4QHUA

Crystal structure of il-17a/fab6785 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
209
structure length
209
Chain Sequence
VLTQPPSVSVAPGQTARISCSGDNLGDKYANWYQQKPGQAPVLVIYDDIDRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCGSYDFFLGMIVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab6785 light chain
publication title IL-17A Asymmetry in a Complex with a Neutralizing Antibody Fab6785 Reveals a Potential Mechanism of Receptor Differentiation
rcsb
source organism Homo sapiens
total genus 50
structure length 209
sequence length 209
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhuA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhuA01
5L6YL 2UYLA 3TZVB 1JUFA 3DETD 2AVGA 4BK4A 3RVWC 2ZKHH 1AO7D 5D7JA 25C8L 3MLYL 1XR9B 4MVBC 4OFYA 2H2PD 1LE9A 3BGFC 4XNYH 2DQIL 4O2CB 1A6PA 3AM8C 3MLXL 5FDYA 4DVRH 1FLRL 4P46B 1MPAH 2VRAA 2J8UB 5FUOL 5BZDB 1RUQH 4EI6B 4QHKJ 3VG0L 1JNHA 2NXYB 1HN1A 4KRLB 4WJ5B 4Z7VE 3X3GH 1XGTA 1AXTL 1HDMB 4ONOA 4C4KT 3MRMA 4MSWB 3MV7B 3FQXB 3D25A 1CE1L 5ABDE 1I8MA 4N1EA 4Y88A 3EZ8A 5C0RL 4LFHG 1GGCL 1GPOH 3QYCA 3VWKB 3KLHD 4AT6A 4HPYL 5DDHB 2BVEA 3VFTA 1KFAL 3FFCB 2GJ6B 2X4QA 5CEZL 4YDIL 3KPSE 3UDWA 2FHCA 2HYMA 1N0LA 4JQXA 1HNFA 1FYTB 1KJMB 4NQEB 3IF1A 2C3HA 4KRPB 4QRUA 1UWGH 2OXHA 3ARZA 1U2HA 4M3KB 4WW2B 1M6OA 4KMTH 3S36X 1A8JH 2F15A 4B7IA 4HIEB 2Y72A 3ZE0F 5HYJD 3LSOA 1T1ZA 3K2UH 1FJ1A 4ZUSA 1TVHA 3FO1A 1MFDL 4PRAB 5ISZA 3NIFE 5EB9A 4U1IA 5E1AB 5DTFA 4XBEL 1TJGH 4OD1H 1OWRM 2EDWA 2HAZA 4WUUE 4P9HH 1X4ZA 4XC3L 3PL6B 3SE3C 3LPWA 1VADB 1T2QL 1MRCL 4OGYH 4JRXA 4JFXB 3QFDB 3VXQB 4FTVE 2BVUA 1KJVA 3BO8A 5IBLC 4PP1C 3RGVB 3THML 2B39A 4WTZG 4Y1AE 3PNWA 4RISH 2FO4A 2ZP0T 4P2OD 4JRYB 4HMDA 5I1DB 1T3FB 3LMJL 3AMLA 1RI8A 4P57A 4X7SL 4L8DA 4DZBB 1HILA 1KIRA 4LF3B 2G9HA 4HKBB 2JJTC 3FMGH 3D18B 1C1EL 3ULUH 4PRNB 4YNYB 4X4XA 4MAYD 5J0BA 2OTUB 1IGJA 1D6EB 3FB6B 2VISA 5A2IH 4ZPVB 4JZOA 1WJ3A 1WBXA 4OCYH 2GTZB 5HHOA 1J0YA 3KYKH 4XCNA 3QDHA 3VRIA 3MR9A 5FHBH 2YUZA 5DD1H 1BJ1J 1EV2E 4P23A 5JUEL 1LQSR 1JZ8A 3BP5A 1GC1H 3IFNL 3D69B 1N4XH 1P5VA 4WHYH 4ZUWB 4YHPA 3U0TA 3V52L 4KVNL 4JFEB 5TF0A 2BRQA 2N7AA 4E41A 2JJSC 4BSVB 4F3FA 4ZFGL 3O11B 3TWCL 4ZDHA 4HMEA 3E2HC 3KR3L 4QHMA 3LHPL 3U7AA 3KJ6H 3WS3A 3V6ZB 3D0LB 5INDB 5C09B 1CXFA 3JWOC 1QBLH 5LGHL 4XMPL 3HMXL 3MCLL 1T80A 2BRRH 1UKTA 3W39B 4Y5YC 2VLMD 1VA9A 2F5AL 1AGFB 5BRZD 4XB7A 1S7VA 5IB3A 3OAUL 5DWUL 3BKCL 1EJOH 2ERJB 4M6OH 4NCC2 1DVFB 3LQZB 3MO1B 2X10A 2BNQD 3HZKB 4KV5E 2MPAH 2YZ8A 2VLRD 5FXCH 1YMMD 4ACPA 3H6JA 3PHOA 3ARFA 4X6CB 4FFYH 5C9JA 2V7NA 4Z7WE 1SEBB 5D2LA 3C87A 4JFPA 1B3JA 1QLFB 1EZVX 1UB6B 4D3CL 3HTLX 3AU1B 3DI3B 3F5WA 3GSQA 3WNPA 1CD8A 1BQLL 3UTSA 1E6OL 5JTWA 2H32B 4YDVB 4P5KB 4LIQE 2YPLE 3AMKA 4OGAD 1XR8A 4LK4A 5CP7B 5KZCD 1KACB 1VGKA 1ZVHA 4R2GC 5DRWA 1YEGL 1UXWB 3S96A 2OI9C 3ALXA 1X5ZA 3SDYL 1PKOA 4L3CA 4OZIB 1U8KA 3O81A 2RCSL 2OJEB 3H3KA 1WC7B 3IYLW 4PJ8D 2F19H 3HKFA 1PW3A 4N0CC 3D0VA 1X44A 3BKYL 4JRWA 3IKCB 1TZIA 1BBDH 2VDMH 5ID1B 1TVBA 3FFDB 5SWZD 3H0TA 3SKUD 1OCWH 4I18B 4EDXA 3PDDA 1ONQB 3RPIA 1SM3H 3T09A 1SHMA 4G6JH 5CGYD 3SOBH 1ZVSA 4QXTA 4CNIB 4L9LA 3QQ4B 2BSRB 3UCRA 1U42A 1IBGL 3ZKQD 2NY2B 1OM3L 1MNUH 3QNXB 3SY0A 5JXAL 4PJCF 4PV9B 2R15A 1LO5A 4MJ4A 1RZ8A 4XBGB 4S1RL 2G5BB 2C3VB 2VO5A 3RNQB 5GRJH 2IH1B 1UCBH 3OAYK 4NQSB 5FO9B 4JCMA 1FSKC 4WHCA 4BSWA 4KTDH 3IXAB 4HDIB 3UZEA 1QO3A 4NWUH 4F37F 1RUAL 1NEUA 2Q3AA 4DN3H 4PJDF 1RZ7L 4QHLB 1J5OL 3UAJD 4NM4L 4MJID 5GJSL 3H7BA 1G9NL 4L4TB 5J06A 5DD0L 1QFWH 3X14B 4HC1L 2QBWA 4PRIE 4E42A 1EJ6A 5IFAH 5EN2A 1L7TH 3M1BB 5IK3A 3QUMH 4RQQA 5DJXA 1CGTA 1NQBA 3PQYA 4Y5VA 1MCBA 3RBGA 1I1RA 1X4XA 2CO6B 4G42B 3RVUD 3QEQA 4U6VH 1L6ZA 4YFEA 1KN2L 3QI9A 2NY3D 1QEWA 4S1SL 3RHWF 2YC1A 2P5EE 3S9DB 4CVXA 2QLVB 2D31B 3ECBB 3HZMA 4KHTH 3L3GA 4PLJD 4JE4B 3LKOB 4LASH 1JF6A 3SDXB 3T3PF 5GS0H 3GSNB 5I71C 2J8HA 4ERSH 1O0VA 3IDXL 4KDTC 5I8EB 5C8JB 1FO0H 1QKZH 1LE5B 4GJTB 1G9MC 4UTAL 5JIIA 2CUMA 3BSZH 4OCMC 3U6RB 2BVPA 1ZT4B 1DQQB 3DUUB 2PKDA 3MV9E 1GIGL 2R4SH 1S9VA 4LQFH 3QQ3B 4M62L 5F7NC 32C2A 1A6UL 3HG1B 4D2NA 5GSVA 3GSNL 4Y16A 5C7XL 3F58L 4X9IA 2GTWB 3LKQA 5I73B 2GAZB 4YXHH 2LAAA 1JZ4A 5H35B 2XQBL 1QLEH 1KN4L 2ORBL 3GMPA 4LVHB 5F7YC 2DM2A 2NTFB 3CX5K 1RULL 4Q9BA 5E7BA 4QRRA 1BEYL 1IGYA 2XY2A 5FKAB 5DD5H 5DEGA 3WO4B 3W82A 4QRTA 2XRAH 2UUDH 1SJHA 4GW1A 5D5MF 3WD5H 1ORSB 5I0DA 3DIFA 3QUZA 2HTKC 4IJ3C 4OF7A 1K4DA 4PRHB 1N59B 5D6CB 5C07A 4BZ1H 4IRJB 3S35L 1Z3GL 2XQYK 5EBLB 5L2KA 4WGVB 3ULUF 3C09B 5D7JB 5DEFA 3BDXA 3CFKA 5HXMA 3MNVB 4PJ7A 3DXAA 4YO0B 3O3EA 3GI8H 5FUZL 3AXLA 4JLRB 1DBJL 2FJFA 3NIDF 1MCPL 4LEOA 2F54E 2R29H 3QXAA 5I1HL 2MKLC 4M00A 1U8MA 4H5SA 3X12B 4Q9QL 4XXCA 1JNHB 4OJFL 3QJHB 4ZFZB 3EJJX 4EZMA 3MTRA 3HE7D 1QSFE 2E7CA 5K9OB 3O2WH 4XBPB 1YA5A 3CH1B 3D1MC 4PTUB 3LEXB 3TN0B 3AAZB 4PREB 5IW3A 1ZLSH 1WZ1H 3SQOH 3U83A 1TETH 5T5NG 1CU4L 1X5AA 4LAQH 2NNAA 1FIEA 4KJPC 2B5IC 2NR6C 4P3CH 5DUPL 5AZEH 2AK4D 4D9LL 1OB1A 4UB0H 7FABL 5HHXH 1KSRA 5JOFA 2BSSA 1JP5A 2KZ1B 3FCTA 4Y8DC 1YPZF 3DO3A 5TE4L 5T5FL 2O5ZL 1RD6A 1A0QL 4HK0B 1C12B 3IF1B 3P9LB 3F62A 3B9AA 1VENA 2ZCHH 3HNTH 4W4NA 5C2BL 1CD0A 3HS0A 5AZ2H 1RQ5A 3ARRA 3HA0A 1V7ML 3QXDA 1NGYB 4OCSH 1MQKL 4R7DA 4UNVA 2Q8AH 4O5LL 2GKIA 2AXFA 3KHOA 2OQJB 4LKCB 3VE0A 5DURD 4LSVL 5D96B 3QWOB 4HAGA 4NDMB 3D3VA 3TBTA 4YHZL 3STZB 2P5WA 5DHVA 4UAOB 2VQTA 1NLBL 3SO3B 3RKPA 1MIMH 3E3QE 2V17H 1J12A 3P0VL 2F58L 5CKAA 1BFOB 1GGBH 5EO1B 3LAFA 3D87B 3FL7A 3BPCB 5B38G 2X41A 3SE9L 4LBEB 2NW3A 2Q7YA 1MFCL 1HQ4A 1E6JL 1C16B 2VMFA 3CX2A 2VL5B 3BO8B 3LS5L 1KJ2B 1HIMH 1IKNA 1BVLB 4X80H 5DJYA 5MEOB 3REWA 4I4WB 1BGXL 1P1ZB 3WFEL 3MRQA 5DVOA 5F9AC 4IHOA 5DMGD 4ENED 3I75B 2P44B 1A1OA 1IEBA 3WLWC 3RWDB 1TVDA 4RBPH 5I2IA 1MCOL 3UYPA 3LEVL 3TV3H 5ACLA 1UH4A 1N3NA 3QNZA 3O9WD 1KJ2L 4C56A 2IMMA 3UJJH 4CU6A 1CTNA 1FP5A 4YBQC 2G75A 4XI5C 1A21A 1HHHA 4PP2A 3OGCB 1IGJB 1TQBC 5HDLA 4PRPD 5MENB 4TNVK 1N6QL 1FVCB 4JHZA 4WWKD 3ZTJG 3WS6C 5T1KB 1FFNB 4H0HB 5HHOB 5ITFB 3U2SB 2QQNL 2PYEE 5KN5B 4W6WB 5LAXB 5FOBB 5DZOA 1EZVY 4OD3H 2SEBA 4P23B 1LO4H 2DWEA 4YEFA 3BN9D 4YAQA 2O61B 2R4RL 4ZYKA 3WDIA 1R0AH 4XHJD 3PV7A 5IHUH 2VQUA 2VZ3A 3MLRH 1N7MH 4N8CH 4JO4H 2DB8A 4KFZC 1MI5E 3ARGB 4XAKD 3U0TB 2QTEA 1N8ZB 1LWRA 15C8L 1A9EB 4P5TB 1CDIA 4TQEL 1PLGL 2H2PC 3PGFH 4Y5XC 2DLIA 1T21A 3MRHB 4F3FB 3RL2B 4ZOEA 3KLAB 1TIUA 3VGGA 3NGBC 4XGZB 1WBYA 2BFVL 4Y89A 1ES0A 5L88L 3O4OB 1X6LA 2XTJC 1AFVH 4D9QD 2JB5H 2JELL 4HJJL 4G9FD 3GBLA 3T0EA 4K23L 3VU2A 1KTDB 4D0BA 5IV2B 2VDQH 1HWHB 3MACH 2XPGA 1NCUA 4Z76B 5E7FA 2M2DA 3P9MB 3WHE1 2X40A 4I0PB 1CFTB 4ZSOB 5ESQB 4PJ5A 4WDIB 1QSEB 2X9WA 1I1YA 1N0XL 3PV6A 4APQD 4JFPB 4GUPA 3MRIB 4Z7VA 3UMTA 2HFGH 2I60H 2XWJA 2BVOA 3BP4B 3GSQB 2A83A 1NFDA 1XFPA 3CMOL 3VFRA 3CDGB 3U7WH 4U1KA 5E8NA 4DW2L 4KK6C 3Q48A 4JPIA 1G9MH 5JQ6H 2MCPH 2HJFA 2E7LA 3B9DA 3WFDL 2IAND 1JPSH 3L7FB 1H3PH 1KPUA 2OTPA 1T66C 2VLJA 3S96B 3A0OA 1FPTL 4K94C 4L3CB 4WRLA 4PJCE 3FJTA 2EICA 4HKJB 3RUGA 1IQWH 2PCPA 2AGJH 1G1CA 1D7FA 3O4LD 4HIXL 4X8JB 1CQYA 2MOVA 2WP3O 1I9IL 2AK1H 4IDJH 1FNEB 4EN3A 5J6HA 1NAKH 3PWVA 2DIBA 3H0TB 5GHWL 1DZBA 4XNUL 3H9HB 4RFNB 2JCCB 3IU3B 4WHYG 5DT1H 4MA1C 2X4PB 5GGVL 4Q6IB 4PJDE 5F7EH 4R90H 3ZKND 1HSBA 1ETZB 4JDTL 5E00B 3FT4B 4LEXL 2XKSA 2YXFA 3X17A 1PD6A 3V4UL 4KAQH 4TSAH 1G7PA 1LO5B 1FNSL 1RZ8B 2ICES 3KGRA 4JDVA 4P2RB 4OGXL 4IRSA 4BUHA 2OP4H 1U6AL 5H8DA 4R4BA 1ZA6B 3MRBB 3VG9B 1A2YA 2PO6B 3O8XA 3UJIL 2OSLA 2VWEE 3Q5OA 1NANH 4WFFD 1ZHKB 2DJUA 3NOIA 4B5EA 1PQZB 3LRHA 5TJWK 3T3PE 1J1OH 5K59F 4FFVD 5C0BB 3MRCB 2DIJA 4BFIB 4ZXBA 5F70A 3H7BB 4MX7B 3W0WE 3OKLB 1AY1H 1BIHA 5E03A 2CXGA 5FCSH 5IFHL 4Z77B 3KJ4B 4KHXL 3QIBA 1YC8A 4Y2OA 1JJUA 1JYWA 1ZWIB 1HNGA 1DQLH 3TT3H 3PQYB 4OLUH 5GJTL 5IJVB 2Y6SD 2BXYA 5K9KB 4MGXA 4CVXB 2HFEB 2MMXA 1LK3H 1T22B 2G2RA 4XPBL 1WAAA 3MOAH 3L3GB 5C0AB 3KPRD 4LLYA 5SX4I 1A1MA 2OR9L 4KDVA 4FQIL 5DMIL 3MMEA 5DUBA 1A7NL 1HYRC 2VDPH 3DV6B 1RUMH 4UDUA 5D5ME 5K93A 43C9B 3QCVH 4GXVH 4JR9L 1HHKB 1F4XH 4LCCB 4OSUL 3JVGC 1Q38A 3EYSL 3U1SH 2FH6A 32C2B 4O4YH 3F7YA 3ALWA 12E8H 4HX1A 4KWUA 5D7KE 3ULUE 1YMHA 3BYTA 2YRPA 3B9KD 4V1DE 2RHEA 5FV1L 5T1DL 2X4NA 4OCXL 3GMPB 3MRRA 1H5BC 1OAZH 4C59B 1R3LB 1F11A 3NIDE 4ELKB 2BOCA 1NMAL 3CFBA 2KUTA 3DIFB 1I3RA 4P2YA 1S9WA 4QOKA 4H8WL 5ADOL 3WNLA 5EO0A 1K4DB 3VXUD 3DBXA 3V7AG 4OGAC 4OUUA 2CSPA 4KKCD 1N5AB 1PZ5A 5TH2B 5L2KB 2VDOH 1DLFH 2VAAA 1AQKH 3IKKA 2F53A 4JB9L 4N8VB 3NPSB 4G7YL 2EDQA 4KJQC 3DXAB 4PS4H 1D9KD 5KVEL 3MLPA 4NQVA 1Q9WB 1ROWA 2FJFB 1YPZE 3NZHL 4ZUUA 1INDH 4LEOB 2A1WH 1U8MB 4G3YH 5DEZA 5HGGS 1TITA 1FIGH 4G9DA 4MB3A 3UC0L 4JJ5B 4TSCL 3L9RB 3BDYH 4JPVL 1AD9A 5C0NC 1RZJH 2R0ZH 4LDEB 5CGTA 4ZFOA 2NX5D 4MD5B 3UTZA 1X5YA 1E27A 4NRYB 1XIWA 5I1IL 3VFOB 1D5MB 8CGTA 3KNBB 3EO9H 1FZMA 2E5EA 4PJGB 4Y2DB 2QR0B 4HPOL 5FGCE 1ZLVH 2N7BA 1OB1B 2P45B 1KIPB 4K07A 5EUOB 3MLUL 4MNHA 3DVIA 3BH8A 4A2LA 4W6YB 1JHTB 1PYWB 1BP3B 1U8NA 2NY4B 4M48L 3QUYC 4KZDH 4HLJA 5D1QA 2VXSL 1TTUA 2Z0BA 4ONGL 1JFQL 1A1NA 1DQTA 5JO5B 3VGEA 1FN4A 3CCHA 1FCCA 3OX8B 2VDNH 1MAKA 4RSVA 4K3DH 1TCMA 4MDJA 3UAJC 3KPQB 3QXDB 3KPOA 3TIEA 2AXFB 2NY5L 4M5ZL 4F7CA 2BCKA 3BIKA 1SMAA 3BZFA 1JGVH 4OQTL 1R3HB 2YBRA 5KVDL 3QG7L 5DMKB 1F4YL 3LDBB 1RK1A 4DUWA 4FQCH 3JTTA 1JF1A 3RVUC 4NZRH 1I9JH 2Q7YB 5K9QG 3CXDL 4JVWA 1LDPH 1J8HE 1FGVL 1HZHH 3WUWG 2YA0A 3G9VA 3MJ8A 1CDHA 4PLJC 2A77H 5DJYB 5EC2A 3MRQB 1UZ6F 1YNTA 2Z35B 3EKCA 1F4WL 1I7RB 3G6AA 3TO2A 2R1YB 2C3GA 3VDCA 2W0PA 4CW1A 1IEBB 3OJ2C 1HKFA 1CVRA 1A7PL 1S7UB 5TE7H 5I2IB 5F88A 1TJIL 5JQHC 1ZA3B 2CLRB 4DGIH 4M4RA 1W2KT 1OAKL 4K94H 3V7AE 3QG6B 4Y19E 5LGKA 5D6DA 4RAHA 2FZ3B 4KK8C 2XG4A 1MCRA 4PP2B 3U4AA 5ID0B 5ERWA 4AL8H 2J5LC 3QDGE 4AJ0A 1PG7W 5DYOA 4A6YH 3FQWA 4GS7B 1NBZB 4FABL 2VDRH 4HXBL 5D1ZD 1IC5L 2QSQA 5CINL 1P6FA 1IC4H 5DJ2B 4LCWA 2GJZA 1FL5A 5F9DC 4YX2L 1LEKB 4ETQA 4YAQB 1I8IB 1MEXH 2HRPL 3C8HA 1IC1A 4WI3A 4HUVA 3L3IA 4CJ1A 2DQCH 5IMOA 2FSEB 4PGEB 1DJSA 3GSOA 1Q9LA 4Y4FB 2KH2B 1JV5A 1RIHL 4AENA 5LCVL 1G6VK 3DV4B 3FTGB 3MJ6A 1U3HD 1J0JA 3RDTD 1PEZA 5E08H 3QFJD 2A2QT 1T20B 4CVZB 1WISA 3RRQA 3CH8A 3TNMA 5I1LB 1ZOXA 1HH6B 3GMMA 4PJIE 2ZG3A 4ODSL 5I19H 5TFSH 5E4IA 1A3LL 4BSJA 5GGTH 4ODUB 3LS4L 4JKMA 4M93B 2IMNA 4Z95H 3SE8H 1DE4B 1EIBA 5IHZA 4H88H 1B0WA 3V0WL 1GOGA 1A7OH 3MUGB 5BJTB 5B3NA 3PWUA 4R9HA 2HLAB 4YJZL 4MYWB 5FK9B 3IDIB 5JXEA 1YQ2A 1U3JA 2HTLD 4KROD 5E5MA 4X6EA 1I1YB 3PV6B 4GRWF 2HKFH 1G7HB 4K3JL 4OM0L 4GUPB 4Z7VB 1FAIL 1U8PA 1JPFA 2GQHA 4J12A 2XWJB 4OLVL 1ITCA 3VFRB 3DTXB 1ZEAL 5E95B 2IH3B 2W65A 3G6DL 3FO9A 4WW1A 5E8NB 1CGYA 5J57B 4CJ0A 3U0WL 4PJEA 3NCYP 2FBJH 5EU6A 3VJ6A 1S78D 3PE9A 4WTXA 4U1HA 4JFFE 3NCBB 1Z0MA 2VXTL 4YPGA 1KPUB 1MLBB 3KPSB 4LHUG 1SJVA 3EFFA 4OZFB 4PRBB 3G6JF 2W9EH 2NW2B 4MNQE 2FD6H 2CLVB 2BNRE 3IRPX 4XWGL 1ZGLA 4EN3B 3KLSA 3Q2CA 3EJZD 5FEBA 3PWVB 5EOCL 1M7XA 4P9ML 1JK8B 2W59A 1DFBL 3MV01 4X0KB 2NY0D 1BZQK 2FRGP 4DAGL 2YZ1A 4F9PA 4NKOA 5MI0C 1Q1JL 1VGEH 3C5ZA 3UROR 3L5WB 5EWIH 3U4EA 5CD3B 4NO2B 1CL7H 1HSBB 3EDDA 4XXDA 2O93L 5JHDD 4WUUB 2PN5A 2A74A 1CN4A 3QUKB 1MLCA 1G7MA 1PG7L 2ITCA 2W60A 3SJVE 3VA2C 1G7PB 3HI5L 4OKDA 1PY9A 3N85H 5D7SL 5EZIL 1NDGB 1A47A 4TUOA 3CLEL 1T83C 2CQVA 2NZIA 4FTVB 3WNNA 3RI5K 3ULVF 2FJGB 4BJLA 2M1KA 1HXMA 4Y1AB 1LNUA 3O8XB 3RWJA 2A9NL 4DKDC 4Z7NF 3RBSA 4J7RA 1MCJA 1T1YB 4YK4B 4CDGC 2V2XB 3MREB 1G0DA 2DQHH 3WFBL 4FQLL 4ZXBB 1M71A 5C0DA 1QFHA 4P59H 3HCVA 1IAIM 2W92A 1RFDH 4MCYA 5BXFB 5C0EB 1AP2B 3TJHD 1CICD 1NGQH 3BN9C 1OY3B 1X5GA 3GGWB 3MOBL 4TVPH 3CDCA 3WIHA 1KENL 5IB1B 5TF1H 4FQ2H 3IDYB 4XZUA 4HUWB 4KRMB 1YEDB 3X13B 1JRHI 2Q6WA 5ALBH 2XKUA 1ZE3C 1QQDA 2PYEA 1W72A 1EHLL 1WEJH 4RNRA 1P7QD 4JM2A 4XP6L 3OL2A 1D5XA 4K8RD 2QQLL 2O5XL 4UINL 1N5YH 4RDQF 5CGMA 5ENWB 4HCRH 2AXGB 3SDAD 3QNYB 4DJMA 1AHWB 2VC2H 4Z7QF 4WEMB 1XGRB 4R26H 5EU7C 4Z0XA 3QDMA 2GI7A 4LOUD 3UBXG 4I3SL 4K3GA 3ZE2F 2D7TL 3HAEH 3M8OH 5GGUA 4K9EC 4NN5C 1WFUA 1P2CB 3NCJL 4HX1B 1A4KA 4AEHH 1I3GH 4UT9H 2HLFD 2XA3A 2CGRL 3QWRA 1A7QH 2B2XH 3DUSB 4XP1H 2EIBA 4X7EC 5IESL 3AUVA 2R2BA 3MFGB 5F44A 5D4QA 4WENB 3P2TA 2GFBA 5JPMA 3QBTB 1XZ0A 4LDOB 4NJAH 4APQC 4BKLA 3PWPE 4OIIH 4M6NL 3P0YH 3KWWB 3V6BR 4NQDA 4NZTH 3ARSA 4XTRD 2EEDA 5HI3C 3S97C 3I3DA 3LPFA 2VXQH 5DSCB 3BYYA 4OCRL 3T2OA 3L1OL 4PD4J 2YRZA 2ADFL 4D94A 2ESVA 4QEGA 4LRNL 5I1AB 4Z7WB 1IM3A 1YNKH 4U0QB 5F1OB 4ORZC 1QYGL 2IC2A 2D0FA 1S7XA 4U6XA 1F8TH 1P4BL 2FECI 2BSED 3VD9A 4XNZC 1L7IL 3AB0C 5HYQA 3PDOB 2COQA 4G8GA 2YPLB 1QSVA 1CBVL 2Z91A 3U7YH 1IE5A 2YD3A 4XMLL 1VHPA 4NC0B 2EO1A 5D70L 1BREA 4ZO6A 5E56A 1AD9B 5FOJA 1LD9B 4YLQT 3UTPE 2RIKA 4I0CC 2FWOA 4XH2A 4JFDE 2IAMA 3ZHKA 4HIJB 3ROOB 1WZLA 4ODXA 1IEAA 1Q8MA 5IMMB 3FN9A 2AJUL 1BJ1H 1DBAH 2HFFA 1MJ7H 1UENA 4D0CB 4LIQL 4WUKL 1SJEA 4DUVA 5I1GL 2DLEA 3S5LB 4H1LH 3DSFH 4MNHB 1MVUB 4NNYA 3ZYIA 1M1SA 4P46D 5HHPA 2R56H 1YN7B 3BMVA 3BMWA 5BS0D 2YPKA 2NY6B 5EZLA 4N9GA 5D1QB 3VXTA 4YZFF 4LSPL 1KULA 2NXYD 3EOBB 1X5XA 1DDHA 5CEZD 4C54A 2A73A 3GKWH 5J12B 4I9WD 4F58L 1UZ6E 4WI5A 3B83A 3MV7D 2F74A 5F3HA 2FL5B 4UT6L 3CVHA 3QRFM 3DRQA 4Z5RB 5E2WL 1VSCA 2BCKB 1H3WM 1EHAA 3VWKD 4LPXA 5E6IB 2AQ2A 3I9GH 2YEZB 3QPQD 5F6IC 3U48A 1TZHB 3BQUB 2GJ6D 4S2SA 3RJDA 3QJFA 3RPKA 1H15A 2ZUUA 3BGMB 1U8IA 2Y6SC 1FYTD 2X4UB 3IRZA 3MA9H 2I5YL 1FBIH 3HR5B 4FQQA 5CMAA 4KRPD 4LPTA 3GRWH 5ETUB 3QCTH 1KXTB 5F9OL 4XCCL 1YNTB 4ONHB 4PRIB 3G6AB 1UH2A 2C1PB 4MXVF 5KOMC 5K9QI 1AXSA 2G60L 2I9LB 2E7HA 1CGUA 1R3IL 4ELME 1EFXA 3SKMA 1OQXA 3C5SB 5KBNC 1T0MB 2J8UF 2P5EB 3LIZL 4OZGA 4Y4KB 2ZUTA 4NCC1 3O6ML 2VERN 1VEMA 2Y07L 1TNMA 2OZ4H 2H2SD 3W9EA 5TQ0H 1L4IA 1BFVH 5ERWB 1FL3B 3CSGA 3B9KC 2YWYA 4HWBH 3FAXA 5CJOL 1S7WB 4KKBD 4YHOL 3MGTA 3LKNB 4P4KA 1A4JA 5DYOB 3RGVD 1F4AA 3MNZA 1RJYA 3X3FL 3VXSD 1HH9B 5C86A 3MV9B 2GHWB 4YFDB 4JRYD 4OZHF 1FL5B 3HC3L 1J0ZA 2I24N 1IKFH 4GSDH 2FEDD 3DGGB 1U8QA 3S37H 3ARFC 4XB8A 3WEXA 1MOEA 4J1UA 5DJAA 3L3JB 1GGIL 1Q9LB 3QEUA 5I1JH 1QRNE 3RWHB 1NCNA 3H42L 4P5MA 1QOKA 5D2NE 1XGYH 3MRPA 4GQPH 3R1GH 1U8HB 1DUYB 4JN2A 1WIOA 1UADC 2D03L 1EA9C 2R2EB 2IALB 3G5XA 4FXGA 5D7IE 5IB2A 3KS0J 2DICA 1TFHA 5AEAA 3KVQA 4NSKA 5M95B 2EYSA 5DD6B 3B9EA 3L5HA 1NCWL 3U9PL 5B8CB 1HINH 3L7EB 2P7TA 3VFPA 3T77A 1CR9L 3B4NA 1CXLA 3IXTA 4JFED 1YZZA 3AS3A 2P8LB 4TUJB 2F54B 5JW4Q 4X6EB 4E5XB 5BOZG 3L3DB 1U93A 4XP5L 4U1JA 5DS8A 1QSFB 1T03L 1A6VH 2B1HL 5C09D 4OLYH 4YBLB 4L9LC 2W65B 3CIQA 4FG6C 4TSBL 4P2QE 3VWJA 4I5BB 3OKDB 4JHWL 4G5ZH 2FGZA 2IFFH 3AROA 1DVFD 2UUDK 3I3EA 2Y4SA 1XCTA 1P6AB 4PG2A 4HQQH 4U0RC 1MJ8H 1AGCA 2AW2A 3K1DA 2IJ0C 4K9EH 3UXFA 1TJHH 5CILH 3VXME 1HQRA 2B20A 1URLA 4FFZH 4DTGH 5C92A 2R8SH 1CF8H 4QRSA 1A14H 4NJ9L 4IOSD 4XNMB 4EI5A 1ZGLB 4GKOA 4JAMA 3ULVE 3H2WA 1WWBX 3MRFB 3GIZL 5EOTA 5A2LH 4BZ2H 5E9DA 2HRLA 3MC0A 4PB0H 3MBEA 2I25N 3HZVA 3GJFK 4NKOB 3UTQA 3MROB 3ZZ1A 3BEVA 5I74B 1PX4A 4XXDB 1KXVC 3BPOB 1NGPH 3LEYL 2EDYA 2A74B 1MIEH 1MLCB 4Y5VC 1G7MB 1IQDB 2CRYA 1CG9B 3QWQB 1I9RL 1FNHA 2O5YH 2R0WH 4MD0B 4WO4A 4Y4HA 4CN4A 1VEPA 5T1LD 1E4XL 4FQHA 3I02A 1QLRA 3NCMA 3QDJE 4MA7H 2HT4D 2NLJB 3TYFA 1CDYA 4DGVL 3IDNA 1RHHB 1XH3B 3RA7L 1VKXA 5F9WC 5SX5H 1S7SB 5GS2D 4MMZC 2J3SA 2XTJE 1XGQA 3NZ8B 4TYUA 4M5YH 2QHLA 4JFYB 2XWTA 4DZ8A 2CIKB 1EHNA 5EO9A 3OKEA 4GKSA 1WITA 3JZ7A 5CP3A 4RAUA 1CTOA 4ZOBA 3V7MA 3RIFK 3ILQC 4XVSL 3R8BB 1WICA 5F89A 4BH7A 2Z4QB 4NQCA 3AM8A 1CLZL 4MJ6A 1QNZL 1S3KH 4MD4B 5KSAA 1MRFH 4HD9A 5B39G 3N0PB 1T5WA 1GHFH 4CKVX 2Q6WB 1U3HC 4S0SD 1AIFB 3P40A 4YE4H 3OGOE 5CWSB 2PYEB 5HDQH 4R3SA 4LNRB 3X11B 1OP5K 4GRLB 1I75A 5HGHB 5DJZA 2VLKA 5IR1A 3IAPA 1RUKH 5I9QB 3RX8A 1UM5H 1IAIH 2IQ9L 3FQUA 3U9UA 2V2TA 3LD8C 3MYZA 3WLBB 5TPWL 4L4TD 4M7JH 4OZIF 5C6TL 2FNBA 1R5VB 5I6XB 2QKIB 2PUQT 1MI5B 5K9JL 3QDMB 2YD8A 5TGBB 2CMRL 3VCLB 4M61B 2W07A 5GGUB 1QA9A 4KZEL 3NN8B 1FDLH 5E2JA 4RBPK 2ADGA 2R2CA 5C0CA 3LH2H 5B4MD 5MP6L 1FO0A 3TH2T 4XXCC 5JPMB 1XZ0B 2ATKA 3UBXI 3Q5TA 4BKLB 3T0DA 1CDJA 3MV8A 3QIWA 2ZZUT 4RFEA 1OPGL 5DVLA 4DGYH 1RK0B 3Q6GL 4P3DA 1YDPA 2VLLB 2XN9E 1DLHB 1HI6A 4F57H 4F33A 3K80A 2XT1B 3VDAA 5FO8B 4WCYL 3OJVC 1NGWB 1OW0C 4FP8L 2CIIA 3SE3A 1S78C 1IAMA 1MF2H 3GO1L 4PJHF 2FX9L 3HG1D 3B6SB 4OTXH 3MNWA 3V4VL 1SY6A 3L3OA 4ZPTA 5FYLE 3ESVF 2OM5A 5CSGA 1S5IL 5B38B 3IJHB 3MYJB 4L9DA 1B0RA 2DQUL 4U6XB 3RX5A 3V0VA 1K2DA 4HK3N 1KGCD 3DX9A 3WUWA 1UEYA 3NIGF 3PABA 3KYMA 4FZEL 4EXPX 3LQAL 4TPRL 5LXGH 4M7LT 4PJ9B 3DROA 3L3HA 3N9GH 2NY0C 3UTTA 1XGUB 3GBML 3M17B 3LVEA 1RJLA 2BDNH 2EYTB 3MRLA 4PRHD 1NLDL 2DKSA 4ZS6C 2XYCA 2FWOB 4IRJD 5CEYB 4PJCB 2JJTA 2ZJSH 3G5ZB 4CL7A 3D48R 2MFNA 4FXKA 4ODXB 4TUKL 5E2TH 2ADJA 2Y7QA 3GJFA 2OBGA 4UI2A 3SDXF 5HVWA 3REVB 2VDLL 2ZKHL 3VXRA 4WNQA 1K8IB 3PIQB 1SJEB 2Q8BL 2GW5A 4Z0BH 1KC5L 4LKXB 1K5NA 3F65A 5I8KH 4OD2A 2LAGB 1RMFH 3C5JB 4NKQB 5KG9A 4P99A 5EZLB 3ARDB 3P4NB 2ZSWB 4XNYL 4CMMB 2OS7A 4IOIB 1FZOA 4J4PA 3HAEG 3WJLC 1NC2A 4DVRL 1MPAL 5IT2H 3VFNB 4KPHH 3TN0D 2F74B 4NQXA 1RUQL 1ZXQA 5C08E 1I3UA 1T89A 3BPNC 2AEIT 1KYOJ 3Q6FA 3X3GL 5CBEB 3ULSA 4KK5D 5HVHC 3AVEA 3RWCA 5L0QC 5IF0B 3PXHA 4UOJA 5HDBF 2J8UE 1JNNH 5CHNB 5DGQA 1GPOL 3O6FA 2DWDB 1U8IB 1MELA 1OTSD 4WFEE 1FFOA 4Y5YA 5MEPA 1A02N 5CMAB 2IPKB 1RZKC 4ZAKB 3W0WB 3CZFB 2OL3A 4K8RC 4AH2B 1UWGL 4OZHE 3SDAC 1EFXB 2FDBP 3SKMB 1WLHA 2ED8A 3EO1A 1HKLH 3CSYA 1KCVH 3K2UL 1LEGB 5FYKU 2EDLA 4J3OC 3SQBA 1ZHBA 2H3NA 4K7PX 3DHMA 4TRPH 2HH0H 5CCKH 2V7HA 4IM8A 1HYSC 2HLFC 3KXFE 4NQEE 3U30C 3EAKA 3BD4A 1TJGL 4U1SB 2BVQB 2GK0A 4OD1L 5E8OB 2WIIA 2HJLA 5DJ0B 1EUTA 3JTSB 4P9HL 3WFHA 4L3EA 3MGTB 3EYVA 3RWEA 5D5MB 3SHSA 2P4AB 5FUCE 1NDMA 3DMMB 4OGYL 2AJ3A 3T08A 5CIPA 1MCIA 3SCMB 4PUBH 5GS1B 4XTRC 1VCAA 4W70A 2V5SA 4AIZB 3SGKC 1JBJA 4TVPE 3V5DA 2Z31B 3B43A 3HFMH 4AY0A 4BH8A 4GW4A 1KB9K 5F3BB 4V1DB 3OTTA 4LHUA 4XCYA 2X4TA 2DQDH 1TPXB 4WFGE 3VGAB 5F7UA 3T0VA 1NAMA 3W81A 2BMKB 3TBSB 4FMFA 4DKFH 2D2OA 5MEND 4ZTOH 2VIRB 3WYRA 5DD3H 1G7LB 3WE6A 5T1KD 1D5ZA 3FMGL 3NH7H 3ULUL 2GSIB 1RAMA 4LDLB 3S37X 1MFBH 1BD2E 4KQ4L 2HJKA 2E7LC 2NZ9D 3QO0A 5D93C 1VACB 5JW5A 2VH5H 4OCYL 4HFWA 5FHBL 4HKXB 5EZJA 4NWTH 1T2XA 4YGAB 3ARGD 4X4YB 3VFPB 1RY7B 4QGYA 4P5TD 1P4LA 5E2VH 1FE8H 5BZWB 4PJBA 1GC1L 1JGLH 3AS1A 1N4XL 3FT3A 2MJWA 3ARQA 1MFAL 3MLTB 4C83B 3RWFB 1SYSA 1MCCA 4MZ3A 3ZHDA 2EDDA 4YPJA 3HE6A 1WSST 3D5OF 2NXYC 3UZQA 4C4KO 1VERA 3EGSB 4MWFB 3K4ZA 3OKKB 4MA8H 3IDGB 2IBGA 3F6IA 3KJ6L 2BX5A 1QP1A 1YJDH 5LGJB 5DO2D 3V5HB 1QBLL 4JEGB 5FGCB 2GYSA 2BRRL 1XGPB 5HPMA 3OAZH 4I0PD 3VWKC 3ZO0A 2K7PA 3VD7A 1EJOL 3QPQC 4J23A 1HQRB 1QSED 3OJDA 4XVJH 1ZT1A 1B2WH 1MH5A 3QO1B 2MPAL 3G08A 3TFKD 4KDTA 1ORQA 2ED7A 4JY5H 4LLWB 4M43H 1S7RB 3NFSH 2WQRA 5EUKA 1J87A 4FFYL 3OXRA 3RZCB 4KRPC 3OR7A 2Y9RT 5AYUH 2A0LD 3UTQB 1S9YB 3GSRA 2FJHA 1OGAA 3ARED 3QIBC 1F97A 1EEYB 2Y1VA 2R2HB 1BQSA 2ZCLH 2CK0H 5I1KL 2EDKA 1CGVA 3UBXA 3ZKXB 2P24B 3O3BA 1F3JB 4UIMA 4HIIA 4Q9RH 4HKZA 2AEQH 2LE9A 4YHNA 1J8HB 1IC7H 4M8QB 4ALAL 5I0ZA 5BQ7B 2BXZA 4L4VA 3P30H 4G6AC 3TEUA 2C4FT 1ZLVK 2DM4A 4JO1H 2B0SH 2PETA 1WTGT 2ZCKH 3G5VB 4G6KH 4KKBC 3MUJA 2F19L 5B3JF 4P2CG 3RGVC 1NC4A 5H2BB 3OB8A 4MS8C 4ELMA 1BBDL 2VDML 4Q74A 5EO9B 4JANB 2CDFA 3OKEB 3PHQA 4GKSB 1T7YA 3C08H 3EUUA 1OCWL 1I1AA 5FYJU 3PWLA 2I07B 2HN7A 3JWDC 3F7RA 1S5HA 3BGFB 4G6JL 5AG8A 4Y19B 1HHJA 3SOBL 5F89B 1QRKA 1T4KA 3P4MB 5D2LF 4QRPA 4HAFA 2GK2A 2Y36H 3IDJA 3F7VB 2DLTA 2E6JA 4P2RD 3AC0A 1KELH 1MNUL 3QDGB 1DQJA 2WWMC 3HPLA 3RY6A 2PO6D 4IIQC 4BFEA 3AS0A 3FRUB 5GRJL 1CXHA 4FA8A 4Z7UA 1F42A 1U3YA 1UCBL 5KVFH 5HYSB 5C0BD 3FQUB 3U9UB 4CN1A 1MFNA 3QUMB 3OXSB 4NWUL 3GSVB 2R0LH 3T65A 2APTA 5FF6A 5T1MB 2R1XA 3W9DB 1BVKB 2H8PB 4MQ7A 3BZDA 1BZ9A 4U05A 4CU8A 5HY9A 5I66B 1ZVYA 1QA9B 1QFWL 1YQVH 1FGNH 3N1GC 3OQ3B 5HHQA 3FOMA 4PJHE 3UO1H 4YR6B 5IFAL 3S8WA 1B6UA 1L7TL 4FQXA 3QUML 3T0WA 5DRZB 4X6DE 1FO0B 2D4DA 3CD4A 4PJIB 5C0AD 3TPKA 1FZJB 4GT7A 3CXHJ 4M7KH 1FZKB 3IFOA 4U6VL 2ZPKH 1YYMH 1RZKH 3E6FB 5F7DA 3ET9F 3NIGE 3HI1B 3SBWA 1HI6B 4UU9A 1ZS8A 4WGWB 4K8RH 4UTBH 3LY6A 4KHTL 1XIWC 5FM8A 4YFLI 5EH1A 4YXKH 2DDQL 4NPYB 5GS0L 4UOW1 3K7UA 2VZOA 3D85B 2ERJC 2P43B 3ES6A 4MJ2A 4ODWA 4XNQB 1CL7I 2V2WA 5MHSD 5J1AA 1FO0L 4PIRF 1QKZL 3EJYD 5IMLA 4QXUH 1JGUH 4AQOA 3BSZL 5CZXD 3MNWB 2CUHA 1YY9D 1EPFA 1QVOB 4Y8AA 4LQFL 2R9HC 1B0RB 2DN7A 5IHLB 1QHPA 1K2DB 5GGQH 3ZMRA 1T6VN 4UQ3A 4PRPE 4K3HA 4ODTL 4M6MH 5HHVL 4U1GB 3WUWB 4P2QA 4RGMC 4YXHL 2WQ8A 1ED3B 1QLEL 3L3HB 2K9UA 2BC4A 3FQNA 2H6PB 4OCNC 4XNXH 4JFFB 3LV3A 3TA3A 3MRLB 4LL9A 3GB7B 4HZAA 1BLNB 3GSXA 1CDUA 2XRAL 2D9QB 2WINA 1AR1D 1TTGA 2AEPH 4QHKI 3FZUC 5I16A 3WD5L 4BELD 2H9GB 4FXKB 2R1WA 4U1MA 4MNQB 2Y7QB 3AS2A 1MHCA 1LK2A 2BNRB 5CJ8A 3S6CA 1J0KA 5IQ9A 4BZ1L 5IBTH 1LHZA 4OF5A 1KB5H 3WS6A 4N90D 2OX5A 5CEXA 1K5NB 4OD2B 5H94B 4E0RB 5KG9B 4ZODA 2I9TB 3HZYB 3VRJB 1IAOA 1RVFH 1F6LL 4ODHH 1M7DB 5LQBH 1DEDA 5HHME 1P7HL 1MFEH 5KSUB 3LKPA 2R29L 4IRZH 2ED9A 4JY6A 3SJVB 2JK5B 3V2AR 1AO7A 4JFOA 1MQ8A 1UB5B 3Q6FB 3V5KA 3VFGH 4H26A 3ULSB 3O2WL 4Y2DD 2CJUH 3ILPB 3VG0H 3LN4B 1ZLSL 1WZ1L 3SQOL 1CDGA 1TETL 7CGTA 4PGZA 3GSWB 4GQ9H 4LAQL 4JM4H 1Q9OA 4MJ5A 4G8FA 4DN4H 1CE1H 1NJ9A 1H0DB 2GITA 4NO3B 1BZ7A 4UB0L 1XF5A 4GKZA 5MEPB 5IGXH 5HHXL 3BZ4B 5TE6H 1G6RH 2VE6B 1II4E 5F21B 1UVQB 5FCUH 3C2AH 2YSSA 4HS8H 5ECJE 3UJTL 3MRKB 4KTYA 5FECA 5DK0B 3EHBD 1CIDA 4WU5A 5AAWA 4GG6A 4PJ7F 4HUUB 1KOAA 3MJ9H 1IGFH 4GW5B 2ZCHL 3HNTL 1I1CA 2V9RA 4NOBA 2YN3A 1IGMH 3CSYB 5E5UB 5AZ2L 1AGBB 4JPWH 3QIUB 4OCSL 4MAUH 1A6AB 1I7TA 3C60D 2V7HB 1J9CT 4OT1H 3BEWA 2EH8H 1A6TB 3O4LE 4LLVA 1XF2A 4OFVA 5J8OA 1MIML 2XOTA 2V17L 1OL0A 2X1WL 1ZSDB 1GGBL 5HYJA 4HXAH 3J7HA 3MRNB 5EBWB 2WUBH 3C6SB 3BRFA 1UXSA 5ISZE 4PJGF 5CJBA 4LCUA 1B90A 4WV1B 5GGRY 3K4AA 1HIML 4R97B 1P4IL 5E6ZA 1OP3H 1BJ8A 4X80L 4NRZB 4UV4H 5A16B 3C2SA 4OB5H 4BH8B 5DMYA 3BDBA 1SYVB 4LHUB 4JRXE 2X4TB 5JW3H 4A6YA 5L7XL 3PWPB 3TV3L 4LVOC 5FHAH 3SEPA 4LVHC 3UJJL 4EBQH 1KG0B 3HI6H 4WFFE 2WMPA 4KQ3L 4P2OA 4YH6A 5TDOB 2HJKB 5TDNB 4DUXA 4KUCD 4LU5H 4HFWB 1IFHH 1LVEA 3V6OA 4HWZB 3JWDH 3U46A 3C09C 2CLZB 4N0UA 4OD3L 1FG2A 1LO4L 4Y4FD 4Q9CA 5HGDB 4MAYA 5IMKA 3OPZH 4L1DA 1P4LB 1R0AL 3RVVD 5I8CA 5IHUL 4EQ2A 5EBGA 3TCXA 3GI9H 1N7ML 4N8CL 3FT3B 3ABZA 4JO4L 5GSRA 4F9PC 3C5ZC 3FQTA 5F7FA 3PGFL 3KPRE 3T4AB 4FS0A 4LPCA 1A3RH 1B4JH 2GT9B 4KKAC 4JFDB 4Z9KB 2OYPA 4QY8A 4KVNH 4QNPF 1JTTA 3DX6A 1JMXA 4LGRB 4PB9H 1CLOH 1AC6A 5L8JB 1AFVL 3GMOA 1R3KB 1U92A 4U49A 1MWAA 3S88L 5KSVB 1JNLH 3VFSA 1OHQA 4E41E 3NCYS 3VMNA 4YHKH 4KK5C 5EZOH 4XMPH 5E94A 2VDQL 3MACL 5JZ7D 3TCLB 5KVGH 1ZT1B 3A6CH 1K8DA 4LLQA 3K1KC 3O41A 1U8JB 4MLIA 4NBZB 3SDDB 1G84A 1ORQB 2A9MH 3EYQD 1HOCB 2ATPB 3BWUC 1DR9A 1VESA 4WHDA 4X4MA 5EUKB 5J4MA 3C8KA 3HRZB 5BRZA 1T5XA 3MODH 1U91B 3DYOA 4NP4H 2RQ8A 2LABA 5B3JE 3GMLA 4X99A 2FJHB 2HFGL 5GRVK 2HG5B 2BNQA 2I60L 1QD0A 5TDPA 3DVNA 2VLRA 3KPNA 1YMMA 3O3AA 3F6LA 3U7WL 5CSZB 1DBKH 4N0FA 3KPSD 2DF3A 3HRPA 3T2NH 4UIMB 1G9ML 4UAOC 3CFCH 3N06B 5JQ6L 1H5BA 5D2LE 4CDHA 4JJHA 3MRJB 3VFUA 2FX8H 2ITDA 2MCPL 3SPVA 1JPSL 4PLOB 5EORH 1H3PL 3WXWH 1UM6H 3UTSE 1W0VA 3WIFB 3D39E 4NZJA 4YDJB 3WJJC 1IQWL 4IJ3B 5EPMA 2AGJL 5EBMB 3VXNB 1UM4H 2AI0H 4M1DH 3S36H 5D8JH 2AK1L 1NEZG 1NC4B 4IDJL 4NQUA 1NUGA 3QULB 4ELMB 3RVXD 1NAKL 1UKQA 1Q0XH 4WUUD 1KIQB 1WIPA 4I3RL 5ICYA 4NFCA 2HN7B 3JBG7 1S5HB 5DT1L 2X9XA 5F7EL 4R90L 4Z7VF 4PJ8A 3NABH 4LLDA 1VEOA 2HT2C 5ACZB 4J6RH 1TDQA 4EUPA 3EZJB 4FTVD 3HUJA 2VL4A 3KPMA 4XHQA 3W11D 2AQ1A 4KAQL 4TSAL 4TN9A 5SWZA 4Y1AD 1IBGH 2YHGA 1U2CA 2IBBA 3NTCH 5GRYA 5JXAH 3O6LH 1FV1A 3B3IA 5EC1B 4HGKC 1ZAGA 2OP4L 4QO1A 1U0QA 4X5XB 4Q2ZB 1EAJA 5GS2H 5IEHA 1CFSB 5FGBC 1MJUH 2B5IB 4U6HA 4M3JA 4X7TA 3RUGF 2AJYH 2R1XB 1J1OL 1P9MC 3I6LE 4MQ7B 1QRNB 1RUAH 3A6BH 1AY1L 2ZG2A 5HHNA 5D2NB 3ARGC 3CVIH 3GMQB 5CJQH 3ZL4L 4G8EB 5INCB 2MSPA 2FEEI 4HHAA 1DBMH 1IEHA 4HGMA 1JGDB 1WFNA 5FV2A 1DQLL 3TT3L 1ND0A 2OTWA 4OLUL 5SWSD 2Q86A 4HF5H 4JFQA 4MJIA 2C1OA 5D7IB 1FL6B 3FB7A 3O4OC 5D1XD 1LP9E 5JDSA 3QR2A 1ZS8B 1LK3L 4NKDB 3HAEA 5C0IB 3SKNB 2EE9A 3MOAL 3KPPB 2MHAA 2XWBB 1FNAA 1KUMA 1DANU 1F6AA 2PXYB 3NFNA 3ORJA 2PR4H 3QEQE 5L9DH 1GZQB 4LFHD 2VDPL 1KT2A 1RUML 1KCRH 2ZOLB 4JFZH 3GUTA 3QCVL 5DZLA 8FABB 4GXVL 1A6ZA 4POZD 5J13C 1F4XL 4I48B 4L8BB 3U1SL 4M03A 4O4YL 2FO1A 12E8L 3TFKC 5IJKC 3F12B 4W81A 4H25A 1BOGB 4V2BA 4P2QB 3MFFA 3SE4A 3IFPA 4TNVF 1ZHNA 4ZUVA 1N2RA 4OFIA 1HSAA 2BC4B 4JZJC 4HUXB 1OAZL 4NGHH 1JYNA 4M9PA 4AMKH 4OAWA 4PLKC 3AREC 1U8LA 5AWNH 4HG4J 5DRNA 1NFKA 3VXMB 1BEYH 1IL1A 4Y7MA 4NKIL 3QEGH 1WAAF 1JZ6A 3S3PA 1TQBB 5CLTA 5HYFA 5IQ9B 2VR4A 4F2MA 1IGCH 1MCQA 1H3VA 4QRRE 1AD0A 4NHUA 2VDOL 5C1MB 1DLFL 1MHPH 1AQKL 2VN4A 1Z9LA 1P84J 2YPLD 1WCBA 2HMID 2ARWA 1RJZA 3TVMD 4MNGA 5HI5D 5C07E 1IAII 2YK1H 1INDL 3BE1H 4BK5A 1JN6A 4Q6IC 5L2KE 4G3YL 2BY1A 5ALCH 3ULVL 1FIGL 3V5KB 1Q72H 3TH4T 4Y5XB 4PJ7E 4KKNA 5SX4H 3DXAE 4YHYC 2IBZX 4U7MA 1BECA 1RZJL 2R0ZL 3FO0H 4QTHA 3QDJB 2YOCA 2ICCA 2X4RB 4HIHB 4ZUTA 4HMCA 4S1QH 1PGRB 2HWZH 3NGBB 1Z5LB 3R0MA 3CFEB 3CUPA 4P4KC 3RNKA 4NO5A 3EO9L 1AKJB 4RIRA 1OF2A 2XTJB 4UUJA 4DCQA 2NY6D 1NBYA 1X5LA 3VG9C 3LRSA 4GXUN 3HE7A 2APBA 1I7ZA 4PGCA 2FLRT 3RL1A 5DQ9A 4KZDL 5FECB 5I75C 3CFJA 4MA3A 4Z7WF 1G7IA 1QPXA 2C4XA 2K3TA 3AFLA 4H20L 5FB8A 2VDNL 2AK4A 4K3DL 2XY1A 5E6ID 3VW3H 1EEZB 2W0KA 1BQHG 5A3IC 4XC1L 4ZG1A 3BQUD 1AJ7H 3DLQR 4KVCH 1MJJA 1XF4A 2BSTB 1JGVL 3ZTNH 3GRWA 5DJCA 2WV3A 1NCBH 1MQKH 1RZGA 4LLVB 3OG4B 1Y0LB 1J0IA 2ARJB 4N68A 1U95A 4QYOB 4FQCL 1VFMA 1JE6A 5IQ7H 4NZRL 1I9JL 3P11H 5EU5A 1LDPL 3WL9B 4PRID 5GGSB 3TBYA 1HZHL 3ARTA 5EA0H 4NRXB 3D3VE 1MREH 4OLZH 4F7PA 4L8CB 2P5WE 4U4BA 2VXUH 3V6FA 2PW1A 1MFCH 3DX7B 3FB5A 1MAMH 1XCQB 4LCCC 3B5GA 3RU8H 3BD3A 4RGNE 1IM9B 2BY0A 1SQ2N 2IG2H 2P5ED 3EJYC 4LLUA 2VITA 4QRQB 4Y4KD 3QXVA 5JIKA 2A6DA 1S9XA 4HWUA 4A6YB 1CFNA 2ZUYA 5TE7L 4OV5A 1T7ZA 3BKMH 3OZ9L 4WI9A 2XZCL 4QCIA 1W72H 5IW6B 1EXUB 5IM7A 4DGIL 3ARBB 2XN9B 4K94L 1MCOH 4MA1B 5MEQA 3FHAA 3OKOA 4KC3B 1IGIH 4C58B 5E8EA 3VWJC 1KJ2H 3IGAA 4AL8L 2DL9A 4DQOH 3MV9D 3ZKMD 3L5IA 4F7TA 2FCBA 4PRDA 4G8IB 4A6YL 4PG2C 1F13A 4QNPE 4RWYH 3TF7C 2VDRL 4HV8A 4C56E 3O9WA 1U3ZA 1ADQA 5IBUG 4NO0B 3BW9A 2B7DT 1IC4L 2VABB 3R8QA 3BP6B 1L0XA 3QAZB 4JREC 4X7DC 3NPSC 4EI5C 1MHEB 1R3JA 1X5FA 5GIRA 1MEXL 1SJXA 4PRPA 2NY1B 5C0JA 2DQCL 4WWKA 1Q94B 5GSRB 1U9KA 4G7VH 5ADPH 3BWAB 5AUMA 5GGRA 5FYLL 5E08L 1BBJA 3KPLB 3VXPB 1JWMA 1PLGH 3EFDH 5JDJA 3I6GA 5FDWA 3DX6B 2ZUXA 4OV6F 3K3QA 4W4OA 4WO4C 3GMOB 5I19L 4Y4HC 1GAFH 1U92B 5TFSL 1OSZA 3ROLB 3DO7B 2QSCH 5F7KC 5GGTL 3VFSB 2DQFA 4CU7A 4ZFFA 4Y2DC 4Z95L 1YUHB 3SE8L 4LSUL 3I85A 3VXOA 2DQEH 2F54D 1NGXA 2XKNB 4H88L 2Y5TA 5JMOC 1AQDA 5BV7B 1K8DB 1A7OL 1OGTB 5B39B 1ZT7A 1M05B 4LLQB 3V8OA 1U36A 3INUL 4X98A 5D71L 5F8RC 1QSFD 1NGZA 1O7SA 2DYPD 5D7LE 3UPAA 3FRPG 1KNOA 1CK0H 4G9FA 3T0EE 2PW2B 5BRZB 3FONA 5C08B 5J7CC 2HKFL 4BUGA 1HCVA 1IARB 4RAVB 3S98A 4ISVB 2P8PA 4X99B 1YY8B 4KJYA 3MBXH 4PGDA 5BV7L 1R5WB 2EIZB 1YMMB 2F8OA 3O3AB 4PJ5E 4RMSA 1K4CB 2YN5A 3TM6A 5KSAC 5D9SA 4N0FB 4BQBA 2FBJL 3IDMA 4IEFB 5FM5M 5C3LD 3M07A 3TNNB 4V2CB 3OG6B 3EOAB 4NKMA 4APQA 2ZUQC 3C60C 4YBHA 2F9BT 4FQPA 1T04B 4WFHE 1NFDE 2HA1A 2JIXD 1DEEA 3ZTJH 3SGJC 4L1HA 2W9EL 1JWUB 4PV8B 3O2DA 5GQBA 2FD6L 4I2XA 1WGOA 1DN2A 3MGOA 4OZHB 5CZVH 3TYGH 2UZIH 5JPNA 3CVHH 2VLJE 1EBAA 2IANA 4Q58C 3BVNA 3SKOB 1QR4A 2J2ZA 4NC1C 4OZ4B 3TBVB 1YYLH 4IMLB 5EWIL 3RUGE 4TNWF 3H8NA 3KXFB 5F1IA 1OSPH 3BI9X 4L5FH 5IB5A 1S7TB 2VXVH 3O2VL 1CL7L 4M1GH 3MJGX 3O4LA 2NYYD 3WNKA 4NUJA 5DRXA 3G5YB 3HMWH 4ZOAA 5AYQA 2CKBB 5J56B 4RFOH 4LEXH 3QIWC 4PJEF 3B3IB 5BS0E 1NCTA 4WI8A 2ZUVA 4NT6B 1L0YA 3GM0A 3QUXD 4OFDA 2DQTH 4G80A 2H41A 3DHJA 1KLGA 2EZ0D 2GY7B 3GIVB 3S7GA 3EYOB 2JJVA 2CKBL 3MCKA 2DQHL 5AD0B 4PTTA 2A6IB 4AEEA 4UQ2B 3TESA 3P77B 4P59L 5T3ZH 1RFDL 1OAQH 3QUYB 5ICZA 1YEHH 1SMOA 3RVVC 4TVPL 5IFHH 1YEJH 5TF1L 2ADIA 2OTWB 4GRLD 3UTOA 3GJEA 1BD2B 4J8RB 3PWNA 3H3BC 1BX2B 1XF3A 2C1OB 3FQRB 5ALBL 2ZOKA 5JDSB 4URTB 2ICWA 3D2UB 3A67H 1J05B 3HAEB 4RZCB 1WEJL 3CJJA 3BXNA 2BHYA 1MI5D 2F8XC 2OR8A 3NFNB 3T1FA 1N5YL 4TULH 4O2EB 2APXA 4HZLA 1I7UA 4HCRL 5F7WC 5DHYA 5F96H 5I1CH 5JLZB 1GVIA 4FQIH 3RTQD 2VC2L 4R26L 2X1OA 1OQOA 1WAAE 2DLFH 5JZ7C 4OLWH 4IOFC 3DVGA 3KPRA 3M8OL 4AEFA 4OBSA 2DBJA 2IFGA 2AS5M 4AEHL 1I3GL 2N1KA 4J4PC 4UT9L 4NN7B 4H25B 1A7QL 2B2XL 3EYQC 4XP1L 3MFFB 2LVEA 5IIEA 2C3WA 3UX9B 4NCDA 1C08B 5DK2A 1T89C 3MOQA 2ZG1A 3MRDA 4LRIA 4OIIL 1FRGL 4OAWB 1MUJB 3BPLC 1FNFA 3P0YL 4FQ1H 5BW7C 4M1CD 1EO5A 5F9JA 4NZTL 1XEDA 2DD8H 3QB7C 2J5LB 2VXQL 3B9KA 3O6FC 4JM2F 3P4OA 4PR5A 1CXIA 5DUMH 1N64L 5HGBA 4HWEH 3HR6A 3L6FB 5DJDB 1TNNA 3WHXB 3G9AB 5J3HD 1RZIA 2ZSVA 4X6FB 1YNKL 1CT8B 3D9AH 1OTTD 3CU7A 1PJ9A 1WCBB 2QADC 2E8ZA 2QEJA 4QOKE 4YHIA 5LVEA 4PJ9D 1VFBB 1KIUA 5T5NF 4JB9H 2FIKA 1F8TL 4WI7A 3P73A 3VXUA 4UNUA 4ZNCD 4CRPA 3VFWA 1JRHH 3ZYJA 4Q97A 3RVXC 4U31A 3LCYA 2X4SA 3U7YL 2F53E 1FAKT 3SO5A 3TO4B 1WFOA 3SDCB 1BWMA 4H1LB 1JHKH 1GYAA 2WBWB 2OMBA 3GMNB 4WI4A 3RWGA 3S35X 1D9KA 4KK9D 3TIDA 3ME0A 3MGAA 4NUGH 3BAEH 3D39A 2EXWD 3OAZK 3MUZ1 3I2CH 2W0FB 4XPAH 2OK0H 3G04B 3CUPB 1PZUB 2AV7A 2DMCA 1P7KA 4P0DA 4RIRB 3OR6A 1DBAL 2UWEA 3R06B 5FA3A 3ARDD 3VFMA 4UBDD 5J89A 1U58B 4HH8A 3WHE0 3DSFL 3DNKA 1ITBB 5L8KB 3RL1B 2R56L 1Q9KB 2NX5A 3DRTA 3UPRA 4M4PA 2L7JA 3CFJB 4MA3B 4R96B 4D8PA 2CD0A 2XFXB 4M48H 2IPUG 1J10A 1T0NA 2E7BA 4LSQH 4QF1A 1JPTL 4X9BA 2GSGA 5HI4D 4HT1H 5C0GA 1FLTX 3SKJH 5I15H 2GY5A 3IDYC 1X9QA 4X6BA 5CBAB 3E8UH 3HPJB 1KTKE 3L95A 1QR1B 1LO2H 3I9GL 3QQ9C 2CKNA 4OGZA 4HSQA 4ZAKD 3BGAA 3W0WD 4NFDA 5FFLA 5IKCA 2LVCA 2YD9A 4JQVA 3WKMH 3ZT6A 4RRPG 3MA9L 5D1XC 2Z92A 1FBIL 2X6MA 5CP3H 4F7PB 1O7VA 3OF6D 4LCYA 1AHWC 3QCTL 1BQUA 2PYFB 2QV2A 4PJHB 4JZNA 5GPRA 4U3HA 2Q76A 3WN5B 1E4WH 1I1FA 4X6DB 4CADB 3DURB 1QFUH 2AP2A 5ILTH 5CD5C 1NFIB 1T1XA 2EC8A 3LB6C 5HGAB 1YN6B 3W2DH 2AJZB 3HE6C 5EFIA 1KCKA 4HEME 2D9CA 2EDTA 4J3WA 1LP9A 3RI5F 3SN6N 4GAYA 4U7KA 2OZ4L 2IPTL 5TQ0L 5ANMA 5FIEA 1BFVL 5JORB 1U8OB 3DMMD 3VGBA 2A6JA 2C3XA 3O0RH 4PJFA 3FO2B 4CN6A 4HWBL 5FYKH 3SCMD 4F7TB 4O00A 2YA1A 3C9NA 4QHNA 4EDWH 4JHBA 5D7KD 3IVKA 1H3TA 4DVBB 3ULUD 2Z31D 3WMSA 2AV1A 4NN6C 1AGEB 4U1NA 2DRUA 4V1DD 1CFBA 5E8PB 3BJ91 4X5WA 2I26N 2E8YA 5I17B 5GXBB 1IKFL 3EO0A 4GSDL 4PRPB 1V7NH 1Y18A 5C0JB 2VQ1A 4YXLH 5D1ZA 5C0FB 1EAPB 3NAAL 5AAMA 5I1JL 1OAUH 2VR5A 1MCDA 4JG1H 4LCWE 4MQXC 4I77H 4XCEB 1D5BB 1XGYL 1MHHB 1NEZA 4R4FH 3R1GL 3N1QC 3TVMC 5HI5C 1INQB 4OZGF 1FORH 1A9BB 4MDIB 1DBBH 1S7QA 1QG3A 2JB6A 3QHFH 1SY6H 1U3HA 3RDTA 3BHBB 3OHXB 1EGJA 5EDXA 5DLMH 3QFJA 1NGXB 2Y5TB 4AEIH 3G6JA 2ICEA 2UYLB 2J6EA 4X98B 5JIPA 1JUFB 5HHMB 4X83A 3VGFA 3MX0A 3GSUA 4KI5C 4RA0C 3U82B 1I1AC 2P8PB 1AE6H 2D7NA 4S0TD 3PDGA 1LE9B 1A6VL 5T3XH 4KJYB 5DMJB 5ITBH 4NN5B 2BVYA 4OLYL 4JO2H 2XZQH 3GJFH 1DQDL 5D9SB 4EJ1C 2CDEA 5JHLH 1REIA 1WBZA 2IFFL 4HUMB 3N1PC 1DN0A 4OF0A 5E8DH 3RY6C 1FC1A 3CC5A 1XGTB 1OAXL 4HQQL 1MJ8L 2FYYA 1RIUH 3MRMB 1UQSA 3D25B 4K9EL 1TJHL 1NUFA 5CILL 1DEEB 1I8MB 3O45A 4FFZL 4DTGL 2K1MA 3RZCD 2FATL 2ID5A 1CF8L 4PJEE 1FHGA 1A14L 2YS4A 5KANG 1OW0A 5EU6E 4AT6B 1TCRA 2DBLH 3VFTB 4EOWH 2X70A 4O02H 3AY4A 1KPVA 2X4QB 4BZ2L 1G7QA 4PB0L 4J3UA 4PYGA 3OJMB 1I8KA 1DUZA 4FQXC 4QRUB 1J8HD 3O4LB 4IDLA 4Y4KC 1M6OB 3JWOH 1MIEL 3O6KH 2ICWJ 3AB0B 3MUHL 3LN5A 3LSOB 1T1ZB 2O5YL 1FJ1B 2EDXA 3GEWB 4ZUSB 1TVHB 3FO1B 4P4RA 2DQJH 2HVJA 3Q1SH 1KXQE 1NKOA 3SBWC 5ISZB 2OL3H 4U1IB 5DTFB 1RIVH 2RR3A 4MA7L 5EZIH 2XA8H 4FNLH 2I27N 1KPRA 4JQIH 5KSBA 5JHDA 3FAWA 4JN1L 4MVBD 1OP5H 4Q7DA 5EU3A 4TTDD 3JV0A 3MCKB 2NXZD 4Y19D 4JRXB 4M5YL 3LRGA 1KJVB 2LTQC 3FT2A 1KTRL 3JSSA 2GUOA 2A6KA 4LMQI 2D3VA 3QDGD 2RFXA 3WFBH 1W0WA 3PNWB 2FO4B 1A6WL 2IADA 5E2UH 3B5TA 2X5PA 3TBWA 3NACL 3WJLA 3RY4A 5F1NA 1MRFL 3GJEB 5C2UB 2MNUA 4O2FA 5FYJH 1IGTA 4F7EA 4AG4H 1GHFL 3TA3C 4P57B 4RMQA 4Q0XH 5CIPH 4L8DB 1HILB 5DJ8A 5JOPE 4YE4L 5HDQL 1KIRB 4PLNC 2G9HB 1CICA 4L8SA 1RUKL 5F6IB 1UM5L 1IAIL 4X4XB 3RWIA 5DI8A 3FOLA 2VISB 1WWAX 4HZLB 4KY1H 1I7UB 4M7JL 1OP3K 5DHYB 5B8CC 3GNMH 5GRZA 4JZOB 3DWTA 1PKQA 1WBXB 4UINH 5GS0D 1NAMH 4YGVA 2X7LA 1BIIA 4XCNB 3VRIB 3MR9B 1H3XA 1P7QA 3TPUA 3KPRB 4Z6AT 1X7QA 4U1LA 4LVNC 1ZLUH 1FDLL 3QA3A 4AM0A 3DETC 3BP5B 2HT3D 1AR2A 5IIEB 3LH2L 1BPVA 3SDAA 4GMTL 4B7LA 3KHQA 4YHPB 1G7JA 3QDME 1ZHLA 5KW9H 2Y5EA 3T3MF 5KS9A 2IQAA 3D85D 4E41B 2DAVA 4DGYL 4ZDHB 4F57L 5F9JB 3GBNH 2J88H 3NFPA 3PWJA 2PTUA 4QHMB 5K33A 1ZTXH 4XPGH 3MLZL 3WS3B 1BQHA 3B9KB 2DTSA 1CE6A 1QHOA 3PUCA 3ZSSA 35C8H 4BM7A 4XMKH 3PGCA 5D7LA 4GBXD 5IBLD 1UJ3A 3L3KA 1MF2L 1NMCB 1CFVH 3BKJH 2R69H 3BRDA 2YMXH 1TENA 1S7VB 3I6KA 5IB3B 1DL7L 4XP4H 1RURH 2ZSVB 3N1MC 4OTXL 4NQDE 1OD7A 5HJ3A 3HC0A 3SGKA 2FIKB 5L2JA 4CMHC 3KLHC 5E1HB 4JFFD 5IP4A 4HK3J 3PHOB 3ARFB 2ESVE 5F7HA 2V6HA 3EIFA 5C9JB 2X4SB 2WK2A 5LXGL 2V7NB 3N9GL 2DIAA 4Q6YA 1KB5A 1GRWA 5D2LB 3E3QC 3MA7A 5EIIA 4D9RE 1I4FA 1J88A 4M02A 3Q5YA 4MNQD 3RWGB 4PJIF 2KQMA 1H8OA 3VMOA 2BNRD 1AGDA 3F5WB 3UTSB 3D39B 4GKNA 4BYHA 2ZJSL 2A38A 3WV0A 5IEKA 1T0PB 5E2TL 4G8GE 1XR8B 2Z8VC 1VGKB 3LN9A 3DX8A 1BJMA 1EMTH 4UILL 5DRWB 2AJUH 4Z0BL 1I8LC 3QUXC 5I8KL 1RMFL 3MUY1 3IB4A 1U8KB 3UPRB 3SJVD 1JI2A 3BIBX 2EZ0C 2AJVH 2DM7A 3MXWH 4YHLH 3D0VB 4WY7H 4HS3A 1TZIB 2XICA 5IT2L 4KPHL 1TVBB 3QCUH 3PP4L 4O2CA 1LMKA 1TXKA 4XPFL 4EDXB 3RPIB 1G6RA 3STBA 5BS0A 1ZVSB 4QXTB 4EI6A 4L9LB 5BOPA 1YEKH 4WJ5A 4P2OC 5J1TC 1PX3A 1HDMA 4NQTA 4PD4K 3SY0B 1JNNL 2KDGA 4GRLC 4MSWA 3MJ9A 3MV7A 4X4ZA 5I9QC 3FQXA 2Z92B 4U0RB 3ZSTA 4JO3H 2QL1A 3V6OC 3VWKA 3OMZA 1FYHB 2C4FU 1JYXA 2GJ6A 4MAYC 4BSWB 4R7NA 3QIUD 1QO3B 2YUXA 4I13B 1ZANH 2CR6A 2DL2A 1I1FB 1FYTA 1BM3H 4XWOD 1MCLA 4U6TA 1KJMA 3WNOA 5IVNA 3RTQC 3H9ZA 4DEPC 1IZKA 3BP7A 1KCVL 1CWVA 4WW2A 5EFIB 2EEBA 1LP9B 3S4SG 4TRPL 4HIEA 2EH7H 2HH0L 5CCKL 4E42B 4XP9H 2KPNA 1RV6X 2XXMB 3FRPA 5EN2B 5IK3B 3VH8G 2EYRA 4PRAA 4RQQB 5DJXB 4Y5VB 2Y07H 5I8OL 5E1AA 3C9NB 1F3RB 3QEQB 1K3IA 2DI8A 2AAVA 3QI9B 1QEWB 2YC1B 4OZGE 5T3ZE 3LQAC 3HZMB 4M1CC 3RIFF 1VADA 4PUBL 4X5WB 1M4KA 4ZO8A 2FB4H 4YDKH 5F9WB 3CMGA 4JFXA 4OIAA 3QFDA 3PWPD 1Y18B 1WT5C 4FQJH 3HFML 3RGVA 2B1AH 3CSPA 2BVPB 3VXSA 2DQDL 5J3HC 1CZ8H 3WSQH 1OTTC 3ZT5A 1S9VB 3V79C 4DKFL 2IEPA 4PJ9C 1JHLH 1GGUA 5I1DA 5GSVB 4ZTOL 4Y16B 5DD3L 1YNLH 1NEZB 1Y6MR 3LKQB 4DZBA 2EE2A 1MFBL 2BNUA 2Q1EA 2X44D 4HKBA 4QGTA 1S7QB 1V3LA 3F7PC 4H0GA 4QRRB 4YNYA 1IGYB 4IIQA 2OTUA 5DEGB 3FB6A 1D6EA 2VH5L 4QRTB 1SJHB 4GLRI 4GW1B 4ZPVA 4P3WA 3QUZB 2APVA 2EXWC 4I1NB 4NWTL 2R23A 2GTZA 2APWA 3RAJH 2OLDA 4YEEA 5E2VL 1FE8L 5C07B 4UBDC 1GZPA 2VB5A 1OD9A 5JR1H 2IPUK 4NYLA 3UTPD 3V9FA 1JGLL 5DEFB 1CR9H 4JFDD 3CFKB 2FGWH 4PJ7B 3HMXA 3O3EB 3AXLB 4M8VA 4ZUWA 4PJ8C 1OT2A 2C26A 4LCIH 4JKLA 4NHCH 4JFEA 1RU9H 4MA8L 4XAWL 3QXAB 5EOQH 4BSVA 4H5SB 3GMRA 3O11A 1GSMA 1YJDL 4ZS7H 4N5UA 4TSBH 3IS1X 3B2UD 5JOEA 1PBYA 1P53A 3D0LA 5INDA 3SDDD 2XZAH 5C09A 5CGYC 4EKXA 3W39A 3MLWH 4TNWK 1GOHA 3WXVH 4XVJL 1B0GA 1B2WL 3ZDZF 2CO7B 1IILE 2NNAB 4ZAKC 1TQCC 1J1XH 1DVFA 4JY5L 3LQZA 3MO1A 4M43L 3NFSL 4PYHA 4JGJA 2X70B 5JOFB 1OOAA 2XZZA 3EYUH 2BSSB 1MCSA 4YDLC 1G7QB 1JTOA 3FCTB 2YD2A 3NA9H 4RMVA 4BFBD 4X6CA 2VDKH 5KANI 2ZCLL 1SEBA 1QLFA 2CK0L 1UG9A 3HS0B 1UB6A 5E9DE 1S8DA 4Q9RL 2AEQL 4P4RB 2NY0B 2HTKD 4R7DB 4UT7H 2IF7A 1IC7L 2H32A 4YDVA 2FX7H 5DR5H 3VE0B 4P5KA 4ZNEA 3TBTB 3D3VB 3P30L 4UDTA 3D6GA 2P5WB 5CP7A 5DHVB 1E4XH 2JJWA 4JO1L 3DMMC 2B0SL 4HFUH 3K4DA 1GOFA 2ZCKL 4G6KL 3SCMC 1UXWA 3IJSA 4RGNB 3V0AC 3L5XH 2NW3B 5GS1C 4OZIA 2BERA 3B8SA 3WFCH 2NY3C 3STLA 5T1LA 1HQ4B 2OJEA 3ULUC 1WC7A 1EK3A 5KJRH 1PG7X 1FH5H 4JKPH 3FT2B 3C08L 5IG7A 4MHHG 4MMXC 2A6KB 3IKCA 3REWB 5I1EH 1OARH 5ID1A 1TPXC 4IHOB 3FFDA 3IT8D 3VGAC 2P47B 4LVEA 3SE4C 3DECA 4I18A 2Y36L 1A1OB 3RGHA 1KELL 4CNIA 1IGTB 3JV4A 5IB4A 2BSRA 1F58H 1N3NB 4HWNA 2WBJD 3QNZB 5DJ8B 3QNXA 4C56B 2E9BA 4KJPD 1KEMH 2NR6D 5HVHB 2G75B 4PV9A 4AYFA 4NQCE 5L0QB 1DANT 1HHHB 5KVFL 4XBGA 3T3ME 4CBPA 3FOLB 2G5BA 1QRND 2C3VA 4JPKH 2M8XA 3RNQA 1K3ZA 4HC1A 1JVKA 2IH1A 3CLFL 1YC7A 4JG0L 2R0LL 3QP3A 5FO9A 4YGVB 3IXAA 1B9ZA 4HDIA 4LPUA 1MRDL 2VLKE 3T2PA 4ELMF 5IROC 4XVTH 1YQVL 2SEBB 1FGNL 2DWEB 2V5YA 4KI5F 3K0WA 4QHLA 4ZYKB 3UO1L 2L4OA 2VKXA 1NL0H 4L4TA 2W9DH 3X14A 4KZEH 5FYKE 3QDAA 5DFWH 1A7RH 3MLVH 1CD1A 3NPZB 5GRUH 1VFUA 4M7KL 1OP9A 5EIQA 4OI8A 5KS9B 1T21B 2PXYD 1YYML 1RZKL 4OZFG 4ZTPH 2FR4A 1UT9A 4G42A 4K8RL 3U30B 4UTBL 5ESVA 5IVXA 2BY3A 5C0CE 1WBYB 4YXKL 1HXYA 1ES0B 1CE6B 3EOTH 2D31A 3ECBA 5D7LB 3L3KB 3LKOA 1CQKA 3T0EB 1J11A 3GSNA 1V5JA 3HE7C 2J4WH 3MV8E 4QXUL 1JGUL 5I8EA 5C8JA 4D0BB 3UYOD 1LE5A 2XPGB 2OJZL 3WLWD 1G1YA 3RZCC 3U6RA 1CI5A 1F2QA 4TVSa 1DQQA 4PJ5B 3DUUA 5DC9B 5GGQL 4RRPA 3QQ3A 1MWAH 5FA4A 3HG1A 4UMGA 1PEWA 4IMKA 4YBQD 4XI5D 3K46A 3VXMD 1KB5B 1F45A 2GTWA 2HKHH 3P9WB 1I4FB 4XNXL 2GAZA 3JV6A 4TPRH 5H35A 2BVOB 2A83B 1NFDB 5KTEH 2NTFA 3ULVD 4U1KB 2AEPL 5D7IF 2LU4A 3T04D 1NPUA 4WEUD 4JPIB 4ONFH 1IT9H 3SGDH 3UTTE 2HJFB 3C6LD 4TOYH 3DX8B 5IBTL 4XPTH 1KB5L 1VPOL 4PJXE 5D93B 4JGUA 2VLJB 1OLLA 5BMFH 4PRHA 1CIUA 1N59A 5D6CA 1INEH 2VDLH 5T3XE 4IRJA 2Q8BH 1JMZA 2UY6A 5EBLA 3RUGB 1KC5H 2PCPB 1YEEH 1RVFL 4ODHL 3DYMA 4OUOA 5LQBL 4HS3B 3MNVA 5DJ6A 1MFEL 3VXRE 1M7IA 4TTDC 4YO0A 5J6HB 2NXZC 5IBUB 2L0DA 3QDJD 4IRZL 4JLRA 1KBGH 1Q0YH 5JW4M 1TMCB 4QXWA 2NTSP 1G6RB 3VFGL 5BS0B 4U3XA 1AKJD 2XTJD 3X12A 2CJUL 4HBQA 5DMGC 4ENEC 3QJHA 4ZFZA 3H9SD 1V05A 1T2JA 2D4FA 5K9OA 3VI4F 4GQ9L 4XBPA 4JM4L 3CH1A 4PTUA 2AJXH 3LEXA 3TN0A 3AAZA 4PREA 5LBSH 4DN4L 4O51A 5IGXL 3O9WC 4JDVB 5TE6L 1G6RL 4IRSB 5FCUL 3C2AL 4KMLB 4NNPH 1OTUD 4HS8L 5DVKA 4R4BB 1A2YB 2OSLB 3CSBA 1C5CH 4R7NB 2X2YA 4EUPH 3GKZA 4WWKC 2Q3ZA 1BVZA 3MJ9L 4UZGA 1IGFL 1MCWM 5GS0C 4HK0A 1C12A 3BP7B 2WAHA 1IGML 4JGMA 1ACYL 3P9LA 4OLXH 4JPWL 5MERA 4MAUL 1RJCA 3IJYA 4KK6D 4NM8H 2Q20A 4OT1L 1UA6H 3QIBB 5FGSA 2EH8L 1NGYA 2EYRB 2HT3C 4O9HH 4XHJC 3IU4L 1A5FH 2DI7A 2OQJA 4LKCA 4GMSH 4W4OC 5C9KA 1Y6NR 4Z7OF 3QWOA 1T66D 4NDMA 3STZA 4KUZH 4HXAL 1RUPH 2WUBL 1FVDA 3VGDA 1BFOA 2G2RB 5EO1A 3BPCA 1IM9D 1FNGA 2WLYA 4LBEA 4LLYB 1A1MB 3CDYA 4UV4L 1C16A 1TLKA 3MMEB 4L3EE 4OB5L 3WJJA 5DUBB 2VL5A 1KJ2A 4GBXC 4LGSB 1D5IH 1BVLA 3ARBD 2YRLA 4UDUB 4I4WA 1P1ZA 4NZUH 4AQ1B 2XN9D 5MEOA 5FYJE 1KYOK 3VXSB 5JW3L 1WQVT 4GG6F 4U1GC 4M9OA 3CPLA 3I75A 5FHAL 2QSVA 3F7YB 1SBSH 3RWDA 4NOFA 4MB5A 5HDOA 4EBQL 1YMHB 3HI6L 4EVNA 3VA6A 4K3EH 2X4NB 4NO0D 3MRRB 2BNUB 5FYLD 3S5LG 1ULVA 3UPCA 1F11B 1NCCH 3OGCA 2BOCB 4IIQB 2X42A 2EC9U 4LU5L 5MENA 2BJMH 2NY1D 3CFBB 4KQ4H 1FVCA 1ZGLP 4FFWD 1IFHL 3JWDL 5T1KA 1I3RB 4QOKB 1S9WB 2R23B 3HN3A 1FFNA 3U2SA 5ITFA 5EO0B 1NBVH 3DBXB 5KN5A 5FGBA 3OWEA 1KCSL 3OPZL 4OUUB 5GZND 5SWSE 5LAXA 1GZPB 2AXHA 5FOBA 1PZ5B 4XPHL 4NYLB 2EDFA 3GI9L 3QQNA 5T33H 2O61A 2VAAB 3ZDZE 2F53B 4W6XB 1P9MA 4RX4D 2AKRA 1MFAH 3ARGA 4NQVB 1A3RL 1B4JL 1N8ZA 1A9EA 4ZUUB 4P5TA 4PJBE 1YEIH 3MRHA 3RL2A 3GMRB 4QTIH 4PB9L 1CLOL 3KLAA 4HS6A 4N0RA 4G9DB 5E99H 4XGZA 3BUTA 1JNLL 4YHKL 5EZOL 3TZVD 4ZFOB 4F8TA 3ZKNC 3UTZB 1E27B 5KVGL 1XIWB 1B0GB 4N9OB 3A6CL 1OT1A 2CXKA 5C08D 1KTDA 5KAQG 1FZMB 5IV2A 3IS0X 4RCAA 3RX7A 1J7VR 2A9ML 4Z76A 3CK0H 3P9MA 4GAGH 4I0PA 1CFTA 4ZSOA 5ESQA 3BH8B 3MODL 4LHJB 4G6FB 4MZ2A 4AK1A 4NP4L 1U8NB 4WDIA 4Z18A 4ZFOL 1EERB 2VZVA 1QSEA 1A1NB 3QIUC 3WIIH 4WFED 1FN4B 3CCHB 5IJKA 1EEUA 1T7XA 3MRIA 4XWOC 1DBKL 4RGMB 2YKLH 1QPPA 4FFVC 4MDJB 3T2NL 3TJEH 3BP4A 1S8DB 5J11B 3T0AA 3CDGA 4DFIA 3CFCL 3KPOB 4JZJA 3TIEB 5I1KH 3TT1L 2FX8L 4F7CB 3QXWA 3BIKB 2V5TA 1OGAE 3BZFB 4UDTB 2YBRB 3AREA 5EORL 3GHBH 3WXWL 4ZMAT 1UM6L 4ALAH 3FFCD 4R0LC 1RK1B 2CRIA 5GISL 3L7FA 3JTTB 1JF1B 3IJSB 4WV1C 1EO8H 2YD4A 4R97C 1UM4L 2AI0L 4M1DL 3S36L 2MWCA 5D8JL 4KJQD 5F7MC 4PY8J 1DQMH 3KXFD 4HKJA 4NQED 5T1LB 3STLB 4L4VE 2WWKT 3IFLH 4UV7H 4X8JA 3MJ8B 4K7PH 1Q0XL 5IG7B 5EC2B 2B4CC 5GZOD 1FNEA 4KGJA 4Y0GA 3TO2B 1F90H 3NABL 3H9HA 4CW1B 4PJAA 2JCCA 3R4DA 3IU3A 4YHMH 4J6RL 5C0ND 5DC4B 4MB4A 2X4PA 1WFTA 4KI5E 4Q6IA 3JV4B 5IB4B 5F88B 4LRIC 1ETZA 5E00A 4MHHI 3FT4A 4KTEH 4TVPD 4QWWD 3NTCL 1K9TA 3O6LL 3PL6D 3P3YA 3BESR 4QRPE 3SGEI 1LO3H 4WFGD 3WCYA 4P2RA 4YFLF 1MJUL 5IWLA 3FQWB 3QUYD 1ZA6A 3MRBA 4HW6A 4BFGA 2LV4A 2PO6A 2AJYL 2JLLA 2W38A 1PDKA 1ZHKA 1PQZA 4LCWB 4Z7UE 3I50H 3A6BL 2GJZB 1FC2D 3ESUF 1JZ7A 4ETQB 1BD2D 3CVIL 1D6VH 5CJQL 3MRCA 5C0BA 4BFIA 1DBML 4HLZH 1YEFH 4DWHA 4MX7A 4JFHE 4HUVB 3L3IB 3OKLA 4KKCC 5IMOB 3D2UD 3GSOB 4Z77A 1CD1B 1BWWA 1JV5B 2RGSA 4RGOH 1ZWIA 4AENB 4HF5L 1ADQH 1D9KC 3HUJF 2FR4B 1CVSC 5IJVA 5IVXB 5ESVB 4N8PA 5K9KA 3WKNA 3TNMB 1HXYB 2JE8A 2HFEA 2EEAA 1T22A 3BUYA 3GMMB 5JIHA 3DUHA 1QBML 5C0AA 2CPCA 2PR4L 2DDQH 5L9DL 3B2UC 1KCRL 4JFZL 4NZDA 1UACL 1C5BH 3SDDC 5IHZB 4LHQB 3DV6A 43C9A 4BZYA 4KRNA 3PWUB 1HHKA 4LCCA 1ODAA 2YPVH 4LP5A 4YWGH 5FA4B 1HHGA 3KG5A 4OBRA 5E5MB 5DA0B 4ODTH 5HHVH 4KK8D 2VJXA 4NGHL 3JV6B 4AMKL 4BQ6A 1U8PB 1JPFB 4ESKA 4LVOB 5AWNL 3U79A 5A43C 1R3LA 4WEBH 3MQIA 3FO9B 4WW1B 3FN0H 4ELKA 3QEGL 4PJEB 1IJ9A 3HLAA 5EU6B 4JQVC 3VJ6B 5HSFA 1A64A 2XTLA 3S4SA 4U1HB 1IGCL 4YPGB 1P5UA 5DQDH 3S34H 2CRMA 3CFIC 3VI4E 2KL6A 1MHPL 3VH8A 3EFFB 3U4BL 3BFOA 1N5AA 5TH2A 3VRLF 1AXIB 3TO4D 4K71C 3SDCD 4N8VA 1DSFH 5CUSH 3CXHK 5DJ6B 1M7IB 2YK1L 3BE1L 1Q9WA 3MXVH 5ALCL 2ENYA 1Q72L 2HFTA 3C5ZB 3U4EB 3FO0L 3MRGA 1IVLA 4JJ5A 3L9RA 4S1QL 3O2DH 2HWZL 5ESAA 2W60B 2ITCB 5I18H