4ZBJA

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
160
structure length
160
Chain Sequence
b'PLGSPNSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
molecule tags Structural protein
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
total genus 31
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4zbjA00
5EIIG 4EO5A 2DZEA 4RRPM 1TEYA 4ZBJA 2IO5A 1ROCA 2I32A 3AADB 5BNXD 2IDCA 2Z3FA 2YGVA 2IIJA 1WG3A 2Z34A 5C3IA 2CU9A 2HUEA 5BO0D
chains in the Genus database with same CATH superfamily
2AQNA 4TQEL 1RJZB 2G3NA 4WI0B 3VRIA 1ZOXA 4LLUB 1PJ9A 3KVDD 1EUTA 1AG0A 5E5RB 2KKQA 2OCJA 2DQFB 4LEEA 4U1KA 4OCYL 3MBWA 1S5IH 4IRJA 4LQFH 5B39A 1R17A 4I8DA 2Q3XA 1J0HA 2XZCL 2YEVB 1TETL 4TN9A 3TN0A 4DOHE 3EO0B 1WHPA 3L7FA 2R27A 4M5ZH 4PBXA 2Y5EA 2JSFA 1G4RA 4X6CB 1RUML 1KXVC 4JANB 3VM5A 4RRPA 5EEXA 4Z8FH 2G2RB 1YY9C 3DGGB 4LOUC 5HJDA 2J3SA 5JNYB 5D7LE 5SV3A 2YLKA 3D0AA 2HTKD 2ICWB 2XRAH 1CDBA 5AOLA 4PRNB 4KGLA 4MB4A 3TWCH 1AY1H 3I6KB 3QCUH 1M56B 1IX2A 1QFUL 4OV6F 1J1PL 4JFDA 1EZVX 2ESVA 4G7SB 4QXUH 4RBPK 4X80H 2EVGA 2VM4A 1ERNA 4LHUB 4YDLC 3FAXA 3GJEA 3U4BL 3HI1A 2P44B 3NJNA 2AZAA 5T1KA 4G71B 2RHEA 3ZDXB 2BHZA 1HS6A 1AS6A 4TUKH 1DJYA 3C5SA 4NCDA 5DSCA 3WENA 1I7UB 1FYTB 3FS9A 2FJFA 4G3YL 5I8EB 4RNRB 3L1FA 4FXGB 3LKQB 3TGXA 4YH6A 4WWID 2XZZA 4HEPA 4LKCB 3MOQA 4BQ6A 4ZX3A 4JKWA 2IADA 4YSRA 3GRWA 1Q9WB 1LK3L 5K9JH 3LX9A 3KPSD 3BUQA 1EXUA 5FYKL 1ZIAA 4OQTL 2BVUA 1KZYA 5HGBA 3IB4A 3IDXL 3CZKA 2I07B 2CJUL 3EGDB 1IZKA 4IRJD 3BWSA 3H0TA 4HJJH 4NQCE 5DFVC 1XZWA 3PGDB 1H6EA 1KT2B 3CSTA 3HVDA 1ONQA 1AGEB 4X6CF 5IK3A 3SODB 4UIMB 1BXVA 4WUUE 4DEPB 4OFYA 2GT9A 2Q76B 2BNQB 4GS7B 1U42A 4DGUA 2QGEA 5ESVB 5AALA 3MRFB 4OI8A 4WGWB 4OZ4B 4BK8A 4QNPF 2YRZA 2DQFA 2HJLB 4GP4B 5ENWB 1KPUA 2OXHB 2VDMH 5EIVA 4PJAA 3C5ZB 3GTNA 1S9XB 2YC1A 3OMIB 4MSWB 4WAFA 4BE6A 3NYKA 5DFTA 1GW6A 2AJVH 2HT2C 4NN7C 4PJXB 3FBKA 1BOYA 4IBZA 4C83A 2MPAH 3BH9B 4M3KB 4MWFB 5L7XH 5EC2A 5LAXB 1JUFA 1AIZA 5DWUL 5L9DL 1BD2D 3R4DA 3TF4A 3RI5K 4HUXB 4YDIL 3JWNG 4ZXBB 3DV4B 4OD2B 5DZ9A 4PJ8C 4LCIH 4FNTA 1SOXA 3VI4E 4WFHE 5HDWA 3ARBA 2AJVL 1XGQA 3MCKB 4N1CA 3AQYA 3MDJA 4P9HL 2YN3A 3DX0A 5AVUB 2ESVB 2MHAA 3H42L 4BH8B 4E9VA 1GGBH 3B7RL 4HJEA 5T3ZL 1ECZA 4LCCB 2VXTL 1KCSH 3WHE0 1FL3A 3B2VH 3LZNA 3CTTA 1CGVA 3AABA 5CEZH 1XR8A 4JPWL 5FDWA 4A68A 4H1LB 1WBXB 1Q8MA 2NY2D 2EE0A 4IRSB 43CAA 3VFTB 3SQBB 3NPSB 4BFEA 2I9LB 3F6IA 5EBGA 2Z8SA 4Z0XA 3UJJH 1QQDA 2GTWA 3GJFK 3ISRA 4KROB 3BH8B 4M1DH 5CZXD 1J8RA 2WHVA 4Z8FL 3QG7L 3ZZQA 1F18A 3CVCA 3BZ5A 4RRPM 3HZ3A 1EXHA 3IM1A 4GLRH 3KZ8A 4P9HC 4XE0A 3NFSL 3U4EA 4PGEA 4GMTL 4D9LL 2C9AA 1EXUB 2DPKA 5F7HA 1T7XA 3O81A 2N4IA 4MDJB 4TSBL 1JHTB 2BOBB 2ED9A 4L8SB 3ZE2E 4DPCX 2PMZA 4ZSOE 2A4ZA 1O5DT 3HW7A 5HJBA 4XMTA 3WFBL 1GR7A 1YG9A 2DQUH 3P2TA 4N2NA 3NFSH 3SDAC 4N2DA 1QZ1A 4N0FB 5AW7B 1WGVA 1DBAH 5KSUA 4JY5H 4ODUA 4L0ZA 1DJHA 1A1NB 1TFHA 5DO8A 4JREB 5ERWA 3QNZA 4RFNC 2R23B 1JK8A 4P2RD 4WFFD 1RQ5A 1FFQA 3RWGB 1OK8A 4JFWA 1XGYH 1S9XA 4U1HA 5LN4A 4N0UA 2FTAA 2EH8H 2ZKXA 5I19L 2X44D 4PGCA 2EDXA 3WIFA 1OCCB 1OALA 2YPLD 1F58H 4OQTH 5GGVH 2O6EA 3ZTJG 1DVXA 4G1MB 1XGUB 2ZT9C 4D3CL 2O5ZH 3K8KA 1RZPA 1I85A 2VDOL 5I5IA 2Q1EA 4ZTOH 3BP4B 5FGBC 4F91B 3ISWA 4RDBA 1GOHA 3T2NL 4EN3B 2JI3A 1WWWX 5DMGC 5HYJE 2DLHA 1E8YA 1EO7A 3MRBB 1L9QA 5DD5L 4JPVL 3OJMB 3U36B 1EZSA 1NH6A 3GBDA 1XCTA 3QZWA 4OM0H 4Y16B 1ASPA 2DJSA 1FSKC 3KH4A 4WWKC 1ZLVH 1LMKA 4L3ED 1Q9OA 3PAZA 1N12A 4AT6A 1N7ML 1S7UB 3C5ZC 2K0RA 3NAAL 4TUOA 1U92B 3G6JF 4QRAA 1FA4A 1K5WA 3RLSA 5KVDL 2FX9H 1Q94A 2NY0D 3K72A 1UZ8B 5INCA 4JVUA 1IUZA 4EI6B 5F70A 5E5UB 1CYGA 2C5DC 2JTDA 2IDFA 1MI5B 5HGGS 4LBAA 2LT9A 3V5HA 3U2SB 5C97A 2WUBL 4IU3A 4ANKA 1PX4A 2FGWH 3BD3A 4QJ5B 3FO2B 4EDWH 1PG7H 4WQOA 4QTFA 5D1ZB 5KEZA 1NAKL 3D33A 2YOCA 4H1LG 3US9A 3FSWA 5C0RL 5HVHB 5T3ZH 2YAPA 1NCBL 3TBWB 4KO9A 3WS3A 5E2TH 3QDJB 2J25A 3B83A 4AMXA 1CJYA 3B2VL 5CWSA 4V2CB 1IBBA 1LYQA 5F9JB 4G9FA 1SUHA 1HHIA 1YA5A 2JE8A 2Q86B 1AI1H 4N0FA 4WO4B 1WFJA 1XF1A 3BZDA 4UNIA 3M17B 4WRLA 1EHNA 4Z9KB 5T3XE 3GZPA 2BSRA 2DY2A 5C07E 3VGAB 1EEYB 2MMXA 2XKSA 4HIJB 4MB3A 4XCFL 4BSWB 2BOCB 4C47A 4CILA 1QFHA 5MEQA 4U1HB 2HUHA 5JDSA 4D0DA 4P59H 5BRZD 1GPOH 1VPOL 3HS0A 4JFXB 1X5FA 3LNGA 2F5AH 2DIEA 5CHNB 2QR0B 4WTWA 3QUYA 4M4PA 4RMRA 4HISA 1W6LA 3PXLA 5CN2A 3KHOA 2A6DA 2UZPA 3C8KA 3ENEA 5TFSL 3STZA 1KXQE 5C07D 5JW5A 1I7TA 4UOW0 5FO8B 4HK3N 2Y23A 4ZZFA 1JF5A 3KPOB 2ZF9A 3ZJAA 3L5WA 2A6JB 4X7EC 3REVA 5CIPH 3RFZB 1MFEH 5F93C 3PWNB 3R7QA 4NO3A 3V7MA 1YMHA 1PW3A 2CK0L 4POZD 3L9RA 3RDJA 1NCWH 2DMCA 3ESNA 4HXBL 4YSCA 4PRBA 2BSSB 1SDDB 3GPEA 3EZ8A 3UPRB 5DK2B 5CUSL 2IO5A 3GSVA 4R0LA 3RVWD 5KYXB 4PCSA 4PJCB 5AVQB 4NC2B 4AT6B 1FYHB 4L48A 1MCWW 3TURA 4LVHC 4LP5A 5CJBA 1UCTA 3MNZB 4JG1L 1WZKA 3TBYB 2ZWKA 5I1DB 3RWEB 5HGAB 2BHFA 2XT1B 3HG1E 4LSRH 4OV5A 3KHQA 1Q94B 2Y69B 4DN4L 3SGKC 2DB8A 2UYLB 1IE5A 4JHAL 3WN5C 4YZFE 3SY6A 3GZQA 5BS0D 4XC3H 3C6SA 5B3NA 3X12A 1MJUH 1T4KB 3L3GB 3P11L 1NANH 2YR3A 4J23A 5GSVB 3VO0A 1RFDL 1GOGA 3HB3D 2HFFA 5DVMA 5DJ0B 5JHAA 1SY6L 3QORD 5E2JA 1XCQB 2NQCA 1QSVA 4X99A 4OM0L 3GB7A 4S1DD 3RPBA 3TYGH 3WIHH 4KY2A 1DDHA 1MUJB 4GSDH 2BS71 4KV5E 2EXYC 4ZO7A 2DL2A 3L3JB 5ESQA 5GZOD 1I3RB 4ZQKA 1KGJA 2DWYA 3QULB 3V0FA 2PP8A 2AK4E 2FQDA 2OMUA 1UATA 4MDRA 4XOEA 2EEBA 2PO6D 2VXVL 4HUUA 1LDPL 3PL6C 4MJHA 4P2OB 4QHUB 3T5WA 1FN4A 5KSAD 4UM8A 1BHGA 5FA3B 1ADWA 1FL5A 1PG7L 1OD9A 3B2UD 5IQ7H 4O4YH 2OMYB 5F7KC 3UTTE 2RR3A 4PY8I 3ULUD 2ZJSL 4G72B 3T04D 1SJEB 4NQCA 4PQXA 1IB5A 1AJ7H 2KDYA 4UUJA 1OHQA 1Y6NR 2AKRB 4FFVC 3V5DA 3GS0A 4LL4A 4YXHL 2C1PA 4QKXB 2CIIB 3ARGB 2FYVA 4PLKD 1P7KA 4PRBB 4WY7H 4MCZA 2OM5A 2VN7A 1CDYA 1UB5A 3S3CB 4OJYA 5DS2A 3WHXB 2FCBA 1BREA 3CJJA 5FO7A 2IWEA 4YLQT 3QUML 4DKDC 5DA0B 5B38B 5CEXB 2VR3A 4GSRA 3FYEB 1AC0A 3W39A 3MNMA 4QHLA 1A4BA 1OARH 4TVPL 4PI2A 3MYJA 4W4NA 1G84A 4WI7A 5FYJL 1WITA 2QMKA 4GY4A 4GXUM 4X6CA 4AVIA 2OSLB 1DSFH 3THML 4YN3A 4BA0A 1CLCA 1JXKA 2ATKB 3BUTA 2GSGB 5KAQF 2LGNA 2ZUSA 1JWMA 3D87B 4YGVA 5DD0H 1CT8B 4DP1X 1E5BA 3ORJA 3WLWD 1XD0A 2COVD 1KC5H 4ZFZB 4JFYB 1SNRA 3ALWA 1A9EA 3QCVH 5TK2A 4RISL 3O3DA 2XLLA 5IOKA 3I3BA 4J3OD 1OB0A 2AABL 1JV5B 2FHCA 4GH7B 1OANA 2ADGA 4LHUA 4YK4C 3NESA 4YEEA 4Z7QE 3U30B 1FLRL 4ANXA 1V3MA 4Q8BA 1CTMA 1U2HA 2X38A 4KHTH 3SE4C 3U0TB 5JIDA 3UTZA 5G4MA 5HPOA 5LWYH 1UWGL 4BFJA 1LO4L 4BWTA 5IJKA 2DKMA 4C4UA 3QZMA 1ORQA 3FTZA 3SE8H 1ZIBA 1FUNA 1JZEA 1PQZB 5JHLA 2QQKH 3KXFA 1YUHA 2Y1AA 2P5PA 1P7QA 2F53E 3ESMA 5T3XH 2DBLL 4I1RA 4XB3A 2IH3A 1ZHLB 4K55A 1MREH 4P2OA 2FX8L 1PF3A 3NGBB 3QUKB 4HF5H 5TDOB 3X1EA 1VZGA 3B9AA 1UM4H 5LCVA 4K9EH 2LQRA 2O30A 1PKQA 5BRPA 1FRGH 3Q5TA 2EE9A 3ZX1A 2X6AA 2YUZA 3H3BC 3DJZA 1T03H 4OTXH 2BIIA 3RAJH 2M1KA 2XETA 3RGBA 5JW4R 1S7QB 1I9RH 1CF1A 1XAUA 3KXFD 1F6AA 1MCFA 1BVLB 1EX0A 2DJ4A 4BFIB 2CUIA 2C1PB 3DMMD 5CP3H 1NMBL 3I75B 5EEYA 4DP6X 5TQ2L 3M07A 2CO4A 1VESA 1KYFA 3GNMH 3VXQA 3WHXA 2CO6B 3L5XL 4KXZH 5ID0B 3P0VH 3LS5L 3I02A 4IU2A 4PJ8A 2VDRB 1R3JA 3EFFB 3RTQD 4RMTA 4JRYD 1KLUA 3O6FB 1KCUH 3FU9A 1WISA 2BC4A 2H8PA 3P4LA 1SVZA 2EUZA 3DIFB 1HXMA 4OUUA 4KZEH 5AOZA 5BZXA 1ZVHA 1KSRA 2QGCA 4GOSA 4YDKL 5GZOA 1U33A 3UGEA 5H94B 3ZDWA 5L8KB 4ZAKD 4RMVA 3PFUA 4LDLB 3MXWH 2AF2A 4QTIH 3BVXA 5IM7A 2C8NA 4ZFOA 3RY6C 4NRZB 1KCUL 2Q2LA 2XN0A 4G8IB 4AITA 3DJTA 2EJ1A 2H32H 2QMJA 4N90E 3VI3A 4ELDA 3TH4T 4HDIA 2UZYA 3QORA 4QO1A 5F6HI 3ZGHA 2ZX8A 5CNHA 3WXVL 2B4CH 4GO6B 3QDAA 4OFQA 3F12B 5I75B 2MQCA 1T1ZA 2X9YA 2XC8A 3GGWA 1QASA 3WJMB 4DEPC 1DQIA 3MRPB 1MHEA 5F88B 2GIMA 2V2WA 4KKAD 3M88A 3HAEA 3MLTA 2F53A 1LWJA 3A4DA 4PP2A 2NY7H 3PRZA 1FGVH 5TH2A 5DRXB 2AC0A 2G4GA 3A6CL 1HHKB 4GRWE 1E43A 1FH5L 4XP1H 4G5ZL 3FUFA 3VXME 4XTRD 3CLWA 3BSHA 3BZEB 1FF5A 5I8OL 2X1OA 4BXVA 1UZ6E 3RY5A 4M7LT 1TEYA 2HYMA 3GXPA 3NIFF 4KXDA 5F0LB 4M8VA 1QO3B 1B0RB 4HWUA 3QUKA 3BLKA 1P4IL 1GKEA 2WLHA 4UOZA 3D30A 4X83A 2W92A 4PG2C 1BPVA 3WHE1 2IPUK 2NY1B 3GEWB 1NFDF 4GAAA 1V27A 4F8QA 2YBRB 1RJYB 1CE1L 1EMTH 1U58A 5JR1H 1BGXL 4O51B 4Z23A 2VDQB 3O2DL 3HC0B 1I53A 1EJ6A 1KB5A 2FB4L 2IDSA 4H26B 4WO4D 3B7UX 5IBUG 1XH0A 4DQOH 2VKWA 4LIQE 4IMLB 2BJMH 1HI6B 1E4XH 1W8OA 3CXHJ 4N8CH 3UIZA 4G7QB 1FVCA 1EAJA 3CH1B 5T3XL 4H20H 1JCVA 1UM5L 3ECBA 3P30H 2I69A 3FFCD 3ZDZF 4NBZB 2QKIA 1FFOB 3IFLL 4RZKA 3ZQ9A 3QZBA 1KXVA 3FB7A 3S5LA 4B27A 4BE5A 3CVIL 3EDJA 1P4BH 4GG8A 4O00A 5ADOH 3T6QC 4OFDA 1F4XL 2GBVA 4WTZA 1G9NH 1SN5A 2K7QA 1UOVA 2J6EA 5GS0D 5EZLB 1O6SA 1XGPB 2CQVA 2P5ED 1YMME 5DLML 1VADA 2D3NA 4FQCH 3KCPB 1IC7H 3FFCA 1MAMH 3MNVA 3NBNA 3V6FB 3UAAA 5GS0H 3UJJL 3OQRA 1OGAD 4POUB 4KVPA 2WQVA 2XTJC 1N5AA 1QWHA 3IDIA 4LDOB 1K8DB 5EF0A 2A9BA 2VLMD 3P0VL 1NMAH 2F7PA 4HVBA 3B8YA 5L88H 4XP4H 3EJSA 4NNYA 1R24B 1T5KA 2BDNL 3MBXL 1IC7L 4QDGA 4V2BA 3SPVA 2VXQL 4EF3A 4Z76B 2R4SL 3QQNA 5GS0L 3WE6B 1LP9F 1CXIA 2DWEB 1DVTA 2M26A 3OMZA 4BZ1H 3JYCA 4NUJB 4D7PA 5DZJA 2GIXA 5AYUH 5IROC 2J7LA 4L0YA 1L9PA 4L3EA 2J8UA 4LSVH 2COQA 1RPUA 1VERA 3IJYA 3PJSB 4LOFA 4WU7B 4XPGH 3B6SA 4OQ1A 4HSCX 1QO3A 1FO0A 1RD6A 3U1QA 1GTFA 3LQMA 3V52H 3MLVH 4P5KB 3SDDC 3GSNL 2R4SH 1OGAB 2K4WA 3IU4H 1OTUC 2V5MA 3PWJB 4OIIH 4P9ML 1QFUH 3RVTC 4K3GA 5CJ5A 4K8RH 4ZTEA 1NCUA 3VQ2C 3U0PA 5ICZB 1G9MC 4UF7C 5I9QC 3M86A 4XHJD 5TDNA 5EU5A 2OR7A 3JTSA 3O0LA 4BH7B 4AENB 4R4FH 3PP3K 2EABA 3AW5A 1NDTA 3QEUA 5I76B 2EH8L 4KI5D 2A83B 5F9OL 3BQVA 3H4FA 4XI5D 4GMTH 4GINA 5KSBA 2NY3B 3HC4H 4PM1A 1RZQA 3EH3B 4KUCF 2V17H 1B88A 3D48R 3S36L 3RZCB 2YD9A 4H25A 1GJUA 1CB4A 5C0DA 2HX8A 3IJSB 4BWUA 3LEVL 2SEBA 5I1IL 3D2UA 4ZX4A 1HJBC 1CQYA 1F00I 3STLB 2YJLA 5I6XC 3CGTA 4H1LA 2WTRA 3HJEA 4P57A 1MJ7H 5GRVK 4PLOB 3KLLA 1TZIB 1BXUA 2IWGA 1AHWA 1LE9B 3SKMA 2HT2D 2OMWB 3MZGB 4CA4A 4PJIA 1IFRA 5HPMB 3OPZL 4CADA 3PNWB 3NZ8B 4MXQD 1IBFA 2ZYHA 3H9SA 1E7VA 4JM2B 4BK5C 3RTQC 1NBZB 3ZKND 2EVHA 4AIZA 3T2LA 3MRKA 1BEYH 2G3XA 3VXSB 3VRLF 5KVGL 3V6FA 1IIIA 5HYJA 2MNJB 3B5TA 3O11A 4PJBF 1E0OB 3EJCA 3CSYA 5JIKA 3GXIA 1GHFH 1SDDA 2Y1VA 2WPGA 2ZXWB 3OPZH 3HG0A 1L7TH 1NPJA 1MXDA 3BESR 3HRZC 1RIHL 2F1AA 4QCIA 2PCPA 1U8JB 4X8GA 1GZPA 4R3SA 4WZ9A 4XX5A 3FZUC 1OQXA 5KVMC 4BUHA 1ZXKA 2YK1H 4KQ4L 4O58L 4G8GA 4FZ8L 4BZ2H 1ZLUH 1U8NA 1JZ4A 2VWEC 3M46A 2EDBA 2APFA 4A39A 1N6QH 1GHFL 5ERWB 4A04A 1HQRB 4HZLA 3POCA 5HI5D 5LJYH 1WFMA 4P07A 2HT3D 2APSA 2FWOA 4Z95L 4EQ2A 4O2FA 3HI5L 1NLDH 2YD2A 1NPNA 1X7QB 1A7QH 1AR1C 1IGFL 1P7QD 3HUJF 1IAIL 3U9PH 1CXLA 2FX9L 2K9UA 4WWKD 4Z7OE 4FCAA 2APBA 4NQQA 4N24A 1U2YA 5H4YA 2Q6WA 3C5ZD 1MW3A 3X3FL 5ALCL 4D7BA 3ZKMC 2ZP8A 3HN3A 4TKWA 4M1GL 3VU2A 4LT7A 4ZUTA 2X41A 2CGZA 3S7GA 3BSGA 3FAWA 4KQ3L 4LAQL 3V9CA 2YSSB 1VEOA 5IB5A 3QPQD 3Q44A 3SDAD 3QC5X 4GG6F 3PPEA 3V7AE 3PAUA 3EF4A 4OGYH 2AAAA 3EGXB 4JRXA 3F5WB 3HE6D 3DRTB 1BZOA 2HJKB 5IB1A 1OXYA 4P57B 4WJ5A 3MJ9H 5CINH 4G7YL 4PRAB 1MLCB 4N22A 2R1WA 4FAAB 5KN5A 1ND0B 4P5TC 4ANUA 4K15A 3S96B 4AE0A 1NINA 1CGSH 4JVPA 1AXTH 2XXFA 1YNKL 4FHKA 3SQRA 3NZ8A 2OJEB 4JCWA 1KN4H 5I9QB 1S8DB 5I66B 3ME0B 1U3YA 2VIRB 5KOMC 5IOPB 1RUKL 3VI4A 2QELA 3QEQA 4NOBA 1NCTA 2YEZA 3FN0L 3WGVB 3OAZK 2XV0A 4RAVB 3ATFA 1CLOL 3ZDXE 2X70B 3O4LB 3ZDYF 1F3DH 2LR4A 2OKMA 2CLZB 3BPCA 3I2CL 5CILH 4XVUC 5T1LB 3GSNB 2K7PA 1WPCA 1AYOA 5L4IA 2DLGA 2PCPB 4E9XA 3HI6H 2V5YA 4P4KC 5B38A 3P11H 5CSGA 2ZG2A 1ZANH 2WBKA 2JI2A 1DZ0A 4EPSA 4LEXL 1BX2A 3HMWH 3OB0K 4N2MA 3T8VA 3U7WL 3NRPA 4UU9B 3QUXD 5D2LB 2F8XC 1XO8A 4QJ3B 2F53D 1MCQA 1KG0A 3VXPA 1RKRA 3L1EA 3QUMA 1ZTXL 1CE6A 1BLNA 2EXWD 5BW7C 4LLDB 1XWVA 1MWAH 3HI6L 2GSGA 3GSWB 1ZTXE 1GY2A 1F3RB 3SGKA 1ROWA 3II1A 3N42F 2BIPA 3DIVA 3TFKC 3SE9L 3CXFA 4QXGH 2G3ZA 1UB6B 4MA3B 5AYQA 3EH1A 1UQSB 4YEFA 3HBGA 2WMPB 2E74C 1IU1A 1I3UA 3L3OC 2CDEB 4UTCA 1G7LB 3A23A 1LDPH 1N19A 4PJBA 3KYOB 5JW5B 2XWJA 2NY4C 4X6DF 1X9RA 1P4UA 2CIKB 4L1HA 2XPGA 3MUUA 3AMLA 4EKXA 1NL0H 2DM7A 4G5AA 2YSSA 5IB5B 3HG4A 3QXVA 2OMVA 2YA0A 2DM3A 4DO6A 2OMNA 5C2BL 5HI3D 3V6ZA 4AIOA 1OTUD 1J7VR 2A77L 3HE6A 3QPQC 3IGLA 1KBBA 4Q6IB 4MQ7B 3SO3B 3ET9F 1GZHA 3QPXH 4NAMA 1WFTA 3RUGB 3B5HA 2Z9TA 2B59B 1E5AA 5IVXA 3S8FB 1IFHL 2H4EA 4MX7A 2AGJH 1MAKA 3HE6C 4HIXH 5D7KE 1JHLL 3AU1A 4G9FD 4S1DC 3WAJA 4BXSV 3LN4A 3VSUA 4J39A 2CCWA 4E41A 4Z77A 1A4KB 2BW5A 4DCQA 3FTUA 1G7QB 1UASA 1VJSA 1YJDH 3QPXL 4YR6A 1TR7A 4IMKA 2ESVE 2X0UA 3HZKB 4QHNB 3W3BA 1G7IA 2O61B 4UILH 4KQ3H 1VACB 1WAPA 5DI8B 3U83A 5A2BA 1HHJB 2ZNXA 3IDGA 5A7BA 5C9JB 3S3PA 4LFHD 5D8JL 1S9WA 4ZUWA 4JAMA 4Y8AA 1PCSA 2X6BA 1CTOA 1E3XA 3QZPA 5HHVH 2IOOA 3QHFH 4QRTA 1E9PB 3VWKC 1OPOA 4IKJA 5DEFB 1CFTA 4GAGL 1A6WL 1KF9B 2ERJC 3CDYA 5IMKA 4MYPA 2MNUA 4PJAE 2OSWA 3S3BB 1X5XA 3H4HA 3RVWC 3B37A 4M29A 1T0OA 2FJSA 1G7JA 1Z2KA 2ICEC 3BKMH 2LABA 2VH5H 5DUML 1HXMB 2WQUA 4FG4A 3ML8A 4C57C 1LTXA 5G55A 5CIPA 4F1SA 2XWRA 2JF1A 4IOFD 4WY7L 1SOQA 3OKNB 5TFSH 2KLRA 2QTEA 5D1QE 4XCNB 1PEZA 4PLKC 1G5AA 4APQB 5E9DA 4G80A 4JFED 3T3PE 3WELA 2XG5B 4L1LA 2EQDA 2E9JA 4GP5B 5T5NF 3DJRA 1FL6A 2JMRA 5AVWB 3NDYE 2XNAA 3FU5A 3KPQA 5IROD 3L4ZA 5CILL 2ZXEB 2AV7B 1ESOA 1XSOA 1ZHBB 3CHRA 4RMBA 2E76C 4ZMVA 5BQDA 7CGTA 2WQWA 4TLKA 2F74A 4AM0A 1L0PA 2D03H 2WIIA 4OCMC 4ODHH 1F2QA 2UWEF 4TL4A 4Y1AA 5TH2B 1DBMH 3S3SA 3V5DB 1L6ZA 5GRWA 4A2LA 5H35B 4ONHA 4I1PA 4I0PD 2VLJE 5HGHA 2DQMA 5BV7C 4LLWA 3O6FC 1AH1A 1OAQH 3V4LA 1XMEB 1W0VB 4WSGA 3Q2LA 4MCZB 1RUQH 1RIUL 2AQSA 2B59A 4PV8A 2CBMA 2VZOA 2FT6A 3HHRB 4B9KC 3O6ML 1S7RB 5I1LB 4P06A 1DBML 3U6XA 4OZIB 3MR9B 3BEWB 4JMXA 2Q0ZX 3HLAB 3CUPB 3IU3A 4JQXA 3K4AA 1UXWB 3ZYJA 3OR7A 3PPSA 1WAEA 3QA3A 2OYLA 4TQIA 1PZAA 1I9JL 3QIBB 1R3HA 5F7DA 5DC4B 3O3UN 4O51A 35C8L 3AY4A 4ZAKB 3WEOA 1JK9B 1BZQK 2DH2A 2BNRE 3KWWB 3LYRA 4YIQB 5E8NA 3TS8A 2V2TA 3MRDB 3O6MH 1WTGT 4HS6A 5JORA 2X1XR 4ZYKA 2L7JA 3OKMA 4KPHH 5CP7B 2O6PA 5DEFA 3VFPA 3T77A 2ADGB 4HAKA 4YNYB 4NPKA 3ZY7A 1F6LL 2B9AA 5ESAA 35C8H 4NSKB 1HHHB 2ZOTA 4XMKL 4XC1H 3SKUD 3TVMC 4E9YA 4MMXA 1NCGA 4PGDB 5IB4B 5J12B 3N41F 4ACPA 4Z78B 4Y9EA 3ZDXF 4NKMB 1ULVA 1E8XA 3KXFB 3MOAL 4G6JH 5AUMA 5JHBA 4HS3A 4BK4A 1HE7A 3W1ZA 3J27A 4UILL 4ICWA 2CZNA 3C9NA 4MCYA 2Z64C 1DUYB 4S11A 4GI8A 3BUDA 2IMNA 3E2HB 4FI7A 3PWLB 2X4RA 4J3OC 5I8OH 1COBA 3LD8C 5EUKB 5EUOA 1K5NB 1AD0A 1Q9LA 2IGLA 5B1CA 4YHNB 5JW3L 3MXWL 3DO7A 1D7DA 1HDMB 4M7LH 4OLXL 1AIFB 1EDQA 1RZFH 1KGIA 4F37F 5I5MA 4KY1H 4NWUL 1ZA6A 2A0LD 4PVNA 4K7PH 3FDWA 1AZBA 4MS6A 3CFKA 3WE6A 1ILSA 4U2YA 5FKPB 1YEJH 4N26A 3WXVH 2XIDA 5EWIL 1CE1H 5IGXH 5D9SA 3ARFD 2W9EH 4HG4J 2X4OA 3NABH 4OFYD 5DJ8B 4F2MA 5T33L 3VSTA 2K6WA 5CZRA 1YAZA 1OGSA 4OUUB 2YGNA 3BCDA 5IQOA 3NJJA 1H3XA 1FIEA 2W9LA 4W6WB 4YDNA 4GQ9H 2HN7B 1P5VB 4HWBH 3HCVA 2C4FT 2OA9A 4TNWK 1LO5B 4ZFQA 3FQXA 4PWJA 2HG5A 4ZOAA 2OJ1A 5DJCB 4S2SA 2I24N 2G0LA 2WKOA 4IJ3B 4O2CA 3VFPB 1QLFA 2IH8A 5L2KB 4H8WC 3FOMB 3QHZH 4XCEB 1RIUH 4AEHH 2AANA 3V0IA 2N7BA 1VFAA 3F7VB 5F97E 2F53B 3GXDA 4NC0B 3TEXA 1YVLA 3QUXB 4X4MA 3ARGD 5D1QA 1LNUA 32C2B 2G5UA 3D25B 4PGDA 3QFDA 3L1GA 2FX7H 4JO1L 2IBZX 5T1MA 1WRFA 3WFZA 4Y5VA 4BCYA 1DN0A 4M61B 1T03L 2DQEH 5HYSB 5FGCE 5A16A 4KTDH 2GC4C 3FTXA 3K2KA 4CVWA 2BW4A 3TESA 2FO4A 2OTPA 3O4LD 4TM9A 1A7OL 4AYDC 3GBML 2BFGA 1CD1B 2YRBA 1QFWL 3MLSH 1PD6A 3Q01A 3UX9B 4OIAA 1NLBH 5FOJA 4IOFC 2H3KA 3WEXB 4CMHB 3OR6A 4KRNA 2J5LB 5K93A 2DAVA 2HX9A 2GBTA 1RIVH 4HWZB 4PJ9B 5IW3A 3WNPA 2WXRA 3A5VA 4NRXB 3MLVL 1RMFL 1ZA6B 3S8GB 4OIIL 4B5ZA 1TMQA 4XMWA 3C08L 2L8AA 2DLIA 5JHLH 2A0LC 4MZ3A 3L3DB 2OULB 1QLRA 1QI5A 4NKIH 3WNIA 1ZVSA 3FOLA 4E41E 4N2LA 2FBRA 4S10A 2W88A 2BP0B 3K4ZA 1WCBB 1MQKL 2F6AA 3MV7A 3WO4C 1F11A 3FB7B 3LXBA 1MEXL 5JLZA 2P46B 3ZE0E 4J3OG 1UOKA 4KK9C 1GGIL 4I0PC 3C08H 4FULA 3VYPA 5KVEH 1LD9A 1XEDA 3MJ8A 2E59A 3GSRA 3NIFB 5E2WH 5KJRH 3TN0C 1NGPH 4JO2L 5EB9A 3BHBA 4UTBH 5BS0B 5GRXG 5J13B 1RJLA 1BMZA 4OGAD 3MUJA 2N3JA 1OLZA 3QRBA 1QMUA 4FQLL 4KHXL 5C0AD 1URIA 3PXHA 4JKPH 1GMEA 2DS4A 4EQ3A 3ATAA 2IJ0C 1MCBA 1QSFE 1H3PH 3MLUL 4WO0A 3A6CH 5I2IA 3C09C 3MCLH 3WI9A 5AZ2H 4PJBE 3L3OB 2Z91A 4WUKH 4QRQA 5K69A 4X0KB 5ETUB 5L2KA 5B22A 1AGFA 3VXRD 4ONFL 3QAZC 1K4CB 4UTBL 3T2NH 5LG6A 3QGVA 3N1MC 5I75C 4JO3L 1DFXA 4F58L 1IO4C 1FZOA 3SQBA 4XN7A 1RJZA 4WI0A 1ND0A 2VABB 5KYWB 4XVJL 1BVNP 1XZ0B 2M2DA 1NM4A 2ED8A 1TPXC 5CBEA 1RIHH 2QDWA 3NGBC 2WZPA 5TJWK 1I8MA 4KJYA 4FA6A 1CZ8L 1EGJA 3EBIA 4Z7VF 5B3JE 4K9EC 5IV2B 2KLSA 5I1JL 3QI9A 2EP6A 4F2EA 2EH7H 4BHUI 4XRCA 3IDYC 5IW6B 1QWNA 2Z3FA 4F7PA 1F4WL 3O2DA 3WFEL 3KPRB 1GOFA 4MDJA 3S35L 1NSNH 5B7EA 3VXSD 1JTOA 3C5XA 5MP6L 3NCBB 3W9EA 2GK0A 1ETA1 4H8HA 1HSAA 4L5FE 2WBXA 5JNYA 4IBQA 3TZVA 1N9PA 1WT5A 2YD5A 1ODAA 2J1WA 3PP4H 4TXVB 5C08B 5IMLB 1F3JA 2A83A 4YHZH 5CFHA 1QNZL 3DSNB 4N9GA 4IOSD 5IHUH 3SDYH 4A7GA 3QIBD 3MC0A 4F37K 3WYRA 4DN3H 2I25N 3RZCA 3MFFA 4K5PA 2GJ6B 4HC1L 4Z7UE 3MV8A 5J3HC 3ZZLA 4UAOC 4Y19E 2Y5TA 5T3XD 5DLMH 1CQKA 5FK9B 2I9TA 4MMYB 5HDQH 1MAML 2ZG3A 3L5JA 1KJ2H 3DTXB 4ZO8A 1C5DA 2JK5A 4ERSL 2G9KA 3TP4A 5B7FA 1SUJA 4XTRC 3MV11 3J2PA 4DN3L 1N6QL 2APTA 2OX5A 4H8QA 4JZJA 5KS9A 4CMHC 2B3RA 4M3HA 3CDGB 4ISVA 2B0SH 3V6OA 4FABH 2XWJB 1Y6KR 1A14H 1F42A 2BSDA 2Y6TE 2MPVA 3UDWA 3QQ3B 3L4YA 5FYLL 2CJSA 2WVTA 4L29B 3P9MB 4HQQL 5TE6H 5EO9A 3LS4L 4NFBA 1KMGA 2HT3C 3VD1A 1OT2A 3BEVA 5F7MC 1NGXB 2VTFA 3WFHA 3BAWA 4G70B 3RUGA 4UQ2A 4H2CA 1GZPB 1EGJL 2K9FB 4PWHA 1OO2A 2EKSB 5DUJA 4OCNC 3EYOA 3D8MA 3FN0H 3N91A 3NZUA 4HUWA 4QXTA 1YYMH 1XF4B 4X8JA 1B6DA 4UYQA 4IBUA 3O45B 2Q7NA 3T3PB 2EACA 2PW2A 3T2PA 4ICXA 1BCIA 2Y3NA 5GGQH 3MV9A 5JPNA 3U2SA 4I85A 3V5HB 1JV2A 1BJMA 3PYCA 4HV8A 2Q10A 1GYCA 5DI8A 2WINB 1D6VL 1FE8H 1I8IA 4N87A 1G6RL 2PETA 1FVDB 4LSRL 1XIWB 3LPWA 4L8DA 4ODTH 1OD7A 3QDMB 1H5BA 5DS1A 4JRLA 1WA1X 4JDVA 5CBAB 4JY5L 4HCRH 4U7KA 1MCNA 1UH3A 3EYSL 2VISB 2ZX6A 2A9ML 2B5IC 5LHDA 2R15A 4F7TB 4FN0A 4KKNA 1MCLA 3UTSB 2ERJB 2CHNA 4P49A 3LHAA 4PJ5D 1ZWIB 4JO5A 1MFBH 5KBKA 3K71A 4DKAA 4Y2NA 3FSAA 5E6YA 2P8PA 1TQWA 2WYTA 5LNEA 3NPSC 4YSUA 3P40A 3F5WA 4XR8C 3W57A 1U0QA 1FJ1A 2QLYA 4EDXA 1U21A 2DL9A 2H1LM 3MRIA 4JFXA 4LHJB 3OJDB 2ZAIA 5I6XB 2YQ3A 4MNGB 1BG9A 3KGTA 1IC5L 5DD5H 5A2CA 5IVZA 3ZYZA 1AR1D 5DD6A 5IF0A 4DNLA 2FSEB 4OCSH 2OX5B 2B7DT 5KS9B 1PTZA 3OKDA 4N3TA 2CGRH 3RPIB 1TLKA 1DR9A 4P04A 3IMUA 4RIRB 5H2BA 5C7XH 2G2PA 1H6TA 4JFVA 5D2NE 2KS0A 2V7HA 5J4MA 1HOCA 2IAMA 5IOPA 5F8RC 3QR0A 3KDPB 3VRJA 3KYMA 1E2VA 2E8YA 1I8LC 3MMEB 4LLWB 3GSQA 3MN8A 4V1DB 4PJIF 1RZ7L 1T6VN 4Y2DC 4Z7VE 5E94A 2FR4B 1L5GA 4BRVA 4YE4L 2R29A 2AP2A 2XWTA 2N01B 3ARDB 1CVRA 3KNBA 4HKBB 2I85A 2IAMC 1IGFH 1A5FH 1O9ZA 1XQ4A 2YN5A 1I8UA 1KDIA 3UOAB 5I16B 4I3SH 3BYTA 3IDNA 4GRLB 4IEFA 4WEUD 4X8CA 2CLVB 1QI3A 4OD3L 1QFPA 1UD5A 3LVEA 1N59A 1A6WH 3K1DA 1RZ7H 3QUMH 1IARB 3N1QC 5L2KE 3B3IB 3J8F7 2LFEA 1E6OH 1BLNB 3SY0B 2JLPA 1LXMA 3ELQA 2GJRA 4HGWA 3EYUL 4E5XB 4HQQH 2ZKYA 5IFAL 3ETBF 5AYTA 5IHZA 4OZIF 2AMUA 5DHXB 4HMEA 5DS8A 4OD3H 2XA8L 3LKRA 4XE5B 2NUPA 5FGCB 1QHQA 2BP3A 3NSFA 3GIZH 2OZNA 12E8H 3FQNA 3MGOB 4FLOA 3VMNA 4XAKE 3L3JA 4L4TD 5ESQB 4QHKI 5HHNB 1TNMA 2VMFA 2ID5A 3A21A 1JWSA 5DJXB 4OGQC 1BZ8A 1LK2A 2GJZB 5TE4H 4Q6IA 4YS4A 1XCTB 1MWAA 4MA7L 2XA8H 1JNNL 4W6XB 2GW5A 3HUJA 1T0NA 1XSIA 1ZGLB 5MEOA 2VMEA 2DTSA 3HNSH 3QEGL 1OAKL 4LLMB 4MX7B 1QVOB 4JO4L 1V8HA 1YECH 2Z31D 2FATH 4LPVA 5DUMH 1A6AB 2W1NA 5D96B 5EU7C 1SLUA 1XL4A 2VRQA 3QIBC 4L4TE 3KPSB 4L1BA 1PLBA 9PCYA 3PWLA 3B2XA 5MI0C 2VQ1B 5D55A 1CFSB 4LRIC 3T0AA 2HUEA 4DCQB 1VEMA 2H26A 2VDPL 3ZTNH 2VXSL 2WXFA 5EBLB 1MI5A 1T6BX 1MNUL 1KYOK 2CO3A 3I9AA 2NY4D 3ZRFC 1J87A 1UM4L 2R2EB 3HNSL 4GQPH 2PPFA 4DGVL 2XYCA 3MRRA 4Z7OB 5HVWA 4CSSA 2MQ0A 4WI5A 3HE7D 4LIQL 4RH4A 1BAGA 3E1F1 1IGYB 3TIDB 1W72A 5ITBL 1QFOA 3HZVA 4LRNH 4DAGH 2E7DA 1IKFL 4PJXF 3FFOA 1XF3B 1MCSA 2EYRA 3MI6A 2UX6A 2D31B 1E5YA 3QFGA 3M1BB 4F57H 1AGBA 3CPUA 1DVFC 3TJEL 1T1XB 2E27L 1K6QL 5E4EC 1PYWB 3UDWC 1RLBA 4LKXA 1FV1A 5DWPA 1HHGA 5E8PB 2DWXA 3RWFA 3BP7B 3TNNB 3V6OC 3ULUC 3PFQA 2OSLA 4NZUH 5EIQA 1J0KA 2IANE 4PVMA 4BQCA 3HFFA 3B9KD 4TQPA 1AP2B 2VR7A 4MJ5B 5G4OA 1DP0A 4P5RA 4IHOB 2HG5B 5JDSB 3VTAA 3LXUX 3W2DL 4DP7X 4IIQC 2Z7UA 4Z1PA 4Y1AD 3D7PA 1MRCH 1SXZA 2R9HD 4QRUB 5DVNA 2J1YA 1IEBA 5IB3A 3GXFA 4ANWA 1CLVA 1JGLL 3AQXA 3QO1A 2ZXAA 1HFUA 5C0AE 5L0QB 4LVNC 1KGYE 2WUCL 3TNMA 1TG8A 5KYYB 2PTTB 1BAWA 4LSDA 5CD3B 2ZWNA 1KYUA 3KPMB 4TRPH 2F74B 4B9ZA 2TRYA 3I6GB 1M7XA 3L4UA 3K2IA 4NNXB 3O8XB 1MFCH 2BY0A 3DX1A 4TLTA 1XXDC 4JM2D 5IHHA 3KCWA 2R2BA 2BHYA 3H3PH 1TQTA 2VLRA 3V5KB 1U6AL 4P4KD 3V4PL 2WUCH 2FEEI 3GSVB 3L7EB 5T5FA 3CFEA 4M6NH 2EC9T 3SYAA 1XH1A 2CM6A 4PJGA 4U1SA 2VOTA 4J3BA 1HZKA 4W9FC 3M8OH 4KJQD 4GRMA 3A47A 3FONB 4D0BB 1EPFA 3MTRA 5EWIH 1L3NA 4OU3A 2W9EL 3QIBA 5F7DB 5A6LA 1JZ3A 1JZ5A 4QJ4B 3AB0B 3EOTL 4X4XA 5IVXF 2FWLB 1C8PA 1JDAA 3EJTA 1DVUA 4FXKB 1NBVH 2WD0A 2WLJA 4YJZL 1G6VK 2GIYA 2NDGA 2JKNA 4RCAA 1IGYA 1AFVL 2FIKA 3RVUD 2J12B 2CO6A 1MJ8L 5KTEH 4AKQA 1QR4A 2ENQA 3P73B 5SX4H 4B9IA 1VKXA 4IHBA 3WNMA 1CXEA 3MLWH 4EOWL 4G43A 5CLTA 5EA0H 3O41B 3MKGA 1HHHA 2BC4B 1PLAA 3N9GL 5D4QA 3WS6A 2Y0SA 4GW1A 3FTVA 3U48A 2AJYH 4LL9A 1H3UA 3DDFA 2D7PA 3AC0A 3V9FA 4JFQB 3IXTB 4JM4L 3B4NA 3OC5A 3AU0A 2WLYA 3QJUB 3VJ6B 1FP5A 3MJ6A 4KHTL 3CK0H 5J13C 4NRZA 4DPRA 3INUL 3IAGC 4X5PA 1IM3A 5LWYL 3WGUB 5D6CB 3LEXA 4X7TA 4YHOH 2CJTA 5F9WC 1ZHKB 4R8WL 3IFNH 1BVKB 1F4XH 2CKBB 3QORB 4JO1H 1GVIA 3K80A 4ZNCD 5AWNL 4F7EA 1SEQH 4IGBD 5C08E 5I1GH 5J06A 4I5BB 2JJTC 3D34A 3BW9B 4GQ9L 1AO7A 1T5WA 4I18B 4LRNL 5FUOL 3UAJC 3BVTA 1B4TA 4J3OF 4FFVD 5IB2B 4QT5A 4QRRE 3FH5A 5J6GA 1A7OH 2R2CA 1JSYA 4YPJA 4Y19B 2VABA 2NSMA 2R1XB 2FQEA 4NP9A 2WTPA 3WY3A 2EYTB 1HX0A 2CIIA 5ABDE 4G8FB 2WXHA 4Y2DA 1INEH 1HILA 4JG5A 4PJDB 5G5DA 5CGBA 3R06B 2XSKA 1XGRA 1ASQA 4OZHB 4CKVX 4N90D 4LOUD 2OZ4H 4QGTA 1UWXK 3LNHA 3PQYD 2VW4A 4X9GA 3RHWF 3EJJX 3A4EA 4ZTPH 3BDBA 4M5YL 1X9QA 4PJ5A 3F58L 3T0EE 3AXLA 3Q8BA 2X7LA 4PD4K 1N64H 4CC1A 3MRJA 1YY8A 3Q6GH 2HPOA 3ECVA 1B0GB 1Z5LA 3IWUA 5D71L 1OAXH 1KEGL 3DDGA 4UT9L 1BA9A 3BXNA 5D1QC 5G2NA 5D7IB 1YEKL 1PKQE 3QEQD 1FZMB 2ATAA 1RZGB 3FFDA 2A4EA 4N0CD 3MFFB 3ECBB 3UTTA 3BWAB 1TJHL 5AB0A 1ZT7B 5F9OH 4I89A 1RZJC 1FPTH 2J8UF 4N68A 1WWAX 1Z3GL 5F0PB 3U0TA 3KXFE 3NIGF 3MLUH 3AXHA 3LPPA 3TWCL 4BFBD 2UWEE 3LRMA 5JXED 5BVPH 1MRDL 3A3YB 1KV7A 4HJ0C 3RX7A 4F1ZA 1NIFA 3ARWA 2CWRA 1FNFA 4MAYA 4QXUL 2HX7A 1TJGH 2QL1A 1N8OE 1ECYA 2XKNA 4AK1A 1G7PA 4V1DE 3BPNC 4X4ZA 2HWZH 1ROCA 2XDHA 1QSEA 5HVFB 3V4VH 3QDJD 2WWKO 4KY1L 4NWUH 4ODSH 2UZXA 4DJMA 4R7LA 2EIEA 3BKCH 3CU1A 4JCLA 2YOAA 1NGZA 2P49B 5KSBF 5EU4B 3DUUB 3IKCA 4KDTA 3TBBA 1A21A 3FT1A 1CGWA 1JZ8A 4JFPB 5EZIL 2IPTL 3D3VD 1DE4B 5ANMA 5I82A 4HPHA 2P28B 4N8VA 4FNRA 1SMDA 5EH1A 5C09A 2AXFA 4M00A 1XAKA 1HESA 1ZY9A 3AG4B 5EA0L 2ODHA 4IK6A 2DZEA 1H3TA 1BVLA 3T3ME 4JHWL 5SWZA 1RERA 4AL8L 1B4JL 4Q9QH 2R9HC 2I5YL 3ZRSA 4PJAF 5CJOH 1L7TL 2G0KA 5T5NG 3UBFA 4RFNB 4U1GC 1E9QA 5EZIH 2P7TA 1J5DA 1UJ3C 1D7CA 1ZK9A 4DOHB 3ARDC 3BJ91 1OZTG 1A3LH 3OHXB 4AKOA 1VHPA 3INUH 1FO0B 4E9RA 5T3ZD 3PUUA 4MNQB 4KI1A 1HEZB 4LLQA 5F9WB 2ADJA 5GGRA 1UOWA 3QO0A 3RTLA 3OB8A 4FNLL 4G1EB 4DSYA 4ZAKC 1RPKA 1BFTA 2HVKB 3GSRB 2CG9X 5BV7L 1IC4H 1SYSB 3Q2CA 1GA2A 2OMTA 1JN6B 1DQDH 1MLBB 1CZ8H 3LNIA 4NZRL 3HFMH 4OIBA 1BFOB 3VNZA 2HH0L 1JGEB 5HHME 4PWIA 2JJVA 4I0CC 1ZVYA 4PJ9D 2UY6A 2DI7A 3U7AA 3WTUA 3LQAC 2DQIL 3GJFB 2WQ8A 3G5XB 3WUZA 4ESKA 5EFIA 5DMIH 4OZIE 2YZ8A 2F0CA 3NCEB 3VE0B 3AITA 4FABL 1FSKB 4NT6A 3PWPD 3UTTB 4KTDL 1DQMH 3TA3A 7FABL 4FQCL 4AYFB 3RX8A 3HI1B 1FVEB 1T7WA 1YEDB 4HT1H 5E2UH 4AMKL 4F7CA 2GFBA 4Y5YC 5JHDA 4G9DA 5EC2B 4YFLI 3MLTB 5CU9A 2WP3O 4MNGA 1J9SA 3EXLA 1QNZH 3VQLA 5INDA 1KLGB 2O6DA 3SDYL 4X6DE 5I0WA 4Z7WA 5E1QA 3V0HA 4RA0C 2QSCL 4MKMA 2BSED 5I8EA 3QUZD 1UWXH 1OAYL 1N64L 3GBNL 3PWPB 4HC1H 1WFOA 2OYKA 5CEZL 4HX1A 4KAQL 1S9YB 2GBAA 1KIPA 4XP4L 2VO8A 1JF1A 3ULVF 4I48A 1XFPA 3MBXH 4G7YH 4AIZB 3VD5A 4YHIA 3FB8B 1NC4D 2YXWA 1IGJA 3FT4A 4X42A 3B1TA 3QNXA 1XH2A 3SPJA 2B5IB 5JIIA 2NSXA 1H19A 2W59A 5F89A 2V9UA 3NVQA 2PN5A 2QSCH 3QG7H 5DZNA 4WDIA 4HJ1A 2Y7SA 1NIEA 3MRLA 5F44A 2ISDA 2C7FA 1TJHH 2AXGA 1NANI 1KIRA 5C0CA 2ZXDA 1TSHA 4ZOBA 4RAHA 3ESVF 5C8JB 4R7NB 4WO4C 3ZHNA 4U3SA 3BFOA 5E1GA 3BD5A 5J11C 4K8RL 1TJGL 1LL1A 1XSJA 1WC7B 5BQ7B 1WBZA 4YXLL 2LLNA 1UZ6F 1WHOA 4FL4B 3SB3A 2CKBH 5FK9A 3UZEC 1CGYA 3VFGH 2F1EA 5F2FA 5JW4N 3WO4B 1YYML 2Y2TA 5AZ2L 2AEPL 2IFFL 3CVBA 3JV5A 3S3DB 1LILA 2Y1YA 2VYRE 1XGZA 3RWIB 1UEYA 3AUWB 3MJ9A 2EDNA 4GKNB 4PS3A 1HYRC 2NTFA 4LU5H 1CG9B 1UXSB 4MS8C 4ZD3L 1GKOA 3HNVH 5C0CE 3LH8A 4D9RE 2YSTA 1YPZA 1KB3A 5C86A 1JGEA 2OR8A 3MNVB 3RDTB 4BA8A 4Z7OF 5AG9A 3FRUB 4HKZA 1OGPA 3LQZA 4HKJB 2C1OA 5EFIB 4LVNB 3QDGE 5BUPA 1CL7H 3ZL4H 5BUGA 3KL0A 1RSFA 5JO5A 5FXCH 4UQ2B 5GJSL 3OLEA 1YEDA 2GAZA 4K23H 3VFRB 3D5OF 2F1BA 3QAZB 2AMGA 4MD0B 5KSAB 1HSBB 1U3HC 4YQXL 3KPNB 1B3JA 2XVKA 1DEEB 4N0UE 3M7FB 3VDCA 3P77B 1JZGA 1SY6A 3K7UA 1OCWL 1PCXA 1MFMA 2WGNB 2VDRL 3DYMA 3A0OA 2Y7QB 1KBWA 2AITA 3KPRE 3ZKMD 2BRRL 4FOMA 4IRJB 4HIXL 5JHDE 1WIOA 1F1GA 3NAAH 4GUCA 1AE6H 2WINA 1JFHA 4BQ8A 5HHOE 2IV9A 1EERB 3FT2A 1MFAL 3QIUB 4NM4L 4NRYB 3WFDH 3ESUF 2KLTA 3D06A 1OSPL 2C3WA 3OKKA 4ZSOA 2BOBA 1C1EL 1JI1A 3LNDA 4ONGH 4AWJC 5GRYA 1WEJH 5AVTB 4PJIE 2BNRD 1OWRM 2NX5D 4GSUA 3QCTL 3WKYA 2OMXA 1JTPA 1FYTD 1ADQH 2WJ5A 2A73B 4H8VA 4K2UH 1Z9NA 3PQYB 2H32B 2OCCB 3ZUCA 5LQBH 2RBLA 1XSKA 3FO2A 1ZV9A 1DQJA 2FEDD 3OC8A 4X7FC 2HXAA 5BQ7A 4QXWA 1XT5A 5LGKA 4YE4H 4F9LA 2NQDA 1NFDA 4MRBA 4BCZA 1PX8A 4OIFA 4HK0B 4I0PB 1CPUA 4PGJA 2X4QA 4WNJA 3LB6D 1X5ZA 4OAWB 5KVGE 3FO1B 3QISA 1WA2X 2AQTA 3BN9C 5MI0B 1BBDH 2W65B 4KTEH 1A65A 2D4DA 3DX2A 1AHWB 3FCGA 3IF1B 1LE9A 1QUNA 2P24A 5LQBL 4F7MB 3NMEA 3MGTB 1AMYA 3EDEA 2UY7B 1AMXA 5FX3A 5F7LB 4LKCA 3QZLA 2GTZA 1E8ZA 3G5VA 1M9WA 3Q48A 3VGEA 1N3NA 2EDLA 4O2EA 4JMNA 5LGHH 4YL4A 5F21B 3HR5B 1JPTL 3G08A 1BQSA 2BOCA 3C12A 1KGUA 3RBGA 5HHQA 4HHGA 4KTEL 5CN1A 4F92B 4FKEA 3I85A 1KELL 2CAKA 1SVCP 1YNKH 4RDQG 4N2EA 1W0WA 4P5MA 1FFTB 5GGQL 4FJ6A 4H1LH 4S0HA 5AW9B 1RUAL 2J1XA 2EXWC 3BT2H 3H0TB 3CFEB 3JV6A 3ZVVA 2HLAA 3UTQA 3JWOH 5B3JF 1KTRL 4QY8B 1AGEA 5C0BE 2Y9RT 3GMQB 3AU1B 1ZE3H 1RUPL 3NA9H 5EHFA 5M94B 2MTAA 4GRMB 3ILEA 5J6HB 2KI6A 3L5WB 2ZCKL 3REVB 3ZHLA 3UG3A 4H88H 1YNLL 4NFDA 4PWGA 3IDYB 1XHHA 3Q2VA 1N4XH 2MNWA 4LCYA 2D3VA 1YO4A 3GHBL 3FYIB 1TO5A 2E27H 1TFPA 4KNTA 3FHQA 4WFFE 3TEYA 2Y7NA 3D4CA 4J4PD 3CPLA 3N6YA 1MZYA 1YEGL 2LV4A 2PPDA 3FFCE 4JHAH 1NKRA 3TBYA 2L0DA 3RDTD 1TU2B 2Z31C 2JELL 3SOBH 4A67A 5ACZB 3SKOB 3JVGA 1Z9SB 4M8QB 3TVMA 1TTBA 2MWCA 3KLAB 5DFWH 2VR8A 1IC5H 5DVOA 1B0IA 3M17A 4ODVH 1MVUB 2R83A 2AXJA 3S36X 2OTWB 3FTSA 4WEBL 1TYJA 1UXMA 1EEZA 1QI4A 5GRZA 2WB1A 2HFFB 2D7TH 3IBOA 2O26U 1IM3B 1KFAL 5KVFE 1II4E 4APQA 3B3BA 1PKOA 2FE0A 2WGXA 4NOFA 4HCFA 3GT6A 1HL5A 1YEIH 4F93B 3LDBC 2QR0A 3BPNB 4F7EB 5A1AA 1OAUH 4NKQB 2D7NA 4KJPD 1RHHB 3NZSA 3QPKA 5ANME 4B50A 2JKJA 1IEHA 2R69L 1K3ZA 4I2XB 1IBYA 4UM9A 3DBXB 3VRLE 5J0BA 1N0XL 1GMIA 3EH4B 5DRNA 3I84A 5F1NB 2JKLA 1X7TA 4AYBA 4M6NL 4L8CB 5JW4Q 1OP3K 5IQ7L 3HS8A 4AQ1B 1JF6A 2YFNA 4DZBA 3LN9A 1CWVA 2EYTA 1V7NL 3VVVA 4HGMA 4TF4A 4Z7QF 2XTLA 1T66D 2ZXBA 4QYOB 4Z5RB 2VAAA 4UM8B 3FJTA 4BFOA 1WO2A 3MXVH 5KYUA 1NC4B 2R0LL 3H2WA 2PWGA 3JV0A 1EJOH 2B39A 1R5WB 3VXMA 4HOMA 2EYRB 1M6OB 3VDAA 1U8QB 3EYUH 3MPCA 1JI2A 4U6HA 3VXTA 4FP8H 4I13B 3TO4A 1YUKB 1IEAB 4P2RB 4NS0A 4PWFA 4D9RD 4WUUA 1MCOH 2WLLA 4PBDA 4Y88A 4D0CB 1Y18B 3OHXC 3C5JA 2DEWX 4HEPG 1U6AH 4NDMA 4X4ME 1F4AA 2HPTA 3AACA 4O5LL 1KJ2A 3AAZA 4LLDA 4LCVA 4J1UB 1YNTB 3DURB 1M7DA 1SDAB 1HKLH 4XOAA 4AH2A 5LGHL 4WEEA 4WTQA 3EO9H 2NY4B 4PGCB 5FM4A 3JWDH 4JM4H 3V0EA 3ILDA 4HWBL 5GSRA 2EIZB 4J4PC 1F45A 4QOKD 4Y7OC 4DETA 1GZQA 1MG2C 1FHGA 3JQOB 4R96A 4DT2A 2G5RA 3HA0A 1D9KA 4AV5A 1Z9SA 3BT2L 2PTTA 2H2SC 3NJXA 4NQDB 3NCJL 5AOJA 4EN3A 3O4OC 3D9AH 2OJZL 4PGZA 3E38A 4W9IC 3UFIA 3HE6B 4J27A 1E90A 2PO6A 2K1MA 3VWKA 3QHZL 4MNQD 1YEEH 1MJ8H 1JAEA 4Y5XA 1FNLA 1U3NA 4TV3A 5HDBF 3VD7A 2PWEA 5F7UA 4E0RA 2BVOB 3H9HB 4GP8B 5BO1H 1KPVA 2APWA 4PJ7A 3P3RA 2P8LA 3BP5A 1FN4B 1T2XA 3GHBH 4JQIA 4PJCE 5IEHA 5D7JA 1IGMH 2DQDL 2Y06L 4HYTB 2AEIT 1S9VB 2DTMH 2FO1A 1AO7E 2FEDC 4ANVA 3QJRB 1LO3L 3T6ZA 2NUTB 2JELH 3B7YA 4U0RC 2P45B 2ALAA 2NTSP 1FNEB 3F8UB 1A64A 4CAGA 1T1YB 4K9EL 4M5YH 4X7SH 3IFNL 5DXWA 2FBOJ 1IGML 2DQDH 3IVKA 2WLIA 3EO1B 3V55A 3WY2A 4WEBH 4XVSH 1PJWA 1S7XA 4O02A 1O7DC 1S78D 2I7OA 2P7TB 4RGOL 1CDIA 3N5AA 3TBWA 5HDLA 4MMZA 2OL3L 5D5MB 3VUAA 5KAQG 2HKHH 3TTYA 4GW1B 3WKML 1SHWA 3CVHL 1S7QA 3OHMB 4ZMTA 4XN9A 1OGTB 4WK2B 4Y4FA 3SO5A 1VFBB 3IJEB 4QRPB 3VRIB 3EJPA 2RJMA 5EC1B 3RJDA 4TNGA 2ZSVB 3E6HA 2NNAA 4PRHA 4R5TA 3VD3A 5DEGA 1KJ2B 3AAZB 4KVCL 4Z7VB 4PRIA 3WJJC 4HJGA 4XAKD 4JY6A 1MRDH 5BXFB 2OS7A 4JFFA 4IQHA 4ETQA 3PABB 3SYCA 5C0FA 3MOAH 1L9RA 4TQEH 3MBEB 3VG0H 2X05A 4NUPA 4GAJH 2NNCA 7PCYA 3DSFL 5DQ9A 3OSKA 5DD3L 5ID1A 4LPTA 2FSDA 4F7CB 5JHDB 5IB2A 1PX3A 2EEDA 2JJWA 3I74A 4M43L 3HBQA 4N0YH 5H94A 1GIGH 3SE3A 5BOPA 2VDKH 1YEKH 2WIIB 4FYTA 4FP8L 4X4YA 2OMBA 3QAQA 4DKTA 3NSYA 1NMCB 1NCJA 1A6TB 5GGSB 5DC0A 4BELD 4DPAX 1QRNB 3HOGA 1A4JA 3VX0A 1KBVA 4M03A 5DD3H 3F7PC 5CGYD 1N2RA 4AYSA 5ICYB 4P48A 4YFEA 3IMSA 1RUMH 5IEHB 1ZGLM 1BDYA 1FH5H 4WHYG 2UUDH 4A2HA 4TNFA 2GK2A 3HLAA 4LSTL 4W9EC 3U0WH 4K94L 4IGBC 4NO0A 2Y25A 2X7LB 4NC1C 4WDIB 1NEZG 5LBSH 3UXFA 3B9KC 4GRWB 5JIQA 1USZA 3HNTH 3UJTL 2QLVB 2G5BB 2TRHA 1MSPA 4RNRA 3KBFA 3T08A 1U93B 2AZUA 1XEUA 3BN9D 2XUWA 3N44F 3PJLA 3TV3H 5H37G 5CGMA 1NSNL 3D0LA 1S3KL 4X6BB 4AQAB 3AG1B 1IC4L 4JLRA 2F54B 4I4WB 3CZFA 3FOLB 3ZHDA 2CRYA 3RX5A 2PCFB 4EIBA 2E7CA 2WYHA 3WKQA 1E5UI 1NIBA 1ZT7A 2J1KA 3X3GL 1LQSR 3UBGA 2NXYD 5TDPB 1WAAE 4R8WH 5FYKD 5JLZB 3WV0A 1FI8C 3FQWA 3ARFA 1XB8A 1T66C 2VUKA 1LEIA 3VFMB 4TOYH 1WFNA 4FFYH 5F7WC 1T2JA 3UG5A 3ZBMA 2Q76A 3D1MC 1NGWA 5MENE 1I1AD 1CG9A 4TSCH 3VH8A 5FA4A 2E6PA 3A6BH 1W72L 3E2HC 4IMLA 4TMPA 5K9KA 2ZAGA 4JY6B 2WBJC 1BFVH 5BXFA 4AVHA 2F54D 2IOIA 2RH0A 3OAZH 4MJIE 2UXTA 3X1GA 3RKPA 4G6KH 3MA9H 4X5QA 4RX4D 3IMRA 3ES6B 4TOYL 1BXXA 2ZUVA 4XPHH 4GG8B 2Z1KA 1O5PA 4XWOC 3WJMA 1GYAA 3ZSSA 3X2QB 5D2NA 1U8HB 3D52A 3GQFA 4DVBB 1YSOA 4TQ8A 4ELKB 4JKMA 4ZTPL 2EUVA 2JV6A 3I3DA 4LARH 4L8BB 4B9CA 4MKTA 2HP4A 4B3EA 2NDFA 1G43A 1FC2D 4N8UA 4WSKA 3R4RA 3HUJE 3HIZA 2X3CA 3FFCB 4M6MH 4XMVA 3MA9L 3PAVA 4AGQA 2F7IA 2HVJA 5EIIB 4OQTA 1XB6A 3Q6GL 3IS0X 3VA6A 2Q2EB 1GC1H 5IHWA 5ISZE 4XGZA 2E7HA 3O2WL 4PSRA 4O9HH 2NZ9D 2LW3A 3TT3L 4XMLH 1SXCA 1ZDQA 3I9PA 1NGQH 1DN2A 5BNXD 1Q9KA 2KZKA 3UACA 2D73A 4PMFA 3HZYA 3KPLA 4YDIH 43CAB 1MCIA 1ZD6A 3VFTA 2WOBA 4OFKA 3TBCA 3VCLB 3WNNA 1SBSH 4XPGL 1Y1DA 1MQKH 4N1HB 2AJXL 3IFPB 1SEBB 1LGVA 1KTDA 1MF2L 1J0ZA 4S1RL 2Y1ZA 1P1VA 2DKUA 4QOKA 3ULSA 2OR9H 4YSPA 8FABA 3EYSH 4Q52A 4X9IA 3US1A 3TPUA 4DK6A 2AQ3A 4JFEE 4AZ8B 2OW7A 4JO2H 2IWKA 1NMCC 4KVNH 1IGTB 1CXKA 4HZ1A 4MNHA 4RVBA 4W4OA 3HNVL 5FS5A 1URZA 4QRRB 3ETBJ 3U0PB 2QT6A 3ZO0A 4QRPD 3K6OA 1HWWA 5C9KA 1HL8A 3WTVA 1N18A 2YRPA 3F2LA 4PEEA 2F7RA 5I76A 4B9PA 3WTWA 4QTHA 3ZYIA 3LEVH 2JJUA 2BSEA 1R3KB 3FKUS 3MGTA 1P84K 2VL5B 1DN0B 3Q43A 3B43A 2YPLE 3BKYL 4PB0L 4XNYH 3BUYB 4L0PB 3EZJB 5JYLA 2MQ3A 2WM0A 1J5HA 3PGCB 3VFGL 4QRSA 4FXGC 1RHFA 3CSFA 3EYVA 3TV3L 1HCFX 1AAJA 3TASA 5IW1A 3D2UB 3QJFB 3RVXD 4PJ9C 1TQBB 3WFBH 2I5YH 1ZLEA 2EILB 3MROB 5DR5L 5I6NA 1NFKA 2BWDA 3L3HB 3V0WL 1G6RB 1DDTA 2CGRL 2XU9A 4IOIB 2W80C 4P5MB 3K8MA 2NCMA 4D2NA 2NW3B 3MA7B 2Q8BH 4EMZA 4Z3HA 5HI5C 4LSPL 4GAYA 1W2KT 1DEDA 4PB0H 2Q5BA 2NRDA 3TO2B 3EADA 2NYZA 4HWZA 3D07A 1SJVA 3KYAA 2HTLC 2ZUXA 1CD9B 4WU5A 4RWYL 2DJUA 1UENA 3OAWA 4HBCH 1EAPB 4L9LB 5DURB 5E9AA 3KJ6H 5FWQA 3QQ4B 1X4XA 2IDCA 1Q9WA 2DWTA 1JYVA 5DJ6B 5DEJA 1EHLL 5DRZB 1WIUA 3M6DA 4LSPH 3P9LB 5DDHB 1KGCE 1O6TA 2F5BH 3MJGX 5FFOA 3TN0B 2NZ9C 2EAEA 3DMMB 4JHBA 1UKTA 2DRUA 4MBRA 4WNSA 3WN6A 4D3CH 5J57B 4HCGA 2X6MA 3QDMA 3ZE1B 4ZMWA 2OK0H 1FFNB 1FORH 1HNYA 2PP7A 2X0VA 3D39A 4FKKA 2TAAA 4FXTA 1G9ML 1H0DA 2E9GA 2R39A 3HI5H 1ZVNA 4Y4FD 1TMCB 2DD8H 1EHAA 2YAHA 3ZT6A 4HJUA 2H5UA 2EDKA 2VXUH 4X50A 5CLWA 3UABA 1AQKL 1EVUA 1KLFB 4Y7MA 5CSBA 4C4BA 5DF0A 4G7VL 3U30C 5L8LB 1A14L 2YPVA 1FJ1B 4TLUA 3MRPA 1UGKA 3T3MB 4MWFA 4BQ9A 3O6LH 3W0WB 5GZNC 5KUKA 3FTWA 4DPBX 1CU4H 4GW5B 4Y1SA 3MRMA 3RWJA 4I88A 1D5MB 1JVKA 1JZHA 1TXKA 3UCRA 1PLCA 5LBVA 1B4LA 1SHSA 2PXYD 2WCPA 3ARDD 5F1NA 1EGJH 4KJYB 4RIRA 4XT1C 1NAKH 4QRFA 2IADB 4MS8D 5JXEA 2AW2A 3OMAB 4YVUA 4QLWA 1XXFC 4F5CA 1T2QL 1KN2H 4M5TA 1HYSD 1U4EA 1NDGA 2R1WB 4YXLH 3GRWL 1E6JH 5FM5O 3O3EA 4JFFD 1CDGA 2GCYA 2ARJB 1FNGB 5FUZH 1P7BA 1J05B 2F8VA 1F97A 1A47A 3VYNA 2XV3A 4PRHD 1DANT 1YEGH 3AROA 4FQHB 3ZKQD 1RSYA 2VIRA 4JRYA 2DEXX 1XH3A 4PBWD 4L18A 2JVUA 4PJ8D 1UEMA 3DOSA 1TTAA 3MUHL 3PWNA 4NO3B 3X11A 1R3LA 5C71A 4H13C 2X70A 1G87A 5J5EA 1XBDA 1M7DB 5C6TL 1CN4A 3DMMA 4R7XA 1THCA 2PPCA 3FO1A 3WIIH 7TAAA 2J1ZA 3K6DA 1R33A 4JG9A 5D1XA 5LXGH 3W5MA 4PJXA 2JK5B 3VWJC 4HS8H 4XXDA 5DHVA 2K8MA 4YDJB 2P24B 3STBA 1NDMA 3P1VA 1QRNE 3EYQC 2MTPA 3EUUA 5TGBB 4W9HC 3X17A 3MKKA 3D39D 4HKXB 3VD0A 3ZRCC 3T0DA 3TA4D 1MHCB 3NJMA 1RJCA 3BGFB 3O4OB 5AOIA 2WB7A 5E8EB 3X12B 2ZXQA 4Y4KD 2PO6B 5AB9A 1XIWD 4EN3C 1E2WA 4WHCA 5IBUB 4BH8A 3F7LA 2R56L 3DXAA 3T4AA 1X5YA 1OGAE 3CBJB 1UCBH 2PPAA 2YD6A 2AK4D 5MENA 1XGUA 4BFKA 4H5SA 2VITB 1EHLH 2XACC 1WBXA 3DJ9A 4QF1A 1CFMA 3BWZA 5A2AA 3UTOA 3DVGA 3LMJH 4RMWA 3VVWA 4JZOB 1YC8A 1LP9E 4RETB 3HPLA 3CQPA 3TH3T 3ULUL 3V4PH 1BM3H 1WZ1L 4KI5C 2VC2H 3BQUC 2X3AA 2YEQA 2V2XB 4JO8A 2PXYC 4OLYH 1UCBL 1VIWA 4FEIA 4CU6A 4D94A 1I8IB 5I6KA 1X5HA 5EEUA 4PJEA 5IVXB 3T6XA 1AKJA 3KLDA 1ACYH 4XHQA 1HZHH 2J6WA 3IMVA 3EOTH 3FT0A 3K5SA 3VXUB 4O5LH 1UTDA 2FECL 3SBQA 3MNDA 3ZIYA 5E00A 2XX0A 3V79C 3L1OH 2WW8A 3TVMB 2TSBA 1JZ2A 5D8JH 3Q7JA 4ODWA 2FQGA 1M71B 3AUVA 4FQHA 1KB9J 4LRIA 2MCMA 1VFBA 2WXMA 4QRPA 2EDQA 4S1QL 5BZDB 1TNNA 4HAFA 4F8PA 5EBWA 5LN8A 3ULUF 3UC0H 5D1ZI 4UOJA 1UB5B 3EFDL 3NIDE 4N0UB 4NP4H 3VH8G 1K85A 3TLRA 3QC6X 2QDVA 3G6AA 4Z7UF 3RA7L 2YKLH 1I4FB 2VM3A 5DMKB 3ASNB 3MUZ1 3KLQA 1NCOA 5C08D 3RDTC 4NC1E 2VDQL 3GXMA 1GRWA 2H0JA 3DX7B 5E4OA 2EDYA 3EYQD 2F54E 5HHOB 5E6SB 5TF1H 4UQAA 4PUBL 3VB9A 2EECA 4W81A 1RH8A 2AK1H 1E42A 3CH8A 4UYPA 4HIJA 3BDYL 1IBGH 4LSUL 5AWNH 3SD2A 1Z7JA 3MRBA 4B5EA 4DO5A 3RA7H 5I30L 3K8LA 3UROR 3ZU8A 1E27A 4KKLC 4HSAC 4KO5A 5C0BB 3RFZC 3DVNA 1BMWA 5E6IB 3GM8A 5E94B 2FR4A 1SFDA 1WE5A 4F9PC 3SYOA 2D03L 3WLBA 4YSSA 2EO1A 4UBDC 3BFQG 3UC2A 2A6DB 4KMQA 3L95A 2VMCA 3PQYE 2D0FA 4PV1C 3TO4B 1UM6H 5TE7L 3TX4A 2OJZH 4RZCA 2ZX7A 1T20B 3AJ7A 5GGUA 3LIZL 4YDMA 4GFXA 4KJPC 5E99H 3QXDA 3BMVA 2VKXA 3QDGB 1QBAA 5HGHB 1ZHNA 4K7FB 4CSZA 3BQUA 3QWRA 3O6KH 1QYGH 1E4WH 1U41A 4FG6C 3CVHH 1X7QA 3N40P 4PS4H 1AD9A 3V4UL 2Z4TA 5CEZD 2F54A 3HPJA 1RV6X 1X4ZA 4YBQD 5J1TC 4PJFE 4A6YL 2Q6WB 3WS3B 1C9SA 1CIUA 3IRZA 3KGRA 3OAUL 2VDMB 3ARRA 4EUPH 4JPSA 2UYLA 3LPFA 4OCYH 1BQ5A 4G9FB 1G7JB 4CU7A 3GINA 3WU1A 1DBKH 2XVBA 4X6FA 5HHNA 1OAUL 1JGLH 3FCTB 3CMGA 4M02A 2NY0B 4UIKL 1IL1B 1KXHA 2K6ZA 2G30A 4S1SL 4U1NB 4M43H 1SXSA 5DZVA 4Q9RL 4ZPVA 3UBHA 1JXFA 2HTLD 1IC1A 3PREA 3KR3L 4DGWC 1CGTA 1QVOA 4OTXL 3CHOA 3S9DB 1F3DJ 1HOEA 1NCCL 2ORBH 4L37A 5FYLD 2Z7WA 4XNXH 2BY3A 5HJGA 2CDGB 3E1ZA 5AZEH 3CLEL 5IB4A 1H15A 1YN7B 3GZOA 2NXYB 4HIPA 4R5VA 1T5XB 4YSEA 4KVCH 4AQ8C 4LPCA 1WS8A 2VLJB 3GNML 3T3MF 4PRHE 1S5IL 3IVKB 1F4HA 3ZE0F 2YIHA 3CDZB 4RAVA 4XBEH 1RVFH 4WV1C 2QZQA 1FL5B 1K9TA 4KKLD 2ZKMX 1NBYA 2ENJA 4NZJA 1E4KA 2PKDA 4HGKC 3BRGC 2PR4H 2XG4B 4U1JA 5EUKA 3ULVL 2W0FB 5AAWA 1S7RA 1PFOA 4FD0A 4ZX6A 2MCPH 1ODUA 2A74C 4FTVA 4PP2B 5IVOA 1UYWL 1EO5A 3ATDA 3IJEA 2EXYD 3HLKA 1KCVL 1W0YT 3B8SA 1R3HB 4MJ6B 2G4EA 3NH7L 3ML9A 1ZHNB 2BVPB 2PNDA 4K7FA 4OF7A 4ONOA 2LTQC 1P7KB 3IDXH 4HJGB 3MACL 3ALXA 2NX5A 4DK5A 2AK1L 4FFZA 4GB9A 1SLVA 3IDJB 2H1PL 4LSTH 3G6JA 4YHKH 3PL6D 5GZNA 3WD5H 4JRWA 1UB6A 3C75A 2YAFA 3PIQB 3PV7A 4MNHB 3HNTL 3UJTH 5BO1L 4ZFGH 4PYHA 4WI4A 2DMHA 1M1XA 1OP9A 5IEKA 3CU7A 3L6FB 5SWSA 3TFBA 3CG8A 4LZKA 3MREA 2GKIA 5CD3A 3Q8FA 5F1IA 2H0FA 3OM3B 4K71B 3WNJA 4I0KA 4G6KL 5DMIL 3EOAA 5ICXA 1K4DA 5F6IB 1OAZH 1I1RA 2XKNB 1L7IL 1RK1B 2EDMA 2WWMC 4FQXB 7FABH 4PJHE 2MKLC 3MNWA 2KYIA 5J1AA 1P4IH 1SM3L 4P2QB 4PY7A 2NXZB 4J3VA 1A9EB 2EUWA 3VFUB 5E03A 1B2WH 2XVLA 2AQ1A 2F7QA 3CH1A 1QYGL 4JQVA 5T1KD 2YUWA 5E7FA 4R2GB 4M6ML 4KWUA 4B9JA 5IIEB 5IMMA 5J6SA 4XCYB 2PYEB 3CDCA 2J4WH 3LN4B 4OF6A 4R4BB 4IOIA 4PJEE 3N41B 2LLGA 3FC8A 4KX9A 4A6YH 3AS2A 4A7VA 3TYFB 3CVHA 2IWFA 4NI6A 4M7JL 3KGSA 2ZYIA 2EIBA 2VN5A 1P7QB 3PAYA 3D3VB 1CUOA 2UZIH 2HLEB 3FZUD 2OL3A 5HDOA 2FRGP 3WCYA 4ZUVA 2P8MB 1EFXA 2QADB 5EG6C 3BPOC 1I82A 4QRTB 2ZWLT 1RIVL 1OAXL 1RZ8B 5ADPH 4JGJA 1QW8A 4DZ8B 4K3EL 5CEXA 2B1HH 1G4MA 3PHOA 5I1CL 2WQAA 1JJUA 4IK7A 4XZUA 2YMXL 3D50A 4F8NA 1NFIB 1J9RA 5DVLA 1XTLA 1V7ML 4PJ9A 4HIEB 2QQNL 4NKIL 1P6AB 4U1LB 4X98B 5I5JA 2OMTB 4Q58C 1PFCA 2BNQD 4HPYH 1A0QH 2EZ0D 3V7AG 5E1AA 3MLRL 3VH8B 4QAMB 4MJJA 1RZIA 4K3EH 4XXWC 4E68A 1NBQA 2XQYA 4I18C 2A1WL 4DH2A 3Q06A 4TSAL 4WU7A 3OZKA 4EIUA 1WCBA 4ZFZA 4UQDA 5L8JB 3U46B 4LAJH 3WMQA 4W9CC 3QNYA 1N6VA 5E2WL 4LVEA 5GS1B 5KJRL 5KANG 3OLIA 5DUBA 1KB9K 1W80A 2DMGA 3SGJA 4L4TB 4MLIA 2A38A 3APNA 3NIFE 4P46C 4RGNB 1UADC 3MLRH 4MXWL 3VSVA 4G9DB 4LO9A 1CS6A 5EU5B 4FNQA 3JTSB 3B2MA 2D7MA 5DRWB 1UKSA 5EU7E 3IJHB 4F3FB 3BH4A 5IVXE 4L4VA 3WY1A 4ATWA 1QHPA 1D5MA 3SO3C 5IJVB 4YBQC 4W9ZA 4M3JA 5GGTA 1YUHB 2DLTA 4NQEE 4HDIB 1IT9L 1IKNC 3IMTA 4K23L 5I17A 4YQXH 4TSBH 2OAAA 1FNSL 4YOKA 2QHRH 3WTSA 3GIVB 4TTGA 1RP8A 3EJRA 2A9NL 2P5WD 1W91A 1CXHA 2P42B 3QA3B 2VRAA 5GXBB 3GI9L 5DSCB 1HHKA 2ITEA 1Q0XH 2XCMC 4Y9CA 1J05A 4XMZA 1DO6A 3GO1H 1OB1A 5CBEB 2QQLL 3BDXA 5C8JA 1KCLA 4LOEA 3WFEH 5I1IH 4FQ2L 1DQLH 4FNLH 1BPLB 3QHTC 3P3YA 2V37A 2WN2A 4ONGL 2VJ0A 4HUVB 1HEJC 2V0AA 1Y07A 1DFBH 2B1AL 1N6UA 2B8OT 3BSZH 4LCUB 4J2QA 5DK0A 1DQKA 5I28A 5D2NC 3F01A 3ARBC 4Y1TA 3KPRA 3EDKA 3LN5B 3OWRA 1Q38A 2GY7B 1M57B 3PHOB 1DLFH 5FKAB 4HJ0D 3O9WA 2ZD0A 2DDQH 3PHSA 3LJ3A 2O5YL 4LASL 4AXWA 5CD5C 3NJIA 2XWZA 4MMXB 4KO6A 2XV6B 5DCCA 5I6OA 1WZLA 3N0AA 4QIRA 1I7ZA 4PBVC 4LXFA 4PHXA 4NKOA 4WW2F 4Y4HA 1P5UA 5I71C 1QSFB 3RNKA 3MRFA 5D4IA 1E50A 4WV1A 1ZPUA 1FVCB 1QPXA 3AGWA 3FUIA 1WD8A 1U8CA 4UZSA 3ZHFA 1PAMA 3OKOB 1BXAA 5K39B 2G2NA 3ARFC 2GI7A 2WZ5A 2YC1B 4Q89A 1HQ4A 2X4SB 5FW8A 3C5SB 3K1KC 4CU8A 2VGLM 3FPYA 4KI5F 4NO5B 5AL8A 4LLAA 1JPST 1ZLDA 2ENYA 4UWQB 2XTSA 4CKQA 4H5SB 4XVTL 2ICWI 3SBWA 2N7AA 4JZJB 1A9BA 4P46D 4Y2DD 4XOBA 4YHPA 1VRSA 4OF5A 3KCPA 1J86A 1QTPA 2FGWL 2L7UA 3QQ3A 2FJHA 5EO9B 1A7QL 1TTRA 2AJXH 3WY4A 2SODB 5DDHA 1BBJA 3NA9L 2DJMA 1PPIA 2ZYRA 4DERA 3NIGE 4LPXA 3QEHA 4F7PB 3JWNH 4GBXC 3TBVA 4WIQA 4WTXA 4ADGA 4FHBD 4XXCA 2EC9U 3NACH 3OGCB 2O6FA 4FYQA 2PW2B 5C6TH 3CC5A 3TEUA 1XF2B 1YQ2A 5FW6A 1DUZB 2YGOA 3X13A 3EFOA 4JFZH 1KB5B 5DT1L 4A7QA 4H7VA 3CXDL 4U1MA 1S7SB 5E70A 4Y5YB 2NT0A 4BZ1A 4Q4IA 1JPEA 3LSOB 4GT0A 2Q8AL 2IPKB 2R0ZH 2AQPA 4ORGB 3NP4A 3TA3B 3MODH 3OZ9L 4YHMH 4CSTA 2Y36L 3NDZE 3UAJA 1ES0B 4PAZA 2KHAA 4ZXBA 1UXLA 2J43A 4HUNB 4OVUA 2VN6A 2QVTA 2ZKWA 1A3QA 5ITFA 3GMMB 3R8QA 4Z7WE 1FWXA 1WAAA 3BMWA 2AAVA 2ICWA 3RWJB 4XMPL 3UZVB 5E5MB 3K71B 5ISZB 3ROOA 3GMRA 4IRZA 1A1MB 4UTAL 4D9LH 5DHEA 4UU9A 3P02A 1JF1B 3GYRA 2IGFH 1MHHA 2CJ3A 4Y4FC 4HBCL 5E5LA 5GGTL 3RWGA 4FQ2H 3IETA 4OCSL 2XY1A 2HCZX 2EXSA 4NI3A 5L2JA 2ODIA 1M2VB 1TQBC 2VC2L 2CHZA 5GIRA 1OPGH 3RGVA 1HH9A 1JNHB 5ILTH 4PRDA 2AQRA 3O3EB 2L3BA 1JMXA 2CLRA 1C08B 2OMWA 4NQXB 4CVXB 3UTQB 2CDEA 3TOPA 3LKQA 3G6DL 4G6ML 4PGEB 2DLEA 4Q0XH 5FW7A 3SDCA 1MCPH 5E8OB 3QIUD 3RWDB 1NZRA 3CFBA 5CCKH 2BIOA 3L48A 3KYMB 3T9WA 4NN5B 5LNDA 1KBPA 5DJAB 4YVNA 5HGBB 1O6VA 5KOVC 5I1HH 3IDMA 4YPGA 1QX1A 4MD4B 4LMQI 3WIHL 5KG9B 1ZXQA 3GXNA 4DGIH 4JDVB 4QUOA 4HU8A 1TTGA 3PGDA 1S7UA 1S7TA 4KRPC 4WTZG 1HWGB 5D7JC 1DCLA 4G42B 4NBXB 4JZNA 5CMAB 1MRFH 4Q74A 2BNQA 1P6WA 2YD1A 4FE9A 3SJVD 2XFXB 4WWPA 5IFAH 1H8NA 1T04A 4XNZC 3VFWB 4UINH 4FI8A 5ALBL 3ZUNC 4P0DA 4U1MB 4LHUG 1WICA 1PNCA 2DV6A 2F2HA 2VDLL 4UV7L 4WWKB 4C59B 3MRQA 1ACYL 3KMDA 5JQIB 3X1BA 3SD5A 2CBPA 2IPKA 5CN3A 1NAMB 1OQOA 2G75A 5FYJH 12E8L 3EGSB 2VQUA 1D9KC 4RFOL 1E9PA 4MNGE 4NZFA 3DVIA 3SJVA 4XWGH 1WYJA 1EFXD 5AVSB 2WSPA 1DEEA 1X5AA 3CFDA 1AZRA 2LU3A 1MIEH 4ZMYA 3PWUA 4UQ9A 1AGDA 4R6UA 2WZAA 4P2QD 3KWTA 5IFJB 4I87A 3FB6A 1NBZA 3C2SA 1OAKH 5FUZL 5B1KA 1A7PH 3QDHA 4LCWD 1YN6B 5FEBA 1TIUA 4BSWA 5MEQB 1FL3B 3ARXA 4OLUH 4V1DD 2V5SA 4FC3E 5TD4A 3FSOA 4YUEH 1Q90A 1YJDC 4RAUB 1ZGLA 3H6JA 1UACL 4NN6C 4CN6A 4ZFFB 4YDVA 1FL6B 1UG9A 3BKML 1U8IB 2QV4A 3R1GL 1L5GB 1U8MB 4P4RA 1OZUA 3LRKA 3OG4B 3QSKB 5JQ6H 1U8QA 3PGFL 5F7NC 1IQWL 2OMXB 3LH2H 1KDJA 4LBEB 4XNDA 1E9OA 2FX8H 1AOHA 2A73A 3RL2A 4GI9A 4N9GB 4FTVB 1UJTA 5ITBH 1BQUA 4LP8A 1C5CH 5DD0L 1Z5YD 2UXFA 1KC5L 2C3XA 3FQ1A 3VFSA 3DUSA 4OJFH 5LKNA 1P0SE 1KBGL 3K6SB 5BRZE 4MD4A 3SDCC 3GHEH 5E6UB 1RL1A 2OXGA 2F68X 2YXMA 5AENA 1IAII 4K8RC 5K1VA 2X6UA 4JFDE 5EPMB 1A1OA 1DBBH 4DKFL 3NCMA 1FIGH 1VFMA 2X89D 4KRPD 4JZNB 5HGAA 3IU3B 4M4RA 4AV0A 1UXWA 4NQTA 1EBAA 3GRBA 1EEYA 5EZOL 3DX7A 4P5TD 3L08A 3QIWC 2BVEA 4Q7DA 5A2FA