOL 4OZHE 3NACH 4C56D 3RJQB 3MRKB 5IMMB 1FYTD 1F6AA 1YEFH 5GS0L 1MQKH 3DYOA 2A6JA 3KWWB 5HPMA 3D2UD 2PR4L 1MCOH 4XNQA 4FQJL 5B39G 4OZFB 1P6FA 3PV7A 2VXSL 3FO1B 3F5WA 5IEHB 2R1WB 2DAVA 5MERB 4FZ8L 4K94L 2QHRH 1LDPH 3ARBD 3DX9B 1HCVA 4K3HA 2ZKHL 3OJMB 4AMKL 1PKQB 43C9A 2XY1A 1SY6A 4JFQA 5GGUB 1MSPA 2ESVA 3SPVA 3RPIB 3D5OF 1T1ZA 3G6DL 2P48B 1SM3H 1CDUA 3ZHDA 3QO1B 1VFUA 3U30C 4G8EA 4LCIH 4WDIB 3CJJA 2IJ0C 4JQXA 3ZL4L 4GQ9H 3QDHA 4L8BB 2XQBL 1EEQA 4S0TD 5K9OB 1BP3B 3BIKB 1ZLUH 4DZ8A 2N4IA 3CLEH 3HR5A 5MENA 3V2AR 4LLWA 1HHHA 3EO1B 4L3EB 4NKOB 2AJZB 1JWSB 4QF1A 4BFGA 5BMFL 1PEZA 3MLWH 1BX2A 1UKQA 1KFAL 2A6DB 3VG0H 1MH5B 2EXYC 3BQUD 3UC0H 4YHLH 1LVEA 4G8FB 5TF1L 3BP5B 3D0VA 4WIQA 5H2BB 1ZGLM 1JUFB 1XCQB 4YHKH 3QXAB 1CXEA 2R0WH 1A9BA 3IDIB 3MCG1 3FMGH 1WT5C 4OGAC 3PWPA 4WHYG 1WWAX 1K2DA 2IADA 4QRRB 4XC3H 3MRPA 4R7DB 3W81A 2EE9A 4PUBH 1MCDA 4HZLA 1BMGA 5MENE 1IT9H 3LIZH 5C08A 3Q0HA 1A4KA 3EJZC 5T3ZD 3K7UA 3GMRB 4ZXBA 4HDIA 2J8HA 2B39A 1SEQH 2VLRB 1GC1C 4KXZI 4OF7A 3PWPE 3IB4A 4KJYB 4QRSB 4LKXB 3TNNB 4DUXA 4OFVA 3DV4A 2ZSVA 4HHAB 4YQXH 1W0WA 3ECBA 2XQYG 3P9LB 1LO0L 4X5WB 3SQOL 4JM4H 2NY7H 4QO1A 3DV6B 5D1ZC 1QYGL 1IC4H 5C08E 3ZZ1A 2IMNA 1S78C 5TE7L 4HLZH 3ISWA 4MNQB 3V5KA 5HDBF 1YPZF 3ES6A 4HT1L 3NA9L 3MRDA 5IBLC 4YDLC 4PY7A 3SY0A 3WO3B 1E6OH 1QFWH 1FE8L 4YHOH 3KPSA 3UBXG 4ISVB 4FZEH 3BEWA 2Z92B 5AZEH 2K9UA 3W39B 4KVCH 1JRHH 4FQIL 1J0YA 4X83A 2Z35B 4XPBH 1A02N 1MVUA 3TVMA 3S34L 1E4XI 4L4TB 3NOIA 4TUKH 3MRKA 5ETUB 5IMMA 4OTXL 3ULVL 3S37X 4H0HB 3KWWA 1CD0A 3IFLH 4PJEB 4OZFA 1A3LL 3FO1A 5L6YH 4M1GL 1CTNA 1PEWA 2YPVL 5IEHA 5BV7L 1AC0A 3C2SA 2R1WA 5MERA 1LO3H 4FQXD 2NY2C 2XY2A 3ULUF 3G04B 2X41A 5CILL 1CDGA 2FIKB 1PKQA 1FAIH 2APBA 1P4IL 1MNUH 4U7SA 2BMKB 1WBZB 2KL6A 4XAKE 1YMMB 5GGUA 3LS4H 4CU7A 3BRDA 4H0IA 1FNAA 4PJHB 3RPIA 4HGMA 2EZ0D 4MA3A 2YEZB 5I8KH 4I8DA 2Z31D 3MNWA 4WDIA 3A0OA 1JPSH 4L8BA 1UB5A 5K9OA 5AYUL 2YD6A 3ULUH 4H20H 4M7KL 4L8CA 3QA3B 3EO1A 4L3EA 4NKOA 2AJZA 4RDQF 3TCLB 4PGJA 2GSGB 3CH8A 4JQXC 2C4FT 2A6DA 1MH5A 1PKQE 3WMSA 2X1OA 4G8FA 3BP5A 3C5ZB 3MJ9L 3QRGL 1JUFA 3BO8B 3ZTNH 5AG8A 1FNEB 4X4ZA 4XVJL 3CFDB 1B3JA 3GSVB 3IDIA 3T3MF 4HCRH 4X98A 4G7VH 1WWBX 1A4JB 5DO2C 3THML 7CGTA 3BN9C 5EWIH 2I24N 4R7DA 4KU1A 4ZQKB 5LWYL 4QNPE 4JRYB 1JPGB 1SJEB 4Z7UA 1UYWH 4U05A 1G0DA 3PWNB 4L3EE 1QBBA 4W70A 1EVUA 4MMXC 3T0XA 3MACL 5KVMC 5H37G 1F3DJ 3BUTA 4FQCH 3LZFH 4IRJB 4RGMB 3TEUA 1DBMH 4Z95H 3B2VH 5SWZB 1CLYH 2VZ1A 2FBJL 2VLRA 2FGWH 2ORBH 3U7YL 3TBYA 1T1WB 1AC6A 3OJVC 2W9LA 3ZT6A 4PB9L 4KJYA 4QRSA 2KKQA 4LKXA 3TNNA 1FGNH 5ESQB 3U0WL 4QRRE 5CJ8A 4ZXBC 4QTIL 4UNVA 4RFEA 5E1AA 4QXUL 3X12B 3UTOA 5EU6B 2FWOB 3I9GL 2PN5A 5HXMA 4X5WA 4HK0B 2R0KH 2GITB 2QQNL 3SJVD 4DGIL 2DQEL 1MHCB 3DV6A 1H8OA 4HXBL 3QG7H 1QSED 5D7JB 3VFRB 4QEGA 1R6VA 1WZ1H 4G5ZH 3SHSA 5E2VH 4MNQA 4N1HB 5MHSE 4RGNB 4EQ2A 4ISVA 1NFDF 2VQ1B 2Z92A 4G6FD 5JOPD 1T5WB 2BZDA 3WJLA 3W39A 2XIDA 2O5XH 5C0AD 1NGXA 2PYED 4G3YL 4TULL 5JMRA 4IRSD 1GPOL 3JSSA 1AP2B 4NUGH 4L4TA 3OBAA 2WANA 3CU1A 4F7EB 5ETUA 4DUVA 5GGVY 1WISA 2WMPA 5DMKB 4UZGA 3T8XB 1RUQH 2YMXL 3O6KH 1MFAL 1U95B 3EYSL 4MNQE 5F1NA 1WUNT 2V7NB 5HHQB 3TVMC 3AFLA 4KKCD 4M7LL 4XCCH 1K6QL 4JGUA 2DQUL 1GOHA 3KHOA 4KJQD 4OCYL 1RHFA 3LN5A 2DKSA 2ADJB 3ZDZF 5DD0H 3G04A 2P5WD 3RKDC 3IETB 2FIKA 4YC2B 2J88H 2BMKA 3LRSB 1WBZA 1PQZB 1HIMH 1YMMA 3JBG7 4I3SL 4PJHA 4U1HB 4L4TE 4C55A 2A9MH 3IJSA 3KPMB 2YEZA 3AB0B 5LGJB 2X4OA 2AJYH 4ZS6C 4EUPA 5HD8D 4YXLL 2FHBA 4PJEE 4AENB 1JCKA 5D9SB 1GC1H 4MXVE 2DQJL 3QA3A 4LGRB 3TWCH 3AXLB 3BMVA 4KJWD 1P84K 2NW2B 1FVDB 3TCLA 1T4KB 3FOLB 2GSGA 4OZHF 4H26B 1BF2A 1J8HE 3LN4B 4OGZA 4UOW1 3PP4L 3GMLB 4WI3A 2DQFB 3C5ZA 1ZLUK 1YMME 1LGVA 4PJHE 3BO8A 3MMEB 1FNEA 4WFHE 4HZAA 1MREL 3CFDA 2M26A 1I9IL 1NBVL 3GSVA 5DGQA 1J12A 2DBLL 2X9YA 1RURH 4KK9C 5IM7B 2I07B 4G6KH 1A4JA 4OQTA 2DQIH 4WUKH 2DIAA 5DD6B 4ZQKA 3A6CL 1FC2D 1JPGA 1SJEA 3PWNA 1GIGH 4X80H 1QSVA 5FUCE 4GAGL 1XF5B 3DJ9A 4RMQA 1KCKA 2FCBA 4MJ5B 3VWKB 1HK6A 2YWYA 1OAZH 2BSSB 4IRJA 5FM4A 5IJKA 3KAAA 2C26A 3KLHC 3L9RB 4Y7MA 5SWZA 3FFCB 1OVZA 2ZOKB 1T0MB 2F54B 5E2WL 1T1WA 4S1QH 2AAVA 4ODXB 1F90H 5I1GH 3IDNB 2IQAB 4NYLB 2ED7A 2CMRH 4WFFD 4X9HA 1BJ8A 5ESQA 3HE6D 4JO1L 3X12A 1LK3H 2J5LB 3PF2A 5EU6A 5IVXB 2FWOA 3IFNH 3MV8D 3C8DA 3TV3H 3EYQD 1G9NC 4HK0A 3DI3B 4JRYE 2GITA 3WNLA 4D0DB 1S7XA 3GSOA 2IGFH 2WWMC 5D7JA 4HEPG 3VFRA 4Q9BA 3G5YB 1JYXA 5I1AB 2HRLA 5F7EH 4LHUG 1A5FH 3D85D 1TQCB 4UU9B 1S7UB 4UDUB 5KSAB 5SWZE 4GAFB 4XVUC 2VQ1A 4UTBL 5EULV 1U6AL 3HI5L 3BD3A 4MVBC 1T5WA 2FB4H 3FQWB 5HYSG 4I3RL 1WFOA 3WNOA 5TFSL 1F5WA 1SY6H 2NYYC 5IP4A 3WD5L 4EI5B 5TE6H 3F7PC 1Z6JT 1AP2A 1N8ZB 3VGEA 3ARPA 3WJLC 4MX7B 5KSVB 1C7SA 2XOTA 2E6QA 5DMKA 3T8XA 1MF2L 4N8CH 4NBZB 2BFVH 3IT8D 4ODWB 2V7NA 2UY7A 5J3HC 5L8KB 1KPUB 1Q0XH 4RGNE 3QISA 3EOYG 1EMTL 4JQVA 3EUUA 3FAWA 2ZWLT 4OBRA 4S2SB 4G42B 1B0WA 1KB9J 1BIHA 3ZKMD 2ADJA 1FG2B 4MDIB 1RV6X 3QQ3B 4NRXB 4X6BB 3IETA 4ZNEE 4OSUL 1V3KA 3LRSA 1PQZA 3CFIC 2X1PA 3MOBL 2I26N 3MXVL 4U1HA 1TCRB 3KPMA 2EIZB 4YFDB 1RZFH 4JR9L 5C92A 1YN7B 3MRHB 4AENA 4ERSH 3BJLA 3U4AA 4FNLH 4FP8L 5D9SA 5F89B 4S1DD 3FCTB 3DUUB 1S5IH 5I1HL 3AXLA 2KZ1B 3V5DB 1FZJB 2NW2A 3K8MA 1FVDA 5FYJL 1T4KA 3FOLA 4XP1H 3RTQB 1V3JA 2VL5B 3CVHL 3LN4A 2D03H 3S7GA 3O3EB 3GMLA 5F7NC 3EJYC 3RWJB 4XMLL 2DQFA 5GZOD 3NFPB 3MMEA 5F1IB 2VAJA 1EX0A 5HJ3B 5FUCC 1X5FA 1UQSB 5IM7A 4OI9A 2QBWA 2I07A 2I9TA 2QSTA 3DX8A 4JDTL 3RU8H 3W2DH 5HHMD 2VKWA 4ZUVB 3V4UL 3C5ZC 1KN4L 4Y1AD 5DD6A 3TBSB 1OTSD 1WCQA 3P73B 5IBTH 1BFVH 3F7YB 5J0BA 1JE6A 1I1AB 5TPWH 4JKWA 5HI3D 2UVEA 3HC3L 1GAFH 1G6VK 1XF5A 5L9DL 1KJ2B 3N9GL 4LVHC 4PRAB 3VWKA 2VTFA 5I1EL 3KGRA 2YA1A 2MKLC 2AV7B 3L9RA 4JFOB 3BH8B 4HG4K 5DXWA 2ZG3A 3EFDL 2ZOKA 1T0MA 3H9HB 1W0YT 2EDFA 2F54A 5DK3A 3RAJL 2QSCH 4IRJC 4PD4K 3MV11 4RGMC 5IJKC 2AEQL 3CX2A 4TSAL 2HMID 5FUOH 3V6ZB 1F11B 1Q0YH 3DVGB 5AD0A 5F3BB 5IVXA 4LOUC 2ZPKH 4XMKH 3BRFA 4D0DA 5CSZB 2VLJD 1VGEL 4Y8AA 1QRND 3P4LA 4OZFH 4GBXA 4N5ED 3G5YA 1WGOA 5T1MB 4HUXB 1SJVA 2CUHA 5I1AA 2E7CA 1YEGH 3RZCB 5DJDB 4UU9A 1S7UA 1BOYA 4AIXA 4UDUA 5KSAA 1H8NA 1HE7A 3OSKA 4XB7A 3DYPA 3FFCE 3DHJA 1FZMA 2F54E 1BJ1H 3FQWA 5DMJB 4QNPF 5D7JC 2QKIA 4BA8A 12E8L 4XNUL 1IM3B 4IHOB 4RGNC 5IT2H 4YE4H 3K46A 1RFDL 5IVXE 1JHLL 1N8ZA 1Y6MR 4IOFC 4LPCA 1OM3L 4MX7A 4WY7L 5KSVA 2B2XH 3REVB 1XR8B 1XGQB 3MRRB 5GS1C 4KAQH 2DI8A 1OCWH 4K9EL 4ODWA 4Y4HB 1XIWA 4QYOB 4P9HL 5CZXD 4FFWD 4S2SA 4G42A 4EKXA 1FG2A 1XR9B 4NRZB 5GS3A 4MDIA 4NRXA 4X6BA 1J88A 2XQYK 4M8QB 4P2QD 4JQVC 2R69H 1JNHB 2F9BT 3BDXA 3EHBC 1TCRA 1CICA 2MSPA 2EIZA 5SWSD 1UCBL 5DJ0A 4F2MA 2NY1B 4P59H 3GSNB 1ZS8B 3K2UL 3CSYB 4NQED 3NPSB 2F5AH 4YC2C 4LCYB 3MRHA 3MRBB 3NA4A 5FA3B 3FT4B 5GGVH 4LLMB 5F89A 4I0PD 1M7XA 3AB0C 4KFZC 1NEZB 3V5DA 4GXUN 1FZJA 4OFKA 2AXHA 3RTQA 2X4PB 4UINH 3ULUD 1DCLA 1F8TL 2VL5A 1KGCE 4MAUL 3O3EA 5E94B 3U2SB 3RWJA 4LRNL 4JFHD 1G9NH 5D7SH 3NFPA 2IC2A 2Z0BA 3NAAL 5F1IA 1DEDA 1KBGL 4YHYB 1YDPB 4Y5YB 1A22B 3U0TB 5HJ3A 5CUSL 1UQSA 1U2HA 3VXRD 3MFGB 1PZUB 4M1CC 4YHML 3FQXB 4DGYL 5D1XD 4PGEB 4HBCL 1JWUB 2R0LL 1MCLA 3TBSA 2AJUH 3N06B 4RAVB 4UILH 5D7LB 1KB5L 3KXFB 3F7YA 2XTLA 1CDJA 1V5JA 1KJ2A 5IMKB 4FQPA 4PRAA 3ROOB 2IPUG 3CIQA 2AV7A 2VL4A 3BH8A 4JFOA 4M7ZB 4NJAH 4PJEF 4PLNC 4KHXL 4EEEA 3H9HA 1I1YB 3MRFB 1BVZA 4YXHH 4MXVF 5HHXH 3VWKC 3CNKA 4PJXB 4L1DA 1V8HA 4PP1C 2CIKB 3PWLA 4R7NB 5DEZA 4KDTC 1F11A 1I3GL 5F3BA 1YYMH 4UQ2B 1OW0C 5FKPA 5CSZA 4KTDL 5DJCB 4WI6A 2VO5A 1BM3H 4P3DB 4ZO6A 1EZVY 3WS3B 4X6DB 1JGUH 2JB5L 3DYMA 5T1MA 1XCTB 5T3XE 2J5LC 1M1SA 3KYKH 1L0XA 2EH8H 5I30H 1HH6B 3GHEH 5BVPH 1YEKH 3FRUB 2XZCL 1IKFH 1RIUL 3BW9B 2J4WH 1IM3A 5IR1A 3P11L 1TQCC 4BSVB 5KSAC 2QHLA 4ZUUB 3T0AA 2Y07L 4C4KO 1XR8A 1XGQA 3MRRA 4EI5C 2X1QA 4PRHD 3PGFH 3LQZB 4CN6A 3GI9H 2YPKB 3MJ6A 1W2KT 4Y4HA 4QYOA 3RL2B 1QO3B 3N1GC 1MUJB 3ZYIA 3HHRB 1K3IA 5K93A 3UTQB 1YNKL 1XR9A 5I8OL 4NRZA 1KN2L 4H1LB 1NCWL 3K80A 1A0QH 2YSSB 2BSED 4M8QA 1Z5LB 4OGAD 1JNHA 5JHDB 4Z8FL 1GOGA 3HI6L 1JN6B 1Y0LB 4L3CB 3QR2A 3BKMH 1T2JA 5EN2B 2E7MA 5KVFL 2MQ0A 4LAQL 1QPPA 5KSBB 1IC7L 2A83B 1ZS8A 3T08A 1R5WA 3CSYA 2H2PC 4LCYA 1CK0L 3MRBA 1H3PL 3I2CL 4NZDA 3FT4A 4R26H 4LLMA 4ALAL 3EJZD 5AWNL 4OLWL 1NEZA 5DFTA 5F71A 1IGML 5I16A 5E99H 2C3WA 2EDDA 2X4PA 1KIRB 2BVPB 2XZAH 2D7TL 3FB6B 2YRLA 1MHHB 3IAPA 2MCPL 2F5BH 5E94A 5EZIL 3U2SA 1WTLA 1T0PB 2LE9A 3UEZA 3WXWH 1YDPA 4GRLB 4Y5YA 3RTQC 3U0TA 5B39A 4NQVB 1FHGA 3GGWA 3HAEG 1NH6A 3MRGB 4JCLA 3FQXA 5JXEA 5D1ZD 4XXDB 1T80A 4PGEA 4KMQA 2VISB 1G6RB 1HHIB 1JWUA 1S78D 2VXVL 4X6CB 2OTWB 4RAVA 4U6VH 4P46D 5D7LA 3KXFA 7FABH 5IBLD 1T03H 5EU4B 3TT1H 4P5KB 3RPKA 4MXWL 5IMKA 1F4AA 5DLMH 3ROOA 4F7MB 1H9VA 5ADPH 1JZ2A 4G80A 1MFEL 2MKWA 4YWGH 2RJMA 3S37H 4NSKB 3MLXH 1F2QA 4LMQI 1I1YA 1I1AC 2AK4A 3MRFA 5EOQL 1N4XL 4GO6B 5DGRA 4PGBB 1S7WA 5HDQL 4Q0XL 3IRZA 2CIKA 1J86A 4R7NA 4F7TA 3RBGA 1WJ3A 4UQ2A 5D7LE 2WBWB 3KXFE 2DQHL 2QLVB 3RWEB 5DJCA 1FP5A 3F12A 3H3PL 1M6OB 4P3DA 1OARH 5TQ0L 2VXQL 3FRPG 3WS3A 4X6DA 4Z77B 5ALBL 1FNHA 2NY2D 4NQDB 4WEUD 1KLUB 2A74B 3AROA 1TZGH 1HH6A 1YZZA 4GW4B 3WSQH 1MLCB 1I3VA 3FRUA 3MBXH 4RIRB 2FJFB 3HLAB 4PJXE 3BW9A 4HS6B 3RZCC 1JFQH 5DUPL 5I18L 1BD2B 2EDNA 3DRTB 4LPYA 4BSVA 4ZUUA 4UUJB 4WFGE 3WN5B 2CK0L 1TJIL 4JFYB 2FL5B 1IC5L 5JR1H 2FO4B 5GZNC 4X6DE 4GRMB 4OLUL 4U3XA 3FONB 4XTRC 1IAOB 2YPKA 2MMXA 2BSTB 3BE1L 4XCFL 3RL2A 1QO3A 4IM8A 2R4SH 2YPLB 4YDIL 1MUJA 3C08L 3M8OL 4U6TA 3UTQA 3QBTB 2XRAH 4H1LA 5MEND 5D8JH 2VUOA 1ZT1B 2LU4A 2YSSA 3BDYH 4Y4HC 1Z5LA 4JN1L 2D7OA 5KBNC 3GSQB 2YRZA 5F7LB 4Y5VA 5DO2D 1Y0LA 3NGBC 4L3CA 2DD8L 4LVNB 2HG5B 5B38B 1MCSA 1NCDH 4J8RB 4PP2B 4ZFOL 1J1XL 3STLB 1AD9B 3GMMB 5K9QI 2CD0A 3PWPD 4OI7A 4DJMA 3CLFL 1EXUB 3LSOB 5DJZB 5IVXF 2NY1C 1KIRA 2BVPA 3O4OC 3FB6A 3NPSC 4XAWL 5E0QA 1TNMA 1G7QB 5H35B 4DKFL 5C08D 3VXQB 4R90H 5EU7E 5JHDE 5KG9B 1GGIH 3VFPB 4ZXBD 4GRLA 4L1HA 2O93L 5KSBE 4YEFA 3MRGA 3U9PL 1WIUA 2VB5A 4XZUB 1NAKL 4K2UL 4JO3L 1TLKA 2VISA 1G6RA 1HHIA 4X6CA 1JBJA 2OTWA 2EE2A 1MCPH 4YHYC 1A7RL 1KNOB 4Y5YC 4ZFFB 2ENYA 1ND0B 5EU4A 4P5KA 4G6JL 1ZLWH 5IHUH 1OAYH 5JXEC 4U0RB 5E1HB 4P23B 4F7MA 1A14H 4KQ3H 3HZKB 3OB8A 3FN9A 2Z93B 1E4XL 1UADC 4NN6B 4PGBA 3LKQB 1KYOK 1N6QH 2ZG1A 4HK3J 3QEHB 1P4LB 4M7ZC 4X6CE 5FECB 4HS8H 3G5VB 5ITBL 3RWEA 4XAKD 3TVMD 3K1KC 4PRBB 1FAKT 4LDOB 1M6OA 2B1AL 4KZDL 4D3CL 4RMUA 1KV3A 3CX5K 1MIMH 2VZVA 1S9VB 4W4OA 4FFVC 4MA8H 1ADQA 4NQDA 2AVGA 5KAQG 1KLUA 1K8DB 2A74A 4IOSD 4WGVB 5DI8B 3RKDD 3VU2A 5CJXA 4DVRH 4GW4A 1MLCA 2RHEA 3ZT7A 1CLOL 1QQDB 4RIRA 2FJFA 3B9EA 3HLAA 4CUCA 4HS6A 5AEAA 3V79C 4TNWF 3DRTA 2X4QB 2CSPA 2IPKB 1FFOB 3WJJA 2B4CL 1G7JB 5DMGC 4UUJA 3WN5A 1MQ8A 3NCEB 3WV0A 4JFYA 2FL5A 2D31B 2V5RA 1WFNA 2GKIA 2FO4A 3Q5OA 2FJHB 3HZMB 4GRMA 1RZJH 2AS5M 3SOBH 2XFXB 3FONA 4HC1A 2OXHA 1IAOA 1X5HA 4NQDE 3D3VB 3HPLB 2Z8VC 3PWUB 3BUYB 4MCZB 5DD1L 2YPLA 3MLYL 3S36X 4E42B 3QXDB 3BT2L 1L9NA 2FLBT 3MR9B 1A7OL 1ZT1A 4RQQB 4C58B 4L3ED 4XHQA 5D7IB 4F80A 1BD2E 4KK9D 3GSQA 1WTGT 3D48R 2A6KB 2DQCH 3BN3B 4I1NB 3GMOB 4XNYH 4U31A 5SX5H 3Q1SL 1ITCA 5D71L 2A9NH 2CDEB 3EDJA 2HG5A 2V17H 5GJSH 5B38A 1WIOA 3L3GA 4J8RA 4PP2A 4YHZL 3STLA 4E0RA 3O81A 3MLPA 3ZMRA 5DMIH 4DAGL 5EU7C 4JO2L 1RIHL 4QRRD 4NWTH 5BV7B 2EDRA 3OKNA 2YPLE 1A8JH 2FX8L 4MJIB 1OAKL 3QUKB 1CFTB 3NCFB 1EXUA 25C8L 3LSOA 5DJZA 1KJ2H 2HJKB 5HYQB 4W68A 4GMSH 5T3XH 5CJOL 5A3IC 3CDCA 4AEHH 2AXJA 3GBLA 5C1MB 1G7QA 5H35A 3PV6B 3VXQA 4P49A 1ZOXA 4DKEH 3ZE2E 5HYJB 3QI9B 5KG9A 3VFPA 1U8QB 5MHSD 1E6JL 4HJJH 3RWDB 4LQFL 5CGTA 2VLRD 3WNPA 4EDWL 3BKYL 1INEH 3U46B 4XZUA 1I3RB 1OWWA 4PR5B 5EC1B 2WWMD 4XMPL 3BGFB 1A21A 4YBHA 1DZBA 5EU3B 1KNOA 4GRLC 1VFOA 5ITFB 4TN9A 1ND0A 3CCHB 2XWBB 1NMCB 4XVUD 1DR9A 2WAHA 4MVBD 4K7PH 1C5BH 4P23A 3IF1B 4M03A 5DJ8B 3T0VA 2X44D 2ATPB 2JIXB 2VC2L 4MNQD 2NYYD 4P57B 4D0CB 3QB7C 2W91A 2ICEB 2Z93A 1D5MB 1P5VA 1IAIH 3LKQA 2GJZB 1Q8MA 2C7UB 3B9KC 5FM5M 5HDOA 4KK8C 4PJCB 3QEHA 1P4LA 2BNRB 2YWZA 5FECA 2EIDA 1NLDH 5DA4A 4M43L 3G5VA 5J7CC 1U8IB 2IQ9H 3HNVH 2HT3C 5J3HD 4A6YL 4PRBA 3TCXA 4L4TD 4PJ8B 3S3JA 4IDJH 5JDSB 4OQ1A 4DGVH 3UZEA 3MLRH 5K9JH 1EO8L 1K8DA 3FTGA 3P4OA 3LKRB 4CAGA 1KTRL 1AJ7H 4QHLB 3QG6B 4KZEH 4Q9RL 2K7PA 1T7YA 2R23B 5CIPH 4WO4B 4S1SL 3TYGL 1ZGLB 4W4OC 2AI0H 2D4FA 4TPRL 1OT1A 1YQVL 1CTOA 5BVJB 5KJRL 2X4QA 2IPKA 1FFOA 3T1FA 1G7JA 5CJXC 1T22B 4I0CC 1YMMD 2R9HC 3GSNH 2XZQL 3RWCB 2D7NA 2D31A 4WFHD 1JHTB 3PWVB 2FJHA 3F58H 1IARB 5BXFB 2XFXA 3QCVL 1ZA6B 3WJJC 3AS2A 3D3VA 5HHVL 3HPLA 4LSRH 3WN5C 4MCZA 5GGSB 5ICYA 3EJYD 1QRKA 3OJDA 4XB8A 4E42A 2ZJSL 1UKSA 3QXDA 4DK3A 5JHLL 4RQQA 3MYJB 5D7IA 3MLZH 4OGYH 1U3JA 3MV7A 2DKUA 3K4DA 2A6KA 2M1KA 4HX1B 2CDEA 3OPZH 4UT6L 2Q3ZA 3C5ZD 4Z7VB 4NNPL 3O45A 3RVUC 1B2WH 1M7IB 2DN7A 2XKNB 4GW5B 1JPTH 4LHUA 5GRWA 4ORZC 1P7QB 3MRQB 4OD1L 1KXQE 3QDMB 4OUOA 3D3VE 4PJXF 3RA7L 5JORB 3JWOC 4XWOC 1N6UA 4K8RL 3LVEA 4KI1A 4MJIA 1IKNA 3AY4C 3QUKA 1CFTA 4ORGB 4CNIB 2HJKA 2DI7A 3FO2A 5GS0C 1T1XB 3RWHB 3EZJB 2DKMA 4NM4L 4GG6F 3NZHL 4ZUTB 1PG7X 3HKFA 2QQKL 5D7IE 3PV6A 5J4MA 4DW2H 2H3NB 3MOAL 2AEIT 4X6DF 3QI9A 1P7HL 5DK0A 1DE4B 3RWFB 4IRJD 1OSPL 3GFUA 4XGZB 1FPTL 1U8QA 1XF1A 3RWDA 5SWZD 4K94C 4LOUD 3ULVE 4Z9KB 3SE9L 3U46A 4YFEA 1PW3A 1I3RA 4PR5A 2J7LA 3O8XB 1Q94B 5DVLA 4M6MH 3WDHA 1CGWA 3GRWL 5EU3A