5M95B

Staphylococcus capitis divalent metal ion transporter (dmt) in complex with manganese
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASRSIFSIDTANWYRQPPGMQRELVATITRDGNANYADSVKGRFTISRDRARNTVYLQMNSLKPEDTGVYYCNAAIRTTVRTSAQEYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent metal cation transporter MntH
publication title Crystal Structure Of A Slc11 (Nramp) Transporter Reveals The Basis For Transition-Metal Ion Transport.
pubmed doi rcsb
source organism Staphylococcus capitis
molecule tags Transport protein
total genus 29
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5m95B00
4WFGD 4XP1H 4LPYA 2BOBB 4WW2C 3NFNB 1DUYB 4ONOA 4R4BB 2R0KH 3EW3B 4OB5L 3D0VA 5EUKB 5CSZA 3JTSB 5D2LE 5GGRA 1LWRA 4KK8D 3LEVL 3NIFF 4RMVA 5KJRH 1ZMYA 4BM7A 1JP5A 4TVPE 3HPJB 3TYGH 4LNRB 3I3EA 3DX7B 4ALAH 1DVFD 5IVNA 3DUSA 1M05A 4CU8A 4U49A 2BVQA 4PREA 5JA8B 1A21A 1QFWI 4JZJC 4MJIE 4ORGB 1JWSA 2Q76B 1QR1B 3QCTL 3RAJL 1MFNA 1TZIA 4GRLC 3U46B 5C07B 4L29A 4FQ1L 4H0GA 4PJBA 4XCFL 1LGVA 2NW3B 3DNKA 2C1OA 4QRSB 5HYJA 2XN9E 1TVBA 4R8WL 4HXBL 4L4VE 3OKMB 2FJHB 4K3GA 3S98A 3FT4B 1MJ8H 1K9TA 4TUKH 4U1GB 1HKLL 4NUJA 5CJ8A 3SDAB 2BP3A 4OI8A 3ZE2E 5FYJH 3WN5C 1IC5H 3BD3A 4EKXA 3DROA 3IU3A 1IC4H 2KL6A 5CEXB 3UTSD 4OF5A 1JCKA 2C3XA 1ZANL 5IROC 3WNKA 2DQEL 1SVZA 2NNAA 4WGWB 3T2QA 3NOIA 3GSNA 3V6ZA 3DMMA 1CBVL 5E5UB 5FCUL 4ODVL 1TQBB 4KJQC 3B9KA 3FO1B 1F42A 2ZSVB 1KJMA 3EYOB 3IDYB 5IBUG 3HB3D 5KG9B 3MRPB 3MRFA 5C0BB 4LCYA 1CGWA 1EHLH 4PG9B 3U4EA 4PRHB 2VAJA 1R5VA 3BKJH 2EC8A 1ZLUK 4EN3A 1F4WH 5J3HC 1Q9KA 3P30L 1ZLWH 3P4OB 3VXSE 3RY6A 2GY5A 4YXLH 5KJRL 2OJEB 4H26B 4WY7L 5I15H 4X6DE 4XH2A 4JN2A 2PXYD 3PL6C 3V4PL 4BSVA 1YUHA 3CLEL 1WICA 4LCUB 2VOTA 1YMMA 3AUVA 3DURA 3EOAB 4G9DA 2EZ0C 4IMKA 5L2JB 5E5MA 5D6DA 2C3WA 5ICXA 3KLDA 4PJHB 4R26H 1EO5A 1A22B 1BAFH 2COQA 2IANB 5D1ZA 3TN0C 2NZIA 4QRPB 4X99B 4K3DL 2X6MA 4Q9QH 4ZG1A 4J7RA 2G9HA 1FG2A 2ZUSA 4NJ9H 3LV3B 3FO2B 1LO3H 1MWAH 4APQC 3D18B 5T3XL 4OLZH 4IRSD 1ORSA 5JNYB 4U1NB 4QXTB 1UCTA 1P9MA 4OM0H 5GJTL 3RZCD 3JV4A 2R9HD 1FVCB 3DSFL 3L3OA 5JXED 2R1XA 3L1OL 1DBKL 2NY6C 4OGAC 3QIBA 2ITDB 2GHWB 2VDQH 4PRBA 2AEQH 4JZOA 4PJCB 1AJ7L 3IJYA 4JFPB 5D1QB 4RRPA 5F7UA 3MUHL 1A7RL 2GK2A 2V2XB 1E4XH 3QFJD 4O58H 4XPFH 1AY1H 1XF3A 2OI9B 2EDRA 1MFAL 4EDWH 3MTRA 3MRQB 1QQDB 2HFEB 3JUZA 4MAYD 4XCCH 3TEUA 5E70A 1B88A 5IT2H 5I1DA 2VIRA 4RFEB 1BGXL 4HHAB 4XPTL 4BFBD 5GZNC 4YPGA 4PJIA 4NWUH 1ND0A 1NGXA 4P5TA 5FDWB 1EZVX 1EEZB 4XCYA 5JQ6L 4G7YH 4L3CB 3VH8A 3TJEL 4LF3A 2Q7NA 5D7KD 3VGFA 1SJEB 1A64A 4L8DB 3B8YA 1XZ0B 1LEKB 3RY6C 3VGGA 1J12A 4TNVF 4NN7B 5F88B 2QV2A 2R15A 1KGCD 4JG1H 2DMBA 2YKLH 2BNQA 2I9LB 2PR4H 4PJXE 4KHXH 4P5MA 5H2BA 3HRPA 4YHZL 3KPLA 4JM2D 2CXGA 5IMOB 1SBBA 5EIQA 3SY0B 4QGTA 3L3IB 5CBAB 4IMKC 1YJDH 2VXTL 3GNMH 5HHQB 2KQNA 3CDGA 1F11B 2K1MA 4UDTA 3IDXH 1JGLH 1LO3L 3GMRA 1QSFB 2I24N 5IV2A 3U6RB 2V9TA 1HI6A 5DK0A 1S5IL 1RZKL 4FN0A 1FL3B 1R3HB 4X6CA 3TWCH 4N0YH 2J5LB 3QHFH 2Z31B 4BA8A 3HAEA 2VLRE 1QBMH 5JW5B 3C09C 1FRGH 1ZS8A 1FZMB 1KJVB 1U8HB 1URLA 2XTJC 2VDQL 4I1NB 3TLRA 1BFVH 2QSQA 2QJDA 1D9KA 3GSVB 4U1JA 3QEHA 1LP9A 3WKMH 3CFJB 1NCWH 2WLZA 5E0QA 4KZEL 4AIOA 5GRXG 3QQ9C 2H32H 1IAKA 4H0IA 4XPHH 3VE0B 3NIGF 1BD2D 3VDAA 1WZLA 5BRZB 2J4WL 2ATPA 3GEWB 1HINL 3LRSB 4GBXA 1Z9MA 4U1IB 1PKQE 1GGBL 5D7LD 3VWKC 2DQHH 5AEAA 4PLNC 3X14A 4HS6B 4Y19E 5F7FA 3SDXF 1G6RB 3O6FA 4S1QL 1G1YA 4G7YL 1IL1A 3QQNA 3QO0A 4L3EB 2IADA 5DD5H 4LCWA 1JVKA 5EU3B 3P0GB 1FL5B 4MA7H 5E8NB 1PSKH 1RZKC 5CZXC 3MV9D 2PR4L 3K8KA 5IR1B 3QIUD 4AIZA 5EZOL 1CDIA 2RFXA 3ZHKA 1H9VA 4HQQH 4P5TC 5FYKH 4QHLB 4W4OC 1AGBB 4N8VB 2VN4A 3VXOA 5I19H 1HYSD 2DIJA 3DV6A 4G6AD 5C0GB 1MUJB 4AL8L 2AKRA 2Q86A 3D87B 4OKDA 1PY4A 1MCFA 3EHBC 5E6ID 4J2XA 2JF1A 3HR5B 1S9XA 5T1LA 5D7JD 4NHUB 4FXGA 4HF5L 4PRPE 4OZ4A 1H8NA 1U92B 1DQDH 1JPTL 5LQBH 1XF2B 3S34H 1AO7A 3UDWA 1FRGL 3TCXA 4DAGL 5DHVH 4NNXB 3WBDA 1IGFH 1U8JB 3FN3A 4XNXH 5DZLA 2YBRA 5DEFA 3MO1B 3U7AA 5JOEA 3VA6A 4AK1A 2B1AH 2C4XA 5D2NA 1ULVA 5EG6C 2GCYA 1ADQH 1EUTA 3MV8A 2F74A 3G08B 1OD7A 5LCVL 1ED3A 4OM1L 5HGBA 4TVPD 3P3YA 3RJDA 4TSBH 2X1QA 4P2QA 1NCAL 1VEPA 3L7FA 5DQ9B 3S4SB 3RDTA 3B9AA 1LE5B 1AGCB 3UJTH 2NY0C 2DQHL 2YN5A 2IH1A 5CZVH 3QA3A 3M1BB 3MNVB 4MJID 3W39A 5JOFA 3MLYH 4HWEH 1L0YA 3REVB 2Q8BL 5FKAB 1CDYA 1G7PA 5DD5L 3RRQA 1AKJA 2GTZB 3CH1A 4Y2OA 4MA7L 5E03A 4WEBL 2A0LD 4GBXC 2XN9D 5I2IA 3KXFA 4N1HB 4JHWL 4KXZH 3ZKXC 4L4VD 4HT1L 4XNZC 5FYKL 5ENWA 3WDJA 1JTPA 5I19L 5JW3L 3QJFB 4Y4KA 4Y1AE 1FFOB 3GBMH 1GGCH 2NY3B 3C6SB 1YEKH 2HKHL 1F2QA 1LILA 1JHKL 2ITCB 3OXSA 1GSMA 1G0DA 3VFSA 3WJJA 3EJZD 3P4MA 3MRRB 2BVOA 2ORBH 5LGJA 2YSSA 4RAUB 1F02I 5B38A 1ZXQA 4HUUA 4M8VA 4S11A 5DI8A 4OKVB 4N0RA 2G60H 5HI4D 1WITA 5IOPB 3BSZH 4P49A 2ICCA 5HHOB 1FYTE 3Q48A 2ADGA 1BVLA 4B5EA 2P8MB 1R5IB 4MQTB 4NOFA 2OQJA 3MJ7A 5DJXA 1U8MA 3AGVA 4O2EA 1JN6A 2Z8WC 4WIQA 2H9GB 2X4QB 3KG5A 2Z8RA 1OAZH 3UDWC 4F15C 4FTVB 1I1AD 4WW1A 4PJHF 5F9AC 3MRGA 2NYYD 5JIPA 1UVQB 2X4PA 3UTTD 5HHMB 1IEBA 1XR8A 4EDXA 1XR9B 2FYYA 4XGZB 4MDIB 3WSQL 4PGCA 4JFZH 2PYFB 1EEYB 2VDOH 1I8LC 2WUBH 3MRMA 4WO4A 4U4BA 4UNVA 1Z9SA 3RDTC 4HUWB 4YHLH 1K5NB 4PY7B 4OLYL 4AG4H 4JANB 4JFHD 4O51A 4UTBH 3SHSA 2FB4L 5FF6A 4IRJD 4HPYL 1LEGB 4HH8A 3C60D 2KPNA 5FHBH 4YQXL 1U91B 3RGHA 5HGAB 5CEYA 2NY2B 3VXQB 1A14L 2Y7QB 4HWZB 3DECA 1VGEH 5C0JB 2APTA 5SX5K 4ODSL 1NL0L 5T3ZH 4RWYL 5C7XH 2NY4C 2NZ9C 2ORBL 3GRWA 1HCFX 3D2UA 1C08A 3MA9L 1S7VB 3T4YA 5I8OL 2R0LL 1MJJA 2BY2A 3BSZL 4Y4KC 5BS0B 1GVIA 1U8PB 2WM0A 2IPKB 3LKQB 1N2RA 1UXWA 1DANU 3SO5A 3VG0H 3TO2B 2J88H 2DYPB 2GQHA 35C8L 1HKFA 2XZCH 3MRCB 1VFUA 5CFHA 5C2UB 1T1ZB 3UAJD 4ETQB 1OAZL 1XCTB 5E4EB 2V9RA 1V7NH 1RIUH 3CSYB 4ZMAT 1MQKH 1XIWA 1ZGLM 1G1CA 3V6OA 3O6ML 2CQVA 3IAGC 4G6FD 1W72B 3QIWB 4ISVB 1NUFA 4H1LG 3BGMA 1W0WA 3FOMA 1I1FA 2BC4A 4Y8DC 2EEDA 2VDOL 3O2DH 4IM8A 2DAVA 1KT2A 5IESL 4OF6A 4YGAB 4F2MB 4YHOL 1FORH 2K9UA 4UAOC 4D9LL 1QBAA 6CGTA 3PWJB 4G3YH 2DJSA 1X9QA 3BMVA 2LVCA 1T7YA 2DBLH 5FHBL 4A6YH 3WV0A 5C71A 5AUMB 3WNLA 1CLOL 5FA3A 3O11B 3N9GH 1FFQA 2DLIA 1AFVL 1B2WH 4N9OB 4P23D 2X4TB 4FQXD 5CP7A 1RJYA 2HKFL 4X0KB 4YHPB 4FHBD 3B6SB 4TTGA 1NC4D 1QRKA 5HHXH 2AXGA 2VLKA 4HKXA 3F7YB 4AMKL 4XVUC 4EBQL 3OMZA 5L7XH 1V3JA 4JN1H 3VXMB 4P5KA 4ODWB 3MRJB 4GAYA 4LGSB 4YWGL 5D93C 1ZLWK 5F72S 1WCQA 1YNKL 4EUPH 4RAVB 2V7HA 3DRTB 4HXAL 4IOIA 3GMNB 4ZUSB 3OHXA 4NFBA 3VU2A 5H35B 4NPYA 3SO3C 2AK4E 2A73A 4KUCD 5I16A 4V2CB 5I30L 1NFIA 4U0QB 4GUPB 1C7SA 3IFOB 4HGWA 5F3HB 4M61B 2ICEB 4S1RH 2P48B 5E8PA 3SE9H 3WUWB 1IGML 2DWDA 4U1HB 4XAWH 3VFWB 4YJZL 2VC2H 1C5BH 1WBYA 4Y16B 1JGVL 4KK6D 1HXMB 2YXFA 4MMZC 2FR4A 3UPRA 1PDKA 1U95B 3EYUH 1TZHB 1AXTL 4LVEA 4NRZB 3U1SL 3V5KB 5EO1B 3LIZH 1CR9H 4JRYA 3TO4B 4K71C 4MNGB 3IFPB 1SEBA 5E94A 1K4CB 3OJDB 3V9FA 3L95B 4LQ1A 3DIFB 3V6OC 3S97C 2HVKB 1QSVA 3FQWB 2EYRA 3QDGD 4J3UA 1F4YL 43C9B 3W0WA 3GBNH 3RKDC 4PFEA 4P4RA 2EDXA 1OVZA 2WBJB 2C3VA 3MREA 4Z78B 4MQXD 2HYMA 1QR4A 1ZEAL 2DLEA 2X05A 5ISZA 5HYJE 5HHXL 4JJ5A 1CL7H 4PGDB 5GRJH 3BEVB 1OSPH 4MAUH 1XH3A 3OKOB 3VMNA 3HI1A 3H2WA 5F3BB 3ZL4L 2FHBA 5C0CA 4P57A 2GSGA 3PWLB 4WVRA 3WNMA 4JG0H 4FXLA 7CGTA 5AG9A 4U1SB 4Y5YB 4DKAA 2XWJB 5FGCE 4I18A 5GS2H 3NH7H 5D5MF 3WL9A 1HXYB 3H9SB 1M6OA 1WC7A 3UX9B 1OT2A 2MKWA 1DQJB 3BIKA 3VXUE 4Z7WF 5DR5H 3STZA 2GJ6A 3N85L 4DW2L 3R4DA 3PWNA 3FRUB 2OSLB 3WIHA 1TVDA 4MZ2A 1CGVA 3ARQA 4C4KT 1U3HB 1QHPA 1D7FA 4GT7A 5IHLB 1PG7W 3EYUL 3VFGL 4X7CC 4ELMF 1G9NL 3VXNB 4HS8H 3CFDA 5C0ND 2EEAA 3VI4E 4MJ5B 5D7IF 3MLZL 1HOCA 4EJ1C 4WI5A 4PB0L 3SDYH 5B3JF 2VO5A 3JBG7 3WFCH 4FQLL 3GI8L 5EZLB 1I8KB 3F6LA 3QH3B 3LEXB 4QY8B 4M1GL 4R97B 1YPZA 3EYVB 4R4FL 1MVFA 5F1IA 3NCCB 4OGYL 3D85B 1ZVYA 3AXLA 5DVMA 4BFGA 1DL7H 2YUWA 2IGFH 3QUZD 2Y06L 5E7BA 5L8LB 2V6HA 3X3FL 3WIHL 4QOKB 4F80A 4K07A 5E9DD 2PTTA 1K8IA 5EOCJ 5H94A 4D0BB 4XCNA 4URTB 4YK4C 3VMPA 5GS0D 3FHQA 3QP3A 1CXIA 4R4NC 4HLJA 4MSWA 5HXMA 5KVFL 1XMWA 4Q0XH 1NEZG 2I26N 1FNEB 1G9ML 3QUXD 1NLDL 4BSWA 4OD3H 1MEXL 4B53A 3LSOA 4M4RA 4LGRB 3L7EA 1DN2A 5AZEH 3H9ZA 1G9NC 5FK9B 3ZE1F 3TESA 4ENED 5ERWB 4FQQB 5C9JB 1CICC 2WQ8A 2H26A 3UO1H 1A7QH 3IDJA 4Z7UB 1EFQA 1T21A 4OZFG 1RUMH 1EXUB 2QLVB 3RWIB 3VJ6B 2EXYC 3IDMB 4EI6A 4J3WA 4F3FB 4GKSA 3PJSA 3T3PE 3RI5K 5BZWB 3V0WH 4X7EC 2Z4QA 3MFFA 4HV8A 4PY8I 4RX4A 2FGZA 5IHUH 3U4BL 5BQ7A 4NJAH 3TVMA 4I3RH 4PJIE 3ARBD 1FZJA 1Z5LA 4LSRL 3R06A 2CJUH 1LO0H 3ZYJA 3SDYL 1YNTB 1CLYL 4F7TB 2PN5A 2IPUK 3WFCL 1N4XH 1U8KA 4LKCA 3MBEB 4QGYA 2A9NH 4DQOH 1JZ6A 4Q6IC 1VB9A 3ULUF 5DD6B 3ALWA 3RA7H 1T1XA 1G9MC 3K4DA 2A6KB 4DZBA 1CXEA 5C0FA 4LNVA 4CVXB 2O61B 5JA9A 1KCUL 2D4FA 1QLFA 2C7UB 1GIGH 1AHWB 1T83A 5K93A 3H3BC 1X4YA 5L88L 1FE8H 3ARDB 1CT8A 1HQRA 5KSAD 5EN2B 4X6CE 5IG7B 5A43C 4X9GA 3V6FA 3CFCL 5DEGB 3L5XH 1MLCA 2XTLA 5E8OA 4DK6A 1VPOL 3KHOA 1QO3B 4MNQB 2OXHA 4WTXA 3QO1A 4I4WA 5F7WC 3DYMA 2YA1A 4QCIA 4M1CD 2VLJB 5GGTA 5JPMA 2DQCL 4WNQA 3U4AA 1HCVA 1RJCA 1QSZA 3TT3L 2EYTB 1PZ5B 1FLTX 4XPGH 5DJ2B 1BBJA 3SDAD 3WXWL 3BMWA 3LN5A 4D9QD 2ICWI 5FV1L 1SY6L 1WBXB 5T1DL 3CXHJ 1CQKA 4M02A 1BFTA 3ZDXF 3H3KA 2P7TA 3T2NH 3QFDB 3WS3B 4D9RD 4UTAH 3F8UB 3P9MB 5KS9F 1CDBA 1QG3A 3QUML 1CDHA 1KPUB 2CJUL 5EO0A 5TF1H 5IMLB 3QRFM 1I3GH 4QTHB 4YXKL 5DTFB 1UM6H 3UPAA 4LLUA 3HI6L 4XB8A 4LCWE 1HDMB 3H42L 1D5IL 4G8IA 3NCMA 2FZ3A 5CP3A 5C09A 3ZLQC 3T09A 1A7NL 2Y9RT 2B5IB 2PCPA 3L5IA 4CVWA 5CUSH 4LP5A 4J8RB 5GGTL 4R7NA 5AD0A 5F9JA 1PLGH 3LRHA 4MCYB 3J8F7 3BZEA 1PYWB 2ZOKA 1JNHA 4LLYB 3RNQA 2VWEC 1BVKB 4F33B 5DD0H 3CVIH 1MAMH 1LO5A 2SEBB 5DSCA 1MHCA 4K2UH 4ZAKA 3ARGD 3S37H 3LKRB 4OF7A 3S3JA 3GHBH 2AK4D 3L5XL 3L3HB 4KRPD 2WK2A 2NXYB 1LVEA 3LOWA 3NIDF 3PP4L 1OCWL 3QG6B 3MLUL 1NLBL 2W0KA 1AO7E 4NDMB 1J05B 1CE6A 1HQ4A 2HLFD 2IAMB 5F71A 5F9DC 4OZGE 1IAIH 4UV4H 2OCFD 1MCHA 6FABH 3FMGL 5D2NE 5DRXA 5F9WC 4NSKA 3FO0L 4X7SL 3MV8E 2VUYA 1Q9OA 1OAYH 4JCMA 3MXWL 3OJMB 4PRPB 5TH2A 5E8EB 2X4RB 3FB8A 3IGAA 4GLRH 3Q3GA 1T22A 1FCCA 4GAFB 4ZDHA 4EZMA 2P5WE 4TPRL 1M7DB 1OAKL 3P2TA 1QFUL 4WJ5B 5EU4A 5DJZB 1YY9C 3RIFK 5FFLA 4C56E 4LSUL 3EDDA 2VE6A 3QDME 5FOJA 1RHFA 2HH0L 4UQ3B 3IDUA 4LSDA 1U8NB 3DJ9A 5HD8C 4PTUB 1UB5B 1A9EB 2PNDA 1C12A 3MV11 3NCJL 3RTQD 3Q6FA 1NJ9B 3F65A 1S5HA 4AIXA 1C5DB 4ZSOA 3F7VB 1PD6A 1SM3H 2YUVA 2CKBA 4LHQB 4OIAA 5EFIB 4CMMA 4B50A 1VFAA 4YX2H 4G9FE 4JO2H 5ECJE 2ICWA 1JF1A 2P5EE 2FIKB 5E1AA 1L6XA 3ZE2F 4FMKA 1FHGA 4S0SD 3P9LB 4BQ6A 1KB5H 3UTZB 5INCB 5F7YC 4RDQG 3REWA 4JFYA 5DYOA 1WJ3A 1FO0L 1B3JA 4RZCA 4RSVA 1J1XL 3VXUD 3DARA 5DZOA 2W07A 1PX4A 4JQVA 2YD3A 3D39A 2AEIT 5F96H 2ESVA 3IJSB 3MCG1 1YY8B 4MWFB 4UV4L 3LKSB 1TETL 2VR4A 3DGGA 4TSAH 5IMMA 1YNLL 2DI7A 2Z93A 4Y5XC 2ZSWB 2WWKO 1G7HB 2AJYL 3ISWA 4WWKC 3QNYB 3ZYZA 4K8RL 4WUKL 3GMMA 1TTFA 2BJML 1OP5H 4Y4HB 1U6AH 1BLNA 1C1EH 3GKWH 5FXCH 1JL8A 3RUGE 2Z31D 2DQUH 4X6DF 1CGYA 3BP7B 4G8GA 4NQSB 4PLOB 3DVNB 2N7BA 5I66B 2VAAB 4UV7H 2OS7A 3U0WH 5ID1B 4RAHA 4H5SA 1YYLL 4OGZA 1PW3A 5I17B 3NAAH 3C5ZA 3KPMB 4GRMB 1ZSDA 3ZKMD 3QXAA 1TXKA 3W9DB 4NBZB 1R3JA 1WAAE 5BRZD 2GFBB 2CK2A 2XFXB 3UTQA 3BPCA 3NZHH 5GRUH 4L9LA 4PJAA 4DGYL 4EI5D 3PHSA 1DCLA 1S7WA 1NKOA 2OXGA 5EOQL 1YYML 4K8RC 4L3ED 3FT3B 4PJ9A 4ZUVB 4TRPH 4OFYA 3EO0B 3DXAB 1I1YA 1OT1A 5F7KC 2FO1A 2A1WL 1ZA3B 3PWVA 3BPOC 3QCUL 4GMTL 2O5YH 5K33A 2OTUB 2NCMA 3HE6A 3MYJA 4N8VG 2OBGA 2FWOA 3PGFL 5J6GB 4LOUD 4ONGH 3ARWA 4NFCA 2D0HA 1AD9A 2E7HA 1A4KA 1SMOA 4FQ2H 4LGPB 4NQUA 3T0XA 1HHHB 4YLQT 1SYVA 2DQUL 3AY4A 2CDFB 3G6AB 4WW2B 4W70A 3FRPA 3VFRA 4IOFC 4Z7VB 4MXWH 2F58H 1OTSC 4I2XA 3LN9A 3ETBF 5T1MA 3RWJA 5GRZA 4LVHC 4JO4L 3EUUA 1GC1L 4FFZL 3S4SG 5F6HJ 3OZ9H 3NVQA 1C16A 2ATKB 3NZHL 1NQBA 4NQTA 4J4PA 4LHUA 4JZJB 1EH9A 3BKCH 3IFLL 4F7CA 2EICA 4GRLB 2XICA 5HVFB 1MFEL 4M93C 2XZQL 3HZMB 1MCOL 1Q0YH 4H8WL 4NO0D 4OIIL 5HPOA 4ZQKA 3DTXB 4LRNH 4YHKH 3KPNA 3P4LA 5DMKB 4YFLI 4ZTOL 3WN5B 4X4ZA 2GITA 4KTDL 5GSRB 5LGKA 2Z91B 2HP4A 3FFDB 4PJ9C 4UB0H 5JR1L 4FNLL 2NY3D 2XZZA 3TV3H 1GGYA 2CK0H 3OGCB 3ILPB 1GC1C 3HE6C 4RFOL 5FGBA 2JIXB 2ADFH 3MNWA 1JZ3A 5B22A 4MA8H 3ARFA 3K81A 1M71B 2E3VA 5HHOD 1VCAA 3HC3L 1KIRB 3T0VA 2GI7A 4BQ9A 1WF5A 4WV1A 4CNIA 2DWEA 2ID5A 4FQJH 4P99A 3AY4C 4H8WC 3PL6B 2I9TA 2YRZA 3QZWA 4W68A 2J2ZA 5BVPL 2BSTA 3NCBB 5HHMD 3ILQD 5CSZB 3U9UB 4QEGA 4YHYC 1D5MA 3GHEH 2DQTL 2XKUA 5GGRB 3BOVA 4W6XB 5EZIH 4FFWD 4Q58C 4S2SA 3MLVH 3C2AH 2QADC 5ISZE 4QXGH 1Q0YL 3GSXB 5BZDA 1CU4H 3DUSB 4OCMC 3S36L 1J8HA 2BVQB 3DETD 4PREB 3RVWC 3C2SA 4J4PC 1RHHA 3ULVF 1X5HA 5C0CE 5HHPA 4ZOAA 1AQKH 4LASH 1JWSB 1NGPL 1A3RL 2Z9TA 1G7MA 3E6FA 4H1LH 4LLQA 4APQB 5KVEH 3KR3H 1TZIB 2KZWA 4UB0L 4JKLA 5DXWA 4PJBB 5IFAH 3PNWA 2ZKHH 4NRYB 3S88L 2NY2D 3LD8C 3UBXI 1E6OL 1TVBB 3VXPB 2NY6B 5IFJA 2YHGA 1CXHA 3ZSSA 5IMKB 4C56D 2ADFL 4NUJB 4U05A 4M3JA 3QDMD 3VRLE 4DJMA 3VWJA 4JQIH 1OM3L 4DFHA 1KJ3H 1S7QB 5BS0D 1FNAA 1VHPA 1MOEA 4Y4FA 3TZVA 5IB2A 3JVGA 5KSBB 4U3XA 2OMBA 3CJJA 2Q7YA 2WINA 3AS3A 4PPTA 2DYPD 4O4YL 2QQKH 3GIVA 3KPOA 5FGBC 4JY6A 4FQJL 3KYKH 4G9FD 5DF0A 2AJSH 3MRFB 4NZTL 1J5OH 1JGEA 1YN7A 2P5ED 3U7WL 3DGCR 3MLSL 4EN3B 3WEXA 3FQRB 1Q9KB 4HCRA 2IQ9H 3QIWD 5DA0B 1P6AB 5FIEA 4XH2B 4WGVB 1OOAA 3C2AL 4PJGA 4BSVB 1YUHB 2K7QA 1YMMB 2CO7B 3DURB 2FLRT 5DLML 1W0VA 2RHEA 4CVZB 3EBAA 1DLHA 5F7NC 1AQKL 2NTSP 4OJFH 5EOCL 1ZA6A 5KVEL 5ICXB 3T3ME 4MXVE 1BOGA 1P2CA 2AQ1A 5JO5A 5JW4M 5IB4B 5DS8B 3U7YL 3T2PA 4PP1C 3MV7A 1FGVH 1FDLL 5K9QG 1QYGH 3PV7A 4WDIA 1F3DH 5TPWL 3F7QA 4OCSL 2DKSA 3C09B 3MJ9H 4MVBC 4X6BA 1KLGA 2G9HB 1FG2B 3DYOA 3SGEI 2FL5A 1UH3A 2KBGA 4HCRL 5EU6A 3GJEA 3S35H 3BIBX 3AU1A 4F9PA 4WCYL 2P8PB 2R1XB 4U3HA 3HLAA 3V0VA 2HVJA 4AEIH 1N59A 3FZUD 3NACH 3L3GB 2D7OA 2AABL 1PVHA 4JZOB 2AV7A 4JFEE 3RVUD 2WAHA 2DMKA 1S8DA 1NMBL 1J5OL 1JGDB 3G04A 25C8H 2QKIA 3IU4H 1VFOA 2G75B 5ALCL 3TZVC 4M6NH 4Y16D 3FB5A 4YPGB 2Y5TA 3W11D 1ND0B 3MMEA 1MCQA 1TQCC 5DO2C 4P5TB 3TO4D 4CL7A 3K2MC 1A3LH 3LQZB 1N26A 1LDPH 4XCYB 4JFOA 3GBLA 4LF3B 3RWFA 5HGDA 4RWHA 1U3ZA 4OJFL 4NZUL 3OB0H 3TYFA 1RIHH 4KGJA 2BNQB 5H2BB 4P5MB 5HBBA 4WEUD 1X4ZA 4JPWH 4KUZH 4Z7VF 3PQYA 4E41A 3BD4A 1WWAX 3QUYD 3BGFC 1JPGA 5EPMA 1CZ8L 4HULB 1HHKA 4I3SL 3CDGB 5IFHH 4UDTB 4K3EH 1EMTH 4BZ2L 2EDYA 3GMRB 4DCQA 1P4LA 5CEZL 5IV2B 1KV3A 1HI6B 4LRIC 4X6CB 4QO1A 1UM4H 2RR3A 2XYCA 5DHVA 4G6JH 2D9CA 5HHVH 1F3RB 3RWGA 4XMPH 5IB5A 2HTKD 3LMJH 2ZUVA 5E99L 1FLRL 1GXEA 3NACL 1ZS8B 1ADQA 3VFMB 3EYSL 1FG9C 3Q5YA 3KPSA 4U1JB 3QEHB 1LP9B 5C0AB 3H9SD 5FYLE 1AI1H 4KQ4H 3B43A 3IU4L 2P49B 1IAKB 2MMXA 3K8MA 2IQAB 3MACH 4F9PC 1JPSH 4S1DD 43CAB 2NQCA 4MD4A 3MRHA 4K3HA 4M6NL 2ATPB 4XZUA 4M7LH 4GBXB 1U3HD 4BFEA 1ZHBB 3ZKXB 3CFEA 3U36A 1QSEA 1QLRB 1YEDB 4XNZB 3X14B 2B20A 4GS7B 5DRZA 3O6FB 4OT1H 1LDPL 5IHBA 4OZFH 4ONHB 1FNSH 2IADB 2HJKA 1OP5K 2VTFA 1IAOA 3IJHB 1H8SA 1RIHL 2JJUA 4WUUA 4PJDA 1KTLA 1MAKA 2FGWH 3ZKSD 2CSPA 1I85C 2I60L 1XGPB 1VFMA 4UT9L 3I84A 4HC1H 4JPWL 32C2A 2X4UA 1G7LA 2X1XR 3LHPH 1Z0MA 2V2TA 3D85D 2OJZL 1IVLA 3CVHH 3DV6B 3BN9D 4JY4A 1T20A 3T0EA 4X80H 5EIIB 2V17H 4CDHA 2AEWA 5JIKA 4KPHH 1T0NA 1BQLL 3L9RA 1S9XB 5T1LB 1CDCA 1UM4L 4FXGB 2JJTA 1JYNA 4OTXH 5JLZA 2YPKA 4OZ4B 3LMJL 2Y5EA 2QSTA 4XI5D 3KPPA 3KYAA 2YA2A 1RFDL 2AV1A 4F15B 2YWYA 4E9LA 2YBRB 3VFTB 5CMAA 3HNTH 1P7HL 3CSGA 2DN7A 1AI1L 2IF7A 1P84K 4NKMA 2GCYB 3V5DA 4DN4H 3MV8B 2F74B 1N0XH 1JPSL 3IS1X 1ED3B 3LDBC 4HD9A 1S78D 1UACL 2IALA 3QULA 4P2QB 4NQCA 5T1KB 3RDTB 2A6IA 1RJLA 2KDGA 1PX3A 2EIDA 1X5IA 3C6LA 4PJBF 4ZSOE 2IH1B 3LH2H 5K9KA 5LGHH 5FOBA 1BQHA 3CFKA 3V4VH 4YDJA 3BPLC 2CUIA 3E8UL 3W39B 5JOFB 4G42A 1BHGA 1E4WH 4NGHH 1PJ9A 3OSKA 1G7PB 2J6EH 1KENL 1OLZA 3OWEA 4GKZA 4L3AA 5ESAB 4P3CL 5F7EH 3MBED 2XOTA 5I2IB 3KXFB 5DJCA 3BQUA 1F8TL 4XNQA 4KH2A 4OAWA 4MA1C 1N7MH 3LHPL 5ENWB 5F44A 2J8UA 4FG6C 3WIFA 5EO9A 5A2KH 1HILB 2GSIA 1UCBL 3D39E 3IXTA 2ESVE 3HNSH 4Y4KB 2Q87A 4KPHL 1UB6A 4HIHA 4J12A 3EOTH 3HC0A 5ADOH 3QPXL 4N0CC 4OTXL 3OXSB 3VFSB 3BRFA 3P4MB 4OQTH 4HJ0D 3KJ6L 4S1SL 2NY5L 1B4JH 4OV5A 3V7AE 3K3QA 4HUUB 1MCKA 5JDSB 2DRUA 1UJTA 5DD3L 3T0EC 1IM9A 4X4XA 3MRLB 4MNQD 4U2ZA 3ZO0A 4G8GE 2WP3T 4LSSH 5TGBB 5CGMA 4YBQD 2ADGB 1BVLB 2R2EB 2JB5H 4M7JH 4DN4L 1XEDA 3VG9B 3MJ7B 5DJXB 5HYSA 2PKDA 4OCXH 1SEQL 1JN6B 5FUOL 1KB9J 1VERA 3D3VB 4YDLC 1EJOL 1CL7I 4WW1B 2ARJQ 3MRGB 4NO5B 5K9JL 3VI3E 1IEBB 1XR8B 3LH2L 3TJHC 3ULSA 4UAOB 5HDBF 5C8JB 2FYYB 4LLWA 3W82A 2K7PA 1XGYH 4BQ8A 4TTDC 4PGCB 1HHGA 1FN4A 2R1YA 1JYVA 2ZG1A 2R2HA 3MRMB 2C3GA 4WO4B 3STLA 3IDGB 5FM5M 1WZ1L 5JHLH 5J12C 1MVUA 4O51B 4V1DD 2NY5C 1DN0A 3PHOA 4A6YA 5FF6B 2EDJA 2XZAH 5C3TA 2B1HH 4PJ5A 3O4LA 3LKOA 1ZHLA 4HS3A 2OR9H 5D93B 4GH7B 5CEYB 3BDYH 1B0GA 2W60A 1JWUA 3BQUC 3INUH 4OZIA 2YPLA 3MOBH 2YRLA 3D2UB 1DQLL 3T3PF 2XA8L 5E95B 3S7GA 5MEPA 4ZO8A 4UOJA 3T4YB 4EUPA 4KAQL 4X8JB 2Y25A 1NBYA 2HFGH 5GGSA 5IVZB 1HN1A 4PJIF 1YEJH 1N2RB 1L7TL 2JB5L 4M5ZH 4Z95H 4M7JL 2IAMD 3MYZA 4KDVA 4N0UE 3S3PA 5CLTA 3TCLA 4XBEH 5C0IB 3BI9X 3GB7A 3QEQE 4I2XE 4XNUH 3QCVL 4X6FA 3RNKA 1IQWL 1ZT1B 1WZMA 4K71B 4XNMA 5JZ7C 4JFFA 4KROC 5EA0H 1V8HA 3K0WA 1P7QD 1XIWB 2W0PA 3L5WA 5IVXB 1TQBC 1NGYB 2AJXL 3BGMB 3PXJA 5IBTH 1W0WB 3SBWA 1CFBA 1I1FB 2BC4B 1JNLH 3DLQR 5B4MC 3ARZA 1HSBA 4H0HB 4Q9RH 2D7QA 1WFUA 2Q20A 3L3JB 2QQNL 5JHLL 4HWUA 4L4TB 4P46C 4M43H 1PGRB 4X6CF 1GZQB 1H3VA 4W4NA 1V3LA 1CGUA 4KKCC 2E9JA 4M00A 4ZS6D 3TIDA 1UKSA 5KN5A 4XB7A 4QRQB 2NX5A 3GK8H 3BVNA 4XPBL 3U2SB 2F54A 3FB6B 5DT1L 5FA3B 3SQOL 1LP9F 4GG8B 3IETB 2P24B 4P3DA 3WLWC 4MA3A 2RGSA 1FPTL 3BZDA 5CP7B 1RJYB 3P0VH 5ANMA 3HRZA 5FYJE 2CMRH 2VLKB 3RPKA 5EDXA 5CJ5A 1A6VL 3SE4C 4K23L 3OKNA 2AEPH 3ARED 4C4KO 1J0HA 4GAYB 2VDKL 2GAZB 3QXDA 3RVVD 1MHPH 4YR6A 2R0ZL 1G6RH 2V7HB 4IOIB 1MIMH 4GMSH 4LCIL 3OHXB 3TT1H 4NNPL 5DVKA 1OP3K 5JHDA 3TNMA 2A73B 5I16B 1NFIB 3RGVA 2M2DA 3VD3A 4U6VH 4RGOL 1EHAA 4Y4HD 4HGWB 2FO4A 4TSCH 5E8PB 1Y0LB 2DWDB 5D1QC 4ZOCA 1KCRL 5IBTL 3T8XA 4ZXBD 5BV7L 2XTJE 2FR4B 4UQ2A 4KV5E 3KDMA 4K9EL 4ZUWA 1OPGH 3G5VA 4LQFH 4JRYB 2FEDD 5GZOD 2CR3A 4PRIA 1BJ1H 4UBDC 2G5BA 4XMLL 4L8SC 5HY9A 1B0WA 1J8HE 3SBWC 5JUEH 5ILTH 3EFFA 4MNHA 1KEML 4YK4B 3W0WB 4RGNC 3TH4T 4OZGF 2XIDA 4P4RB 5IJKA 4UIMA 2C3VB 2OZ4L 3KYOA 3MREB 4OGXH 3RVXC 5FO7A 4AQOA 4Z77A 4HG4J 3P0VL 4Q2ZB 2VDRL 3CXDH 2I07A 1AR1C 5CCKH 4KKLC 2EH7H 3B3IA 1CD1A 2MSPA 4FRWA 4TYUA 5J1SC 2AEPL 3DXAD 1XH3B 5EUOA 1EV2E 1N8ZA 4XCEB 1CE1H 4LCCA 4P57B 2NY7H 1LO2H 2GSGB 4LMQE 1JJUA 3RHWK 2IJ0C 3DO3A 4Q74A 2VQ1B 5BV7C 4JRXE 1MIML 4GMSL 2YPVL 1JYWA 1DVFA 3EYFB 3TT1L 3B5TA 3G6JA 4I18B 4NUGH 4K9EC 3VXTB 5IF0A 4PRNB 3ORJA 2F5AL 1G7QA 2OP4L 4IJ3C 3WL9B 1WC7B 5HJ3A 2J5LC 2FD6L 1M4KA 4RBPH 2I27N 4W81A 1DBMH 1Q72L 3U0PA 3OB0K 2GJ6B 3PWNB 4Z76A 2WUCL 5DUMH 1DBJH 3ZYIA 1AP2A 3VRJA 5ABDE 4YAQA 1BM3H 4Q6IB 2E7LA 1HWHB 2DI8A 4F7EB 3RGVC 1N64H 4LQFL 1NCBL 3CFDB 1NFDA 1RK1B 3UTSA 1P6FA 1IAII 3V52H 4O5LH 4OFKA 4E5XA 4Z7WA 4GW4B 4NT6A 1BIIB 1JF5A 2QHLA 1YPZB 1RZIA 2ZZUT 3FONA 4X7TB 3V7AG 1VEOA 1OAXH 3AXLB 1J0ZA 4M6OL 4QWWD 2MKLC 4NZDA 3O3DA 1CXLA 4KJYB 1INQB 3VFOA 5SWQB 4GRLD 2FX9H 1K8IB 5H94B 1DBBH 3GMPA 4XCNB 4YZFE 4DFIA 3B2UC 4WWID 4MSWB 2PXYA 5IJKC 4HDIB 5EU6E 7FABH 2VXUH 3RVTD 4NO3A 4NUGL 1NDMA 4M7KH 3LSOB 3L7EB 4XC1L 3HS0A 1RULL 3RZWA 2AJVH 2H26B 3MOAH 4KK8C 3RBSA 2UUDH 2Q6WB 1DBML 3IDJB 1T21B 4X8XA 3O41A 4KJQD 2JIXD 1QTYT 1W2KT 3B5GA 4QXUL 1DVFC 3U0TA 2JCCA 1F58H 4FQIL 2HRPH 3MFFB 4HV8B 3D25A 3IF1A 4PIRF 2YUXA 3PF2A 4L1HA 3TVMB 4NP4L 4IRSA 1JGUH 2BFVH 1FZJB 1T0MB 3OQ3B 3R06B 2EDFA 3RZCA 3V52L 1N5YL 3K4AA 5JXEA 5MHSE 1Z0NA 3B83A 1U8KB 3BESR 4FXKB 4LKCB 1JTOA 1ITCA 5TE7L 3ROLA 4OCWL 2E7LC 3CK0L 3D9AH 5FYKE 2EZ0D 1FZOA 1T1XB 2F53A 5IEHB 1ORQA 1QEWA 5IJVA 4YDIH 4JJHA 2HLAA 4DZBB 3QFJA 2H8PA 5C0FB 4C83A 5I8CA 5DJ6A 5KVDH 5CSBA 5MP6L 2JLLA 1Q9WA 2FBJL 4NQVB 1QLFB 1VFBA 3TC9A 5LJYH 3TN0D 5CJQH 3JV6A 4MAYA 4DEPC 4X83A 3QUMB 4FP8H 1CT8B 1HQRB 4HIJB 4XVTL 1MCIA 3O6LH 2X7LA 4WHTA 1W72H 5F9WB 3V6FB 1MLCB 5E8OB 4APQD 2NW2A 5ADPL 3QO1B 2BNUB 3NA9L 3LVEA 1BFOB 2AJVL 3QWQB 4EXPX 5IB3B 4QCIB 1PG7H 3H9YA 1T6VN 4PJEA 4NIKB 3RY4A 5JQHC 5JPMB 4WNQB 3ZDYE 3T1FA 1I7TA 5HVHB 2NY6D 3NTCL 2BSSA 1JZ2A 5DMGC 1HZHH 2PXYC 1CK0L 4JM2A 2ZG2A 4OV6F 1YQVH 3LN5B 4LEXH 4DUWA 1ZGLP 3PL6A 2HRPL 3X3GL 2YEZA 4D0DA 2W38A 1NBVH 1K3IA 2AK1H 1UWGH 2DQGH 3X11B 1MI5E 1YEGL 4L4JA 5CAYB 4JQXC 1QOKA 5ETUB 2QR0A 4BQBA 1R3KA 3QXWA 2OTWA 2GK0A 4YGVA 4GG6B 3AC0A 4LLUB 4LU5L 5BW7C 4KK5C 5C08E 4Q7DA 3ULUL 3I6LE 3BIAX 5C09B 2FZ3B 2N4IA 5F21B 4WUUE 1VA9A 3N1QC 2PCPB 3E3QE 3Q2CA 3OKDB 3HI5L 1MRDL 2GUOA 5T3XD 4R7NB 5AD0B 1JRHI 5HDLA 1K2DB 5FUZL 1FBIL 1JFQH 1BD2A 1UWEH 2AJ3A 5I71C 2ZWLT 2ZOKB 2VZVA 3RNQB 3R0MA 2BVPA 3UTPE 5IIEA 1YMMD 4FP8L 5D7LA 5T33H 3WNNA 1LO5B 4Y5XB 2F9BT 4HUKB 3S96B 5DSCB 2FJGA 1NKRA 1QRNE 4WWKB 4DVRH 2I5YL 5J4MA 2DBJA 4N0FB 3RWEB 1IEAA 3V95A 5EWIL 5CINH 3OKEB 4X9IA 3DHJA 2R4SH 2G2RA 5CGTA 3H0TB 1B6UA 1HQ4B 3H3PH 5LWYH 5GRWA 3OV6A 3MV9A 3QI9C 3QIUA 2XTJD 1TVHB 4XNYH 1YQVL 4NSKB 4PJFA 3ULUC 4Z7OE 1Q9OB 5TH2B 4B0MM 5HYQA 2LU4A 2VUOA 5DDHA 4O9HL 3QDAA 2YOCA 1FNGA 3FB8B 3IGAB 5EBMA 5GHWH 3BPNC 1T22B 5I1KH 5J1AA 3SPVA 4ZDHB 1MIEL 5E6IA 1FO0B 2XQYG 5M94B 5EU4B 3C8KA 5D7JA 4PBWD 4JM2C 5E4EC 2VXSL 4M48L 4OBSA 1BZ7A 2ZUYA 3QYCA 3U9PH 2ADIA 3VWKD 1A2YA 4BUHA 3A67L 4NKDA 4GAGL 3DUUA 1C12B 1MRCL 1OAUH 1TZGH 1A0QH 3G5XA 5GS3A 3Q6FB 3K2UL 3OKKA 5EC2B 5D2LA 4OD1H 4UMGA 4X9HA 5FUCE 1LDSA 4E0RA 3QAZB 4CMMB 1RIVL 1FZKB 5DVNA 3BPOB 1UWEL 1KSRA 3BYYA 5ICZB 5CZKA 1S9WA 2ICWB 1JF1B 2DB8A 3N1GC 5T3ZE 1KLUB 1X7QA 2FX7H 4JRXD 4XVJL 1KELH 1BFSA 3HCVA 3GMOA 1UYWL 3REWB 4JFYB 1CS6A 1TMCB 1KCVH 4MJIA 1RMFH 4NKOA 1GZPA 3RWCB 2R4SL 5C70A 1F3JA 4XXDB 3FB7A 4OLUH 5I1CH 2XN9A 2YRPA 3LAFA 1W8NA 2LQRA 3DGGB 1J0JA 5IMMB 2Z93B 4CADA 4L4VA 2MHAA 1IGYA 3QT2A 5L8KB 3UJJH 2D2OA 3F58L 4NWTL 1YECL 1G84A 3GMMB 2PTVA 4PYGA 4U0RC 1GOGA 4UT6H 2DQIL 3SJVB 1UQSA 4JM4H 4LEOA 4QF1B 5GHWL 2X9YA 1BLNB 1EEQA 1A1NA 1CVSC 1YPZF 4TVPL 4LVHB 2X1WL 4I8DA 3DUHA 3ZKQD 4UDUB 1PAMA 5FKPA 3QIUC 1KYOK 4IS6A 1P4IH 4JY5L 3H8NA 2R2BB 2NY0D 3I6KA 1YEHH 4KK9C 4PG2C 3BKYH 4GRWE 4H5SB 1HYSC 1KFAH 4ERSH 4QRRB 5C0AD 1KEGL 12E8L 5F7MC 1RUQL 4F58H 2GYSA 1RK0A 1N5AA 1OAUL 1T2XA 3SEPA 3T3MF 4MXVF 3BKML 4HWBA 1HIMH 1R3JB 5E6IC 4M93B 5D7JC 1DJSA 1OY3B 1T2QL 1INDH 1CLCA 2MPAL 4GBXD 2H2SD 2LV4A 3BPCB 4PJ5E 1OF2A 4NO2A 4PJAB 3VXRE 1HH6A 3UYRH 4UT7H 1S7WB 2QSCL 4C55A 4Q9BA 1I1AA 3E6HB 3A6OA 2UWEB 3UTTA 3LEYL 4XC3H 4DZ8A 4PJ9B 4FZEH 2APXA 5E8DL 4YNYA 4OZIE 3T65A 4QTIL 2VZUA 2YPLE 3F12A 4KI5E 5EC1A 5FYKU 4LDEB 3D69B 4K7PY 4Z8FL 3U82B 1DQMH 5TFSL 5SWSB 5SX4H 2IBZY 3HE6B 4PD4J 3MYJB 4OCRH 1JNNL 4IDJH 4KQ3L 4KU1A 2ED7A 2ZOLA 5HSFA 3TBSA 3HR6A 3UJJL 3MRNA 4IRJA 4UT6L 1AD9B 5LBSH 5CJOH 4ZD3H 5A2IH 4Z0XA 4NHCH 3C60A 3TP4A 1T7VA 2CLRA 1MJ7H 3J7HA 1NUNB 1EDQA 4Y5YC 1QP1A 2AXFA 1FAIH 1RZ7L 4JFFE 3DI2B 4NKQB 3QUKA 1WT5A 1A5FL 2DLTA 3IKCA 1RAMA 1CG9A 4R96B 3HE7D 3ALPA 4WTZA 3PHQB 3MJ6A 1D3CA 5FYKD 3VFRB 1KFAL 4ERSL 1DQQA 1FP5A 1V7MH 1KJ2L 1GHFL 1KYOJ 3L5JA 4KMTH 2UZIH 3RWJB 2DIAA 1BF2A 1HIML 5F89B 4MCZA 4X7FC 4KRNA 2QADB 2C1PB 3V79C 3P11H 5T1KD 1C16B 3NZ8A 4G5ZL 5E08H 4MX7A 1S7RA 3AS0A 4HKBA 5I1LB 1UG9A 1WFNA 5D4QA 3JWNC 3UYRL 2NX5E 3VMOA 5L6YH 4LHUB 4EIGB 4R7DA 4NQEE 3SKOA 2DDQL 4F7CB 2EE3A 3OXRA 2EKSB 4FZEL 4H88H 2WSKA 4RBPK 3MRKA 4R97C 5ANME 2Q8AL 1A6ZB 4TOYL 3LD8B 1ACZA 4HPOL 4H1LA 1I9IH 4ZQKB 1MHHA 5J9PA 2NY4D 2NZ9D 4PJXA 4BZ1H 4DKFL 3KPNB 5BO1H 1I1AC 4IDJL 5C2BL 4JFQA 4PUBL 2GITB 1NAMA 3BZ4A 4N9GB 3MRIA 1E27A 4I0PA 2EYSA 4Y4KD 2GJZA 5LBSL 2R8SL 1DANT 4I0KA 1PFCA 2DQFA 1UC6A 1MI5D 4AZ8A 2VDLH 5AWNL 1GH7A 4LDLB 3MNWB 3LS5H 3ZT5A 1QVOA 4P23A 4YEFA 1KPRA 5C08D 5E6YA 4JB9H 4JFDE 3O9WA 1A6UH 3AMLA 1T03L 5C92A 5K9OB 5SV4A 3P4NA 5H37G 2OK0H 1C5CL 4LARH 4YHNA 3C60C 5E2TH 5D71H 5F1SA 2UZIL 4Z18A 5EU5A 4AT6A 4G43A 5DVOA 2NTFA 2JELL 1Q8MA 4PJ7A 2WIMA 1R3IL 1WT5C 1X5ZA 3D3VD 3QZWB 4U6TA 1NAML 2BSTB 1PKQA 1UXSA 1IEHA 3SGKC 2YMXL 5ICYA 1D5MB 4WU5A 4EOWH 1QRND 1RUKL 4CW1B 1LQSR 1FFRA 4HFWB 1K4DB 2CLVA 4MB3A 2A6DB 1OP9A 4ZFFB 2UUDK 2MCG1 1OGAE 4S2SB 1A6AA 5BZDB 4JAMA 2VR9A 4R3SA 5GISH 4JDVB 5EUOE 3WXVL 3ULVH 3HMWH 5BO1L 1T7ZA 4QNPE 5E2WH 4YXHL 4XVUD 3E6FB 1G7MB 5I1IL 1JK8A 4RA3A 4ZUUA 2FECI 3MGAA 5TDPA 3PNWB 4D8PA 3G6JE 1CIUA 4I77H 1S7TA 1EBPA 1F5WA 1EBAA 4NFDA 5I1AA 4P2RB 2P44B 3QDGA 5IFJB 1DDHA 2X89D 1ZVSA 4HJGA 4M8QA 3D2UD 2WLYA 3LQAL 3VWJB 4N8CH 1I75A 3K4ZA 2E9WA 4I0PC 1KTRL 1CFSB 3PIQA 4Y4FB 3EJJX 3TZVB 5IB2B 4GAJL 4LARL 4HKJA 2H1PL 1NBQA 4P9HH 3UP1A 5DEZA 3GIVB 3KPOB 4JY6B 5MENE 5IW6A 5F97E 4CBPA 1ZHKA 1JGEB 1YN7B 3DX8B 4JLRA 3O9WC 3PDOB 2VDPL 2VLME 3WEXB 3FQTB 1RZJL 3FTGA 4NQXA 3HZKA 1YEIL 2E7BA 4WI8A 1MFCH 5J7CC 4KY1H 4I5BB 2W9DL 4J3OC 3RKDD 4PJGB 4QT5A 4F9LA 3B2VL 1HE7A 4POYA 5B39A 4G6MH 2XRAL 4L4TD 4A2LA 3IS0X 3L3DB 3O6KH 3BGFB 3GUTB 2BDNH 5T5FH 3KPRB 3LQAC 1NANI 5KOMC 1VDGA 1KNOA 3O8XC 2HA1A 1P2CB 3ZDZF 2X1PA 3PV6A 3MV7B 1MPAL 2H41A 3M17A 2ZCKL 2XKNA 3RBGA 4WDIB 1ETZA 5FB8A 3X17A 1Y6NR 5TE6H 4FOMA 3DVGB 2IG2H 3IDNB 4X6BB 2VLKD 2CUMA 2FL5B 3KPQA 4KFZC 1UZ6F 3VI3F 5TDOA 4MQ7A 4OLVH 3I9GH 5FV2A 3KS0H 4BUGA 3QUZA 3MRDA 1Z3GH 4PJAF 3BE1L 1QKZH 4QHKJ 1RZJC 2VDNL 5E9DA 1TTGA 2APWA 3V0VB 2HVJB 1N59B 3QNZB 4PGZA 3QWOB 1DLFH 4YDVA 3IVKA 2WQRA 2WW8A 2BK8A 4OCYH 2AV7B 1FV1A 1S8DB 3OPZL 1NEZA 3VXRD 3IXAA 2V5SA 3O3BB 3R1GH 2F15A 3QUXA 3G04B 1WIUA 2QKIB 3HC4L 1MH5A 1CI5A 3UYPA 3CMOL 2YK1H 3UBXB 4M7LT 4X5WB 2OR7A 5KOVC 1F90H 1S3KH 1G0YR 3FB5B 4FQCH 3BP5B 4KY1L 1E4JA 1FGNH 3CAFA 1N6VA 5IW1A 3FQNA 4G6ML 3PDGA 1Q1JL 3O81A 1EJ6A 4B41A 3W2DL 3RWFB 4HC1A 1CDUA 2P47B 1RZFL 3TYFB 2RBLA 5F8QC 3CVHA 5DMIL 3GSOA 5ID0A 4R4ND 2HRLA 5GS1A 3I02B 4M1DH 3PWPE 3T04D 2R56L 1GPOH 4KZDH 3PQYB 2YZ1A 4TULH 5D7KE 2BOBA 4E41B 1DUYA 1CTOA 1JPGB 2IG2L 4PJEE 5EPMB 15C8H 4NM8H 2F8OA 5LKNA 1ACYH 3TA3A 5EUKA 2Y72A 4O2FA 2MNUA 4OLXH 1HHJB 1INEH 3JTSA 4DCQB 4ZFGH 1CICD 1QBLH 3I9GL 3N1MC 1IFHL 5DHVB 4HUVA 3VGAC 2ZNWA 5IB5B 4GQ9H 1QKZL 3LDBB 2PW1A 4LNRA 4NQDB 3VW3L 2EXYD 3DX7A 1DLFL 1F4AA 5KSAA 1LO4L 4Y2DC 3BHBA 3MXVL 5T5NG 5BMFH 3KPSB 1RUPL 4D3CH 3BPLB 2DTMH 4NQED 1Y18B 3HN3A 1QACA 4XBGA 2Q1EA 3O3AA 2D7MA 1EVTC 4YIQA 4QRSA 4MD4B 1ITBB 3U83A 5GS0C 5B8CA 3TIEB 3DBXA 2DICA 1S3KL 4OB5H 2FJHA 4KMLB 3FT4A 3VD5A 5LXGL 1B9ZA 2J6EA 1QSEB 4JEGB 3LEVH 2R0WL 5DRZB 3MBXL 4Y8AA 1U8QA 1OSZB 2XG4A 1SJHA 4ENEC 1AC6A 4XX1G 5GS2D 2HJKB 2EDQA 2FEEL 2Y23A 2APBA 1IAOB 5D7LE 2E27L 4PJDB 1KTLB 2EIEA 3SQBA 5CS7A 4K55A 3P0YL 5EU7E 2D31B 4M1DL 5LVEA 3E2HB 5L9DH 1KXVC 1GPOL 2X4UB 3RAJH 2V2TB 4HMEA 4XCFH 4FQ1H 5EBWB 4G8FA 15C8L 5DUPL 5E2UL 3VD7A 4HK3J 1T20B 3T0EB 3L3KA 1J0KA 4JFDD 2DM4A 3FFCB 3EZ8A 3MV9E 3SDXB 1IKFH 3MNZA 4R8WH 4HXBH 4JZNA 3CDYA 2W91A 3RPIB 5J89A 4L8CA 1HKLH 4P2OA 1IC7H 4R0LC 1ZWIA 5DJDA 3KPPB 4YDLB 2AV1B 5ESQB 3EOAA 4R2GB 1ZANH 4DK3A 2DQEH 3TA3C 5CMAB 5L2JA 2P45B 4ELKA 3ARGA 5BMFL 2A77H 1S7SB 2AK4A 1CBVH 1EVUA 1QNZL 4ODVH 3QEUB 4NKMB 1QLEL 5MEQB 5HYIA 3SGJA 2V7NB 4YH6A 1AGDA 4DN3L 3QULB 2IALB 3VFNA 1OGAD 4X99A 3IAPA 2A9MH 4NQCB 2Z8SA 2A6IB 1NC2D 3DPBA 5KSAC 3GMQA 5DMJB 1MHEB 1RJLB 5J12B 3C6LB 1U2HA 5DWUL 3P30H 5K9KB 4BH8A 5FOBB 4YBLB 1FC2D 3FO2A 3CFKB 4YDJB 2P43B 3D18A 4WY7H 3W81A 5GRVK 5FAAA 1BZQK 1IE5A 3W5MA 1CGSL 3C9NA 2CGRL 3V4PH 3CLEH 4GKZB 5B8CC 4DTGL 4PB9L 2BCKA 1MQ8A 5DJCB 3BQUB 5DGQA 4K7FB 4XNQB 4OAWB 4PJCA 5L9DL 2CDGA 4KKBC 3FT2B 3AAZA 3JSSA 3CX2A 4DGIL 2J8UB 3WIFB 3IXTB 5EZJB 2ZCLL 1GJIA 3RTQA 1IKFL 4BKLB 5L2KB 4YFLF 4ACPA 4K3DH 4HIHB 3HC0B 2PYEE 3WJLC 1QQDA 2HFEA 3KNBB 2H6PA 1FCGA 1IC7L 4RFEA 4HHAA 3NCYP 1TFHA 5T3XH 4X4MA 4OV5B 5MEND 3WFHA 5GJTH 3ZE0E 1IM9B 1CCZA 3DSFH 5GJSL 3NPSC 1G7IA 2A77L 3BDXA 4K7PH 3L1OH 4KROB 4QKXB 1DBKH 2C4FU 8FABB 2VLMD 1L0QA 4L8DA 4PJGF 2Y36L 3LY6A 1XZ0A 2DKMA 5F88A 2J1KA 4P2OC 3WDIA 1AJ7H 2VL4A 2JB6B 2I9LA 2V9QA 3VXUA 5HYSB 2BNRB 2BZDA 3WFZA 1A7RH 3O45A 2HFFA 2A9ML 3T0DA 3L3IA 1FIGL 2YD6A 3RU8L 5HD8D 4P46B 5HHQA 4ZPTA 1MFAH 4OFDA 5KSUA 5JOPD 1F11A 1FNHA 5I1JL 1V3KA 3ULSB 4JO3L 1RI8A 4LLWB 4LVOC 1BGXH 4UNTA 4XPTH 3SGJC 1H3GA 1FL3A 5DGRA 5GPRA 1HHGB 3DX6A 1FN4B 2R1YB 4C54A 4PGEA 2Z31A 2R2HB 3UTTE 3STLB 4NZRH 3RX7A 5JQ6H 1VACB 3BXNA 5CIPB 3TJEH 2UY7A 1U8HA 1P1ZB 1MVUB 2AQ2A 1DN0B 2YR3A 4GQPH 1BOYA 4G8EB 3GSNL 3GSVA 4HIXH 3CFJA 4RQQA 3O4LB 3LKOB 1BP3B 1GAFL 2VMFA 2BHUA 4YHZH 1TJGL 1QFWH 3QHZL 3HZVA 4HS3B 3VE0A 1IGCH 3AS2A 4ZNEA 3IYLW 4JFHE 3N1FC 5EB9A 3DX9A 1X4XA 3UXFA 1PEZA 1JZ5A 2W60B 5DRWB 3CFIC 2VXTH 1XGRB 4EI5A 5CD3A 4WWKD 1S5IH 4HS6A 4U1MB 1RZKH 3QQ4A 1G6RA 5DK3A 4OQ1A 1NBYB 5GGSB 3SDDA 3RTQC 4L3EA 4JPKL 4XXCA 4K7PL 4GO6B 5EU3A 4RMUA 1QFPA 1CWVA 3EO9L 1FL5A 5E8NA 2EDOA 3S37X 3QPQC 1FVDB 1J11A 2AXHA 3PGDA 4X6EA 3TCLB 1EX0A 2IMMA 2QSVA 1J9CT 1RZ8B 2J8HA 1MNUL 1NGZA 3RI5F 4LPVA 4KZEH 1FH5H 1AGBA 4N8VA 3RNKB 4XNMB 3LS4L 4QRUA 1MUJA 2FH8A 2J4WH 3DMMC 3NIFE 4L8SB 1HINH 4LLMA 3B9KC 1GGBH 4NHUA 4EVNA 4N68A 5KTEH 5DFWH 3ZKND 4RGNB 2GTWB 1YC7A 4NZRL 3PWPD 3WYRA 4S1QH 3FQXB 1I3VA 4EN3C 3QDJE 1TJIL 4NNXA 1P69B 2LTQC 4M5YL 2YD9A 3MO1A 4K8RD 4HIXL 4AJ0A 2FATL 3TIDB 1D5XA 2F5BL 2FDBP 1QFWL 3F5WA 5EZOH 1WWBX 1IGCL 3ZDYF 3BVNB 2F54B 2X9XA 3GSRB 5DQ9A 4WI2A 1KC5H 3BP4A 4MA3B 3W9EB 5BV7B 4AL8H 4WFED 1AGCA 5GQBA 1LE5A 1S9VA 5D6DC 3UCRA 2APVA 2X2YA 4ZYKB 1I4FB 1NBZA 4LFHG 1PY9A 5A16A 3M1BA 1M7XA 5E56A 3MNVA 1T89A 4IJ3B 5D1ZC 4HUNB 5JPNA 1OTUC 5IP4A 4HF5H 4R9HA 3ZKMC 5FKAA 1JPTH 5J6HB 1QFOA 2GTZA 5CKAA 1MREL 4QHKI 2NXZD 1JHTB 4DAGH 3A6CH 2A83B 3EO1B 1GCFA 1E28A 4LLDB 4NO0A 3VDCA 5JHDB 3TNMB 1RQ5A 2CKNA 1Y6MR 1FH5L 3CZFA 1ZLSL 1KG0B 3RGVB 3IFNL 1P9MC 2DJ4A 3SJVD 4IOFD 4TUJA 5DJYA 4PJDF 5LCVH 4OM1H 4PJ7E 1I3RA 1OTSD 3SDDC 3QIBC 4K94H 4M6ML 5HYFA 1EAPB 1NCAH 4EEEA 3C6SA 1UEYA 3TPUB 5IEKB 5A2FA 4JPVL 5KTEL 1F6AA 4UQ2B 3KDMB 3G5VB 4QRRD 2Q8BH 3UROR 4PRAA 4PRIB 4DKEL 4P59L 2G5BB 3HTLX 5HTSA 4GW1A 1S7UB 4GXUN 2BRRL 5HHOA 4WEBH 5HY9B 5SWZE 4WHYG 5JDJA 3BRDA 4JHWH 3B4NA 4HT1H 4HUXA 4MNHB 2O93L 1FC1A 4UIMB 1KC5L 3KYOB 4AQ1B 5D1XD 5FO7B 1E6JL 5JW3H 5K9QI 1FFPA 4U1LA 4LAQL 5CJBA 2I07B 4U7MA 2GT9B 3QDGE 3B3IB 1CD1B 1XR9A 2HKHH 1XF4B 1JHKH 2ED8A 1N8ZB 3HNVL 3O0RL 4LCCB 4MDIA 3TBTA 4D94A 4CAGA 1EEYA 4NCC2 5SWSD 3A6CL 3G9VA 3HFML 4P48A 1DVFB 1N6QL 4PY7A 1YQ2A 4OZGA 4JR9L 4LSVH 5IF0B 1G7QB 5KZCD 4TNWK 4ZO7A 3SKJH 1P5UA 2PO6D 3GSWA 4K94L 3U0PB 4LKXA 1ROWA 2FSEA 3Q5TA 3RIFF 5D8JL 2P5WA 4UI2A 1D9KC 2J8UF 4PY8J 4YAQB 4NC2B 3UYOD 2XV6B 4C56A 3QSKB 3QDMA 1IGIL 4N1EA 2HT2D 1S7VA 3WKNA 5TDNB 2OL3A 3WSQH 1NFDB 5I8KH 3UTSB 1FNFA 5D5MB 4JHAL 1U8PA 3HG1E 1X6NA 4XP5L 4E5XB 4OLYH 4Z7WB 4H25A 4NT6B 2PYED 1MCPL 4DEPB 1A02N 2FB4H 3MRCA 4GS7C 4YDKH 4HPYH 3O6FC 1RZIB 2OYPA 5H37H 3RVWD 4ETQA 4G9FA 4LHUG 3FONB 4P4KD 1Z9LA 1QA9B 2P5EA 4YQXH 1QFWM 4ELMB 2RB8A 1A14H 2X4OB 1ZT7B 1T66C 5D7IB 3O4OB 4ODSH 1NL0H 1W72A 3QIWA 4RWYH 4XPAH 4K94C 5LAXA 3MA9H 5BOZG 2PXYB 1UM5H 3JWDL 3KWWA 5I8OH 3UZVB 5I74B 2R0LH 4NOBA 3QEGH 1NDMB 5AAMA 3ARPA 2XWBB 4JDZA 4LSVL 5E9DE 3GJFB 5A40E 3HS0B 3PWJA 3SKJL 1WEJH 3NIGE 35C8H 3VGHA 5C0DB 3WMSA 4ZFOA 1MFBL 1IM3A 2ICWJ 3RUGA 3LN4A 5AYUL 3O11A 5D72L 2XQBL 3U0TB 2JCCB 4NRXA 2QHRL 1JTTA 3B6SA 5D2NC 3O6MH 4ESKA 4AENA 3F7YA 3IF1B 4MLSA 4GJTB 2PF6A 4XBPB 1AIFB 5I8KL 3T4AB 2X4SA 3GSQB 3OR6B 4OZIF 3FOLB 3CUPA 4KI5F 1DTUA 3PP3H 5IESH 3FO9B 5ITBL 3QZWG 3KLAA 1NCNA 5I71B 3H6JA 4RAVA 4YHOH 1WAAA 5CHNB 1VEMA 3WLBA 4YDKL 5H35A 3JWDC 4D9LH 3UPCA 1FZOB 1P7KB 3WS6A 4JKKA 2F53B 1ORQB 1QEWB 2VQUA 2HLAB 3QFJB 4OZHE 3IFOA 3CC5A 1CLOH 4M61A 4C83B 5I8CB 3G5YB 3WHXA 1AFVH 1NFKA 4PP1D 1NUGA 4HIEA 4M62L 2HKFH 4XPAL 1OARL 4Y16A 1KN2L 1PBYA 2HWZH 2XPGB 5ACZA 4AMKH 3QI9B 3BP6B 1UM5L 4MVBD 4EBQH 1U95A 4J6RH 1TZHA 4WHTB 1JWMA 4G6KL 4HJJL 3QEGL 4YWGH 1UADC 4U7KA 2HN7B 1YNKH 3L95A 4KJPD 3BPNB 4HXAH 4LSQH 3WJJC 1WEJL 2AW2A 1WBZB 4P2RD 3T1FB 4UOW0 5I30H 4JM2B 5CLWA 3BH8A 2VXVH 3QUYA 3QDJD 2AGJH 4UUJA 2YEZB 1IGMH 4D0DB 4PGDA 1SYSB 3MV01 2DD8L 3UJIL 1SJVA 3VG9C 3MSPA 1BF8A 1JGVH 1MCDA 1RVFL 5DJAA 3OKOA 5SX4I 2O5ZL 4JREC 2VSDA 3GRWL 4ZTPL 2QR0B 4F37K 3U1SH 3PWLA 1AXTH 2RJMA 3DVFA 4WI6A 4D9QE 1RU9H 2OTWB 2GIYA 4GRWH 2GK0B 4YGVB 1AGEA 3VCLA 1LE9B 4IRZL 4XVSH 4D9RE 5JW4R 4J3XA 3JWOL 4ZO9A 5KVGH 4MJ6A 1HXYA 1T5WB 3H9SA 2A74B 2GUOB 1AE6L 1F4YH 4WI4A 1DQJA 4WO4C 5C0BE 1BD2B 5KS9B 4F57L 4PRHE 4KDWA 5CILL 1ZEAH 2ED9A 3FZUC 5IIEB 2HWZL 1U3HA 3BYTA 3RVUC 4J6RL 3KPRD 2FJGB 3ME0A 3ZL4H 4U0RB 5DQJB 3EJYC 1RUAH 4PGJA 4OBRA 3DYPA 3AM8A 4LSQL 5A2LH 1BMGA 4OLWL 3MV7D 2G2RB 3ROOA 5M7QA 3BO8B 5EZLA 2W9EH 4QY8A 3QIUB 2ZPKH 3EYVA 3HPLA 4PJFB 3S5LA 2IANE 2E9IA 2VXVL 2NLJA 5HYQB 3D85A 3THMH 4LSTL 2AGJL 3N50A 3N85H 3O3EB 4DW2H 1BZ9B 1FNGB 3OAYH 3JWOC 2XQYK 4QRPE 1KACB 3FN0L 4X5XB 5ESVB 5J1AB 1IT9L 3ARTA 5E6IB 2R29H 2IC2A 2ERJB 5SWZD 3V4UL 4Y5VA 5D7JB 3ZT6A 5BJTA 2HG5A 3VFGH 2ILLA 1RU9L 1G9NH 2XXMB 1A6WL 1BZ7B 3S35X 3SCMA 4DUXA 1FNEA 5EUOF 3MLZH 3P40A 1XIWC 1JV5B 1NAKL 4GKOA 1EFXA 2DQDL 4OUOA 4XVSL 5F1NB 4NKDB 1IAMA 4QNPF 3DUUB 4PB0H 5BXFA 5FK9A 3UBXG 5KVGL 5GGVY 5IB1A 3G5XB 1J8KA 3CFBA 1TCRA 4FQLH 3GI8H 3VA2C 5CEZD 5D2LB 4MQSB 4PJCE 4M1GH 4CU7A 4Z7UA 3S3SA 1YC8A 1DUZB 3G6JF 1KCLA 4R4FH 3QISA 1UKTA 1Q0XH 4NZJA 5D7SL 1IJ9A 3PWUB 4OGYH 1S9WB 1V3MA 4F3FA 3FCTA 1X7QB 3DHMA 4RMWA 3X13A 3CZJA 2Y06H 2VH5L 2CLZA 3HCVB 3X3FH 3WIHH 5BOPA 3ZZ1A 2HJFA 1RV6X 2VKXA 4MJIB 1RUAL 1KPVA 5KVFH 4NKOB 4X4ME 3B9EA 3MCLL 4S1DC 2B0SL 4F7TA 1G9MH 2Z0BA 3FB7B 5M95B 1WV7T 1NLDH 4OSUL 3PQYD 1MEXH 2ZUTA 2XN9B 1NFDF 3MBEA 3WFDL 2W9EL 2ZPKL 4CADB 2Q3ZA 4L4VB 2MHAB 5DD6A 1T1WB 1ERNA 4X4YA 2ARJB 5C6PB 1UQSB 5HDQH 3THML 4L8BB 3ESVF 4LVNB 1EGJA 4D0CA 3FHAA 1A1NB 1IQDB 2ENYA 4GW5A 2IFFL 3TNNB 2R29L 1MSPA 4NQDD 5IHZA 3HG1D 3MOQA 1O7SA 4KTEL 4MD5B 5FKPB 5GIRA 3U4BH 4IS6B 1QSFE 5EBGA 1DE4B 4LSRH 4UILL 4NM4L 3BN9C 4CMHC 4PP2A 5IBLC 3MR9A 1QO3A 4MNQA 1CLYH 1RK0B 3EDFA 1L0XA 4Y5VC 2JTDA 3VXSB 1Q0XL 2EYTA 5K59F 5I18H 1OQXA 1PZ5A 1TIUA 4X6DB 2X70B 3SCMC 4NO2B 4ONFL 3LKPB 1QSED 4ZNEE 1I1AB 1BEYH 1K8DB 4G7VL 3L5HA 3SE8L 5BRZE 1WBXA 1EGJL 1KCUH 3OGOE 4KTYA 2NPLX 1BX2A 1JZ8A 1EERB 3I6GB 4ZUTA 2DLHA 3WFBH 1KJ2B 2BHYA 3QFDA 5L88H 3O2VL 5EC1B 1MLBA 1T04A 2JCCF 1U42A 4N5EC 1L9MA 1NMAH 3CFCH 2Y6SC 5DTFA 1YZZA 1RD6A 2E7CA 3A6BH 4L3EE 1VPOH 1HDMA 3N06B 2ZOLB 4V1DA 5DUBB 1JHLL 2XG5A 2DQCH 3FFCD 4IRJB 3O2WL 3CDFA 5HDQL 3TT3H 4Z0XB 3C60B 1EO8L 2CLRB 5CGYD 3WXWH 1KXTB 3HUJA 4I18C 1K85A 1SY6H 3QUKB 1BVKA 4WFFE 5T1DH 3CNKA 1OB1A 2ZUQC 2SEBA 4HH9B 3TJHD 4JFEA 1DQQB 5INDA 2VISA 3QUMH 4YPJA 1OL0A 3QG6A 4YXKH 3P77B 4TTDD 5E00B 3HI6H 2HTLC 4RISH 3H42H 3MLRH 2IAMA 1D5IH 2ZNXA 4IHOB 5C6TL 5I18L 1A7NH 4MX7B 1S7RB 4HKBB 2J7LA 3LZFL 3EKCA 5GGTH 1KBGL 4PJEF 2Y07L 1IGJA 1BEYL 4MGXA 5E8EA 2ZUUA 3I3BA 2P8LA 3D0LA 4JM2F 1P7QA 4XRCA 3WFBL 4HIIB 4CN4A 1YEEH 1Z6JT 1M7DA 5J8OA 2EO1A 4UINL 1MHHB 1NMAL 5J9PB 4PJXB 2P4AB 2MOVA 3A6BL 2A6JA 4JFQB 1JZ4A 3PP4H 5C07D 1OCWH 1NAMB 3BZ4B 3MLUH 1NLBH 4R90L 1UB5A 1A9EA 1ZK9A 5FA4B 4U6HB 2R1WB 1E27B 3GM0A 2EYSB 1BQUA 2GJZB 2Y1VA 4I0PB 5L2KD 1D5BB 4MHHI 3F7VA 5CP3H 3FMGH 3V7MA 1I9EA 4BYHA 4X7SH 3FO0H 3QNXA 1BBDL 3MXWH 1A7OL 4XTRC 3IB4A 4AH2A 2VLRB 1KPRB 2FH6A 1A9BA 2ZJSL 3O9WB 3UTZA 5JZ7D 4TPRH 4LPUA 1WGOA 1OAKH 5FM5O 1QFUH 1D6EA 4MXQC 4YHNB 3AREA 5DD1L 4LSUH 5I76B 5B3JE 2HH0H 5HYSG 5EU5B 1OAQH 2XY2A 4AT6B 2ZUXA 1U3JA 2BNRD 5B4MD 5C0BD 4PJ7B 4RISL 3MLRL 4FFVC 3OX8B 1YY8A 4PRHD 2E6PA 5HHOE 1MF2L 5IM7A 2JK5B 3NCJH 2BRQA 4DWHA 4P46D 2ZSWA 1G7HA 1PKQB 1Q94A 1UXSB 3TVMC 5A3IC 3QNYA 4ZOEA 5ICYB 2B39A 4LIQH 4KKCD 4Y19B 3O8XB 1XGTB 4M3KB 2CLVB 2DM7A 3ECBA 1RURH 5HGHA 4FTVE 1YEEL 1R5WA 4PJFF 4L5FH 2H45A 5HHME 3BP7A 4NQSA 4JAMB 3DVNA 4ZXBA 2IEPA 3WLWD 3D5OF 2VITA 2FRGP 2E5EA 1FO0H 3EZJB 3KYNA 4JRWA 3O4LD 5I17A 2IAND 1JK8B 1J1XH 1I9JL 5FYLL 1T83C 4QRPD 3W9DA 1W0YT 3HMXA 4J3SA 1TETH 2EECA 5I1AB 1YNLH 2GFBA 4MJ4A 3PP3K 2AJYH 2UYLA 3D1MC 4K8RH 4WUKH 4M8QB 1ZVSB 2BJMH 4MJ2A 4I48B 5D2LF 2CIIA 5IQ7L 5I75B 3BJ91 4ZS7L 3I50L 3MLWL 3PIQB 5HVHC 3GGWA 1A7PH 4ZS6C 3DXAA 5AZ2H 2E7MA 1OAQL 4JVUA 4NC0B 5D1QD 4Z5RB 5IUSA 3I2CL 4W6WB 1YYLH 1UH2A 2MTPA 2W92A 1XGQA 5BS0E 4TQEL 5IW6B 4F8TA 5J6GA 4JLRB 4U6YA 3MLXL 3MGTB 4UBDD 4EQ3A 4LIQL 3AREC 3GMLA 2VABA 4NQXB 3FTGB 4Q97A 3HZKB 3H9HA 3NGBC 4DGYH 1RURL 4L5FL 2FHFA 4RGND 4KVCL 4WHCA 4QT5B 5EOQH 5B39B 1YYMH 1FAKT 5F6IB 3RVXD 4WW2A 2EC9U 2XT1B 2A1WH 3MODL 3F6IA 3QCUH 4NYLB 3LPWA 4GMTH 2OMNA 4JPIA 1R3LA 1TJHL 1OWRM 3PV6B 2EDLA 2F54D 3VGAB 4Y1AB 3M17B 3G9AB 3MUZ1 2XKNB 5FB8B 1A6TA 4U1KB 5I1GH 3PGFH 1NCCL 4ZXBC 4ZAKC 1GGIH 3C8HA 2ATKA 2NMSA 2A2QT 1QSFD 3VGEA 4Y2DB 1UJ3A 2FEDC 3KPQB 4WHYH 2CKBL 2ZCHL 1ES0A 2AAVA 5HPMB 2D4DA 3PG2A 5AAWA 4MQ7B 3B8SA 4BJLA 1QPPA 1RPQA 4GRLA 3QUZB 4HZAA 2AQ3A 1A7PL 5AZ2L 3VFVB 1FYTB 4TUOA 4S0TD 3HZMA 3GO1L 2MCPL 4PLJC 5ACLA 1WWCA 3DWTA 5F7DA 3DTXA 4YDVB 4GXUM 4K3JL 3IVKB 1II4E 3VXME 3RGVD 3IXAB 4O02L 3M8OL 1I9RL 1MH5B 1T7XA 4JO4H 1GC1H 1UA6L 4FFZH 5IROA 5DVLA 5EOTB 2CRYA 3ILPA 1MJUL 3ARRA 2BHZA 2JIXA 2O5XL 3IFLH 4OCNC 5E2VL 4QYOA 3OKYA 4P0DA 2ZG3A 5IKCA 4XWOC 1MFEH 5TQ2L 1H3XA 2XZQH 3FQUA 3I75A 3QAZC 1MCOH 1P53A 3OAYK 4H8WH 4KGLA 2OLDA 4OIIH 3ARXA 5C3LD 3GSOB 3B2UD 4MNGE 5GS1B 5CBEA 5ID0B 5SX5H 4ZTOH 3T0BA 4R0LB 5I1GL 3BZFA 1TITA 4KTDH 4PGBB 1GGIL 1XGUA 1OD9A 3OF6A 4WFFD 3BT2L 1I7ZB 4JGJA 5JR1H 3TA3B 5F93C 1H3PH 4FNLH 4O2FB 3U9UA 1UFUA 3RKPA 2YN3A 2J8OA 4F8QA 4JQVC 4RFOH 3CCHA 4HUVB 2PW1B 3TN0A 3MJGX 4AEFA 1IARB 3GSXA 5B3NA 5C1MB 2DLGA 4N0UA 2H3NA 5KSAB 1UJ3C 3BHBB 3HC3H 3QEQA 1ZKAA 1JPFA 5GGSY 4QWWC 3DV4A 4GSDL 3U30B 4APQA 3FJTA 4Z9KB 1CDGA 4XT1C 1HSAA 4UU9B 3IT8D 4XBGB 5EIVA 3O3AB 4PJXF 4YIQB 4NRYA 5BVPH 3DO7A 3VXPA 5B8CB 3DBXB 2AJZA 5IK3A 3H9SE 5IMKA 3KJ4C 1E4KA 1JYXA 2DQTH 3C5ZC 1FYHB 4LMQI 3RVTC 3NCEB 2VL5B 4KRLB 1KN4L 1U8QB 1S7QA 1SJHB 1Q9LA 3QQ3A 3WCYA 1G6VK 2WNGA 5KSBA 1VGKA 4L9LC 4MD0A 1V5JA 2F19L 2J12B 3S36H 1E4XI 2DKUA 4NN5C 3ZTNL 1CN4A 3G5ZA 4L1DA 4PJ8A 4HSQA 4PLKD 1NGPH 1A3RH 4XP1L 5GGVH 2MJWA 1JMXA 4G8FB 5EULV 2R0KL 3S88H 1H3PL 3L3KB 3NPSB 1E6OH 3FQRA 4PJ7F 3MNZB 1T0PB 1JF6A 1P4BH 1TTUA 1L6ZA 4JZNB 3SDCA 2VZSA 2EKJA 1AD0A 3MFGB 2FIRT 4L8CB 4X5LA 4P2OB 5DMGD 3TYGL 4KUCF 1ZWIB 5DJDB 1OM3H 4ALAL 2EDDA 1GL4B 2BERA 4TN9A 5EBLB 1U8OB 4QOKE 2HT4C 4U6XA 2EH8H 4YO0A 4CVZA 3ARGB 4NC1E 4ELKB 1HH9A 2AK4B 4EXKA 4O4YH 4KJWD 4KRPB 4LPCA 4LVOB 5IB4A 4OD2A 1I8MB 5DS8A 1AGDB 1BWMA 4FTVD 4NZTH 3VFNB 2Q3AA 3U7WH 3QBTB 3DRQA 4XP9H 4KK5D 3D0VB 1OLLA 3MLSH 1MJ8L 3GMQB 4HGMA 4TUKL 2AS5M 4Z7UE 5C6WH 4BH8B 5FYJL 1IC5L 2DS4A 2EDEA 1IC4L 5DFVC 3EOBA 3OL2A 1WIPA 3C9NB 2P8PA 3EDKA 3BWUC 5IQ9A 5DLMH 1M05B 2BCKB 5MERA 4CJ0A 1E4KC 1QD0A 1T1YA 3L3GA 5EOCH 3RIAK 3VWKA 2CDGB 5GGVL 2F53D 3AAZB 3B9VA 2XNAA 4L29B 1EHLL 1JGDA 3BKJL 3U7YH 4NN6C 2C1OB 4OUUA 2G75A 1FDLH 5HYJB 3RTQB 1F4WL 1MWAA 4NCDA 4Z6AT 5TPWH 1P4BL 4OCSH 5JIIA 2W65A 4YXLL 3RHWF 2H6PB 5I15L 5HYEA 2E6QA 2EXWD 4PJ8C 3QI9D 3DROB 3NCYS 3IU3B 3P73A 4HCRH 1U36A 4W4OA 3ULUD 3WFHB 2CIKA 3LQZA 4JRXA 2EH8L 2NNAB 5FGCB 4WCYH 1G7IB 3GSNB 3V6ZB 3DMMB 3SDCC 1M1SA 1EA9C 4JVWA 3B9KB 4R26L 2AABH 1KJMB 1BAFL 3VXUB 4KKNA 3KHQA 4LCYB 1NMBH 3C5JA 5C86A 4MNQE 3ARFC 3U4EB 3O45B 2HFFB 4XP9L 1R5VB 4Q9QL 4NNYA 1PG7X 1F4XH 5ALCH 1RY7B 2VLJE 2LTQB 4ZPTB 3WO4C 1T7WA 4NJ9L 5F7HA 1I1CA 5KSUB 1WSST 4FMFA 1MWAL 2VQTA 4WV1C 4BFIA 3BUTA 4OLZL 1FSKC 4JN2B 4OM0L 3KAAA 2NY1C 3DX6B 4PGEB 4G9DB 3BXNB 1H0DA 1NGWA 5E5MB 4FFYH 2AEQL 3GI9H 4NZUH 3VFMA 5C0AA 5HDOA 4RQQB 3ES6A 3AMKA 1E4XL 5D1ZB 4O58L 4XPFL 1AY1L 2Z92A 3HZVB 2IQAA 4ZPVA 43CAA 4EDWL 4RMSA 3DX9B 4V1DE 4XCCL 1CZ8H 5IT2L 4X7DC 4I3SH 5I73C 3AVEA 3RX8A 1ZHBA 4BZ2H 4NWUL 4EI5B 5CD3B 5CEZH 5J13C 1YEDA 1QLRA 3VXMD 3TBVA 1ORSB 1X5KA 3QQ4B 3HUJE 3JV4B 4ONHA 4MB4A 3SDDB 4KXZI 3L3OB 3QIBB 5E99H 1FLRH 3QR2A 3IJHA 2H32A 4DVBA 4PRBB 2HJLA 4JG1L 2YKLL 3PGDB 3IJYB 4X6EB 3VWJC 3EYSH 4KHXL 5I9QB 1XGPA 4RMTA 1ZGLA 4KC3B 1NGZB 3ARYA 4GFTB 4KK9D 1XF3B 1F4XL 4Y4FC 2EDHA 3WUWG 3KYMA 1YJDL 3GNML 3JVGC 4QRUB 5CD5C 5EIIA 3IDXL 1IILE 1JGLL 4OZHF 4P2YA 1N3NA 4LLMB 5I1DB 2VIRB 2YD1A 4AYFA 4HEPG 4JFXA 3TWCL 1N0LA 4PJIB 4EVNB 4N0YL 3QHFL 1NGXB 2BMKA 1QBML 3VH8B 3ULVE 3ARVA 3HE7A 4FFYL 4AEEA 1BFVL 3GI9L 3VFTA 1CTNA 5I1HH 1MCJA 3WKML 1NCWL 1EK3A 1D5XB 2I60H 3KPLB 4XPHL 3F5WB 4UT9H 2VSCA 2WBJD 2D7PA 5JORA 1I8LA 3MJ8A 2OJZH 1I7UA 2NR6C 3BP4B 3OJVC 5T1KA 3MA7A 3EYQD 1S9VB 1MY7A 3V8OA 1NBZB 5DK0B 1CFVH 1BQLH 5A16B 5JPNB 1YJDC 2ZP0T 2QTEA 3SGEH 3ZSTA 1U8IA 2BY1A 3HAEB 1MCCA 1RFDH 1PSKL 2JJVA 1FFNA 2LAAA 2V2WA 5ESAA 5FM4A 1KCKA 1I3UA 2H2SC 1E28B 1D9KB 2BY3A 4NO0B 1I8IA 4UZGA 2V5YA 3EGSA 1J86A 4HQQL 4J3VA 3CZFB 3AROA 4TUJB 5DJYB 1HILA 1I3RB 2XA3A 3A0OA 1UACH 4RIRA 1MI5A 1EZVY 2AERT 1F6AB 2WMPA 1DQDL 3E8UH 5LQBL 3S34L 1IL1B 3QO0B 3BFOA 5JDSA 2Z8VC 5C08A 1IGFL 4LCWB 4PRAB 4XNXL 1IKNA 1KENH 3MRLA 4GW1B 1H8OA 4FQPA 5I1HL 4OCLC 3OTTA 4P3CH 5TGBA 2B1AL 2R2EA 3UZEA 1F8TH 1ADQL 4AIZB 1ZTXH 3VXSD 4HUXB 2RFXB 4IEFB 4MYWB 4TSBL 3VXOB 3HZYA 1IZJA 3D3VA 1DEEA 2L7JA 1UCBH 3HE7C 1YMHA 2AKRB 1FFPB 3LB6C 3UJTL 2Q86B 4U1LB 1F97A 4NO5A 4KDTA 4QOKD 5CZVL 1CFVL 2C5DC 5C8JA 1QRNA 3QPXH 5DURB 3MLYL 4HWEL 3KJ6H 4S1SH 3TBTB 2NY5H 4R6UA 1AO7B 3IDGA 3GSUA 5DD3H 5DEFB 4LPWA 1G7JA 4HKZA 2BSED 4OZGB 3DXAE