4HK0B

Uca fab (unbound) from ch65-ch67 lineage
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
QSVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords UCA heavy chain
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 210
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0B01
2Y9RT 4LQ1A 1FYHB 5DZNA 3R1GH 4DCQB 2NX5D 3DSFL 4J3VA 4YDLC 1BHGA 4JZJB 1VPOH 1OB1B 1YEHH 2FIKA 3D85B 1FL6A 1RFDH 5H8DA 4ALAL 1IAOA 3N1QC 4POYA 4Y4FA 1BP3B 4C54A 5TQ0H 1NGZB 3ULSB 4KDVA 1VSCA 2FB4H 4FFVD 1YEIH 4Y2DB 5KS9A 3QIBD 2DI9A 4D3CL 3P9LB 5KVFL 3U7YL 5FM4A 5A16B 2VR9A 1WEJL 4MAYB 4R0LC 3QFJB 3VH8A 3NH7H 4M7JH 2PYEA 4R3SB 3BQUC 4Y1AA 5L0QB 3R0MA 5IWLC 4HGWB 1C7SA 3O6FA 4JFFE 4XWGL 4HT1H 2IPKA 3IF1B 4NO2B 3KPLA 1U91B 1PYWB 1L9MA 3BN9C 2PW1A 4PJGA 1FZJA 2H41A 4FQIH 1VDGA 1QPXA 4HUUA 5EU3A 1IVLA 1T5WB 2E8ZA 5IMLB 1FIEA 3CVIH 4LSUL 4GBXD 4YHPB 2AJSH 3FT4B 1A6AA 5CZKA 2K7PA 4QEGA 3GFUA 1G7HB 2DQJH 4PRIE 1FG2B 2DYPD 1F42A 3HN3A 2YD4A 4NFBA 4OUUA 2FGWL 2VUOA 4K3EH 3LEXA 4HKJA 4QHLB 1ADQL 3WHXB 1NGXA 5IK3B 3HNVH 4X6CA 3GBNL 4XCNA 1F58H 2D4FA 2FLRT 5I16A 3UJTH 3EZJB 3PG2A 2P5WA 5ADOL 4KJPD 4MNQE 2A2QT 2P8LB 4PLOB 3GSNA 4FQQA 2CKNA 2Z8VC 5DMIH 5E6IA 1U8NA 4YFLF 3OJ2C 4FZEL 1AXSA 4P2QD 1GIGL 2QADB 2OXGA 5J11B 2DTML 2G60L 2PXYB 3G08A 4PY8I 4Y5YA 3ZDXF 4YFEA 5CP7B 3CSPA 1HHJB 1XCTB 2V7NB 4Y16A 1MIEL 3GSQA 4U1IA 4QTIL 1KIQA 1KJ2L 3MREB 4QCIB 4WV1A 5CBAA 1FRGL 3U4AA 5BOPA 3VXMD 4I8DA 4Q6IB 4U0RB 2BVPB 1Q38A 3VFGL 3B8YA 1FV1B 1D9KB 3C60B 1ZA3B 1T1WB 5T5NF 3G6DH 1NAMB 4YHZH 2F19H 1DUYB 1BFOA 1Y18B 4W6WB 5J1SC 5AAWA 2JB5H 1WZLA 5EU6D 1ZHKA 1A6WH 1KULA 4FFYL 3IFNL 8FABA 4I0PB 5I0ZA 3H9SB 1OF2A 5JXAH 5I30L 2BNRE 2NX5A 5FYKD 3SEPA 2EDNA 4AK1A 4HIJA 2ZJSL 3GBML 5GS0H 3BIKA 3VDAA 43C9A 5JO5B 3P2TA 4PRBB 3N85L 2DICA 1DQDL 4HX1B 4YHLH 4PLNC 2YWZA 5D93C 5M95B 5F7EL 3RX5A 3VW3H 4OLUH 4HS3A 1JZ7A 1A6UH 1CI5A 2XFXB 5K59F 1OAUH 2ICCA 4ZO8A 4Y4KB 1BVKA 4HV8B 1G0XA 4FXGB 4MCYA 4ZD3H 2CKBH 3NFSH 2RB8A 4OJFH 4L8DA 5HD8D 5C0JA 3EYOA 5KSUA 1G9NL 5KOVC 3JTSB 3DRTB 4LCWD 1CGSL 1ACYH 2GTWB 3OB0K 4O51B 3RWEB 1FFPA 5E5RB 1NSNL 4AM0A 3VD5A 1HWGB 5J8OA 4Q2ZA 2AJZA 1BM3L 3D69B 4J1UA 4MJIA 2JK5B 3MV7D 4G6KH 1FFQA 4IDLA 4CVWA 3I9GH 2H2PD 1U8QA 2OTWA 5DHVA 4JO1H 4XH2A 2VXTL 1SMAA 4XBPB 5CAYB 3EYUL 1RUKH 4H26B 4JFPB 2ZSVB 3PWVB 3STLA 1B4JL 4GAYB 5CWSA 3R4DA 5T3XL 5DMYA 2D7PA 2VDOL 5F7WC 4QTHA 4PPTA 4PRPB 1P7HL 3U2SA 4YDKL 1DBBL 5J12B 1MRFL 2AEIT 1MCEA 4EKXA 1DBML 2A9NL 2L0DA 2D0FA 4OBSA 4Z7OF 3SQOH 4UNUA 2VDML 1J12A 1RIUL 5DD6B 4ZXBA 4U1MA 4C58B 4K2UH 4U1SA 5ILTH 3H9HB 3CCHB 3QZWA 5HYIA 4P2QA 4G6AC 2GCYA 1A1MB 1A14H 1BZ9A 3L7FA 5CEZL 1U3HD 2C1PB 3QHFH 3EAKA 4U6VH 4MJ4A 1ODAA 1CXLA 2DQTH 4OCMC 4D9LH 3LVEA 9CGTA 1DDHB 1FO0H 4LBEA 2F54A 3GBLA 5MENE 3MRHB 3MUGB 5FAAA 1N7ML 5DK2A 4M6OL 2QSCH 3TIEB 4I5BA 4JFYA 1J0ZA 3WDIA 2IGFL 3QWRD 3VXRE 2YS4A 3QWOA 3M1BA 3C6LA 3MGOB 3PP3H 5H37G 2NY2B 3UTSD 3VFWB 1L9NA 2EEBA 3MJ9A 3BGMA 2CRMA 3MROB 4OCRH 1T21A 1WVZA 2F53D 4KTYA 3W9DB 2WBJC 1MCKA 4HAFA 3NAAL 1MCOH 2LU3A 1FDLL 3G5YA 4OF3A 1FLRH 1I7RA 1X6NA 5C0BD 4FABL 3QIWA 4LSPH 5E56A 4RMQA 4J3SA 2J8UE 3O3BA 3QA3B 4XWOD 3GRWL 2SEBB 4LSQL 1GAFL 4L9LB 5E08L 4PTUB 1ZHNA 4UQ2B 2G75B 5MEOB 1VESA 4LMQE 2X7LB 3M8OH 1AXTH 4MD0A 3HR5B 2P5ED 4NPYB 4QF1A 2H26B 1KFAL 4H1LB 3AAZA 1GHFH 2ATKB 2VYRE 1PG7X 1BFTA 2PETA 4E5XB 5GISL 4PJXE 2BVUA 5C3LD 3LAFA 4UDUB 1IT9H 1YMMB 1Q72H 4PP2A 2COQA 5B21A 2AGJH 1FZMB 3EOTH 3RU8L 4KC3B 5IMKA 3BESR 4JDTH 5ISZD 3MV7A 7FABH 2YKLL 3S9DB 4H88H 2BZDA 2C4FT 4MGXA 1JP5A 1CK0H 2JF1A 5DRXB 3BPOB 3EGSB 1CYGA 4PJHB 1OOAA 5I1CH 4UI2A 2R0ZH 3WKML 5D1XB 1BBDL 1P9MC 5TF1L 3TPKA 1T89C 2YPLB 2EDOA 5E4EB 1P7KA 4KHXL 3TYGH 4YGVA 3RZCA 2AABH 1QRNE 3CFKB 1C16B 3VJ6B 4BELD 5D4QA 3VFRA 5T1KD 4I4WB 1U58B 3BQUD 1KNOB 4TSAH 5D7SH 1AKJA 3AMKA 1LO3L 1F90H 1XF3B 1J1PH 1BOGA 4ETQB 1G6RA 1OY3B 1P7QA 5AUMA 1T1YB 2H1PL 2AK1H 1TENA 3BN9D 1HNFA 3ARPA 5E8NB 5DD0L 5SWQA 5C9JA 4MSWB 4Z8FH 1KB5B 2R2CA 1NQBA 4PRAA 1DQJA 2GK0B 2EXYD 3CXDL 3RL1B 3QDMB 5DK0B 2VXQH 3VGAB 3PP4H 1KXVC 2VLKD 5D71L 5IVOA 2CRZA 3NIGF 4ZFFB 4CBPA 1MFAL 2RCSL 4ODHL 2AEQH 4PJAF 3IJHA 1N4XL 1NCDH 4GW4A 2CIKB 4OQTH 1NCBL 4RGOH 5DMKB 4K3JH 3JV4B 1HQRA 1UJTA 5FGCB 2YD6A 3DIFB 4P9ML 3O6KH 1NUFA 5E2TH 1E6OH 2LTQC 5DD5H 3QWRA 2XWBB 1RJZA 3X13A 5ETUA 1IJ9A 1H15B 2VXVL 2W9DH 1PY4A 2HH0H 3D25A 1GGUA 4HKBA 3TVMA 3BISA 2AEPL 2L7JA 1I85C 2JJTC 1I7UB 3WJLA 1ROWA 4Q9BA 2VRAA 2F53A 1TJHL 2YC1B 4MJ5B 4LCIL 1CQKA 5KSAD 4ONOA 3D48R 5DLMH 4PUBL 1P5UA 1GRWA 4Y5XA 4J3WA 1OLLA 4ERSH 3HG1A 5JOPE 1IAIH 3PWJA 4XPGH 4KPHL 3S88H 4NO0D 5J0BA 1WBXA 3EBAA 4Q9QL 3VGGA 1DFBL 3OGCB 2CUHA 1I9RL 4XC1L 2WANA 4M1DL 3MLTB 5T3XD 5D7IA 2ICWA 1NANH 5TE4L 1ADQA 1CDHA 1N8ZB 1UWXH 4X7TB 1DEDA 2BY1A 3AREC 5EBMB 4NBXB 4E41E 4PJDB 5I1AB 3NIGE 3NIFE 3KPSE 5CHNB 1R6VA 3TBSA 4PJAE 1HSBB 1ZGLB 4YHNA 3DUUB 2Q7YB 4F3FA 2Z91A 5ANMB 1W2KT 1RJLA 1J1XL 3TBYA 4WWKA 2P8PB 4CVXB 5BV7B 4IIQC 5C0AB 1MCWM 1KELH 3DI3B 5CEZD 4IBLT 1CD1A 4PJCB 5CFHA 3DMMA 4V1DB 3MRIA 3HUJA 3QXAB 2X4RA 1NH6A 3T04D 4DOHE 2GK2A 2A73B 1BQUA 3BDYH 3I3DA 4X6DF 1FNGA 4LPVA 3K4AA 1XGRB 5FYLE 4JPWH 2R39A 3THMH 2HP4A 4PJ7B 4OGYH 1A7BA 3VFOA 4WW2A 3S97C 5HHNB 5BVJB 4NWTL 5E5MA 3U9UA 1INDL 1W0VB 4N9GB 1CF8L 3E0GA 2GFBA 1JPFB 1N0XL 5KAQF 1M71A 3MUJA 4DZ8A 3W0WD 2X4UA 4KQ4L 3ECBB 3FKUS 4Y4FC 1C08A 3RAJL 5T1KA 1REIA 2NXZB 1RZGA 5FOBB 2N7AA 1RSFA 3WNKA 2VDQL 4P2YA 3C2SA 1WBZB 1DLHB 1A2YA 3GJEA 2C4FU 1CE1H 2NY4D 3PL6C 2C3XA 4DUXA 4GKNA 1OAZL 2X4NB 2P47B 3DX7A 5AYUH 3D0VA 4EI6B 5E8DH 2VLJA 1FNAA 3I2CL 4P3DB 3MV01 4UINH 1YYMH 2BK8A 4HWEL 2F8XC 1TCMA 3B3IA 2FJHA 2V2XA 2EDXA 1QLRA 4R4NC 1U36A 3AM8A 1LE5B 2X4QA 1EFXB 2G2RA 4UUJA 3NZ8B 2K3TA 4NWUH 3PIQB 3GJFH 3O6FC 4HS6B 2EYTB 2UZIL 1NMCB 1CDCA 2F5AL 5C09D 3CJJA 1IAKB 1XF5B 1KJVB 4F7EA 5F1IB 1TQBC 3QJHA 2GITA 2DD8H 1KN2L 1I8MA 2CKBA 4NKDA 4UT9L 1MHCA 5CKGA 3V5DB 2G9HA 4UU9B 2X10A 2F15A 3IT8D 2F5BH 4I9WE 4KJYA 3MZTA 1S7RB 5E2WH 3U7AA 1NFDF 4E0RB 4L4VE 2IADA 1F4WH 3GJFK 5ELIA 5KSAA 1QYGH 1EGJH 3IKCB 4JPIB 5EOTA 3MRPB 4NP4L 4UTAL 3NCEB 4FFZH 3SKOA 2FWOB 1LO5A 3SPVA 4JM2A 3H8NA 4GKSB 3HR6A 2HVKA 1U2HA 1CXKA 3AY4A 5E6IC 4OFDA 4ODBD 4QWWC 4ODUB 1S7SB 1JWSB 4BSJA 5D2LB 4YWGH 4EXKA 4QRUA 3ARGB 1Z9SA 1CZ8L 2EXWC 5F3BA 2GSIB 4JY6B 4KKLD 3H0TB 5AZ2H 1VHPA 5D72L 5FO7B 3CFDB 4ZOCA 3VE0B 3KLSA 3LKSA 1I9JL 1VKXB 5C0CA 1Q1JL 2VERN 4Z6AT 5SWSE 1A7OL 1ZWIB 2VN4A 4LGPB 5EB9A 2WBJD 3GMPA 3QEHB 1ORQB 1ERNA 4FN0A 3WIHL 4W4OA 5EC2B 2ZG2A 4P4KD 2FYYB 3IAGC 1UJ3C 1D5MB 4XVJH 3RWHB 4MB3A 2XZCL 5GHWH 4J6RL 1NBVL 2QQLH 4M7LL 2D31A 5BW7C 4DKAA 3I6GA 4EDWL 1ZV5A 2O5YL 1Q9KA 1IAOB 3VH8G 4EOWH 2E7CA 5FUOL 4N68A 4OF8A 4HFUL 3CMOH 2B7DT 1OGTA 4ONGH 1QR1A 3V4PH 2ZNXA 35C8L 1E4WL 2V5MA 4QXTB 4GKOA 1ZVHA 1T2QH 1DP0A 1OARL 2AKRA 2B1HL 2X4SB 5EFIA 5KS9B 2BMKA 4JO2L 1S8DB 3F7YA 4YXHH 5I1HH 4UIMA 3WBDA 3W9EA 5FYJD 3OSKA 2R0WH 4LHUD 4R97C 3X3GL 3MR9B 1YJDC 3WE6A 1KCLA 3MYJB 2P42B 4H20H 1KENL 4I3RL 4Y1AB 1KTLA 1G6VK 3GNMH 2DQDL 1K8IA 2LU4A 3MLXH 2MQCA 3MRRA 2VZOA 3BVNA 3EKCA 2IPKB 1CL7I 2M8XA 1QO3A 2OR9H 3QNXA 1FVEA 2CDFA 4JLRA 4K94L 4BK5A 3VDCA 1ZSDB 2PW1B 5EUKB 1FZJB 4KRPC 1FSKC 2IMNA 3UPCA 5GJSL 5HVHB 5I1IL 1ITCA 1DZBA 1RJCA 4BQBA 1HXYB 4OCWH 2BNRD 5DUPH 4G8GB 1EVTC 4MA7H 1KCSH 2YPVH 1A6AB 3LB6C 2KZ1B 1QQDA 2V9TA 1A6TA 4P57A 1C8PA 2W0FB 5T1DH 1KOAA 2OBGA 3LEXB 2HT4D 4HKJB 4YX2L 1NGXB 2XRAL 4X6CB 4M62L 4XCNB 1UCBL 3D9AH 5I16B 2WINA 1AC0A 2P5WB 5LXGH 4C83B 1AIFA 1RIHL 4U33A 1NLBL 1IGTA 2ZUSA 3R8QA 3NCFB 4YE4H 1F2XK 1ZXQA 1U8NB 3RP1A 3AB0B 4DEPC 5CEXA 4R7NA 4G6JL 1AXSB 4KUZH 5T33H 5DO2D 4RMVA 3KG5A 3MRGA 4ODTL 3BPLC 4UDTA 2RQ8A 3HPLA 5JZ7C 3IDYB 3MYZA 3O9WD 4Y5YB 3QI9D 5CZVL 5BMFH 5CINL 3E2HB 3D39A 4QY8A 2EH8L 3F6LA 3OKNA 4JFFA 3SCMA 4Y16B 4DKFH 3TCXA 1KGCD 3GSQB 4U1IB 1IFHL 4LLDB 1KIQB 1UWGH 4XC3H 5BRZE 3ULUE 3NPZB 4WV1B 1KCRH 1T83A 5IW3A 4DGVL 2VMFA 2G5BA 4QXUL 3WO4B 5F8RC 1QD0A 2Q7NA 3PGDA 4IJ3B 4E42A 1NFKA 2EC9U 2EDQA 1Q9OA 2ZCLL 2Z31B 3OJDA 4P59H 4PRIA 3MV8E 1BFOB 5ALCL 3V4UH 4KY1L 5ESQA 4Y7MA 4P4KA 4JZNA 1ZHKB 1NC2D 1MFDH 2ED9A 1XIWA 4X8XA 1DQML 3ZT5A 2RBLA 5KVDH 4H25B 4FQ2L 4G5ZL 1OF2B 3MJ6A 3ARSA 1C5CL 1PEWA 2NX5B 2R2BA 4MNQA 2J4WL 3K2MC 1JV5A 4HIJB 4TN9A 4MJ2A 4GRLC 3ZYOA 4CMHB 4QXGH 4KZEL 3BIKB 3JSSA 43C9B 4NQCE 3K1DA 4KTEL 1N6QL 4PP1C 4BFBD 4X6BB 5IESL 1AQKH 2FZ3A 3RKPA 4HPYH 4TNWK 3T0EA 4OLWH 4KI5E 4HS3B 3SGJA 1EX0A 4ODSH 4X4ME 4ZUVA 1ZEAH 2L7UA 1NGWB 4AL8L 4AEIH 3EOYG 3WXWH 4TOYH 4G43A 1BVKB 1VB9A 1SQ2N 1QLFA 3CFCH 3QIBB 4CU6A 2XA8L 2FHBA 2EZ0D 4JG1H 4MCYB 5GGSY 5DYOB 3UZVB 3MRLA 3BE1H 2H8PA 5MEND 4L8DB 1ZT4A 5FYLL 1CIUA 2DQHL 1LK2A 4QHKJ 5KSUB 1EFQA 5KSVA 1WAAF 4YAQA 4AEEA 1QFWM 1C7TA 1CD9B 4PJBE 3MOBH 5DJCA 3GHBH 3K8KA 2C9AA 4RA3A 2V17H 4AM0B 3JWDL 5I66A 4OCXL 1QA9A 3QDJE 2F58L 2MPAH 2AJZB 4WEBL 3LRSA 4P2RD 1D5IH 3PDOA 3MV11 5GZOC 3E6FA 4MA8H 3MRBA 4M7KH 5CGMA 4KU1A 4U2ZA 3TEUA 1CXHA 1U41A 1U8QB 2OTWB 5DHVB 1NGPH 3NFNA 3OAZH 3QQ9D 4DAGL 2AI0L 3MRCB 4LCCB 1IKFL 2FL5A 1AY1H 3STLB 3OF6D 1RZJC 3LKNB 1JHTB 5CWSB 2LVEA 3PL6D 5FGRA 1A4JA 4BQ8A 4X8JB 1DBAL 1CS6A 3VG0H 5K9KA 3U2SB 3C5ZD 1TETH 3O0RL 4LQFL 4ZQKB 3RZCC 3MRKB 4ELKA 4TUKH 2ZOLA 4R4ND 4JHWL 1DSFH 4XI5D 5EO9A 5EO0B 4JRXE 2V9RA 2JJSA 4ZXBB 5GRWA 4U1SB 1KXQE 4GT7A 3QZWB 2DN7A 2HVJA 3P0VL 4D0DA 4JDZA 4P2QB 1PSKH 1BZ9B 3L7FB 3ZTNH 2GJ6E 5ADPL 4EI5C 3UYRH 2A83A 4BH7A 1G7QA 2H2SC 1MFBL 3MRDA 4LU5L 1X5FA 4PGBA 4ZUWA 1WIPA 2CQVA 3MBED 3LD8C 4RSVA 4P23C 3SDCC 2XNAA 1AGCA 2QQNL 4LK4A 3V5KB 4JFYB 2E6JA 4U1LA 1N5AA 5I18L 4Q9RH 2QLVB 1MRDH 3QWOB 3WSQL 3K81A 1UH2A 2Q20A 5GS3A 3M1BB 2ZCHL 3C6LB 3P9WB 4Z7QF 3JV5A 4OZIA 1RQ5A 5GSRA 3HMXL 1T21B 1S9KC 4OKDA 4PBVC 2IC2A 1NC2A 5LGHH 2YXMA 3O2VH 1H3WM 4AT6A 2CO7B 3ZTJH 1MJ7L 4APQC 4QWWD 4NNPL 3C5JB 3TVMC 4CKVX 3G5YB 1P4LB 2XG4A 2EXWD 1I7RB 3RNKA 3GMOA 4OLEA 4W68A 1EHNA 1QNZL 3QIWB 5I1GH 4KTDH 1DE4A 5IGXL 2X44D 2BP3A 3CLFL 2B2XH 2BSTA 1BVZA 4P2OC 3KJ6L 3EOAA 1T1XB 5DVKA 4JFQA 3IDJA 1N5YH 4F7TA 3ARFA 1PD6A 4XXDA 3L3JB 4TRPL 4QF1B 4YIQA 3RUGB 4B5EA 5HYSG 2WWKO 4W6YB 2CD0A 3TBTA 1NUDA 4F7MA 5MENA 4WUUD 4FG6C 1U8OA 2BX5A 1TTUA 1RUML 5JQHC 2P49B 1JGLH 3QPXL 4LCWB 5FA4B 5FHBH 4YFLI 1EGJA 4JPVL 2ZUQC 3N1GC 3FQXA 4PP2B 3VXRA 2B1AH 5F3HA 4FZ8L 4HEPG 4U0QB 4WWKC 3ARDA 3LKRA 4K8RH 1F3JB 4LSSL 1F4YH 1X4XA 3U6RA 3TZVA 5F7DA 4TSCH 4LARH 3MV7B 3ULVE 2O5XH 3N50A 3HS0A 3DMMC 4CMMB 1E4XL 1E6JL 1JGUL 5EORH 3MX0A 3E3QE 4HC1H 1GGIL 5JOPD 2GQHA 2B5IB 4JGUA 5ITFA 2W60A 5DF0A 1JWMA 1P7KB 2J8UA 5DR5H 3S5LB 5ID1B 2XN9D 5GRJH 3WIHA 5T1MA 5FDYA 3BUTA 3C8KB 2IF7A 4XVUC 3HLAA 2BY2A 4NCDA 3VFRB 3C5ZA 2NY5H 3TH2T 3MXWL 5I74C 1FNSL 2FB4L 3RI5F 1AKJB 3KPSD 1DQLL 4KK9C 1BOGB 1F13A 5D5MB 1KBGL 1I3UA 3FN0H 5AUMB 4L3EE 2FD6H 2DTSA 12E8H 2ADFL 3WNLA 2DKSA 5B38A 4PJXA 5MP6H 4KVNH 2WP3T 3IU4H 5SWQB 1UM6H 3LHPL 3IDGA 4PRAB 1P69B 1DQJB 4P5KA 5IB1A 2H9GA 3B9VA 2IPUK 4Z76A 2W9EL 3LB6D 4ODVL 5HI5C 5GS0C 4MB5A 3MBEA 1AI1L 3AM8C 4Z7WF 3OHXA 3IJHB 1PLGL 5FYLD 2CK0L 1G9MH 4GW4B 2IBZY 4KROC 1HQRB 1CFBA 4JHAL 1IGIL 2NY3C 2W0PA 3EDDA 2D03L 4K7FA 5C2BH 1Z9OA 1YNTB 3O2DA 1NDMA 5ETUB 5CJ8A 5JHDE 1FL5A 3D25B 4HKBB 1UWEL 4EUPA 1ORSB 4Y8DC 4M48L 3QCVH 3I50L 5FKAA 2OSLA 4G7YH 1QRNA 2F53B 3TO2A 1MVFA 5EUOF 4M1CC 1E27A 3VCLA 4Y5XB 1W72H 2FO4A 5LVEA 3HG1B 2BRRH 2HFGH 3U46A 3IRZA 3ULUL 3JVGC 1WBXB 4RAUA 1FP5A 1QBMH 1HK6A 4ZAKD 2CDEB 6FABL 5INCA 3AS1A 4NZTH 5J7CC 2FATH 3GSRA 3WKNA 4ZPVA 3AY4C 5LGKA 1WITA 1UKSA 1CBVH 1FNHA 4Z7WE 4YO0B 4Z77B 5JDSA 3VFTB 3CPLA 4YHNB 3IYLW 2VR4A 2NY1C 2Z91B 2ZUYA 1RJLB 1ZK9A 3ARBA 4IS6B 3TBYB 3MXVL 3OXRA 4OLYH 3B9EA 3TJHD 2VZ3A 2YN3A 3MACL 2MMXA 4NOFA 3OKLA 2C3VB 4YDLB 1CG9B 4YK4C 2EEAA 4GRLD 3UTQB 3IB4A 5KG9B 3U7WL 3OAUH 1S7XB 3O3AA 3G6DL 3MRIB 5EUOE 4PP1D 5ISZB 3QWQB 2VR5A 2BVTA 2GW5A 4LMQI 1KJ2B 2R1WA 4L4VD 3HMWL 3MNVA 2X89D 4HJGA 1FPTL 1J1OL 5JIPA 5D96B 4ZS7L 4MX7A 4WO4A 4ZUSA 4MA3A 4HZLA 4X4YA 1TZIA 3S7GA 4OZ4A 3C2AL 2JIXD 3VFOB 4F8QA 4YHIA 5E5MB 2ERJC 5CKAA 4I77H 3T8XB 2X1WL 1T2JA 1M71B 4DZ8B 4XMPH 1F6AA 2X4UB 1EERB 4O4YL 4ELMF 2BNQA 3VW3L 2GY7B 3TNMA 2DIJA 4AMKH 5T1KB 4E41A 4PB9H 1A6UL 4MDJA 5EZLB 5HHVH 3OV6A 3TBVA 2BVOA 4LLYA 1UZ8A 4JJ5A 4QRSB 4LASL 1RK1B 3GJEB 4PJAA 2HN7A 5J06A 2CLRB 3DX8A 5SWSD 5GZOD 3EYQC 4GKNB 2Q8AH 5CP3H 4L8SC 4NN5C 2VLJB 3MNWB 2VXUL 3IFPA 1G7MA 2ARJA 3GEWB 3QAZB 5A40E 1WWWX 3B3IB 1Z0NA 3BEVA 3VFNA 2FJHB 4A6YH 2V2XB 1QLRB 3C9NA 3RIFF 3VG9C 2DBLH 5DJ0A 2YK1H 2G2RB 4M93C 2J8HA 3CSBA 4QOKE 4UILL 1MLCA 2VLKB 1UB6A 1WCBA 5D2NE 4UB0H 1TIUA 3KPNA 4UAOC 1JBJA 1JPST 1BGXH 5JUEL 4G6KL 4DGYH 1FH5L 4RFOL 2VL4A 4F7EB 1FBIL 5F6HJ 3QJHB 4KMQA 3GK8L 4G8FA 3UBXA 1NGYA 4NKDB 5AZEH 3WFEH 1MHCB 4PS4H 5FGBA 3MODL 3UROR 2G9HB 2Y5TA 1KYOJ 1CFQA 1X3DA 2FHFA 3CU7A 4KJYB 1MCFA 1DCLA 3WNMA 4NJAL 3S35L 3F6IA 4S1DC 3BKMH 1KPVA 2IADB 2JELH 4OLVH 1IM9A 1UA6H 4KV5F 5KSAB 1IKNA 5BO1L 4HIIA 5EOTB 1KB9K 4OGXL 4Y88A 4NC0B 3UTPE 1LO5B 1AHWA 2FSEA 4TTGA 5FM5O 1CFSA 3SPVB 4JM2B 2HVKB 4PR5A 2HYMA 2IALB 4Q74A 4XMKL 3RKDC 3U4BL 4P23D 4M43L 3GHEL 1WV7T 4QRUB 1F4XH 3GKWH 5F3BB 3RZWA 3BP5A 5HYJA 2A1WH 1F4AA 1T0PB 3H42H 3RWCB 1FGVH 4L9DA 5FV2A 2NNAA 5I1LB 2IJ0C 1X7QA 4YBLC 3QO1B 5J9PA 3TV3L 5C0CB 3SCMC 4N5EC 3HNTH 2MSPA 3BSZH 5D6DA 3NCJH 5F72S 1QBLL 3GMPB 3WFCH 4APQD 5DD1L 4UQ3A 3PE9A 1GZPA 3QUYA 3GO1H 3BI9X 2DAVA 1IAIM 5EZJA 4OM0L 3UJJH 4OCSH 1SBSH 3VD3A 4ODXA 4HH9A 4KV5E 2YA2A 1A6PA 4L4VA 3QUXA 4MQ7B 5GGVH 4XXCA 5JW3H 5DURD 3KJ4C 5DD3L 3S6CA 3I6GB 3SKJL 2H6PA 3IXAA 1Q9KB 3C5SB 4NKIL 5HPMA 1YY9C 3B2VL 2X5PA 3REWA 1LNUA 1IGCL 3SJVE 1QR1B 3SY0B 4KAQL 2B8OT 3HMXA 3L5HA 3IRPX 5FCUL 3G9VA 4AH2B 4RMTA 2HFEA 5EFIB 4NN6B 4YUEH 1AFVH 3T0EC 1BOYA 3AXLA 3SGJC 4XX1E 3F7YB 4P5TA 3NACH 4UIMB 3W9EB 1MAML 5BRZD 3ULVL 4P49A 2NY4B 1XF1A 4K7PY 5FA3B 3WE6B 1EO5A 2E3VA 3RDTA 4LHQB 4UMGA 5IW6A 1KTLB 1T5XB 3QXVA 3VMNA 3HB3C 4PG2A 3I6LD 3V6OC 1K8IB 2BOBA 1FZKA 3MV8D 1J18A 3MRRB 3BVNB 3LY6A 4EEEA 5FK9A 1Q72L 5A2IH 3QNXB 1FVEB 4JLRB 1D5ZA 2AGJL 2H45A 1KLGA 1JGDA 5EOCJ 4LLWB 2YHGA 1HINH 4M7ZB 2V5TA 7FABL 3KPRE 5C09B 3BWAA 4GW1A 1IQDA 2DQCH 3B43A 1HKLL 4YGAB 3WJJA 3I75A 1BWWA 1A6ZA 2AQ3A 1QQDB 4TULL 1A6TB 3ISWA 4JY5H 2VWEE 4P57B 3SOBL 1I1FA 1FQ9C 4UIKH 2CXKA 1OWWA 1IQWH 3K0WA 1I9IH 1H5BC 4I18A 4JFDD 4PRHE 5JDJA 4PTTA 1AIFB 4OFYD 1BX2A 1CTOA 3CIQA 1IGTB 4ZYKA 3HPJA 3L3GB 3O3EA 2MCPH 4DVBA 2XY2A 5DDHB 4FTVA 4GXVL 4R7NB 3VXNA 5CEXB 4N8VG 2E9WA 1I1AA 4XAKE 5GS0D 3MRGB 3PHOA 4UDTB 3LS4L 1LO0L 4DKEL 5EIVA 2EDYA 1GGCH 5BS0E 4YHYC 4KROD 1OAXH 3BZ4A 5FDWA 4QY8B 1I4FB 3OKNB 1YECH 2PO6A 2NY3D 4JFFB 4Z8FL 4LP5A 4PJEF 2G5RA 4KKAC 3R06A 5FUCE 5GGSA 3V0AC 2VXQL 3MNZB 4HUMB 5FECA 3IFLH 2G5BB 5DMGC 1JZ5A 1NCWL 4M1CD 3PGDB 1IEAA 3INUH 5F7LB 3RTQA 1S9VA 4J3OC 1MHEA 4K3JL 3OJDB 4Z9KB 3HI6H 3VGHA 1YNLH 3QXWA 4Y5VB 4S1QH 3VGEA 1DTUA 4HAGA 5ESQB 4XT1C 4AJ0A 4P4KB 4YC2C 4JZNB 4OSUL 3T1WA 3ZL4H 4X9FA 2YUVA 1XIWB 1T03L 1JUFA 2R0LL 4MXQC 3UCRA 1LEGB 3BP4A 3C87A 3U0TB 4OFPA 2R2BB 4KKBD 4KDTA 4MNQB 3QCTH 5EOCL 3SBWA 1JV5B 3OWEA 4HGMA 1HILA 5JW4M 1Z9LA 4YBQC 2RHEA 5H35B 4K3DH 4JRWA 4S2SB 2GKIA 5CJXA 4XPGL 5GRUH 3GMMA 2FZ3B 2X9XA 4Z95L 1A3LL 1A7QL 3HCVB 5IUSA 2P1YA 2QHLA 2GJ6D 3NGBB 1MQ8A 1X9QA 4ZUVB 3LDBB 4KXZI 1GPOL 5DSCA 3WXVL 2YD9A 3K4DA 3BT2H 3FT3B 3HE7A 1QLFB 1XGYH 5JPMB 4W81A 4JREC 1YEFH 4R7DB 1MFCL 5BRZA 3WFBH 1FC2D 3ARFC 3MRLB 4I1NB 4LHUB 1G7IA 4H8WL 2NLJA 1F2QA 3O81A 1LK2B 2Y06L 3KLHC 5K9JH 5KSVB 4WFHE 3IDIA 4YAQB 3KDMA 1VGKA 5C92A 2O93L 4OT1H 4YZFF 2CGRH 3ARZA 4GG8A 3T3ME 3FFDA 5I66B 4X7SH 5FYKU 1FIGL 2AJVH 1BVLA 4NUGL 1HH9A 4HQQH 3MV8A 4X5WA 5DQ9A 1JNNL 2CJUH 2NW3A 5DJXB 2AJXL 2DJSA 3VD7A 4ZTOH 2IANE 3AMLA 4HXBH 4NJ9L 1MOEA 4HEME 1QBAA 3A6CH 3EW3B 3UO1L 1E4XI 2BNRB 5IB5A 3FB7A 1M7IA 1RUQL 3LQAL 1AO7D 2MKLC 3KAAA 4HHAA 3THML 4NQCA 1J8HD 4N90E 1QFOA 3F62A 4DK6A 3NZHH 3KXFD 5JR1L 4CJ1A 1A4JB 1HYRC 3RWDA 2AK4D 1S7QA 4O00A 5K9KB 5HJ3A 4X4MA 2VDLL 1JPGA 4JO3H 4PJHE 4TVPE 2DWDA 3EDJA 2P8MA 2EIEA 4QRPE 1DN0A 4ELKB 3UYPA 2ZOLB 2YPLE 1HOCA 4NCC1 4AIOA 4CU8A 4K7PL 3WNNA 2VLRE 3V95A 4EVNA 3UMTA 5CJOL 5IIEA 2Z93A 2AV1A 4D0DB 4FS0A 2XG5A 1KCUH 3O9WB 4PJBA 1EEYA 3QI9B 2A83B 1Q0XL 4BH7B 5T3ZH 2BY3A 2NY6C 1G7QB 1YYML 3QDJA 4POZD 5GRVL 3MRDB 1VCAA 3OZ9H 4PGBB 4ZUWB 4YDJB 1NBYA 1WT5A 4WUKL 3BPCA 5CCKH 4NWUL 2W9LA 1UGNA 4S1DD 2XNAB 1OW0C 1EJ6A 4LFHD 3RWGB 4RAVA 1U8KB 1H8OA 1JHLL 3QDME 1JJUA 2HKHL 2DWEA 3UXFA 5IV2A 4ZTPL 1S5IL 4LIQE 4Z7UF 5DQDL 3FO2B 4L8CA 5GSRB 3O6LH 5A43C 3VD4A 1NC2B 3TO4D 4DTGL 4AT6B 2XPGA 4ORZC 1BFVH 3C6SA 1XT5A 5C0IA 3S37L 5E2WL 5IEKA 3RNKB 3GMOB 4L1DA 5I6XB 4L3ED 4JFXB 4R8WH 1DE4B 4FQPA 4JRXA 3LN4B 3TP4A 3MLVH 4L3CB 4FQCH 4FFZL 2OP4L 4LKXA 4N5ED 3EOAB 3OKDA 5I1KH 1EJOL 4HPOL 2GJZA 2GJ6A 4JFQB 3IDJB 4HJ0C 2PKDA 4PRDA 3LZFH 5DWUH 3TCLA 5C7XH 1NAMH 3U30B 1F8TH 5JOFA 2HT2C 4OAWA 4MYWB 3OTTA 2VDRL 4N8CL 2D0HA 3QEQA 1KXTB 4JVUA 5D1ZD 1INEH 5C86A 1JYVA 1A9BA 1CXIA 5MENB 3F58L 3P0YH 1U8OB 1TPXC 1MWAL 1RU9H 4WI9A 1X5HA 5KW9L 1YEEL 4PB0L 4OLZH 4OLXH 2VITA 3NN8B 5DT1H 3FQXB 3SO3B 5DHXB 3VXRB 4DVRH 5F3HB 1K5NA 5JHDD 5JW5A 5ICXA 3ARDB 4PJFE 4G3YL 3TZVB 5F7DB 4QNPF 5ANME 3O11B 4DK3A 4M6NH 3HS0B 3MLRH 3AROA 3P77A 3BP6B 1BMGA 4NO3B 4HK0A 4X5XB 1PKOA 3MRQA 3VI4F 4WCYL 3X11A 4R4FH 4PJCE 1YNKL 4IOIA 3HZYA 3RA7L 5B38G 2R0KH 2W60B 3BKYH 1XR8A 4FQLL 4WO4C 1CD8A 1II4E 2KH2B 2IWGA 3MCLL 3PL6B 4BZ2H 4O5LH 4OGAC 3HLAB 4IRJC 2NY0C 3BRGC 3C5ZB 4JM4H 4I48B 5JORA 1U8MA 3DRQA 4LLQB 3OPZH 4JFOB 4MAUH 2F8OA 1L6XA 4PJXB 5SV4A 1S7WA 1A7PH 1T0MA 1L7IL 5ACLA 1LK3H 1A4KA 1BQHA 1K85A 5IF0B 2AJYL 3IDGB 4H20L 1XGTA 5FFLA 5IB1B 5ITBH 4CVZA 5F7MC 4JRYD 4Z76B 2UV3A 4QNPE 1BFSA 4JKKA 2Z4QA 5J1AA 2B4CH 2VQ1A 2OI9C 4O58L 4R26L 2H32A 2KPNA 3GMNB 3DBXB 5EO1A 3MBEB 1KTKE 1EZVY 1R3IL 2HT3C 3OHXB 4X80L 3VI4E 4NFDA 4BQ6A 4EDXA 1BBJA 1CDJA 4EQ3A 5I9QC 1ZANL 1G1CA 5J3HD 4NQSB 4K7FB 3V79C 1JIBA 4OV6F 2DDQH 1H3PH 3STBA 3SE8L 1NDMB 3Q5YA 3STZA 4G8EB 5DRNA 3WV0A 3BKJH 1BLNB 3FFCE 4EUPB 2ZPKL 5FKAB 4PBXA 2XQYK 3HI5H 3QDAA 3WYRA 1E27B 2FO4B 3QNYB 3F12B 3M45A 3U46B 4ZODA 1I8KA 3V52H 1R5IA 4KKAD 4L3EA 4PGZA 3RIAF 5KSBF 1IKNC 4YXLH 4IRZL 4K07A 1NAKH 1U0QA 1KPRA 5INCB 2O5ZL 3KYOB 4WI3A 5T33L 1OAQL 1FFNA 2KBGA 3GSRB 5D1QA 1IC7L 2DKMA 1C5BH 2YR3A 1YPZE 1B3JA 1FC1A 2R2EB 3QO0A 1SY6L 3LPWA 2ICES 1XH3A 2IBGA 1ND0A 5JDSB 1CGWA 3MJ8A 4DGIH 3ARBB 2J5LB 3I6KA 5E8OA 1E4KA 2VAJA 3OXRB 4KHTL 3DURA 4N0UB 4TSBL 4TQEL 3QDHA 2EIDA 3ZE2F 3OKLB 2GUOA 5D6DC 2HJLA 4YBQD 1V7NH 1L7TH 3QUYC 5SWZD 3RVTC 4GLRI 1NCTA 5D70L 1P84J 3RGVA 1P53A 3QQ3A 3MNVB 4J8RA 3TF7C 4DN3L 4PREA 3DGGB 2DQGL 4MX7B 4MXVE 4S0TD 4ZUSB 3P40A 4MA3B 4X4YB 1TZIB 3U36A 4GRWF 4JQXC 4H1LH 4NQUA 4KH2A 2WUBH 3QUXC 4YHIB 1PJ9A 5F6HI 4XXCC 3RGHA 2B0SH 4NRYB 2W0KA 1PKQE 1OD7A 2HKFL 1CLOH 4K71C 4QGYA 1UCTA 3QXDA 1LP9F 5FXCH 1ZHLA 3TNMB 2EKSA 3MMEA 4E41B 3BZFA 4MDJB 2WUCL 3MLWH 4Z0BL 5J13B 3BDBA 3WFDH 3KPSB 3HE6A 5A3IC 4LLYB 4AEIL 1UZ8B 3PWPE 4UT6H 4Z7WA 3N9GL 4PJAB 1IGML 2HN7B 2CR6A 5E2VL 1J05B 5C9KA 3DX8B 3X3FL 2R29L 4EBQL 1JE6A 4IMLA 4XP9H 2ARJB 3UJIL 1CDYA 1LEKB 4Y8AA 4B53A 3UBXG 2BFVL 3BEVB 3VFNB 3GHBL 3VWJC 5BJTA 1RUAH 1HIML 1PZ5B 2VXSL 1UG9A 4PG2C 5EUOA 1WCBB 4DOHB 1DL7H 5FHAH 1QSEE 4TVPL 2V9QA 3KPNB 5HHXH 4MA8L 3C09C 1VFAA 3U82B 4KZDL 5JMOC 5J89A 2DIAA 5CSGA 4GRWE 1AGBB 4JQIL 3PWLA 4JFHE 4G8FB 1TJIL 4HK3N 4RA0C 1C1EL 3SDDC 5LQBH 1NGYB 2DQIL 4U6YB 2IPTH 5L9DL 5TGBA 2PYFB 2EIZA 3SJVD 3TNNA 4XHQA 5TGBB 4XVTL 1KPVB 5E9DE 2FDBP 4DCQA 1ZMYA 1H8NA 1KSRA 4G8GE 4U7SA 4JZJA 1IM9B 1KB5H 4HIIB 3BYYA 2FECI 1NPUA 4L4TE 4F9LA 2DJUA 4UT7H 2Y36H 5JW4R 4QKXB 3B2UC 4EZMA 3BWUC 1CFNB 1AHWB 3U79A 5I8KH 3SGEH 1CFSB 1ZLSH 1NGZA 1YC8A 4ZAKB 4ISVB 3ULSA 4DQOH 3MLUL 4FQXA 4PR5B 2QHRH 1D6VL 4K8RC 4F37F 1MQKH 5C0EB 1MJUL 3EOBA 4P46C 1CWVA 3NABL 3D1MC 1I1AC 5F88A 1T80A 4LIQL 4MQSB 1YUHA 5IW1A 3UYRL 4Q58C 3VRLE 4XTRC 4MAYA 4XGZB 2WQ8A 4QOKA 3RWIA 5J9PB 4AG4H 3FB8A 5D2NA 1JNJA 2PO6C 4RISL 4W6XB 1H8SA 1BEYL 3KPRD 5D7JA 1FCGA 1EBAA 5GJTH 1KIPB 3B9AA 3EYFB 2X4PA 3GUTA 3A6BL 3FOLB 1NLDL 2NY7L 3QBTB 1H3UA 5DC4B 5EZJB 2KUTA 1PYWA 2NY5C 2J2ZA 1LO2H 5KTEL 1MRDL 4LEXL 3SGDI 4HWZB 4M6ML 4ODXB 3O6MH 4EN3C 2AW2A 3FQRB 4HH9B 3RPKA 5DRWB 4LVHC 4PRHD 4L4VB 4YHPA 3ZDYF 4WFEE 1VENA 3FT4A 1Z2KA 4JFED 2EYRA 2QSQA 3GMLA 3D3VD 3RHWK 3O45A 5IQ7L 2H6PB 1FG2A 3IXAB 5TPWH 4CAGA 1YEGH 5JHLH 2JIXB 4LL9A 5HPMB 2HT2D 3SBWC 4KDTC 5LJYH 3ZTJG 4LSTL 4AIXA 5DVMA 1LNUB 3Q1SL 4JDVA 2QV2A 2R8SH 3BP7B 1NBZA 4Z0XA 5BS0D 2D7TH 3HZMB 5BV7H 5CJXC 3CLEH 4PJIE 4OIBA 2HFEB 2P8LA 3EFDL 2ED8A 1G9MC 3AXLB 4P5TB 1F45A 2WZPD 1GC1L 1NCCL 2H3NB 5BZDA 5E2UH 3H7BA 3NCCB 1TQCB 3HE7C 3LEYL 5IJKC 5SWSB 4FXLA 1JNLL 1XMWA 1S3KL 4YDIL 3RDTB 4S1SH 5IW6B 2YD1A 4OF5A 3E8UL 5IHZB 2E27H 1J87A 4KDWA 2BOBB 3OL2A 4I0KA 1A3QA 1SJHA 2YN5A 5FK9B 1MCDA 4WIQA 1FYTE 1NFDB 3MSPA 1T6WA 1JFQL 3BUYB 4Q6IA 4XP4L 3KYKH 1U42A 1A6VH 1F4YL 1I3GH 3BPNB 3OKEA 1BJ1H 4OGAD 4LLUA 3C60A 2NY0D 4GW1B 4IRJD 1T1WA 3RVVC 5IEHA 2HRPL 3I75B 4NRXA 3RY4A 5I73C 2HTLD 5FYJU 2YZ8A 1I1FB 3B9KC 3FONA 4M9OA 2A6JB 3O8XA 5ACZA 3UPRB 5DI8A 5D8JH 4I0PA 3SJVA 5DR5L 3P73A 3V8CA 4I18B 4O02L 3AFLA 2CMRH 3QT2A 4PTTB 4N0CC 3VRJB 1QACA 1BX2B 1NGQH 3WUWA 5IHUH 4GQ9L 4ZYKB 4RGND 5A1AA 4NM4L 2BJMH 4HX1A 4DVBB 4M7LT 3VXNB 3BGAA 5IG7B 2IPUG 1F4HA 5GGQL 4WFHD 1XF4A 5TFSH 1WC7B 1CTNA 3BZ4B 5FDWB 2R4RH 4RGMC 2D4DA 4HV8A 3MC0A 3ZE1F 2BHUA 1GH7A 1OSPL 1RHHA 4KQ3L 1HXMB 4JANA 1OCWH 3GDBA 5GGSB 2C3HA 3X12A 3DRTA 4X6FA 1C5DB 5FECB 3VI3E 2CUIA 3OAYH 3KPRA 3LS5L 3QHZL 4B7IA 3QUZC 1IEAB 4E9LA 4M9PA 3RTQB 1OTSD 4APQB 1S9VB 4NQDD 5HGAA 3HFML 3D69A 1LD9B 4FXKB 3MBXL 2IG2H 3FRPA 3UTZA 1H0DA 1RMFH 3W2DL 1JWUA 2J6EL 3VXME 1JUFB 1B90A 2Q6WB 2V7HA 4FMKA 3ZYJA 3D2UA 3KR3L 1WFUA 3BP4B 4R90H 1X5YA 4FOMA 4QRPD 2FEDD 4OIIH 3OGOE 1G7PA 1GXEA 4JFPA 1HILB 2ZSVA 3PWVA 5DURB 1V7ML 2ID5A 2VLRD 4RDQF 2BRRL 3CSYB 4GAYA 4NQEE 4IDJH 5C07E 1WGOA 5EU6E 1Y6KR 3GMMB 1NMAH 1VFUA 1R3HA 4TUJA 4MMZC 3MUHL 3EO1B 5DSCB 3BKCL 2Q86A 3CH1A 3DX6A 4JN2B 5FYKE 1ZT1A 1XF2A 1MY7A 3NFPB 5I8EA 3FZUC 1Z5LB 2AJUL 4K23H 2Q8BL 3T1FA 5IBUB 4M5YH 4NZRH 3VDBA 1QKZH 1V05A 5BRZB 2XXMB 3CCHA 3V0WH 2A9MH 3WS6C 3MQIA 1KB9J 3IDIB 3TN0D 4PJ8D 1BZ7A 3KDMB 2XKNA 2Y07L 4GG8B 3FFDB 2BHYA 4OLYL 5BVPL 1BVLB 4XP1L 3MV8B 4URTB 3IDUA 3MRHA 3MUGA 4H0HB 4KK6C 1KJMB 2IAMA 1SJEA 2O26U 1SY6A 3TIEA 3KPMA 2X4OB 2LU7A 5DJYA 2NR6C 3VU2A 5IM7A 1MPAH 4G8IA 5IB5B 1A7RL 1UZ6E 1NC4D 1UT9A 4DN4L 2AQ1A 4NQCB 3KS0H 4XP5H 3HAEA 5A3ID 3QSKB 3MROA 2Q3ZA 3EO9L 1WFTA 1SVZA 5CJQH 1S7QB 5HJ3B 3L3DB 1JPGB 3RVWD 5INDA 2DWDB 4XMPL 1N64L 1VGEH 1NL0L 5EU7E 5CJBA 4OD1H 1VFOA 1DQQB 1JGVH 2EDDA 2MQ3A 2XTJE 4PTUA 2Z93B 4CNIB 2ORBH 2G75A 4XAWH 5MEOA 2VIRA 2X7LA 3LIZL 5GS1C 4W4NA 3PNWB 4PJBB 2Q8AL 1DR9A 2M2DA 1QFUH 4NPYA 4C56D 1JN6A 3QDJB 5D5ME 5J56B 5C08D 4NSKA 4H1LA 3T08A 4X83A 2ATKA 3H3PL 3SDDD 1WICA 2F74B 1R0AH 2IANA 3BPCB 1TNMA 2I25N 4RWYH 4MVBD 4AQ1B 2OJZH 5DFVD 3WNOA 2D9CA 3WN5C 1YMMA 1Z3GH 4NC1E 2YRPA 3VXUD 2DWEB 5IV2B 1OTTD 4MA1C 3K3QA 1QLEL 4HUXA 2FX9H 5CSZA 5AZEL 3WFEL 1TZGL 1UEYA 4IOFC 4H0IA 2XPGB 5DRXA 3EGSA 4BUGA 2GY5A 4R96B 4PJHA 5C0IB 3PDGA 3TA3A 4P46D 1RIVH 4YQXL 4TPRH 3M17A 4OCYH 5IEKB 4QRPA 4CDGC 2UWEE 3PV7A 4XNXH 1CVSC 2YPLA 1OAKL 2VOTA 4G7VL 2APBA 5E94A 4Q0XL 4JRXB 3DPBA 2VLRA 4HCRH 3UTSE 5F44A 4LKXB 5T5FL 3WIIL 3VJ6A 1VADA 4OD3H 4PJ9D 2GJZB 2GJ6B 4XNUL 2OXHA 1RZFH 4PRDB 4HKXB 3U4EB 1VA9A 3NCMA 4JQVA 5JOFB 4QRRD 5TE6L 5C0BE 3GKWL 5HHOD 5I75B 1UQSA 1KJ3L 5F7FA 3CX5J 4HF5L 4ZS6C 4PD4K 5D1QC 1A9BB 3TH4T 5E8NA 5CEYA 2R56L 4AEHH 2XACC 5DEGA 3WDJA 1ZVSB 5LG1A 4EN3D 3TJEH 4Z78A 1TZHB 3TT3L 2RJMA 3HNTL 2MFNA 3S34H 5DUML 3EYSH 2FX7H 4NN7B 2GK0A 5EWIH 8CGTA 3L1OL 3CDYA 4RBPK 2P5EE 3QDMA 2PR4L 1E4KC 1JTTA 4XMLH 5ICXB 1YEKH 5C6TH 1T66C 2ESVE 1HHHA 3UDWA 5MI0B 4PIRF 4D9RD 1WZ1H 2ERJB 1RURL 3UJJL 4OCSL 2VSDA 2CIKA 1IC4H 3EYVA 2A6IA 5FKPB 1N0LA 2HWZL 2ZUWA 4NHCL 3C8HA 3BGFC 3F7PC 3DIFA 4GMSH 1UACL 4HK0B 3MRQB 2QSTA 3X11B 1SM3H 4NOBA 1NC4A 3RGVC 1AO7B 4IOIB 1RZKL 1H15A 3HZYB 5I1JH 2EDEA 1EHLH 3BRDA 5JW3L 2XA3A 2R23A 3S3SA 1XR8B 5ISZE 1JTPA 1M7DA 1ZTXH 2OZ4H 3JWOL 1B2WH 1IGYB 3PXHA 4N5UA 5ESVA 3IVKA 3LSOB 1Y6NR 4RZCA 3MO1A 3T2OA 2Y4SA 1AR1C 3OGCA 1JPSH 4YR6A 1U8MB 3DRQB 3X14B 5CIPA 4M93B 4OGZA 2APTA 1DBKH 1DLFH 4A2LA 1KC5H 1S7WB 1T0MB 2HTKC 5E99L 4X7TA 1ZS8A 4LP4A 5EBMA 1BQHB 5DHVH 4P3CL 3G6JF 3ZKNC 1FNEB 1TTFA 3RVVD 1JHKL 4G6MH 4CVZB 3QUML 1FHGA 1Q94B 2PN5A 2X40A 4PJFA 5J1AB 1P6AB 2D7QA 4UOJA 1ZGLA 2Q7YA 2H32B 5ANMA 4DW2H 3B9KD 2OK0L 4M6AA 1IBGL 3BRFA 3EHBD 3SDXF 4ENED 4CVXA 2P8PA 3AC0A 1BBJB 3JUYA 4B7LA 4XRCA 4H0GA 4L8BA 4PJCA 1KPUB 4HBCH 1P4IL 3STZB 2VLKE 5DRNB 1S7UA 3V7AG 4JY5L 5EC1A 2PTTA 2FBOJ 4HWBA 3TO4B 1K4DA 3U1SL 2KDGA 5IT2H 3V9FA 4B50A 3OR7A 1RK0B 1I8KB 5BVJA 5AAMA 1JPTL 4JZJC 4L3EB 4LPCA 3S4SG 3SDAA 1JZ4A 1KPRB 4Z7VE 5IVXF 5DJ2A 2W38A 4OI9A 3PABB 3RBGA 3DV4B 3BZEB 3QUZD 4P5MA 1MI5D 1WBZA 1BQLL 4LPXA 1YECL 4XVSH 3QO0B 4Y2DC 1HNGA 4F7CA 2OYPA 5C0RL 3SDXE 1QSED 2X4NA 1KLFA 3MJ9H 4TNVK 5CUSL 3UC0H 1AJ7L 5D1ZB 4P3DA 1JRHH 4M5ZL 3I6KB 2PTVA 2J88H 4U49A 4NGHH 3OKKB 25C8H 4JFHD 2GUOB 3GIZL 2XXCB 1S78C 5L0QC 2NXYD 3LRGA 5JHDB 5KVEH 1BAFH 3FFCA 3GZKA 3HI6L 5MHSD 3GSUB 4O2FB 4S1QL 3VFPB 5E9DD 5FYKL 3FHAA 2IQ9L 5J4MA 1MCNA 1EUTA 1KJVA 4J8RB 4Z7NE 4CADA 4PREB 3ARVA 1JVKA 2ZUUA 3UEZA 4LF3B 4G42A 1V3KA 3LMJH 2E6PA 3FZUD 3MJGX 1GGBL 4LCYA 3U36B 3BYTA 4HIXL 4UU9A 4OFKA 4U1HB 4FNLH 4KK5C 2DM2A 3EJYC 3FO0L 5JXEA 1MJJA 4HS8L 1ZHLB 2E6QA 2J6EA 5B39B 1S7TA 2EKSB 3MMEB 3BZFB 1U8JB 1YYLH 3SE9L 1B0WA 2DLIA 3W39A 2R69L 3HE6B 2XWTB 3BAEL 1EO7A 1YPZA 3ES6B 3BT2L 4Z7WB 3SE4A 1DJSA 1WLHA 4AYFA 3BEWB 1YMHA 1FE8H 4UV4L 4I0CC 3W0WE 4IMLB 3TH3T 1S7SA 1JWSA 2DQUH 4JR9H 1AC6A 5HVFB 1KCVL 1AD9B 2Q3AA 2JJWA 2NR6D 2GSIA 2QADC 5J11C 5H2BA 4YEEA 1X5GA 4XPHL 2J7LA 2PXYC 5FO7A 3O2WH 4BSVA 5ERWB 3VE0A 2DMCA 5BJTB 4HXAL 1M1SA 4KK8C 2R9HD 1VKXA 5EUOB 1T7ZA 3LEVH 3B5GA 4DZBB 1BD2E 4I3SH 4P9HH 4JFZL 5L8LB 2FBJL 3UX9B 1OGAD 1VFAB 4MS8C 4HXBL 2XWJB 3PWLB 4Q6IC 4U0RC 5DFWH 5EC2A 1G6RH 4LPWA 1D9KC 2YD3A 3C60C 2FYYA 3HC3L 5E1AA 2EIZB 1D5MA 4ALAH 5IBTL 3RWHA 5C70A 1SEQL 1QFWH 3TNNB 4GMTL 5IFAH 3NZHL 2FJFB 4F33A 5C09E 1L4IA 3E6HA 5HI4C 1M6OB 1URLA 1CICD 4JO3L 4NC2B 3QFDA 3MLYL 2EDJA 3PWPA 3P4OA 3FOMA 4D3CH 5KVFH 3U7YH 1EMTH 3VXTA 1WEJH 5D9SA 1ED3A 4FQXB 4X4XB 4QXTA 3G04B 3N0PB 1MNUH 1WWCA 1VFBA 2X4SA 3EOBB 1DUZB 4QO1A 1A47A 1UYWL 5F88B 1S8DA 1NKRA 4MD4B 1YUHB 2VJXA 1KIUA 5IW1B 4LPUA 3GSOB 3EJZD 3QIUD 1K8DA 1FYTD 3MR9A 4XWGH 4Y4KC 4QOKB 3RWIB 3NBNA 4XPFL 3FB8B 5D2NB 1QSEA 3CFJA 4D0CB 3MYJA 3OJVC 1ZAGA 4M8VA 5I71B 5D7JB 2CRYA 4PJDF 1IC1A 1G0YR 4BUHA 4Z5RB 3L3IA 2X4PB 3GUTB 4MNGE 4B41A 4LSUH 4OB5L 1IL1A 5J6HA 2ADGB 2VDNL 1ZSDA 1TCRA 2I9TA 4RCAA 1D6EA 2C26A 5EUKA 4OZGF 4N8PA 1I1YA 4R2GB 5E1HB 1HXYA 1R3LA 1ADQH 4UV7L 4G8GA 3GBNH 2ADJA 2EYRB 1KEMH 5E6ZA 4AENB 3GMLB 3VXQA 3LKPB 4LGSB 4L4TA 3RY6A 1JYNA 4XHJD 3O45B 3OB8A 5ADOH 3HA0A 4OIAA 5D7LE 2W0FA 4F2MA 2EICA 2WBWB 2BDNL 3DSNA 4ZS6D 5HDLA 4UTBL 4WU7A 5HHPB 1HCFX 4JDVB 4FZEH 2B4CC 1CIDA 1NBZB 4Z0XB 1GZQA 4C83A 1GIGH 2DTMH 1AGEA 2G60H 2VH5L 2ZKHL 4XP6L 4Y4HD 3UTTD 1A64A 1Z9MA 5EZOL 3SGKC 5J12C 4OQ1A 4XPBH 5BZDB 2EYSA 1T66D 1OPGL 1MIEH 2VQTA 4N0YL 5JIKA 3H7BB 3O4OB 4QTIH 2UY7A 3BDXA 3ZO0A 1INEL 1AP2B 2W1NA 3W82A 3V4VL 1FRGH 4KRLB 5DEFA 1HE7A 5JOEA 4KRMB 5DXWA 4XB7A 4G6FD 1DBJL 3VFGH 1DVFD 1QFPA 3MV9D 1SJHB 1IGFL 4OZGE 4LLDA 4AZ8A 1P4BL 2VLLB 3GSVA 4HCRA 3LPFA 5FYJE 2QR0A 3VWKA 4DVRL 1IC5H 2AAVA 3S3JA 4BM7A 5AYQA 1WFOA 4MMXC 1HQ4A 3OKEB 4RMWA 5GZNC 1A3RL 2X1XR 5E2JA 4LLUB 4FFYH 3C08L 1MIML 1MWAB 5IEHB 1A7NL 2Z31A 4NRXB 3ZE0F 5I30H 1DANU 4NQED 2ZJSH 1AR1D 1YDPA 3GBMH 5C07D 3J8F7 2AXFB 4YXKL 3VXPB 2NYYD 3FONB 3O8XB 5ACZB 1DQDH 5DI8B 3SJVB 4J4PC 3JWNC 4H25A 3P73B 2NY2C 4PGJA 5F7EH 4P0DA 3G6AA 4PJIA 4ZO7A 3T2NL 4ZO9A 3WUWB 2CSPA 5MERB 3Q6GL 3CXHK 1HYSC 3VXSD 4X6BA 3OB0H 4KFZC 5L8KB 5EA0L 3ZDXE 5B8CB 1OLZA 1XF4B 3OPZL 2XICA 3QCUL 3FQUB 1NGWA 1G9NH 4NQTA 5HGHB 3S36L 4L9LC 3FRPG 3QIBA 1PG7W 3J7HA 2J1KA 3IGAB 1RHHB 5DYOA 4MJ6B 4JANB 1RUPL 1CR9L 1BM3H 4PV8A 1U93A 3X12B 4X6FB 3KYMA 5D2LF 2OZ4A 1X44A 1ES0A 3KPRB 4D2NA 3NCBB 4ZNEE 4JO4H 5ABDE 4JKPL 3OMZA 1FGNL 1MELA 2XQYG 5HGAB 1CL7L 4BQ9A 2VXTH 3DUSA 1KGCE 4YHOH 4XPAL 3UTZB 5IB2A 5CGYC 2AQ2A 1H0DB 2DDQL 3EYUH 3QUMA 5AWNL 3HZVB 2VZSA 1JWUB 5T1LD 1B4JH 2V7HB 1MFEL 5T3XH 3AU1A 2VDOH 3D2UB 4PRHB 2ZOKB 1UM4L 4GBXA 4M00A 3G5ZA 3MRCA 4LCCA 4YDKH 1DBBH 3HI5L 5A2FA 1T3FB 1MRFH 1G7PB 3WMSA 3WHE1 5GGRB 3BPOC 1MCBA 1K9TA 1DBMH 2A9NH 2DYPA 3LKNA 1JHTA 2YBRB 2WIIB 2XTJD 2GAZB 5D1XC 5K59E 4X8JA 2BSRB 5D6CA 3WD5L 2X1QA 1R3HB 1RIUH 4TUJB 5E4EC 1LVEA 3O4LE 3QFJD 1TPXB 5BS0B 5CGTA 3CH1B 3DX6B 3NA4A 4ZQKA 2Q86B 1ZT1B 1XF2B 4Y19E 4JG0L 3MRKA 3OQ3B 4LVEA 5I8EB 3QG7L 5CEZH 3B8SA 5EO0A 4ZOBA 3T1FB 4M02A 1S78D 1C5BL 3DROA 4IRSD 4WGWB 4JQVC 2EH7L 4GXUN 2DQFA 1K2DA 4NZUL 5FB8A 1BZ7B 2KZWA 1MREL 2XKNB 1N7MH 2OL3L 1JF1A 4M6OH 2XOTA 5EBLB 1NJ9B 1J0KA 4MDIA 5C0GB 1EV2E 1P1ZA 3BZDA 3MOAL 2IGFH 2HLAA 4FQ1L 2MCG1 4PGEA 3ZT7A 2IAMB 4KK5D 4XB8A 1SJEB 3L95A 4XZUA 3VXMA 1ZGLM 3KPMB 5TDPB 3V5KA 3MA7A 5DJYB 2DOCA 5IM7B 3UDWC 5JQ6L 4G8IB 4NKMA 3BJLA 3KYNA 2NY0B 3NAAH 1LEIA 4OZFA 1FN4A 1T4KB 3DYPA 1FDLH 5FUZL 4P2RE 2YUZA 3HAEB 5M94B 1N26A 4PJGF 4FABH 5C07A 2ZCKL 5EU6A 1WFNA 3C5JA 1X4ZA 3GRWH 4LSQH 1GAFH 5INDB 5E08H 1A5FL 2YPKB 4X98A 4Z7OE 1P4LA 4PJEB 4H1LG 3ZKXB 4D94A 2QADD 4WJ5A 1HI6A 1O7SA 2PXYD 3IJYA 4RGNB 3WHE0 2I24N 5F7KC 4X6CF 1FFOB 3HHRB 2P48B 3MLZH 5IFHL 1T1XA 2VIRB 2DJ4A 4U1NA 4HJJL 1G84A 1TMCB 2VB5A 1OL0A 1MJ8L 5GISH 3IS0X 3ZKQD 4XP9L 3L3JA 3F5WA 1JN6B 2VABB 2YRLA 4NSKB 2ESVD 3RUGA 1A1OA 3CH8A 4F15B 3I02A 4U6XA 1RUAL 3FQWB 2IANB 3RU8H 3DYMA 4LCWA 5FA4A 3ETBF 4LSVH 3T4AB 4PJGE 1J8KA 4MXWL 5BV7C 3KLAA 1F3JA 2XT1B 2EECA 2V5YA 3DLQR 2AJ3A 1XFPA 3I3EA 1Q8MA 3WKMH 1BBDH 4HUXB 5TF1H 5CSZB 1LQSR 4KHXH 4CMMA 2ITDA 2GEEA 3TA3B 1IEHA 3M17B 4XNMA 4QRPB 3W5NA 2QL1A 5E94B 1LO3H 2VLRB 3S5LA 5ID1A 4Y4KD 4S1RL 3C8KA 2H1PH 1J0JA 4CU7A 1VADB 5L7XL 4JVWA 5LCVL 5CILL 4F58L 5TF0A 2RR3A 4HDIA 5DD0H 5ICYA 5D5MA 4JPKL 1CVRA 2K1MA 1UQSB 2NXZC 3TC9A 3CXDH 5ENWB 4Y2OA 4GUPB 4J3XA 5CEYB 5D71H 5DEGB 1BJ1J 1T7XA 4Z78B 4AG4L 3TN0B 4PJ8B 1MFAH 1CE6A 2RCSH 4ODHH 1BWMA 1U3HA 1NCBH 4N9OB 2CIIA 2QJDA 4PG9B 2UUDH 4P9MH 4XCYA 1QRKA 3IDXL 3L5XH 5F9OL 1HHHB 3ORJA 5K9QG 2VXVH 4WUUE 1T2XA 1VACA 5KZCB 3OKYA 3G5VA 4HWUA 1OWRM 3EYVB 4WGVB 2A6IB 3O6ML 4M3JA 4N0UE 2F9BT 4OZHF 1TJHH 4LCIH 1NMCC 1BQSA 1YNTA 4U4BA 2UWEA 2E8YA 1NC4B 4PUBH 2DLFL 1KTRL 4K9EC 4JB9L 3UTSA 4LVOB 1ORSA 2R23B 1PVHA 4KPHH 4M1GL 1YEGL 4Q9QH 1M7DB 2UUDK 1S9XA 4MQTB 2RIKA 1D5XB 1I9RH 4O2CA 4XC1H 4M1DH 4YHML 4F57L 2X70B 5TE4H 5FYJL 2D7TL 5ESVB 1UKQA 3IVKB 5DJAB 4RZCB 2X42A 5C0BA 3MO1B 3IDNB 4XNZB 3WEXA 4ODWB 4YR6B 3ME0A 5CIPB 1CU4L 2X05A 2CDEA 2XN9E 4GAJL 5E95B 1I9EA 1MAKA 1ZS8B 4KJWC 1J1XH 5FO8B 3MFGB 5EOQL 5B3JF 1FLTX 3CK0L 2P5EA 2FIRT 4YO0A 2ESVA 3ARGC 4PJFB 4Z77A 2QQKL 3AS3A 3VFTA 2XZQL 3GB7A 4IS6A 4OZHE 3H6JA 4MJIE 2Y5EA 4OUOA 2ATPA 3CGTA 4XRCB 1J86A 2C3VA 1CG9A 2PUQT 5HTSA 4L8BB 3UTQA 4M8QB 3SKMB 5KG9A 4S11A 1GL4B 1S7XA 2OQJA 3HC4L 5ISZA 1S7UB 1KJ2A 3D87B 4HFWB 3ROLA 2X09A 4NWTH 1INDH 1V5JA 4U2YA 5EC1B 1CF8H 2PTTB 1QVOA 4PY8J 1N0XH 3ARQA 3ZYIA 5D8JL 1K4DB 2A6DB 3ARXA 4KQ4H 3FL7A 1YY8B 3ZSSA 3PQYE 3MCG1 3OR7B 3RAJH 3CFBB 4HZAA 2ZNWA 2VDQH 3T8XA 3SDAB 3V6ZB 5I2IB 2CRIA 5DJ2B 3TPUB 4KGLA 2QSVA 4O9HL 1OAZH 1YEJL 4NHUB 4PJ9B 3BQUA 5EZLA 1RZ7L 3O3UN 4LPTA 1HH6A 4J12A 2YMXL 4P5MB 1FVCA 2EDBA 4HWEH 3AVEA 4QRSA 1RK1A 1V3MA 5TQ2L 2CLRA 4F7CB 5CGYD 3H2WA 1BD2D 3BMVA 3TWCL 3MNWA 2IH3B 2UZIH 2F5AH 3PGFL 5JTWA 2LAGB 3KS0J 1KCKA 5DJDB 4WU5A 4X6DE 2VLKA 1KN2H 1PW3A 3FFCB 1MEXH 2IG2L 5D1XD 1EO8L 1TVBA 3NA9L 1VEPA 3KHQA 1YQVL 2EDRA 4CADB 1IILE 4JEGB 2UY6A 5GGTL 4G42B 5HVHC 3P30L 4LCYB 1KT2B 4NP4H 3MLSL 4UTAH 4OIIL 1HDMB 5C8JB 4NQXA 4HG4K 4KJQC 3SDYL 4Z7VA 4G6AD 3QYCA 3GMQB 4RMRA 1MJJB 2I60L 1S7TB 2C1OA 3V6BR 4PLJC 4WTZG 4RRPG 2IFFL 1EVUA 2NZIA 2EC9T 3W39B 4R9HA 1YPZB 5ID0B 1DQTA 4NO0A 3RBSA 4LSRL 1CQYA 5ACMA 2DI7A 3OXSA 4MCZB 1YMHB 1LDPH 2IALA 4NZRL 3ZKMC 3AB0C 15C8H 5GRZA 4EJ1C 1I9JH 1Q1JH 2HFTA 1U8IA 1A7OH 3D0LB 5H2BB 2VDPH 3IDYC 5HYEA 3RWCA 4Y5YC 4BSVB 5I1LA 3E2HC 3PHSA 3QO1A 3FMGL 5F1OB 3ZLQC 1G7JA 4Y16C 3WIHH 3LKQA 2A77H 5JW4Q 3VGFA 2C3WA 3T09A 3TLRA 3L3OA 3P9MB 3FB6B 2R1XA 2ENYA 3SKUD 2XZCH 4WV1C 4J6RH 1PG7L 1TJGL 1NBVH 5KSBB 4M7LH 3WO4C 2CLVA 5D7LD 4NYLA 2OL3A 4IJ3C 4MQXC 3CFIC 4XPTL 1NFDE 3KGRA 1RZ8A 2ILLA 5E1AB 4EDWH 2Z31C 3CUPA 1QSZA 5FUOH 1PKQB 1BJ8A 1NFIA 4HFUH 4F33B 4MQ7A 3F7QA 1U6AL 3E6HB 3A67H 35C8H 1E4WH 2FJGA 4X9BA 2RFXB 32C2B 3QFDB 1OARH 2B1HH 3C5SA 1FORL 5EG6C 4U1JA 1FFRA 3PWPB 3P4OB 3FOMB 4JO2H 3MCKA 1NCAL 4CMHC 3VXTB 4XNYL 1I1CA 5TJWK 4NBZB 5D9SB 1ED3B 3SY0A 2Z8WC 4GAGL 1N2RB 3W0WA 3X3GH 3DXAD 5F97E 4GSDL 4AH2A 5I1EL 1VFBB 1QEWA 5F9WB 5L2KE 1KENH 5E7FA 1V3JA 3O2DH 4NFCA 2O61A 1K8DB 5DHYB 3P4LA 4LNRB 2YD5A 2P7TA 5C0AD 5FA3A 4MWFB 4EUPH 4HMCA 3QIBC 5D7IF 1QSEB 3CFJB 4K94H 4V1DD 3T4YB 3GRWA 3U9PL 1T5XA 1R0AL 4GRWB 4HUVB 4FQJH 3L3IB 5I1IH 4XBGA 2DS4A 2DM7A 1S7VB 1IL1B 5J6HB 2NXYB 3GSNL 2I9TB 1TCRB 1GGYA 1D6EB 1X5LA 1X5JA 4LLWA 1I1YB 5E9DB 1R3LB 3B6SA 5C09A 4YX2H 1X5AA 4OTXL 1AD0A 5B3NA 4M62H 5LBSL 1UCBH 2ADJB 2XZZA 1ZOXA 3VXQB 4L4TB 1R3KB 3HUJF 1RIHH 2E7MA 1YN6B 4ONHA 3L5JA 1NLBH 4F2MB 3LN5A 2NXZD 3NCYP 4LCCC 5ESAA 4JCMA 4WU7B 4G6JH 4LVNB 1L0YA 1N6VA 1GZQB 2FRGP 1AGEB 4B0MM 3Q0HA 4KVCH 1MY5A 4OD3L 1FJ1A 4WW2F 3L3GA 5CZVH 3L7EA 5CINH 4HIHB 2NPLX 2EH8H 3DOSA 5D7IE 5DDHA 2HMIC 2DI8A 5IFJB 2EYSB 2X2YA 1VEOA 4RFNB 1EFXD 1JZ6A 2M26A 3VFMB 4I2XB 4ZXBC 5DEFB 1IMHC 5C2UB 1I4FA 4DGVH 2YXFA 2UZXB 1JGEA 4QXUH 4MNGA 3GI9L 3K2UH 5DA0B 5AEAA 3GSVB 3RWJA 2QR0B 3N1MC 3VWKB 5ALCH 3PUCA 3MNZA 1YN7B 4KY1H 2WBJA 1HQ4B 5KOMC 4TTDC 3EDKA 3HUJE 1IC4L 3I6LE 2NTFA 4X9HA 4FQ2H 4G5ZH 1C5CH 1KG0B 4Y5VA 3CZJA 2J4WH 5D7LA 1YJDL 3VXOB 2VZVA 1YDPB 5F93C 4KZEH 4WI4A 2CK2A 4OM1L 4KTEH 5E8EB 3D6GA 1N6QH 1MHHB 1NEUA 3C6LC 3O4LD 1LEGA 5FO9A 5IESH 3U0TA 1ONQA 3G6AB 4GW5B 4Y19D 4PJIB 3ARED 1ZTXL 1EUUA 3NMEA 1CICB 4AL8H 1BIIA 5H35A 4S2SA 1WWAX 1DEEA 4WY7L 3ARGD 5SX4H 2XA8H 4WVRA 4K55A 3QIWC 3HCVA 5HY9A 3C8DA 2R15A 4LRNL 1EA9C 3BH9B 2VDKL 4JFDE 5FYLH 2DQHH 1MCPL 4CN1A 3FT3A 5F1KC 3LOWA 2OS7A 5JPMA 3NPSB 4R7DA 2J8OA 4XNQA 4OCXH 4JM2F 3QIUB 4LHUA 4G6ML 1FYTB 4HD9A 4PV8B 3T0AA 3IDMA 1ZKAA 3MUZ1 2OMBA 1U93B 2D0GA 4RNRB 3P11H 3KYMB 4GQPH 1ES0B 3IAPA 3LH2L 4NQVA 1CLYL 4ONFL 4BZ1L 2XZAL 5IP4A 1I75A 3BO8B 3QRGL 3RJQB 3VA2C 1EHAA 3DUSB 4DAGH 1T89A 2AI0H 2HJFA 4PGDA 5DJXA 1IKFH 3BIAX 5IB2B 1PQZB 4N0RA 3QUMB 4EIGB 2QBWA 1CFVL 3BN3B 1I3RB 4KMTL 1U8HA 3AU1B 4Y4FD 2BNRA 2FX8L 1DBAH 4GBXB 3G5ZB 3HNSH 2Z8SA 1T6VN 5ALBL 4WFFE 3O0RH 3U0WL 4LQFH 2JJVA 2OLDA 1FAIL 2DYPB 2H2PC 3QZWG 3RNQA 3MRJB 2B5IC 4N0FB 5D6CB 4ZO6A 5JPNB 5I8OL 1KTDB 5F9JA 5IR1A 1EAPB 3SGEI 3P0VH 5DRZB 2AV7B 3S98A 4P9HC 1JL8A 2PYED 4Y4HB 5ADPH 5C3TA 4Y1AD 2HG5B 3WDHA 4BFEA 1WAAE 3DROB 1OM3L 1BF2A 1CLZL 4LU5H 3O6FD 3VRIA 1UXSB 2DQFB 1K2DB 5FB8B 3O9WA 3QI9A 4QHNB 1JF1B 4ZFGL 2QQNH 5K9QI 2WSKA 4NGHL 4MDIB 1DVFB 4QHMA 1P1ZB 3PGCA 2OJEA 4YDJA 5I18H 2HLAB 2GHWB 3WSQH 3MA9L 4RMUA 4PGEB 4KJQD 4KUCF 1HZHH 2ZCHH 1I85A 2JJTA 1MHPL 3L95B 4XZUB 3VXMB 2BY0A 5HDQL 2YOCA 1EAJA 5FF6A 3HMXH 1TNNA 4Q97A 3MA7B 3RWGA 1J10A 1U8KA 4NKMB 4XCFL 3KYNB 2OMNA 2P43B 4JN1L 1LEIB 1MJ7H 4OZFB 1FN4B 3NCYS 4NNPH 1MF2L 1FNLA 2P5WD 5TH2A 4NQEB 1QNZH 3FO2A 1KN4L 5C07B 1KEGL 1UADC 5F7YC 5EU6B 1NUNB 5EZIL 1LO4L 1MCQA 1WIOA 5IGXH 3CLFH 2FEEL 5E6ID 1CGUA 2J3SA 4PV9B 3CVHL 3KJ6H 4LEOA 4X98B 5L88L 3WJLC 5KVGL 3FAXA 4WJ5B 1AO7E 2P24A 1HI6B 4JFXA 5IB4A 5IMOA 3IJYB 1J8HE 5GGTA 5I19L 4Y5XC 3LN4A 1Z0MA 4L3CA 4TRPH 3VXSB 2HRLA 3KXFE 5CLTA 4Y16D 3CAFA 2AK4E 4U1NB 1ZLWH 1FE8L 3IAQA 2GSGA 1RUMH 4XWOC 3F5WB 2DQUL 1SBBA 4JPVH 3ELAT 4LGRB 1RZJL 4FP8H 1A1OB 1HEZB 3DARA 4X6EB 43CAB 3LQZA 3WLBA 3ZZ1A 2BHZA 4FZ8H 3I02B 4RQQB 4U6XB 2NMSA 4OF7A 2ICWJ 4LSSH 4U3HA 2EO1A 1M7XA 2K9UA 1QP1A 1FAKT 4ZPTB 3TYFB 3NN8A 4Z7QE 1E4XH 1NEZB 4Y0GA 1B88A 3VFUA 1ZLWK 1E6JH 5DUBA 1JGUH 3S5LG 4GJTB 1GGIH 3KLAB 4P2RA 2AJ3B 1S9YA 3TM6A 3T0BA 1G6RL 3O11A 4LAQL 4AIZB 4WFGD 2XQBL 3BP6A 1U3YA 1MAJA 5T1LB 1T22A 1QFWL 2ITDB 4NO3A 1CT8A 4X5XA 5IFAL 4MB4A 3R1GL 5F6IC 4XNMB 5I15H 4IEFB 4ZFZA 1UH3A 1B4RA 1VPOL 2VZUA 2PTUA 3MXWH 1YEHL 1FNSH 5D96C 3OF6A 2DIBA 2CO6B 1RFDL 3RWFA 2WLZA 1DQLH 2YWYA 4GOSA 1KBGH 3PL6A 2XTJB 4WW2C 4LLMA 1XGUB 1EMTL 2ADFH 5TQ0L 2YUWA 3CZFA 4HDIB 4AEFA 1MCIA 2Y72A 3DVFA 1H9VA 4I48A 1MNUL 1YEIL 3ZYZA 5ICYB 3LHPH 4M3KB 4H5SA 4LLQA 3VFSA 1JF5A 4JFOA 1MLBA 1UENA 3LKOB 4YHKH 3D39E 4IRSB 2MNUA 2W9EH 2AXGA 3B4NA 4KRPD 4MJID 4LKCA 1MCHA 3CXHJ 4ODVH 1NUGA 4YPJA 3NH7L 1MVUB 4M7JL 5IF0A 1AI1H 3ET9F 1CE6B 1U3HB 1PLGH 2CK0H 4QRQA 2CIIB 1J7VR 2ZP0T 4YJZL 3QAZC 4JHAH 1IGIH 4XCYB 2D03H 4HT1L 2CH8A 3GMNA 3DBXA 3L5IA 4NNYB 1UB5B 2EXYC 3ESUF 1VACB 2A38A 3G5VB 1UWEH 1F11A 4M48H 1NCUA 3I50H 4FQIL 5DC0A 4NQSA 1WWBX 3PQYD 3B5HA 3CVIL 2UWEB 2HAZA 2AJSL 5SX5H 3OKOB 3BX7C 1G9NC 1KEML 1ZE3C 3CC5A 4G8EA 5KBNC 2E9JA 3UTSB 1BLNA 2HMID 3VGBA 2DQJL 3ULUH 2Q76B 1UEMA 3MJ7A 2XY1A 4K3EL 1S9XB 4S10A 5JZ7D 3HNVL 4O2CB 1F58L 6FABH 4ZXBD 3ZHDA 3UJTL 3QNYA 3F12A 5DGRA 2LABA 3T0EE 5C0BB 3WEXB 1G1YA 3AGVA 5KSAC 1T20A 3O41A 3LN9A 2FCBA 4GAFB 4BH8A 5DMIL 3BXNB 5SX5K 3KYOA 2QKIA 1MRCH 4XPBL 3MRMB 2ICEB 1UVQA 2F54D 4TTDD 4JM2C 3FQTA 4L29A 3MXVH 4PRNA 3V6OE 4BFIA 2P5EB 3MACH 2R2EA 1A21A 2ESVB 3H9YA 2JLLA 4U1KB 3U7WH 2EIBA 3U0PA 3GB7B 3HRZB 4WUUA 1UJ3A 4GS7B 1IC5L 3RL2A 3C6LD 4N0UA 2LVCA 1J0IA 2ATPB 4OF6A 3HMWH 1AQDA 5BW7A 1CXEA 1FPTH 1J1OH 4JRYE 4ZS7H 4YHZL 4HSQA 2F19L 2OQJB 5IKCB 5MEPB 3C2AH 2HA1A 5DQJB 4W4OC 2W92A 3QIWD 3ROLB 2JB5L 4D0BA 2FR4B 3BMWA 3GSWB 1A6WL 1QVOB 3DGGA 4LLAA 1G9EA 5C0DA 4M61A 3Q5TA 3QJFB 3ZDZF 4O4YH 2VAAA 2VKWA 5JXAL 3BD4A 5IJVA 3F65A 2WP3O 4OZIF 5GS0L 1LILA 3PV6A 4LCUB 2XN9A 4NRYA 4R0LB 4YHLL 4LASH 1ZT7A 4GXUM 2P4AB 3BJ91 2A6KB 1A9EA 2GT9A 4OLUL 4CJ0A 1EEZA 3V7MA 2MTPA 2C5DC 3BQUB 5B4MC 1HH6B 2VXUH 1OAUL 3KPSA 1FVCB 2I07B 5C71A 4X99B 5E00B 4NN6C 1J05A 3BD3A 4ZD3L 2CKBL 4ZMAT 3NFSL 4F9PA 4OZHA 4UILH 4OJFL 2LV4A 3TIDA 2NY4C 1LEKA 5JUEH 3GGWA 1WTGT 1FH5H 1ACYL 4K3GA 4RFOH 2D7MA 1FBIH 4WU5B 1PZ5A 3OBAA 4JO4L 5DS8A 3GK8H 1SHMA 4EIZC 3N1FC 4YPGA 4P2CG 3MODH 4YHOL 2BNUA 1TVBB 3ZDZE 2PNDA 1H3VA 4ESKA 4NJAH 3S35H 2IMMA 1AGBA 3DECA 4OZIE 3I9GL 4KWUA 3RZCD 4M7ZC 3PQYA 4JO1L 3CU1A 4U6YA 1F5WA 5BO1H 2PYFA 1RUKL 4OGXH 4NQXB 4ELME 1JNHA 1AKJD 3CDFA 5SWZE 4Z7VB 3QISA 1I7TA 4NIKB 3G6JB 1P7QD 1P6FA 4EI5D 4XMKH 3U4BH 5L2KD 1IEBB 2C1OB 3GHEH 2H2SD 4M43H 1HHGB 5C0FA 2J8UF 4NO0B 1CFNA 4OI7A 2APXA 2VQUA 3OXSB 3SDXB 4ZAKA 3SQOL 4ISVA 4GRMB 1TVHA 1AXIB 5C0EA 3SDCD 3S8WA 4K2UL 5ILTL 3TV3H 1U92A 5BXFB 1U8IB 1A14L 3I3BA 1QBLH 3QHFL 3QQ4A 4X6DA 4XGZA 5DD1H 4U6VL 1YZZA 2DQTL 4D9LL 5I8CB 2EDKA 4NNXA 1G7JB 2JJUA 4PJXF 3LKQB 1FO0L 4OM0H 3QPQC 4KKLC 1XR9A 4GLRH 3L3OB 1KIPA 2R1XB 3EYFA 4HW6A 5ECJE 3TVMD 1T83C 2QSCL 3FCTA 3FOLA 1K3ZA 4GRLA 2CLVB 4NYLB 2OL3B 4C55A 5IVXB 4P4RA 3DV6A 4HWZA 1RZ8B 1QG3A 2W0LA 5DD3H 3RX7A 3SKJH 4AQOA 1RAMA 3HG1D 3FQRA 1WTLA 3CUPB 5D93B 1R5VA 1MCJA 4NKIH 3DO3A 4P2OD 4Y5VC 5DRWA 1K6QH 2X1OA 1NFIB 4OCRL 3B2VH 2X89A 4TYUA 2GI7A 4P4KC 1IGCH 5F1SA 1MCOL 4KAQH 1XIWC 2FJGB 5FCUH 4FQHA 4HULB 1GSMA 1FLRL 5KJRH 2JIXA 3EFFB 3PP3K 4U1JB 4U1GC 2BERA 3MCKB 2H32H 4LSPL 3KYAA 4PFEA 4WW1A 1MAMH 5AD0A 4FG6D 3ULVH 3W0WB 3BP7A 3HZMA 4OBRA 3MLZL 5L6YH 5I76A 1QEWB 2CLZB 3M8OL 1AXTL 3NGBC 2YRZA 3CVHA 5JIHA 3LDBC 4KI1A 4BYHA 1A0QH 2H3NA 3L3HA 2O61B 4WWKD 5FGSA 2P7TB 4WWID 1KYOK 3DETC 5SWSA 1GHFL 1BD2B 4OV5A 4UNTA 1OT2A 3DMMD 5IHZA 2PW2A 4LHJB 1X6LA 4XBGB 5HYSA 1IT9L 4LSVL 1CD0A 1T04A 1HKLH 3KPQA 1AGFA 5DJZA 5H94B 2XTLA 1NFDA 4POUB 3EOTL 4TULH 3BUYA 4JDTL 2GIYA 5IQ9A 3SOBH 1I8IA 2BVQB 2Z8RA 1GOGA 3B6SB 4H88L 4XVUD 1AD0B 3T0XA 1CK0L 1R24B 3QXTA 4CGTA 1BREA 5I1CL 3U83A 4KK9D 2R0ZL 4ONHB 3FT2B 3LN5B 2A6JA 3UPRA 1CDGA 3IU3A 5ESAB 3TYGL 4BSWB 5EH1A 4GXVH 1O0VA 3VRJA 1U3JA 2AABL 2FECL 3CFEB 3LV3A 5I17A 2GTZB 3LS4H 4JFEE 2HT4C 1LO0H 4EI5A 5L2KA 1FJ1B 3D3VE 4DKEH 3L7EB 2VLJD 3LRHA 4TSAL 5D7SL 5GGUB 2DQEH 1F90L 1J1PL 5TDOB 5JA9A 2P44B 5IG7A 5HI5D 4JKWA 4QXWA 2XKUA 4P23A 2AK1L 3SDCA 5CD3A 2JJSC 1WC7A 2ZUXA 3NIFF 4TNWF 1M05A 5DO2C 1JGEB 1JRHI 1NCWH 4HGKC 4MNGB 3O9WC 1HXMA 3QI9C 3RWJB 2Z92A 2W65B 3RJDA 3PP4L 1C5DA 1UFUA 4N1EA 3L5XL 3SGDH 2LQRA 2WBJB 3JV0A 5DEZA 4OSUH 4A2MA 2AEQL 4JJHA 3L6FB 4APQA 1T03H 1NCDL 4HUKB 4WFFD 2R0LH 4OQTL 4RGOL 4QHKI 2NTFB 1LD9A