5M95B

Staphylococcus capitis divalent metal ion transporter (dmt) in complex with manganese
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASRSIFSIDTANWYRQPPGMQRELVATITRDGNANYADSVKGRFTISRDRARNTVYLQMNSLKPEDTGVYYCNAAIRTTVRTSAQEYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Divalent metal cation transporter MntH
publication title Crystal Structure Of A Slc11 (Nramp) Transporter Reveals The Basis For Transition-Metal Ion Transport.
pubmed doi rcsb
source organism Staphylococcus capitis
total genus 29
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5m95B00
3ZYZA 4NQXA 5E08H 2FLBT 2WANA 2OP4L 5IVOA 3RDTD 4P5KA 1GGYA 3KHOA 3WE6A 1KJ3H 5FV1L 1BMGA 1EHLL 4UB0H 1EVTC 2NY0C 4R26L 3ARFA 4DKAA 4WHCA 4S11A 4TULH 2IQAA 1MJ7L 5TF1L 4X6DE 2VDRL 1U93A 2WUCH 2VLKA 2HLAA 3WJLC 2UWEE 3KPSB 2BC4A 4JFYA 4HEME 3G5XA 4YC2C 3LSOB 2QEJA 5L2KD 3TLRA 3OZ9L 3LB6C 3GSNB 4FQ2L 3B5TA 4Z7UB 5J12C 3EJZC 1CT8B 1ZA3A 1CZ8L 4GW1A 2PYED 1C12B 5DRNB 2BSRA 1Q94A 4P46A 3NIFE 3VI3E 3ZDYE 2VMFA 5DK2B 4YE4L 2VDNH 5CLTA 2BSSB 3JV0A 5TE4L 1FVCA 5T3XE 5BW7A 4KKAD 3LKQA 2A1WL 4I48B 2FSEA 1FH5L 1YC7A 4NJAH 1CFBA 1AD0B 4PJCF 3RZWA 3UO1L 1J0HA 2CRZA 2NY6D 2PXYD 2CLZA 4L3EA 1OLZA 2ED8A 2OSLA 3HG1E 4BFIB 2BOBB 3CXDH 4JY6A 2Y36H 1MFAH 1ES0B 2IFGA 2Z92A 4L8DB 2XACC 5MEOA 1OGTA 4GG8B 4KKBD 1L7IL 1LWRA 3QPQC 4ODUA 2I9LA 5L8LB 1CE6B 1XGYH 2JIXB 3WKML 4MXWL 1T0NA 1RUPL 4B7IA 1AXSA 1YUHB 2XIDA 1OT2A 1AI1H 1KG0B 5CHNA 4OIAA 3OJMB 4K9EC 2AJXL 1P7KB 3C6LA 3DV6A 3WIHL 4TUKH 1CR9L 4NQEA 3OX8A 4MD4A 2NNAA 2AJYH 1XCQA 2ZCLH 4DK6A 2VE6B 1YPZB 4MA8H 4DGYH 5TPWH 2A6KB 3HMXL 3LEVL 4MQSB 3DSNA 4KQ3L 1P5VA 1A1MB 1RHHA 1YEJH 4MLIA 3WXWH 5GGSB 3MRNB 2IADB 2GJJA 2CLVB 4J3TA 4HIHB 2D4DA 5AZ2L 3IDMA 5D5MB 5C0CD 2V17H 5DZOA 1K5NA 2DWEB 1JF1A 5EC1B 2ADIA 5GRUL 2W0LA 5D1QC 1RZ7L 4ONOA 2OZ4L 2CO6B 3MFFB 3HPJA 3RZCB 1CFQB 5ELIA 3L5IA 1R5IB 5CAYB 1RIHL 2A73A 5EU7E 3EDFA 5FYLL 2O5YH 4XVUD 1XIWB 4H5SA 5IEKA 3CVHA 3MLPA 4NN6C 1Z3GL 4ZFGL 1DN0B 3TPUB 4GKNB 2BY0A 5EFIB 4WDIA 4GMTH 3TBSA 5C3LD 5E5MA 1RK0A 1WBZA 4I3SH 3IKCA 5DUPL 4H1LH 5IOPB 3PXHA 4HX1B 5ID0B 4M5ZL 2UYLA 3BW9B 3G04B 2B7DT 2E7BA 3UJIH 3ULVE 2L4OA 3FQNA 4Q0XL 2HVKB 4KK6D 4M3KB 4E42B 4XCFH 2MWCA 4JRYA 4J4PC 2W60B 4XPAL 4GRWH 2JCCA 1I7ZB 1BVZA 1UA6L 3HUJB 2IGFH 1CDGA 2NY2D 1KC5H 8CGTA 1MCRA 1ZE3C 35C8H 2QSVA 3B2UC 4KGLA 3OKMA 2WMPA 3E2HC 5K9QG 2YUWA 4HT1H 4J23A 4K7FA 2P5EE 3VFGL 4G7VL 2JK5A 4XPHL 4EIGB 2W91A 5D7SH 3HB3D 43C9B 5T3ZE 1AXTL 3MSPA 5F6IB 2X4NA 2VITA 2YS4A 1YEFL 3RVUD 2HKHH 3TN0D 5JXAH 1KELH 1FBIL 3TZVD 3W82A 4LCYB 1XCTB 4N0CC 1OP9A 2XZCH 1KJ2A 1E4XH 4FFVD 3V0VA 3FB7B 3HNTL 2FJGA 3CH1A 3CLEH 4LHUB 3MOBH 5FECB 5IB3A 4AMKH 1YN6A 3FN9A 4R4ND 5I1KH 1RY7B 1JYVA 4JEGB 5I1AB 2OK0L 2UZIL 3QQ4B 3H9HA 4EEEA 1BP3B 3H8NA 2EH8H 1DQMH 2LU7A 4V2CB 1FYTD 3A6BH 4PBVC 4S1SH 2R1WA 2OL3B 2NTFA 1UB6A 5FGSA 2OLDA 5TDPA 1D5BA 4PGCB 3P9MB 4QHLA 2Q7YA 3EJYD 1ORSA 4P23B 3KXFE 3MLUH 3VGEA 4HPOL 1NMBH 3FO2B 3H9ZA 1WITA 2WW8A 3ZKND 1NAMB 5ALCL 4JM2B 1IC5H 5SWSB 1D5IL 1RZ8A 3VFRB 4D0BB 3K3QA 3RNQA 1F4AA 2VLME 2W0FA 4TSAH 1TJIH 4F80A 4OCMC 3TBTA 1CICC 3T2OA 2GTWA 1EX0A 2OYPA 5IVZA 4OV6F 1EEYA 2HP4A 4M03A 5FYJL 3QIBD 4PJ8D 3MRBB 3W11D 2ID5A 1EFXD 4PJGA 4L8BB 3D9AL 4OGZA 2E7MA 4JQVA 3MA7B 4JO1L 3MZGB 4ETYA 1NL0L 1J88A 3HS0B 5JW3L 1SJHA 4PLOB 3L6FA 3UYOD 2YXFA 3VWKD 3X11A 4QRPD 4GS7B 3S88H 1UM6H 2NY1D 3NIDE 2C26A 4U33A 3WSQH 1NKOA 1HDMA 1CGTA 5F7DA 5F7MC 3HZKA 4WW2B 3QCVH 1JWSA 4YO0A 1RFDL 3IETB 4L8CB 5EUOE 3SY0B 4G6AD 4NNXB 4LARH 4EI6B 2X70A 3X14A 4F9LC 4H0IA 2ED7A 3ARFC 1IC7L 4HFWB 5HHOD 1XF4B 4IOIA 1WCBB 1P7QA 2NY5L 4ZSOA 3VFOB 3SGDH 2VR9A 4PJFF 1QVOB 1KOAA 2P42B 4XMKH 5DQDL 4NNPL 2BCKA 4M6ML 3TYFA 3S4SB 1VFMA 5IFHL 2EYTA 1ZS8A 3GRWL 1S7VB 3HAEA 1E4KC 1EHAA 2D0HA 5J6GA 4XH2B 5I1JH 4RZCB 1LVEA 2FX7L 2A9NH 2PW2A 4JO2L 5FO8A 4XPBL 2YHGA 1V7NH 5FHBH 1HHJA 5DDHB 4QY8A 1TFHA 5CD3B 4OZ4B 4K3JH 2B4CC 1ZGLP 4YHZH 3VDCA 3DURA 2NMSA 5F1IB 3P2TA 4X5WB 2QR0A 3PWLA 1SYSA 4U7MA 5KN5A 5HTSA 3WYRA 2CK0H 2O5XL 4FQQB 5DA4A 4MNQA 2MPAH 3BWAB 3REVB 4O4YH 4U6HB 1CGSL 4XP1H 4NGHH 5KSVA 4HQQH 1QPPA 2DBLL 4DKFL 3UTTD 2HTLC 4PJIF 4Q9QL 1RI8A 5JZ7D 2F5BL 5IHUH 4E41E 4PLJC 4DFIA 4JPKL 5D7JA 4Z8FH 1XGQA 4LPYA 2AQ2A 2YD7A 5CSZB 1W0VB 2D7TH 2H32A 5HYJB 3TF7C 2ARJB 2IANA 3S5LB 1CFNA 4GG6F 1JI1A 5C0BB 3C5JA 4Z76B 5HHPA 2XTJB 5GGUA 1YJDH 3MNZB 1KSRA 1C5DB 1NFDE 1I3RA 1LMKA 5ISZD 2AABH 3GSQA 3STBA 5FA4A 5JXEC 4Z7NE 5HBBA 4CVZB 1JGVH 1K8IA 3B2VL 4PV9A 4MJ6B 4YAQB 2FWOB 5DYOB 4HBCH 2QSTA 1V3LA 3B9AA 4JFFA 4QXGL 3GHBH 3O3AB 3G6JE 4IIQB 4EVNA 4TRPL 3VFUA 2P8LB 3D39B 4RX4A 1N6QL 1QBBA 2Y72A 5DQJA 5EBGA 1NDMA 3G08B 4J3VA 4DVBA 2J4WL 1M7DB 1H15A 4JO4H 1P9MC 1J0JA 2DTML 4J6RH 3ROLA 5I76B 1I1FB 1JTOA 4LVEA 3DVFA 3C60C 4Y4KB 3ARXA 2MQ0A 3P77A 5C0GB 3VXMB 1SM3L 5HI5C 1AKJD 2GJ6E 4QTIL 5DD5H 1XF1A 3V6ZA 5HHNA 3CU7A 4RFEA 2XG5A 5HPMB 3PHOA 1L0XA 1UVQB 1I1YB 2KUTA 2BVYA 4XMLH 1BQUA 1JRHL 2D4FA 4EI5A 3LQAL 5KW9H 1S9XB 1KB5B 3BT2H 4YDKL 4PG2C 4DVRH 1RU9H 1I9JL 3GSNL 3OJVC 4NRZB 1AR2A 5I75C 4FZEL 4XWGH 4IRJC 4Y2DD 4HXBL 4I4WA 2GSIB 2VH5H 4S10A 4FRWA 3NZHH 4HKJB 4OIBA 3JBG7 1DUZA 5CMAA 1AIFA 2H3NB 3LZFL 5DD1H 3ZYJA 3BXNA 3QP3A 4PJDA 5H35B 2D3VA 4P3DB 3UTPD 3PV6B 1JGUH 2XXMB 4KDTC 4LP5A 4NBXB 4EDXB 4PP2B 4QKXB 3RBSA 3UBXB 3TBVB 3BDBA 3PWJA 4EQ2A 5FKPB 5C09A 2VYRE 3ALWA 2V5SA 1CE1H 1ULVA 2VXTL 1TPXC 4WI3A 2XI9A 3MV7B 1SQ2N 3D25A 3MV9A 2YWYA 4L4TD 1MUJA 1IILE 2GK2A 1KCLA 1E28B 3SGEI 3MRPA 1J1XL 4TVPL 1YDPA 4U2YA 4F7TB 1P2CB 3L5XH 2YZ1A 3D2UD 1MH5B 2Y5TA 4LSRL 4ONGL 3G5ZA 3GSWB 3IDIA 4NO2B 4FTVB 1JPSH 3PWVB 4HKXB 1DVFB 4PGEA 3FCTB 2V7HA 4F37K 4M7ZB 4L29A 4X6CA 5CJBA 1D7FA 2NY0D 4R97B 4G6JL 3QXTA 4NP4H 1CG9A 3CSGA 4FQJH 4JZNB 1LO4H 5DEZA 4QO1A 3MPCA 1KGCE 4C56A 3CK0H 1IGFL 2R2HA 3NABL 3TGXA 4DOHE 3FB5A 4OF6A 4U6YB 1KB9J 2VTFA 4LNVA 3Q6GH 3D6GA 5F89B 3LB6D 5D4QA 1WIUA 2FNBA 1FRGH 3V4PH 4B7LA 2DQEH 1WZMA 3JZ7A 4OLZL 1VACB 2V7NA 1NGQH 1VSCA 4XP6H 3DXAD 5F7EH 2QADC 3P0VH 4TUOB 5F9OL 1KLUA 4LPTA 1L0QA 4XGZB 5KSAA 2I07A 1I8KB 4LNRA 1FN4B 1IM9B 1QYGH 1HH6A 2A6IA 3O2DH 5C0AB 1PY9A 4E9LA 2F19H 2WUBL 1R24B 4NT6B 2HJLB 2EXYC 2RAMA 5C8JB 4LMQE 2VLJE 3VFPB 2JJSA 2DIAA 2ORBH 4ZO8A 1JWUA 3PV7A 3VXSB 5HVHB 1CXKA 2WNGA 5IFJA 2C3GA 4LLAA 3ZKXB 1QFOA 4HJJL 2VKXA 4FFYL 2DMBA 3I9GL 4X7FC 4ZNCD 3VFTA 5F9WC 1F02I 2APFA 3MRHB 4J1UA 3RWHA 1VGKB 3UC0H 3QDGB 4HH9B 4X6DA 3CDFA 3S96A 1KIPA 3P9LB 2ATKA 3LQZB 2FIKB 1H5BB 1QBAA 2UWEA 4WUUB 3QCTL 1FNGA 2EYSA 3MJGX 3HC3H 1KNOB 4L9LB 3MNWB 3OXRA 2Q6WA 1WV7T 1J0ZA 1RUKL 1E27A 1KXTB 3VE0B 3K4AA 2BRRL 3BHBB 2BJMH 2R4RL 2R1XB 4JFEB 4Y19B 1ZVHA 2WZPD 1FC1A 3VGAC 1CK0H 1HHIA 5A3IC 2AXHA 5EO9A 5E1AA 4YGAB 5DVNA 4U1HA 3QXAB 4WFFD 1Y18B 3JV4B 2BOCB 4NKIL 1OARL 1UM5L 1MEXL 3ILPA 4PGJA 2WBJC 3HG1A 1X7QA 2R56H 3CLFL 4NSKA 2QQQA 3TNMA 5F9JA 2H2SC 1X6LA 2Z4QA 5IQ7L 1NGZA 1ZV5A 3VRJB 1HH9B 4XCNA 4LSTL 3HFMH 5D71L 2YA0A 3RUGE 1S7XA 2CGRH 4GRMB 3TO4B 3ZE1F 4HWBL 3TIEA 4JJHA 2R0ZL 4O2CA 2BVQB 1K4DA 4CMHB 4LPVA 4R8WL 4CRPA 3FAXA 1QLFA 1I3GL 1J11A 1LE5B 4ZXBB 5CP7B 4LKXA 4PRPB 5GGVL 4H8WH 1BBJA 2C1PB 4HGMA 5H94A 2OL3L 2PO6B 1F00I 1U8JB 3L3KA 1QBMH 3QIUC 2Y4SA 3PP4H 4HPYL 4J4PD 1VKXB 4CVUA 3SBWA 1KN2H 5LWYH 2ZCKL 4XXDA 4YXHH 4PJ5D 1NAML 1QSFE 1VPOL 4XP9H 2NYYC 2MCPH 2OS7A 1GZPB 5LGKA 4R2GC 2CXKA 1ACYL 2ZJSH 2BK8A 3CFCL 1B4JH 1BLNB 1EDQA 4PV8B 5DD3L 1SEQL 2I60H 4IDJH 4MZ2A 1LNUB 4Z0XA 3GKWL 4MNGB 1T80A 4CBPA 3HA0A 1EGJL 4ZPTA 5TQ0H 1QEWA 4PB9H 4UTBL 1HXMA 1FG2A 5B39A 4Q9CA 5BVJB 2J8UF 5GISH 3QEQB 4L9DA 4F7PA 1UJ3B 5DHVH 2Z93B 1ZEAL 5EZOH 3CPLA 1QACA 2EDTA 1VADA 1T3FA 4KJYA 4OM0H 1Z2KA 4UILL 2F58H 4IJ3C 1ZHNB 4QWWC 3EOTL 1BQSA 4QOKE 2P4AB 1C8PA 4QNPF 3MRJB 4OLXL 4N0CD 1A7NH 1CLCA 5DHYA 3QIWC 1TMCB 3V5DA 3LD8C 4JGMA 2OXHA 5E6IA 1QSEB 4HWUA 4JE4B 4D3CL 2W38A 3MXVL 4K3DH 3O4LB 1H8OA 1GRWA 1MCQA 1GGCH 4JDZA 4P2QB 5C1MB 5GGQL 4NC0B 4U1MB 3V4UH 2OI9B 3HI5H 3LS4H 5IT2L 2HH0H 2XQBH 5DQ9A 2QSCH 1JNHB 5HYEA 2MCG1 2EE9A 3IXTA 2PN5A 1J8HD 4HWEL 1FZOB 3HCVA 3T8XA 2OTWB 1FFPB 2P5EA 4H25A 1F8TH 3SDXB 3OKLA 3JTSA 3RTQD 2RFXA 2B20A 3PGDB 5DUMH 5FAAA 3T0XA 3HNSL 4UT9H 3DMMC 3CVHH 4RMUA 3BKYH 3RWDB 1CI5A 2NY3C 2BNQD 1ZWIA 2QKIB 5J06A 1XZ0A 3HMWL 1GGUA 1NCCL 4OLYH 1T22B 2VUYA 3MC0A 1U8KA 1IEBA 3ARQA 4OZHB 2DQDH 2YPKA 4P2OA 3BEWA 4KK5C 4HH8A 3MLTB 2OXGA 2O26U 4BZ2H 5EU6B 2DBJA 2YKLH 5DT1H 1A1OB 3OKOB 1Y6NR 3H0TA 4S2SB 3B9DA 3WS6C 3TIDA 5ANME 2OTPA 1OP3H 5D2NB 4PJEB 2X4TB 4JDVA 3OL2A 3GBNH 3D18B 3QJFA 5KSBE 2JB5H 2X05A 4KMTH 4YHKL 3ARFD 5INCB 1A6VH 3KXFA 3M17B 3TVMC 2XWTA 4X8XA 4JHWH 4Y4HA 1IGYA 4LIQL 4YBLC 2NXYD 3GUTA 4MQTB 3W9DA 2X89A 4RIRA 3LHPL 3WEXB 1N7ML 2W92A 5F3HA 5JTWA 4MCYA 4RWYL 1A9BA 1KCUL 1OB1B 2EZ0C 2R0KL 4XRCB 4LVHC 1WTGT 3ZT6A 5K93A 5LXGL 4ZS7H 4QF1B 2DQCL 2VL5B 2ESVD 1MFEH 1N3NB 1P4BL 2K7QA 3NCMA 5HHMB 2LVCA 3QEUA 5FYJE 3KYMA 3MUJA 1UG9A 2E6JA 1ZVSA 3LKRA 5IHLB 2DLFH 1N5YH 1OD7A 4AYFA 2ADGA 2DIBA 2OJZH 5T33L 4GXUM 4Y4FA 4JREB 5AUMA 4PRIB 4ZUTB 5CEXB 5JHDE 2PW1B 2Z9TA 4JQIH 1GXEA 3JV5A 3ZTNL 3PGCA 2X1WL 1T89A 4XBEL 4JO3L 4L3ED 1AJ7L 1KTDA 3HC4H 3VFNA 1CBVL 2D7QA 2EKJA 1T7XA 4GRLA 4AEIH 2HTLD 3T0DA 3F7YB 5EUOA 4OD1H 3JTTB 2ZUTA 1T1ZA 2VIRB 3P4OA 4R90H 4U05A 2CXGA 4JLRB 1Q1JL 1SJEB 3CMOH 1F6AB 3IXAA 1NCWL 5GS0H 2DQGH 4TNVF 3MRLB 4DZ8B 3QNYA 4GAYB 3I50H 4PJDF 2YEZA 1KB5L 4XNUL 4OKVA 3MBXH 2RHEA 3C6LD 4PJAB 4V1DE 5J0BA 3G9AB 4IM8A 2AXFB 5I74C 4B53A 3ARYA 4XNZB 2EDNA 1MFDH 2J88H 3WMSA 4OTXH 1QHOA 2G75A 1GGBH 3RVVC 2DYPD 2V2TA 2FJFB 5MENE 3NCBB 3CFEB 4TNWF 1ZKAA 3TYGL 1NLDL 4I2XE 4O2EA 4RCAA 4E5XB 4D9QD 2G5BA 1GGTA 4GJTB 4DTGL 2BHZA 2CLRA 1BQHA 3BISA 2EXWD 4N90D 1XFPA 1JHTA 4Y5YA 4H0GA 1BOGA 1X5AA 3EGSA 4KH2A 4X6CF 4HUXA 2BHYA 1KCSL 5J57B 2HJKA 3K2UH 3M8OL 4E41A 1OQOA 4OZFG 1AO7B 3PL6B 3QEGL 5DEGA 2FO1A 3V52L 2C3VB 1FZMA 1HILB 1UWXH 3HRZA 4UUJA 5I8KL 4LP4A 5DRWB 3G6AB 3A67L 4TSCH 1A6AB 2R23B 4HUVB 2Y1VA 3PIQB 1MNUL 1FJ1A 4C55A 1A9EB 3NCYS 3E6FB 3SKUD 4NPYB 3VXPB 1X5GA 1NFDA 5E8EA 3RNKA 4X0KB 1ZVYA 2HG5B 3CFKB 1EEZB 1UXWB 3GJEA 3WO4C 3WN5A 4LAQL 5CJOL 1S7UB 4PUBL 1A21A 3SPVB 4CN4A 4FQ1L 5CSBA 3QULB 3KPRD 2EDHA 4J8RB 5IFAL 3MRKB 3DPBA 1H3VA 4KY1L 3WS3B 3G6JA 3GSUA 1TITA 2D0GA 1S9KC 2W1NA 1YYLH 2ZUQB 1NGPL 3O0RH 3VD5A 1T7VA 3IFOA 2R4SH 3RWFB 2OM5A 3QFJB 3S3SA 4JN2B 5EU7C 1Q0XL 3SDAC 4NYLA 5FF6B 4G43B 3DUSB 3NAAH 1T1WB 4ELKA 1FP5A 3WIFB 4R7NB 2HRLA 4YHOH 2Z8WC 3KPNB 2H32H 5KVDL 3DRQA 3RVXC 3FT4B 4NRXB 5F96L 5T5NG 1KACB 3DSFL 2WQ8A 2DKSA 2JELH 1S7TA 2YD9A 2UWEF 1XEDA 3O6FC 4UU9A 4LHUG 2BNUB 3VMOA 4HGWB 3UAJC 1CL7I 3M45A 4WGWB 5B3NA 2C9AA 3P0YH 2GJ6A 4MNHA 4G8IB 1Q9KA 4HJGB 2HYMA 3RX8A 4XNMA 4HG4K 2GI7A 3R0NA 4B5EA 3QDMB 2VO5A 5F1NA 4PRNB 4U6XB 3TJEH 4MA7L 4MX7A 1NSNH 1RIUH 1U9KA 3CDGA 4CVXB 5CGYD 4R4BB 1PZ5A 2NZ9D 4Z7UE 1S5IH 1J7VR 3IAQA 1G0XA 4FOMA 1VFBA 1R0AL 2X7LB 4B0MM 2YMXL 4TQEL 2UVFA 4A6YA 3W2DH 3LRSB 1L4IA 2Q87A 4FQHA 3Q6FB 2Y07L 3NCCB 3BQUC 1PG7W 4XBGA 5GS0D 3O6KL 4ZS6D 1A1NB 1RZIB 4GAGL 1A5FH 4QXWA 2X6MA 4O02H 1MCPH 4NQTA 4RGND 3F8UB 2VDOH 2Q8BL 4X98B 1J12A 1NDGA 5EN2B 5IR1A 1NUNB 1CD1B 1XR8B 2VLKB 3T1FA 3NPSB 3J8F7 5ADOL 5I1IH 4PJ9C 3B9VA 3WLBA 3QH3A 3F12A 4LRNH 5ICZA 4TVPE 3PDOA 2X44D 2NXZB 1XGPA 3SJVE 1ZA3B 2FL5A 3GM8A 5E7BA 4LCCC 3B9KA 3HC0A 4X8JA 4Z9KB 1RURL 5E1HB 5GIRA 2GFBA 4FQLH 2EDEA 1U8IB 5J11B 4HUWB 1SMOA 3LKQB 32C2B 4GOSA 1YNLH 3FO9A 3O9WB 4KV5E 3SKNA 4K94H 4PBXA 4OD2A 4S1DC 2CIIB 1FHGA 3G9VA 3EFDL 3E8UL 2VABA 4GQPH 5J13C 4TYUA 1YPZE 4JZJB 4JANA 3S4SG 3IT8D 1YMHA 1KFAH 1HKFA 4X4ZA 1U92B 2I9LB 3KLHD 5DUBA 1N6VA 2VXSL 1FGNH 1FZJA 5D5ME 1U3ZA 4AIOA 3VFWA 3TBYA 2NY4B 5CHNB 3VGGA 4FZ8H 4IS6A 1PEWA 4YXLL 4F2MB 2RB8A 1YEHH 5KVMC 3DV6B 4GW4B 1MHPH 4CW1A 5IW6A 4MWFA 4CN6A 3ULVF 2VLJA 4KAQH 4E0RA 1I1AA 3K81A 1XF5A 1ZK9A 5CBEB 3C5SB 4XPGL 1S7RA 4GSDH 1I9RH 1HXYA 1T89C 2H2SD 3OV6A 4NN7C 3K2MC 2MNUA 1RHHB 4NIKB 4C58B 1OP5H 2VDKL 4Y2OA 1WZLA 1TQBC 1DBJL 3CSBA 5CKGA 1LGVA 4L4VD 5FCSH 4F57L 3LV3B 4HBQA 4KROB 4PS4H 4XBPB 3GK8L 5A2KH 4X6BA 3HUJE 4KKLC 5EOCH 3V5HB 4WHTB 5LGHH 4G5ZH 3ARUA 1C08B 2X4PA 2AXGA 3I6KB 3U83A 5ESQA 3IRPX 2A73B 2IAND 4OZGF 1WEJH 3KPTA 4YUEL 1G1CA 4KHXL 2YZ8A 1HE7A 3NA9H 1RHFA 3QIUD 3H3PH 2ZPKH 1ONQA 3PWNA 4WDIB 1R3LB 4FXGA 5E5MB 3G5YB 1RK0B 4LSVL 5CGMA 3Q0HA 4HGKC 2NYYD 2WK2A 4G6KL 2AEPH 2HWZL 2UYLB 1T4KA 1N5AA 1M7IA 3FQNB 1T5XA 3KR3H 5DLMH 5EB9A 4JRYB 3X13A 5JR1L 2OJEA 2JCCB 1R6VA 4JFFD 1KYOK 1S78C 1G7MB 5D8JH 5ESAB 3OTTA 3MYJB 4P9HC 4APQA 3QWRD 4G8GD 4EN3A 4AIXA 3BVNA 3OKMB 4Y89A 1A7PH 3GMLA 1Z0MA 4NWUL 1CTOA 2C1OA 3RUGA 3VXTB 3KPOA 2EEAA 4N9GA 5B38B 1A7RH 5DJAB 3QIWD 5MHSE 3SGEH 4JFZH 5C0RH 5E94B 5FO7A 5C6WH 4N0FB 3WIHA 2OMBA 1PX3A 4NO3B 4KHTL 1UWXK 2EEDA 1U3HA 3DBXA 5BVPH 5T3XH 1W0WA 4JN1L 1QSFA 3IF1B 3HMXA 1ZTXH 5IESH 5SWSE 2PNDA 4X99B 4OZIB 4JHAH 3U4BL 4K8RH 3O81A 4NZTH 2EICA 2EDJA 4FG6C 1WBXA 5DI8A 4EZMA 4G6FD 2OZ4A 3UBXG 1A6UL 4R6UA 3RQ3A 4CU8A 1LK3H 2R1WB 2NY3D 1IM3B 4QOKA 2W0KA 1UYWL 2MOVA 4R96B 1DP0A 5GGRB 2YA1A 5F7YC 3FN0L 2I9TA 4M9OA 5HD8C 1CFTB 1W8NA 3QUMB 1T2QL 3PWPE 1G0DA 3C6SA 4HV8B 3AS2A 4M1DH 1AP2B 1DLHB 3MJ8B 4Y16A 1MCOL 4DW2L 1JI2A 3T2PA 1RZGA 5AZEL 2GTWB 1VGEH 3PE9A 2YUVA 1LDPL 4Z7QF 2DQUL 4WWKC 1D9KC 1ZA6B 1MLCA 4FXLA 4ZFFA 4NQDB 2RBLA 3TWCL 5IF0B 1NMAL 4P4KA 1SJHB 1AGFA 5F1SA 5HGDB 5BO1L 1OCWH 4I77H 1FE8L 3CFJA 2XKNA 1BBDH 4NDMA 2DQTL 4ZUUB 5D72L 2VOTA 3QXUA 1WBYA 4NM4L 4P5TA 1I8IA 3MLXL 4ZAKB 4KPHH 1WISA 3HZKB 1WC7A 2BVOB 2X2YA 2OTUA 5T5FL 1WAAE 1UEYA 3FFDB 3WUWG 5K9OA 2WIIB 4XNYH 1P7QB 3QA3B 1NUDA 5IMLA 1NGYB 1C16A 3QUZA 2VWEE 3BKMH 2ICWB 6CGTA 3GMNA 4CMMB 3ULVH 5BXFA 2Y6SC 4F58H 1HINL 1O5DT 4FQXC 3HAEB 1DE4B 3OHXA 2P24A 5FK9B 4L4JA 5D1XA 5J6GB 1ZHBB 3VG0H 4OGAC 4ZTPH 3DVGA 5ANMA 3DYOA 4FFZL 3IJHA 3TO2B 1HHJB 5FUZH 3P9WB 4QY8B 3C08H 1MCDA 3X12B 4LVOC 5HYJE 3MXWL 2EDXA 3GFUA 3V4VH 3O2WL 3U2SA 4Z7NF 5KSBA 5C0BE 5KN5B 3NOIA 3L7FB 2AP2A 3VJ6B 2FB4H 2XTJE 5T3ZH 5F7NC 1JYNA 3MRFA 4ODTL 3FTGA 4AM0A 5JDSA 3U82B 3G6JF 2BSTB 4GKSA 2XNAA 4PGBB 5F88B 2AERT 9CGTA 5I17B 4LVNC 1UFUA 3ULUC 4KKCD 1FGVL 5D6DA 3G5VB 4LLDB 1RJZB 3MBEA 1FORH 1PSKL 5MI0B 3T2NL 5D7JB 5D7IB 5DVLA 1XGQB 3SKOA 5GS1C 4HK3N 3ALXA 2WAHA 1WIPA 3DX7A 4JY5H 3D39E 5JIHA 1OGAB 3RVVD 1FPTL 5B8CA 4DEPC 3C2AH 4OI8A 5T3XD 4FP8H 3RL1A 1JPGB 3ARDA 5JHDA 5GGUB 2F74A 2ATPA 2FEEL 2FZ3A 4LLQB 4TNWK 5LJYH 4K8RD 4ZUSB 3BO8B 4DQOL 5B21A 1FO0H 4R0LA 1BF8A 2PF6A 3UJTH 2G2RB 2QQKH 4D2NA 5H37G 2JF1A 2NY2B 5L9DL 3LKNB 3WD5L 5BRZB 2CDEA 1O0VA 4ENEC 3VXME 2Q8AL 5L6YL 3MJ9H 4XNXH 5C0FA 4HFUL 2FJHB 5HI3D 3FT2B 1G7PB 3FN3A 4JFHE 3HZVA 3BIKA 3MRGB 4N9OB 1DZBA 3MLSL 3VA2C 3VFUB 3QUYC 1JHKL 3HNVL 4UBDC 2E8YA 1BVKB 4Z77A 3O2VH 5DFWH 5FYKE 3REWA 4V1DA 1H15B 4X80L 2CUIA 4ISVA 2YBRA 3ARBB 1XF2B 4OCWH 1YN7A 3NZ8A 1N2RB 4HKZB 4RAVA 3ROLB 2PYFA 3RWGA 3FHQA 4LQFH 4K23H 5C71A 4JG0L 5MENA 3AMKA 1FCCA 3O3BA 1MLBB 4I2XA 1OAKH 4L3AA 2AI0L 4DUVA 4HK0A 1A7QL 3U7WH 5IW3A 5DO2C 5CINL 2P48B 5F93C 3C9NA 3LDBC 5L8KB 4XP4H 1U3JA 2DMCA 4I0PC 3RWCB 1JRHI 3MRQA 1AE6H 3MV7E 3NN8A 3QI9C 1ZLUH 5EO0A 1A6WL 5I73B 3ZDZE 1CFVL 2AV7B 4XB8A 4HS8H 4APQC 2XZQL 4EN3C 2YRZA 1MPAH 1RZKC 1A6PA 1F45A 1HN1A 3X3GH 5TE7L 2XG4A 3KYNB 3PNWA 3IU4H 4HC1L 4MDIB 1QR1A 3RVXD 4FTVE 1N59A 4Y5VB 3DVNA 3JV6A 2ADJA 4JQXC 5D7LE 3O6FD 4J3SA 1MHEA 2X4RB 3UAJD 3ULUF 3NACL 5E6ID 4N68A 4DCQB 1WWCA 4EXPX 3FRPG 5KS9F 4OCXH 4RFNC 5C09B 3VGFA 4O9HH 1Q9WA 3ULVD 1N0LA 5J3HD 1IEAA 4Q6IC 1YZZA 4FQPA 3EFFB 1R3IH 4DGIH 3R8BB 3HE7C 5SWQB 4Y88A 4U1KA 1YEGL 3EOBA 3K8MA 3KNBA 3QISA 4PJ8B 2V5RA 3MRPB 3PGFH 1J1OL 1OTTD 3QG6B 2Z31C 3CUPA 3WXVH 4RQQB 4XVSH 4MA1C 3V0WH 5MEPB 2P5ED 1QSVA 5JUEL 1R3JA 4Y0GA 4AL8H 2GY5A 2DLHA 2R0LH 5T3ZD 1YEKH 1JJUA 4QRPB 2V7HB 1KUMA 4LSSL 5DURD 1I7RB 3DOSA 5DJXB 2ZUVA 4I18C 4IRSC 3BQUD 1F4XH 5E6ZA 2OQJA 1JYXA 4JKMA 2V5MA 5C0AE 5DJYA 4UIKH 3QSKB 4LPWA 1CG9B 3I75A 2H26A 4S1RH 5EZIH 3MUY1 4YXKH 3TA3B 4U0RB 3GI9H 2VC2H 4QXTB 5AWNL 5IGXL 4P2OD 4FQIH 3T0EC 1T1XB 4PJ9D 2RCSH 3AREB 2MKLC 4WTXA 5F8RC 2CRYA 1GGIL 4LCWD 4LQ1A 3CVIH 5E9DD 3QDGE 1G6RB 3NIGE 4IRZH 2JE8A 2V7NB 5D96C 4FXKB 4JKLA 1FIGH 1PKOA 2I24N 1I9IL 2P5WB 5E8OB 4OCSL 3N50A 3HR6A 2AJSH 3ILQD 1V3JA 4WUUE 4MYWB 3HN3A 15C8H 4LLVA 4UAOC 5I6XC 4PJXB 4Z7UA 1C5BH 4PLKC 2I26N 4S1DD 4UINH 1CT8A 3VXUD 1GC1H 5LCVL 1C12A 5T1KB 3KXFD 5DRNA 3KJ4C 4J3UA 1X5KA 4Y4HD 4H88L 4UT7H 4DGVH 3OAUH 1N26A 4JFEE 4Y19E 5DK2A 1BJ8A 5HPOA 2BSSA 2CRMA 1FAIH 3T09A 1CQKA 3GKZA 5E2TL 3JVGC 4I48A 1BD2D 4UNUA 3RWHB 3GNML 1P4IL 3RPKA 3F58H 4YDIL 3S96B 25C8H 4WUKL 4KTEL 4NM8L 1LK2B 4BFIA 5E03A 2BOBA 4L8DA 2KQNA 3EYOA 3SQOH 3DO3A 5CJQH 1G7JA 4GG8A 4IMLB 2K3TA 1VENA 1CE6A 2JIXA 3SJVA 1YQVL 2YN3A 1YUHA 1BAFL 4O5LL 4LPUA 5I1GH 1EBAA 5FO9B 1HHIB 1EUUA 2ICES 2GTZB 4PRDA 4PRPE 1NCAH 1P7KA 5ISZB 5E1AB 3KPMB 2IWGA 5HGHB 4U1HB 3UP1A 3V6OC 4A6YH 1HQ4B 1YNKL 3T4YB 4LSPH 1NC4B 2JJUA 2VE6A 1YPZA 2A6KA 3U36A 2DM7A 2Z4QB 5F7LB 1OAQH 4WI7A 1DL7H 1A1MA 5GGSA 1NFKA 5E5RB 2IADA 4QXUL 1QTYT 3VFVB 2FGWL 4HIHA 4MNGE 1HIMH 1U8OB 5D5MA 4X6EB 2WLZA 4RISH 3TIEB 2DWEA 1HWGB 2E6PA 5EC1A 2J8OA 3EHBC 3QEQE 4D8PB 4NZRH 4M48L 4JRXB 4NQSB 3LEYL 1R3KB 5GHWL 2HFGH 3MFFA 1CFQA 1JE6A 3QHZL 1R5IA 5B8CC 3AM8C 3OPZL 4Z7VF 3KDMB 5HYSB 3ELAT 1XIWA 1OM3L 1AKJB 2BDNH 4MDJB 4NHCL 3ZKMC 4JFOB 3E6HA 1DN0A 3VCLB 3BUYB 4GKNA 1S78D 4MAYB 5EFIA 1A47A 4OZFA 4XXDB 2BX5A 3S34L 1H3GA 1JHLH 5IOPA 3QUML 3GGWB 4HX1A 5ID0A 4MB4A 2H2PC 2EEBA 1J1PL 1MFCL 1QSEE 2EDYA 1XGUB 3BW9A 3G04A 3MCLH 1HCFX 5J7CC 3O6LL 4WV1B 2B8OT 2WSKA 2HVKA 1XGRA 4P2QE 4E42A 5B39B 4LSDA 5JMRA 4HDIB 2W60A 1DANU 3VI4F 4Z78B 1T0PB 3ULUH 3HUJA 2E9WA 2EDOA 1T83C 5AD0B 3CPLB 5IBUG 2KH2B 1CL7H 5HYQB 1EO8H 3S7GA 1KBGH 5E4EC 2B2XL 5CCKL 4YQXL 4CDGC 1L6XA 3ARGB 3SE9L 4I13B 5D1ZB 5BV7B 3SDXE 3INUL 3SE4A 43C9A 5TFSH 4KVNH 1F58H 1X5IA 4NUJB 4YDLC 2YPVH 2XN9E 2UZYB 1DBAH 1AGEB 1MCKA 4WFEE 5INDA 4LCYA 3D85B 1BVLB 1XCTA 4LCIL 2VAAA 4OZHE 2X4OB 5DQ9B 1T2JA 4R26H 2YUXA 2VXUL 3VRLF 2XPGB 3FB7A 5FGBC 1OPGL 1H3TA 2XRAH 5EU6E 4UNTA 4LDOB 4LHUA 2VDRH 3S3JA 2P45B 4HWBA 3HI6H 5AYUL 4GAFB 3ROOB 1QG3A 5I1AA 1BFVL 5HD8D 4KRPC 2QV2A 4PRAB 4FQ2H 5D2NE 1FFRA 4PJEE 1M7XA 4M7KL 1JGLH 2GJ6D 4YC2B 1XZ0B 4PGCA 3P9MA 4P23A 5J12B 3MR9A 4WWKD 1S9YB 1D9KD 1U8KB 5TE4H 3FO2A 4R9HA 4XP5L 1NAMA 4JM2A 4I3RL 1FH5H 3DXAB 4G7YL 4GBXC 5SWSA 5DSCB 3GSOB 3SDCC 3VFRA 4D0BA 3NFPB 4K7PL 1J8KA 3UO1H 1EGJA 3H0TB 5K9JH 2O61B 1T20B 3KS0H 4QRRD 5HHME 1TJHL 4F9PC 3D1MC 3L3JB 1RZKH 3MRBA 1T03L 5D6CB 4X83A 1BZ9B 4L8BA 1AGBA 4JDVB 3WKMH 3PWUB 4MXWH 1QKZH 1RUPH 3BSZH 2PTUA 3MA7A 5ITFB 1VB9A 1BQLH 5C2BL 3QNXB 4PRIE 3D3VB 4AEFA 5I1HL 1P6AB 3AS0A 5DEFA 1UH2A 2AJXH 1IJ9A 2Z35A 5I15L 3PWPA 3VGDA 3WIHH 1A9BB 1CR9H 1PY4A 5ECJE 1A3LL 4WW2A 3SOBL 2F15A 1UCBL 3IETA 5DWUL 3SY0A 1WZ1L 4H20L 4L8CA 1DQTA 4NNXA 4NHUB 4FQXD 4U7SA 4YDVA 4EI6A 3AVEA 4HFWA 3WNMA 3VWJC 1BFSA 1WCBA 3TM6A 3HMXH 3LEVH 3LMJL 3QEUB 5BCAA 4OFDA 3B9KD 2DL2A 3VFOA 2FATL 1QVOA 2BXYA 2UUDK 4HZAA 5AZ2H 2KBGA 3S4SA 2BY3A 2F5AH 4NO0A 4M3JA 2KPNA 2DLGA 2WUCL 3T0WA 1S7VA 4N1EA 3WFHB 1RZ7H 2EECA 4XH2A 4RZCA 1KGCD 1HSAB 5DDHA 1RIHH 3VDBA 3C5ZB 5JNYB 5D1QB 5CD3A 4OZ4A 5FYLH 3SDYL 3ULUD 5F1IA 4ZFGH 1WAAA 5J1AB 3FQRB 2FEDC 2VXQH 3M07A 2ERJC 5DUPH 1HHGB 3BWAA 4PJHB 2G5RA 4NN6B 3FOMB 3SCMC 2XQYG 4U6HA 3QNYB 3FJTA 5K9KB 5E8DH 4Q9BA 4Q0XH 3IKKA 1A0QL 4OKVB 2YD1A 4W68A 2X09A 2R29L 1SJXA 1KTLB 3FO1B 1NUGA 2GW5A 1JNNH 5F3BB 1AO7E 5B3JE 4N0RA 6FABL 1Q8MA 2DDQL 3RJQB 1S7SB 1CF8L 5JW4M 4EUPB 5CSZA 1W0VA 2ZUYA 5HYJA 3ZHDA 1NCDL 2E9JA 2ARJA 2P8MB 2PCPB 4ENED 1KLGB 3VFGH 5C0BA 1U0QA 3N0PB 4MD5B 4Z76A 4G7VH 4XPHH 3E2HB 3MNZA 3GSVB 4I8DA 4X9HA 2VRAA 1C5DA 2EDBA 3QUYD 5AAWA 4QRTB 1AXIB 4TUKL 4PJFB 4CVZA 1RMFL 4ZUVB 1FBIH 2BNRE 4MJ6A 4I3GA 2FWOA 2AJYL 5DYOA 4YAQA 4ONFL 4M61B 4XC3L 4E41B 4DGYL 5FOBB 1AQKL 1F6FB 1RD6A 4NKOA 5EBWB 1AGDA 2IBBA 4Y5XC 3WHXB 2P8LA 3D39A 3HNTH 1FVDA 3HRZB 3SDDA 4UUJB 3IU3B 1JZ2A 3H7BB 3G08A 3V9FA 3KG5A 4XCEB 2IH1B 3QFJE 2V17L 3RZCC 3LAFA 1EEQA 1M7DA 5DO2D 1MJUL 4M7LL 2OK0H 2UZIH 5EZJB 4I0PD 1CDCA 3TC9A 5I76A 4U1NB 1I1FA 5I9QB 3GJEB 3WN5B 4WTWA 4APQD 4RGMB 4Y4KA 4EN3D 1WCQA 2DLTA 3LKOB 5C0GA 3VXMA 1L9NA 5B38G 4U1GC 4PJIB 1UJTA 4Z7UF 1TXKA 1UC6A 3F6LA 2FECL 5C07D 4HPOH 1J8HB 1G6RL 3LH2L 4I3SL 1ED3B 5HPMA 5ICYB 5FFLA 1QRNB 1D5IH 1UVQA 2B0SL 3QDME 2J1KA 4HMEA 2J7LA 3ABZA 3IFOB 1S9XA 3UJIL 3HKFA 3KYKL 5F7UA 1KB5A 4RMVA 5DJ2A 4NYLB 1F5WA 3F5WB 3IB4A 2ZSWB 2GSIA 2XOTA 4HKJA 2D9QB 1CICB 3D9AH 1WWBX 4WFGE 4Y1AD 3T08A 3FHAA 3HE7D 1WICA 4JO1H 1S7TB 1JZ5A 1WIOA 1RZFL 4N5UA 1QSFD 3QG7L 4WFHD 5H35A 4P3DA 4OGXL 3PV6A 4EDXA 4PP2A 2AKRB 4P57B 2Z0BA 3UBXA 3TBVA 1YEIH 1Q9KB 3IDXL 5EULV 1NKRA 4ZYKB 5IM7B 4XNMB 2WINA 3MX0A 3EIFA 3MOAH 5GZNC 3MV7A 2LU3A 3TFKC 1Y0LA 1OTSC 1PVHA 2HKHL 3RGVC 1R5WB 4NCC1 3CDGB 1KELL 5A40E 1IZJA 1X5YA 1IC7H 1FZKA 2WWKT 4F7TA 1P2CA 4MJ5A 1KTKE 4KV5F 2XZCL 5FYLD 4QOKD 1MH5A 1JPFB 1CU4L 4PRHB 3WNKA 5DQDH 3GSWA 4NO2A 1L6ZA 4FTVA 3D69B 3EO9L 4HKXA 1DVFA 1OAZL 2ZOKB 4AT6A 4M6MH 1YPZF 5D7LA 3T0ED 4A2LA 3MOBL 5IFHH 3GRWH 2F8VA 2E9IA 3EO1B 3GMRB 4LBEB 2DJUA 4AZ8A 4O51B 2FX7H 4JO2H 4JZNA 4XPBH 1MRFH 3CX5K 2EH8L 1DQML 1MIML 1ZLSL 3LRGA 5IK3B 4Q7DA 2ESVB 1EK3A 1OW0C 4U6YA 1VCAA 4DAGL 2O5XH 5F89A 5IEHB 3MLUL 4PLKD 4ODSH 4P4KD 2FL5B 2QQNH 4MA3A 1VACA 1P6FA 1RK1B 1MCCA 3WUWA 4DKFH 1MY7A 3MLYL 2IBZY 5DD0L 4TUOA 5EU5B 4TSAL 4LRIC 2EIZB 1TETL 1TJIL 4P5TD 1I8KA 1IM9A 3D0LB 2GCYB 2BVTA 4JFXB 5C0AA 2PKDA 1R24A 1XAUA 3IGAA 4NT6A 2HJLA 5C8JA 3VFPA 1F90L 2PR4L 3PP3H 5DHVB 5GGTL 5ACZB 1CVRA 1S5HA 3L95B 5E7FA 4GS7C 1UQSB 1A7BA 3QUZD 1RVFL 1V3MA 4Y7MA 5BOZG 2CMRL 2FX9L 2AJZA 2AS5M 3W9EB 3MRHA 4WW2C 2C3XA 1D3CA 1FG9C 1VGKA 3QDGA 4HH9A 4NFDA 5D1XD 2NY6C 2AJUH 3P9LA 2FIKA 1H5BA 2HA1A 2EC9U 3OJDB 1IAIL 4WUUA 1SEBB 4OFKA 4LHJB 4OLWL 4MJ4A 2DM4A 1KNOA 3MNWA 2LQRA 3EYSL 3O3DB 4TRPH 3EDJA 2DKUA 1JGDA 3VE0A 2EDFA 5BV7L 1S7RB 5DC4B 2NX5D 2R1XA 4JFEA 5FM5M 4Y19A 5BS0D 5HHXL 4RWHA 2UV3A 1HYRC 2J4WH 1D5ZB 1RULL 3WDJA 1REIA 1IKFL 2A6JB 4FABH 4OFYA 2A9NL 3QXAA 3BPLC 3JV4A 2BOCA 5FHBL 1YEEL 4NFCA 2QBWA 3MBED 4RRPG 2EE6A 2FGZA 2VWEC 1SM3H 1F11B 5DK0B 1A3QA 1BFTA 2AXGB 3VRJA 2H45A 3C60B 4HUMB 1TZHB 4TOYL 4P2CG 3AB0C 1JMXA 5JHDD 4GRMA 5T1LA 3TO4A 2B39A 4NGHL 4XZUB 3ZKMD 1JRHH 2E8ZA 4HQQL 2BVQA 4FXGB 1CIUA 4G6ML 4YDKH 3EYFB 3MQIA 5DD6A 4YGVB 1LE5A 2XXCB 4ZD3L 3GSNH 4JM2F 4FZEH 3VG9C 4PRPA 4HXBH 4Z0BH 3ARPA 3CD4A 2ADFL 1T4KB 2P43B 1KLFA 1M7IB 2C1PA 2PO6A 1U8JA 1U8LB 4JZOA 3LZFH 5LBSH 2GAZB 4PRBA 3TEUA 3KPQB 2OJEB 1VKXA 5C0DB 3QXWA 4IRJB 3KPRB 4CUCA 3RU8H 1ITCA 1INEL 3BVNB 1GZPA 3PABB 4G9FB 2PTTB 3L5WA 2VXTH 1BLNA 4OZIE 1NC2D 1A3RH 4MNGA 5FCUL 4KK6C 1X5HA 5CS7A 4N9GB 3CCHB 1NFIB 5EIIB 3U7YL 1ZSDB 3C87A 2VB5A 4M6NH 4IIQC 1TPXB 3BX7C 3QEQA 5E56A 1J1XH 1UJ3A 2Z93A 3VH8G 1NEZG 4BQ8A 4J12A 3AMLA 3ETBF 1ZHNA 4WW2F 4QCIB 2AVGA 2Z8RA 4LSRH 4ONGH 5BZWB 3HR5B 3QUXC 2X4SB 1BF2A 3OJ2C 1DQDH 3DBXB 1BIIB 5DMIL 2R8SH 1Y6KR 4KVCL 4G6JH 4HXAL 4XHJC 1QSEA 4K9EL 3RY6A 3RVUC 4YHLL 5JOEA 4NC1C 4J6RL 4PY8J 1LEKA 5HYIA 4BUGA 4P2QA 1IGFH 3TZVC 3FRPA 3NABH 4U1MA 3SGJA 4POZD 2OBGA 1HK6A 4KRPD 3W0WD 4FFVC 4N8PA 1JNHA 4XCCH 2P7TB 1D5MB 3P11H 4NQDE 3GI8L 4J3OC 4OLZH 4R4FL 1WAAF 2OTWA 5AYQA 4XMLL 1FFPA 5F9OH 5F9DC 1QFWL 3SDXA 1TCRA 5KAQG 1WT5C 5HDQL 3H2WA 5SWZD 2EDLA 4DVRL 2HAZA 4GBXD 2WUBH 2QADB 2DF3A 3SDCD 1XR9B 3RI5K 4U1LB 1FAKT 2XN9A 3RWDA 5FM5O 1KJVA 5DJ0B 4KQ4L 2QKIA 2YRPA 2K7PA 3IDJA 3EJYC 5DD1L 1DTUA 4HJJH 1RUAH 1T22A 4FFYH 3I9GH 4OZHA 3R8QA 1CTNA 4HKBA 5BQ7B 5KBNC 5DJ8B 2J8UB 3MV01 1X5FA 3WFDL 5FDYA 1CE1L 5EU6A 1IQWH 4KI5C 1A1OA 3OKOA 4OCLC 4HEPG 4NKMB 4NDMB 3DLQR 2XFXB 3QO1B 3DIFB 3QIBC 3QCTH 3S35X 3ZKQD 2V9QA 2AEWA 1I8IB 5D2NA 4PJEA 2IQ9L 4L1HA 4HG4J 3I6LE 3LKPB 3D18A 4MCZB 4ZOEA 4H1LG 4R97C 2BRRH 3GEWB 3GO1L 2R4RH 5K9OB 1V5JA 4X7CC 5INCA 2XA8H 2R69L 1P53A 2NY1C 4Z7OE 4N8VB 5C0CE 3GMNB 1DDHB 4NP4L 3WEXA 3HHRB 5DR5L 1ZT4A 1IGTB 1OB1A 3DARA 3KPSD 3U0WL 3VGAB 4JHBA 3QFDB 3KLAB 2A6DB 1UZ6E 1OARH 5IB1B 1P5UA 3OHXB 2P24B 1H8SA 4QF1A 3IFNL 2VL5A 5GRJL 1N3NA 3DVGB 5D7IE 2AK4B 3Q6GL 4PG9B 1EA9C 2VDQL 4OJFL 1EHXA 1OGAE 2WBJB 5D71H 3V4PL 3FO0L 4RGOL 5KSBB 4HWBH 2R0ZH 1G9MC 3IRZA 4PRIA 4XP6L 4ZUTA 5CEXA 4R8WH 2FEDD 2PW1A 2AJVL 3V7MA 1I3GH 1I85C 3U0PA 5C70A 3FTGB 2N56A 3C8DA 4OT1L 2BSED 1S3KL 4NZJA 5E0QA 3KLDA 2BHUA 5GGVH 1VDGA 2OL3H 3DHJA 5IJKC 5BRZE 4YHPB 2ORBL 4LEXL 3F7YA 1U3YA 4HPYH 4J2XA 3JTTA 4KK8C 4WNQB 1BM3H 2IAMA 2JIXD 2ZCKH 2VIRA 1WFOA 1NAMH 3L3DA 4JLRA 1VPOH 3MACL 2CKBH 5T1MA 1GOHA 1F6AA 3FQUB 3DX7B 3IFPB 3MRLA 4UV4L 4DZ8A 1ACYH 3MODL 4GAYA 5DD3H 1SEQH 1K4CB 1SJVA 4OB5H 3UC0L 3GKWH 1T5WB 4UTBH 3ARDB 4JG1L 5J89A 5A2LH 4OF7A 4R2GB 2HVJB 3MO1A 4L9LC 4TSBL 2AXFA 5E2WH 2HRPH 5IQ9B 2HT4C 5EG6C 3QDJB 4NWTH 3HC3L 2R39A 4UILH 1UCTA 3QAZC 2FJFA 3EOTH 2CUHA 3TV3L 4XXCC 3P73B 4PTTB 5IB5B 1QBLL 4G8GB 5EIQA 2W65B 4E5XA 4KI5F 4NUGH 4KUZL 4IJ3B 3T04D 1BJMA 4R7DB 3MMEB 1JZ7A 3W5NA 2FHCA 5I1EL 4MHHG 2EKSB 4UQ2B 3O8XA 4OLUH 3MXVH 2Z8SA 5HI4C 4Z77B 3RZCD 5GGQH 5I1LB 3B5HA 4PJ7B 2YD8A 1CCZA 1XIWD 2R56L 1AO7A 3PL6A 3RWGB 5EBLA 3QUKA 2C3VA 1HILA 3HE6A 4ODHL 3DGGA 2GUOB 2OX5A 4HWEH 3G6AA 4PFEA 3OKDB 2CGRL 4ZXBC 2R23A 4PY8I 3PIQA 4XNQB 5EO1A 1A9EA 1XMWA 3LIZH 1PAMA 3NFSH 5IJVB 3UXFA 4NPYA 3VXPA 3EYVB 3NN8B 3HNSH 4PY7A 4X0KA 4DUXA 3P4LA 3D0VB 5SX4H 4OCRL 3CFKA 1EEZA 1UXWA 3MGOB 3HMWH 4M62L 2BNRA 5GRXG 2HLFD 1NCCH 3TBWB 1BX2B 2B4CL 3DMMB 3PNWB 3QULA 4Z7WB 3ARVA 5LWYL 4UT6L 3MRKA 2NY3B 3MREB 1LP9E 4UDUA 4DK3A 4MMZC 4ESKA 1FFNB 1N59B 5C7XH 2VQUA 2ZJSL 4QRPE 3DUUB 1B4JL 1CGVA 3K4ZA 3BD3A 4QHUB 3RIFF 1MHEB 1F2QA 1KYOJ 3QFJA 5IBLC 4I0CC 5FF6A 2IF7A 5TH2B 4G43A 3DUSA 5GISL 3WIFA 4R7NA 3NIGF 5EZOL 2I25N 2IH3A 3KPNA 3TFKD 2P8PB 1I8LC 3BMWA 4WU7B 5EPMB 3FT4A 4NRXA 3SKJL 4LCUA 4OM0L 1OTSD 3KNBB 4G8FB 4HGWA 4YHKH 5GSVB 5CEZL 4X4YB 5HVWA 4G8IA 4LIQH 3T3MF 1N7MH 2OI9C 4LPXA 3VFMB 2P5WE 4XT1C 1BFOB 1KCUH 3QDMA 2VZTA 1TCMA 3TVMB 4U6XA 4YBLB 1OL0A 1LO5B 5EBMB 3GHEL 3CMGA 1KEML 2DQCH 4PJXE 5HDLA 3N1QC 4R4BA 1P4BH 4GRWE 4WGVB 4XAWH 1MQ8A 4F37F 1E4WL 4JR9H 1K6QL 4P23D 1OAUL 4EJ1C 2X7LA 2HT2D 3P3YA 3LRSA 5T33H 5IWLC 2ZCHL 4JM2D 3Q6FA 3VDAA 1DBBL 5SWSD 5FUCE 4CVWA 1A1NA 1RZIA 1F8TL 2YK1L 3ZTNH 4Q9RL 2SEBB 2F53B 3H3KA 3UTTE 4XBEH 4OAWB 4JO3H 5DUML 1KXQE 4X98A 1AJ7H 5I2IA 1AFVL 5EN2A 3B8SA 5BMFL 4JVPA 5EA0L 1CD1A 1XR8A 1ZGLM 1CBVH 4UT9L 1HSBB 2E7LA 3MV8B 4JY4B 3STLB 1FL5B 4LLVB 3I2CH 1BPVA 3EZ8A 2NZIA 3T0VA 1NCWH 2DQDL 4HC1A 4RAUB 4H0HB 3U30C 1NEUA 5K59E 1YJDC 1KB5H 1EVUA 4XNUH 4BZ2L 2N7AA 5C0EA 1U8IA 2YKLL 4HUWA 2APTA 5D2NC 1OSPL 4W6XB 3GB7B 3V6FB 1X5ZA 2F54B 32C2A 5ISZE 3O9WA 4I5BB 4YPGB 2CIIA 1HNGA 2M8XA 1T1YB 1TVBB 2EDRA 3O4OC 1H0DB 4DFHA 3HZMB 4BYHA 1A14L 3MRDB 3ZSSA 4JZJA 4D9RE 1IGCL 2DD8H 3EYOB 1G7JB 4WENB 3CSYB 4DTGH 1UKSA 1U92A 4K2UL 1BECA 1CGXA 3SJVB 4P48A 5JORB 1HHHB 4MAUL 1TIUA 2B5IC 1MIEH 4LGRB 4WY7L 1CLOH 4JRXE 4PRDB 4YBQC 4AENB 3L5HA 1AR1C 4F2MA 3MLRL 4GW4A 3QEGH 4JREC 3V52H 5CBEA 4M9PA 5I8KH 2EYRB 3C5SA 5EORL 3UPAA 3KHQA 3BESR 4F7MB 4PJCE 1CD0A 1ZHKB 3U36B 1YYMH 3MLZL 4X9FA 1JWMB 3QT2A 5KANI 1OSZA 5FB8B 2XA3A 2G60L 3LV3A 1NANH 4EUPG 1CDIA 2X1QA 3SDXF 2CD0A 3I84A 4XBPA 4LAQH 5CJOH 1Z9LA 3WFCL 3V5HA 4WHTA 4XVTH 3GMPB 1C08A 4YK4C 4MJ2A 5HYJD 3I6KA 3OKYA 4K7PX 4R90L 3WO4B 4XX1G 5C0BD 4CNIA 2ENYA 3OKKB 1C7SA 5JIIA 2R2BB 3E6HB 3IYLW 5CEYB 4NCDA 4XNZC 3FQXB 3IDNA 3L3GB 1R3LA 4OZFB 3G5YA 3U46B 1I9EA 1JPST 1NMCB 2EDWA 1G9MH 1Q0XH 1FL3B 2W0PA 4OBSA 2AGJL 3BKJH 2NW2B 1KCRL 5KVDH 1XGRB 4MSWA 4GKZB 5F96H 1QRKA 3VXOA 3SDAB 4RFOL 1A2YA 4QHMB 4JPIA 1G7MA 1IE5A 2DQIL 5ESAA 1OAXL 3MYJA 2XWJA 4PJEF 4OF8A 5IB4B 1U8PB 3R1GL 5I71C 4C59B 4OI7A 2E9BA 2EIEA 4MS8C 3VXTA 4F33B 3QUXD 1JFQH 4WHDA 5B38A 5DJAA 4GXUN 4MA7H 4MQXD 2Q86B 3TH3T 3M1BB 1NJ9B 4GXVH 3QXDB 4EDWL 3OAZK 4XHJD 5E94A 4N0FA 4NOFA 2QHRL 4WI2A 1R0AH 4POYA 4TQEH 1MCWW 5INDB 4X4ME 5HGGS 4MLSA 1IMHC 1F4HA 4NO3A 2VAAB 5E2VH 2Y07H 4GAGH 1KB9K 3IF1A 2E27L 1MREL 3DXAE 1KENL 5C08B 5EOCJ 4L5FH 1KJMB 2Q8BH 4X99A 4OZIA 3BQUB 5J1TC 4P9MH 5D93C 1G9EA 4LDLB 2R2CA 4M43L 1G1YA 4YIQB 3QEHB 3RDTA 2W59A 3EDKA 5JMOC 3BI9X 3ARTA 4PJ9B 1IM3A 4OV5A 3D3VE 3KPLB 3V0AC 1UWEH 3QPXH 4RA0C 1JV5B 1IFHL 4R96A 3MR9B 3O0RL 1GPOH 4KJPC 5GGRA 3RTQC 4LLYB 5E9DB 3MV7D 1RSFA 4BKLB 1CFTA 3CC5B 4LCCB 4BZ1L 5LGJB 3ARWA 3KGRA 3QUMA 4L8SC 4Y8DC 5DS8B 2K1MA 3BE1L 4HV8A 2VLLB 1AP2A 1DLHA 3MJ8A 2ZG2A 3GBLA 1B9ZA 4KI5D 1RJYB 4PJAF 4HMDA 4WO4C 3EFDH 4LLUA 2CIKB 3RWJB 5EZLB 2AQ1A 5CD5C 2JELL 5FDWB 1ZA6A 3FB8A 1EPFA 1O7VA 4FTVD 2IC2A 3TPKA 1DVFD 4OIIL 1AGBB 2BY2A 5HGBB 1NLBL 4NQDA 5J13B 2X10A 3S98A 4HHAB 5IF0A 3HPLB 3QBTB 2C7UB 5HGDA 3U48A 1BD2B 4NJ9L 5DEFB 4P4RB 3TJEL 1LDSA 3BPNC 1C5CL 2BY1A 4ZUUA 4ZDHB 2Z35B 3E1F1 4WVRA 3B4NA 3PWPB 1AHWB 2PXYA 4ZAKA 1S5IL 2J3SA 4P3WA 2BVOA 1CIDA 2LV4A 1BOYA 3FFDA 4YDVB 5CKAA 4Q74A 2WIIA 5EWIL 2NCMA 3WUZA 5B3JF 1H3XA 1NCUA 3QA3A 4PJHE 1NGYA 2NXYC 3KYOB 2ZUUA 2ICWA 4O02L 5CZXC 4CMMA 3BGFC 5TJWK 4BJLA 1DBJH 1TENA 1G0YR 1LILA 3NTCH 1KT2B 4NN7B 4NO0B 1KPVB 3T3PF 4TTGA 4PYGA 5FK9A 1DE4A 1TZGL 3GK8H 4H8WC 1ZHBA 1TQBB 1YMMB 3BZFB 4MZ3A 3BDYL 1G7IB 1T7YA 3TO2A 3BYTA 3VXSD 1B2WL 4P46C 3X12A 4YUEH 1Z5LB 1UB5B 3EYQC 5J11C 5BW7C 4PJ5E 3GM0A 1RIVL 3UTSD 3L7FA 2DQHL 4KK8D 3VJ6A 4CJ0A 4POUB 1IGJB 5GGRY 3QDGD 4Z5RB 4FQLL 3BPOC 4XX1E 3VXRB 4WCYL 4G6KH 3WCYA 5C0CA 2BSTA 1YNLL 4PGBA 5F88A 2HWZH 1OVZA 5I17A 3DRTA 4KRMB 2XICA 4QTHB 4WUUD 5C0JB 4M6AA 4PJFE 2BVPB 3G5VA 3WJJA 5KJRL 1S7WB 1CLYH 4LLDA 1RJZA 4RMTA 1YY9C 3UYRH 5I66B 2HT4D 1G7HB 5D7IA 4BM7A 1A8JH 3SGKA 5HY9A 1KFAL 3RPIA 3FRUA 1OGAA 4JFED 4Y19D 4LKCB 1X4YA 4RRPA 3QJHB 4OF5A 3E3QC 3NCJL 4PR5B 1JPGA 3C6LC 2X42A 1HYSD 4HCRH 4LLQA 3I6GB 4PYHA 3TCLB 2ZNXA 3AS1A 4ZUSA 3BO8A 4HIXH 2JJTA 2G2RA 5HI4D 5FOJA 3LKNA 5BRZA 2IFFL 1H3WM 5HVGB 4ERSH 5I1CL 3RKPA 3TH4T 4KHTH 3JWNC 4LGSB 1Z9SA 4PJIE 2FJHA 3QHFL 3FT2A 4NKOB 1J8HE 1JIBA 1G7PA 2BFVL 1AGDB 4JN1H 2EXWC 3MRGA 1I7UB 3ES6A 1QRNE 1K3ZA 4WRLA 5JO5B 3L3HB 1FVDB 3SDDB 5FUOL 4HUUA 5DRZA 3U4BH 2HFFB 1BVKA 4ZXBD 1JUFB 5DK3A 4PRPD 3QZWB 5CJXA 1X3DA 1QUNA 1WSST 2PO6D 3ARBA 1XF2A 3LPWA 3WNPA 2ICEB 5LGHL 1EO5A 1FNHA 2BNQE 1N2RA 4G5ZL 4HKZA 4HLZH 4XMPH 3TN0A 1A6UH 5CFHA 3WBDA 4JPWL 3LN4B 3O45B 2Z8VC 3QWQB 2GSGB 5DJDB 4U6TA 4YFEA 1CGYA 2D2OA 1NAKL 1MLBA 3NA9L 1UYWH 2FECI 1CVSC 1BZ7B 3H3PL 3VH8A 1FC2D 1BWMA 3FN0H 3V8OA 3MRMB 1VFUA 3LS5L 3RWCA 4U6VH 3H42H 3UTQB 5IHZB 3QEQD 1MCOH 4K7PY 5IIEA 4DW2H 2AV7A 1HCVA 5IMMB 5AZEH 4KGJA 5DJ2B 1CXEA 5IBLD 4OUOA 4JB9L 1LDPH 2B1AL 4OBRA 4ALAH 4DZBA 3KYNA 3RIFK 4W6YB 4FHBD 4MDIA 4PRHE 3TT3L 2P44B 4LL9A 4TUJA 3TWCH 4Y5VA 4WWKB 1NMAH 2X4RA 4P59L 5BO1H 3BH8B 4DCQA 1A7RL 4IOFD 1L7TL 3LKSA 5D2LB 1B0GA 2DQTH 3O4LD 5D72H 2WINB 3TCXA 4NM4H 1X5LA 2H6PB 3EFFA 3UDWA 3CX2A 4ACPA 3RHWK 3BP7B 1K3IA 5SWQA 4K71B 4U2ZA 1Y0LB 2ESVE 4QRRB 4PJ8A 3CFBB 1F2XK 3QG6A 1FZKB 3QCUH 3PQYB 1A64A 4MJ5B 4WWID 4RQQA 3A6CL 2ED9A 5MEPA 1LP9A 2DLEA 3N1PC 4M00A 1EERB 4F15C 4AT6B 4QRPA 5D7LB 3EO0B 1I7RA 5DJXA 3MCKB 4J3XA 1HINH 1F3RB 2Y5EA 4LLMA 1F4WL 4NZTL 5CGYC 1ADQL 2NZ9C 3T1WA 1G9NC 1UWGL 4FFZH 3FB6B 4WFED 1YY8A 3TA3A 4FQXB 2QQLH 4QXTA 3VXQB 2BERA 3MXWH 2H41A 1LK3L 4OQTL 3OR6B 1T1XA 4G80A 5ENWB 5GS0C 4P2RB 3AREA 4ZS6C 4ODTH 5CEZE 4LVOB 3WHE1 3IDYC 4RGNC 2DWDB 4MA3B 1G6RA 4H1LA 4FXKA 1DUYB 1KF9B 1JN6B 3WUWB 3DO7B 2P5WA 5E8OA 1FGVH 4OM1H 3RAJL 1HZHL 5ERWB 5F71A 1VGEL 3AY4A 4JQVC 4LVNB 4PJXA 5CZVH 4FQCL 5AG8A 3IGAB 1MRCL 3W5MA 2YWZA 3G6DL 2HTKC 4N8VG 1S5HB 3Q5TA 3SKMB 1MCSA 1AY1L 5T1KA 1FPTH 2JCCF 4ELMB 1W72B 3ET9F 4JAMB 2VISB 1B0WA 3FZUC 2AJZB 3JWDL 1MCLA 4XCYB 5KZCB 4I77L 2HJFB 2YD6A 3UTTA 1BBDL 4WI5A 1JGEB 2Y7QB 3ZE0F 1MFBL 1TDQA 1W2KT 3NGBC 1KPUA 1DEEB 4TVSa 4YEEA 1IAII 5HHMD 1QLRB 5L9DH 4WEMB 3WD5H 2I5YL 2J6EL 1LK2A 1U91B 4XVJL 3H9SB 2Q8AH 2DQJL 4YBQD 1AR1D 4IMLA 5FIEA 1CN4A 7FABL 5F70A 1HQRB 4BFEA 3KLHC 1IVLA 1AC0A 4PRID 3S35H 1U8NB 1IKNA 2IPKB 1JGDB 1JHKH 2EDKA 3HNVH 2VZ1A 5IMOA 3FMGL 1NGWB 5FO9A 3P40A 2AV1B 3U9PL 1WWAX 2GTZA 2H8PB 4X80H 4A2MA 4CADB 1Q72H 5ISZA 3KPMA 1M6OA 4ZTPL 3U0TB 5HGHA 4KTDH 1D6EB 4OZIF 2V6HA 5FUZL 3C08L 4F8TA 4JG0H 5EOTB 1HQ4A 4KI1A 4BQ9A 4W4OA 3T4YA 3KPRE 3V4VL 1NC4A 2W07A 3BJLA 2AI0H 3AAZB 3FKUS 3MLVL 1A7QH 2FB4L 2GY7B 4G9FE 4GMSL 5JA8B 3P4MB 2C4FU 3VFVA 1F42A 3T77B 5T1LB 1U8OA 2R0WH 2YSSA 3PHQB 4X6EA 1A6WH 5I30L 4YFLI 5MI0C 3L3IA 5D7JC 3LDBB 3I85A 2HKFL 4D8PA 5DD6B 4JRXA 4NQSA 3QI9B 3OG4B 1R3KA 1OWWA 4HC1H 3KDMA 2DI8A 3LPFA 5HYSA 5I16A 4JFQB 2LTQB 4JZOB 4OFVA 3ZL4L 4PRBB 1D6VL 1AKJA 5GGTA 2HFEB 4MDJA 4O00A 4JFOA 5D7KD 3VCLA 4ORZC 3BUYA 5ILTH 2OR7A 4MAYA 3RIAF 4PJCA 2D7MA 3VXNB 2N1KA 1FNLA 4PJGF 2E3VA 1SBBA 3GGWA 2FH6A 4ZFZA 1JTPA 2F9BT 3L5WB 2KZWA 4UZGA 1N6UA 1XGUA 5F7WC 4MS8D 2Z91A 4HMCA 4WV1A 2VQ1B 1FO0L 5I1DB 1RZJC 4RFNB 5TGBB 3WHE0 4HDIA 1AO7D 1YEGH 2QQKL 4Y2DA 2P49B 5CILL 3PL6D 5D70H 1ZLVK 4Z78A 1KEGL 5HHQB 4OLVL 5AD0A 1KN4H 3MJ9L 3HE7B 5HYQA 3MA9L 4UDTB 3UPCA 3DI2B 2V2WB 2XZAL 5E70A 3ARGA 1EXUB 2Z31B 5D1ZA 4MA1B 1BGXL 3OKEB 3O2VL 5E8NB 3EBAA 3SE8L 3CJJA 4NUJA 1EFQA 2NY7L 1GL4B 4I18B 4IRSB 2ITCB 1LEKB 1BEYL 1X9QA 1AGEA 5AWNH 5IGXH 1FV1B 4PP1C 3RL2A 3D85A 1BVLA 3U1SL 3D2UA 2X4OA 3CXHK 1LEIB 1OAKL 1GGIH 2DJSA 5I73C 4EI5C 2J8UE 2XPGA 3OXSB 2ZWLT 2VZOA 4XP4L 3QFJD 4PGDB 3T0EB 2Q7NA 4ZQKB 1QFWI 5JQ6L 3L5JA 3N85H 1ND0B 4KJPD 1TCRB 4OFIA 3ROOA 3GZKA 4I9WD 4K94C 4N5EC 43CAB 4PRAA 2YR3A 3X3GL 3DGCR 2VQTA 2C3WA 3RRQA 2OMNA 4JKPL 2XN9B 3WJLA 1GSMA 4HIIB 4KUCF 3ZLQC 5LCVH 2ARWA 1KJVB 1R3HB 1CDJA 1UZ6F 4UAOB 4WO4D 3CGTA 3IDJB 5I6XB 4YZFE 4X4MA 4H88H 3SO5A 1E6OL 5CD5D 3UMTA 5E99L 1LD9B 1S9YA 2C3HA 4HKBB 3QDMD 3DXAA 5DSCA 3KJ4B 3GSOA 3DYPA 3GNMH 4LDEB 1P4IH 3NFPA 4YDIH 1MI5D 4XB7A 4AH2B 1KCKA 4DGIL 4WUKH 2O61A 4KTEH 4NM8H 1T20A 4DN3L 2AK4E 2DOCA 1TJGL 2BP3A 3L3JA 5D6CA 1BZ9A 3PG2A 3NH7H 3IJSA 3L1OL 4ZUWA 5IMKB 1YQVH 3PWUA 3NCYP 4MQ7B 5ITFA 4P9HL 3A0OA 4M7JL 3QNXA 1IL1B 3D3VA 4YBHA 4ONHB 1BAFH 4O5LH 1YEKL 2FRGP 4X7DC 1SBSL 5JOFA 1VERA 3TA3C 4U0RC 4L4VE 2VLKD 5CZXD 2CDGB 4P49A 2VN4A 1ZT4B 2EIDA 5CWSB 4ZTOL 1KV3A 4JFDB 2QSQA 4NBYB 1YA5A 1JBJA 1YNKH 2VC2L 4NHUA 4V2BA 1QP1A 1MAML 1ZANH 1KJ2H 2NXZD 1B4RA 4OF3A 4G9DA 1JZ6A 1GAFL 4FQIL 4X7SH 2RCSL 1UGNA 1BREA 4KMLB 4P46D 5CZKA 5KVFH 4QXUH 1P4LB 1MRDL 1S9WB 3DV4B 3EYQD 5KSAC 4XI5C 4IRZL 5BS0B 4KC3B 3CAFA 5K9QI 3O9WD 4ZNEE 5J56B 3U0PB 3WFHA 2JJSC 1P84J 3DI3B 3ALPA 1UM4L 3LEYH 2A77L 3QDJE 5GHWH 1HSAA 3QHZH 3VD7A 5MEQB 3UTOA 3C5ZA 5JNYA 2BMKA 5D1QA 4EBQL 1G9NH 5EH1A 4U49A 1OM3H 5CJ5A 1M05B 5CGTA 5H2BB 4YHML 4PBWD 12E8L 4NHCH 4G8GE 2XWBA 5J1AA 1EZVY 3FQRA 2AEQL 4XPTL 2IAMB 3DROB 4WHYH 1YY9D 2JTDA 3L3DB 3I02B 1HHGA 5T1MB 1WJ3A 4PJHA 4QRQA 3FOMA 2APVA 3KS0J 1J1PH 2NY4D 1MFCH 4NN5C 4CU7A 1JP5A 5CIPB 5K9KA 4BH8A 1DQLL 3O6LH 5FYKL 4KKCC 3F58L 3JWOC 3VFSB 4AQ1B 3LN5B 1UADC 25C8L 4PJ7E 3MO1B 1MCEA 1KTLA 3MRCB 2Q20A 3FO1A 4NQED 2Y9RT 5F3BA 4KJWD 1E6JH 3SQOL 4XPFL 4J4PA 2B2XH 1S7SA 5CCKH 2B1HL 4EUPA 4YQXH 1CDHA 1T04A 3PDGA 2P8MA 2PCPA 1S7QB 1WGOA 4PJ5A 1KLGA 3SE9H 4MD5A 2YOCA 3INUH 4WU5B 3DUHA 1N4XL 5DTFB 2O5ZL 3GSVA 1NC2B 3WDHA 5TE6L 4K8RC 4KROD 4W4OC 5GQBA 1DANT 3O8XB 4QRTA 3K1KC 4LOUC 4FMKA 5DFTA 4PJFA 3RX7A 5SX5H 4ZUVA 4YDLB 4BSWB 2D31B 2EO9A 1TQCC 4M61A 4Z7WE 5HI3C 4LF3A 5FOBA 5EBWA 2VXUH 4GW5B 5EBLB 1OAQL 3WHXA 1DR9A 1I4FA 3QUKB 5D9SB 3SE3A 3Q3GB 1I1RA 3HE6B 2DS4A 3DGGB 3IU3A 1ORQB 5E2UL 3H7BA 1Z9OA 4XCEA 1FNAA 2IH1A 3HAEH 5IBUB 5CUSH 3CNKA 4NNYB 5EO1B 5AYUH 4YHYB 5DJ6B 5EZJA 4NZRL 1VEPA 4N1HB 5DC9B 5E4IA 4JRYD 4N1CA 3SBWC 3GJFB 4PY7B 4U1NA 5HVFB 4HK3J 3BZ4B 1G7LB 4M7KH 4OD3L 4Q6YA 2Q76B 3K46A 4I1NB 2BNRB 1CQYA 3LKOA 1NCBH 4WI4A 4HF5H 1L0YA 4PJXF 4YH6A 4PJIA 4MVBD 1J8HA 1U58A 4XP5H 2DI9A 1DLFL 1ED3A 4UDUB 1A6ZB 4I3RH 5KVEL 4G7YH 5ICYA 3HLAB 1QRNA 3UZEA 4U1IB 2GQHA 4K7PH 4YPJA 3MCLL 4NCC2 5IV2B 5SWZB 3GSXB 5GXBB 1INDL 3SDCB 3N1FC 3F5WA 3BAEL 2X1PA 3QB7C 4NO5A 2ZSWA 1TJHH 3ULUL 3UJJH 4BSVA 1FFQA 2A0LC 2BNQA 2IH3B 1A4KB 1MSPA 3BP5B 4M4PA 1CICA 1MWAB 1CL7L 1P1ZB 4X6DF 5BV7C 5IVXB 4HS3B 1EUTA 4KXZH 4LCUB 1W72L 4RMQA 3K0WA 1RUML 5C2BH 5I8OH 4LSUL 3KPPB 4PB0H 5E6IC 4HIEB 5I1HH 4W81A 1Z9MA 2AKRA 2VZUA 4P57A 1KTRL 1VHPA 1AGCB 2F53E 3ULVC 4L1DA 5J3HC 4NC2B 4ZYKA 5IM7A 1F58L 2XQYK 5I15H 5F72S 1ZHLA 3NIFF 3MV8E 3VI3F 1S9VA 3ZDYF 4KDVA 4NQCB 3SOBH 5GSRA 1DBAL 1R5WA 1UCBH 5DWUH 1GOFA 1WZ1H 4H20H 5DZLA 5HSFA 1OTTC 1RZJH 4LMQI 3LMJH 5C9JB 3OAYK 1XH3B 4DJMA 1JPFA 2FATH 5HDBE 4PRHA 4C54A 3U4EB 4F9LA 3VWJB 3D69A 1CWVA 2ZOKA 4K3EH 2XRAL 2VNCA 3NFNA 1INQB 3MJ6A 3QRGL 3NBNA 5JPNA 1IGIL 3KJ6L 2F54E 3EO1A 3GMRA 4LBEA 1AQDA 3HI6L 1VESA 4O51A 5TDNB 1DBMH 3BJ91 2VLRB 2YPLB 4PTUB 5I2IB 1Q0YL 5GJSL 4TPRL 5F7FA 1CFSB 2ZP0T 5IK3A 3SDYH 1E4KA 2ESVA 4DKEH 4P2OC 4KRNA 1JGLL 3EOAB 3VW3L 1HI6B 4NQDD 1MF2L 2P47B 1WFUA 5ADPL 5IEHA 4RNRB 2H1PL 2HTKD 3WIIL 4ZODA 1RK1A 3MV11 2ERJB 4LLWA 2JJWA 5C0EB 1A0QH 5EU5A 5E00B 2EIZA 3ILQC 3FZUD 2R29H 2F8OA 5MP6H 3SCMB 3D0LA 2GCYA 5K9JL 4ZAKD 3BD5A 3IDGA 4JFXA 3U7AA 3RY5A 4HIJB 2WP3O 6FABH 2W9EH 1RZKL 2DDQH 4X5XB 5DHVA 5FA3B 1CF8H 5ACZA 1MQKH 3L95A 1LO0L 1NCDH 1P7QD 1SVCP 1UQSA 4Y4HC 1OAYH 1QKZL 3BSZL 4ETQA 1BQLL 3Q1SL 3ZE2E 3W9EA 3K74B 4JKKA 3B6SA 3GMQB 1CDBA 2XY1A 1NCNA 1RMFH 4M6OL 1J0KA 3OJDA 5JW5B 4RDQF 1SEBA 4ONFH 3KAAA 4XC3H 3U4AA 2ARJQ 2BZDA 2HN7B 1QOKA 4O58L 3THMH 3I6LD 1AQKH 2DYPA 3UPRA 5JXEA 3O3DA 4Y4FC 2ILLA 3TH2T 4MNQD 2J5LC 2WWMD 4OCYL 3L3OA 3QQ9D 4H26B 4Y5XB 3EDDA 1PQZB 2F5AL 1D5ZA 2V2XB 3C5ZC 3BYYA 4GRLC 1MJUH 4M7LH 4MD0B 4KUCD 1OSZB 2A6JA 5DC0A 4OGYL 3WNOA 1CYGA 2CJUL 3BEVB 5D7JD 1BQHG 1P9MA 2WWKO 4UOW1 1X4ZA 4LU5L 4YFLF 1F11A 1OGAD 5DK0A 2X4UA 2VXQL 4LFHD 3C60A 3RKDC 1TZHA 1G6RH 1N8ZB 3LH2H 4CNIB 5LAXA 2B0SH 3FFCB 4XZUA 3MYZA 1EBPA 4U1GB 3IDNB 4MB5A 3QNZA 5E8DL 3KYKH 2A74B 4QYOB 3EYFA 4YGVA 4PREB 4X6FB 1ZT1B 3CFDA 2VDPL 5T1DL 4BH7B 3RIAK 1T0MB 1JNNL 5ETUA 1QO3B 5BRZD 1M4KA 3FT3A 4OUUA 4WI8A 1U8LA 4MSWB 4PG2A 2GAZA 3KPQA 3VXOB 1Q9OB 2AJ3A 1A2YB 1LEGA 5C0DA 4IRJA 2DM3A 1RZFH 3KPRA 3QG7H 4JPIB 4PJBB 4OGXH 2ZUXA 1F3JB 5ESVB 4RX4D 3F62A 3O3UN 3V95A 2XWJB 4Y5YC 3QZWG 2GIYA 2X4QA 5C08E 3IDXH 3PABA 4G9FA 2PTTA 5LKNA 3S37L 4KDTA 5C6TL 1X44A 1FDLH 1I75A 4OZGE 3GIVA 3ARBD 3CCHA 1FL6B 1NFIA 5EIIA 5GRVK 1ZSDA 1EIBA 3JWOH 3SE3C 5SX5K 5IB2B 3QHTC 7CGTA 2FIRT 3RGVB 1CD9B 1CU4H 4QCIA 5BZWA 1SY6L 1A7OH 5JOPE 2G9HB 3HR5A 1I3UA 2X4SA 3EO9H 1OAZH 4PP1D 4LCWE 4F3FB 1OY3B 5E9DE 1BIIA 2LVEA 5FM4A 5I9QC 4CGTA 4EI5D 4MJIB 1HKLH 4S0TD 1U6AL 3WN5C 1U8HB 4RGMC 1ZLWK 1MIMH 1ZLSH 1AD9B 4GQ9H 3PF2A 1U41A 1OF2A 5AEAA 2FBOJ 2L0DA 1UACL 4JPVL 4DAGH 1DBKL 3NIDF 4N5ED 5ICXB 3VXUE 4GT7A 1GC1C 2CDFB 1CS6A 2MHAB 2IG2L 2P7TA 3RDTB 3HZYB 5CBAA 1D5MA 4M4RA 1A4JB 5JW4N 2CKBB 4OV5B 2KKQA 5EUOF 4FFWD 4S0SD 5C09D 3RGHA 3WFBL 3MLYH 1BD2E 5DD0H 3X3FL 1ROWA 5EU4B 1TETH 4PJHF 3MV9D 1J10A 2HMIC 1XR9A 4U1LA 1RJLB 1F90H 1JNLL 2PR4H 5GGTH 5L7XL 5DJ0A 4LLUB 1V7ML 5L2KB 5FM8A 1EAPB 3P30L 1RVFH 3VD4A 5IHBA 1QFUL 1ETZB 5DXWA 3MUHL 3C09B 2CMRH 2FX9H 1GHFH 3FB8B 2PYEB 5TDOB 5BQ7A 1WFNA 5DJ8A 4ORGA 1YEIL 2J8UA 1HHKB 1UXSB 4UOW0 5FHAL 5A1AA 1PG7L 3DX8B 3MOAL 4YHIB 1J0YA 1JPTL 1XGTB 5SV4A 3C8KB 4BUHA 2A2QT 4NKMA 1U8QB 1IAIH 1YMME 2IBGA 2XFXA 3QO1A 3DIFA 3TA3D 4C56D 2VDMH 5KVGL 1OQXA 1B6UA 2NY6B 4OLWH 5I18L 2PXYB 3QQ3B 1EMTH 3EYSH 2DTSA 1C1EH 3PHSA 3LKPA 3ARED 1B3JA 4MCZA 5JW4R 5BV7H 3X17A 4ZPVB 4MXVE 1J86A 5F44A 3GIZH 2M2DA 5HHXH 3VXRE 1RULH 4N8VA 2YRLA 2P5WD 4Z7QE 4HJ0D 2OR9L 1IKFH 1DDHA 5ITBL 5KSAD 1IGTA 2NW3B 2EC9T 5DVKA 4XI5D 3DX6A 3ZMRA 1YEEH 3KLAA 3QFDA 1MRFL 3MNVB 5KTEH 5KSUA 5F9AC 2A6DA 3AXLB 5IBTL 5IB1A 4BELD 4X9GA 4FN0A 1YEDB 5HHVL 3BPLB 2AK4A 3B9KC 1NFDF 4PG9A 1QLEL 5T1KD 1B90A 1R5VB 3OG6B 2VSCA 2XV6B 4TOYH 4XC1L 2WBJA 1JTTA 4ODSL 2QQNL 2RR3A 4LSQH 3OB0H 3TT1H 2D7PA 2JB6A 4G6MH 2IEPA 2NR6C 4G8EB 3AB0B 4ZD3H 5C0CB 5DZNA 4L4VA 3RWIB 1MJ8L 1F13A 2ADFH 4YFDB 3DRTB 3QXVA 1FLRL 1P69B 4G42B 4YHPA 1TNNA 1NBVL 3VG9B 4WNQA 1MOEA 3JUYA 1INEH 5JPMB 5HY9B 3FQUA 3IFPA 3FONB 3QIUA 3RPIB 3FRUB 5DF0A 4EKXA 4R3SB 1K4CA 1LE9B 5FCUH 4FA8A 1T5WA 3BWUC 4M1GL 2AJUL 3U7YH 2L7UA 2DM2A 2HVJA 4RA3A 4U1SB 4AG4H 4PGZA 4ZNEA 5J6HB 2ZKHH 3FQWB 2HT3D 2W9DL 5IQ9A 4U3HA 1I1AC 4C4KT 5M7QA 1WLHA 1BZQK 3QDJA 1MWAL 2DRUA 3HG1D 1NC4D 4LOUD 4D9RD 3F7RA 3P73A 4PTTA 5IB5A 4Z95L 3TNNB 4KDWA 3QWRA 4G8GA 1JK8B 2W65A 3VRIB 2V9TA 4ZMAT 5DMIH 3IS1X 3EJJX 4KVCH 3MMEA 4R7DA 4HXAH 4NZUL 4LASL 3ES6B 3KWWA 3LCYA 3QUXB 4ZO7A 1H3PL 1MHCB 3B83A 4UV7H 4K9EH 1FFOB 2PUQT 4YJZL 2EKSA 4HUUB 4UQ2A 4YHLH 5DRZB 4FABL 3QIWA 4JRXD 5CJ8A 4EOWL 1H8NA 3BP6A 5I1LA 4F7CA 4PJ7A 1RJCA 4K3HA 3BN9D 3TN0B 4KFZC 3MGTA 3PJSB 1YNTB 3N9GL 3TZVB 5IKCB 1QPXA 3R06B 3DETC 3GI8H 4MAYD 5ACMA 2GUOA 1DFBL 1QNZL 4R4FH 3OKDA 4KZDH 4XNQA 3VH8B 3AC0A 1EJOH 1NEZB 1QFWH 5D2LE 2APWA 2M1KA 5HDQH 5IJVA 4N8CH 3EYVA 4Z0BL 2R1YB 4EQ3A 5IIEB 1MVUB 4QRRE 1F3DH 3D0VA 3IS0X 4ODVL 3MGOA 3IFLL 5LBSL 4KQ4H 2AK1L 5E95B 1FYTB 3PQYE 1BX2A 3DMMA 3DWTA 4Z7WA 3TBWA 4DZBB 4WEBL<