4ZBJA

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
160
structure length
160
Chain Sequence
PLGSPNSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone chaperone ASF1
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Structural protein
total genus 31
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4zbjA00
5BO0D 2IIJA 2I32A 2DZEA 1ROCA 5BNXD 2CU9A 1TEYA 2Z3FA 1WG3A 5EIIG 4ZBJA 2Z34A 2IDCA 2YGVA 3AADB 2IO5A 2HUEA 4EO5A 4RRPM 5C3IA
chains in the Genus database with same CATH superfamily
3HZKB 4GAGL 4P46C 4I13B 1NKRA 2WZAA 3O3BB 4JM2F 4F2MA 4Y19A 3FQUB 1FYTA 1DVZA 1RD6A 4MS6A 5JHLL 4XNXH 1DFBL 2CDFA 1KV3A 1O7DE 1UA3A 3TPKA 1E40A 4ONOA 4CMHC 4UQ2B 4MXQD 2VAJA 4OCYH 3VUAA 1L3WA 2N1KA 2CM5A 1SJXA 3IETA 5DFVC 5C0EB 3GMQA 1DE4B 2VDMB 1L5GB 3MJ9A 3FU0A 1FNGA 3GT6A 2DF3A 2R7EB 1O5DT 3E9UA 5D7IF 4IKKA 3QXVA 1PKOA 3HRZB 3OZKA 5B1BB 1FV1B 2EDKA 5CCKH 3T6QC 4G6FD 4YUEL 4Z7OF 1QFWL 1JGLH 3X12A 2FJGB 3CX5J 5EOCJ 2H2SD 3T2NL 2DQHH 4K9EL 2P8LA 3P3RA 4OLWL 4QHPA 1A6PA 3GC3A 4PH8A 3GUTA 1MFCH 4K3DL 4RMSA 1UTDA 5DHEA 2HKFL 4PG2C 1J88A 4PV8B 4O2EB 4L8SA 2ITDA 2J4WL 1X6LA 2QTVA 3QDME 4XC3L 4X80L 4KO6A 2CK2A 3GB7A 2VM9A 2AV7A 3NACL 5TF1L 1F4WH 3BJ91 3Q1SL 4Z5RB 4I1RA 1GKEA 4P46A 3GRWL 1DJIA 1FH2A 4XVTL 4C4KT 1GZQB 3TNNB 4DVBB 1OSEA 1QEXA 3OGOE 4UNIA 3VG9C 3RDTB 1R3HA 5IZ7A 4J3OH 2K3TA 4UQ3B 3I75B 4HCRL 1QI4A 1HHGB 1DN0A 3OZ9L 3QUZC 3RURA 3UYPA 2ALWA 4KAQL 2XUWA 5DD3L 1QFUH 2XXGA 3BPCB 4LCCB 2WQ8A 4PRDA 3UBXI 1JCKA 1NAKL 5CJQH 4MNQB 5INCA 5AENA 3SOBH 2CLVA 3B7RL 4GXVH 4PG9B 3VXUD 4KI1A 1FZOA 1CL7H 2NT0A 4GINA 4J5VA 2WMPB 3QDMD 4QY8B 3DECA 3MRGA 4KHXL 4X5RA 4Y16B 2LVCA 4WNQA 5E9DB 5FKAA 1CFSB 2YGQA 1KXQA 1NBVL 2F74B 5DUMH 3BP5A 1TZHB 2MQGA 3VD5A 4BK5C 4AYGA 4A2GA 4P23A 4I2XA 4LARH 4OVVA 4FJ6A 3VFWB 1T6WA 4AT6B 4PG2A 3FCTB 3ZDXB 1K2DA 2GJ6A 3IRZA 5I71B 3CIAA 3MNWB 4WWKB 4XNZB 2X4OA 2ZOKB 1R3KA 1QEWA 1I31A 1QSEB 3LVEA 4C83A 2O6DA 3H9SB 4BGLA 2GHWB 5SX4I 3MLTB 1XQ4A 3L3DB 3LNFA 1HNYA 4Y5YB 2EXYC 1AKJA 2Z92A 1DVUA 3UX9B 2XU9A 2JKRM 4P4KC 4KNQA 3HLAB 4EDXA 3GKZA 3BKYL 3GZKA 5JW5B 1UWXH 3BYYA 3WJMB 3EUUA 3HG2A 4PP2A 5G55A 3BGMA 4GW1B 4PIRF 3ETTA 2JJUA 4KZ0A 1T04B 3OVUB 4NP4H 3U6RB 3B3IB 3KWXA 4LSSL 4XR8C 4U7MA 1XDTT 5JZ7C 3OMIB 1CLVA 3FQ1A 1QRND 4LCYA 3QJTB 4AX3A 4UINH 3HNTL 1TQCC 5D7JD 1LMIA 2VLKB 5BUPA 2WUCH 3MYJA 5JPMC 3RWHB 1RK0A 4UTCA 2CPUA 2FAUA 1NBYA 4QT5A 2VR9A 4JGJA 1DBBH 3N41F 4EIBA 1OF2A 1R34A 1S8DA 1TPXB 2HFEB 5FB8A 4UQBA 2YD6A 2A3TA 2A6JA 3QQ4B 3DOIA 1UB5B 4PMFA 5AUMA 1QLRB 3PP4L 3VD3A 4EN3B 1R5WB 5E95B 5C07E 3NZSA 3QQNA 3HFML 3QPKA 2F8OA 1T66C 1DVFD 3DOHA 4LP8A 2ZXAA 5GGVH 1U30A 1HKFA 3ARGA 5EU6E 2YWZA 4JFQA 5B3JF 4XWOD 4QXWA 5D1ZI 1TO4A 2PO6C 3LRGA 3FT4A 4XBGA 4ZBJA 3NQKA 4ZPTB 3TIDA 4O9HL 1RZPA 1B2WH 5EEWA 5I23A 3MA7B 3PABB 2ICWI 4KTGA 3ZMNA 1CD9B 1G9NH 5HGGS 4O4YL 1EHLH 4YDLB 3LXAA 2CIKB 1I3GL 2DWSA 3LNEA 4WWNA 1XFPA 3IJ8A 2JF1A 3C6SB 1CLZH 3Q5YA 4NQCA 4ZTPH 1MCWW 4QXUL 4BQ9A 4HUVA 7CGTA 3RVWD 3QWOB 5LXVA 1HL5A 1RI8A 1V3KA 3V4PH 4W9GC 3UAJD 1UM6H 3VGDA 2DKSA 5C07D 4EMZA 4D0DB 3GK8L 1RZ7H 3EOBB 3MFGB 4ODTH 5LBVA 3GSOA 4K94H 5JPMA 1KPRB 5MHSE 1PZUB 1TNNA 3LN5B 1TZAA 1ND0B 4PJFA 3Q2NA 1IAOB 5EU6D 3HN3A 2DJ4A 3RB5A 5DUPH 4U4IA 5AZEL 3HRPA 5C0AE 4HH8A 2ZOOA 4BH8A 4AIZA 4AJ0A 2EVIA 5DUBB 1UWEL 4N2NA 3NG5A 1FAIL 3AQYA 3MUJA 1P7BA 2BP8A 2KPWA 1H6TA 3LH8A 2WVVA 1ORQB 1JYXA 1ZTXE 1KIUA 4M62L 1AZZC 1U8CB 5E99H 4AV0A 3KPQB 3GSXB 4GS7B 4Z7NF 1LEIB 1WHPA 4L05A 1UKQA 3RAJL 1FG9C 4MAYC 1R3IL 4WDIA 1VPOH 2PO6A 5IMLB 5CLWA 4DCQB 3WHXB 3ILPA 4YHML 3QJHB 2OK0L 2H26A 5MHSD 1E8ZA 4H0HB 1S6NA 5MEOB 1ZDSA 3T5WA 2APBA 1N0LB 1QBML 1WAAA 2J3SA 1JWMA 2P24B 1MQ8A 2A9DA 1LO4L 4FNSA 5DC4B 4XP5H 3DA0A 1QPKA 4RVBA 1YPZB 2OR8A 4A2HA 4P2OC 4HX1B 4KTDH 5B7MA 2ITCA 3QAQA 4RWHA 4WIQA 1LQSR 4X0KA 3G5XB 2EH8L 2A74B 3P73B 1OPGL 2L3BA 2CO6A 4YDVA 3D34A 2FO4B 5ABDE 4H25B 1CC3A 4RIRA 1OGAE 3K46A 4XP9L 5BQ7A 3STZA 5I8KH 1ZLWH 5JXAH 1YDPA 2EE3A 3PAZA 4MJ5B 3UBXA 4JFYA 1A66A 1MEXL 4YHIA 2Z7ZA 43CAB 1FC2D 1OSYA 3ZDZF 2BP0B 1E43A 4MYWB 2WGXA 4HKXB 1G7MB 1YEJL 4LOFA 4PCYA 3UAFA 3WMQA 3GJFH 1T0PB 3EJSA 5DJ8B 8CGTA 2PETA 1I3VA 1I9IL 3TCXA 3BEVB 4QRPB 4MAYA 4RFOL 2HP4A 1K6QL 2X9ZA 1TU2A 1PD1A 2AV1B 1DQDL 1K8DB 2XN9B 5L6YL 1PLGL 4Y9CA 3MFFB 3P0GB 1BQRA 4AWJC 4GLRI 3PWPB 1QTPA 5AW4B 1Y18A 5I0DA 1R5IB 1OGAD 3INOA 2IV8A 2NW3B 1X4ZA 3GKWL 5D1ZC 4LLMA 1RIHL 2VDQB 3MCYA 5JOFA 1SZNA 3IB4A 3A22A 3LPOA 4P2OA 4UUJB 2W1NA 3HZMB 3EFOB 1BZ7A 5HI3D 1GYUA 4JDTL 1URZA 3SDCB 1GSKA 4BFKA 4JM2C 5BXFB 2R0WL 3QORB 4P9ML 4GO6B 1BAFH 5GIRA 3GEWB 3CC5B 1B2YA 2AP2A 1N10A 2YBRB 1YEFL 2VITA 1KN2L 3F7RA 1IBHA 3LX9A 3OKKA 3RIFK 4Z7VA 5IEHB 5DD0H 1ZEAH 4Y4KB 3BAEH 2NZ1A 1N19A 2YPVA 4ALAH 2NQ3A 4KK8C 3Q6FA 1R46A 1MCEA 5IJVB 1KGJA 4N5EC 2CA4A 1KCVL 2K8MA 1BX2B 3BN9D 5E0QA 5HHQA 3NGBC 3C60C 4LSQL 4V1DB 1JWUB 4GIOA 2WWMC 4GO9A 4W4NA 2NY5H 5IB1B 1CYGA 1MOEA 1YPZF 3GS0A 2VZ1A 1QWHA 5BZWA 12E8H 1KFAL 3QEQE 4F27A 3LS4L 4Q74A 1X7SA 4PJ7B 4TQEL 1FGNL 3LKPA 2D03L 4XCCL 4CVXA 3WKPA 3UACA 4KKZA 2VRAA 1X5GA 2AJVH 3ABMB 5B22A 4J2XA 3OXRB 1QI3A 1U95A 5KW9L 1KBKA 1IM9A 4FKKA 3KPPA 1QATA 2P5EA 1XF5A 4JBSA 4PGCA 4ONGH 5FW6A 5IW6A 2FWLB 2GTQA 3JSSA 2DQUL 4G5AA 1XGPB 3D8MA 4LESA 2FJUB 5K1JA 2ZG2A 3CFQA 5D1ZA 4AE0A 1JPFB 3SZ6A 2NR6C 3RX5A 1NGZA 2QHLA 4P9HL 5B1AB 3TEUA 3WIIL 4AQAA 3D85A 2L8AA 1CD1A 2ADIB 4TTGA 2JK5A 1U93B 2FT8A 3EFDL 4PWHA 3ZTJG 4ZFFB 5IR1B 3QQDA 4FKHA 4NQEB 4PV9A 1RP8A 4WEUD 4X6EA 3SN6N 4NENA 5ALCL 3W2DH 5L7XH 3QEQD 3UC2A 3ZQ9A 1BDYA 9CGTA 1C08A 5GRYA 3VWKC 5DLLA 3QZMA 2N1TE 1CGTA 5L8JB 5C0JB 4OLUH 3WIHL 2NSMA 3VXSE 3WFZA 4HFWB 1DUZB 2YPLA 4PWKA 4FFZH 1LP9E 3C60A 4NRZB 4RMQA 3APNA 3AS0A 4UDUB 1LQBC 1ZHKA 1MLCA 4FXKB 1L7TL 4RGOH 5GHWL 3VB8A 2YAEA 4O00A 1JRHL 1LWRA 4BQBA 1DUYA 3S9DB 4JPVL 3DGGB 6PAZA 4U6YA 2NNAB 4DGWC 2Z8RA 1A7RH 1A9EA 3N6YA 3VB9A 1Q9WA 3L7EB 3ARFC 4GG8A 5DJ0A 3RNQB 5F8RC 3ULVL 1FZJA 3S34L 5F9DC 2TSBA 3AWGA 4G7RB 2Z34A 1A4KA 2VN7A 3REVA 4OIAA 5F70A 1WZ1L 4G6JH 1IFGA 4AXWB 4UU9B 4BWUA 4KGJA 1LDSA 2C3HA 1EV2E 3MODL 3KPSE 3MCKA 3O4LE 4NM8L 3VXSD 3FTWA 4QLRA 3UGEA 4XN2A 3NA4A 1LWHA 4YPGB 3PL6A 5F9WC 2X2YA 3MNVB 2R4RH 3SKJH 2ZAHA 3N1QC 1QYGH 4BZ2L 3MROB 2YEZA 4GMSL 2ZOWA 3CFNA 2LR4A 3GSNA 4HJJH 1GHFL 2XWTA 3EH5B 5B39A 4NN6B 1PIGA 4NI3A 1NCDH 4FYTA 1D5IL 5E8EB 1P5UB 1L0XA 2CHWA 5C08E 2WV3A 4GSQA 1ZGLP 5A2IH 4W9DC 4XRCB 3PG2A 2BVQB 1UA6H 1U6AH 1EZLA 3SJVE 2IEPA 3ELAT 3ZE0F 3ZT5A 2Z91A 3T8XA 3HZKA 4M93C 2EO1A 3KWWA 3O3BA 2QLVB 5D4IA 5H94B 3G6JE 2UY6B 3FQUA 1RERA 3VO0A 4XVOA 1J18A 1CGXA 1OQOA 3O4LD 3CBJB 1RIVH 1A6UL 4FZ8H 5LGYA 4YDKL 3QG6B 2TSAA 3ARFA 3HR5A 2VZSA 2XVBA 4M3KB 4UQ2A 1D2PA 3R7RA 4PRIE 5BO1L 4NO5B 2JIXB 3EIFA 3HB3D 4FXLA 1DE4A 2AJUL 4DKEH 4LF3B 3I6LE 1L5GA 2XWEA 5C09E 4YBHA 4OZIE 2M26A 1L0PA 5GQBA 4M6OL 2R7EA 1JGVL 3L1GA 2QHRH 5AB0A 4Y4FD 1CK0L 5C08D 4N2KA 5A3ID 5DRZA 3HRZA 3TEYA 2QADC 3RZWA 5GRXG 4MSWB 2P48B 1F0LA 1FV1A 3JBG7 2G9HB 3D3VB 5HHNA 1HHHB 5C0CE 3SJVD 1LO5B 4PLJC 2DD8L 3X1NA 3GO1H 2O72A 4IHOB 5BS0E 1JPGB 4FMFA 4JY5L 4OCXH 1DVQA 1JGUH 3SYOA 1FHGA 1AGFA 2R0LH 3AXIA 3MXVL 2BIIA 1N64L 1XXDC 3A4EA 3MCG1 4HIJB 4AMKL 2Y1YA 1Y07A 4XCYB 2W9DH 2FWOB 3KR3H 3QZWG 3SE4A 2PW2A 4KQ4L 5C0BB 1PG7H 4PRID 4Z5RA 1JZDC 1SOKA 2F7OA 3LN4B 3I6LD 3GFUA 3V6OE 4Y5YC 5C09D 2EEXA 2X6UA 1QA9B 1GZQA 5DCCA 5IVOA 3U1SL 3TNNA 4X6CB 4DVBA 4JM0A 4I0PC 3RDTA 3LEXB 4G6AD 5CZVH 4KKNA 4KXZI 4HISA 4UQ3A 2HT3D 3I75A 1U8JB 4K8RL 3EUDA 3PUCA 2H1PL 4NHUB 4K5PA 2I9TA 4KV5E 2D8KA 3QJUB 3O6FD 5BS0D 3BPCA 4LCCA 4YL4A 3JTTB 1NKOA 2EDEA 4MNQA 3HI5L 4MRCA 3RWJB 3MOQA 5EEZA 1BECA 1CCZA 4PG9A 1EO8L 1I8LC 8PAZA 5D6DC 5TK2A 2XXFA 5TPWH 4MS8C 3VFUB 4ZZKA 1QW8A 2X05A 2R56H 1FVDB 4Y16A 1MN4A 1N6UA 5E9DA 4EOWH 1CFSA 1TPXC 4Q9QH 2WN3A 4GMTH 3CAFA 5E7FA 5HYFA 1UM5H 2ZUSA 2WNKA 1GA2A 3QFJB 2ROXA 1THCA 2Q20A 1KCUH 2CGRH 4EN3C 4A7VA 1QBBA 4GRWE 4PJIE 2IQAB 4AT6A 3FCTA 4UYQA 5GJSH 2Y5QA 4CNIB 3AWFA 3AC0A 3KPMA 3MNWA 1KG0B 4WWKA 3ZY7A 2ZOKA 3V5DB 1FGVL 1PLAA 2WXGA 2Z31B 1IKFH 1QSEA 4B0MB 5JR1H 4AGMA 3MLTA 3L3DA 1IEBB 3AACA 4MCMA 4YHOL 1NJ9B 3R4RA 4Y5YA 3U9WA 3ZE1F 1WFNA 3ETSA 2Z4QB 4DFHA 3ARWA 1IBFA 4H20H 1DBKL 5AB2A 1NFDB 4EEEA 5JW5A 2YGVA 2R51A 1A64A 3U46B 3WJMA 4I3RL 5JOEA 3F7QA 1ASOA 2HT2C 3FHEA 1WWCA 4GW1A 1F56A 1L0QA 1U8HB 4P59L 5F7EH 2J88L 1LO3H 1T04A 3U6RA 3B3IA 4N2BA 3VJ6A 3SIKA 5DYFA 4MCZB 3LAFA 2VLKA 4E9LA 2RB8A 1I8LA 3ESOA 5D6DA 2R2HB 4QGTA 4PN6A 1XCXA 3FSOA 3I84A 2DEWX 4YSDA 3AAZB 3JT2A 2FL5B 1P9MA 4LBAA 4LQ1A 5I74C 1MREH 2VLRE 2WB1A 5GS1B 5GS0C 5GRWA 3B2XA 4EN3A 4LSRL 1R5WA 5HYJE 3T1WA 2CUMA 4S0TD 3OKOB 1NEZG 4AW4A 2G60H 2P43B 1JOIA 3PPEA 1KGCE 4Z3IA 5FHBH 2I25N 3OPZH 1OE2A 3NCXA 5SX5K 1QFWI 3D9AH 2XTSA 4XWGH 5D8JH 2R8SL 3KGRA 2X4UA 2IGFL 3FS9A 4ZPTA 2X40A 3FTGA 3IGAA 1L6PA 4HS6A 4XNYL 4YC2C 4X9HA 4WCYH 3TJHC 2CIKA 4KWUA 2N59A 2OYKA 3C6SA 5CHNB 2DY2A 3NJIA 2LTQB 1YEEL 1C5CH 4G6KL 1EMTH 1MAKA 3QWOA 2IH8A 5FM4A 2VLRD 3I6SA 4XOCA 2NXYB 5HYJD 5EBWB 4G7QB 4TRPL 3T77A 4IBVA 3EOBA 4FP8L 1KYOJ 3CN1A 5J11B 4ENEC 4KKAC 3VQMA 4U1GC 3U0WH 3UYOD 3LN5A 4KMLB 1KGCD 1ND0A 4X5QA 1SEQL 2ROYA 1TVBA 5BOJA 4C4KO 5I9QB 3U36B 3HI6H 2EE9A 1I8KB 1U36A 2W92A 3TVMD 3HCVB 2O5NA 2XXMB 3F5WB 4TVSa 5DUBA 3CFEB 4TVPL 3EJQA 4ABVA 4HHWA 2H9GB 2WINA 4WAFA 1MHCB 3KJ4C 1ORQA 5EB9A 3T0EE 1MJ7H 4AEIH 1X7TA 4LB8A 5IIEA 2F19L 1U8CA 3KPQA 3GSXA 3HAEB 4BFBD 4URKA 4V11A 4XNUH 1JFQH 1KGIA 3RY4A 3FN0H 5IMLA 1Z9SB 4GQ9L 4AENA 1RPQA 5E00A 2GIYA 3WHXA 5MP6H 3CZGA 5KVDE 5JDSB 3N40P 3N42F 4NNPH 2OI9C 4G5ZH 1T7VA 4PW3A 1U92B 4KX8A 4ELDA 3AGWA 5MEOA 1KYFA 2VR6A 3CVHL 5AOZA 2YD2A 2P24A 4JM4H 2C8NA 4PB9H 1QD0A 1N6QL 2VRKA 4P48A 2K1MA 3R1GH 1YPZA 3QYCA 4HX1A 4ZXBD 2HTLC 3NFSH 5DD6B 2ITEA 3UBGA 3DMMD 4MYPA 2A74A 1UCBL 3VXNA 3T0ED 2WP3T 1G7PA 2FO4A 4KK9D 4H25A 1VKXA 1JL8A 3C5XA 5CXPA 3ZR5A 1TJHL 3TASA 3WTVA 1B90A 4MJ5A 4MMZB 1I8AA 4JDVB 1XL6A 2OMTB 1CF8L 3PAUA 4DP4X 2BP0A 5I1KL 4HGMA 3H85A 3QB7C 2O5ZH 1CBVH 4HKXA 2CU9A 1I1RA 1T7YA 3NPZB 3DETC 1OQXA 1AYOA 4S1SH 3RL2B 3MJ9H 4IIQC 5J9PB 3WO4C 5DJ8A 4F3FB 5EDXA 5GRJH 3VH8G 3F62A 2DYSB 4HH9B 3KE0A 4NWUL 4UQDA 4WEBL 2DTMH 1OWRM 1CFBA 3S5YA 1ZHNA 2BSSB 4JFPA 1OPOA 1JMXA 1NCCL 1NGYA 1MCPH 1YNTF 5CD5D 3KD4A 4FERA 2I60H 1Q0XL 1CXFA 1K8DA 2ERJC 1HWGB 2XN9A 4L8CB 4Y2DC 3QRLA 1F4YH 3BGAA 4QHKJ 5KSBB 4JFOB 5KYUB 4K7PX 1JXFA 3FCGA 1FL5B 1NIFA 4DVRL 1XT5A 3P77B 5E9NA 5L0QB 1CLCA 3K3QA 4PJAB 5B8CC 1SM3L 2ZP8A 3PWPA 1KJ2A 3MQIA 4DO6A 1NL0L 1G9ML 2OJ1A 4W93A 3C2AH 1SYVB 1C7TA 3PJNA 4NNYB 3NRPA 1EAOA 4OD2B 5SV3A 4Z6AT 3MGTA 1QPXA 4FX5A 1U2HA 2PXYD 3DXAD 5F7UA 4UUJA 1GS7A 4E9YA 4M3HA 4NPYB 4BKTC 3C5SB 2KYIA 3EFOA 3HZMA 5BPPA 4HF5L 3ES6B 1XF4B 3SDCA 1RIUL 5BXFA 5BV7B 1E5CA 4AIOA 2E8ZA 3HKFA 3LZFH 4X4YA 4FJYA 3AGVA 2RGSA 2YBRA 2D2OA 4M56A 1AJ7H 5IEHA 3AQXA 3VFRB 4Z8FH 1NA8A 3GYRA 2B1HH 3B6SB 1AZRA 1BQKA 3HG1E 4Y1TA 5TGBB 2E7MA 4A04A 4MCYB 1AHWB 4NSKB 7PCYA 5IJVA 3LH2H 1XR8B 5C0FA 2A0LC 4L1SA 4RISL 1RLWA 1WIOA 5HHOA 1YN6A 5D7LE 5DJYA 5JHLA 2IXQA 3HNSL 4V1DA 1MWAL 1AACA 2AXWA 4PVLA 1FVEB 2MQ3A 2WTOA 4CKVX 5LGKA 4IIQA 3BQVA 5IB1A 2P80A 3GTNA 2FGWH 5TH2B 4NDMA 4PJBB 4H13C 5CJ5A 5C0DB 3GI9L 3L13A 2CKNA 4U1LB 1MFBL 5LJYH 4RX4A 1BMZA 2H1XA 2CH8A 1T2XA 4U1IA 2BO0A 1L7IL 3RUGB 3D7PA 3CCHB 1HSBB 2J5LC 2GCYA 2OJZH 1AE6H 1X5IA 3MBXL 3QH3B 2A1WH 2VDPH 3BOVA 5DMYA 2CKBL 3OXRA 4F9LA 1Z5HA 4PS3A 2KZKA 4OI7A 5EEYA 3ZYZA 3AG1B 2CUAA 3PWUB 4ZMYA 4JQVC 5F72S 1KC5H 5FO7B 5J12B 3NIFF 1XGPA 1KSRA 5HPOA 3HG1D 4OF8A 1JPFA 3FCBA 4W9IC 4DTGL 2XIIA 3NEEA 1H19A 1U3ZA 3CSFA 1FNAA 4YZFF 4ZQKB 2FLMA 4PJ9B 4U1KB 3SCMB 4TUUA 4KZEH 2ADIA 4W9HC 4BXVA 5D7LD 2OZNA 1QSFB 4ZFFA 3S36H 4F8QA 5IGXL 5IR1A 1IC4H 4CVWA 2APXA 4NQEA 3IDMB 3O3AA 1OHQA 3C09C 2B0SL 3QXTA 2E27L 4MQSB 1RZJL 5F0JB 3JQOB 3VMNA 4JFZH 4IMKA 1UYWH 3DNKA 1ITBB 1IC5H 4FTVE 1LLAA 1TQSA 2FLBT 5C0JA 1TQBC 4NN6C 4E9WA 3O9WC 3IU3A 4HWEL 2B59B 3U7WH 3GRWA 3W56A 2ORBL 4HFWA 1DUZA 3RHWK 3QQ3B 5CZXD 1A6WH 5CAYB 3LZRA 4X98B 1XSJA 4HCRA 4N8VB 4UDUA 1EO7A 5DF0A 4JO5A 3SKMB 4P5KB 4Y5VB 1AY1H 4PJGB 3UTTE 4E9TA 3FCSB 3O2WL 5J06A 4OUOA 4UT7H 4P2CG 2NNAA 2EUZA 3Q01A 1EWHA 1EJ8A 3DROB 3O6LH 5A1AA 4KH2A 3VD2A 1WVZA 4QYOB 3L7EA 3CXHJ 5FIEA 3RNQA 4Z3HA 2A83B 1G4MA 2OR9L 4WFEE 2EILB 4I77H 2ZG3A 4N1CA 4JQVA 5F9OL 5HPMB 4JRYA 1UXMA 2EVFA 3EJZC 4EPSA 4AXWA 1H6EA 4FTVD 4QI3A 4UU9A 3ZYOA 4A6YL 5I6PA 3ZZQA 3OPUA 2VLJE 5C92A 1OAUL 2IC2A 3UG3A 5CSZB 1QFHA 1EXUB 1ZTMA 3P2TA 1BGXH 1AR1B 1LEGA 4JPKL 4YPGA 1BFVH 4NXKA 2DWEB 4O02L 3NA9L 2P28B 2QQNL 4H7VA 1PEWA 5CSGA 3EOAB 4YX2L 5JLZA 5LAPA 4B3VA 1CFTB 2W0KA 1IT9H 3MROA 1L0YA 5C9KA 2VH5L 3REWA 5J6GB 3UTTD 4YHKL 1JNNH 1MI5A 3FB8B 2V37A 4RMTA 1DBAH 3QRBA 3O9WA 4ZUWB 4B9GA 3FL7A 3II3A 5I76B 1P5UA 3ZTNL 1EZUA 3CIQA 3ATEA 1RZIB 2E6JA 1D6VL 2VERA 3M86A 1YEDB 1ADWA 4ODXB 4RH4A 1HC1A 4WFED 5INDB 2W9EH 4QGYA 5CN1A 3MAWA 1KTJA 3TX4A 4O2CA 1RURH 3BAIA 3DX4A 4S0HA 3DHJA 4MMXB 5H94A 4HIHB 3TBYB 2HN7B 2TAAA 5FPIA 3B9KB 3RZCD 4ZX5A 2VLJD 3G6AA 4HWBL 3FFCE 4OZHE 5IFAH 4HJEA 1CFQB 2NLJA 4JY4B 5TD4A 4NO5A 2JIXA 1AGCA 2KUTA 3QYMA 4LF3A 4XP1L 4P2RB 3B34A 3QZWB 5IVXB 3ARDB 2OTUB 3W11D 4ANWA 4UM8B 2H6OA 2QGDA 2VXUL 1YYML 1G0DA 1XVSA 4DERA 2CRMA 3MBEB 4ZS7L 5H35B 3QR1A 2WM0A 3D3VA 3JYBA 1LO5A 4WKXA 5AVYB 1DCEA 3IAPA 3BWAB 4XGZB 3SQOH 3EBAA 2WNWA 4IHOA 1JPGA 4JPIB 4E0RA 5JQIB 2EO7A 4YXLL 5IUSA 1LO0L 2IMNA 5I5RA 3BQUC 2C7FA 3PIQB 4B9CA 4N0YH 5I1HH 4GRLC 1MFDL 3TO4B 3FFCD 4WHYG 3RGVB 4JREB 3HKZA 2X9WA 1S46A 3IMTA 4JNXA 2AXFB 2FWOA 1WISA 1JD7A 2Z31C 3MPCA 5JORB 5C0BA 3SGJC 3IJ9A 1U58A 4QIRA 5JQ6L 1YAIA 4UMSA 4KQ3H 3LN4A 2ED9A 4FABL 3BLKA 4UQ9A 4OBRA 3SGEI 3TA3D 1VLXA 3G08B 3T3PF 3WDIA 3CHQA 3LEXA 3TS8A 4HJ0C 2EIDA 2KLRA 1U8JA 5CLZA 1TZIB 4KRPD 4Z7UF 4MA3B 4XCNB 4YOKA 2X4RB 3F05A 5HVGB 3W82A 4R7VA 4B9PA 2VDKH 4QTIH 2E3VA 5KTEL 2C3WA 4S10A 3S98A 3ULUF 4UQAA 3JTTA 4JKPL 3PGDB 4ONHB 4B9ZA 5FGRA 1MPAL 2KMWA 3S88L 2IANE 3LRMA 2XC8A 1UT2A 1JRHI 2FEDD 1U8IB 3RWJA 3GSWA 3QEGH 1NIEA 3VFUA 1M7IB 3RX9A 5I1EL 5ID0A 2V3EA 3BH9B 3F6JA 3N85H 4YHZH 4BE5A 1FLRL 3BKCL 4XHQA 2EVHA 2D31A 1C5DB 2FEJA 1BAWA 3V4UH 3ZXAC 2JQZA 3PHOB 3QNYB 5DD5H 5GS1C 4OIFA 4NQDB 4U0RB 1EDHA 3BQUA 4HLZG 4JN2B 1ZMYA 3S5ZA 5C3IA 3TURA 4GRLA 3UO8B 1RUAL 4CNIA 1JNHB 4UBDC 1KG0A 2E6QA 2X7LB 3BDXA 4RSVA 1BIHA 2Z31A 4LK4A 4P5TB 5D6CB 3SGJA 4PRPA 3HMWL 3MJGX 4ODUA 2AEQH 5FV1L 1IEBA 1I7TA 1NJ9A 4TPRL 1JXDA 4HXBL 4UV4L 5KVFH 1QACA 4G11A 4R5XA 5JW4R 1MCJA 2CJTA 3EGXA 1CN4A 2HJLB 3D4GA 3S96B 4DEUA 5DFAA 4L0YA 4YPJA 5T1KD 3ZRCC 4AITA 5DMGC 1COBA 2YPVH 4OFIA 3IJSB 5JIMA 4XMVA 2OMUB 3GRGA 4PU2A 2GW5A 1AZUA 1IGML 2F6AA 3KM1A 4MGXA 3WKNA 1U8HA 4B95C 1NEZB 5ETUB 4LHUG 5IESH 2WKOA 4MCZA 1I1AD 1VEPA 4TN9A 2HRPL 5J11C 3D52A 3HJ0A 5L2JB 3RFZB 2R2HA 4GI6A 4G7VL 2WKLA 4PGEB 2ALAA 4JHAH 4XMLL 5CEYB 1P4BL 2AC0A 2E0PA 5GRUL 2NQCA 3SPJA 2NY0D 4WU7B 3NH7L 4CSPA 3U4EA 1C16A 1BVKB 1XGYL 3D18B 1ZRUA 5ICXA 1S9VB 3T71A 1V27A 2F58H 3AAZA 3B9AA 2FL5A 3HUJF 5GS1A 2OMWB 1KTRL 3TN0D 1ET5A 3W0WE 3DPDA 1BVLB 2YUWA 4Q4IA 1ODAA 1EVUA 4UMGA 4UTBL 4JPQA 4BELD 5E08H 3VI3B 1MCNA 1CLYL 1VFOA 2WWNA 5T1MB 1KWKA 4WFHE 4DNLA 5JXEA 3W9DB 1E4XH 4L1DA 4MCNA 2PKDA 4UDTB 5GGQL 1AC0A 3PQYB 3L4CA 3ZT6A 4WTZG 3CFKB 5K9OA 3ARUA 3NCYP 3IVKA 1OKEA 1CE1H 3UTPE 4UAOB 3NCCB 5HI5D 3TT3H 2AK4E 4Z1PA 4P9HC 4HP5A 3EYQC 1KENL 4AE1A 1ECZA 3HC0B 3T08A 4NQSB 4FQLH 4LDOB 4PJ8B 3U79A 2VQUA 1T89A 4WI4A 3BVVA 5CILL 5KZCD 4XAKE 4POUB 1TUPA 1T1YB 3NFPA 3VFSA 5GZOC 4HETA 3TYFA 2YMXL 3MKGA 4KI5E 3W0WD 1AXIB 1OWWA 4MA8H 4UQEA 5EBWA 3QIUB 1XZWA 5IVNA 3N50A 3CFCH 4LL4A 1ZVHA 4TOYL 1KFGA 2ZCHH 3WLWC 2ZWKA 3B5TA 1R6VA 1MWAB 1ZA3B 3U36A 5IQ7H 1N8OE 1I8KA 2CALA 4JFEB 4AGLA 2PPAA 3SDXB 3HCVA 2XPGB 2BINA 1MAML 4YBLC 1IKOP 3KLHC 3CFEA 3UTPD 4QWWD 4GEJA 1XXFC 2YSTA 2AK4D 4ZUTB 3B5GA 3MGOB 2I85A 1KLUB 5DHVB 2H4EA 4MWFB 4LKCA 2CKBB 3JWOL 1XF2B 4ISVB 1H0DB 3ULVC 1M1SA 2NZ9C 4XAKD 2F7IA 4NAMA 3GMRB 1N8ZB 3HBQA 4W9CC 1Z9SA 4GSDH 4WJ5B 1X5XA 1AQ8A 1F6LL 1HAWA 3WJLC 2EDLA 2JKJA 5JDSA 4WU5B 5A2FA 5K9QG 2J2ZB 5L0QC 1BMGA 1IGJA 3WENA 4Z7WF 1U92A 1BXVA 3F7YB 1MFEL 5DVNA 2FUQA 1J8HA 1O6SB 2Z7YA 3BMVA 1YNKL 1HILB 2IV9A 5D93C 4JN1L 1OAKL 1WZAA 1QBLH 3V0VB 1M6UA 1HCFX 3WTTA 4M9PA 3UADA 1XTLA 3CSTA 2PPCA 5DD6A 3ZQXA 4Z3GA 3TBCA 3ZBMA 5HDOA 4OLYH 5GXBB 2W95A 4J4PC 2P5WB 2B9AA 3WIHA 3CPLB 1OAQL 3CLFL 3SBQA 5HJ3B 2KBGA 1BZQK 1ZANH 2MKLC 5AWNH 1AHWC 4C59B 5I0VA 3KGTA 3QZOA 4JR9L 4PJDF 5CIPH 2OMTA 4D9LH 4K3HA 2YGOA 4JEGB 3UMTA 3MJ8B 2H45A 3Q2LA 2X0VA 3B7SA 3EO9L 3RL2A 4NAJA 5IW1B 5CWSA 4F3FA 3WFDH 3RTQD 4HIQA 3AB0B 2ZTBA 4HH9A 5J1SC 3QUXD 4KVNH 4CN4A 4AUUA 2MSPA 5DRNA 4WWOA 1HNFA 4XMKH 1XB8A 2PCPB 5CP3A 3QRFM 4ZDHB 4L8CA 2CCWA 3EDDA 4NO0A 4WI9A 1K8IA 2P8MB 5KSBA 5KYUA 1JCVA 1JNLH 1SHSA 2UV3A 2XWCA 4FZEL 4A6YB 4B5ZA 1M2VB 1FL5A 5HGBA 2DS4A 2NY6B 5AL0A 4PJAA 3NOIA 5ADOH 3SHSA 3UAAA 4ERSL 5J12C 3OB0K 1SYVA 2V5YA 1ES0A 3EOTL 2OV0A 4NNYA 3FUEA 2E7LC 1MJ8L 4OD2A 3NAAL 3G5YB 1S5IL 1JUFB 1GRWA 4BZ2A 1PF3A 1DANU 5IB5B 1MHEB 2VN3A 4JQIL 1CZ8H 4NPYA 3C5SA 3OGCA 3KJ6L 3SCMC 1B4JH 1FCGA 1QHQA 1XF4A 2VDRB 4IGBD 4W68A 5B3NA 2YZ8A 1ZLSL 3L9YA 4O58H 3AFLA 4KDTC 2CBQA 2WO4A 3TOPA 3V0JA 3KLAB 3LB6D 3QXWA 4E9XA 5D5MF 5B1JC 3RFRA 2F5AL 3VFRA 1C12B 2N7AA 3B6SA 5TGBA 4ELME 4MCYA 1AHWA 4NSKA 2VT0A 2FD6L 1ZV9A 3DI2B 3VXTA 1B9ZA 2PR4L 5E1HB 1TOXA 3VWJC 3V0WL 1FVEA 5T5NF 4EI0A 4K8RC 4LOUC 5TH2A 4JGMA 3EJUA 2DI7A 4NJAL 4G6MH 2BWDA 1T0MB 5C0DA 4DESA 5A2JH 5JOPE 4U1LA 1GZPB 2DYPD 3L4ZA 1JIBA 4R96B 2WSKA 1HSBA 1H8LA 4YQXH 4MZIA 4DP1X 4M5ZH 3EBIA 4MDRA 4EE2A 3PGCA 2FX7L 3DYOA 3ZQWA 1EFXD 1X9RA 3CMOH 1RZFL 3MU3A 3CQPA 3D2TA 3PWUA 4OTXH 1BZ8A 1K5WA 4L4TB 1ZT1B 5FO7A 4JJHA 2XPYA 4FQ1H 5IQLA 2ZX7A 4GFTB 4HMDA 3QJXA 1T1WA 3ALXA 1FRGL 4K3GA 2BH0A 1YY8B 3K4DA 3QT2A 1NCJA 4ZQKA 5FCUH 2LQRA 4Q52A 4U1KA 3SCMA 1ZVNA 5F89B 4XBPB 1AR1C 1QSFA 2HUHA 2VZVA 2XZZA 3QQXA 2PYEB 1OAYH 4LVEA 1LILA 3DUSB 1SDYA 3IDMA 1AXSB 5L4IA 1WWAX 2ED7A 4XZ4A 1NANH 2J8UF 2VMCA 4L37B 5IREA 3GM0A 5JOPD 3SD2A 4M7KL 3UTZB 1VGKA 1A8ZA 3AM8A 3IDGB 3STLA 2QPUA 3UJIL 2B59A 5JW3H 3ULUC 3G5WA 1IVLA 2F8IA 4FQXD 5AQ0A 5K59F 4K7PL 1CICC 3VWJA 2X9XA 1A1OB 4HEMA 1PG7X 4HPYL 2WTRB 1N70A 3SKMA 3IJEB 2JJWA 4P5KA 4XCFH 4Y5VA 1UOWA 4PJGA 4X9FA 1OARH 3GD1C 1OTSC 1U3HB 3B9KC 3BSHA 3HS8A 4J3OG 3H2WA 2O5YH 1MFAL 2X44D 1WTLA 1DDHB 2WP3O 2K3HA 1WK0A 4ZD3L 2WBJB 4HZLB 2MHAB 2Y9RT 3PJSB 2A83A 2YD3A 4JO2H 2XZAH 1IAMA 4QPEA 1HU8A 3EDEA 1KN4L 1GCYA 3CZSA 4YE4H 4FG6C 4JZJB 4KK6C 1FC1A 5AW2B 5EF0A 1UXSA 4YSAA 1AIFB 2CUIA 3MGAA 1OCZB 3UEZA 4DK3A 3CG8A 2DLHA 4RFNC 3KPRB 1PD6A 3COOA 2E9IA 1OXYA 1EXUA 5ISZE 1G6VK 1ZTXL 4LPXA 2LHAA 1E2VA 2RCSL 3R18A 3MBEC 4AVHA 1TTUA 2DWEA 2AVFA 5IHBA 1TF4A 4YBQC 3SDDD 1CFTA 5J6GA 3K1DA 1M3IA 2Y69B 2OW7A 4OQ1A 5E70A 3FB8A 4KMTH 5I76A 4QJ3B 5F93C 1OW0C 2D3VA 2F54E 5FOBA 1T7ZA 2AANA 3RGVC 2W59A 4KO5A 4F1SA 1RZIA 2RBLA 3O3UN 4HC1L 4ODXA 4OM0H 5INDA 3T4AB 4AK2A 1GW6A 2FJHB 4UT9L 3BPNB 5CEZE 5BUGA 4IQHA 1H15A 3V6FB 4FI8A 4KFMA 5FM5O 4MMXA 5FA3B 3QI9D 4HIHA 1LDPL 3B9KA 4L1BA 1FWXA 4JO1H 4Z7AA 4H8WC 5EIIG 4L3AA 5D1XE 2KDGA 4PGDB 2WPGA 2P1YA 5EHFA 5ISZD 1CFQA 2YGNA 1IBBA 1SUHA 4PJCF 1GPOL 5E4AA 3AY4C 3VTTA 5CCKL 5GS0H 2GB2A 4ZFGH 4RRPM 4Y4HD 1ZIAA 4IRJB 4DP9X 1FH5H 2D7QA 1N67A 1HKLH 3QZWA 2AI0L 3ARDA 1HINH 3HC2A 4DN3H 5MI0C 1OSZB 4BFOA 2R69L 4EI5D 3ALWA 1A5FL 3MBEA 3PAVA 4WUUE 5ITBH 4AJWA 5HVWA 5T33H 5CEZD 4JHBA 1Z9NA 1KB9K 2MRYA 3BWAA 1N18A 5IV2A 4JPIA 1PPIA 5D1QD 4E5XG 2FBOJ 3QR2A 2BW5A 4U0RC 1X5YA 5DVOA 3RVUC 1D9KD 5TDPB 3FO0H 5I17A 2F8XC 2WQAA 3Q2WA 1KBGH 1SXNA 5D1XD 1OW0A 2CMRH 4LFHD 3RGVA 5CSBA 3X1BA 4G42B 4N2GA 4AC2A 4I5BB 1RL1A 2AXFA 3UERA 5JORA 3MRQA 3DBSA 3OKMB 1REIA 4S2SA 1EAQA 1FHNA 3V55A 4D0BB 4WFFE 4KXZH 5J1TC 5DVMA 3TM6A 3L4VA 1G7QB 4LBEB 3QZLA 5DD1H 3G08A 2QKIC 3VU1A 2WO3B 3MLZH 5HI4C 4AV4A 2R2BB 2V2TB 2FIRT 5L2KA 4GXVL 4LAQH 2YPKB 4OIIH 3FQWB 1TZIA 1CL7L 1FA4A 1QNZH 3IBEA 4MA3A 4XCNA 4WUUD 2C9QA 4LASL 1A6ZA 2X4RA 2RR3A 2IPTL 3AY4A 2WVTA 2WXMA 3IE4A 4PP1D 5I8EB 2VR8A 5EZIL 1ECYA 2R4SH 3NCWA 4HALA 4ONHA 3PGDA 1NMBH 1GGIH 2YWYA 2W91A 5ECJE 1TR7A 4LARL 1U8IA 3C12A 3CZEA 1YQVL 1S4IA 3AREC 5FYKE 5EIQA 2V2XB 5EU4B 3MV8E 3BH9A 1YG9A 2A77L 4FFYL 1C5BL 3DO3A 2OBGA 1H5BB 2AABL 1AXTL 1ZLDA 3QNYA 4WFFD 2W60B 4NQDA 4JN2A 4LPWA 1EGJL 4JPSA 1A7QH 1E4WH 1KJ2H 2C9XA 4X7FC 2GBVA 2VB5A 2XDHA 3KXFD 2X7LA 4IU3A 4LHUB 4ZW5A 1E8XA 3OKYA 4P5TA 4LT7A 2VZOA 4Z77A 3VXMA 2YD1A 3FQRB 4FFVD 4KRMB 3IRPX 4UWQB 5C9JB 1G9MC 2DMBA 2WNGA 4NKMB 4U2ZA 3RBSA 5EBMB 3CVHA 4UM9B 4OFYD 3OQRA 4RZCB 4UAOC 5CJBA 2HJLA 1IC0A 3QGVA 2Y2YA 5J3HD 5FYKD 4CW1B 2MWCA 4Q6KA 2CWRA 4L1HA 1KJ3L 3MV8D 1OB0A 3IJSA 4PJ8C 3QDMB 4AQEA 2OMUA 1H3PL 2CA3A 2Z0UA 3O8XB 4G8GB 4GAGH 1MJJB 2BOBB 5ETUA 4L4VE 4MHHG 4TNEA 2DDQL 4TLTA 5JHLH 3VW3H 1DFBH 4NCC2 2R2EB 3PE9A 3S8WA 5L2JA 3AREA 4HUWA 2LU4A 4X6DB 5AZ2L 4PGEA 4LCWB 2DTSA 5BOZG 1QFOA 1ESOA 4JG9A 4RETB 3D2UA 4WU7A 5GGVL 5E24E 3NSFA 1SLWA 1BVKA 3GMPB 4XI5C 2DI9A 1S9VA 2FWUA 4EZKA 4OZGF 2OMWA 1BF8A 2Q7YB 4EIGB 1BVLA 2A9ML 2ITFA 2JKIS 2MOQA 3K6FA 3EYSL 2EKJA 4YN3A 1PKQB 1U42A 4PCTA 1PY0A 1G9NL 1F3DJ 2MFNA 1EHLL 2VDNB 5T1MA 1QFWH 4JUTA 4Y2OA 4BINA 5M94B 1NMAL 3W9DA 3T2NH 5KVEH 4OLWH 4UDTA 1JGDB 3PQYA 4L4VD 5C0NC 1Q72L 3V4PL 1ACCA 1HYSD 3A6OA 5D7KE 3FUDA 3B9DA 3LQAH 2J4WH 5DEZA 5I30L 1EBPA 1RZ7L 1IAKB 3BIKB 4X80H 2D3LA 2AEIT 2CXGA 3UIYA 5JTWA 3VDAA 5TF1H 4PJ8A 2VZTA 4CBZA 3Q1SH 5EU3B 3FU3A 5L8LB 3GRWH 3OJDB 5D7EA 4XVTH 5DUPL 3QNFA 1NCUA 3QHFH 1ET7A 1RZJC 2NXZC 1KIQA 1B88A 1XZ0A 3MRRB 4HIIB 4TULL 1VACB 2AQ2A 4L8BA 3OZ9H 5T1DL 2YJLA 2NY3D 4KAQH 4N22A 1SYSB 1DVFB 4J2QA 5DD3H 5I1GL 2N0MA 3K0YA 1MWAA 1QKZL 4PIBA 3TU6A 4JFEA 3VGFA 2GFBB 3DVNB 3SDXA 2EZ0C 5DJZB 2XPGA 3O11B 4UB0H 2E74C 2VWEC 2WLZA 5D7KD 3VFTB 3P2DA 4ZUTA 2F53E 3W5NA 5SWSB 1DEEB 1KLUA 4IDJL 4MB5A 1G9HA 2DBJA 4MWFA 2CKBA 1BLIA 3VGGA 1NBVH 1XF2A 1AZVA 4ISVA 1H0DA 3UH8A 2LLGA 3ZHDA 2DQGL 3ABGA 1N8ZA 3GMRA 3ISRA 3IGLA 4QOKE 2AJSL 3IJ7A 4WJ5A 4BXSV 5TDOB 2CPCA 4X4XB 3UIZA 3VDBA 5D5MA 3UC0L 4KTDL 3BT0A 4N6RB 2Q76B 2YZ1A 2J2ZA 3B37A 3AG3B 2XVKA 1E27B 4RMUA 3F7YA 3QBTB 3TCTA 2DQCL 3THML 4BIKA 2PR9A 3GSVA 5JXAL 3WHE0 3P9WB 2EDMA 3V0VA 3QAZC 4ORZC 3MX0A 1NM9A 1P84J 2HT4D 1HH6B 3VH8A 2LFEA 4DZBB 2F53D 3MO1B 2ZJSL 3LHPL 2P5WA 1IARB 3ARBB 2DLTA 1XTMA 3CPLA 3P02A 5KG9A 1MRCH 3KYNB 5HJ3A 3ATFA 2VQTA 4LCIH 1SVZA 3N44B 3ZO0A 3E3QC 2ODIA 1MNUH 3HHMA 4EUPA 3PPSA 4QOKD 2H5UA 1F2QA 3D39B 1IQWL 3HNTH 2NSQA 4QCIB 4GBXD 3P1VA 4XT1C 1ICTA 1VCBC 4Z7QE 4ETQB 5T3XE 4WW2B 3EH1A 2PTVA 5IW1A 4AL8L 3C6LB 5JPNB 4PWGA 1M05A 1PCSA 3PP4H 2PCPA 2B5IB 4FN0A 4K5LA 4ZDHA 5C0AB 1MFMA 4X8JB 5HHVH 3HFMH 2CRZA 2APFA 2J8UA 3HPJA 4A6YA 1M2VA 2HLFD 1WIPA 4XN1A 2IWEA 2A9BA 5I5IA 2AQNA 1ACXA 3S3CB 2CK0H 3N43B 3FO1B 4JX0A 4YO0B 3UZEC 4Q14A 4O02A 2VLLB 1ZEAL 3TH4T 3G5YA 1JUFA 2Y7SA 2HLAA 4O9HH 1AS6A 1RUPL 1R3LB 2Z64C 4XN4A 5LNDA 2DEXX 4PUBL 4ZAKB 1IO4C 5T3XD 1JERA 4TTDD 3DX9B 1I3GH 5LGHH 4DPAX 2EIZB 1L9OA 2ZWZA 4UIMB 2NY5L 3NIGB 4F7PB 5I6MA 1T5XB 3FOMB 5E2WH 12E8L 3U0TB 1OCCB 5JDJA 4LRIC 5HYQB 2L7EA 2XQYG 2BS8A 1W8EA 3S3SA 2IBBA 4N0UE 3LY6A 2AJVL 5L8KB 1XAKA 2E7HA 1NPJA 2EQDA 4HWBA 2AJZB 4LLYB 5LAXB 7TAAA 2GT9B 1R3JB 1B4TA 5IFJA 3OKLB 4ONGL 1RFDH 3UBFA 2QKSA 5JA8B 4APQD 1S9YB 1UWEH 1VZHA 1D5ZA 4HOWA 1FAIH 4R96A 2EXTA 1IMHC 1N12A 4XOEA 2WBJC 2EC8A 4XTRD 2C9AA 1TT6A 2WXFA 2DN7A 3CZJA 3RAJH 4L4TA 1ZT1A 4JZJC 1YMMA 2ZXBA 5L7XL 3UZEA 3JYCA 3ASOB 4I8DA 5EOCL 3ZO9A 4WWID 3PDDA 4YXKL 2Q8BL 4YVUA 1YY8A 2ZICA 4J7RA 4YHMH 2OK0H 1BOGB 1CFVL 3KYMB 5KBMA 4QRTB 4XBPA 1MCKA 1FP5A 2MOGA 2PYEA 2XSKA 3TV3L 4POYA 5BNXD 1AXSA 3WEOA 5L9DL 4LEXL 4RGOL 1DLHA 2ZWLT 4HW6A 2QQQA 3K4AA 4L37A 4PJCA 4QXTA 2WZPA 4XN9A 3UTZA 4ZMPA 5I66A 3IFOB 3IDGA 3LQZB 5CBAA 1RZQA 2V3FA 5IMMB 2FTAA 4LCVA 4URTB 4PPTA 1VDGA 2PPEA 4GAYB 2VDOH 2D4DA 2W94A 1A1OA 2WTRA 4XP9H 5B7EA 3ZSTA 1KELL 1W0YT 3N0PB 3IJEA 1U8QB 1NC2B 5FLVA 4PS4L 5KVEE 1MEXH 1WJ3A 4G6JL 4ODBD 4CRPA 5FYJE 2QR0B 3TC9A 1DDHA 2QDWA 2EC9T 2WBJA 5SWQA 2MHAA 4MA1B 4IKJA 2LAAA 3FUHA 5LO7A 5I28A 5IWLA 3JWNC 3PJSA 4RAVB 3PWNA 2CDEA 1XEUA 4ANVA 5GGRA 1ZXKA 2VW7A 3SKJL 2C4FT 2NYYD 3RI5F 2JCCB 2YAOA 4JZJA 4RFOH 3SKNB 4AZ8A 3IPEA 4J1UB 3MUUA 1K6QH 1RZ8B 1DQDH 2K4WA 3OB0H 1ASQA 4IKIA 1T1XB 4KO9A 5DEGA 5L6YH 4JCLA 1Z9PA 1Z9LA 4BWWA 2VQ4A 4FXGB 2COQA 2YGPA 1WBZB 3UTSE 4MXWL 3TP4A 3CHXA 5D70L 2Z8VC 5GSRA 1K4CB 2M83A 3EFFA 2ESVE 5EIIB 3GKWH 4WI3A 1RHHB 5D4HA 1BAGA 1KJMB 2AQTA 1RIHH 4QRFA 2OQJB 2ZT9C 1S7RA 3WUWG 2X0UA 2VXSL 5DK3A 4HULB 5G2NA 5FYJD 3SO5A 1JZHA 2IWKA 3TGXA 1BQLL 1XGTB 2R0WH 3QEHA 4FZ8L 4P9MH 4PFEA 5TE4L 4H1LG 1GZHA 1T2QH 3W37A 2XWJB 1KTLA 3N40F 1KN2H 2FJHA 3T4YB 4MXQC 1A8JH 3FMGL 3V6FA 5FUZL 1IM3D 3BKJL 5FA3A 2X1XR 4U4BA 4DKTA 1KACB 1AFVH 1P7QB 2X89D 4OIBA 4LNRA 3SBPA 3N1MC 4WTWA 1KCVH 3L3IB 4XPTH 4PGDA 4LSQH 3VACA 4R26L 1PZBA 4JO4L 4D7BA 4E5XB 3UTSD 3SZKC 1DYZA 2V9UA 4WSGA 1KFAH 2ESVD 4XC1H 3IKCA 2F15A 3LS4H 5EZPA 4G43B 3O6KH 4IRJA 4TQEH 2H2SC 5K9QI 2GEQA 1FGNH 4JRXB 2D03H 4XCCH 2DM7A 3RWIA 3T04D 2VQ1A 3WUZA 4HOXA 5JNYB 2VN4A 1XH0A 1QX1A 2PCYA 2G9KA 5IB2B 3KL5A 1O7DC 4MJ6B 2VR4A 4GG6B 5E4EB 3QP3A 4DQOH 3S5LA 4BFJA 1E6JL 4U7KA 5DURD 2QVFB 4XVUD 1IC7H 2DQUH 2XA8L 1SNRA 1PG7L 2BNRB 1KPUB 2J7LA 3JWOC 2ICWJ 2NMSA 3MI6A 2G0KA 4Q97A 4KJWD 2Y23A 4P9HH 5EFIB 2EXSA 3X2QB 3WIIH 3ZIMA 1GOFA 4ZFOL 4MFHA 1I7ZB 3VAEA 4U1SB 3HE6B 5CZVL 3V4PB 1HQ4B 3EFDH 3KPSB 2EEFA 4GI8A 4G42A 3JVFC 4DP6X 4IOSD 4Z3TA 1HZKA 5ALCH 2FR4A 2JKXA 3OKMA 1ZXQA 5DC0A 4F7MB 2V17H 3HMXH 4G80B 1SDAB 3RQ3A 2JH2A 1NDMB 3S4SG 5E5LA 2DWTA 1G7QA 3K2UL 4C8XA 4IBYA 4LBEA 1LD9B 2GUYA 2R2CA 2F1AA 1EK3A 2V2TA 5I19L 1G94A 1YO4A 1YEWA 2XV6B 2YPKA 3FQWA 5AYUH 1QR4A 4PSPA 3DX0A 1L7TH 4OLZL 5GHWH 1TYRA 2KZBA 4WI2A 4EOWL 1CGUA 3GXUB 3O8XC 3DX7A 5I8EA 5AYQA 4DAGH 4Q9QL 3MRHA 3QR0A 4ORGB 4HWUA 1UM5L 5IOPA 3U0PB 4P07A 2CGRL 4R2GD 25C8L 1RAMA 3G6JB 4BZ1L 3PP3K 2ZXQA 5CCGE 3DDGA 2ZXWB 3S34H 5EU4A 3X1GA 4TXVB 2YSSB 3F83A 4X0NA 3CFMA 4PGZA 4JQXC 5I1IH 3M17B 1JVOA 2Q3ZA 5CP3H 5JR1L 2H8PB 3CQFA 1IQDB 4KVPA 4LDCA 2W60A 3MDJA 3AY2A 3MODH 3WMSA 4NM8H 1LP9F 4OZIB 4KKBD 4H20L 4LPTA 4JUSA 3ML9A 5C8JA 1G4RA 4LHUA 4AKOA 4BCYA 2G5RA 5I6NA 3QDGE 3SPIA 4BZ2H 1HTYA 1UFUA 4GMSH 5AOKA 2HVJB 5C0CB 1DQTA 3FQRA 5F7EL 5EC2B 3G7TA 5C9JA 1Z2KA 3D4YA 4NKMA 1GHFH 1NKGA 2V2WB 2BMKB 2APWA 3IE9A 4UM9A 2DQEH 4K4KA 1KB5L 2IH1B 2ZYRA 1D5IH 1AMYA 4FHKA 1HYSC 1EZSA 4QRAA 4DPRA 3B8SA 2BNQE 3VD0A 3QDHA 3QDMA 1SEBB 1GCFA 4HV8B 3O8XA 4G8GA 3BI9X 2BOBA 3MRIB 4FG4A 4G72B 2E75C 2YAPA 5AAPA 1MREL 2XV2A 2X3BA 1W9XA 5KAQF 3MV9B 4G7SB 1KCKA 4X6DA 4ES8A 3UCRA 4XMTA 4LCWA 3PYCA 2FEEI 4WTZA 1YC7A 2Z1PA 1DVFC 5BO1H 3ZTJH 1EVTC 4JQXA 5EA0L 5IQOA 2AJUH 3ABKB 5HJGA 4DPCX 3GMPA 5DUJA 3NJJA 1NCTA 4XWOC 3D9AL 1JGVH 1ORSB 2NCEA 1RZGB 3NCFB 4NI6A 1MCDA 3P0VL 5D8JL 2Q7YA 3SQRA 3VXPB 4W9EC 1PKQA 3EO0B 3SO3C 3WTYA 3HI1A 3DPBB 15C8L 3O2DH 3QUMH 2BNQD 4QKXB 2PWFA 2GI0A 1W2KT 1WCBB 1TTRA 2YEVB 4JY5H 5IW3A 2O61B 4PMEA 2X4SA 2XTJE 2YMTA 5B21A 2Q3XA 3ZU8A 5MENB 4HKZB 1C5CL 2BRRL 1JGDA 5FGCB 1EMTL 1NC4B 2UX7A 3H55A 3FFDB 2WCSA 3MXVH 3RVWC 1N64H 3LNGA 3T0AA 5B8CA 3E38A 3EF7A 3UAJC 1GY1A 3AS3A 2WAQA 3I6KB 2C7UA 2DQTH 2W07B 1HIML 4E41E 2DMCA 1IAKA 4JFDB 4JQIA 3EHBB 5FK9B 1JPST 4KQ4H 4KXDA 3ORJA 2ISDA 3WFBH 3T2PA 2C34A 3BFWA 1BIIB 1MLBA 3BVNB 3UJJL 4KPHH 2KKQA 3N5AA 3OJDA 1J05A 3U7AA 5C6WH 4KFZC 3U1SH 5E2TH 1Z5LA 3D08A 4DUWA 3MRRA 2EACA 4F8OA 4HIIA 4K8RH 2RQEA 2MCPL 5ILTL 1GAFL 2AJ3B 3V4VH 3GIVA 1ZGLM 4W9JC 1SYSA 1CXIA 1DVFA 2FGZA 3KBEA 3O0RH 4JFTA 4HU8A 1CL7I 1J48A 5KS9E 4XXCA 2VAAB 2XTJD 4XNUL 3HI5H 1BD2E 2GFBA 3DVNA 3VGBA 5DJZA 1GYAA 3S0PA 3FN0L 2L7QA 3O11A 2HG5A 3L16A 4OGZA 4MX7A 2FATH 4BRVA 4ZO9A 3VFTA 3TBSB 3DX2A 2QQKL 4E41D 5SWSA 2CDGB 2DICA 3VE0A 1WAEA 4QO1B 4G5ZL 2OMBA 1V3MA 4ILDA 3QDJE 4W81A 2BVUA 5IJKC 4DETA 3ATAA 3PWVA 4Y7MA 1AQMA 3R1GL 1NGWB 1PZSA 3LCYA 4PRBB 4X4XA 5TDOA 1A3ZA 5EN2B 4N6RA 3UAJA 4TV3A 3VVWA 5J8OA 4KV5F 5C07A 1L9PA 3EYVA 4I1NB 1CO1A 2OULB 4PJEB 4LDLB 5AZUA 3L48A 4X9YA 3ZDWA 2WBKA 4AYDC 2JKNA 1EZVY 2CO7A 3I9GL 3IAQA 5BJTB 4YHOH 4K55A 3WNMA 1V3LA 3ULUH 1BD2D 1MG3C 5E5UB 3VFVA 3WEBA 3MRMA 4BFFA 4FQIL 1HH6A 2BCKB 3OAYK 4HPHA 1CBJA 4DZBA 3LDBC 1SOSA 5FX3A 1CBVL 3ARBA 4YR6A 1M4KA 5DZLA 4S1SL 3KYNA 4P59H 3OAUH 4K0OA 4YSSA 5CJOH 3GBEA 4GRWF 5I6XC 4PJIF 2DTML 1TQVA 1MCPL 2CIIB 2ZCZA 2I60L 2FT7A 2ICEB 4NC1E 3QUYD 4XVSL 1J5OH 1VIWA 1B0GB 5HVFB 3AADB 5F7LB 1YMHB 4I18C 3C9NA 3GS4A 4E9SA 4I48B 1XHHA 2FYVA 1WITA 5JPNA 5E8OA 32C2B 4S1DD 1KIRB 4PD4K 2KC0A 1FFOB 5C0AA 4QHLB 1S3KL 1LNUB 1TQUA 4PV1C 2E9BA 1J0IA 5HI3C 4KITB 4LVNB 3NBNA 2ZOLB 4QXVA 5EV7A 3QNXB 3MREB 2B77A 1AVAA 1UJ3B 4FF9A 1PEZA 3FO1A 3AXHA 3MRCB 5EOQL 2VLLA 4X5XB 2B1HL 2L7JA 2R8SH 2EXWD 1UOLA 5FYLD 2IGFH 4G9FB 2GIXA 5AAMC 4WZ9A 3KVDD 4HCFA 1R3LA 4R7LA 4XNYH 4RDQG 4ZAKA 1TJXA 1YN7B 2M8XA 2YKKA 3RNKB 4H44C 5DVPA 3BN9C 3DX9A 3EGDB 4J3OC 3IDYB 5CF3A 4UIMA 2JLPA 3K8KA 4UOW0 4X4KA 5F6IB 3BZEB 1T5XA 3ECVA 4HC1A 3FOMA 3U0TA 5JW4M 4H8WH 4B96A 2WYHA 4WI0B 3UXFA 2H7WA 3LPPA 5HYQA 5LNGA 2ZUTA 3EH2A 4TRPH 1P2CB 3LNHA 3I02B 2YUVA 1AE6L 1A0QL 5BZXA 4OF5A 4DGVL 2VGLM 4I89A 1BQHG 1SEQH 1XSIA 4I18A 5BZDB 3DVGB 1J1OH 4FTDA 5LAXA 1R3JA 4HK0A 3OKLA 2OX5B 3DGDA 4NKOB 4P2QE 2HAZA 1OGAA 4I2XE 3C87A 1IIIA 4TVPH 1U3NA 4X5PA 3EJYC 1WZMA 4NN7B 4ADIA 2GJ6E 4TS6A 3DRQB 3PY9A 4KZEL 2VKWA 5CMAB 1UM4L 5LBSL 3L4WA 1QZ1A 1IC4L 2HWZL 3TEXA 2X4TB 4AGOA 3QIBB 1EXGA 4JFZL 4ZTEA 1IC5L 3KCPA 4GQ9H 5AAMA 2WKGA 1I7RB 5KUKA 4TQ8A 3TO2B 1OO2A 4ZRGA 3KYMA 4BSVB 1YEIL 2DLGA 2JJTC 4ZFOB 4QRTA 3VRIA 4MHHI 1A6WL 4OT1L 1ZSDB 1CB4A 3U9UA 4JMXA 3CVHH 4UYPA 1ZOXA 4TL4A 1PAZA 3TFKD 1N6QH 4P23D 4GSRA 4P2QD 4M1GH 5T1LB 3PAYA 2WXNA 3G5ZB 3V6BR 5IT2L 3FO2B 2VYRE 3IFOA 3KVQA 2C1OA 3LQZA 5CBEB 3RWFB 4Q0XH 2GJ6D 5IMMA 4HKJA 3O6LL 3ZL1A 4HIXL 3FT3B 4GAYA 2C3VB 2XJLA 1M2OA 3AG2B 3CFDB 3PREA 4HKBB 1TJHH 1U8QA 1YZZA 5LVEA 1NC2A 5AFAA 4M5SA 2JJSC 3ZL4H 7FABL 2QR0A 2J25A 3L9EA 1D2OA 3J7HA 4RCAA 1ZLVK 3VI4B 3WUWB 3MXWH 5EEVA 1BFVL 1ZS8A 4IOFC 3UCQA 4WEBH 1PX4A 3SKNA 1E3XA 5LNEA 1H3UA 3ZTEA 1IT9L 3F7LA 4FFYA 1NCCH 4MBRA 3UP1A 1DZ0A 1RZ8A 2G2PA 3D0LB 3WE1A 3U82B 1J9TA 4UOJA 5PCYA 1DBAL 1MG2C 1JDAA 4FXGA 3NJGA 3C5ZB 3I3BA 3QIWB 3VXPA 2JJTA 1EGJA 1WBZA 3IDJB 4P06A 5E4EC 1M7DB 1SM3H 3TF4A 1M53A 1S7TB 3L3GB 2C1PA 3QZPA 3WE6B 1NL0H 1G9MH 3FQ4A 4J39A 4R4FH 3WG7B 5EIIA 4I1PA 4WO4D 5DMIL 3HN8A 1QSVA 4F91B 1XH3B 1RCYA 4FYQA 3VNZA 5I2IB 3RTLA 3VXRB 4FMVA 3BAKA 4HF5H 3HE6C 1RIUH 1SBSL 1OT2A 4N0CD 1KB5B 1GC1L 5LLIC 5IFAL 3EBHA 2KLSA 3ARGD 4FNRA 1CD0A 4F7CB 2PP9A 1R47A 2ZYIA 1ACYL 2EXYD 1AGBB 4PRHE 1CGVA 2JJSA 1SJMA 4DK5A 4M7JH 2BXYA 4NN5B 3IJHB 4M29A 5F7WC 1SRDA 3L3IA 4KKCD 1UB6B 3Q44A 2HUEA 3VXSA 5HYSB 4E5XA 1IBGL 3SDAD 5A3IC 2ZAIA 4NQCD 3ZMEA 1HHIB 4PCSA 4YGAB 3U9PL 5EF1A 4V2CB 3SQOL 4G43A 3GI9H 3U2JA 1OAZL 4AM0A 1F1DA 4X6FB 5JNYA 2DIAA 5JMOC 2CKBH 3NT0A 2L04A 2QVMA 2IJ0C 1NBCA 2MH4A 4J3VA 2JV6A 5IB2A 4MJ6A 4GG6A 5I82A 2P8PA 1J8RA 3S4SB 1T1ZB 4N2LA 1SGKA 2QMJA 3MV7E 3BT2L 1RU9L 4OJCA 5L4JA 3GSQB 1KTBA 1XX9C 1KPUA 5EUOB 4U1JB 1MH5A 3HG4A 4PRHD 3EYFA 5EFIA 3KGSA 1JV2B 1A3RL 4ZOCA 5CEXB 4ZSOE 1I7ZA 4U1SA 3N1FC 5D2LB 3HE6A 1T66D 3V4PA 4H8PA 3ZKND 3KPSA 3O4LA 4G6AC 4R8WL 5IGXH 4JMNA 1OP3H 3O6ML 2PWDA 4M3JA 1YC8A 1RZJH 3QNZB 4PLOB 4F7MA 3KPNB 3GPEA 4G80A 3DDFA 3OG6B 2HX7A 1NDMA 3O6FC 3CVIH 2VOTA 1OP4A 1G9EA 4HWEH 1DQJB 1LD9A 1NMCB 2ORBH 2CG9X 2HKAA 2UWEB 5FHAL 3F04A 4H40A 4NHCL 2CGZA 2YO3A 3QEGL 4MD0A 3G6DH 1NOFA 4I4WB 5GPRA 3NK4A 4UAHA 3R06B 4YHZL 3MV7D 4EUPH 3UL4A 3L5XH 3HJEA 4PWIA 3SJVA 4B5EA 1LJMA 2H0PA 5C0IB 3O2WH 1A7OL 4ORGA 3V0FA 4PGBB 1L6XA 2NCMA 3V6OC 3U0PA 3LS5L 3FXIC 5DTFB 2OMNA 1A6TB 3G6JA 4KZDH 3KH4A 2OR9H 4FULA 1ETZA 2YSSA 4FA6A 3FUJA 4OJAA 4WFGE 4LZKA 1U91B 3LN9A 3M17A 3PGFL 5F9OH 1N7ML 4FNLH 3LZQA 1IQDA 4PRIA 2AEQL 5EC1B 4M48H 4KXAA 4AL8C 2K7QA 5KVFL 3BP7A 4U1NA 3HUJE 5C09A 3UBHA 4OZIA 3TPUB 2BSTB 1KCBA 4N5UA 4O5LL 4KROB 3NP4A 2CBTA 4HWNA 3ARVA 1OB1A 1T2JA 4JPKH 1WQVT 1G87A 4O02H 3NA9H 2QQNH 4YX2H 2VH5H 2A6KB 4K3JH 2HVJA 5C0CA 1FJ1B 1E9OB 5EC2A 4YHKH 1ZE3C 3WN5B 1M7UA 2V2WA 3O6FA 4LFHG 4Y19B 2CHXA 1FYTB 2X4QA 3NCBB 4F2MB 4WUKH 1UWXK 2IH1A 2BNUA 4F57L 5LWYH 3ZTNH 3HS0B 3WDHA 4JKKA 4R97B 1S7SB 1D6VH 3NJXA 1MUJB 4JHAL 4PHXA 4Y89A 2P44B 4XMZA 4WFGD 3IETB 3WEMA 4HV8A 3KGUA 2VXQL 3WGVB 1PU0A 2NY5C 2N7BA 2EIBA 2F9BT 2QVTA 4HK3J 2IAMD 4G8IB 3KS0H 4P2OD 2X6VA 3V6OA 5AVVB 5IQNA 1KZYA 4E36A 2XG4A 1M9SA 3MV9A 1K72A 2F1BA 2P5EE 1AI1L 5G4OA 1USZA 1P6FA 4C55A 3LEVL 4YLBA 3IJYB 3E7JA 4XODA 5KSVA 1E4XL 3ZMRA 3X3FL 1UENA 1ORSA 2H1LM 1RZGA 3A47A 4X6BA 4HT1L 3LXBA 2Y5TB 4LEOB 3CDCA 1YYMH 2IANB 4GKZA 4OD1L 3NTCH 3T8MA 4L8SB 2E76C 2ITDB 3EO0A 4DGYL 3BRDA 3FUMA 2H0JA 4W9FC 4ZS7H 3DPBA 4K71C 4GRMB 3GB7B 1WCBA 5M95B 2O61A 1LWJA 4QHNB 2XPZA 2YRLA 2FHCA 5DI8A 4YXLH 5MENA 1LO0H 1T6BX 4FQHB 4HKZA 1NC4A 3FFDA 4OZHF 3O2VL 1HL9A 1MFDH 4F8NA 1R3HB 5CD3B 2UUDH 3BUYA 3I6KA 2W07A 2Y5EA 1IM9D 5FWQA 4JFDA 1BHGA 2P5ED 5FK9A 5EWIL 3CFCL 1OE3A 1JZGA 3GQFA 3Q3GB 4Z3FA 5JQ6H 3ZYJA 1BIIA 1U41A 2KH2B 3BVNA 4Z7WE 4FABH 4PJXB 5AAWA 3QC5X 5LDSA 2E6PA 1CJYA 3L95B 5INCB 4JRLA 1WD9A 1I4FB 3D85D 4UOQA 5MEPA 2DV6A 3WFHB 4AMXA 3FT1A 2FYYB 3MRPB 2AGJL 3OHXC 5CEZL 1H6UA 4WNQB 2VDPB 2FHBA 4Q6IC 5FKAB 1LL1A 3D12B 5KTEH 3E8VA 1E5ZA 2VAAA 4R7NA 3CUPA 4PB0L 4ZNEA 1UT1A 2ZWSA 5JHBA 4UT6L 5CUSL 2B2XH 1ZD6A 3VGEA 2ICEC 1NFIB 2Z65C 1KEMH 4OCNC 4PJDE 3TBSA 1K2DB 4N6QA 2CDGA 5GISH 2X4OB 2WWMD 4D2NA 1R3KB 5I0YA 5I1EH 1QEWB 4QO1A 1R9FA 1FLRH 3BKCH 3K8MA 1JZJA 4OD3L 5CO1A 1IAIM 1TMCB 4HBCL 1PZCA 5I6OA 3RB7A 1NBZA 1SY6H 1AKJB 1UHVA 1NGWA 4PRBA 1YUHB 5EN2A 1RUAH 2HVBA 2MEJB 4ZXBC 1VESA 3OHMB 4LVNC 1VF5C 3E2HC 3WD5L 3QUZB 1SLVA 4OLYL 5DSCB 1TQWA 4PJEA 5AALA 1FNHA 4EIUA 3T0EC 1UJ3C 3HMWH 4KK9C 4QTFA 4WY7L 1SQMA 3RPIA 1ZANL 4BD4A 3A21A 4TPRH 4UV4H 3DJ9A 4HXBH 4L4JA 5AWNL 3O3EB 1V55B 3FH8A 5J5EA 4DUXA 2BCKA 3BDBA 4D3CH 1T5KA 4GUPB 1BJ1H 1PDKB 1VFUA 4FGMA 4OSUL 3PL6D 3F64A 3OHXA 3IDYC 4QT5B 5JIHA 1IGMH 5F6IC 1OF2B 3LRKA 1S8DB 4WNJA 4NB7A 4UNTA 3WAJA 3SKUD 4KVNL 3RY5A 2CHNA 4LEBA 1OT1A 1UKTA 5AVZB 3WU1A 2Z7UA 3P4MA 3JWNH 5E6SB 2Y06H 4WK0B 2ICEA 2HRPH 5F2FA 2LT9A 1IGTB 4G7VH 1KV7A 2JKWA 3L5WA 1WPCA 1MCQA 1P4BH 1W0VB 2J1YA 1YMHA 4WHYH 3H3PL 3NH7H 1X5FA 4I48A 1XGYH 3QO1B 3KWVA 2FBRA 4JFQB 4D9QE 2I7SA 1RZKC 2IDFA 4WHTB 5EO9B 3E6HA 4X99A 5KVGH 1I9EA 1KIRA 1XSKA 1FFOA 3IRCA 2ETWA 4YNYB 2PXYC 4P4KB 4NN7C 4QHLA 4AEEA 4UTBH 3FTSA 3RVVD 1LNUA 3MCLL 4DT2A 1UA7A 2IDCA 1VJSA 1DJWA 2XQYA 4PY7A 4O58L 3T0EA 1UJ3A 4XMXA 1X4YA 1HZHH 2BM3A 3M7FB 1FUNA 2XFXB 2R9HD 3H8NA 3MRCA 5GGQH 1OK0A 4X5XA 3VFOB 3UTQB 1BQHB 3OM3B 1TQCB 5LCVL 1KENH 5FM5M 3UTOA 3VA2C 1URLA 2H6PA 2YA2A 2V9RA 2Y3NA 1GGUA 1DL7L 5KEZA 2WXPA 1AD9B 4HWZB 4R7DB 3BX7C 4L5FH 2HX8A 3EO1B 4G6ML 4MNQE 4X7DC 5GSVB 3B7TA 4AIZB 1KCRL 3OL2A 4AYMC 1PNDA 4MKMA 3I02A 2BP8B 1F41A 2A9CA 4PSRA 3MR9B 1KIUB 4UV7L 4J8RA 3RA7L 4TOYH 4Q2ZB 1DJYA 3QS3A 3KDMB 2DL9A 5I16B 3V7AE 3NCMA 4WEEA 4ZT1A 1Q4NX 4WDIB 1MAMH 5JHDB 2PO6B 4LMQE 3CFBA 3DK2A 4FLSA 3RDTD 3S3DB 1L9TA 2VERN 4WV1C 1J11A 5LUMA 5HDBB 3B8YA 3FPYA 1OHZA 4XNBA 2H26B 5CMAA 2BIPA 4ZMZA 3ESMA 3H9SE 3B2VL 3ZDZB 1HQRB 1TJIL 2WCGA 1Q9KB 2XJKA 2X4TA 3F00A 1UXLA 4MNQD 2VXTH 1Q9OB 1YNLL 2D0FA 1I7RA 3TO2A 2ITCB 2Q5BA 3C5ZC 4RDQF 4BSVA 4ZFOA 2CO6B 4Y16D 2AQSA 4WHDA 4A39A 1MFEH 1Y6MR 2NT1A 5CZXC 5E9DD 3WS3B 4B7IA 1ZSDA 4Q9RH 1FIGL 2Y72A 4I3SH 3STZB 4M6ML 2UVFA 1DSWA 4JN1H 2IBZY 3P4NA 4FQCH 4YHIB 1OARL 3NESA 2VDKB 1F90L 3G5ZA 2VLKE 3FO2A 5CBEA 1BBJA 5CZKA 3RWFA 2QPSA 4OF3A 3NFNB 2DRUA 4WWKD 4XO9A 5KANG 3FT3A 1OAQH 3CLFH 1QSED 2C3VA 3H9SD 4JO2L 3CFDA 4TKWA 3MLUH 4B41A 4KJPD 2W81C 3P69A 2IFGA 2NTFA 2P9RA 4MAYB 1BXUA 2ARJA 3HG1A 2KPNA 2Y3AA 4WV1A 4HS8H 3GSRA 3JVGC 4R9HA 3T65B 3BRGC 2H32H 3EO9H 3VI4A 3WUWA 1HI6B 1Y18B 4Z78B 4CVZB 1IC1A 2BFGA 2Z7WA 1F4HA 1L6ZA 3FSAA 4H1LA 4AYFB 1S7UB 2VJ8A 3ZHKA 2VLKD 2CHZA 2XQ0A 1OAJA 4Q8BA 1KXVC 2Z3FA 3FT2B 3CMGA 3BCDA 4LSVH 2PF6A 1E8WA 4GUCA 1AQKH 3C5ZA 3GLZA 3QIWA 4DOHB 3IDJA 4FEMA 2DQJL 1S7TA 2ZAGA 4OM0L 5HJDA 3HEIB 4XMUA 5AEAA 3EOTH 4A2LA 4Z7IA 2XQYK 3NAAH 4NZTL 1S5IH 4OZ4B 1XH3A 3BVDB 1WS8A 3Q6FB 4YFLI 5I2IA 2WC7A 1F5WA 5DT1L 4JQIH 3S7GA 3VXRA 2NUPA 4NRXB 5CU9A 4WJKB 1S78C 5AW0B 3RZCC 4MQXD 1KB5A 1ROCA 1ZLSH 2PCXA 2A73A 4YLQT 4F7CA 1YEKH 3CU1A 3ARTA 3FZUD 4H4NA 2F5AH 3OKEB 4ZFGL 3PCYA 4IHBA 1JZ2A 1CI3M 2XOTA 1HKLL 3LKPB 2FD6H 1BSIA 4CVXB 3IJHA 4FTVA 1XH1A 4DP0X 2H0FA 1ASPA 1HINL 4XMPL 3JVGA 2PR4H 1BWWA 4W70A 2NY1B 4G9DB 2CO4A 3L5HA 3V0WH 3KPPB 4I7ZC 1HHIA 3VM5A 4PGCB 2HT2D 3NRFA 3MZTA 1KLFB 4NJAH 4NWTH 4OLXH 1EUUA 2WLLB 3BUTA 4TSAH 3IF1B 3FKUS 2D7NA 3CE1A 2OCCB 4NFDA 1KB9J 1X5AA 3DBXA 4FLHA 3X3GL 4YDZA 4E9QA 4BA0A 4X6FA 4AQAB 5IMOB 3FO0L 2GSMB 5F7KC 5T3XL 2GY7B 2CMRL 4JM2B 4BWTA 2FX7H 4F7TB 4HFUH 3S4SA 4EAEA 1VEOA 4DKFL 2K6ZA 2ZUXA 1MCFA 1T1ZA 4ELMF 3TT1H 4BCZA 4AYSA 3H7BB 2ICES 4YSQA 1BJMA 1U4EA 5LN4A 5GS0D 1FRGH 1JV2A 4PYGA 2QEJA 4IJ3C 4N2CA 5DD1L 5CEXA 4O2FB 3TA3C 2YPLB 5D2LA 4X4ZA 2VLJA 1TFHA 3NGBB 3C60B 1C8QA 1B0IA 1OCOB 1QNZL 1LK2B 2PN5A 1J5DA 3ESPA 2IGTA 4KRPC 1ZHKB 5HJBA 4AKQA 3QNZA 3RVXD 3WXVH 5D7IB 3L4UA 5F71A 3KPNA 4J3WA 3NJVA 3D09A 4TSBL 3RVTD 1DEDA 1DUYB 5HHME 2FT6A 2R4SL 4M7KH 1EEUA 4WGVB 4Y4HB 3K2KA 1IL1A 1NMBL 1IUZA 4Z7OB 4LLVB 3UJIH 1DQJA 3MLXL 4AYID 3TONA 1I75A 2UWEA 3HS0C 3NCYS 3FPXA 4R97C 1Q9WB 3VX0A 4GG8B 1XF1A 4K7PH 1E4JA 5EU5B 4LLDB 2F54B 3LH9A 1FIEA 1GOHA 3R06A 4QRPE 3WNIA 1ZLVH 1JFHA 1PZ2A 5C0IA 3HPLA 2BX5A 2EADA 2XN9E 1O75A 1OALA 4PGBA 3Q8CA 5DJDB 2ARWA 3BAYA 3OX8B 2ODHA 5DTFA 1A6TA 3JT0A 3D0AA 1E4WL 3PWPE 2Y6TE 2EYSA 3FFCA 4OZHA 4LIQH 1KN4H 4DGIH 1HESA 1QPPA 1U91A 3IDUA 5DWUL 4WQOA 5IUCA 43C9B 3MUY1 2EECA 4ZZFA 4TLUA 3VWKB 5F7BA 5HHMD 5EC1A 3UMNA 5GS2D 2XWTB 1VEMA 4ECNA 2XBDA 4OZGE 1XD0A 5C70A 1RMFH 4HXAH 1ZTXH 2ATPA 4QJ5B 4ZX3A 1DO5A 2VR7A 2IH3B 2FQEA 4QRPD 1ZWIB 3HZYA 1QR1B 3OR6A 1FJ1A 2Z91B 4P5MA 1E9OA 3SE9L 2D2CC 3T8XB 3KWWB 4WO0A 3RP1A 3WN5A 1EBAA 1ROWA 3VQ2C 3BAWA 2XN9D 1F42A 4U2YA 4ZYKA 4A7SA 3VW3L 2VZUA 2WIIB 1CXLA 2EYTB 3FTXA 1ZVYA 3HS0A 1WFOA 4U7SA 1S7SA 1I1AC 3ARFB 3HR5B 4HC1H 5CIPB 3V0GA 3PWPD 1MUJA 4UT9H 3DWTA 4XX1E 2NY0C 3KYAA 4PJ7E 2FQFA 1LDPH 2A6DB 1SN0A 4G8IA 5AVTB 1IEHA 4ZUSA 3NSXA 4QKTA 3TN0C 1E90A 3SDCD 4GKNA 3QORD 3US9A 1E9QB 5DRZB 2F7RA 3BVUA 4ANKA 3BDYL 1GPOH 5F9WB 2FX8L 5DHMC 5HHNB 1DVXA 5M7QA 3IJYA 4Y4KD 3QHTC 4K23L 2BW4A 1U8OB 2OSYA 5I1CL 1F11B 5KVEL 3Q6GL 1WFMA 4NKDB 1JN6B 3U1PA 2AI0H 5FYJL 1AGFB 2XACC 3LKSB 1U8PB 3GM8A 2Y5TA 4LEOA 1ZK9A 3VXUE 2IANA 4C54A 4B97A 3LQAL 2R69H 3PRZA 2XQBH 5KBKA 1A5FH 4NQEE 2GK2A 3PNRB 4G8FB 4AYEC 2P80D 2PW2B 4GRMA 3KPLB 3D33A 3W1ZA 1BMWA 1OSPL 4QHNA 2X2UA 1CT8A 1G84A 3MLWL 4FQHA 4M93B 3R7QA 4XB3A 1DVSA 1W8OA 2F7QA 3QHFL 3S2AA 3N41B 1PBYA 4MLSA 1CDHA 5D4JA 3LNDA 5CD3A 4XXDA 1G1CA 3CN2A 1LXMA 2I9TB 4F37F 3B7YA 3K2IA 3Q3GA 3VRLE 1OF0A 3WNJA 5IB4B 4JFHE 5DS8B 4PJXA 4HVBA 3ABLB 3AROA 1SF3A 3HA0A 3L95A 4PJHE 2R29H 2CCLA 3DC0A 4JL2A 1I4FA 3TBWA 4UB0L 3ESUF 4GH7B 3LRSB 4QWWC 4YSRA 3RJOA 3WFHA 4LASH 4NQED 2FYYA 1NGPL 2QADB 3MRPA 4JPWH 2IPTH 3TWCL 1PMYA 3U48A 5EZIH 1SF5A 1TLKA 2GTZB 2HYMA 2L0DA 3NABL 1QRNE 3C5JB 2CNYA 1YQVH 4D0CB 3CDGB 3STBA 3GUFA 1PCXA 1NFIA 4KI5C 3UEQA 1JK8B 3DYMA 3KPMB 3MSPA 5CINL 3ZTDC 2J6EL 2A77H 2Y36L 4FFYH 4H26B 4L8DB 4A7QA 1C5BH 2JMRA 3LRLA 2HVKB 2GY5A 3GXIA 5LBSA 2AABH 4JGNA 1AXTH 4JFHD 5ACZA 1JPSL 1Q90A 2JELL 1HVXA 1EGJH 5CGYD 2DWXA 1NOAA 2QQLH 4I0PB 1YUHA 3C8HA 1UQSB 4M6NL 2A4ZA 2DM4A 4QF1B 3QUZA 5DSCA 5ICZA 3MRBB 2H3NB 5ADPL 1MRCL 1P7KB 1FO0L 1WA1X 3UPAA 5E56A 2CBPA 1F3RB 1BOYA 1JWSB 1GGBL 1KZQA 4LCIL 4A38A 3VJ6B 3M8OH 2ILLA 1OAXL 3O3EA 3F01A 1MNUL 4Z7NB 2CUHA 3WTWA 1OLLA 3U1QA 3M1OA 1WGOA 4GI9A 4GUPA 2AXHA 1PDKA 1KULA 1KJ3H 1NSNL 2AK4A 4KU1A 1GC1C 4JG1H 2VISB 1H3PH 2Q86B 2E9WA 4BDVB 3LKOA 1IBZA 3GBLA 3RTQC 4BK5A 2A99A 2DDQH 3QUXC 1FZMB 3G9AB 1WA2X 1A6VL 4LSDA 1IFHL 4N2MA 5EORH 2X2IA 4JKLA 1ID2A 5HHVL 5TQ2H 3GNML 3US0A 1IGTA 2B4CL 5A6MA 4R7XA 5AZ2H 4PVMA 1J0ZA 1W0VA 2YR3A 4N3TA 2Z35A 4ZOAA 2DW5A 1UWYA 2CK0L 3QO1A 4TQPA 4WHTA 5EO9A 3ZRSA 3IGKA 3K6DA 3MOAL 2X4UB 1E4XI 2A9MH 4ZMLA 1PS3A 3IK2A 3EYSH 3FTGB 3IGAB 4P4KA 4TNVF 2ED6A 4YNYA 4HS6B 1R75A 2KS0A 2BERA 4NPKA 4DKAA 4RESB 5C0BE 3TXAA 3EAKA 3GXPA 1NMAH 2JIXD 5LGHL 3ZJAA 4ZMVA 1G6RL 4Z76A 1MKFA 2XFXA 4TNWF 2BVEA 3EJZD 5E2WL 1Q72H 4ADJA 3CVCA 2GQHA 4IDLA 4X6CE 1Q1JL 3IMUA 4W1TA 3UTQA 1BQHA 3VFOA 4DFIA 1CPUA 5I30H 3T77B 3RL1A 3Q5TA 5IG7B 4K9JA 3MZGB 4MZ2A 1NUNB 2PWEA 1A65A 3ELQA 5J13C 3FTZA 3D3VD 4YSEA 3E1ZA 1YQ2A 3QXDA 1TVBB 1AD9A 4HWZA 4LIQE 4R7DA 1KNOA 4TNFA 3KLLA 5LG1A 1RFDL 1MXGA 3EO1A 4OM1L 1DSFL 5GSVA 5I74B 3SE3C 4HUCA