4ZBJA

Ubn1 peptide bound to h3.3/h4/asf1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
160
structure length
160
Chain Sequence
PLGSPNSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESLKHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVFSADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVNNEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Histone chaperone ASF1
publication title Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 31
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2015-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 4zbjA00
1TEYA 2Z3FA 1ROCA 2YGVA 2HUEA 4RRPM 5EIIG 2IIJA 3AADB 4EO5A 1WG3A 2I32A 5C3IA 5BO0D 2Z34A 2IDCA 4ZBJA 2CU9A 5BNXD 2DZEA 2IO5A
chains in the Genus database with same CATH superfamily
2CMRL 3IDMB 4JN2B 4R7DA 5F7DA 3S97C 1MLCB 1LQBC 1J9QA 2IADA 1KGJA 3CCHA 3EGDB 3SGKA 5TK2A 4WTWA 2BWIA 3C5ZC 3QEQE 4HOWA 1UENA 3HCVB 5L9DL 2RA1A 4G2AA 4OD1H 5DZJA 2OYKA 3KL0A 1Q1JH 2P5ED 3DV4A 1U30A 5E5RB 3BP4B 2XFXB 2Z7WA 4LCWE 3EJYD 4W9DC 1HILA 2X1XR 3MV01 3O41A 1OB0A 3HZMB 3FW6A 4TS6A 3V0WH 4I18C 5D7JB 2BSCA 4PJDF 3QNYA 5C09B 5I1LB 3Q01A 4G70B 4YEEA 1R3JB 5GGVH 2R15A 5D5MB 3LXAA 2OMXB 5JXEC 4AIZB 4ELDA 4PREA 4JO1H 1ED3A 4D2NA 3HZ3A 1JPFA 3HN8A 4WKZA 1CBVL 5MP6L 1X5HA 3HG3A 1PDKB 4JFUA 3MNZA 2J1ZA 3SJVD 4KRPB 2JKXA 3VD0A 1A7QH 2EDRA 4P2RE 1WHPA 3MCG1 4NPKA 1LK2A 5GGSB 4AEEA 1YDPA 3LSOA 1AKJA 3TIDA 3A23A 2V2XA 3DYMA 4XAKE 3CX5J 3NZUA 3QIBB 5AEAA 3MXWH 5AUMA 4BKLA 2L7JA 2XIIA 4AOFA 1MHPH 5LBGA 4TNVF 1X44A 4JFDE 4YPGA 4XNUH 1J9SA 1Q72L 4ZPVA 5HGAA 4APQC 5DT1H 2F1BA 2QQQA 4LLUA 4L29A 1XCTB 1UZGA 2PXYA 1KSRA 1WEJH 3SCMA 2R1WB 5IGXH 4HWEL 3RJDA 5F3BA 3LQZA 1S7RB 2V5SA 3MR9B 3S98A 5FYJE 2DQHH 1AMXA 4WNJA 3ZVVA 5I1JH 2IMNA 3U46A 4F7TB 3Q05A 4AMWA 2NW3B 4K8RD 5MENB 3HE7B 1QFWH 2ZCKH 4F9PA 1J05A 2W65B 3TCTA 1T0OA 2VW7A 4GSRA 4RAUB 1QQDB 4JJ5A 3FT4A 3GHPA 1JGVH 1IC5L 2QKSA 2PN5A 3KLAA 3N1GC 4ZO6A 2DICA 3EG9B 2QHRL 3RVXD 2ZX5A 3TT3L 3WTUA 1DBMH 3X13A 2CO6B 3BPLB 4MX7B 2UY7A 3E9UA 2GSIB 2J8UB 4PTTA 4HLZG 3T0VA 3MRJA 2X4RA 5K9OB 1FGNL 1UWGL 3C8KB 3T3PB 1NGWA 2GCYA 4XR8C 3FBKA 3GXTA 5HYJB 2X4UB 2CQVA 1XL6A 3AAZB 4ZAKD 5FYLL 4A2GA 3STLB 3RWEB 1GYAA 5DJ8B 4K7PY 4FNLL 1QBLH 5KTEL 4HIXH 2L7EA 3KBPA 1NSNL 4R96B 4TV3A 4ZMWA 5I66B 4NAJA 4Z7UA 1QAWA 3TZVC 2CIIB 3MNVB 2DWXA 5AVTB 3GS0A 4JPQA 4PJGF 4E9VA 2JKNA 1G1OA 2R0WH 2VLJB 3PAZA 4JHWL 3BQVA 4IM8A 4WEEA 2AF2A 1RZ7H 3CQQA 3L9RA 1DSYA 4ZXBA 1JXDA 3MBXL 1GHFH 4YSCA 2AXHA 2UY6A 1ZVYA 3PHSA 3QUML 5FGCB 3SGKC 4GW5A 3LKQA 3ZOAA 3G5XB 2OULB 3QCTL 1UWXH 2YSSA 1X7QB 2ZCZA 4MRBA 1P2CA 4RGOH 4XXWC 5KZCB 4X6CE 4WWKA 4XO8A 3HHMA 2AJUH 4MJJA 2AJYL 2CA3A 3EHBC 3VXQA 4X5XA 4ZW7A 4EN3D 1J0HA 4P5TD 2IANA 2AJXH 1ZLWH 1LO2H 5HHQA 2DQGH 1FG2A 5HPMB 2XN2A 4KHTL 2MQ0A 3MCKB 3FO0L 3MV8D 3PWPE 4KHXH 5EA0H 3U0PB 3S96A 3QH3A 2VMDA 4JPVH 1J5OH 1FORL 1WFNA 1XCQB 4W6XB 3ALXA 3HLAA 2NSXA 1JPSL 3LKSB 2BIIA 4UILL 4HJ0D 4DNLA 2WBWB 4MA7L 1Z32X 5ENWA 4PW9A 4IRZH 3ULUF 3GO1L 3ECVA 4PV1C 4UIKH 3QQ9D 1B0GB 2BK8A 5HJBA 4GG6F 3CFEA 5GSVA 2OJEB 2UXGA 3BZFB 4GP8B 3GXUB 3Q8AA 5FM4A 1M2VA 2DH2A 1MQKH 5BRZA 2BSED 1AS8A 4UOW0 1BFTA 2ZOTA 2EUXA 4EJ1C 4BFRA 1U6AH 3F5WA 3RVUC 3TJHD 3VFGH 1OK0A 1KENH 4WNQA 5AVZB 1S9VB 3VAEA 4OGXH 4NN7B 4XPHL 2VLKE 1JJUA 2XKSA 4R4FH 5LBVA 4B97A 2G9HA 3KYMA 4TUJB 3ILQC 3RZCA 1OCCB 4TVPE 4RH4A 5AKRA 3SCMC 5I6KA 1IBYA 1U92B 1YYMH 2FEDD 2VXTH 4G7VH 4H13C 2J43A 2WPGA 1CTOA 5E1AB 4PRDB 2C1OA 1FNFA 1ZA6B 2GJ6D 1AO7A 3QPXL 3KDMB 1AGCB 3FUFA 4HJGA 4MQSB 4F9PC 5I1EH 2VMEA 3TBVA 4MJ6A 4A39A 2YGPA 5T1MB 2JELH 4JKWA 1YMHA 3HI1B 4LB8A 4FNUA 1RVFH 4G6KH 5I23A 1U8PA 3GKWL 2Y7LA 4GO9A 2P52A 3X14A 1WC7B 2PWDA 1BIIB 3KGSA 3ETTA 3OKLA 4PS7A 2L8AA 1IL1A 5FO2A 4B96A 2QV2A 4NRZA 4GAJL 5AVWB 4QHNB 5TE6L 3VQ2C 2P48B 3HI5H 2VLRA 3IXAA 3NAAH 5EO0A 4Z7IA 5FB8B 3OJVC 3PHOA 1KYAA 3V0VA 4NZRH 1CICA 3G08B 2FYVA 4UIMB 3RTQB 2DWSA 2I7OA 4R97B 4PJEA 2QQLH 2YXFA 3KWWB 1CI3M 1N7MH 4NQQA 1IC4H 1RIUH 1CGSH 3QUXC 3SQRA 3UPCA 3H54A 2FUQA 2HVJB 5D1XC 2PNDA 2X70B 3O4LD 5C07B 3H3PL 3J07A 3LS4H 1UGKA 2W60A 3QUHA 4U3HA 5IHUL 4AK2A 4KDWA 4ZXBC 5FUOL 5GGTL 3WV0A 4PW4A 4B6ZA 4NM4H 3FPYA 2BW4A 5HP5A 2DQIH 2Z4QB 3WFCL 4DOHB 1NLDH 2IAMB 3QPQD 1RZFH 3DIFB 1JNNH 5I8OH 2VDQH 3VM7A 2BMKA 4UT6H 4A7GA 2OMZA 3MUJA 5B38A 3MJ7A 3BAEL 4CSSA 2YAEA 1BM3H 4OQTA 1PFCA 2P5WE 4XOAA 1Q9KB 2XLLA 3AXIA 2XWDA 5D4IA 2XY2A 1KEML 2J6WA 3HMXA 4MD0A 3VU1A 1VFOA 3DUSB 2YFNA 3IDGA 4Z7NB 4O51A 3UO1H 1OAYH 2PR4H 2ZPKL 1BAFL 3TO2A 4J2XA 5T1KA 1O6SA 2YD7A 4QOKD 2NZ1A 3L6FA 1EEUA 35C8H 2ZUSA 1WZ1H 1DQKA 2WBJC 2R1YB 3PJNA 3UADA 1XIWD 2Y7SA 4GP5B 2CLVA 4UZUA 1PCXA 4PSPA 1OP3H 4B9ZA 1X5ZA 3CDGA 4D7BA 4OZIA 1U2YA 1ZE3H 2WNKA 4ZUSA 4LCCC 3GXMA 3NSCA 1H3TA 3LZLA 2RJMA 2VXVL 2YFOA 2FGZA 1XGUA 1QNZH 3E38A 5JUEH 2PUQT 1QLFB 4XN1A 5JW4M 2YD1A 1V3KA 4PEEA 5SX4H 4Y2OB 4ZFZA 3HVDA 4FJYA 4X5QA 5DUBA 3QULA 3BQUD 3CDFA 3GSNH 4OIIL 2XZCL 2QQKH 5E9DD 3RZCC 2E7BA 2DLFH 2RHEA 4M8QB 5CKGA 1LEGA 2BJML 1WH0A 3AY4C 5KVGH 3CE1A 1KJMA 2UWEB 1QZ1A 5D1ZC 5GSRA 5T5NG 5L7XH 2HJLB 4LSDA 1T20B 4YDJA 5ALCL 1PG7W 3QG7L 2XUWA 4AGMA 3L5JA 3PWNB 5HI5C 1RUQH 4OW6A 2MRYA 2O61B 1L9NA 3BP7B 3I9GH 1CD1A 4KVNH 5DJDB 3TEZA 2J1WA 4PWKA 5TDOA 4OI9A 4PI2A 3HPLB 1X5XA 4FYRA 3V5KB 3MUZ1 2PCPA 3SGEI 1I9JH 1QI4A 4PJCE 4OV6F 4F9LA 2CHDA 1AY1L 3IJ7A 2O6DA 2P26A 4RESB 4BCXA 5I30H 1F42A 1FYTB 2R2HB 1HXYB 1ADWA 2JLPA 1HJCA 3WTXA 4W6YB 3NIDB 4DP1X 1KB5A 1ZANH 3APNA 1RJLA 1CICC 3GS7A 2Z93A 1G7IB 1NCWL 3BYTA 2WUBH 5IBUB 5I76A 3RFZB 1SLUA 1S4IA 2JB5L 3BT2L 5GGUA 4K3DL 4L2YA 4YL9A 3U36B 3QEQA 3EFOB 1OM9A 2IDTA 1Y1UA 2DQFB 4JUTA 3UZQA 1BAWA 2VDOL 3RY4A 5I19H 1T2XA 1GKOA 3K4DA 4LCWA 2HYMA 3SDXB 3W1ZA 3HZKA 2CKBB 2JKIS 2NT1A 5BXFA 3MLTB 3BIKB 3EO1A 1UT9A 2WNXA 4LEBA 4LOUC 3MJGX 3QQXA 4JFOB 3LHAA 4JFZL 3CFBB 4WI5A 3IMRA 1C9SA 1E30A 2I7SA 5HD8D 2VH5H 4YXHL 2D03L 2CHZA 4HMEA 1M7UA 2QGCA 3U30B 3VFPB 4CU8A 2RMNA 3OKKB 3HC4L 4KITB 5FFLA 1OSPL 2W38A 4WI0A 3V9FA 1D5MA 4PJBF 4XTRD 4BFEA 1RH8A 1A7PH 4QRFA 1TJXA 5CINL 5F3HB 5TD4A 3IDYB 4TULH 5C8JA 4P2RA 2NCMA 2DKSA 3WNPA 3MRKA 4FG0A 1PYWA 2OYPA 4H8PA 3JTSA 2QKIB 4PQXA 1FE8L 4XC3L 4B0MB 4S1DD 4J5VA 3HNSL 3ELAT 3G6JB 4JFDA 1CCZA 3GSUB 1NM4A 5DMIL 1BVOA 3ZSSA 5IT2H 2P43B 1DN0A 1BFVH 4V33A 3AVEA 1VFUA 3RDTA 2CXGA 4F8LA 2KC0A 4PBVC 5C97A 2BHYA 2O5YH 2R59A 4KQ4L 2NY1D 4LPXA 3NFSL 1PD6A 4L4TD 1GOFA 1GVIA 4RMQA 5IVXF 5J1AA 2AK4D 4IBSA 3FB6A 2VC2H 4Z7WE 3P4MA 12E8L 5F72S 1EO8L 3C9NB 3U2JA 4HGWB 3W11C 4LLVA 4E9XA 3IM1A 3F7YA 5FFGA 3MJ8B 4KTYA 4XBPA 4FADA 3TNNA 1JDAA 1I1FB 1R5WA 4C56E 2AJ3A 1I3GL 2XTJC 1H5BA 1I3UA 2VJ0A 4QRTB 5EZLA 2R7EA 1CDIA 2FWOA 5EIQA 1KBVA 3V6FA 4UV4H 3WD5H 2AMGA 1FFTB 1K4CB 1U93A 3PV6B 4DP0X 2Y0SA 3NJLA 4BFFA 3CSTA 3DX9A 4M8VA 1B6DA 3KBHE 1WPCA 3MREB 4YS4A 5J4MA 1AQDA 1I9RH 4RWYH 4FQQA 3HC3L 5ADPH 3WN5B 1XSJA 1JZ5A 1H6EA 3GB7A 1OV8A 2O6PA 2P5EE 4IBLT 4LHJB 4F8TA 1KBKA 4QXUL 4F9LC 4HQQL 3TVMB 4NQDD 1RP9A 2WQRA 4DERA 3VD9A 4IIQA 2DY2A 3ESNA 4IRJD 3VXOB 3G3LA 4APXB 3UGUA 4UQEA 2VE6A 3MRGA 1MCWW 1BF8A 3VB9A 1ODUA 4G1MA 4HKJA 1ES0B 4QCIB 5T1LD 5IEHA 4N2DA 5JOFA 4JE0A 3U2SB 2NY2C 4XE5B 1SY6L 1UZ6E 2WJ5A 3K6SB 4CRPA 2DMGA 5EWIH 3KPQA 1LWRA 1NLBH 4W70A 2PR9A 4H25A 3U0TA 1CLYH 1ET5A 3SJVE 1S7VA 1RXLA 3VFMA 2JIXA 4JQIH 4IK6A 4HV8A 5F8QC 4Z76B 4LSSL 3TO4D 1NCTA 1NH6A 2NXZD 3QUYD 4N8VG 2KS0A 5JW5A 1OWWA 3NABL 2VDQB 4D0BB 2J2ZB 2AABH 2K9UA 1H3XA 2I32A 1GJWA 3PWPA 5ABDE 2D7QA 4FABL 2KZKA 5BOZG 2I26N 3ROOB 1BF5A 3VH8A 1FN4A 3A3YB 3IFOB 1Y0LA 4HZLA 4O58H 3UTOA 4AT6A 2GJZA 2ZZUT 1NDMA 1E4WL 3CAFA 5FUZL 3V52H 4IGBA 4XT1C 4DKFH 3P54A 4I5BA 1N67A 5GRVL 3OXRA 4O02A 1UZ8B 4PJ7B 2DQDH 3MA9L 4HBQA 2JK5A 4PRIA 4Z7QB 4YSPA 1ZT7B 4ZOBA 3T2QA 1KBGL 3S36L 5CLWA 1D6VH 3VI4E 3DOSA 4W9CC 3U25A 3CMOL 3GHEL 2FT7A 4P4KD 4CNIA 1GZHA 2HFEB 3LKRB 5J3HD 4NKOB 4GBXB 1DVFB 4IW4C 3ISWA 3Q2VA 5H8DA 1A6UL 1QPXA 3S4SB 1U41A 4ZO9A 3N0AA 1XVSA 3H3BC 1NBYA 4H8QA 2AI0L 3KBFA 4NT6B 1JUFA 4OZGB 1RLWA 3UABA 1HHHB 2D7TL 5EF3A 3N91A 4K5OA 1XFPA 1E2WA 4PH8A 5C7XH 3ARQA 5EPMB 2WXHA 4GRLD 3V5HA 1NIDA 3A6CH 1NINA 5MEQA 1K85A 3RJOA 2UXVA 3D4GA 1OOAA 2ZD0A 4Y2DD 1MW2A 2HN7A 2DI8A 4MAUL 4KJWC 3L7FA 3SKOB 5JOPD 3QDGD 1MNNA 3LY6A 1H5BC 3TBWA 5IBTH 3GRWA 5ELIA 3A4EA 1GGBL 1FZKB 4FXLA 4QXWA 5D7LD 3MYJA 3VYPA 3SBWC 4JRYA 4P23D 4U49A 4AV4A 2H8PB 4Q0XH 3MV9D 4S2SB 1MRCL 1U95A 2JB6A 4CC0A 32C2B 3WHXA 4IQHA 3EYVB 3T8MA 1CWVA 3B9KA 1A7RH 3GIZL 3WFEH 5C0RH 3DWTA 1OXYA 5FR3A 4JFFA 2KZ1B 2PPCA 3E1ZA 1U91A 2WIIB 1JP5A 4ZAKB 1G9HA 1O9WA 1Z9NA 5DR5H 2QDWA 1FJ1A 4Y5VA 2WWKO 4GIOA 1ZS2A 1OAXH 1XGZA 3W0WB 4IIQC 4PUBH 2BRQA 1UHVA 4JDVA 5KS9F 4KKNA 1Q0EA 3CFMA 4DN4L 2YKLH 4Y7MA 2OX5B 1P6AB 4FL4B 5A2LH 4FA8A 4R7VA 5ESAA 4AL8C 5DD3H 2B5IC 3OX8A 2NDGA 3BKCH 3OZLA 4ISVB 3W3BA 5IHLB 3FMGL 1SMOA 5LDSA 1IGFH 1DFBH 1MCDA 3MV8E 4XP6L 1DE4A 5EU3B 3RL1A 1MXGA 4N2AA 4S1RL 2YXVA 1S7UA 1AD9A 1CU4H 3D9AH 2YD5A 5CZXC 3MRLB 1XR8A 4BQ8A 5EORL 1PFOA 2FECL 1EPFA 4UM9D 3VGAB 1AZUA 3HKFA 4UZSA 3BESR 2HX8A 4G72B 4YDNA 2N1KA 3PWUB 5EB9A 4BQBA 5HYSG 2P5WA 3MRNA 2WUCH 2A99A 3ZDZE 4GKNB 3JWDC 3QAZC 4W9LC 3B83A 1EJOL 1HWWA 1NGQH 5DRXA 1X7TA 4YSTA 4XNAA 1JSYA 1MFAL 5DYOB 1UA3A 4U1IB 5A2AA 5ALBL 4OFYA 5CEZE 2WVTA 4J3OC 3F00A 2P80A 1UXWB 2F5BL 5JPMC 1NDGA 2CUMA 2YBRA 4KX8A 4PP2A 4C83A 5B3NA 1ZTXL 2FIKA 5DJCB 2EE0A 3MBWA 4IGBC 2Q7AA 1J1XL 1EX0A 2BNRB 2UZIH 2AAVA 3HIZA 3GHBL 4ZSOA 5JIKA 1UM4H 5JPNA 2BX5A 2GJ6E 2GW5A 4LEOA 5F89A 3VFRA 3I84A 4WO4D 3R0MA 4RMWA 3RKDC 4MZRA 4UINL 1HCVA 4UDTA 5F97E 5J0BA 2BP0B 4BSWB 2B0SH 3IGLA 2Z0BA 3BUIA 3O2VL 1XZ0A 1I1YA 1ZKAA 4OV5B 1XF3B 3TA3D 5FCUH 1OZTG 4K7PX 4X80H 5DRWB 4J8RB 3S35H 2EIMB 4N8PA 1N18A 2WXLA 2E6JA 3F3HA 3ZUCA 2ZF8A 3CH1A 4LSPH 1GSKA 3QS3A 4HAKA 2MKLC 4WGWB 2Y36L 4YXLH 3ZMRA 4I18B 4K55A 1VERA 3UH8A 1MCOL 1RJZA 1QWHA 1RPQA 4R26L 3KYNA 3ALPA 4L1TA 1WCBB 1HXKA 3MMEA 4AM0A 1UOLA 1UKSA 2MOQA 3BW9B 4QKTA 4Z18A 1L9MA 3PL6C 2AEOA 4WW1A 2W9DH 2VLME 3NJFA 1L7IL 1NCIA 4PJCA 1TCMA 4PRHB 2JQMA 5FK9A 4OH2A 2XWEA 3O4LE 5DQJB 4L3ED 4GXUM 5CSBA 3SIKA 2QVKA 4QJ4B 3B9KC 4XC1H 2NW2B 3H56A 2Z4TA 2X4QB 4GFTB 2X6MA 2Z31C 1URZA 4KTEL 5EOTB 4ZPTB 1YJDL 3L5HA 3ET9F 4XPAH 3PGFL 4FQ2L 1B3JA 2GT9B 3WIIL 1OTUC 4Z7UF 5F1NA 2X1WL 1FHNA 2GK0B 2ZTBA 2XOTA 5D7IF 4DF9A 2AJVH 5CLXA 1SHWA 1DVZA 1S78D 2ZUWA 4HPOL 4Y5VC 5ILTL 3LPGA 3LXUX 1ESOA 1NAML 2KT6A 2X2JA 2VN4A 2CRZA 3COOA 4APQB 1T3FA 4JFYB 2VMCA 3MLSL 1JF1B 4ODHH 4DZ8A 4OFIA 4JDEA 2YIHA 1DVUA 2X4SB 4QOKE 5BZWB 3GSVA 1M53A 3RY6A 3HG1A 4ADIA 4LCIL 3LRLA 2HPTA 1JZ6A 1C1EL 5FO9B 4TUUA 1G9EA 1NJ9B 6TAAA 2GSGA 1B2WL 3FO9B 1Z0MA 2BZDA 1I8IA 4QRSA 1UACL 4D8PA 4MD5B 2Y4SA 1UB5A 4ODXB 5DJ0B 2OI9C 1F13A 1BVNP 1PQZA 3UIZA 3QS2A 4F7EA 4YWGH 1PY0A 2OR7A 4A7UA 1J9CT 5DS8A 3LN4B 3UC2A 2R69L 2JH2A 1BQHB 5EU4B 4TQEL 4MXWH 4JVPA 2G9KA 4PJFE 4XCNB 2N59A 3BI9X 3NSJA 4AKOA 4F3FA 1N10A 1UTDA 3NJIA 4FI6A 2X3AA 1E6OH 1CFQA 1E9QA 4GG8A 2IQ9L 2XXGA 4WV1A 4YZWA 1QVOB 4M6OH 3RBGA 4NJ9L 4P9ML 1WIOA 5C0CD 4MSWA 1GCYA 1E4XL 5E9DE 2F6AA 4FQXD 1TU2B 4X8CA 2FWLB 3L1OL 1BD2D 3F7PC 5IB1B 3Q8EA 5B39B 1YEDA 4UOW1 2FZ3B 1VGKB 3RPBA 1N0LA 4C4UA 5JPNC 5L8JB 3GK8L 1OGAE 2VITA 4RMBA 2HFFB 5E2TH 4RZKA 3TZVB 4UT7L 1YN6B 5FGBA 4P07A 1ZHNA 4BH8B 3W2DL 3QUZD 5T5FA 2C26A 2ZKYA 4Z7WA 1EHNA 3BDXA 1K8IB 4R7DB 5F7DB 3SDDA 2RTTA 2P7TB 2PTUA 1N0XH 4YGVB 1GYWA 1G7HB 5A3ID 4C57C 3V4UL 4I0CC 3CHPA 43CAA 4XPBL 2O6FA 3G6DH 4ODSL 1KJ3L 2LGNA 2XA8L 3NJMA 4KO6A 3ZDWA 4U1GB 2A6JB 4WDIA 1AXIB 3O41B 1FAIH 1EHXA 5IB4B 5I73C 1J18A 3EHBB 4HPYL 5GZNA 5F93C 1YO4A 5ACZB 4OQTH 2EDXA 3N5AA 5HI3C 1GS8A 2HVKA 4LSTL 1SBBA 3HMXH 5C0DA 4OLVH 3UJIL 3CDCA 4NKDB 3K8KA 4C58B 4IMLB 5KSBF 1EGJL 2MCPH 1QW9A 1EXUA 1WICA 2ZOOA 1ACCA 3UAAA 1OT4A 2P5EA 2ZXQA 1TTRA 5EBWA 2VIRA 4GRWH 4L8SB 5K9QG 1XZWA 5AVYB 3SE9L 4Y1SA 3UTTD 1YDPB 2D4FA 2WK2A 3LSOB 2V2XB 2HH0H 3BH4A 4M02A 3S0PA 4CVUA 2FCBA 2IXQA 3DK0A 3ILEA 2P8PB 43C9A 1MFNA 1A7QL 4XPTL 3A5VA 3WG7B 2HTLD 3QHZH 3OAYH 3BZEA 4RFOH 3BAKA 5E1GA 3C5SA 2QGBA 2Q3AA 4ZPVB 3HUJA 4JPKH 3MVSA 1A7NH 3KYKL 5TDPB 1E5ZA 1EHKB 4L29B 2EEBA 3S8WA 3FSAA 2KLTA 4I3RH 3VXNA 3ULVF 1NOFA 2XV6B 2LAGB 2F53D 2VM4A 3VFNB 4XNUL 4WI4A 3RY6C 1MFEH 4V2CB 4QLRA 3EOTH 2R0LL 3EYSL 1SYVA 2BZ7A 2P1YA 3U46B 1T21A 1F3JB 4UNVA 1SFHA 2ILLA 2NYZA 1A4JB 3RUGF 1ZSHA 3FT4B 1BJ1J 3K72A 5DHVA 3F83A 3KLAB 4W9KC 3I2CL 1RUPH 4PJIE 2HZHA 1BWWA 2ICCA 2UY7B 5ICUA 3WSQL 3FXIC 4LKCA 4KY1H 4PTTB 1PZAA 2UZXB 4L4TE 1MFVA 3NRPA 4K07A 1X4XA 3T9WA 3H9SA 3VXMD 5KANI 1DUZA 3O8XD 3B5TA 3FSZA 3QJQB 4WV1C 3RU8H 3HE6D 4Z78A 2WTRA 1OP5H 1SJMA 4DVRL 4YAQA 1BPVA 1GC1C 4LKXA 2J3SA 2N0MA 1EAOA 2HT2C 4OM0L 1H0DA 1X5MA 3DBXA 1KB5H 4OF7A 5J12C 2PWFA 1CFBA 2X3BA 2LFEA 4D0CA 1DJZA 4XNMA 4GRMB 3EH1A 4NUMA 5GRYA 4RAVB 3QUXB 1HKLH 1QSFB 1IM9A 1R24B 2FSEB 3QC5X 5D1XB 1QBLL 1ZSDA 1V7ML 2EQDA 2ZX8A 5IOKA 2YD0A 3ULUL 5FO7A 3SDDC 2AV7B 4J8QA 3ZY7A 2PYED 4ZXBB 3FU7A 2UY6B 4KI5D 3ESMA 4M7JH 4YZFF 4H0GA 1BJ1H 1ZJBA 2WYTA 3KG5A 2AK4B 4FCHA 4TSCH 4U1JA 1CXKA 2YSSB 5DYFA 4NQCB 5CSZB 4FN0A 2FX7L 4RIRB 2HT4D 4WY7H 2GG1A 3IDXH 4NQDE 1P4IH 4G9FD 4FULA 4YHIA 3SOTA 1KCLA 2VXUH 2M1KA 1WVZA 5DZAA 1A3LH 3WIAA 4AUJA 1J1PL 4WAFA 4ODTH 3VXQB 4G1EA 3L9YA 4X5XB 5HDBE 5GZNC 3V7AE 4RGOL 3ZHDA 2HJKB 1DEEB 2H0FA 3T6WA 4U6YA 5AKTA 4BKSC 2ADIA 3IS1X 4WSKA 4Z9KB 5CLZA 1IKFL 3D30A 3BEWA 5JO5A 1QSVA 4GQZA 2WBJB 4YXKH 2WQSA 5E5LA 5SWZD 1DJXA 1UH3A 5D1QB 3U1QA 4UTBA 3BAWA 4X7SH 3HLAB 1AGFA 3BVDB 3ZTNH 1JYWA 3HEIB 4M1DH 2PCYA 2J5LC 2YOCA 1UM6L 5BOPA 5J7CC 4QT5A 5ENWB 1YEHL 1KFAL 3VTMA 1P1ZB 4LCCB 4KX9A 4H7VA 3GF8A 3AXHA 3WLWC 1BZ9B 1HQ4A 1QTPA 3CFEB 4J6RH 1IJNA 4P5TA 5BRZB 2WWKT 2OSWA 4FERA 5I75C 3VW3H 3F5WB 4FZ8L 1CE1L 2K1MA 3L3IA 3MO1A 4PJ5D 1DBJL 4WNQB 4XVSL 3UBXB 1IEBB 1T2QL 2FGWL 2IO5A 3DTDA 5FYJH 5CCHE 3N43B 1EDQA 2ZOKB 4I77H 2N3JA 1U8QA 3K4ZA 2WZPD 1DL7L 1KTDB 4XP4L 5L4MA 1G0DA 3RZCB 4PRBB 3KEDA 5IMLB 1X9QA 2YAOA 3P73B 5INCA 1I4FA 4NIKB 1VFBB 3QDJA 5D1ZB 4H8WH 2JCCA 5DC4B 4F1ZA 3K4AA 1AO7B 4Y19D 3E1F1 4HG4J 3CVCA 3FN0H 3LQMA 4EI5D 1T1WB 1U3JA 3NZ8B 4MJ6B 5D2NB 4R7LA 3QG6A 3TBVB 3U9UA 4MJIA 4YE4L 1YMHB 4Z7AA 1RIHH 2O5ZH 4KXDA 4XMUA 2ZOLA 4FQJL 3Q2CA 5F6HJ 4MMYB 1JYVA 3X14B 3K0WA 5I1EL 1GIGL 4I8DA 1K2DA 1R5VA 4DUVA 2FDBP 1Z9MA 4NNXB 3OKLB 1QSZA 1Z3RA 4WQOA 4XWOC 1KCKA 1OP3K 1BZDA 5F1KC 2AXFB 2UYLB 4HUNB 4RCAA 4UQCA 4CGUB 3BN3B 2Q8BL 2WLKA 4JQXC 3T3PF 2B9AA 3PIQA 2WC7A 2E27L 4DPCX 1TJGH 3V0VB 4O2FA 4X4ZA 3U83A 3P9MA 1CICB 1RZPA 5JDSB 3PGDA 4PU2A 3QUKB 2X5PA 4LT7A 4YHML 5I1HH 3NG5A 5JOPE 3QR1A 3QDGE 3UERA 1A4AA 4PJEB 3R06A 5BUPA 5IQMA 5D7LE 4P4KB 1LD9A 2Y06L 2F15A 2LFGA 3MV9E 1C16A 2E0PA 4NO2A 4Z0XA 2BERA 2DQEL 2XG5B 3CUPA 1A4KB 3GMOB 3WN6A 1UH2A 3JBG7 3TONA 3V0JA 3D4YA 4AYBA 4U3CA 4URTB 5EZIH 2XZZA 1CR9L 4KK8D 3ZKXC 2VQUA 1BJ8A 3PDOA 1NDTA 3T1WA 1F4WL 1GCFA 3V0IA 3MRDA 4GRLB 1INDL 2GJRA 2OMZB 3AT9A 3UP6A 5B38B 2A4ZA 3QPKA 3VWJA 1Z6JT 2OR9H 3MJ7B 5K1VA 2WXIA 3P2DA 3L13A 4HX1A 4M7LT 4P3DA 3O4LA 4BFKA 4HIHA 5B4MD 1JNNL 1I3VA 5FDWA 2NZ9D 4FF9A 2ZXCA 2IPTH 4OI7A 2C9PA 1GY1A 4UT6L 1IGMH 1MEXH 1H3PL 3IDGB 2J20A 1IT9H 3Q1SH 5C6WH 1U42A 3JV4A 4MCNA 5T1KB 4C4KO 1ETB1 1ZMYA 2ZKMX 1AOHA 2NY5C 4O02H 3O81A 3JWNG 1NCHA 1A6VH 3DPBB 5J89A 1M3IA 4ZFOB 4PG2A 3JT0A 3GSOA 3QIWD 2CLVB 4BSVB 3WLBA 3K6OA 1VPOL 1IGJA 1ZTMA 5BO1L 2EDTA 1A6ZA 4ZUSB 3EIFA 1VAHA 1WZ1L 3II3A 5DJAA 5AB1A 4N8VA 4DP7X 3RTLA 2G2PA 4YH6A 5E8EB 1BDYA 4K2UH 3ASNB 4FQLH 2WZ0A 4G6JL 1XGUB 4TVPH 4QOKA 4PJAB 1KXQE 2N1TE 1FH5H 3OBAA 4F8OA 2D31A 4ZFZB 4X6CF 3E8UL 1XIWA 2BSSA 3CHOA 4DGWC 3BRDA 1WSST 2VDNL 1SQMA 4L23A 2IH1B 5EC2A 2ZX9A 5LUMA 2G2NA 2VZVA 1BBJB 1XX9C 2LE9A 5IMMA 4TRPL 1C5DA 4UQIM 5B1JC 3X1EA 5C3LD 3ZZQA 1JVLA 1LEGB 4X4MA 2ZNXA 5LVEA 5ISZD 2B4CC 3LEXA 1QBAA 5I16B 2JXMA 3QQ9C 2YPLD 3EOBA 1K9TA 3QJVB 1KJMB 1F97A 4N2KA 5GSRB 4QJ3B 2ZXEB 4GQ9L 2G5BA 3PDGA 1JZIA 3GRWH 3QJHB 3IU4L 3T1FB 4AXWB 2AEWA 2QVIA 1HU8A 4XRCA 1MLBA 2HFGH 5AOKA 3CZNA 1KLFA 5IIEB 4YQXL 1CD1B 5E9DA 1Q94A 5L88L 1BZ8A 1CDUA 1RUQL 3NK3A 1SM3H 2N0KA 1G0YR 2N01B 3PABA 1T6WA 4E42B 3WEXB 1A47A 1OGAA 4F57L 3S8FB 3TCXA 3AU1B 2BSTA 1S7SB 4Z3JA 2ZUUA 1KB5B 2GBUA 5ACMA 5EBLB 1QI5A 3M7FB 4Z5RA 2X42A 5L2JA 4WI6A 4XCFL 4JDTL 3T4AA 2NY2B 1RHFA 2DKUA 3V4PA 2VL5B 1A8JH 1A66A 1DJWA 1RZJH 3FT3B 2ENPA 4IOFC 1TJHH 4FQHB 4TUOB 1C08A 4L3EE 2FWUA 4S0SD 4DKEL 2YGVA 4GFXA 3B6SA 5CHNB 4W1TA 3I02B 5JW3H 2BCKA 4XXCC 3WKNA 5F8RC 4XB8A 1S9WA 2VO8A 1P7KB 5F7KC 2CBQA 1OP9A 1S2EA 1RURH 5CUSL 5D71L 1Z9PA 2V5MA 3ARRA 3CPLA 5FA3A 3UTZB 2Z0UA 1E9PA 5BRQA 1DBBL 2UXTA 4WI0B 1YUHA 3VWJC 4ZTPH 4U1KA 3GXFA 5LDUA 1SVZA 3O3EA 1KV7A 5LN4A 3K81A 4JLRA 2H26B 2AERT 2LABA 2YPKA 5HDWA 1ZHKA 1P4UA 3EBAA 3VXSD 1IGTA 3MOAH 3D06A 3OJDA 3ZE1E 2XVGA 3MRKB 4QHLA 3REVB 3QEHB 1JPEA 3UAEA 4HIJA 1GXEA 3ABGA 4AIXA 2NNRA 4JM4L 1ZA3B 1G87A 5EZJA 1X3DA 5DZLA 2WMPA 3HNVL 5AVXB 5HYSA 5I15H 2Q86A 5F9WC 5IW6B 5KYWB 1OP4A 1E50A 4ZTOH 4G43A 1ECZA 1T7WA 3RX5A 4TLKA 4WUKL 4AC2A 3SYQA 4EQ3A 4HLZH 4FYTA 1JN6A 1JXFA 3N9GH 1AZVA 4W4OA 2G60L 4U2ZA 1MCNA 4K94C 4KMQA 4Y9BA 5GHWL 2ICWA 3FB6B 5FYLE 1BFVL 1JTTA 2HPOA 3P4MB 1PKOA 4AH2A 5IKCB 3OKOB 5C0CE 2OK0H 4IU3A 3KLKA 5B8CC 4LLVB 2ZUQC 3BH8B 1FSKC 2XFGB 4L1LA 4LVHC 1IM3B 1J8RA 1EFXD 2F18A 4BZ2L 2OMVA 1R5WB 2Q2EB 3S3PA 2AJ3B 4M93B 2VDLH 2XQYK 1CDJA 4JN1H 4QKXB 4G59C 4QMEA 3CHSA 1IQWH 3FH8A 4QF1A 5C08E 4N3UA 3IGFA 4ZMOA 1H5BB 5DA0B 1MH5B 1USZA 1E67A 5EZLB 4Y9FA 2FWOB 3V6FB 4JO2H 4MASA 4FP8H 3VQLA 4RDQG 1QATA 1ZDSA 3MN8A 4HUXA 4MAYD 1A0QL 4YO0A 5DLMH 5I6XC 1J8HE 3DX9B 3BRGC 4KO9A 2R0KL 3OAUH 1MJUH 4F33B 1D2OA 1E5BA 2EAEA 4UV4L 2ENQA 2ETWA 3WJLC 4F93B 1PGRB 5IVZB 3ELQA 1S7QA 2F5AH 5D7EA 1IEAA 3KEHA 2WD0A 1ZS8A 2VB5A 1DQMH 1G9NC 1I9RL 1MOEA 5EOCL 4IIQB 5D4QA 4N9GB 1WS7A 1BD2B 2ZXWB 2VE6B 3MRGB 4LVOC 4EAEA 5IEHB 2B5IB 2ENSA 1SRDA 2HT3D 2QSCH 3NIDF 5DZVA 2BHUA 3AMLA 2BSRA 4GO6B 5HSFA 4OM1L 4IRSD 2BOBB 5KJRL 4E9LA 3KPQB 4EVNA 1QEWB 3O6ML 4Q4IA 3RWDA 4HXAH 5AYQA 4NQDA 3U0TB 4IRJA 1S7VB 1TUPA 3BUQA 3UTTE 3GMNA 2A0LC 3DIVA 1S5IL 3JWNE 5EUKA 2ARJB 3SDXF 1RUML 3QAZB 4TLSA 5JW5B 4AK1A 4NNPL 4G3YL 4QRQA 2YQ3A 5DO2D 1URIA 1M4KA 1FA4A 1YEIH 5CCKH 2DAVA 1OTSD 1A1NB 3T2LA 2XZQH 3N55A 4LSRL 3VH8B 1RL1A 2MCG1 5DFAA 3IT8D 1K3ZA 1UD8A 3MJ9A 4AT6B 1HOCA 2GJZB 3FHEA 3QJZA 1T66D 3EDFA 5JPMB 2R4RH 2DPKA 4PJ8D 3UX9B 4IGBB 2F53E 4OZHA 3ESVF 3K6FA 5DS1A 5AENA 3ARUA 5H4YA 5IROA 4PRIB 1F3DJ 5G5DA 2BOCA 4K9EC 3UTSD 4JREC 4JKPH 4DKFL 3NOIA 5KYUA 3GBMH 4CNIB 4EF3A 2DQDL 4OTXH 1ZXKA 3LQAC 2Z9TA 4GS7C 1K4DA 1H8LA 1I53A 2DZEA 5TDNB 1RZKC 3UZVB 1QBBA 3KL5A 1JZ4A 3UPRA 1IO4C 1YNLH 1SEQH 1QLRA 4W4OC 3AJ7A 1HYSD 2QADD 1AR1C 1NEPA 5DVMA 2HTKD 5GJTL 1A4CA 4RA3A 4HCRA 4ZFQA 5MEQB 1N8OE 5DJZA 2GUOA 2A2QT 2W80C 1VEPA 3ZTCC 3FFCA 5FXCH 2XN1A 2EEFA 4CVWA 1XF1A 3Q8FA 3GMLA 1CGVA 3PL6B 2CWRA 5IW3A 1RV6X 3TBWB 5I8EA 1MI5D 2A83A 4HF5H 2RBLA 1CFTA 3IF1A 3MYJB 1G84A 4JRYB 4G42B 2Y6SC 2O5NA 5F9DC 3EH2A 1WWWX 2JB6B 2YD2A 3WHXB 2PW1B 4QI3A 5DD0L 1FFQA 2PYEE 3K74B 3B9KB 4KRNA 5ESQA 5EULV 4B9PA 1G9ML 4KUZL 1EBPA 4UCFA 2Z31B 3FOLB 2ICES 3RWHB 2R51A 3KDPB 2WZ6A 4P2AA 3VXMB 4Y2DA 4Y4HD 4JFFB 4IKIA 3QDGA 1AFVL 4PYHA 1ZHLB 2VISB 2AW2A 4J6IA 2ZUTA 5J56B 3HS0C 3CTTA 4G9FE 3CU1A 3SY6A 2OPCA 1P7QB 5D7LA 1ZIAA 4P23A 4U7KA 3O3BA 4NHUB 3OC8A 4GI9A 4KKPA 4N0YH 1DFXA 5ESAB 1DSFH 4JFEE 4UM8A 1A2YB 3M1OA 3O2DL 5DR5L 3QAQA 2VERA 2XZAL 3VFOA 1NFDB 3IE9A 1TMCB 4XOEA 4P5KB 1URLA 1E2VA 1UOKA 3MA7A 3RNQA 2Y07L 5E08H 5SWZE 1FCGA 1HHKA 3I75B 1S7UB 2IDUA 3LN5A 3BD4A 2OMYA 3OR6B 3NESA 2OTWA 2CJSA 3ZT7A 5DDHA 3HLKA 2HKAA 2RAMA 4JFXB 2OI9B 5DHVH 1NL0L 3ZLQC 2V17L 3MRNB 4O5LH 4YDIL 5BVJA 1OF0A 2ZXGA 1ML0A 3NIGB 1J9RA 1TSRA 4KAQL 4F7MA 2XU9A 2IQAB 1E27A 3AQXA 3I6GB 4K8RH 4M7KL 1L4IA 4H2CA 3SOBL 1NDGB 2YBRB 4PP2B 4PR5A 2G3NA 4EIZC 2FIKB 4GSQA 3DJRA 3PU7A 1XD0A 5HBBA 4M7LH 3BZ5A 3QI9D 4JG9A 4DWHA 2YAPA 1V3MA 4ZSOB 2X41A 5JPNB 1UZ6F 4ETQB 2NXZC 3EYOB 2ZP0T 4OJCA 5IROC 3S88H 2APVA 4Y19E 4G82A 1JGDB 3VFRB 3U0WL 1CK0H 3B5HA 4NN6C 4H5SA 1KXQA 1IC7L 1V54B 3HPJB 5ICZA 4PV9B 4Z7QF 4A6YB 4OCWH 2Y7OA 3OJMB 3QFGA 4OAWB 4J3XA 1CFVL 4ZS6C 1XZ0B 3H9YA 2C9SA 1FHGA 1OPGL 2P46B 2V2WA 2CLZA 4PJ5B 5F7EL 3FFDA 2V5TA 3EBGA 2WCSA 5K9JH 3IAQA 3Q43A 1ITBB 3CH1B 2ZAHA 4EOWH 3BUYA 4K71C 1OTTD 4WO4A 1VCBC 2MNJB 2Q20A 2Z7ZA 3MLUL 4HK3N 5I73B 1D3CA 2D4DA 2CG9X 1RJZB 4HDIB 3B1UA 2VDLB 3KYNB 4MB5A 3TYFB 3B8YA 3CFTA 4EI6A 3MMEB 5AW1B 1NKRA 3ENEA 3QQ3A 3CN0A 1NCOA 3TA3A 4X6BA 1FVDA 4MB1A 4XPFH 2DDQH 4MJ4A 2WN3A 3K7UA 4WW1B 5HHVH 4AYGA 4AMKL 4ZMXA 2FX9L 3QZWG 4RRPG 3FQTA 4H26A 2NY5H 2LVEA 5DTFA 5DQDL 5FK9B 3VI4F 5JIIA 4N8CH 2JKLA 4UTBH 1AHWC 3VFVA 2XRAL 3L8QA 1WBYA 3STBA 3GI8L 1U3ZA 1R3IH 2RQ8A 5EZPA 3DDFA 4D7PA 1ZLUH 2QZQA 4PM1A 5HYIA 2YEZA 4H20L 3K0YA 1J87A 1QKZL 2OR8A 2C9VA 1V10A 4BJLA 5F1NB 3QRGL 5EF2A 1WBXA 2PPFA 3P3SA 3VRLE 5IW1A 1R47A 1YEGH 1PNDA 1OAUL 2IVFC 3M46A 5IF0A 3CX2A 4NUQA 3ULSB 3MLRH 2AQTA 2C34A 4L3EA 1T3FB 1L9TA 1KELL 2X1PA 1TZAA 3VA2C 5JIHA 3N85H 1TCRA 3TJEH 2O1AA 3OQ3B 4LSQH 2VYRE 2VT0A 2NUTA 2J71A 5I71C 2B4CH 3HG1B 5AW7B 1LE9B 2IJ0C 3MXVH 1XSOA 5GGSY 4JM0A 2WN2A 4FA7B 4IJ3C 4G8GB 2YSTA 3QJSB 4POZC 4QO1A 3U9WA 2P3YA 3L1GA 3QGVA 1AHKA 1TZIA 4HFWA 5BUGA 1ZHBA 4WW2A 1I8IB 2YO3A 4QRSB 5T3XL 3BUBA 4HJJL 5KYXB 1BVZA 1BWMA 1WFJA 3NYKA 4AGQA 5CEZH 3GJFB 1ZEAL 1FPTH 1CDGA 1FL6B 3TEUA 4BK5A 4BWWA 1NICA 3LRKA 4OT1H 2I9TB 5J8OA 1X7SA 5DS8B 3BVNA 1SXAA 2EUZA 7CGTA 1M56B 1D9KC 1H6FA 3IETB 4I0KA 3CZFA 4GEIA 3PWVB 3MUGA 5GISL 1CFQB 1E9QB 1TJIH 4GG8B 4WV1B 3FCSA 4XVUC 3DV6A 5LGHH 2WLJA 2EDOA 2IPKB 1PNCA 1U33A 3BZ4A 1GZPB 2CK0H 3Q1EA 1ZT1A 3MGTA 4ELME 3DVGB 3GFUA 5HJ3A 1GYVA 4M5SA 1S8DA 4GAFB 5LNEA 5ISZE 4NC1C 2YPLE 2ATPA 3K2MC 1YCSA 4TL5A 5DUMH 5FW7A 1M7DB 3BP5B 1N0LB 4NB7A 3QIWB 2QSQA 1SLVA 3ERXA 3ESOA 4N85A 3WTYA 4CJ1A 2IBZX 3GIVB 5DHEA 4M6AA 4MS6A 5IV2A 3ULUD 1DVXA 5AZEH 2QFRA 2VDRL 5JYMA 1ZHNB 2W8CA 4FD0A 1G43A 1W72A 1IBZA 1OE1A 2A5UA 4NAQA 2ZKHL 5DWUH 4Z7WB 4JFVA 4OCSH 2A74A 4FTVE 5C0CA 1F0LA 4M3JA 2Z3FA 4K3HA 3OKEA 5E2TL 4M43H 1TJMA 4G8IB 4JAMB 1HK6A 1EO5A 3CC1A 1SDDA 1R34A 3P4OA 2VQTA 3X3FL 1NGYB 5KSVA 5K9QI 3G5YA 5C08A 1FUNA 3U4EA 3DRTA 3O45A 4JG5A 3VWKD 5JR1H 3GXDA 4DN3L 1HESA 1A64A 4IHOA 2LQRA 5DMJB 1MCEA 4XP1L 5CXPA 2VXSH 3FS9A 3ULVL 4BHUI 1HINH 1SUHA 3OPZH 3NQIA 3NJGA 3FCTA 4JE4B 3QUMA 1KV3A 1J8HA 2G3XA 1CFMA 2HVKB 1MCWM 1GY2A 2CJUL 1IE4A 1BZQK 3VE0A 3VGDA 2QVMA 5C0DB 2IH3A 2BIOA 2NUPA 3VXRB 3S37H 3C09C 5F7HA 1U8OB 3AREC 3MRHA 4N1HB 4L18A 3HFML 2QV4A 4KJYA 1GGIH 4RZCA 2A9ML 5F9JA 5TE7H 2FT6A 1KCRL 3O3DA 2J5LB 3CMGA 3O6FC 1H15B 3VSUA 3MBEA 1G7LA 4NWTH 4YUEH 4DP8X 2OMNA 5K5YA 4X4XA 1TZGH 3ZL4H 1DVTA 1EMTH 4WHCA 5I75B 4OFPA 1EEYA 1RPKA 2VZSA 4K23L 3VQ1C 8PAZA 2DM3A 1JZDC 2NQCA 4QRPA 3NH7H 4JQVA 3WY3A 2MPAH 3D48R 4M1CC 3P1VA 4K94H 3MRCA 4Q2ZA 4AGPA 5LGYA 3HUJB 4AVJA 4KZEH 1JWSB 3PWJA 4PRNA 4IU2A 3PCYA 4FS0A 1KN4L 2KI6A 3VXNB 4E9RA 1NMAL 3QIUA 2ZJSH 1KBPA 1CVRA 2D8KA 4NUJB 4ZYKB 3VXSE 3KJ6L 2QHLA 5CN3A 4Y89A 5F44A 2P8LB 4RSVA 1T2JA 5H35A 4AZUA 5CF3A 1C5BL 1T21B 3SQBB 1PG7H 3D3VD 3NA9L 3NPZB 3QP3A 4W93A 4CMHC 1YQVL 4WW2C 1DEDA 3GBDA 2WM0A 1FBIH 5DHVB 3VQMA 2P42B 1A3RL 4LQFH 3SZKC 3JQOB 4RX4A 3F7VA 5BQ7B 4BK5C 1MFCL 5D96C 4ZX6A 5CP3A 4RWHA 4AQAB 3D4CA 1UFGA 4P59H 1F58L 2WCGA 1E28A 2CNZA 2APWA 4QRBA 1YEWA 1CE6B 3H9SB 1PD0A 4MA8L 4HUMB 1YNKH 4OZFG 1O0VA 2EP6A 2KPNA 2XETA 3TM6A 2NY6D 3OF6A 1XSIA 3DTXA 3APFA 4WU7A 3BD3A 3CBKB 2BY0A 3HHSB 4Y5XB 1KT2B 2BY2A 4EN2A 2FSDA 4RGMC 1EQWA 4ZMTA 4Q4EA 2YQBA 4F37K 4D94A 3QEGL 2AEQH 4D0CB 3LZFH 5I8KH 3OXSA 2OMWA 3KJ4C 2H3KA 3CHRA 3TEWA 4PGBA 3V4PH 5DQ9A 4K3EH 4IBYA 2HSIA 4NCDA 3T4YA 3MRQA 3W57A 3RL2A 4PS4L 4I0PD 1DQIA 3CLFL 3HN5A 1IM9B 1AIFA 1NMCC 3B56A 3FAWA 3O8XA 4OF6A 1A3ZA 1KTLB 3HE6A 5LKNA 3TT1L 2A74C 2H9GB 1RP8A 2UUDK 3Q6GH 2AS5M 5FYKL 1BGXL 3AG3B 3FU7B 5FOBA 1QR1A 4E9TA 1N64L 4I48A 4HFUL 4J4PD 1R5IB 1T1XA 4L4JA 4M61A 3ZKXB 2ICWJ 4ACTA 1ROCA 5JTWA 1Z9OA 4PJFF 1TYRA 2DL9A 2XKNA 2EINB 5DJXA 5DFWH 4M7JL 3IDJB 3VGHA 3KPMA 3LKPA 3CK0L 1KLGA 1THAA 4FNTA 2FX8H 1T83C 4G1EB 3VRJA 4EKJA 1WIPA 5GGTA 2WLMA 3B9VA 4L4VD 3FQNA 2PYEA 1JI1A 4U6YB 4ODWA 2H2PD 2VXUL 4HP5A 2ADIB 3B3BA 4YSAA 5JO5B 3BEWB 1KULA 1PZ5A 2DJSA 4MAYB 3IPEA 4ZZFA 1MUJB 3RILA 5CSGA 2YHGA 1I8LA 3CGTA 1TMQA 3U9PL 4JGNA 4G9FA 4K9EH 1BVLB 1YECH 3GKZA 4HK0A 1R0AL 2NCEA 3LCYA 1I82A 5ES4B 4MNQB 2F0CA 3MBEC 2F54D 2YRLA 4U6VH 4UMSA 4GUOA 4CSTA 2VSDA 1GL4B 4XXDA 2ITCA 3LQAH 4X7SL 4JFEA 5MEPA 4P2QB 5GGVY 4TUKH 2W95A 1YG9A 2E5EA 3VXPB 3ARBA 2WO2B 4ELKA 5D4HA 2ZKXA 4FEIA 3X17A 2H2SC 1BVNT 5SWZA 4HG4K 1ZTXE 4EDWH 4AG4H 2GI7A 2BFVH 3GSQA 1U8QB 1CDYA 2BVPA 2FO4B 4GB9A 1RSYA 3QNXA 3QIUC 5FF6A 1KTJA 3EGXB 1EAPA 4NHCH 3HBPA 5FYJL 3JWNC 4I2XE 4ZT1A 4F7KA 1XQ4A 2A38A 3C6SA 5D8JH 5EF0A 3QDJB 4EZJA 4ZMPA 2JCCB 3KS0H 4Y16D 5BMFL 2UXFA 2H3NA 4X0KA 1A6WL 3UTSE 4UTCA 4HIEA 3N1MC 1LVEA 4KDVA 1AHMA 3FU6A 3QG6B 4ORZC 4MJIB 3WI9A 4H1LG 5K59E 3LH8A 3ZKSD 5CU5A 4NZTH 2WZPA 5GS2D 4YSOA 5CILH 3OHXA 1D6EB 3MQIA 1ONQA 1K2DB 3VCLA 4BSJA 3MLYL 4M1GL 4PLKC 1R1CA 1FNSL 2EO7A 1JPST 2ZIDA 3EDEA 3GYRA 4HKZB 4Y19A 2BNUB 4OI8A 2Y3NA 1A3QA 3CLWA 3ZHKA 4CADB 1VJSA 4X9BA 4WWOA 2WSKA 1RMFH 3VRIA 5I5MA 4JHAL 2V9UA 1VB9A 3P9MB 1UVQA 4MXVF 3DRQB 4YK4C 1CLZL 2WHVA 5FHBH 1EANA 1RULH 3HNTL 5DGRA 2DS4A 2FE0A 2JQAA 2AJSL 5KWYC 4JANB 2DYSB 1IIIA 5HYQB 3CN4A 1TLKA 4OCYH 2V37A 4GW1B 4A67A 3O8XC 2WOYA 1C16B 3SPCA 1IKOP 4MCYB 3OD3A 2R0ZH 5F96L 1MAJA 2B2XL 2K45A 3CUPB 3K3QA 5AAMA 3G04A 1HT6A 3ZIMA 4YBQC 4UV7H 2DWDA 1NAKH 4LQ1A 4YX2H 3W5MA 1T4WA 1W6WA 2IDFA 1KIUA 1WK0A 4PJIF 5CWSA 3L95B 4PCSA 4MDJA 1HTYA 1T22A 4GW4B 4S0TD 3DVNA 1FV1A 3GEFA 3ZSTA 2XACC 3MRDB 1NEZG 3N50A 2GKIA 4M5ZL 1MRFL 3VJ6B 5CR8A 2EUVA 4UT9L 3VWJB 5D93C 3H9HA 4A2LA 3STZB 1DJYA 2B39A 3L3OA 4OJDH 1DDTA 1HXMB 1KLUB 1TITA 1OM3H 5LQBH 1J1OL 4HIHB 3QXVA 3INUH 2MQGA 3FT9A 3ARFC 3MJ9H 2EYSA 4LESA 3I6LD 5ESVA 1MI5B 4O2EB 3RWJA 4FDWA 3CV5A 4NUGL 4P4RB 1UJ3A 4ENZA 4ETYA 3MTXA 1RUKH 4I4WA 4XP5L 5A43C 1FIGL 1U3YA 1RK7A 4XNZC 2IPTL 3GSOB 3S3BB 3N2JA 3RX9A 2E7MA 4BIKA 1AQHA 3C8DA 4KUCD 1CDCA 4LLWB 4KXBA 1AOZA 4BCZA 2WINA 3LH9A 4BDVB 2JJUA 5F9WB 2WO3B 1TETH 3MTRA 2Y23A 1AE6H 5E5UB 4HISA 3P30L 2DWYA 1GGYA 3B5GA 1IFGA 1A6AB 2GJJA 3ARBC 2YGQA 4GO8A 2Y2WA 1O9ZA 2WWNA 3BH9A 4PD4J 4QTFA 5EC2B 4WWPA 2IFFH 3HI6H 3K6IA 1NGXA 4U1HA 1FSKB 4LVHB 4M29A 4XMPL 1C5DB 4HCRH 2CGRL 4X0NA 3SHSA 2OCCB 2BVEA 4QHPA 5SWQA 3LPOA 5ICYB 1GZQA 1W8OA 3HMWL 3EOBB 3ARDD 2EUWA 3GSXA 1RIVL 1K5WA 1DBAL 5MHSD 2AQNA 1LO3H 2G5BB 1W2KT 4C55A 4MQXC 4L9LA 4BD4A 5JHMA 5FFOA 3MOBL 3UAFA 2ZAGA 4R84A 1DLHA 4KMTL 4HS3B 5C0AD 5I6XB 3JV5A 3OLGA 1KLFB 2EE9A 4PWHA 2Q1EA 4FC3E 4K3JL 1NCBL 1Q94B 1XF5B 1UXSA 2EYTB 3OHXC 4HU2A 4RMSA 2PPAA 5HDQH 2IH9A 5ERWA 3KYOA 1M7IB 5ISZA 1QZNA 3Q9QA 2WYIA 5C0FA 2VDPB 2YPLA 3PF2A 1DN2A 4QXTB 2J21A 5BS0E 2J8HA 1U2HA 3FU9A 3RIAK 4DO5A 5GJSH 4OLWL 1MJJB 1RSFA 2GAZB 2EDKA 3NSFA 1P5UA 3EBIA 4JPIA 5LN8A 1PX8A 1AZNA 4PB0L 5HGHB 4ENEC 2ENYA 2TRHA 3LMJH 4LVOB 3POCA 3A0OA 4FTVA 3SGJA 3ZGIA 2IDCA 4DUWA 4Y4KC 5IJCC 1PZBA 3OR7A 1SVBA 1E4KA 2AGJL 1V7NH 4XPGH 3WE1A 3ZDXF 4CVXB 5T3ZD 5LWYH 4ERSL 1AD0B 3H3KA 2I27N 1YY9C 3I85A 3RWFA 2QBWA 5TJWK 5HJGA 2JJSA 3N6YA 4NWUH 3DBSA 4X5WA 2H6OA 2CDFB 3BE1L 5AAMC 3E3QC 4N0UB 4WIQA 4IHBA 3NACL 4FYSA 5J13B 4Q6KA 1SY6A 4DPRA 1S9WB 2BDNL 3H55A 3MLVH 3DX0A 4PMFA 3WL9B 2CZNA 1D5IL 4MMXA 5FA3B 3MROB 1VFMA 5EF1A 2OW7A 1DQQA 4NZDA 1YUHB 3C8HA 4BH7A 1T6BX 3L3OC 1YYLL 3CFKB 3PQYD 1JHKH 4JLRB 1XGTB 4R8WH 5GGRB 4JDZB 3WXVH 2CA4A 4U1MB 5DSCA 2Q8AL 4D0DA 4WK4B 2V8MA 1UJ3C 1ZHKB 2MOVA 4PJGE 5IQNA 4NM8H 3NUKA 5DEFB 3WNOA 3ROLA 5FAAA 2KHAA 3C5JA 5C0BD 3N04A 1KF9B 1FVEA 1I7RA 4LF3B 1S7XB 2F7RA 1PAZA 3BP6A 4JREB 3GTNA 4S1SL 4F5CE 4AQOA 4Q9RH 3A24A 3S34L 3BWAA 4NQED 2MCMA 2HMID 2E9IA 3KPSA 2Q86B 1ACYL 1GMIA 4GUPB 1RK1A 1LO4L 2ZG3A 4OGAC 4Z3IA 4ZMVA 1Z9LA 2P8MB 2A9NL 3GI9H 4GS7B 1D7CA 3W9EA 5J6HB 4FZEL 4KJPC 4L1SA 1T5XB 3CC5A 4ZMAT 1JN6B 3QO0A 2GC4C 1FDLL 2XIBA 3SBQA 4AVKA 2ICWB 1AR1B 4ZTOL 2B1AL 2K8MA 2K78A 3X12A 4I13B 4IU3B 4PJAF 4KVCH 4Z3TA 1AQ8A 2CAKA 2WXOA 5IB5A 5JLZA 5KYNA 3DX2A 4AE1A 5BJTA 5IZ7A 2NLJB 3GJFK 1QSEB 3VO0A 1CZ8L 2CO4A 2W88A 4M00A 1L9SA 3GM8A 2EZ0C 4PJ9D 4IJTA 1TZOA 5AVVB 1M42A 3TWCL 3ULUE 5GZOD 5DC2A 4ONGL 3ULAB 1TNNA 3BEVA 1Q9LB 3GUTA 3SPHA 4KKLD 4NFCA 4JN1L 2XPGB 5LGJA 3SODB 3ZMNA 4GG6E 1QFUL 2J88L 4P2OD 1JD9A 2CKBL 2OL3A 3T8XA 4UTAL 3D39D 5KVEE 1EFXA 4MRCA 4NI3A 1I7ZB 2Y9RT 1I8KB 3ASWA 3L5IA 2CR3A 5EU7E 2H5UA 2ALAA 2ATAA 2AQ1A 1ZS8B 1DO6A 3HS0B 3WNNA 3NTCL 3QRBA 4ICWA 4KV5E 3EJTA 1CBVH 5MP6H 1P5UC 4GIPD 5C0IA 1G94A 4LE8A 2E7CA 1CN4A 2F5AL 2AQ3A 4XGZA 1S7TB 4AKPA 3J7HA 4YSQA 5FGRA 5HHOD 3SGJC 2LTQC 3VFUB 4HUUA 2XPYA 3AZUA 1OT2A 3QZWA 2ESVB 4RRPA 3FQYA 2BSRB 1MHEA 1E4KC 4NDMA 3LKNA 2E47A 4WU5A 3HFFA 3AMKA 1JGEA 1W0WA 4OCXL 3WEAA 1TVBA 2Z35A 5L2KB 1T03L 3RWDB 3VNYA 3HA0A 2JJSC 3CFCL 5K9KB 4JGMA 1Q72H 3NPSC 1I75A 4P46A 1FZJB 4WVRA 3HW7A 4XBMA 5EUKB 2WOBA 1RK0B 4KXCA 3MFGB 4DEUA 1FF5A 4HWEH 4JFHD 1VACA 4MMXC 1GPOL 1MCRA 1H3GA 5F21B 1QA9A 1WFMA 3FQ2A 4IRSA 1Q0YL 1C12B 1CFSA 3QORC 1F3RB 4H8VA 1N4XL 3RRQA 3OL2A 1Y07A 1PIFA 5CO1A 4GIAA 1HOCB 4MNHA 4PGCA 4EE2A 2QHRH 3QFJA 5EEUA 2J6EA 4UYPA 4HZAA 3TT3H 4MMZA 3KWVA 4OZHB 4MJ5A 1Q4NX 3IVKA 1NC4B 1JZJA 4OJAA 4AYFA 3GDCA 1FH2A 1FGNH 1UWGH 3LKOA 3D3VE 1U0QA 4NENA 4PBDA 3V9CA 3IFLL 4NN6B 5DK0A 5IQ7L 1GAFL 3KR3L 4JRXD 2G3ZA 3TH4T 1W72H 3QCVL 1E43A 2Y22A 5FKPA 1PBYA 2EXWC 5FYLH 5D9SA 5JZ7D 1CFNA 3ZHNA 3GBLA 1BAGA 1DCEA 5T1DL 4PJHB 5KTEH 5CN1A 3A6OA 1NSNH 4GUCA 4I2XA 5T5FL 4F37F 4E41E 5IFHL 3BXNB 1GGUA 2BHZA 1ZXQA 4K71B 1DO5A 1LILA 4L9DA 5GS0D 5DRNA 1PSKL 4R3SA 2G2RA 4JHWH 2VN3A 4ZNCD 2IALA 1IFRA 3FFCB 2CRYA 3EDKA 2BNQA 3TWYA 3MBXH 3ESPA 3AG1B 3QUMH 4WUUD 3TNMB 1KEGL 2Y6TE 4W68A 1HHGB 1MG3C 2EDJA 2HLAA 1MVUB 4MDIA 5E99L 5I8EB 2A83B 3IJEA 3ZE1F 3W39A 1CFTB 3BWUC 3VXUD 3PP4L 4HVBA 4EBQL 3VI3A 4GI6A 3SO3C 1AHWB 2CBTA 5C0EA 4M4PA 2AJYH 3OLIA 5AZ2L 4I85A 3ZTJG 5ESQB 2A4EA 5DURB 1KXTA 2EYRB 2EDLA 5LXVA 4ATTA 1D7FA 2D2CC 2YN3A 4R7NA 4UQ2A 5ITFA 5E00B 1WG3A 2WNWA 3QWNA 1F4AA 1WFOA 5C1MB 4KHTH 5BW7A 2XG4B 1COBA 3FO0H 3D18B 4LNVA 1NANI 4EDXA 2C3VA 2BPBA 1FORH 3FUMA 1M7XA 1JPSH 4JM2C 4UILH 1I8MA 2WWMD 4YHPA 1EK3A 5IQ9A 4MA7H 4L4VE 3ZO0A 3F85A 1LEKA 3GO1H 4RFNC 1TTCA 3VFOB 2JKRM 4XNQB 5I71B 2A73B 3BJLA 3MA7B 3Q3GA 3JWNH 4Y4HA 4IJ3B 1KGYE 1OSZA 3DOIA 3EXJA 1N3NA 1XT5A 3L81A 1NAMA 1A65A 2HKFL 5FM5O 1ZGLA 2IBBA 4X98A 4QRRD 4XPHH 2UZPA 2F54E 5DJYA 4P46C 5E08L 4Y1AD 4IBZA 4X6DA 4XMLL 1AGDB 3P3YA 1KIRA 2DYPB 5D2LE 1CS6A 5CBAB 5ICXA 2NRDA 3ZO9A 1HSBB 1D9KB 4PY8I 4CDHA 1E5CA 1JHTA 2JI1A 5CP3H 5FYKU 4NPYA 4HEME 4N1CA 1KC5L 1ND0A 2GSMB 4GYBA 3FZUC 3FL7A 5JQ6L 3I74A 1B9KA 2EDDA 2NX5D 3QPXH 3CVHB 3L5XL 5TGBB 5C0ND 5HGDB 1J0ZA 3MLXL 5SX5K 5T33L 1YQ2A 3AW5A 3H6JA 3T77A 1MAML 2O6EA 4J3OF 3QJUB 1NPUA 5F7LB 1LP9E 4YC2B 5F1IB 1OIOA 3KPRD 2BFGA 2R69A 2G30A 3GKWH 2R29A 4MMZC 1JZ8A 1RZGA 4DFHA 4N90E 4K8RL 1A5FL 1PAMA 4R2GD 1OSYA 2XICA 4GAJH 1FC1A 4NQTA 4M7LL 4PJDA 1TQVA 5TE6H 5ICZB 3U82B 3SDAC 5A7BA 5EU6B 3RVVC 1HL9A 1QWNA 2FEEI 2D9CA 2V2WB 1FC2D 4OUUA 4KJQC 3D85D 3WIFA 4QGTA 1BVKB 5F88A 2AXGB 4NO5B 4P3CL 3M1CA 2YXWA 4PJBE 3QI9A 3V4VB 1F2XK 4OCWL 1RAMA 2YWZA 1AMYA 3CU7A 1YSOA 4HT1L 4OZFA 4KROC 1ORQA 4FFWD 1HCFX 3G5ZA 2VRAA 3D2UD 5GRJL 4JY4A 1MWAL 5I8CA 2LOEA 3NDZE 4R6UA 5SWSB 3PUUA 3CZJA 3H3PH 2XI9A 5K9JL 2V8LA 4W9ZA 5IHUH 3KYAA 4EI6B 2H6UA 5E2WL 5FUOH 5GGTH 2IPUG 1CF8H 3KLDA 2OCJA 3BN9D 1X9UA 3QQ3B 4KWUA 4PGDB 1FVDB 5D70L 3RIKA 3WFCH 3ZU8A 4HETA 1OQOA 3C09B 1KGIA 2FECI 2J4WL 3AREB 1YN7B 4OCLC 4UQBA 1O7SA 1MN4A 1NC2D 1AANA 5BS0A 1I1AD 2VMJA 4JBSA 3HOGA 5DTFB 5FYJU 2CU9A 1OQXA 4YE0A 3K71A 1E3FA 3BAEH 4F92B 1MKFA 2WYHA 1SJEA 3O6FB 5CBEA 2DDQL 3LVEA 5IVXE 2VRKA 4MNGE 3LOWA 3WS3A 2HLFD 3WFDL 1DUYA 3C08L 2AKRB 1KEMH 2WLLB 1JZ2A 2YEZB 4RBPH 2ZPKH 1BAFH 3LRSB 3EH4B 1OB1A 5BW7C 1EGJA 2WLIA 1OKEA 1WBXB 2OSLA 5IW1B 4E0RB 4G6AC 5IF0B 3KNBB 3UCQA 1U8CA 3PG2A 5CIPA 2OXHA 3BSZL 2DQTL 3F6LA 5I2IA 1QFOA 4UAOB 1ZVSA 3B4NA 5IK3A 5KOMC 2JI3A 1PZSA 2V5YA 1TCRB 1IUZA 3I6LE 1FP5A 3AWFA 1YJDC 3CSYA 1TVHA 4N5EC 4U31A 1G5GA 3DO7A 5J9PA 4Z77A 1UA6L 2H1LM 2NUTB 3GXNA 3PGCA 2YJLA 3V7MA 1BXXA 2FB4L 4PGJA 2VXVH 1HZHL 2NY3C 1JDDA 4QO1B 1IQDB 3DSNA 3TJEL 5D6DA 5E8PB 4HFWB 4ABWA 4WW2B 4CMHB 5TPWL 4AGOA 5AG9A 4OIIH 2A6KB 4EO5A 2XZCH 4ATWA 2GK2A 1XBRA 2QL1A 1UUNA 5JORB 4KI5F 1KJVB 5TQ2L 3BVNB 2BJMH 2NR6A 5D96B 5I0ZA 4R83A 1JPGB 5CEXA 1D7BA 3CZFB 4IS6A 1EVUA 4PJGA 4XOBA 2JKJA 3MUGB 4P04A 5ALCH 1S9YA 3JV0A 2J7LA 3QG7H 3PWLB 2VW4A 5DVOA 4F5CA 2APFA 3SY0A 3BZ4B 4ES8A 1BQRA 5E94B 3WS6C 4RGMB 5HJ3B 1S8DB 1VRSA 2I60L 3FH5A 4RFEA 1KPUB 3D69A 4FFZL 4Z8FL 5MHSE 3ESUF 3LD8C 3US9A 3KJ4B 5D7HA 4LP8A 3ZDYE 1EAJA 5IJDC 1AY1H 3U7YL 1N6QH 2FO8A 3D08A 4BE6A 4H1LA 1NMCB 3T0WA 5IEKA 3DJTA 4KRPD 2AAAA 5C0AE 6CGTA 5J6GB 3VGEA 3FO2A 4LP5A 4CILA 2ZP8A 4G6MH 2VN7A 3OKEB 2JFCA 2FYYA 1UYWL 3DROA 1NCWH 1BHGA 3ZIYA 1REIA 2DQJL 1SDDB 2XKUA 3NIFB 3P4OB 3QIBD 4X6FB 5KSVB 4PLNC 3GINA 3G5YB 2JB5H 3L3GB 4K3DH 3U4EB 3DRTB 2B59A 3O45B 5I18L 5E8DL 3BLPX 3SE8L 1FL5B 4BUGA 4LVEA 1FL3B 4BGLA 4IHOB 4TN9A 2VDOH 1P5VA 4KTDL 4GG6A 1FI8C 3OWEA 4J7RA 4N2EA 1TQCC 4CW1A 2UZYB 3QUMB 3WKQA 3B7YA 1JGLL 5F3FA 2X2UA 4PRPD 2D3VA 5D55A 3BMVA 3RX7A 4JFZH 4KFMA 3O6LL 1XGQA 3C60A 4MD4A 3RWGB 2ADGA 4YXHH 3PXJA 4ZMLA 4MWFB 5MEND 1B88A 2BOLA 4KK9D 5CLYA 4KJYB 2YEVB 1HWGB 1Z3GL 1OSPH 3K2IA 1MCCA 5GRUL 2R8SL 2XQ0A 3LPFA 3MBEB 3FQRA 3VB8A 1LXMA 2LW3A 5CINH 1E8XA 1HSAA 2A9BA 1YPZB 1RJCA 3CFNA 3NFNA 4IKJA 5F7UA 5HYEA 3NCWA 1P4LA 2MQ3A 2OZ4L 1NEZA 4NQSB 3RGHA 5E0FA 1JK9B 1QLEL 4N4YB 4NXKA 1AS7A 1HL8A 2O5XL 4ZUWA 5ID1A 1U8MA 6FABL 1E4XI 4QRPB 5HYJD 4FG2A 4Z0BL 3M1BA 5CD5D 2ADYA 2B20A 2EVJA 1BLIA 1FE8H 1ZWIA 3HNSH 3QRFM 4IU2B 5F7NC 1NOAA 1QRNB 3ZE0E 1MZZA 1XB6A 3QIUB 5DMIH 4AQ1A 2YD4A 4M6NL 4LARH 3CG8A 5HHMB 5CCGE 1P6WA 2W94A 4OLYL 3N1PC 2JJTA 3SDCA 1WZMA 2X10A 5D6DC 5HVHC 2V33A 3H4HA 2Y1VA 2VLJD 1TO5A 1I1CA 4NQEE 1U4FA 12E8H 1EO8H 2CIKB 3ES6A 4F80A 4KGJA 1L6XA 1NGZB 3JUZA 1ANUA 2FAUA 2ODIA 1S6NA 4BQ9A 1M6OA 2NR6C 1I3GH 1YYCA 3PHQA 1T04B 3PJLA 2Q0ZX 4HS6B 5DHXB 4B50A 2NYYD 3G9VA 5KS9E 5KZCD 1E28B 2HAZA 1E9OA 3QDMB 2DBLL 2ZAIA 4CUCA 4OLZL 3PQYB 3JV6B 1FO0B 2DRUA 4DVBA 1Q90A 1U8KB 2FJSA 1FZMA 3D3VA 3LRGA 3MJWA 4YHNA 3DTXB 1CUOA 4WU7B 2UVFA 3KCPA 4OSUH 4PY7A 2MNWA 3M45A 4YK4B 4DO4A 5C0BB 1FGVL 3C6LD 4KX7A 4GAGL 5CGTA 1P0SE 1PY9A 2VL4A 4QTHB 3HAEG 2D2OA 4XO9A 3TS8A 4PGBB 4JMNA 1IBGL 4NQXA 2YN5A 2C9XA 5TE4L 1VKXA 4QXUH 4FHKA 4X2UA 4HQQH 1BEYL 3H2WA 3VRIB 4E41A 4ZJ9A 3KM1A 1D5ZA 3S2AA 1OHQA 3TYGL 3PUCA 1A4BA 1MCBA 1BFOA 1V55B 3D39E 5AL0A 3UAJA 2Z91A 4M7ZC 4QXGL 2QTVA 1SDYA 3APCA 4M61B 5ID0A 1SY6H 4HGKC 4KKAC 1MREL 4K4KA 5FECA 3DVIA 4LLYA 3B43A 5AW0B 1UASA 5D93B 1AGBA 2X6AA 3KPMB 2XVKA 2HLEB 3LKPB 4FXTA 4I0PA 4IOIB 3RVWD 4QY8B 1CMOA 5F0JB 4WFFD 3VRJB 4QJ5B 1A6TB 3EFDL 4IEFB 4R0LA 5HHOE 5DK2A 3ARFB 4XNYL 4QNPF 5JNYB 5JXAL 4ELMF 4EUPB 4ODWB 2VWEE 1YLBB 4XAWL 1BMWA 3C60C 3LYRA 5E5MB 3D25B 3NABH 4NEHB 4TXVB 5EU7C 5F7YC 1T1ZA 1DJSA 5DEGB 5MI0C 3QYNA 4FFYL 2CKNA 3TGXA 4FABH 1N5YH 4HK0B 3RWIB 5HYFA 4Q89A 4YSDA 3IMBA 1E4WH 4WGKA 1HEZA 4XXDB 4L4VA 2ITCB 3T6XA 3WNLA 4JFEB 5MEPB 2GFBA 4JFHE 4JO4L 2EECA 1QUNA 1ORSB 4Y9CA 1JZFA 3MA9H 3GUFA 1U8LA 1KBGH 3S36H 2KZWA 3CMOH 5CS7A 3E6HA 3GHEH 2XT1B 2Y2YA 4F8PA 5A16A 4FA6A 3ILPA 2BVPB 1G6VK 3BHBB 3H0TB 3AT8A 3GMQA 3RTQD 5GIRA 3QNXB 4J28A 5FF6B 3DUUA 1A6UH 3TIEA 3SZ6A 2GBTA 2AXJA 5B3SB 3MRIB 4OGYL 4KK6D 1TEFA 2HRLA 3CFIC 4XN7A 4AG4L 1ZY9A 2AI0H 3WMSA 3PV7A 2JJTC 3SDCC 3B2UC 3O9WC 2IH8A 4X4YA 3RNKB 4HEMA 4FXGB 5C07D 3IDIB 5ANME 3CZUB 4RDBA 4P9HL 1H3WM 5DMGD 1LE5A 5KVFE 1DP0A 5BV7B 3FSWA 2R23A 3QA3A 2YA1A 5D7IE 3VYOA 2DEWX 4HH9A 5IG7A 2PW2A 3NCEB 1AGEA 3GJEA 3OHXB 4GKSA 4U0QB 5DC0A 2IAMD 2OL3H 2NXYC 4MAUH 3VCLB 1OEZW 1IBBA 3DETC 3OB8A 2NNAB 2ZYIA 2XXMB 4GXVL 1BQKA 4H8UA 3L4CA 4YLCA 1GGBH 1U8HA 4QPEA 4OGZA 4FLHA 1IX2A 1NPJA 1R19A 1DLFL 1G6RA 1IAII 4MDRA 5KOVC 5C86A 1MRCH 2QSVA 1E0OB 5AB2A 1Q9WA 1UVQB 4WUUE 1CYWA 2N4IA 4FXKA 4F2ME 2GITA 2QPUA 3GIZH 1NFIA 4Y4FA 4Y4KB 2OP4L 3OQRA 5DC9B 4PJBA 3VXUE 4DP2X 5B7FA 3EUDA 3NDYE 1ZLEA 3X11B 4O00A 3T2PA 3K2UL 2IOMA 1RJYA 3HBQA 3ZKND 3BGMA 4JZJC 4MHHI 2VAAA 4DN4H 5HHXL 2DD8L 3RE0A 3UAJC 5AWNL 1T4KB 3CXHJ 3J2PA 3PYCA 4TQIA 2P9RA 2W92A 2JTDA 1FV1B 4XP6H 4MS8D 4S1RH 4ABUA 4UV7L 4PLJC 4N0CC 1ZLSL 4Y9GA 4B95C 3H9HB 2EO1A 3B37A 4I0PC 5EORH 4XCCL 4XO3A 3T0BA 3ZE2B 4N26A 4U1LB 1DJIA 4NKMB 4R0LC 2JKTM 1Z9SA 4L3CB 5IVXA 4KK5C 1IFHL 1YEKL 4R7XA 1UJ3B 2J6EH 4FAAB 1EJOH 3HHRB 2OQJA 4I4WB 1PTZA 5T3XE 3S8GB 1MFAH 3MV11 4QRAA 3MJ9L 1SUJA 4QYOB 5DD1L 2VMFA 1KIPA 4PHXA 5ALBH 5EUOB 2OKMA 1HHJA 3SKUD 2XV3A 4PD4K 2F5BH 2WINB 3T04D 3WNKA 4Y1AE 1LEIA 3ECQA 4NBZB 4PCKA 4Q74A 3VG9C 3MLZL 1ZTXH 4FJ6A 1KDJA 4ZX3A 1J1XH 1JV5A 3QQDA 3GHBH 3N0PB 4KRLB 3AXLB 2WBKA 2FNBA 2YOAA 2VZTA 5H94B 1FYTD 3ZMEA 4AV5A 3FU0A 4HD5A 4U3SB 1T7ZA 3BKML 1FNEA 4QRUB 4K5MA 4N2NA 4F91B 3NBNA 1DSWA 4HKXA 4UINH 2Y7QA 2D73A 3BKJL 2W0FB 3AB0C 1NCNA 4U1HB 3U7WL 5FLVA 1YEFL 1DVYA 2X7LB 3KPRE 1HYRC 3ME0B 3O2VH 5HGGS 1EBAA 5SWQB 4P5RA 4G7QB 1QFWM 4LNRA 4F58L 2DM2A 4O9HL 2RIKA 5BZXA 5DD6B 4NYLA 3V8OA 1QOKA 4JY6A 4MA1C 4PG9A 1T0MB 1XR9B 3FDWA 2G75A 1MHHA 4XMTA 4LOEA 5CLTA 2Y36H 2VABA 3MRMA 1T5WA 4BZ2A 1MCOH 4R26H 3L3KA 1JHLL 3ZZLA 1JVOA 1XB3A 4FFVC 5ERWB 4M4RA 3OMIB 4HJEA 5C0FB 2NX5B 4H4NA 4LDLB 1SN0A 3ARDA 3QCUL 1PKQE 3GZKA 2P44B 4DCQA 1NEUA 1L7IH 1UADC 4X6EB 5FA4A 1P5UB 3FB7A 4DHLA 1YC7A 3LIZL 1GJUA 1MW3A 5GJSL 3CFDA 3IJYB 5AW9B 3SKMA 2WLZA 4POYA 1GSMA 4FXKC 3WMQA 3V2AR 4KTEH 5DVLA 3RUGE 1YJDH 4NO0B 4Y4FC 2EIZB 3PGFH 4FQ2H 5DUPL 3IMTA 3WIIH 3GM0A 4W9GC 3EYUL 3FYEB 4NNYA 4ZFOL 1HH9A 3HB3C 1NGPL 1UATA 3RYMA 3UTQA 3PXHA 4GY4A 5ILTH 2Y5TB 5C2BL 5J06A 3DHUA 4X5WB 1NAMH 2MQCA 5IM7B 3MACL 3L45A 1J48A 5DUJA 5BVPL 1IEHA 3T0EC 3BC9A 3MLSH 4J27A 3L3JB 2V3DA 2HCZX 2KERA 2JKSA 4MFHA 5I17B 4BZYA 3VGBA 2OTUA 1S7WA 4ZQKA 4WF7A 2V3EA 3CVBA 5E6IC 3S5LB 4LCIH 1IKNC 5KJ4A 4WFGD 2PCFA 3S7GA 1IAKB 4JY5L 1C1EH 1DQQB 2KYIA 4G5ZL 3RBSA 3QORB 1EJFA 3VFSB 3WFBH 5KSAC 4OB5L 1B2WH 5F0PB 2PYFA 5ABAA 1WJ3A 1UACH 1XH0A 1G7QB 4NSKA 5C0GB 4FKEA 3GMMA 5DSCB 2CPUA 1QMUA 3U4BL 4ZO7A 4N0FA 1UKQA 2R69H 2RQEA 2R29H 4TQEH 3C5JB 4G8EA 1FVEB 1DCLA 4R8WL 5LG6A 4LGSB 2FNWA 3POHA 1NUDA 3BWAB 4GOSA 2IQ9H 4YZFE 1QHQA 3IJHB 3S5ZA 1AZRA 4NJ9H 4NM8L 4P9MH 3KPSB 4OKDA 1CQYA 1E4XH 4NPJA 1KTRL 1OCWL 2YPVL 2DWEB 2NTSP 3L9EA 4Q9RL 2BC4B 3L1OH 1E90A 3CC5B 2VKXA 3W82A 3QO0B 3QBTB 3GK8H 3TVMD 3ECBA 1P4BL 4OZFH 4U1NA 4UT7H 1WP6A 2Z1KA 3KXFB 3W2DH 3GS4A 4KY2A 5C09E 2EE6A 2CHNA 1ETA1 5IREA 5D5ME 2CCLA 2CO7A 1DR9A 2FLMA 4PJXB 1SHMA 3H2PA 5CR1A 4M5TA 5I1AA 4G9DA 5E8NA 5HXMA 3V4UH 2VLLA 4XPBH 2OMUA 2IEPA 4ZK8A 5KS9A 1JE6A 3BEVB 1KJ3H 1BX2A 4ODSH 2XA8H 5FYKE 1KXVA 1I7TB 3EJZD 5LGJB 1MXDA 1GYCA 1RFDL 5DJ6A 3DDGA 4HPYH 5GS1A 4KKQA 1CF1A 1ZT4B 3AITA 4M5YL 1KPVB 3RWCB 2EXYC 3OB0H 4LGRB 4LSTH 3TFKC 2L7UA 2BY3A 3L2MA 1CO1A 5I26A 3UJIH 2WLHA 3IU3B 4PBWD 3ZL2A 3G5VB 2XXCB 4L37A 3T5WA 3GLAA 5EEYA 5DCCA 4CSZA 1EGJH 2VKWA 5E2VL 3WFZA 5GZOA 4RQQA 1WFUA 2FR4A 2TAAA 1CL7L 5IESL 5C0JA 4JM2B 4EI0A 3WIHL 7PCYA 5CIPH 3ARYA 3LHPL 1HL5A 1LMKA 5BZZA 3FUHA 4HHAA 3MNWB 4RFNB 5TF0A 2GB2A 4AYDC 3SE9H 1U8IA 3D39A 2Q7YA 2W0KA 3QZWB 5J57B 1Y18A 5L4JA 5MENE 4HALA 3M88A 3GGWA 1YVLA 2HB0A 4WU5B 4KZDL 1B2YA 1IAMA 1JGEB 1THCA 3IFPB 3NVQA 4F7CB 4XPTH 1SNRA 1DVFD 1Y1DA 4GBXD 4MVBC 5FPIA 1V8HA 2ICEA 3PHAA 1AP2B 2PTTA 4FOMA 4LHUG 2ZCHL 3NGBC 4P46B 2NY4B 3KYKH 3O2DA 3SE3A 1GYUA 4GAYA 2J8UE 3P9WB 4AC4A 3MRFA 3FPXA 3IJSA 4HUKB 5HHOA 3L2NA 1WAAF 2UV3A 1SLWA 2F74A 3WFHA 1VACB 3O2WL 3T3PE 2ZT9C 2BY1A 4AUUA 1QA9B 3EYSH 2OA9A 2R0LH 4W9FC 5HYJE 3DECA 2ZSWA 5AVSB 1U2CA 4PRPB 4MNHB 4I1NB 3RJQB 3FUIA 1ZRUA 3DGCR 3I2CH 3QFJB 2GHWB 2OMTA 2V7NB 2XWCA 4ONHB 3WSQH 4AYFB 5A2IH 3LKOB 2VLJE 4LLMA 2CLRA 1TLMA 1I3RA 3P2TA 5GXBB 3SDAB 1XD1A 2GABA 4H1LH 3MGOA 4DVRH 5FGCE 5C3IA 4OM0H 3OSKA 1DQLL 4WJKB 1NUFA 3KPTA 1R3HA 5AVUB 1KJ2A 1A25A 3T65A 1W72L 1OAQL 3NCXA 4KROB 3W0WD 3WUZA 4XH2A 4FG6D 5DFVD 3AUVA 2QR0B 4OD2A 3FO1A 1V7MH 2R39A 4LIQL 5ANMA 3RPIB 3ULUH 3EFFA 1F1AA 2HG5A 2BNQB 4OCMC 4KI1A 4MCZA 3WU1A 5D7IA 3DXAB 2APTA 2ZCLL 1WO2A 1BMZA 4MDIB 1MELA 4QEGA 1WT5A 3IJEB 5I9QC 2ZYRA 5IBLC 5SV3A 2FX7H 3W39B 1RZIB 3MRBB 5KANG 2YC1B 1NCGA 4DGYL 3VI3B 2AJZA 2MH4A 1KXVC 4LCUA 4RISL 1N5AA 2ZYHA 1FFNA 1EDYA 1XF4A 1J1PH 3CDYA 2A7BA 3TEXA 1IAIH 2C7UB 2CDEA 4XI5D 4CC4A 2VDKB 4KDTA 2PP7A 1NIAA 5ITFB 5JHDA 2R56L 3JWDL 3N3EA 1XH1A 4F2MA 5H2BA 1F90L 5D6CB 2ARWA 3IFNL 4M3KB 1IKFH 5DRZB 4JEGB 1MW1A 4DGVL 1J5IA 4WHYG 2B1OA 2C3VB 3S35X 5GZOC 3VXUA 1PLAA 2NMSA 2FQFA 3MX0B 1I8MB 1X6NA 5CGYC 4WFFE 1EEZA 1UM6H 3C6LB 1QD0A 3F7LA 1FZOA 4DETA 1DZBA 1YEHH 2BNRD 1LEKB 2HUHA 1KFAH 4B9IA 2QJDA 2X38A 5DI8B 1PZ3A 2H6PA 1R3KB 1XGPB 2ZSVA 1GMEA 5LCVA 4AVHA 2NY0C 3SYCA 2E8ZA 2JNZA 2XQBL 4YBHA 2NY3B 4BFNA 3QWRD 4FZ8H 1CE1H