5M95B

Staphylococcus capitis divalent metal ion transporter (dmt) in complex with manganese
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASRSIFSIDTANWYRQPPGMQRELVATITRDGNANYADSVKGRFTISRDRARNTVYLQMNSLKPEDTGVYYCNAAIRTTVRTSAQEYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent metal cation transporter MntH
publication title Crystal Structure Of A Slc11 (Nramp) Transporter Reveals The Basis For Transition-Metal Ion Transport.
pubmed doi rcsb
source organism Staphylococcus capitis
molecule tags Transport protein
total genus 29
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5m95B00
4Q0XH 5GS2H 4KJPD 1FO0L 3RTQD 2MCG1 4XVUC 4DN4L 4HT1L 3H3PH 3LN9A 3X12B 3OZ9H 2HFEA 4TSCL 4DZ8B 3QNZA 4JY4B 4H5SB 1NMAL 4RISL 1XGUB 1OQXA 1JGVH 1YMMD 3DO3A 5SWSE 43C9B 4HUXB 4IRSB 3PWJB 4HKBA 4O2CA 2E5EA 4RGMB 2VLJD 4X4XB 4XXCA 3SDYH 2F8XC 3HPLA 5D1ZD 1OGAA 3RY5A 4L1DA 4C56A 1CCZA 3SDDB 1WZKA 2ZPKH 1D3CA 2JELH 4XNYL 1ZT4B 4L8DB 1P9MC 3L3IA 3C9NB 3T77B 5HPMA 3L3GB 5EBWB 4Y4FD 1MRDH 1JK8A 2OL3H 1EXUA 4GS7B 4PRDB 1YN7A 4LPUA 3S3JA 1M05B 3HNTL 3MMEB 4WNQB 3GRWA 4HUUA 3WJJC 1ZVSB 2Z35B 2GT9A 2FL5B 1PDKA 5DYOB 2P5EA 3O3EB 3QWRD 4ZUUB 3FMGH 3WUWB 4ODXA 5EA0L 3OKOA 3DUUB 1U3HA 1UJ3B 2R4RH 2P5WE 4JFQB 3KNBB 4YHMH 5FDWB 3BZ4A 3S37H 3NH7L 1CQKA 5GRYA 5E4IA 1JL8A 2PTTA 4BH8A 4RGOL 4QHNA 4GLRH 4HMEA 3VGEA 3WFBH 1CTNA 2NQCA 2WBJB 5F7FA 4U49A 4IOIA 4MQTB 2H2PD 4Y5YC 1AO7E 3MXVH 3VXNA 4XGZB 5LGKA 2EDFA 4KKAC 1S7XB 2UUDK 5E1HB 5JOPE 4OFYA 5FM8A 3TA3A 1CXHA 1U95B 2HG5B 2V2XA 4H8WH 3I3DA 3EDDA 4J7RA 4M48L 4PRHD 5FF6B 4J12A 3SDCD 1QRNB 5IB3A 4JN1L 4KKLD 3PDOB 1QO3A 3LCYA 3R1GH 1LILA 4HH9A 2MJWA 4A6YA 3CPLA 4HAFA 4TYUA 2BSRA 4PGDB 4Z18A 4JQVC 4PJHF 4MJ6B 3GRWL 4KK8C 1RJLB 4NCDA 4PJEE 1FLRH 2NR6D 2M1KA 1CL7L 3WFHA 4N1HB 4HKXB 2XG4A 2KZWA 1L7TL 5GSRA 3V4UL 2YWYA 5JOEA 2A1WL 3U30C 5FO9B 3JVGA 4F15C 2CUMA 1XF2A 3HZKA 4N8VA 1CR9L 4G8EA 3VD4A 4S1QL 5CJ8A 4ZO8A 3SKNA 1MI5D 1P1ZA 2J8UA 3F12A 5HHPB 2IADA 4PJGA 1FNHA 3QDGD 1KLUA 4Q9QL 3OMZA 5BQ7B 1QSEB 4PR5B 4KXZI 2WAHA 4UILH 4YPJA 1WISA 1AE6H 3EFDL 4M8QA 5JORB 1SYSA 4XVTL 4B5EA 4P23C 1BQLH 4KZEL 1BIIA 2ZUQB 4IMLB 1IARB 4NFDA 4FQJH 1R5WB 5IIEA 3VA6A 3VXMA 3O3DA 4X6CE 1ZT7B 5F7DB 3TVMB 4U1MB 3DHJA 1C08B 3B5HA 1KEMH 1QSFE 4GRMA 4X9IA 3WSQL 1PEZA 2CDGB 4FQXC 4Z95L 1J10A 2Y6SC 1QBBA 2R0WH 3O41A 2DIBA 4MAYA 4QRQB 4A6YL 3UTZB 4RAUB 4HCRH 5DQDH 3CLFH 4M93B 1CVRA 3GUTA 3W82A 5K59F 4WUKH 5J3HD 1FL6B 1S3KL 1ULVA 1JZ4A 1RZFL 5DJCA 3DRTB 4JFDB 1WUNT 5EOTB 4LDLB 2APTA 4GAGH 5TQ2L 3TZVC 3RPIA 4KQ3L 3QSKB 2IH1B 4ZS7H 4Z7VE 4GW1A 5SX5H 3ROLB 1LQSR 2NLJB 1SHMA 3QDAA 3BP7A 3SN6N 1G9MH 2R8SH 3JV4B 4WHTB 1I9RH 1HSAA 4HGMA 4D3CH 1KTDA 2X4QA 5IROA 4G9FE 1MJ7L 2VXQL 2W38A 1X5GA 5HYSA 2FEEI 2D0GA 4MA1C 1LE5A 1OGAD 2EYRA 4U6XA 4MGXA 4I0PC 4YBLB 1GHFL 2SEBB 1P84K 2N7AA 3TH4T 3UBXG 4APQC 2GTZB 5DD6B 4LNVA 1HH9A 4CL7A 3HE7A 2VB5A 1H8NA 2AABH 3QIBA 4DGIL 3ZDZE 1JNNL 4OBRA 4ZAKA 4P46C 5DJDA 4O4YH 4R4FH 1B90A 1ZSDA 1UM4L 4X80H 1GC1H 3KYOB 1WC7A 4PRPB 5HGDB 5HHQB 1RUAL 2GCYB 4PJIE 3MRDB 3QCTL 3VFOB 4HG4K 2ZOLA 4G8FB 4QOKA 1H15B 1KC5H 2DQFB 5CBAB 2X40A 2LVCA 1RUQL 4YHPA 4UV4H 4PRBA 5KN5B 4JRYD 4F7PB 1TJGH 4CN6A 3BUYB 2B5IC 1H8SA 2COQA 3ZSTA 2Q8AH 4V1DE 4G8IB 4LLVA 4HQQH 4ZUTA 4JDTL 1JHLL 4L4TA 3BXNB 1IAKB 2C3VB 5ERWA 3TBWA 3GIZH 4P2RB 3TYGH 5CSGA 5FA3A 3V7AG 4XB7A 4TTGA 2CUIA 5GGQL 1EDQA 2F74A 3STLA 3ZE0E 3H7BA 4ZFOB 3L7EB 5I1HH 5FB8A 3D2UA 3H9SA 5FHAL 4PFEA 3ZHKA 2HKHL 2F58L 3GO1L 3QJHA 5F3HB 4ELKA 1XGRB 3BKCH 4U3XA 3TA3D 1CT8B 3QNYA 4X6DB 1CF8L 3QDMD 3EYFA 4NUJB 2PXYD 5TDOA 3VWKD 5DT1L 4WGWB 5E70A 1QHPA 3HC0B 4J3UA 4JHAH 4NSKB 2P24A 1ZHNB 4GSDL 5DD0H 3STBA 4X5WB 1YJDH 5C0ND 2VR5A 5KSUB 1DVFC 2GIYA 5EU7E 3TNMB 2AJZA 1NCBL 1E4JA 5DWUL 1P7QA 3GB7A 3VFVB 4NO2B 2YR3A 2EE6A 5B8CB 1QNZL 2YUXA 4JPIB 2AVGA 1J7VR 3IJHA 2D31A 4OZGB 5TFSL 4QY8A 4PGEB 2BMKB 2QSCL 1U3JA 2VR9A 4G8GB 2EEBA 4GT7A 2AKRB 1DDHA 4TVPH 4PJFE 3HMXL 5EO1B 2UY7A 4RWYL 1BIHA 4NO0B 1A6UL 1ZWIA 5JTWA 3QDJA 4ONHB 3KHQA 1I8IA 4HS3B 3TH2T 3C5ZD 2GAZA 1X5AA 3PGCB 2AJVH 2WK2A 4NHCH 4LARL 1XGQB 1A7OL 5TE4H 4X8XA 4NQDA 2AEIT 4LVNB 4NZDA 4JRXA 4KJWD 1VKXB 3P11L 5KSBB 1MVUB 5IF0A 4PJ5E 3JV5A 2EKSB 5IOPB 3WUWG 4NKOB 5ID0B 3EJYD 4ZUVA 4BQ6A 5EU7C 3KPOB 1GZQB 2QSTA 4HS6B 3PHOA 12E8L 1XF3B 3O9WC 1A6TA 4AMKH 3RDTC 3NIGF 5BOPA 1NKOA 3G08B 3MLVH 3SE8L 2ZJSH 4KKNA 4UIKL 4E5XA 3UPRA 4G9DB 3CLEL 4MAYD 3VW3H 1UM5L 2ITDB 4KI5E 2AXFA 4D0CB 4I48B 1CFQA 2AEPL 2Z91B 3MBED 5GJTL 3CH8A 4NP4H 5BRZE 2ORBL 5F1NB 4KVNH 1G0YR 4XPGH 5JPNB 4TSAL 2O26U 2EDJA 3C5JA 1ZE3C 1NC4A 1D6EB 1A6WH 3VFUB 1KJ2A 2WWMC 3VE0B 1NAKH 5BS0B 1LDPL 4NN6B 2O5ZL 1QR1B 5LAXA 1X6LA 4DGVH 5C09E 4CDHA 3CK0H 4Z7NF 5HD8D 3S35X 1NGQH 3ARYA 4PRAB 3VFPB 3WLWD 1WK0A 3MV8A 2BSSB 1HKLH 4OZ4B 1J0HA 4YUEL 2GSGA 4JZJB 4M6OL 2V17H 3VG0H 3HS0A 5I76B 1W2KT 3DETD 3GJFA 5B38A 4RDQF 1A47A 1B0GB 4CMHC 3IFLL 4UMGA 1DQLL 3SCMA 2HH0H 3GKWH 1FGVH 5EU4B 3HE7D 2NY7L 5FOJA 3QULA 3AVEA 1OAXH 1NDMA 3TIDB 5IWLA 1RZGB 4KC3B 2YSSA 1DUZA 1T5XA 5DXWA 1HH6A 4O2FB 2LU3A 5JIHA 2NXYC 2G2RB 3P9MA 4PP1C 4JQXC 3EZJB 4KI5C 4HFUL 1MHEA 1NAMB 4HPOH 1CLYH 3V6ZB 5L7XL 3OGOE 1NBZA 4XP4H 2IPKB 2FEDD 2P49B 4HWBA 3MGAA 3QEHA 4LVHB 3O4OC 2NY3D 3QXAB 1KB5B 2RIKA 4MDJB 5IV2B 2B2XH 1P4BH 4QOKD 1J87A 4YK4B 4M9OA 3NFNA 1ZXQA 5CJOH 3RVTD 4LRNH 2R2HA 3QIUD 1AQKH 4JPWH 4WJ5B 4XNXH 3MUHL 3RGHA 1R24B 3K4ZA 5DHYB 5DRXA 3HB3C 1G7MA 3SQOL 5F70A 1I7RA 1TNMA 3FCTA 2X89A 1YN6A 4DN3L 3DJ9A 4PJCB 3S36H 1KJ2L 1TPXC 4CVZA 3F7QA 4R0LC 4KVCL 4MMZC 4PY7B 3I02B 3UJTL 1KN4L 1A9BA 3ZTNL 2PR4H 4K07A 1HILA 4R2GB 3D2UD 1A1NB 1NFDA 3H9SD 3Q3GA 5HHMD 2VDRL 5IMMA 1YMME 5F9WB 3ULSA 1EO8L 4K23H 4AG4H 4MXWL 1HHKA 2EDOA 4JAMA 2VLJE 2B4CC 1UYWH 4MDIB 4MSWA 4MXVE 1CIDA 1FZKB 1AY1H 4U1JA 2R0KH 3F7PC 4FQ2H 5J13C 4NUGH 4X6EB 3HUJF 5DO2C 1N4XL 2FZ3B 2FJHB 5DJYA 4YWGL 5DHXB 3OR7B 4XZUA 2J1KA 4MJ4A 5GRXG 1XGPA 4HWBL 4YE4L 4KJYB 4ZDHB 5DRNB 2DJ4A 2HT4C 3WHXA 2EDTA 3P30H 3FB8B 3MGOA 1AGCB 2EZ0C 4PJXE 3PGFH 3H3BC 3HPJB 4KJPC 4LSVH 4NZUL 4RMWA 5DD3H 3RTQC 1AI1L 4MWFA 3WN5C 4Y4HB 1JGDB 2QHRH 3RVXD 1VFUA 4L5FL 1A4JB 1T0MB 1C5BL 1JPST 1YPZE 1S7VB 2R29L 3S34H 1LD9B 2OS7A 3QDJD 3THML 3RVVD 5J12C 3TBSB 1SJXA 5DZNA 5D1ZC 1FYTB 2E27L 4JM2A 4MHHG 1NUNB 1H5BA 5HHVH 3QO0B 3U4EA 2PNDA 1RUPH 2Y07H 4XPFL 1L0XA 1I3UA 2XZAL 5L88H 4Y4FC 3G5VB 3V5HB 1I9IH 2VERN 4N90D 1RZ8A 4RSVA 1IFHH 1MIML 4D2NA 1LO3H 1ITBB 4OLUL 3HNVL 5IB1B 5BV7H 4YR6B 2G5RA 4PRHE 5D7KD 3UDWC 4AT6B 2X4TB 5DQJA 2Q87A 2K1MA 2YXMA 3AS2A 4LLMA 4XNUH 4U1IB 1JF5A 4LKXA 3FFDB 3JWDL 5D4QA 1MCIA 1RIHL 2HJFA 2UZYB 3MUJA 1MCPL 2YD8A 5KG9B 4AK1A 3OKDA 2DQDL 2IFFL 2ZP0T 2H26A 1DN0A 1MCBA 4YDKL 1RJYA 3MLZL 4OM1L 5AG9A 4NN7B 1NC4D 2GSIB 3KGRA 3V2AR 2HLFD 3GIVB 5E8EA 4L4VD 4D0BA 5D2NA 5IVXB 1OB1B 4MXQD 3C08H 1KSRA 4K71B 2CLZB 2BOBA 2F53A 1MJJB 3FB5A 4AEEA 3DX6A 2ZUUA 3O45B 2BRRL 3LQMA 4X4ZA 4UT6L 2X6MA 3JTSA 1OGTB 4P5MA 3PHQA 2J2ZA 2FLBT 2F19H 4K3JL 1ZGLA 5GJSH 5TDNA 1MUJB 2H2PC 3G5XB 4KUZL 3LS4H 1MI5E 1TIUA 5D7JB 4IHOB 1CFTB 1FL3B 3QDGE 4KMLB 4O51B 1NCTA 1NDGB 2VE6B 5ADOL 4NBXB 4PS4L 1LEKB 3SDCC 1QLFB 3U6RA 1A21A 1WTLA 3RFZC 5GRWA 4F57H 4JFXA 4KKLC 2H6PB 3MO1B 5DUPH 35C8L 3UC0H 2FB4L 4KROB 1HHJA 4PB0H 4LASL 5IKCB 1R0AH 2H9GB 5DS8B 2XWBA 3SDXE 1F2XK 3DMMB 3RWIB 5MEQA 1WIOA 4OLYH 4Z7QF 1Q0XH 3V0VA 3WKMH 1MWAA 5MI0B 4B0MM 3HRZB 4HHAA 3EYQD 2DQTH 3S37X 2RQ8A 2WQ8A 3O11A 2NR6C 4NQVB 5IBLD 1IGCL 4LQFL 1SYVB 3IDXH 4JFPB 4JO3H 4OZHB 3V6FA 1IGYA 1AD0B 2WBWB 1KIUA 4OZHF 3VG9C 2CR3A 1WFNA 1JPTH 2Q76A 3BKYL 3T65B 3FQNA 1G7LA 5J57B 3B8SA 1TVHB 4JPKL 3KWWB 5T3XL 5E24E 3D39A 4XVSH 3MFFA 3UPCA 3NABH 5FXCH 2R0LH 4DEPC 2Z93A 4UINL 4FQHA 1S8DB 2KDGA 4K7PH 3FQXB 4MNQB 3T04D 4CN4A 1BZQK 4W70A 5EWIH 1OD9A 1B2WL 1ZS8A 4E0RB 5C2BH 4K2UH 5D96B 1NCAH 2NCMA 4HUNB 1OGAE 4C56E 5KS9E 1CGSH 4LLQB 2DTML 5EOQH 3FHQA 1OP5K 4Z76B 4IMKA 1YNKL 1OL0A 1IKNC 3AXLA 1W72B 1LO0L 4JHBA 5INCA 5T5FL 4AL8H 1RZ7H 1FVCA 2A6JB 4NJ9L 3CMGA 3SKJL 4GG6F 4F9PA 1NGWA 3BW9A 1FZMB 1LWRA 3GBNH 5DC0A 2KL6A 3DX8A 5J3HC 5E6YA 4OSUH 3MUZ1 1WF5A 3RQ3A 4MVBD 3FHAA 5FYKL 4TPRL 2HJLB 3T2NL 5I8OL 5LWYH 1F4XL 4JRYE 5E9DB 5D8JL 5KVDH 2ERJB 4UIMA 4ODHL 3BMVA 1CICA 5I1KL 1BJ1H 2YEZA 1ZA3A 2EIBA 4LCIH 3T08A 1NGXB 4OF5A 2XNAA 2WANA 3IDYB 3MBXL 3GMNB 3IDGB 2I9LB 2GFBA 2WQRA 1JPSL 4OZFB 1LK2A 2FDBP 4HDIB 2FNBA 1TQBC 1AXSB 3RY6C 1EBPA 4AM0A 3ZYZA 1WEJL 3UTSB 1OP3K 3QBTB 5I71C 4XC1L 1K6QL 2R2BB 1W0VB 3TO2A 1ZLUK 2IMNA 2VXUH 3P0GB 3F58L 5CILL 5E2WL 2HRPH 3PABA 3QDME 4S1DD 3DGCR 4MMXC 3KPPA 3X17A 2XIDA 1FN4B 3QJFB 1JRHH 4XI5D 4EN3A 5FGCB 1AKJA 4W81A 1VGEL 3PIQA 4N0FB 4ACPA 4FQLH 6FABH 4ISVA 1T4KB 4UNTA 4YIQB 5EUOF 2Z31B 1F4WL 5D7SH 1BEYL 1JNHA 4JO2L 3CX5K 4I5BA 3EBAA 3KXFD 2VL5B 4PRNB 1K8IB 4J8RA 3CFCL 5E1AB 1AQDA 2PYEA 1JHTA 3KS0H 3LPFA 1F11A 4FXGA 1XGYL 1PBYA 1Z3GH 1FZJB 2ARJA 3AROA 4HV8A 5IQ7L 1QRND 1ADQL 1EGJA 2IBZX 1SMAA 4KDTA 3FTGA 4Z7UF 3T4YB 1U8NA 3LB6D 3G6DH 5DI8B 2J8UE 4LPYA 4HKZA 1MCKA 1U8QB 1KELH 4U1SB 1TITA 4PJGE 3TA3C 4MX7B 2FJGA 4WUUD 2PXYC 3VWKC 1G6RB 3DO7B 1L0QA 4YDIH 1EHAA 1C5DA 4Y19A 4NJAL 4R96B 3AFLA 2VR4A 1YMHA 3K7UA 2ICES 3CSYA 5D5MA 2X9WA 5C0NC 1QBAA 2ATPB 1D7FA 2DQCL 4TOYL 5B3JE 2DD8H 1BHGA 5F96L 3CX5J 3LEXB 1OAUH 1T20B 4AEIL 2V7HA 1TZHA 7CGTA 3ZDYE 3I3BA 1ORQB 4HMCA 3FOLA 3BSZL 3EJJX 5GS0D 3FB7A 4XMLL 4J3TA 4K3EH 3RIAF 4HWZA 2B0SH 5ISZA 3VXSA 1C12A 1NSNL 3JVGC 4OD3H 5EDXA 3WFZA 1RQ5A 4CVUA 1Q9WB 3HTLX 3GMLA 3QFDB 1NMBH 2OQJB 2DKMA 3MXWH 5D2LB 4PG2A 3C5ZC 5D2LF 1II4E 5AWNL 3GHBH 3BDYH 5EBMA 2NX5B 5D71L 2BSTA 3OKNA 3WIHH 1EGJL 2D4DA 1BBDL 3DV4B 3V0WH 4KJWC 1GGTA 1PQZA 4DKEH 2M8XA 4GRLA 1Q9LB 3T0EC 4L9LA 4WW2B 2PKDA 4MJ5B 3BD3A 3RZCB 1UZ6F 3LEYL 1YUHA 3EJYC 3TCLB 3LQZB 5T1KB 4CKVX 4HIEB 3K2UH 4LLYB 4P9HH 5BXFB 3KYMA 3HHRB 1FNGB 4ZO6A 3ARTA 2A73B 3G6JB 3F7YA 3KPNA 3FQTA 4K7FB 5EC2A 4MJIB 1M6OB 2YRLA 1LK3L 1G7JA 2FGWL 4UUJA 3V4VH 1OAYH 2XA8H 1VFAB 1IGTA 4MAYC 1CGUA 1QFUL 4J4PD 1U8JB 5TH2B 3MBEC 1O0VA 3GI8H 3ARGA 4OM0L 2HT3D 4ZQKB 5IB5B 1FORL 2WMPA 3OPZL 3RL2A 5IFAL 4PV8A 2EDEA 4I77H 1GPOL 1KBGL 4JB9L 2AXJA 4QOKE 4D0DB 4LIQH 5SWZB 1D5ZB 2EDXA 3WEXA 1SJHB 3K1KC 1R3LA 3GJEB 3Q6GL 2E7LA 1EFQA 3Q6FA 5HD8C 1Y6MR 3WLWC 1L4IA 1XGTA 3IDJA 3RL1A 2MSPA 5AYUL 3VGGA 2OZ4L 1WQVT 1ROWA 2ED9A 2RFXA 5AAMA 1DBAL 4OD1H 2IGFH 2Z92A 4OIIL 4Z7OE 1T0NA 5EOCL 2ICWJ 4B7IA 1QVOB 3DETC 2XI9A 2GK0A 4NM4L 3IJYA 3QI9B 4M5ZL 2A9MH 4H88L 1JYXA 2Z0BA 3DURA 4OQ1A 3SJVA 1MF2L 3HE7C 3H9SE 5HHME 4PB9H 3RKDC 3RVWD 4YQXH 3M07A 4JDVB 3MLSL 2AV1A 1RK1A 3EGSA 4N0UB 3CFEB 4HJJH 4OLWL 2WM0A 3HC3H 4X0KB 2P8LB 2BVTA 2FEDC 3RI5K 4U1HA 5CUSL 4DUXA 5EU6A 2J7LA 4KY1H 4OAWA 1WAAA 3MNWA 2NY3C 4EN3D 1N6UA 4JGUA 1ZK9A 4OGAD 4AYFA 4M6NH 2BFVH 3HI6H 1B6UA 3V5DB 4HK3N 1QFWL 2IAMA 1UQSB 2GKIA 1TTUA 3QIUC 1U36A 3MUGA 5FK9A 1CLOH 3WIFA 1MLBA 4KPHL 3V6OE 2X4NB 5I30L 2YC1B 1DBKH 3DI2B 3MRLB 4P2QB 2CIKB 4LLUB 2BJML 4FTVB 5SV3A 5HI3D 5INDB 3RGVD 1R3JA 3WS3B 3L3JA 1IGML 2V7NB 3MLUL 4OQTA 5EN2B 5JNYA 5MP6L 1FAKT 2QL1A 3G04B 2AJSH 4WV1A 3VD7A 1EH9A 2NY4B 5I8CB 4DN4H 3QUMA 4HT1H 3N9GH 1Y6KR 4XNZC 3E6FA 5JHDA 1T80A 3IDIB 3IFNL 3FN0L 3O3UN 4TSCH 4H26B 1NCNA 4I18A 1NMAH 4RISH 1DEEA 1OF2A 2CSPA 3QDJE 3TYFA 3QUYA 3AY4A 15C8L 1AGDA 4RX4D 4EI6B 2ZSWB 5KSVA 5GGSA 4MB5A 2X1WL 5I74B 4HWUA 3OAZK 5JDSA 4XNYH 3AAZA 3IKCA 2EDKA 4OZIE 5I73C 5J0BA 2IALB 5JUEL 1Y18B 1OOAA 4EUPA 1ZHLA 4K7PY 3TPUA 4P5TA 4JY6A 3RIFF 3FOMA 4N90E 2P42B 2EYSA 3V6OC 1I1AB 5ID1B 1N6QL 5C9JB 5HDQH 3T0XA 5D7KE 2BNRB 3FQWB 4LF3B 3L5WA 3S36X 4L8SB 2A83B 2UYLA 2HFFB 3QEGH 3VFGL 5A16B 2AK4D 2VN7A 4DVBA 2CDFB 3GSOB 3DSFL 4OZFG 5JA8B 2BNUA 1DBJL 4HXBL 3O4LD 3QUZA 2W0PA 5EA0H 5ISZD 5IEKB 1T22B 1WZ1L 2QQNL 3B9KB 2XY1A 5ICZB 5CWSA 4YFEA 1MRFL 5DUBA 1LP9B 1I1FB 3DXAA 4WFHD 3WBDA 3NH7H 2FATL 4K9EH 4OQTL 4L4VE 3D69B 3RVVC 1IAII 2BY1A 3IXAB 5EO9B 4U1LA 3QUML 3S3SA 1YECH 3BPLB 2CK2A 1M7IB 5I8EA 4UT7H 1EEYB 3C6LA 1WBZB 2D3VA 2W0FA 4ZPVB 5DURD 5E08L 5IVOA 4AQOA 5I1DA 1E6OL 5D1XA 5HI4C 2NY6B 5D7LD 4M48H 2YHGA 5H37G 2Y06L 3O6FA 4Y16D 3LRGA 2PW1B 5DDHA 2F5AH 1H3UA 4YNYB 4WI8A 1T03L 3WNOA 4GAJL 3P0VL 1KXVC 3DWTA 4OB5L 3W39A 3T2PA 5JXED 2UWEE 1QA9B 4QF1B 5L2KA 2YK1H 2JF1A 4CBPA 2F5BH 1RJZA 4OGYL 3L5XL 1K5NA 3RJDA 2A74A 4U7KA 2HLFC 4XRCB 1CL7H 1GZPA 3NGBB 5EU5A 4MXQC 3RWCB 3V4UH 3EZ8A 3WFCL 5AD0B 5F6HJ 2JB6B 2A1WH 3RUGA 2FECL 3VWJB 3B6SA 3WXVL 2GHWB 3BE1H 3CVHB 1CZ8L 5H35B 4G42B 5E5MA 4EI5B 5AYQA 2H2SD 1W8NA 4N0RA 4IIQB 3CFIC 3HMWH 1BBJA 1ES0B 2N7BA 5LGJB 4Q9QH 3EO0B 2UVFA 3K8LA 3SGJC 3O8XA 4RIRB 3BQUA 3SJVD 4U6VL 3GSVA 5T33L 1BM3L 5D7IE 2DQGL 3EFDH 1WBXA 3MCKA 3OKYA 5DMYA 4XVTH 4DQOL 2KBGA 3MFGB 5E2TL 4KZEH 2Y23A 3RVUD 3BZEB 3NZ8B 1LNUB 1UVQB 1A6ZA 1I8KA 4F7EA 4KZDL 1LHZA 1INEH 3BP6A 3NFPA 5EU6D 5FKPA 5EIIB 1X4XA 2MPAL 5FYLD 3WSQH 5I9QC 4LBEA 3ZE1F 3EYQC 4FXKA 4Z95H 1S7TA 1KF9B 4C83A 5EO0B 2FHBA 3C8KB 4OFVA 1F58L 5IBLC 4A6YH 4L8BA 4Q6YA 3MOAH 1I8MA 2DBJA 2XWJB 3DUHA 2NY5L 4M62L 1F3JB 4ZFFB 1RZFH 2X4RB 4KJQD 5D6DA 1OSZA 1UZ8A 3S96A 4Z77B 1FC2D 1BQUA 5TQ2H 4GW4B 2C7UB 3L6FA 4HC1A 3MLWL 4WU5A 1NFKA 1FFNB 4QXGL 1P7KA 4NNYB 4G43A 5CIPB 4I3GA 4OLVL 1U92A 1CWVA 4HWNA 3DX7B 4O2EA 3TJEL 2ZCHL 2VXQH 3C60A 1B3JA 1GHFH 4HGWB 5IMOB 1QLRB 2VC2L 4E42B 3BRGC 5I1EL 1LEIB 4ORGB 3OGCB 1DLHB 3MRIA 1AGFA 4DGIH 4MA8L 4EXKA 1ERNA 2EIZB 1JNNH 4NQXB 4P5TD 3CSPA 3IU4L 3BPNC 4M5YH 4R4BB 5IMKA 4X6BB 2OTUB 4HIHB 5DSCB 2EE2A 5SWSB 2G9HA 5D6CB 1UM4H 3VDBA 2Q8BL 3FO9B 1GGYA 1RUAH 3JZ7A 3SKOB 3QCTH 4LOUD 4OD2B 5KVFL 1DANU 1M7DA 2WW8A 3IFOA 1RUQH 1U8MA 1P7HL 3DRQA 2H1PL 3F5WB 1V7NL 2F54D 3I50L 4UQ3A 3MJ9A 1IC4L 5JW3L 3QUZD 5ENWA 3FONB 1PLGL 4HS8L 5CP7B 3HE6A 4QTHA 4I3RL 5FO7A 3AU1B 4I3SL 2R69L 1JHLH 1S7RB 2R1WB 3KXFE 4RNRA 4N5ED 5D2NE 5IB2A 3EFFA 3IU3B 3U9PL 2D7OA 4GS7C 5T3XE 4LK4A 4HC1L 3PQYD 2AQ3A 5F88A 3HG1A 1HKFA 5FHAH 3MRGB 4GAFB 25C8L 3JWNC 2KH2B 2HKHH 4HIJA 4QRTA 2F58H 3GO1H 1U8OB 1MCDA 4F80A 3MNZB 4JFZL 3CU1A 5CJBA 5FO8A 4FHBD 1ZT1A 1SMOA 5HDBF 5ADPL 3VRJA 3FO1A 2P5WB 4WUUE 3CUPA 1NBQA 3ORJA 5DT1H 4ZOAA 3QXVA 3PWVA 2R1XA 4XI5C 5FOBB 1KEGL 2FIKB 4GSDH 4IRJD 5EPMB 1OLLA 3U30B 4DCQB 4F15B 5JA9A 1NCBH 3GHEL 2DF3A 1PKOA 5DWUH 4GRWE 1D5MB 1G7HB 2Q1EA 3MLXL 1AO7B 4XCYA 2WINB 2X1OA 3LN5B 3MA9H 3QXTA 5HY9B 2HFTA 2QSCH 4AENA 5DJZB 5E6IB 3DI3B 2J5LC 1MHPL 3MJ9L 4XX1E 3G5ZA 5HHOD 4RWYH 2GYSA 3KPSD 4XCCH 4LSQL 4J3XA 1A6UH 4H20H 5KOMC 4G7YL 3GBMH 3NCJL 3QEUB 3TV3L 3A67L 4P3DA 1Q1JL 3U4AA 3WO3B 5M7QA 3IB4A 4OF6A 1MFEH 3FFCD 1G7IA 3LB6C 5C9KA 4I2XA 4PJ9A 4LARH 1J12A 1A7OH 2NW3A 4PJEB 1XF5A 2IF7A 4FQXB 1GOHA 3P11H 2QR0B 5EC1B 1ZLWH 1F8TL 3WDJA 3QIWA 2D7TL 4GMSH 5SWQA 4HXAL 4RAVB 4XPHL 5CCKL 2PUQT 3BN3B 3OAYH 3WNMA 1Y0LB 4XNQB 4Y2DA 3FT2B 1K85A 1T66D 2PYFA 4ELMA 1GOGA 1KCUL 2OP4L 5FCUL 1JZ3A 4Z7WE 1CXFA 4DTGL 3GGWB 4QXUH 4M7KL 3B43A 3TZVB 3IGAA 1CTOA 4MAUL 4EQ3A 5GS0C 4HJ0D 4F9LC 1CIUA 3CLEH 2BHUA 2LTQC 3KLHD 5GZOD 2AEPH 5GJTH 1U58A 2ZG1A 3UTTA 3SDAB 2ORBH 2QEJA 3KR3L 1DP0A 2QSQA 1KJMB 2XWTA 4TSAH 3DGGA 5GRVL 3ECBB 1U8KB 4XH2A 3RBSA 3P0YL 4UAOC 1INDL 3C8HA 4M4RA 4MA1B 5MENA 4XP1L 4HPYL 2ZUQC 4I0PB 1LDPH 4X6CB 4EJ1C 4X98B 3MV9A 1GGUA 5CZVL 1QSFB 2VJXA 2P8MB 4LLDA 3LH2H 2OTWB 4HKJB 1E4XI 5C0AA 5E8PA 4Q0XL 3GMQA 3X14B 4F2MA 4YUEH 4KV5E 2Q6WB 4OKVA 4P46B 3SO5A 1YNLL 4UDTB 1YNTA 3T3PE 1GH7A 3IFLH 2MHAA 1JGVL 2GUOB 1MHCB 4G6KH 1HQ4B 4WU7B 3PWNB 2NY7H 1CD1A 5H2BB 5SX4I 1FFQA 3O6KL 1FG2A 2OJEB 4B7LA 4YLQT 2B5IB 4WHCA 1D6VH 3GK8L 4Z7VB 4F33B 2YBRB 1NFDF 2Y5TA 4J4PC 1RK0B 4HFUH 4DFIA 5E9DD 3WDIA 5DJ2A 5L7XH 3KVQA 2ADJA 1RHHA 5F1IB 1WBYA 1XH3B 1UWGH 2HT3C 3ZDXE 1U6AH 1JN6B 2YPKA 3ZYIA 3ARRA 1KG0A 4G9FB 3P73B 2OL3L 3O2WL 3IVKB 3LN4B 2NXZD 1KJVB 2XPGB 1S5HB 1XZ0B 4LEOB 5IM7B 1UADC 1DR9A 3UZEA 2AEQL 4BH7B 4Z6AT 1HOCB 4YHIB 2JIXB 2YS4A 1C8PA 3MRMB 5D72L 4L3CB 3X12A 4HUVB 3SQOH 4G6JL 3UTSD 4DN3H 3VI4F 4JY4A 4H5SA 4N9OB 1XGUA 5C07D 3G5YB 4AIXA 1ZLVK 3VH8A 2B39A 2PYEE 3SPVA 3RKPA 3O2VH 3UJTH 1KN4H 4IRSA 5C3TA 1I9EA 3PWJA 4AH2B 3ZTNH 1HCVA 5IG7B 3BAEL 4PJIB 5A1AA 3SDDA 5C7XL 4S1RL 1DVFB 2A6KB 2VDRH 1ZT4A 5DVNA 4L8DA 5ESQB 4BFIB 2HWZL 4IRZH 5E2VL 3RVWC 1Q72L 2VITB 1EO8H 3T77A 3L3GA 3GJFH 5EBWA 4V1DB 4NQTA 5DD5L 3W9DB 5J6GB 2XN9D 3UTQA 3S8WA 1IM9A 4ETYA 1M05A 5DUMH 4P2OD 1X44A 4WNQA 1EV2E 2CO6B 1AHWA 3L3DB 4F7MB 3VGDA 1N4XH 1ZVSA 2Z35A 3AUVA 5CBEB 2R39A 4JM2F 4KDVA 2XT1B 3ARED 5K93A 3ZE0F 4YWGH 2DMKA 1OT1A 5DYOA 1U93B 4ZUUA 3OB0K 1UXWB 3BKJL 4HWBH 1SJEA 4YE4H 3QUXB 4TRPL 3NCEB 1UJ3A 3JBG7 3RGVC 3W5NA 3SE3A 4JFQA 1SQ2N 3KNBA 4PP2B 4LCCC 5C0CD 4MLSA 3ALXA 3WNPA 5FDWA 2AK4E 4HK3J 1X9QA 1I7TA 4NZUH 4C59B 1AI1H 3DVIA 4L5FH 3O4LE 4EDXA 5ISZE 1C5BH 3DNKA 4UTBL 1WCBA 5GS2D 2DLGA 1WIPA 4KDTC 2WBJA 3THMH 4WFHE 3OTTA 1TXKA 4OI7A 4GKSB 3O9WB 3MNVB 2VABB 4XGZA 3RDTB 2QQQA 5DRZB 4Y88A 1SVCP 2X5PA 2E27H 2RR3A 3L3HB 3PV6B 3RHWK 5B8CC 1U95A 1OLZA 2HG5A 1YQ2A 1T89A 5FF6A 1EPFA 2PTUA 4QHKJ 3LKOB 5HHNB 3ZTJH 3S5LB 3IXTA 3P9LB 1A3RL 2XZAH 4PJFB 3H8NA 4XPFH 5TF1L 1T2JA 1MREH 3VMNA 2GK2A 5HYEA 1IRAY 1MIMH 2XZZA 1YQVL 4OLUH 3HNVH 4LPWA 1AE6L 5D7LE 4L1HA 1S7WB 1KIQA 4MJ6A 3MLRL 2CMRH 3INUL 1RJLA 3KYKL 1BD2D 3JWDH 1CBVL 3EOBB 3RWGB 2M26A 4HKXA 3S4SB 1KB9J 4LVNC 4PJ5B 3FQRB 1JGEA 2DQDH 4HBQA 4QRSB 3X13B 1T04B 5FO9A 4YDKH 3QQ3B 1X5LA 2VQUA 4L8CB 3IS1X 3MLZH 4LCWA 4L3ED 1HNFA 4CMHB 2OJZH 2J88L 2AW2A 5DQDL 5L9DL 4QRRD 4G80B 5F89B 5HHPA 2BRRH 5DK2B 1RUKL 3IDMB 4UT6H 5C0AD 5BQ7A 3MRBB 1QSEA 2NXYB 3T0DA 4KUZH 5JORA 1T3FB 3EOAB 4GKZB 2EXWD 1UT9A 5BRZB 1NC2D 1T7XA 4M1CD 3LY6A 2YD1A 4YFDB 1DL7L 1L9MA 2VDMH 3O4OB 4IMLA 3GSUB 1FNFA 1G9ML 4LLWA 4AIOA 3Q5YA 4HZLA 4PS4H 5ADOH 2R8SL 3VFRB 3C5SB 1QRKA 4POZD 4Y16C 5F7DA 3SJVE 4BFBD 3LKRB 4WFFD 3TVMA 1A7PL 1I3GL 4OF8A 4U1MA 1C08A 5C09B 3PL6D 3M45A 2X09A 4WGVB 1J8HA 2FB4H 1NEUA 2CDGA 1MAJA 3TP4A 1T1XB 4NQED 5J8OA 5ETUB 1NBYA 5CZXD 4RAUA 5JXEC 3P4MB 1TPXB 1HIMH 5EU6E 4FP8H 1OTSD 4R0LB 1DCLA 4QHLB 3Q48A 5FYLE 1HEZA 4GOSA 4X4MA 1TETL 1IGCH 4LQFH 1PW3A 3I75B 5JMRA 3KPQB 5EOTA 2WP3O 2E7LC 4M1GH 1U2HA 5HHXL 3HAEB 2CXGA 4HWEL 1U8PB 4PJ7E 5DC9B 2PCPB 2IH1A 3CFBB 1YDPA 1VADB 1R5VB 4M7JL 3MR9B 4WDIB 4YHKH 3W0WD 3BKYH 1L0YA 3ROLA 2NLJA 2XKNB 2H2SC 3NACL 4ODUB 1HHHB 4JHWL 4WHTA 4BSVB 1V05A 1AP2A 4JPKH 5B22A 5T3XH 4HQQL 1I7ZB 3CXDL 3TNNB 5J13B 3RWJB 1U42A 4LVHC 3K8KA 4UINH 4HIXL 2XV6B 4MQ7B 2GTZA 4UNUA 2VLLB 5DD6A 3EUUA 3OKLB 2PW2B 5A2LH 4YK4C 2B20A 2Y4SA 4GAYB 5I1HL 3RVUC 4PG9A 3RNKB 4PJDB 5CLTA 2ED8A 2JJSC 3BHBB 1IM9D 4AJ0A 2AK1L 4N1EA 1RZJC 3BKCL 3WHE1 5GRJL 3GSNA 3KYOA 3RTQB 1RIVL 4F7CA 1P2CB 3WN5B 5HHQA 4K8RH 2H45A 4WWKD 1LO0H 3MRDA 4ZUSB 1Q94B 2DQFA 4NJ9H 2NY4D 4GRWH 4JHAL 3CDGA 3SKJH 1QQDB 4M9PA 4UV7H 5J6HB 3S97C 5DD0L 4N5UA 1PX4A 1YMMB 1YJDL 3BUYA 2E7CA 1IAOB 4MD0A 5CJQL 5J12B 1KFAL 1MWAH 5GGUB 5GSVA 2Z4QB 4JFEA 2VLJB 1NPUA 3NN8B 5EIVA 5A3ID 4NWTH 3K81A 4P2RA 5CP3A 4MXVF 5FYKH 4TPRH 3T2NH 1ZHKB 4P4KA 1DQDL 3U0PB 5I8OH 3RY4A 1F4XH 2F54E 5D8JH 1YEDA 2C9AA 4ZFOA 3L7EA 3VXRD 4GG8B 4ODHH 4O00A 4Y4FB 2F8OA 4UU9B 5I1KH 2X1QA 5SX5K 1BQHB 4LSSL 5E94B 5F3HA 3MBXH 1J0YA 1XGRA 1RI8A 3DUSB 2GY7B 4PJBE 4YXHH 2C3XA 3B9VA 1JPSH 2VDQL 4X6DA 1MQ8A 1RIUL 4YHOL 3PQYE 4NUJA 4YGVA 5E00B 2IMMA 4PJXB 2BNRD 3HC0A 1XCTB 4RWHA 4NHCL 4XC1H 4NSKA 1K6QH 4NYLB 1S7QB 2YD6A 4P5TC 5CILH 5E2WH 4BSWB 1YPZB 2BOCB 1H0DB 4K94L 1D5IL 3T2QA 3X3FL 5DMGD 1ZLSL 2W9EH 4NRXB 3CC5A 4PGBB 1F42A 4RCAA 3VFVA 4NO2A 3GSNL 4GXUM 1GVIA 4OCXL 4PJ8D 5IFHL 4LOUC 1K4DA 1VGEH 2X4UB 4OZGA 3QHTC 2DYPD 1AGBB 2BMKA 1D5XB 4U3HA 1IZJA 5C0EB 2V2WA 4G8GA 1JPGB 1YC8A 1BEYH 4X6FB 5D5MF 1FFPA 2AKRA 5BZWB 5EO1A 1N2RB 4JO2H 1E28A 5DGQA 4NO0A 2R0ZL 4LCWD 2BC4B 3VW3L 5DJ0B 5F44A 3P4LA 3TT3H 1A22B 1L6XA 3CSBA 3CFCH 1TJIL 4D8PB 1JTPA 1R3HA 4N5EC 5E2JA 4XPGL 4PRHB 1EJOL 3L3KB 4JZNA 3SDCB 1KIRB 1DANT 5H8DA 5DK3A 1XGYH 4X99B 4D9QD 3PGCA 2JJUA 5DR5L 5HHOE 1XGQA 4AEHL 1A6WL 1IT9L 4QTIL 3KPSE 4ZFOL 5A2FA 5IQ7H 3VXOB 3ZL4H 3WMSA 4OFIA 3MRKB 5F9AC 2JJTA 3R8BB 1A4KB 1TZGL 3WO4B 5DMKA 2X7LB 2NW2B 1MVUA 4KHTL 4LKCB 4QRPD 3FFCE 1NGQL 2EKSA 3QPXL 5IOPA 5DMIL 4NKOA 5ID0A 5F7MC 1SEBB 5DFVC 1RZKC 4NO3A 3KPOA 4M6AA 4LHJB 3BEWB 1FNEB 4FFYL 4JJ5B 1G9NC 4LSPL 1XF3A 2V17L 3VG0L 1FJ1B 1ACZA 5JMOC 4NN7C 4Y5VC 4NJAH 1FO0B 1HI6B 4JANB 3G08A 4IRJC 1J8HD 3VG9B 3BT2L 2DQCH 4NDMA 4XNMB 4TOYH 2HH0L 3WLBB 1WTGT 1FGVL 1EVTC 5F96H 4G9DA 4AEIH 2W60B 2ITDA 2CDEB 4GBXD 4I48A 1S9XB 4D0CA 1IKFH 1KYOJ 2Z91A 5C0JB 2FHFA 3QCVH 1MI5B 2P8PB 2NY5C 4XHJD 1OW0C 5JPNA 3UBXI 2Z9TA 4W6XB 3QDGB 4JKPL 4HPOL 3KDMA 2C4XA 4XP4L 3GSRB 3VE0A 2RGSA 4DEPB 1CFSB 2AS5M 1URLA 1QR1A 3VFSB 2X1XR 1NSNH 1P4BL 3ARDA 2VOTA 5HTSA 1DQML 5CJOL 3VFPA 3P4NB 3S5LG 2KPNA 3I6KB 2BSSA 4OZ4A 3BH8A 3SDXB 4TVPD 3MROB 4JZJA 3FL7A 5FM5O 5IW1B 5I76A 5DQ9B 1IC7H 5D71H 3OV6A 3V8OA 1BBDH 2DQUH 4FZEH 1ACYL 3RNQB 1PEWA 4F7TB 1UB5B 5MI0C 1N8ZB 5EU4A 1CFNB 5IJKA 3IDNA 3LEYH 3EYOB 3RWEB 3TIDA 1JUFA 4JG1L 3NCCB 1KXQE 3ILQD 4O2FA 2V5TA 1AIFB 1FBIL 1Q8MA 2G2RA 1PKQE 3FT4A 1M71B 2XACC 1IEHA 3PWUB 3V6ZA 1IEBA 2IPKA 3RA7L 4AG4L 3WS6C 4UB0L 3C6SB 3DARA 5BJTB 4IDLA 2FGWH 3MV7D 2XKSA 3QXAA 5IV2A 1I85A 3NMEA 4HJ0C 1IL1A 3P3YA 4WTZA 3KLHC 2DWDB 2HFEB 5GZOC 1D9KD 3QNZB 1CGVA 3TWCL 3WL9B 1Y6NR 1N0XL 4OM0H 2GEEA 1N6VA 2R2CA 1FORH 3OPZH 3DVGB 1QZ1A 1UWXH 2UUDH 5HVHB 1R24A 3D25B 4I4WB 2D03L 2P1YA 3BH9B 1GPOH 4Z0XA 4U2ZA 4HKBB 1KBGH 4PJAF 1EBAA 4NCC1 1OGAB 3F6LA 4RQQA 4C56B 3A6BL 5KS9B 4G7VH 1TQBB 1WAAF 2FBJL 5I75C 3I02A 4Y8AA 2I60L 3QZWB 4ODTL 1MFBL 5I71B 1NGYB 1AH1A 1UXSA 3QNXB 3QQ9D 3EDJA 1A1OB 4LSVL 1JK8B 4C4KO 1A1NA 4ZXBD 1JNJA 4LP5A 5JW4N 1DBAH 3ARUA 4H1LB 1EXUB 1EIBA 4OIIH 5FFLA 1DJSA 4JVUA 5EOCH 5C07E 2FH8A 3WJLC 4TUJB 3PDGA 1CDUA 1AFVL 4XP9H 4HUUB 4NM4H 4MCZA 4AQ1B 3BI9X 4MDIA 4WO4A 4CW1A 2V9RA 5C1MB 1WT5A 4JRYB 4XXDB 4ODXB 4X6EA 4OCSH 3MLSH 3OKOB 4PYHA 3HAEG 4JZOB 2Y9RT 2FZ3A 4YAQB 5HHVL 4OLWH 1NEZA 1ZTXL 2BNQA 2XN9E 3BZ4B 2ERJC 5CUSH 1SM3L 5L88L 4ZDHA 5C8JA 1IFHL 2NXZC 1TTFA 3OF6A 3IDYC 1QFWH 1JF6A 4QHNB 4ZD3L 4JGJA 3RPKA 5BCAA 3HPJA 4KPHH 5I30H 5J9PB 4Y4HA 1JGDA 4XNUL 4EIGB 1A4JA 4NRYB 2BJMH 1T0MA 3U2SB 3E6HB 1GGCL 2BXYA 3M17A 2ZCKH 4NZRL 5GGRY 3QEQA 3TA3B 1IGMH 1LD9A 3QDMB 2A38A 4XAWL 1T83C 5C0CE 2PXYB 2ZZUT 5MP6H 3WV0A 4M7LT 4J1UA 4FFZL 3BKML 3TBSA 3WFEL 5IB3B 4IEFB 1OAQL 1IAMA 1AR1D 5A2KH 3IFNH 3FN0H 1FYTA 1E4XH 3B9EA 5IK3B 4A6YB 3DROB 2BSRB 3QO0A 2PTVA 15C8H 3G5VA 5L8JB 3QH3A 3SEPA 4QKXB 3QPQC 1NLBL 4FOMA 3WFHB 1ZGLM 2FSEA 4P2OC 4AT6A 2X4TA 2OI9C 5SX4H 3OXRA 3V6BR 5JUEH 5E6ID 1KCRL 5BZDA 5E56A 3AREC 1XF2B 1MRCL 3LIZL 4JG0L 3BP5A 4F57L 1CXKA 5E8NA 5T3ZL 1N6QH 3SKNB 3UC0L 1P1ZB 2J8UB 4ELME 5KG9A 4QO1A 1BQHG 4PJGB 2FYYB 1ZOXA 2L4OA 4OCNC 3VFMB 4RAHA 1XAUA 3ULVC 2CIIB 1R0AL 5JIIA 3VFGH 2GSIA 3VI3E 4G3YL 3GIVA 3UTPE 1BD2E 1JVKA 1PYWB 3KLSA 5IVXA 4OLYL 1OB1A 1DBJH 4HXBH 2OR8A 2CLZA 2WV3A 1WZ1H 2QQNH 4MD5A 1MJJA 3O45A 3ARDD 5GGTA 1ZHBB 5DMJB 1BIIB 1OGTA 1U91A 3FAXA 4JO3L 4L3EE 2FATH 4HLJA 2JCCE 4OQTH 1H3XA 3RWFB 1MUJA 2YWZA 4QRRE 3MV9E 5D7JA 3QUMH 4IHOA 1JPTL 1FL3A 2CK0L 4HFWB 5DLMH 2VE6A 5C0AE 1LEKA 1QLFA 4MAYB 3MOBL 3X3GH 5E08H 1IC1A 2R56H 3RUGF 2H6PA 3MBEB 3NABL 1BQSA 1KCVH 2R0LL 3AS1A 2OSLA 5CINL 2NY2D 2IQAB 3GUTB 5IKCA 1P4LA 3VRIB 2H9GA 3C2AL 3KYAA 4K7PL 5DS8A 1JMXA 1FP5A 4WHYH 3DMMA 5KTEH 3DIFA 5DJCB 1P5VA 4WFFE 1T03H 2H32A 5SV4A 1HXYB 5J06A 4EUPH 3NA9L 4JVPA 2ZUTA 1NCAL 4GAJH 3HRZA 3P0VH 2FIRT 3RPIB 1S5IL 1EUTA 1CGSL 1KULA 4F8TA 3H9YA 4GW1B 4OB5H 4NQEE 4JFPA 4OZHA 2ID5A 1QYGL 1AD0A 1KTDB 3RAJL 4XPBL 1GL4B 2X4QB 3S3PA 4OGYH 4WW2C 3L5XH 2NNAB 2GJJA 3RZCC 2ICWI 4CGTA 4ESKA 5HYSB 3T65A 3MV01 1A7BA 1LE5B 2EYRB 3ZKMC 1K4CA 2BVPB 1AC6A 1MJ8L 4KK6D 1F90H 2FO4B 1HH9B 1TVHA 3HE7B 5CMAB 4FMKA 1HK6A 5I6XC 5GGTL 1TTGA 3WXVH 4QRUB 1CZ8H 3QAZC 3W0WE 4U7SA 4R26H 3QG6A 5DJDB 3FQXA 4MNQA 1ZSDB 2EXWC 4M1CC 1N59B 2NY3B 5HJ3B 4Y89A 3PWLA 3AC0A 1OVZA 4WO4D 2ZOLB 4QOKB 3EHBD 4POZC 5IT2H 2J3SA 4IOSD 1YEIL 2DQGH 4J6RL 4YHPB 3QIUB 4DQOH 1E4WH 5F72S 4Z76A 3PL6C 3GMOB 3AM8C 1E4KA 4H8WC 5A2JH 4KZDH 2A6JA 2JIXD 4L4TB 5CZXC 2BNQD 4GG6A 3TBWB 4PGCB 3QQ4A 5FA3B 2MPAH 1UACL 1OTSC 3ULUL 2JK5B 5KAQG 2DLTA 1JMZA 3R0MA 4MD4A 1F58H 2X4SB 4XNZB 5FB8B 5F3BB 3D2UB 3H9SB 2HJLA 5HHMB 1MCWM 2XOTA 4BK4A 1V3MA 4DKAA 4FQIH 2F15A 3QEQD 2DB8A 3RWHA 5JQ6L 4JDZA 1X6NA 4OUOA 3KPLA 4XBPB 3BIAX 2Y36H 5F7UA 3GMNA 3IDGA 4P48A 2H8PA 5FUCE 2I9LA 5I73B 3MJ8B 4H0IA 4QXGH 3GZKA 4UDUB 5KSAD 4OZFA 4OLVH 2KZ1B 1MFAL 4S11A 3VXRE 5K9JL 2CPCA 4H25B 1RV6X 2IEPA 5CEZL 2MFNA 5DC4B 3EOTL 3T0VA 4M7LL 4O58L 3TJEH 4O9HH 3ESUF 2ZCHH 3WIHA 1W0VA 4J3SA 1ED3A 3RP1A 2D4FA 3OJVC 4NCC2 2VC2H 3HFML 3PWPA 1FN4A 1BLNB 3PP4L 3QJFA 4MA8H 1WZMA 1DDHB 4CDGC 2FEEL 2V5SA 4WWKC 5KZCD 3QZWG 3IU4H 3SO3C 2W9LA 4YDIL 5TE6L 2WWKO 2NY4C 4J3WA 1CDJA 5DJ8A 1ZWIB 1ZEAL 5EULV 1T4KA 4HF5L 3QDJB 4YIQA 1YY9D 5HGAB 2DM3A 4PJHE 3E1F1 4H1LG 2Q8BH 3SGDH 4IS6B 1TJHL 5JZ7D 2PO6D 5JW5B 4OKDA 5KVFH 3BJ91 5A3IC 1K8IA 4QXTB 5E1AA 1BFOB 2H1PH 3I50H 1IC4H 4Z8FL 4OZIB 4JFFA 5IF0B 1PLGH 1EFXD 3T1WA 4HS8H 5T5NG 1FZJA 1UJTA 3B3IA 4I3RH 3MLPA 1GCFA 4WRLA 4I3SH 2R69H 3B4NA 3CZFB 4KK5D 2Y7QB 4LCWE 3CZJA 2LV4A 2VSDA 3PHOB 3T4YA 4M7ZC 2DWEA 1X5KA 4BUGA 4ETQB 5DI8A 3U9PH 3U79A 1U8QA 1MFCL 4U1SA 4D9QE 1HN1A 4HC1H 1NMBL 1G9MC 3K4DA 2UY6A 1G6RA 1HSBB 5DJ6B 3DO7A 25C8H 1ZMYA 3D48R 3CH1A 3BYTA 4BQBA 1I1YA 2AXFB 2QADD 3BDYL 4JFZH 4QRPE 4R96A 3HR5A 3WIHL 5ADPH 3V0WL 1CDYA 3R4DA 1T7VA 4N68A 1MCCA 1X5HA 4JKWA 5K9OA 5DMGC 3LSOB 3B9KC 1NC4B 4DW2L 1KJ2B 1NANH 2EIEA 4L4VB 4S0TD 3CCHA 4PJ8C 1S7SA 5ANMA 5BW7C 4W4OA 1J8HE 1Q0YL 4ZOCA 2E9IA 4NQUA 2FRGP 2QKIB 3GHEH 2HN7B 1GC1C 2A2QT 2I5YL 4BQ8A 3Q0HA 3MLXH 5K33A 4TNWK 2XZQL 2XA8L 1BJ1J 4ZO7A 1T2QL 4RMVA 5K59E 1WVZA 2MQ3A 4MNHA 3QFDA 1TQCC 4X4ME 2EYTB 5MERA 4KI1A 5D2LA 3T0BA 1UA6L 1MHPH 3MJ9H 1WWAX 4DK6A 1UCTA 3QULB 2XTJD 1NDMB 4LSQH 1N7MH 1A9EA 2NX5A 4G7YH 3NCJH 1HH6B 3DV4A 3TV3H 3A67H 1IGFH 5C09D 3NVQA 2MNUA 2OBGA 5TQ0H 2UWEB 1NBZB 1WV7T 5MEOB 1KCLA 1VPOL 3FN3A 3L95B 2MOVA 1DQJB 3LQZA 3PUCA 5T1KA 4YDVA 5CJ5A 4HIEA 2IGFL 3LPWA 1G6RL 5BXFA 2MKLC 3TN0A 1J5OL 1A5FL 2IAND 2BVEA 2A73A 3G6JA 3PP3K 4EOWL 1F8TH 1U8LB 1BFVH 2D7TH 3GSXB 4MJIA 4HXAH 3NTCH 5C0BA 3NGBC 5DRXB 3N85H 2MQ0A 4P57B 4XPHH 1G84A 5CCKH 1G7MB 4GQ9H 3FCTB 3HCVA 4YEEA 1YN6B 2R2EB 1KOAA 4GBXC 4LFHD 3QCUL 5TH2A 4CVZB 5FYKU 1JNLH 1KCUH 1YJDC 2OP4H 3I84A 4ZQKA 5FCUH 4EI5C 4DTGH 4GW5B 4XHJC 2QV2A 4M7KH 3CJJA 3WYRA 1A9BB 3MV7E 4MAUH 3FO2B 3KS0J 1XF4A 1HILB 3GEWB 1JF1B 5SWZA 1D5ZA 4XTRD 3IRPX 5D7IB 1OAKH 1SJHA 3KR3H 4PTTA 4HW6A 5IHBA 3SKMB 1Z5LB 1A6VL 3C87A 3GJEA 1LGVA 5CKAA 1EMTL 1CXEA 1NFIB 4R3SB 1INDH 2YZ1A 3UZVB 4JFEE 4OCMC 3SBWA 1CLOL 3ARFA 4LPVA 2BHZA 2ZSVA 4XBEL 4OI9A 5CZVH 1QVOA 2HTLD 4ZFGH 1S9WA 4QLRA 2DN7A 5D1QA 5F8RC 4NKDB 5DJYB 2AJSL 3BPNB 4XPAH 1CS6A 1U8IA 1WWCA 4ODSL 1YNLH 3N9GL 1BGXL 5JO5A 5LGHL 2R9HD 3TBVB 3ILQC 3BZFB 4JDVA 4W68A 3WHXB 1ZVYA 2C1PA 1VFBA 4N1CA 3HZYB 4N0UA 3CFEA 3MGOB 3PWPD 5HYSG 3OKKB 4X0KA 2P8LA 1VB9A 2IPUG 2VNCA 4WI7A 3O6KH 1RJCA 4MWFB 5J56B 4PD4J 1K2DB 2YPLA 3GK8H 4PRID 3V5DA 2ARWA 3LRHA 1UQSA 1KN2L 5I18L 1D9KC 5I1IL 4HUKB 3PJSB 5GGSY 3OQ3B 3WFDL 2X4NA 2YC1A 1BREA 3VGBA 4BQCA 4HULB 4EVNB 4P2QA 4N0YL 3O2WH 2VZ3A 4LLUA 2D2OA 2HKFL 3BPCA 2CKNA 5HYQA 2V7NA 2X70A 4WI5A 1GGBL 5I17A 5HDQL 1X5FA 2AEQH 4JFFD 4OLXL 4Y4KD 5I8CA 3QEGL 5D72H 3QQ9C 3LRSB 4G6JH 4XPTL 1BOGA 5EZIL 4ZXBC 4U1KA 3FT3A 4H26A 3OHXA 5KOVC 3NA4A 3QDHA 3WIIL 5LVEA 5DQJB 3BAEH 3MV11 4C57C 5JIKA 3PHSA 4K9EL 4R4ND 5C7XH 1H3PH 4S1RH 3MQIA 2EDNA 2N1KA 4IDJL 2Q86B 2HWZH 5E2VH 1Q72H 1YECL 2IALA 3W9EB 4KRPD 3SOBL 1Y18A 3OKDB 4UT7L 5DD5H 1WITA 1DN0B 5EZOL 1XCQB 5CGTA 3KXFB 5EG6C 5F7LB 1I1AA 4DKDC 5ID1A 1I1RA 3NIGE 5D2NB 5C9JA 3GKZA 2J5LB 4ZTOL 5IHZB 3FQWA 4LF3A 1KJ3L 4L8SA 3T3MF 2A83A 5A16A 2VYRE 4Y1AD 1DN2A 3GSOA 4X7TA 2F5AL 2EE9A 6CGTA 3BKJH 3VFWA 4F3FA 4RGND 2VIRA 2L7UA 5TDNB 4TRPH 3CD4A 3FRPG 5IEKA 1ZANL 4WUUB 1I1FA 4BYHA 2W9DL 1T5WA 3D69A 2ATKB 3UMTA 2YK1L 3U6RB 2F5BL 3EDKA 1CQYA 2ZCLH 3IXAA 5EO9A 4Z7NE 4OCRL 1I9JL 4JFXB 4Z5RA 1VDGA 4LCUA 5HI5D 2FR4B 4NT6A 4UTBH 1TCMA 1AR1C 1M7IA 3TO4D 5HYJD 1EEYA 4OFPA 2W92A 1C1EL 1HDMB 2XWBB 4GRWB 1T1YA 3BE1L 5AUMA 5D93C 2EEDA 3FQUA 2DQEL 1V3LA 5EFIB 1JHKH 2APFA 1JI1A 1RSFA 4X83A 3W5MA 3O11B 3HMWL 3DYMA 3CFDB 1B0RB 2LTQB 2PW1A 2Z8RA 5I1CL 3MA7A 1IGYB 1A3RH 5TF1H 5C0BD 5E6IC 3BYYA 1HXMA 1YQVH 4O5LH 4LPTA 2X4OB 3NCFB 1J0JA 1T21B 2OR9L 2VZ1A 4UAOB 5DHVB 4JLRB 2N56A 1QA9A 4QF1A 3MLRH 2ADFL 1I8LC 2FWOB 3INUH 5F93C 3HLAB 4J3VA 5IFJB 3KYKH 4JGMA 3H3KA 1INEL 4E41A 1CBVH 4XRCA 3VGHA 1K3IA 1OP3H 1MLCA 3RWCA 3DYPA 3U7WL 3PGDB 3TIEA 5AD0A 1ZLUH 1AD9B 4OGXL 3LQAH 3ARDC 5C08D 1DE4B 4K3HA 3CVHA 1ZS8B 1VFMA 5EZLB 5H35A 1BWMA 4G42A 5DVOA 1XIWA 3MOAL 3ARFD 2J88H 5C0IB 5L9DH 3HI1A 1TCRB 4IIQA 4JO4H 3ARBD 4KKBD 5LGJA 4Z7WB 1PZUB 4OLEA 4HUWA 1RUKH 2ICWB 5D1QD 3AXLB 1OM3L 1F00I 3D0VB 5IJKC 3ARQA 1F2QA 4U0QB 1U9KA 1A02N 4M8VA 1NGWB 2NY2C 1DL7H 4Y5XC 1FPTL 3BZEA 2A0LD 3SDAC 4QNPF 3NZ8A 3VU2A 2E6JA 2E9BA 2GITB 3UEZA 3K8MA 2QQLL 4JFYB 5EU3B 1MJUH 1TLKA 5BVJA 1A7PH 1I3GH 5ACZB 1A2YB 1W8OA 3U4BH 4C56D 2EXYC 4UOW0 5L6YL 4JN2A 3HUJE 2YPLD 3TPKA 2C3GA 4NOBA 5BV7C 3C8KA 3F7VB 3T09A 2YEZB 5E0QA 2X9XA 2BNQE 2XWJA 3IAGC 1J86A 4TULL 5TE7L 4M5YL 5A2IH 1F3JA 2GFBB 4NO5B 4ZFFA 2R4SH 1TETH 1CD8A 2X4RA 3MRRA 4KK6C 4Z77A 5HHXH 2V5MA 3ZKSD 4GW4A 4HWEH 1WFUA 2C7UA 1P9MA 4M7JH 5ITBL 3TO2B 1ND0A 2P5ED 8CGTA 1HCFX 1IGJB 1FG9C 5CIPA 5IVZB 3QEQE 3C2SA 3PABB 3NACH 1M7XA 4JHWH 1INQB 1U3HD 1IC5L 3KPPB 3DX7A 3ES6B 4BFEA 3QO1A 3CXDH 3L5IA 4EN3B 3WJJA 4WO4C 4HIXH 3RI5F 3EHBC 4HGWA 5IMOA 1QLRA 4E42A 4M61A 4LAQL 4ISVB 3OGCA 1I4FB 2EIZA 1JNHB 1RFDL 4NFBA 5C0GB 3ZTJG 1KGCD 5ALBL 3RGVB 5GS1C 4LCCB 2AK1H 2VAJA 1KNOB 5SWSA 4R7DB 5D6CA 1HHIB 5GRJH 2PYEB 1JYWA 4OFYD 5DVKA 1F11B 1RIVH 4X6DF 4OD2A 3FAWA 5K9QG 2H3NB 1NL0L 4NKQB 4TUKL 1JPFB 4LCYA 3ALWA 4JPVH 3FTGB 3F5WA 5CSZB 3BWAA 5CJQH 3FONA 4TSBH 4M6MH 5J7CC 1KFAH 4QGYA 4HKZB 4Y5YA 5BO1L 3AU1A 2FJGB 2XA3A 3G6AA 1O7SA 2R1WA 4PLKD 5F7EH 1DQDH 4Q9CA 3EDFA 1C5DB 3IU3A 3MA9L 4J23A 3CVIL 4PUBL 3ZE2F 4OZGF 4QHKI 5KSAC 3OX8A 2VAAA 3ZKXC 5DJAB 2CO7B 5ESAB 2DRUA 4FN0A 2GJ6A 4LSSH 3MNZA 3NPZB 4XCCL 3QXWA 4XBGB 1TZHB 4H20L 5C6PB 3GBML 4JQVA 2VDQH 1RIUH 5I16B 4YHOH 4LSDA 3FOLB 1MFEL 3QUXC 5E8OA 4W6YB 2AK4B 3M1BA 2FX9L 4ZUWB 3CU7A 5FOBA 2FIKA 3O4LB 4HWZB 5C2UB 5ISZB 3K4AA 5EPMA 4K94H 2VKWA 1D5IH 2CUHA 2E7MA 3X3FH 5DD1L 5KSBF 1X4YA 3HI5L 1ZLSH 3ROOB 4GMSL 2GJZB 5F9DC 3GSNH 3BRFA 4OCXH 4Z7QE 2WINA 5IFHH 5JZ7C 2PO6C 3LN5A 4ODVL 4RFOL 3VXMD 4E41D 2BSTB 3OKNB 5DJZA 3P4OA 2EDDA 4QXUL 5DURB 2DMBA 4P23A 1O5DT 2R0ZH 3MYJB 4KK5C 4U4BA 1OD7A 4UBDC 3QEUA 1XIWD 5DRWB 1WICA 1TJIH 5D7LB 5CP3H 1EJOH 2RCSH 3NAAL 2DBLH 4Y16B 5DEGB 3RBGA 5DR5H 4LVOC 4AEHH 3VXQA 2XTJE 4QTIH 1IT9H 2DI8A 5GGVY 4KAQL 4UUJB 4MNGA 1TZGH 4FQXA 5EC1A 4KHTH 2QADC 2ZOKB 1N0LA 3LH2L 3QPXH 2A6DB 5DMIH 5DJXA 1MFNA 4PV8B 4RAVA 4FFYH 4ZSOA 4LSPH 5FGBC 1Y0LA 4OCWL 4XNQA 3REWA 1IM3B 2IPUK 4GMTL 3FT2A 5E4EC 2IANE 1R3LB 3GGWA 1FE8L 3BT2H 2CKBB 1QFPA 5F71A 3TZVA 4LP4A 4GLRI 3TT1L 1XGTB 4G6KL 5F9JA 5GISL 4FQQB 1JBJA 3BUTA 3QIBD 3SKUD 5ICYB 4IJ3C 2ESVA 2RFXB 4YXLL 4GG6E 4MS8D 4KTDL 2UV3A 4ZAKD 1YEJL 3E8UH 1D6VL 5CJXC 3AS3A 1ETZB 1UKQA 3ECBA 4G6ML 3UYRL 4JKPH 3OAZH 2W1NA 2GK0B 3IJYB 4PBVC 1UWGL 4HEME 1U6AL 3DURB 2X1PA 3SJVB 4APQA 1RULL 3OR6B 2XTJC 3MSPA 1QSFA 2WIMA 2P8MA 1EEQA 2DKUA 2VDLL 3L7FB 43CAB 1DQMH 3ZHDA 4XX1G 1LE9B 5J1AA 2LFGA 1OWRM 1J0KA 2LQRA 4L9DA 3UO1L 1EAJA 2UZIL 4P46A 4GFTB 4XWGL 2ICCA 2VQ1A 5EU6B 4UDTA 4BQ9A 4L4TD 4PJDE 3O0RL 4I9WD 4GXVH 4PJCF 5CD5D 3W2DL 1ACYH 2GUOA 4JREC 4WU7A 1HQ4A 1KLGA 3O2VL 2A6IB 2HVJB 3PWNA 5DVMA 4NQCA 5H2BA 4XCEA 5FK9B 3WIFB 4C54A 1ZLWK 5FYJH 4JG1H 4PJ7B 2OJEA 3NCYP 1FBIH 1Z2KA 4Z7VA 2CLRA 2YBRA 5DK0A 1RK0A 1R3JB 3L3JB 4IRZL 3GI9H 3PWPE 3RA7H 4X9FA 4U3CA 1JN6A 5JNYB 3CX2A 4UB0H 4WV1B 2NPLX 4G9FA 3P73A 5AEAA 3QUMB 3IVKA 4M03A 4LSUL 2XPGA 4PRIE 1S5HA 4LEOA 3ZKND 2I07B 5DUML 1ZA6B 3TWCH 1LO2L 1N0XH 3OJMB 5EUOE 1DEEB 1OF2B 2F8VA 4CMMB 2F9BT 4YHIA 2D03H 5K9KA 3MRMA 3ZZ1A 1PD6A 4L3CA 1JZ6A 4HUVA 4Z78B 1R3IL 1Q9KA 1P7QD 5CFHA 3A6BH 1T6VN 3G5YA 1DUYB 2FBJH 2I60H 2LVEA 2HTLC 4JFFE 3IKKA 4ODTH 1MFBH 3BJLA 2G5BB 2HMID 3CFKB 5FHBL 3VGFA 1ZHLB 5JW4R 4P5TB 4JY6B 4LIQE 4Z7UE 1DVFA 3H6JA 5MEPB 2EYSB 5ESQA 4HBCL 4BFIA 2VITA 5IHLB 2R9HC 1AFVH 2KQNA 3BFOA 2YN5A 5J6GA 3SGKC 3CDYA 4MQSB 3IF1B 4DVBB 2EDHA 4PLJD 1CLZL 2BNUB 3LKQB 1U0QA 4XT1C 2F54B 2X2YA 4NQDD 3QUZB 5IUSA 4P9HC 4I1NB 1H3VA 3BMWA 4JRXD 4F7MA 3WKNA 5CBEA 5HSFA 1ZTXH 1U93A 3GSWB 5IR1B 1SM3H 1UXWA 1MREL 1X5IA 4YZFF 4CNIB 4PJBB 5ANME 5KVEL 4PP2A 4ZD3H 3PQYB 3C09C 5IESL 2R23A 5F6IB 1YY8B 4TTDD 5I8EB 4Y1AE 3U46B 2C5DC 5GGRA 2CMRL 3MRQA 5FV2A 4Y4KC 4RGNE 2OK0L 3V4PL 4P23D 5HXMA 1GGCH 4NZRH 3KPRA 3BX7C 2KQMA 3P40A 3PXHA 4XAWH 4B53A 1CXLA 4GUPB 4HX1B 4FFZH 3BKMH 4GKSA 3O9WA 5FIEA 3WFEH 2Y25A 3RDTA 1LEGB 1J1PL 1MOEA 1YA5A 5DRZA 5I1LA 4Y5VB 1OAQH 3ILPB 4IRJB 5HYIA 2OJZL 1BX2B 3L3HA 4R4NC 1FV1B 4Q2ZA 5HYJE 1DSFL 5IVXF 2JLLA 2OCFD 3W39B 5HHNA 3LKOA 1TZIB 4P5KA 2O5YL 1BZ9B 4KRPC 2YD9A 3G9AB 3MV8D 1W0WA 1W0YT 3VFTB 1RJZB 3RWDB 1NLBH 1G6VK 2A74B 4NNXB 1GZPB 1S7WA 5EU5B 3MACL 1FVEB 4WTXA 4BFGA 2VDML 1O7VA 4KDWA 3IAPA 3ZMRA 5HHOB 5C0BE 1KCRH 3SCMD 4QT5B 2P47B 3KPSB 5FV1L 1MRCH 3B6SB 2VZOA 3LIZH 4JG0H 1AXTL 3RWGA 5E5MB 5T3ZH 2ESVD 3FFCB 1KTRL 2N4IA 1BVLB 4OUUA 3FQRA 4LGRB 3WO4C 3X13A 2JB5L 3QQ3A 4L8CA 2D7PA 1MFDL 3I9GL 4G3YH 1HIML 3BQUB 3IRZA 2ENSA 2Q3ZA 4FP8L 4APQD 3EYVB 3D87B 3ULUF 1TNNA 2YKLL 5F89A 5CGMA 5HI5C 3CSGA 1NMCB 1PJ9A 5DK2A 1HQRA 4P3WA 5C08E 3IDMA 3TO4C 1VA9A 3MRBA 3VDCA 3WUZA 4F7EB 1I8KB 1F3DH 3D0LB 3MRPA 4JQXA 4M1GL 5DA4A 3EOAA 2D7MA 4GKZA 5BRZA 2BY2A 5FKPB 3LD8B 4YHKL 5E8DH 1FCCA 2X89D 3KJ4C 5F21B 4Y2OA 2ADGB 2CK0H 3OB8A 4LBEB 4C83B 3C5SA 2NTFB 1IAIL 1P6FA 3MOBH 3LKRA 3PNWB 4L8BB 4NIKB 1L6ZA 4NQCD 1I8MB 2P43B 2P4AB 5CINH 2VLRA 4JO1L 1T1XA 2APWA 3C2AH 2WUBL 5ETUA 2HA1A 1EZVY 1UZ8B 1BJ8A 3S96B 1YEFH 4R0LA 2E9WA 3NA9H 5I75B 4QHLA 1HWHB 5EUKA 1S5IH 4U6YB 2YPLE 4WU5B 3LPGA 1P7KB 4WCYL 1U92B 1YYMH 4S2SB 3KPQA 4YHNA 1QYGH 4GQPH 1WFTA 2P44B 3HAEA 4K8RL 3RAJH 4O2EB 4XPBH 1U8PA 1A7QH 2PCPA 1VADA 1R5VA 3MR9A 1PKQB 4YHYC 3ARFC 2XKNA 4XVJH 4UV7L 1IZKA 2AP2A 1MJ8H 1YEGL 1HHHA 5GS3A 3ARBC 3QUKB 4KKBC 2V5YA 4KWUA 1MWAL 3MRIB 1I7ZA 3KLAA 4KK9D 1AGFB 5GGTH 5EZJA 4K9EC 4M43H 4ALAL 4NWTL 2P5EE 1KV3A 5IMKB 2PW2A 4BKLA 2G9HB 4GAYA 4Q7DA 2I24N 2A0LC 1A14L 1KIPA 4JY5L 3RNKA 5C0DB 3ME0A 5HVHC 2NXZB 3T1FA 4BUHA 1M7DB 1H3GA 3MODH 1YEIH 4J6RH 3IFOB 1D5BA 4XXCC 4YXHL 2VZVA 3DRQB 4B50A 5T1LA 3CFJA 4NQSB 3WN5A 2DQHL 4JM2D 1QTYT 4QTHB 4ZUSA 3BIKB 3BP4B 1Q94A 1PG7L 4KXZH 4RFNC 1KGCE 2DLIA 1IMHC 1MIEL 4DWHA 2DOCA 2NZ9D 1GOFA 1QQDA 5J6HA 1CK0L 5C07B 1UACH 3ULUH 1YMMA 1IAOA 2H32H 1C7TA 5GGUA 3DOSA 4MA3A 3DTXA 2Z4QA 1JV5A 2IQ9H 2VLJA 2W9EL 4YDJA 3NN8A 5D1ZA 4KFZC 3U0PA 3N06B 5IBUB 2P7TA 3L1OL 2VDNH 3OKEB 3VRJB 3FO1B 4GG8A 4QCIB 4Y4FA 2GTWA 4UU9A 4LHUA 5GIRB 4LDOB 5JQ6H 1U3HC 2B4CL 3GM8A 3OJDB 2XN9B 3P77A 1OARL 1BQHA 5E94A 4BELD 2HLAA 3DUSA 2BERA 4XAKD 1A64A 3TT3L 4P2OB 3UDWA 2L0DA 2OI9B 4OJFL 3ARWA 4LGPB 5K9JH 1MFAH 5EBLA 3LOWA 4TUOB 4PJXA 3AREB 1CG9B 5CEZH 2F53D 1BECA 2C1OB 1FH5L 4N9GA 1XCTA 5T3XD 1ZGLP 4POUB 3EOTH 4G6AD 4M7LH 4O58H 2FH6A 3TBYB 1FZOA 4NN5B 4NYLA 4FNLL 2MCPL 1G1YA 3ZL4L 1S7QA 2FGZA 4BSWA 1YPZA 2EC9T 4FZ8L 4RA3A 3HFMH 5C0CB 3ULVF 4NRXA 4PGBA 2VDOL 3EJZD 3PP4H 4LNRB 4Q9BA 2YRZA 3NIDF 3G5ZB 2AJXL 2X4UA 3NIFF 1JWMA 1L7IL 1UCBL 5TE6H 3CXHK 4U6HB 4ZTPL 1AGBA 1ZEAH 5IW6B 4HF5H 1DEDA 4LPCA 5C0EA 5HGGS 1JPGA 1EAPA 5JQHC 4K8RD 3BEVA 1QG3A 1TJHH 1WLHA 1EEUA 2BC4A 3MLTB 5DJ0A 3DV6B 1NGZB 4PLKC 3VXME 4E41E 1IKFL 1XF5B 4QHMB 2EH7L 3QCVL 4D8PA 4Z8FH 4PRHA 3SDCA 5IB4A 5I2IB 4X99A 3JV0A 1ZKAA 1T6WA 2QBWA 3RHWF 1GAFL 1JGUL 5SWQB 1E6JL 3VXOA 4L29B 5FYKD 2CQVA 1A4KA 4LKCA 3CMOL 2PYFB 4ELMB 2A9NL 1MFCH 5ILTL 5F7HA 1QBML 1SEBA 2OL3B 3I2CL 1U8HB 2VH5L 4OZFH 4V2CB 3IGAB 1ONQB 5T1DH 1BD2B 4JJ5A 2EO9A 3BN9D 1FJ1A 3D39D 5L2JB 2NYYD 3CXHJ 4KUCF 1U58B 4PTUA 1IC7L 2ZKHH 4JANA 4FABL 1NKRA 32C2B 3BGFB 3BISA 2DQUL 3QFJA 4QHUA 2VLRD 2XWTB 4XNMA 4FZEL 3X11B 3WLBA 4L3AA 2HVKB 3TBTA 4X8JA 4L3EB 4TN9A 2W60A 4DW2H 5CEXB 4WW2F 2CDEA 2JCCB 5ESVA 1S9XA 3MGTA 5ABDE 5C0JA 4WFGE 4QRRB 1MI5A 3VDAA 3MV9B 3O3AB 3ZE1E 4LHQB 1MH5A 1N64L 1Q0YH 2W07A 3QDGA 5B39B 5I6XB 5C0AB 3G6JF 2HT2D 3GNML 3QAZB 4ENED 2I5YH 1BWWA 1NCDL 3MCLL 4F58H 2XZQH 1V7ML 1HWGB 3FB6B 1JGLH 1YEHH 1T2QH 1BZ7B 1NC2B 2WSKA 5J89A 5H37H 1XIWC 2AAVA 4XWOD 1OP9A 1NJ9B 1T2XA 5BMFL 1UA6H 1T7ZA 5GRZA 2YXFA 5IW1A 3VD9A 5B4MD 4D9LL 3H9ZA 5DQ9A 2RHEA 1FG2B 3PL6B 1T1WB 4NNPL 1IKNA 4M00A 4G7VL 1A1MA 2P46B 5FUOL 1R3KB 2Y5TB 3OB0H 4NQEB 4F7TA 1UB5A 3JV6A 4HAGA 4RBPK 1CFNA 4K55A 2K7QA 3LDBC 4EEEA 4K3DH 1DQQA 1VPOH 1KG0B 1CICD 4L4TE 1AIFA 4I9WE 2HAZA 5GPRA 1G6RH 1M71A 1RZIA 1J5OH 1A5FH 3PWUA 2XQBL 5IROC 2EZ0D 4EOWH 1IILE 5T1LD 4XP9L 1HHGA 1FL5A 4F37K 4PLNC 3C6SA 5BJTA 1EA9C 4OCYL 1JYNA 1IEAB 3R06A 1T7WA 3W0WB 3KYNA 2DWDA 3QIBC 3NFSL 3VJ6A 3QCUH 3SE9L 3WL9A 2G75A 5JR1L 4MS8C 1EJ6A 4OCSL 4ZAKC 3DVGA 3VH8B 3SPVB 1NGPH 3D25A 4I4WA 4PJAA 3BH9A 4LGSB 4X5LA 1RU9L 4HLZG 3LEVL 5KS9A 3ARVA 3OXSB 5IBTH 3RY6A 1AKJD 1A6VH 3M8OL 2K7PA 4YPGB 3QZWA 1WFOA 5EB9A 1EMTH 3RVTC 2LAGB 1NGYA 4X7DC 1UKTA 3QNXA 2UVEA 4LL9A 5C70A 3GMPB 1A1OA 4MCYB 4LHUD 3QXDB 4H1LA 1FGNH 3UTQB 3FO0L 4XBEH 1C16B 4YX2L 1IM9B 5LKNA 2ZCKL 5C86A 3F62A 4TUJA 4ZPTB 3MRNA 1PSKL 3HKFA 4DKFL 1AHWB 5CD5C 2PYED 4WWKB 4XMPL 1L9NA 3DBXB 2VXSL 3SO3B 4CU8A 1S9YB 2VLKA 4ODSH 5ALCH 1UENA 2GJ6E 3V52L 1BGXH 1SJEB 4JRYA 4XXDA 5LGHH 5GHWL 4EDWH 5HDBE 1E4XL 4U0RC 7FABL 4JZOA 2A77L 5KW9H 4YAQA 2ICEB 5E7FA 4LSRL 4OV5B 2D7QA 1I7TB 3KPMA 4NQDE 4EDXB 4GO6B 2ITCB 4JRXE 4Y19D 2VRAA 1WCBB 3ZKNC 3VXRB 1KN2H 5I18H 5I1IH 1OSPH 4KTYA 4KU1A 3WFDH 5B3NA 1PY4A 3BD5A 4M7ZB 5J9PA 1V5JA 1Q9OA 4N0YH 4NRYA 3U2SA 2HKFH 3E6HA 1UWXK 1S78D 1VCAA 4EBQH 3QDMA 4POYA 1GGBH 2PXYA 3VWKA 4KMQA 4Q6IA 5HDLA 1IQDA 4OLXH 4LRIA 3R8QA 3IXTB 2HMIC 4XPTH 3BO8A 5EZIH 4NKMA 4A2LA 3D5OF 5IK3A 3D85A 5I1JL 1MNUL 1Z0MA 3JWOH 3RVXC 3VXSD 2Q20A 3DROA 3VRLF 5IGXH 1KLFA 2NY1B 3WIIH 4PJHB 4N0CD 1KIQB 2C3HA 1GSMA 4W4NA 1LP9F 3DVNA 4PJ8B 2IC2A 1JTTA 3BGMB 4MNGE 4PBXA 2DYPB 4IDJH 4PLJC 2DLFH 1IVLA 2C4FU 1X3DA 3UYOD 1T0PB 5DLML 3SOBH 3U7YL 1V8HA 1XR9A 5IBUG 1JGEB 3KAAA 3QFJD 3MV8E 2EKJA 3QHZH 4GRLD 4P3CH 3DX9B 5EZOH 4LCWB 2CGRH 4ZSOE 4ZMAT 3X3GL 2R56L 2HYMA 1TQCB 4QYOB 1KCVL 2XZCL 4ZTOH 3C5ZA 1KJ3H 1G7PA 2FYYA 3VFMA 2CIIA 4TTDC 5KTEL 2QSVA 1PYWA 2DM7A 5H94B 2ESVE 3T0EA 4Y8DC 3MJ7A 4QRPB 2UZXB 5I1AA 2IG2L 1ZANH 1ZHBA 3BVNB 1JWUB 3L9RB 5EOCJ 3ARGD 3JUZA 5J11C 4P0DA 4LLWB 2DI9A 2W9DH 3QRGH 4HZLB 3FRUB 3RWFA 2XTLA 1JRHI 4OCRH 1I9JH 1IBGL 5FYJU 4D94A 3JSSA 1AJ7H 4HFWA 1MHHA 3PE9A 1J8HB 4JCLA 2LU7A 1CDHA 2V9QA 4RRPG 1F90L 1C1EH 1NBYB 5HGBA 3R0NA 1H8OA 4GBXB 3MBEA 4U1NB 5LCVL 1T1ZB 4R6UA 2DQEH 2IQAA 4R26L 1X5ZA 1HEZB 4LDEB 1QKZL 3VRIA 2QLVB 2DI7A 2WBKA 4M02A 5I1CH 4G6FD 4NQCE 1LMKA 1HXYA 3MJ6A 5KANG 3SCMC 1KPVB 1SBBA 1YDPB 5IT2L 1NFDE 1BVKB 5IWLC 1E4WL 2OR9H 1KTLA 5JOFB 3EIFA 1AP2B 2ADFH 3UROR 1R6VA 2NNAA 4JFHD 1HE7A 4U1GB 2BVPA 4NWUL 3AB0B 3U7WH 4DVRL 2FO4A 4OGXH 1X7QB 5JLZB 5CMAA 2C26A 3T4AA 2XFXB 2IAMD 4QRUA 5DGRA 2DAVA 1J1XL 4PG9B 1ZV5A 1MCRA 3VI4E 4R9HA 4PV9B 1Z0NA 3GMMB 4WENB 4FQIL 4S1SL 3GSNB 3ALPA 1N59A 4MQXD 4F7CB 5HJ3A 3MV7B 1A3QA 3VFNB 2P48B 3UTOA 1OM3H 1QBLL 2VISB 4WHDA 2Y36L 1AGEB 5B39G 2VLKD 3QIUA 1D9KB 3CDGB 3MYZA 4XCFH 5JHDD 3GMOA 1RY7B 2DIJA 3HMXA 4MD0B 1FPTH 2W91A 3H0TA 2M2DA 4YBQD 5GSVB 3QUYD 4JFEB 1BP3B 4AZ8A 1LO4H 2QQLH 3MRJA 4O9HL 4PGCA 3QA3B 4P4KB 4UQ2A 2AJ3B 2ZNXA 4YXKL 1P84J 5L6YH 2JK5A 4ODWB 1I3VA 1YEDB 1N3NA 2X4SA 1V3KA 5IJVA 5F3BA 5E6ZA 4HJGB 1QEWA 4P59L 4ZXBB 4TULH 1QP1A 3JWDC 4PIRF 5TF0A 2ADIB 5TE7H 3D9AL 2CH8A 3ARZA 3V0AC 4YGVB 3IFPB 3OKMB 4XBPA 4HG4J 4RFEA 2JJVA 4KK9C 3VXTA 3QWOA 4CN1A 2FD6H 3DLQR 5ITBH 3AGVA 3MJ8A 1RVFH 4MVBC 3CVHH 4UDUA 1A3LH 3KPRE 3LHPL 2JJWA 3D85D 2C3WA 4H25A 5F8QC 2FHCA 1FAIL 3FRPA 1IC5H 1RURL 5FCSH 1J9CT 3CC5B 3V6OA 5C0FB 5JHLH 3T8XB 4ZODA 3DXAD 3I6GB 4YFLI 4K7PX 3KJ6H 3MRHA 3VH8G 4XAKE 4J2XA 4OLZL 1K4DB 3BPOC 3F7RA 4LAQH 2GY5A 2G60L 2F53E 5C0RL 2V2WB 3IETA 3UCRA 1BLNA 1FFPB 2XY2A 2LU4A 4JM2C 4ONFL 1RFDH 1H5BC 3C6LD 1DTUA 1E28B 4UOJA 2X42A 1E27B 5ALBH 1UB6A 2ZUWA 4CVWA 5GRUL 2ZG2A 2XRAL 2NZ9C 5HGAA 1R3HB 5D1XD 3TEUA 4JZNB 1EHNA 2XQYG 4IS6A 4S1DC 5DA0B 5JW5A 1MCNA 3O6FD 2YD3A 1NL0H 4TUKH 1IQWL 4CU6A 4QXTA 2OMBA 3VMPA 1A8JH 1BFOA 3UYPA 4UOW1 3T0ED 3IT8D 5DMKB 2AI0H 4R8WL 4OZIA 1FRGH 3D18B 3D3VA 5BO1H 1MCSA 1EUUA 3CZFA 1KCSL 2Y7QA 5D93B 1FSKC 4NO3B 2X9YA 4AIZA 5L2KD 1G7QA 3OL2A 4KTEL 4BSJA 5HGHB 4ETQA 4YGAB 4DZBB 3QHFL 3CVIH 1ODAA 4JM4L 4PUBH 5D2NC 4NDMB 5CIPH 3D6GA 4P2CG 5CEYB 1HSBA 5DJ6A 5FYKE 4G6AC 1KT2B 1N7ML 2MMXA 5FECA 1SY6A 5GZND 1IGFL 3O6LL 1F45A 4G5ZL 1A0QL 4KGJA 3LSOA 4M3JA 2X4PB 3KDMB 5TQ0L 5DTFB 2FX9H 4L4VA 3EJZC 4DOHE 3D39E 4JKMA 3PG2A