4HK0B

Uca fab (unbound) from ch65-ch67 lineage
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
QSVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UCA heavy chain
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 210
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0B01
2NX5B 4LASL 12E8H 1YMHB 5HY9B 4M4RA 2AK4B 1WWWX 4GMTL 4JFPB 4Y1AA 3SJVA 3X14A 1G7JB 4YXKL 1P4LB 5F96L 4OLZH 2NYYD 4QOKB 1NANI 4KKAD 4FNLL 4DKEL 3T0EC 1T3FA 4H88L 2R4SL 4YNYA 3E8UL 2FGWH 4PRAB 3FTGB 1XGRA 5GZOC 2WP3O 4PJDE 1T22B 5CJXC 2DL9A 3ARFA 5FYKL 4D8PB 4WWKA 4Y4KA 1KT2A 2R56H 3PDGA 1IGJA 1OF2A 4H88H 2R4SH 4MWFA 4S1RH 3MRCB 1SYSB 2A0LD 1ZHNB 3LQZB 3O8XB 4JQVC 4J3VA 5MEND 1BBDL 1PG7H 4QTHB 1XR9B 4OD3L 3G08A 3D0VB 3WNPA 3SE4A 1SJHA 3QQ3A 3S3JA 3QG6B 2CDFA 1DZBA 4LEXH 1EEZA 5DEGB 2DD8L 4HKXB 3U7WL 3ZKXB 2Z92B 2P5WE 1CDHA 5D1ZC 2BVOA 2X44D 3EYQD 4UIMB 4ZTOL 1AY1L 1ZHBA 4XBGB 4QKXB 3HZKB 2AW2A 4OBRA 3ARED 5KS9E 5J1TC 2R4RL 5E9DE 4D94A 3UTQB 4NKOB 4G9FE 3H9HB 4LHQB 1Z9MA 1A7NH 1DLHA 1TZGH 5CIPH 3DUUB 3WNKA 1F4YL 2KBGA 4XCCL 2OTWB 3HE7B 2EE6A 5ICYB 3V95A 3DBXB 1I1RA 2EDBA 4S0TD 3QI9B 2XWJB 4KPHH 4JRXB 4UAOC 5IHUL 5IG7A 2YN5A 4CRPA 4XC3H 3SE8H 3ZTNL 3MLVL 3DX9B 2BFVH 1G9MC 4NQDA 1BQHG 4MD4B 3QDHA 2KQMA 3F7RA 3C6LA 4JM4H 4KK6C 3U0TB 3TO2A 1FRGH 3IJHA 3IFOA 4DKFL 4O51A 4Z76B 3CFCH 3RVWD 2HT2D 3WNOA 3SDDC 5DJDB 3MLWL 1YPZB 3TYFB 3EDFA 4P3CL 2ZOKB 4XX1G 2QKIB 2VYRE 3U36B 4ZS7H 1H0DB 3PUCA 4E0RB 2XPGA 1OAKL 1UVQB 2C3WA 4ZXBB 3OF6D 4FXGA 3PHOB 2IANB 3MLWH 4OZFB 4XP1L 5D5MA 1N8ZB 3WLBB 4BSJA 4M1GH 4XPGL 2E7CA 1KNOA 3V4PL 1EBAA 5DHVH 4X6FB 4JY5L 3CVHA 2J8UE 4DKDC 4JN1L 4DUXA 4CJ1A 1W0VA 1TNMA 2W60B 1RMFL 3RTQB 2GQHA 3MBEC 3V4PH 1A5FH 3CFEA 1PX4A 1C16A 4R0LA 3DRQB 3RWCA 1VKXB 3VDBA 2EZ0C 3C60D 2E7BA 1L6ZA 3T3MF 4XHQA 3PGFH 4Q0XH 4Z7UF 1CGXA 2NXYB 1CYGA 4PJ7E 5HPMB 1IEBA 5GJTL 5I1JH 1JGUL 5KSAB 1LO5B 4AIZA 1CICC 4IIQC 3TESA 1AD9A 1MPAL 1WQVT 2W9EL 3HRZA 1QRKA 3RZCD 4RMSA 3M8OH 1U8QA 4OKDA 1CGUA 3GMRB 4UQ3B 4X83A 1Q9LB 3EGSB 3CMGA 4CNIA 4R8WL 5FDWB 1JPGA 2F53D 4TTDC 4QHLB 3QUYB 2JCCF 3KPSE 2IPKA 2W9EH 1RHHB 1KTDA 4Z8FH 4JPIB 4WHDA 1NBYA 4QWWC 3SGDI 1ED3A 4PTUB 3WFEL 3V4VH 2Y9RT 5IB1B 3FKUS 2YD9A 4WW2A 5FK9B 3X13B 3FQNB 5DK3A 3O3EA 4K7PH 4BUHA 4NN7C 3WFEH 5EU5A 4M3JA 5BJTB 3FO9B 5CLTA 3HLAB 3KPNB 4YXLH 3T04D 2EYTB 1UJ3A 2PF6A 4MXWH 2ADFL 4Y2DB 4OLWH 2P5EB 1X9QA 5EFIB 1JUFA 4ALAH 3TN0D 3MCKB 4UNVA 3NIGF 1N6QL 1X7QB 1AGBA 4X5WB 2ADFH 1ZS8A 1X4YA 3ARDA 4P2RB 3L3JA 4XP5L 3VXSD 1EK3A 5KVDL 4XXCA 3UJTL 4PRDA 2FYYA 4I18A 3KPRB 1NGYA 2CIIB 5IMKB 5I18L 2YEZA 3HS0A 5D6DC 4LKCB 3BSZL 1TVDA 3FQWA 4APQC 1T4KB 5KVDH 2GSGB 4LMQE 2VE6A 3V6OE 3UJTH 3RUGF 4NSKB 2APVA 4NO0D 3ARBB 1F4WL 3OQ3B 2QR0B 4GG8B 2QSQA 4G8IB 2OL3B 4X4ME 3UPRB 1RFDH 3QIWB 5CSZB 3BSZH 4JDZA 4TUOB 4N0YL 1RI8A 4NQED 1L0YA 4PJCF 1DVFD 2YN3A 2NX5E 4HPYL 4P0DA 5DLMH 2FO4A 1IEAB 1J11A 2ZCKH 5I74C 3BRFA 2XTJC 4JLRB 2RCSL 2AK4E 4G43A 4HS3B 3IDJA 1ZVSA 3BMWA 4PFEA 5SWQA 3VWJB 4QOKE 4HPYH 5EU6D 5HI4D 4LSVL 1U93B 4K9EH 3U6RB 1X5AA 2RCSH 4DZBA 1JYXA 3L3IB 3WS3B 4C57C 1NSNL 1IQWH 3MFFB 3KR3L 5HSFA 4PRPD 5F1IA 1A3LL 5FGRA 3E6HA 3RVXC 3OKDB 1XZ0A 3IETB 1TJHH 1U92A 3MRNB 1HQ4B 3PP4L 4BKLA 1NMAL 2YUZA 1EDQA 3KR3H 5FOBB 3HG1D 4J8RA 5C0BB 1NJ9A 2QQKL 5J1SC 3F12A 1A6UH 4LAQH 1ZTXH 3D18B 3MQIA 1SEBB 2BMKB 5CJOH 5AG8A 1P7KB 3MOBH 4GKZB 4P4RB 1YECH 3L3DB 1UXWA 5HHXL 3BEWA 1TZIA 1CD1A 4MA8H 4JO3L 5ADPH 2KDGA 1KIQB 3O81A 3OGCA 1C08B 2NNAA 5SX5K 4TUKL 5E6ZA 5L2KD 1YNKL 3GBML 3EJZC 2V17L 4M7ZC 5KZCB 4G5ZH 2EYSA 2GK0B 1HWGB 1XIWB 3KYOA 3LN4B 5DD0L 3DHJA 4JRXE 1S7VA 2NY2D 2MFNA 1P4BH 4NRYB 4Y4HC 1ACYH 2NW3A 4P57A 2V17H 4JKMA 5GISL 4WTZG 4IRJC 2H2PC 3C5SB 2NY0D 3H9SB 2CRIA 5C6TH 3O4LD 1KFAL 5DQDL 4GRWH 1KCVL 4OFDA 3LD8C 4MQTB 4OCRL 4NYLB 4TQEH 3LPGA 3PDOB 3VFOA 1WWBX 1B3JA 1AKJB 1NGXB 4K3HA 2R2HB 2HJKB 3V5HA 1I9JH 4PY8J 1ITCA 1KCVH 1D9KD 2BC4B 5TJWK 1V7NL 2CIKA 2X5PA 5CINH 1QA9B 1S7UB 2B5IB 2VIRA 4U6YB 1TQBB 5GS0D 2R2EA 5EU4A 2HFEB 1HDMB 3IFNL 1CQKA 3ORJA 3TBWB 1QHOA 1XF1A 4DEPC 4CN1A 3T2PA 3VI3F 4AEIH 3MRLB 1MFBL 2YD2A 3GBNL 5GZNC 3CSYA 1G6RB 1JF6A 3BZFA 3BO8A 3D3VD 3IFNH 3KPOA 4LPYA 4D0BA 3IVKA 4M8VA 3QCTL 1F4XL 4JFQA 3IU4L 1FNAA 3N50A 1R3KB 4HBQA 1ZGLM 2FLBT 5TDNB 1GVIA 2ATKB 1MFBH 3U4EB 4RZCB 3W39B 3VXPB 1ONQA 4QCIA 2Z4QA 2YR3A 3P77B 3QCTH 5BOZG 1LO4L 3C6SB 4HWBL 4GOSA 2NY7H 4R4BA 1XF2A 3DJ9A 4R7DA 2NY4D 2VDNL 3NCJH 3O2WH 3FOLB 4L29A 3V6FB 2YPKA 5AYUH 4MHHG 2NZ9C 3WIFB 3ISWA 3MBXH 5BZWB 1DDHB 1DUYB 1JGVH 3GSVB 2FO1A 3BDBA 4WHTA 3BIBX 4NZUH 4DQOH 2VDRL 1JTTA 4Y16B 4Z7VA 4ZO7A 1WBZA 3I02A 4N5EC 1A3RL 4KK8D 4UB0L 3T2NH 2NMSA 1X5HA 3QUMA 2DBJA 5L0QC 3CFJB 4JFXA 1PG7X 2AJ3A 5ITBH 2X42A 3DVNA 3HZVB 3QWRD 4WUUD 43CAB 4N0CD 4BH8A 1YEHL 2CKBB 2P5EE 1U58A 2IMMA 4LSTH 1KGCE 1W72L 2JJTC 2W0FA 1BOGB 2NXZC 4BQCA 5C0GB 1JZ8A 4NQCB 1FO0L 1JGLL 4LMQI 3NCEB 1CTNA 5C08D 2V5YA 3MXVH 5ACMA 4U3HA 3V0VA 1X6NA 3MPCA 2DIJA 3EO0B 4M03A 4P2RE 4YHIA 5GS1A 1AHWC 4POZC 5IROA 2XQYK 4ODWB 1JK8A 5I1EL 4P2QB 4KC3B 3KPRE 2OLDA 3U0WL 1YEFL 3RIAK 2XOTA 5SV4A 1CFSA 4X80H 1IBGL 2KL6A 3K7UA 5I1EH 3K8MA 4Y4FD 4XTRD 3C09B 3UO1L 5E4IA 1JN6B 4HUVA 3MRGA 3VU2A 2VZSA 2O5YH 1P7QA 3ZKSD 1I4FB 3UO1H 1FPTH 5JXED 3OKOA 3BPLC 5TQ2L 4LQ1A 4NBZB 4ODUA 3MZGB 4LQFH 4QHNA 3L6FA 1O5DT 5A1AA 3S96B 1G7IB 3BDYH 5D8JL 4JFEA 1U8NB 5IBLD 1U9KA 2XN9D 3WHXB 5FB8A 4YHZH 7FABL 4X6CB 5DI8B 2IBGA 4M1CD 1GC1L 2GKIA 3L5IA 4X9GA 1MHCA 2DYPD 4F2MA 3I6LD 3ZHDA 4DTGL 5KSVA 3SDXA 1IGCH 1V5JA 4W81A 2PW1A 3QCUH 4K71B 2Y6SD 1AP2A 5B4MD 4YQXH 1G7PA 3SQOL 1QSEA 4KI5F 3VH8A 5CGTA 1HHIB 4PP2A 3P4LA 4LHUB 5C0BE 5EPMB 4EBQH 5F3BA 1WCBB 4ENED 5TPWL 3MRQB 4QHKJ 2ICWJ 4OZIF 4IOFD 3L3OA 3LKNB 1FZKB 5DRWA 4PJAB 1CDUA 5DUBB 2VC2L 4PGCA 2H32H 1DBBL 1MIML 1OLLA 2QQQA 4PREA 5TPWH 3ULVD 1A47A 4KVCL 4LVOC 1W0WA 4U1SB 3VGHA 3MRHA 1BAFL 1CLCA 3SY0B 3HI5L 1OWWA 3RWFB 3QEHA 1KTKE 4J4PD 5GGQL 3G6JB 4Z0XA 1DBBH 3DGGB 3MV7B 2EO1A 3MOAH 4JZJC 4IMKC 1QLFA 3W9DB 5EZLB 1V3KA 3HI5H 1JL8A 3ARYA 1NCCL 5T3ZH 4ODHL 3EO9L 3GMNB 1XCTA 3BHBB 3RAJH 3JBG7 1H5BB 1OGAA 3JV6A 5IR1B 2VZVA 1KENH 1RUKL 3LV3B 3SKMA 4NO3B 1U36A 5C8JA 1C12A 1BWMA 4X99A 5I9QB 1A4KB 2JJSA 1R5WA 3QFJA 1RIHL 4K7PX 4XPTL 4I77H 2PO6B 2OYPA 1HH9A 2A9MH 3GO1L 4Q6IB 1LE5A 1FL3B 1I1AC 3TV3L 6CGTA 1RUKH 5DJXA 4WJ5A 1CIDA 1M71A 2ARWA 3MRFA 3EJJX 2EE2A 4JRYA 1RIHH 3EYUL 4QXUL 3I2CH 5DRXB 4NZRL 2WWMC 1AXTH 3BYTA 4YK4B 3WO4B 2X4OA 5D1XC 1NMCB 1MJJA 1YQVH 5BRZB 3QG7L 4ORGB 2ZNXA 1OTTC 4NZRH 5DR5L 4OGYL 4XCEA 4HK0B 3BGMA 4PG9A 3T0ED 2AXFB 2ATPB 3WSQH 4FABH 5GZOD 2WQRA 5BV7H 3R06A 4LIQE 1M7IB 4YEEA 5JPMB 4OGYH 2VKXA 5DGQA 3F8UB 2LVCA 1E28B 4MAYA 1N3NB 3ZE0E 3OJVC 2XA8L 4KGJA 4HIEA 5IFJB 1HILA 4CMMB 4O4YH 5IFAL 2APBA 4FOMA 3GSNB 1YUHB 4NRZA 1CF8L 1KB5L 1AGEA 2Z35A 5BVJB 4HAGA 4YO0A 2QHRH 2IQAB 2CUHA 1T20A 4ETQA 4EDXA 1JPTL 2D7PA 4E9LA 4U1LB 3AB0B 5D1ZD 1CF8H 2ZZUT 1F5WA 1JPST 2OZ4L 3LKRA 2EEBA 5JW4M 5DTFA 3INUL 5E8EB 1T1XB 4K3DL 2IADB 5F7FA 4EXPX 4H1LH 1S9XB 1ZXQA 5KVEH 4AK1A 5HI5D 2DQUL 4X98B 1RZKH 4ZUUB 2ICWB 4FFZH 1DQLL 3LKOA 4K3DH 3X11A 3Q3GB 3KYKH 3EDDA 4M48H 4MLSA 5DQ9B 4HGWB 5ICZB 3FHAA 3NAAL 2DQUH 2HFGL 2XRAH 1DQLH 3ZYJA 1ZWIA 2DS4A 2GHWB 4P9MH 4PD4J 4I0KA 3HR5B 1QSFE 4KK6D 4QO1A 2VSDA 4LLVA 2FHCA 5F7DB 5IHLB 4OSUH 5DJ0A 4TUJB 1S3KL 3T0AA 4NQCE 4ZUSA 1TVBA 4P9HL 3SDDD 2E27H 4JCMA 2R1XA 1B2WL 3RY5A 4CU8A 1AFVL 5D70L 1S3KH 5ESVB 4PJDF 4L9LA 1S8DB 1K4CA 3NABH 4QTIL 2I07B 4PGDB 4P2QE 2H26B 3ARXA 3W5MA 1K6QH 1WAAF 4GAGL 3KLHC 2Y5EA 3A67H 4AIOA 3I6GB 4QTIH 3WN5B 2BOCA 1D5MB 3H7BA 1FSKC 2IF7A 3AU1B 2IGFH 3SE9H 3LAFA 4D3CH 5FA3B 4N0FA 3PQYD 3QRGL 2ARJQ 4JO1L 2GAZB 5GIRA 4YDJA 5C0JA 4HJGB 3HC3L 5CEZE 1A64A 1GPOL 3V6OC 2X10A 3P4OA 5D72H 2PN5A 4YFLI 4RGOL 5KS9F 5KVFH 2OM5A 4JO1H 2EYRA 2WQ8A 3VW3L 1CICD 3QFDA 3HC3H 3ZE2E 1WIOA 5GGSA 2IC2A 1GPOH 5EDXA 5IIEB 1ZOXA 3CH8A 4LNRA 4CVZB 2UWEB 4V1DB 2O61B 2V2WB 1FN4A 5HGDB 4X6CE 3MV9B 1UQSA 3N1MC 4HUNB 4NBXB 4Y5YC 1YEDB 3WXVL 1X3DA 1BZ9A 1TFHA 5B38A 4P5TA 3BP5B 4QWWD 1EJOH 3E3QE 5GQBA 1INQA 2ZUWA 4UINL 3WXVH 1FE8L 1AI1L 1NLBL 1I3GL 3IXAA 3QULA 1MCSA 3JWOH 4Z7OF 5IHZB 2VQ1A 2W38A 4PJIB 1FFNB 5F21B 3FFCB 4NKIH 1T7XA 2Z9TA 4WI7A 1YYML 3ZKNC 4UINH 1FE8H 1NC4B 5DGRA 4PJAE 4UU9A 3SDYL 4HW6A 4PJ9A 3U2SA 5K93A 3ULUE 1A0QL 5HYJB 3I3DA 2YZ8A 5D7LA 3ZKXC 2CJUL 5HVFB 3RDTC 4NJAL 2MQ0A 3MJ9H 5CEYB 3IF1A 3G6JE 5EO9B 4G6JL 5FKAA 3QISA 4PGZA 2DJ4A 2VR4A 3IDNA 4OZHF 4Z7UA 1X5XA 4IRSB 1FAIH 1KCSH 4OB5H 1JVKA 3PWUA 4MDIA 2CR6A 1I8MA 5HYEA 5I6XB 5E6YA 4G6JH 5INCB 4KAQH 5CCKL 1TVHA 3HE7C 5LVEA 4X6BA 5SX5H 1DFBL 3EHBD 2X4PA 5F9JA 3JWDC 4EUPA 3REWB 1FG2B 2G5BA 3CZFA 3MJ9A 3FT4A 5JDSB 4LSQH 5DC0A 4PJ7F 4M00A 4G9DA 3FB7B 3QDMB 3ROOA 2JCCA 1F3DJ 3WXWH 1OOAA 2YPLB 2PETA 1BZ7A 2R23A 4HXAL 3VG0H 3WIHH 2YK1L 3FONB 4WFFD 3BFOA 4JKLA 1ZLUK 3FT2A 3MLZH 1MAMH 4BSWB 2HKFL 2JK5A 1JNHB 2XTJD 4JAMA 5I15L 4HXAH 4QRPD 4AZ8A 2JF1A 5BRZE 4YGAB 1P5VA 1VEPA 1WF5A 4BK5A 4M6NL 4DZ8A 3A6CL 4P2OC 1NCWH 4ZXBC 2X1WL 3KWWB 5ECJE 5DJ8A 4U1KA 1G7LB 1LHZA 1HINH 3L95B 4U1IB 2A6DA 1U0QA 4Y0GA 2XY1A 1U3YA 1S7RB 3LHPL 3GFUA 4YE4H 3QDJD 4G6FB 3TT1L 4JDTL 3MZTA 4Y8AA 2DJUA 3IDYC 3FO2A 4HS6B 4XVTH 3RVXD 3U46A 2K7PA 3O6FD 3CSBA 3VXUA 5I1KL 1LP9B 1OL0A 3NACL 3RTQC 5A2KH 2P42B 1VADA 2Y7QA 4LCUB 2FEDD 1KXVC 3CFDA 5JO5B 3AS3A 4H25A 2BXZA 1U3HB 1FVEA 1A7OL 2VLKD 1Q8MA 4LAJH 4U0RC 5DQJB 4IRZH 3FT3B 5KSAC 4G8EB 1QQDA 4BZYA 4MCYB 3BPNB 1UJTA 3E2HC 4XI5C 3T8XB 1AJ7H 2DWEA 2VQTA 5ELIA 1ZT4B 2Q3AA 3SCMB 3RUGA 1MH5B 4OZGB 4UT9H 3DNKA 2IH1A 3D9AL 3O3BA 3EJZD 3WNNA 5D7JB 2GT9B 4OLVH 4PJCA 3IFPA 2O5ZL 1CXLA 4FFYL 5DJAB 5F1NB 1A1MB 5EIIA 1HIMH 2X4RA 3D9AH 4CU6A 4KFZC 4Y4HD 1DR9A 2B20A 5E8PA 2RHEA 5SX4I 2R2CA 5JUEL 1N5YL 3GSRB 4IRJD 2H2PD 2XG5A 5DJ6A 4MNHB 2LQRA 4NKMB 4I4WA 4X7TA 5TDPB 1N5YH 2XZZA 3L3HB 4MVBC 3QNYA 4Y2DC 2QEJA 1CFVH 2V5TA 3SPVB 3UTPE 3X3FH 5I1CL 3FQXB 3OXRB 1XH3A 1Y6MR 5KVGL 2XQBL 1I8IA 1EUTA 2MWCA 4FQLL 4RGND 3F6IA 3TZVC 5HYFA 2FJHB 4JZOB 2OTPA 1AXIB 1CLOL 1I9RL 1MFDL 5E8OB 4ZSOB 5I1CH 1U6AL 1E6JH 1GGYA 1RUAH 3S36H 3KPQB 4JZNB 4P23B 5FCUL 4JPWL 1NFIB 5CSGA 4QRRA 3MNVA 3QUKA 4BA8A 4ONHB 3QYCA 3NCFB 4XNQB 1TPXB 3MODH 1XGPA 5GZND 1MFDH 1LEKB 1UCBL 3EAKA 3LEYL 2IFFL 4JPWH 5FCUH 4HWZA 4HDIB 2XZAL 3MBEA 1SYVA 4N8VB 5DC9B 3VXNA 3ARBC 5MEOA 4X5LA 1MI5A 4DKAA 4WW1B 5DRZB 4L4TD 3J7HA 3CX5K 2IFFH 1EH9A 4U6VH 1AO7D 4OT1L 3QXAA 4XBPB 3V7AG 4OIBA 4ZODA 2XV6B 1R24B 3LH2L 2UWEE 1B9ZA 4V1DE 1F6FB 3DETC 2GFBB 4MB5A 2E6PA 4BFEA 1LVEA 4FFWC 3G08B 4C59B 4CDGC 3VWJC 4F80A 1REIA 1SJHB 1W0YT 2OP4L 1T5XA 5F7MC 2IPUK 2Q76A 4YPGA 1EEZB 1LNUA 5DJ2B 3CC5A 1UA6L 4DFHA 5E7FA 3OKEA 4HFUL 2PXYB 4EDWL 4OCMC 1OAUL 5DMGD 5IHBA 2BVOB 4L4VA 4ZDHB 2OP4H 1ZHBB 2IH3A 2EDNA 4PJIE 2JIXA 2R29L 3FFCE 2VLJA 4JDVB 4HFUH 3UBXG 4EDWH 5E2UL 1YPZF 4NP4H 4UMGA 5HYJE 3HI6L 4D9QE 2R29H 1VHPA 5JIKA 5GGUA 3ILPA 3O2DH 2EXYC 3LDBB 4PRIB 2Z0BA 2R1WB 3RVUD 1YJDC 5TGBB 3BN3B 5I8EA 3UTSD 3AS1A 2OJZL 4KRMB 1KUMA 2HA1A 3VA6A 2EIZA 4U6XA 4POZD 2J12B 4O2EB 4XVSL 5EZJA 3GSUA 4GRLD 5A43C 1VGEL 3CSPA 3GIVB 5CIPB 4S1QH 2GTWA 1QR1A 5FYJE 3O2DA 1XIWC 2KZWA 3P0GB 2D7MA 4XVSH 4FQXA 3SGEI 3M1BB 1IKFH 1KG0B 3W2DL 3OSKA 1VGEH 3QDME 3FFDA 4FQCH 4MQSB 2YPLE 4APQA 4A6YH 3GHBH 4FXGB 5JOPD 2VLME 4Z7WF 1TDQA 4YIQB 3OWEA 5DSCA 5D5MB 3FZUC 3LY6A 2VMFA 2CMRH 1IARB 4TNWF 1T04A 3CVHL 4BH7B 1BJMA 3QO1A 5L2JA 1RK0A 5EO0A 4YAQA 3ZDZF 3NFSL 1RJZA 1FIGL 2DDQH 2X4QA 2VR9A 3K81A 4M5YH 1C16B 5I17B 1GZQA 3H7LA 5M7QA 4A6YA 4XNUL 1U3JA 2BSRA 2B5IC 1EHNA 3SDCB 3VXMA 3D48R 1TQBC 1JNJA 4WY7H 4ZO8A 1S78C 2W9LA 2EDDA 1MUJB 3NFSH 4YR6A 3KPLA 4ZD3H 5HYQB 2PR4H 4RQQB 1U8LA 1PD6A 5DHVB 3GNML 3MUGA 4PYHA 4U7KA 4N8PA 1G0DA 1LP9E 1U8KA 3QEQA 1JYWA 1RAMA 1KJVA 2QJDA 4GG6B 1MSPA 5DZOA 2G75B 2EDWA 1AIFA 3S35L 1CXIA 1JPGB 3NVQA 3UBXA 1RZFL 1TIUA 4YJZL 1D6EA 5FYLH 4X8XA 3QSKB 1S9VB 2C1PA 3IGAA 1JFQH 1ZA3B 4I2XA 4WDIB 5JXAL 3MV01 3BPOB 1TZHA 3ARUA 3HZYA 3O45A 3S8WA 1IC7L 5JMOC 5ISZA 2DI7A 3BUYB 2IAMC 4KJYB 1UM6H 3H3PH 3LZFH 1HHKB 2AJVL 5JNYB 2EC9U 5F1SA 3HUJF 5JXAH 1MFNA 1KTRL 4QRTB 4Y19D 3D39D 5B3JE 4ODTH 5C0IA 3TC9A 4LLUB 4KTYA 3I75A 3C5ZB 1UJ3B 1YA5A 3BI9X 4MJ6B 3G5XA 4MNGE 4NIKB 4YHMH 4MA7H 4TULL 3GJEA 5LKNA 1CWVA 4XAKD 4OKVB 5CP3H 1JUFB 5F6HI 1OAQH 3Q6GL 3DYOA 1RK1B 1CI5A 1AGBB 3K2UH 35C8L 1A7PH 4TULH 1LGVA 4OLEA 1P6AB 2FZ3B 5IB2B 3HPJA 2JTDA 5GRVK 1N6UA 5AEAA 3Q6GH 3FN0H 3LKQB 3GGWA 3QAZC 3TJHC 1IZJA 3GMOA 4MAUL 4C58B 1NGYB 3PL6C 4GAYB 4X0KA 3ZDYE 2WWMD 3QZWA 4PTTB 4U7SA 2VXSL 5F88A 3SDAA 5D1XD 2FBJL 3X12A 4JPVL 4OLYH 4ZFGH 3DMMD 1EO5A 1ETZA 5IVZB 5E8NA 4XVJL 1CDGA 4ZSOE 4JG0H 4IMLB 1ZA6B 3OG6B 1ACZA 5A2JH 1JV5A 1OTTD 4GQ9H 3PP3H 5E2WL 2ESVD 1M6OA 1J5OL 1CD0A 2APWA 4JPVH 2Z31D 4JDZB 1ROWA 1OTSC 1HHJB 3VXRB 3OKNB 4XVJH 2Z91A 2XKUA 2ZNWA 3BGAA 4HPOL 4J23A 1LD9A 1IQDA 5IW6A 3SJVE 1PKQA 1ZVSB 3C09C 1CG9B 5I19L 5DVNA 2BX5A 5J6HA 1ODAA 4YHNB 4PGEA 3MNZB 5CKAA 1F00I 1NCUA 5LXGL 2Y23A 5TE6L 5T1LD 4DGYL 4AL8L 1RPQA 1MCKA 4IDLA 2P24B 4F7PB 1IGMH 5BXFA 4NQVA 5I1GL 4NUJB 2AEWA 1UXSB 4FQIH 4DGYH 2FIRT 1MQKH 4AL8H 1Z3GL 5DJYB 1MF2L 2A1WL 4NWUL 9CGTA 3BW9A 4NM8L 4C4KO 1HXYA 3HE6A 3MLUL 4R97B 2AEQL 2RR3A 4Q9CA 3T4AA 1MFEL 3KPSD 1T1ZA 1QLRB 5ACZA 1IAIL 1UXWB 3BRGC 1TZIB 2ZJSH 1Z3GH 4HGKC 4EZMA 4K71C 1VFAA 1ORSB 5HHOD 3O0RL 4S2SB 3MLUH 1NGWA 4HKZA 4KDWA 1W8NA 2ADIA 2NNAB 3IU3A 1U8HA 5IM7A 5C07D 1J1XH 3PWPB 5I1DB 3ARZA 1S5IH 2EYSB 2E9JA 3R1GH 3AGVA 5HGHB 3KYOB 1CS6A 3V0WH 5FHBH 1YNTA 3FAXA 4HXBH 4XHJC 4B0MM 4I0PB 4PLKC 3ULUC 5J9PA 5LQBL 2DQHL 3DOSA 4E41A 5BW7A 4DCQB 4J3UA 3BVNB 4F7TA 1ZGLB 3DXAA 4YBQC 5DT1H 1R3LA 1PLGL 3GMMA 2NY3C 1KF9B 5GRWA 1FH5L 1LILA 3DI2B 3IRPX 3ZE0F 3NZHH 3KLHD 1L9NA 1HEZA 2GSIA 3KHQA 4OV6F 1E4KA 2VL5A 5T1KA 3OV6A 3P30L 2XNAB 3TIEB 1GGIL 3V5HB 4LCCC 2VNCA 1EVTC 4Q6YA 2CIKB 1S7WA 4W68A 3PABB 1VCAA 4GBXB 5JDJA 5D5ME 3P30H 2PO6C 4OF3A 4Q6IC 2EDQA 5L9DL 1UYWL 3CXHJ 3LS5H 4P99A 1FL5A 4GRWB 2ITDA 3ZT5A 2NR6C 1T1YA 3IJYA 2YBRA 2F74B 3RWGA 5C7XH 2CK2A 4BQ6A 1NMCC 8FABB 1X6LA 2F54D 5I1IL 1ZLUH 1XGTB 1DEEA 3HAEG 2ZSVB 1ONQB 5JORA 3NPZB 3S36X 2ERJB 2Z4QB 5IW1A 5DUPL 4KKNA 2IBBA 3LPFA 2NY5C 4O58H 3RVTC 5I1IH 3ARGD 3J8F7 1MY5A 3UDWC 5FYKD 4GG6E 4BQ9A 3S4SG 1S7SA 4PJDA 2ZUTA 3PWNA 4GXUM 1JHKH 3D85B 1V3MA 1WAAA 3ZKND 3O41A 4KMTL 5HDBF 3LEVH 4TSCH 3QO0A 1FORL 3BKJH 3PGCA 4MA1C 4YZFE 2J88L 5FDYA 1KXTB 3I02B 3VE0B 1OQXA 5IOPA 5TE7L 3QPXH 1FDLH 4K2UL 4FQHB 1MFCL 3KS0H 4JREC 4KMTH 4PGBB 3RDTD 2DQJL 3FB5A 4TSBH 3BEVB 4FFVD 3QIUA 2BNQB 1LO2L 4LVNC 4OCXH 5TE7H 4L8DB 5IF0B 3DVNB 3MLYL 5KS9A 1QBAA 3FRUA 2AK1L 2OMNA 5E9DA 3GRWA 4G9FA 3UJJL 1NCAL 4EVNB 1XF5B 4L3EB 4OCWL 3IDGA 5CBEA 3QHZL 1MCOL 3VA2C 4CVUA 3LKSA 3CK0H 4EI5B 3MLYH 5LGJB 3BYYA 1JWSB 3DRTB 3JTSB 2AK1H 2FWOA 3UJJH 1NCAH 2YA2A 5A3IC 3K8LA 3OKMA 3QHZH 4XH2B 1VFMA 1MCOH 3D2UB 3ARWA 5EBGA 1F4HA 3ZE2F 4JFFD 1XR8B 1Q72L 3M17A 3ALPA 1U8PA 4QT5A 3VGGA 1OPGH 3CD4A 4PUBH 1K8DA 2WMPA 1UADC 2LFGA 4DWHA 1J8HB 1RZJC 4X6CF 4PJ5B 3MLRH 3Q5YA 4HHAA 3RY6A 4RFOL 3EOTL 3NCYS 1I8LC 4NGHH 4P2OD 1BF2A 3KGRA 4RGMC 5DA0B 5E2TL 3VXRE 4G42B 1U8OB 1Z0NA 3N9GH 3MRDB 1I7TA 1QR4A 4KMLB 4Z6AT 3RIFF 1OCWL 3ZHLA 2D03H 4CN4A 3WN5C 3IDIA 2C1OB 3OMZA 1CDJA 4M61A 1Y18B 3U9PL 4KJWC 4PJAF 4X7CC 3S4SA 1MVFA 5T1DL 3VXSA 1IC4H 4OZHA 4IOIA 1L0XA 5IJVB 1OCWH 1Q38A 2EDXA 3SKOA 6FABL 3DX7A 3U9PH 5I71C 1MNUL 3BE1L 4AMKL 3G6JF 2CQVA 5T1DH 4K3EH 3SDXB 2ZUQB 5HHPB 4GW1A 5B8CA 4XP9L 1AP2B 4XI5D 3BISA 5IJKC 4PJ7A 4NNPH 4NO0A 3WLWC 1MNUH 4AMKH 4LLDA 3SBWC 5HBBA 3IKCB 1NGZA 2ADGB 4L3CA 3PXJA 3MR9A 5GS2D 1DVFA 2DLEA 3KYMA 1NCTA 1MWAL 4LNVA 1KIUA 5DRWB 4YHOH 1X5JA 1F3JA 3RGVD 3AROA 4CJ0A 4OV5A 1Z5LA 4I3RH 3EOBA 3LVEA 1W0WB 1VGKB 5L8JB 1BIHA 2BJMH 5C0EA 4NRXB 1CR9H 1DQQA 1MWAH 2F19L 5EU6A 5IEKB 3QEHB 1NKOA 4KHXL 5DJZB 4Z0XB 4V2BA 1EAJA 2ZPKH 4PB9H 1H9VA 3K2MC 2Q8AL 3MA9L 2PYFA 2IALA 5M94B 2M8XA 4PRPA 4KV5F 3QCVL 4OGXH 3K4AA 1ZGLP 1FVDB 5C09D 2H32B 3ETBF 2VDPL 1OW0C 5DUMH 3QIBC 5CKGA 3U9UA 3K3QA 4LCYB 3SGJA 2BRRL 3C2SA 3GJFA 3O9WA 1R5WB 4Q74A 3S37H 2HKHL 2VXQL 2R0WH 3TZVD 2OK0L 1OY3B 1CLZL 5E6IA 4R4NC 4JM2B 1YMMD 4WJ5B 3VWKB 5JLZA 1F6LL 2BRRH 3MROA 5I6XC 1UACL 1IVLA 4JRYB 3H0TB 4RWYL 2RBLA 2R0KH 1PQZB 4X7DC 1CLZH 2AJXL 2Y25A 3MJ6A 4WNQA 2YD1A 3OL2A 1MJJB 1OB1B 4AT6B 1UACH 1F3RB 2Z8WC 5I1HH 3U4AA 4ZFOA 1RIVH 4M1DL 3RBGA 3KYNB 3U48A 2ZKHL 4WI4A 3QXVA 3M07A 1KPUA 4GRWE 1CGVA 4JB9L 4TVPD 3OJ2C 4M1DH 1GGBH 4X4MA 3BAEL 3MYJA 3RIFK 2YKLH 3BXNB 5ENWB 3MRPB 3ZL4H 2DRUA 4MAYB 4UNTA 5GS0H 4NPYB 2V5MA 4JB9H 2NX5A 1LO3L 1YNLH 1YMHA 1UZ6E 5HY9A 4FFWD 5DFWH 4JQIL 4N8CL 3VWJD 1J0JA 4O02L 3DROB 2AK4A 4NHCH 2Z35B 4JFPA 3ES6B 4NOBA 1FZOB 4PRHD 4OZFG 1P4LA 2FATL 3REVB 1KN4H 1FNFA 1T20B 5FUZH 4ETQB 4QOKA 4XBEH 4CMHC 1SBSL 4XNZB 2WWKO 5BV7B 3NGBB 1MCRA 4PRAA 4JEGB 1T22A 2BHUA 3KPTA 5DDHB 1EA9C 4D8PA 1DCLA 5EA0L 2BVTA 3MRCA 1ZHNA 3VFSB 2G2RB 3LQZA 5FO7B 3O8XA 4H8WH 4F37F 1F90L 4QTHA 3KJ4B 2C3VB 1U3HC 3D0VA 1C7TA 5HPOA 3QG6A 3B9KD 2EXYD 3ZYZA 4LSUH 5DEGA 4RX4D 4HKXA 1NUGA 3EO1B 1Q9WB 2X40A 2BNQE 3LKPB 1KB5B 3DECA 5GGVL 3SCMC 4UIMA 4UTAL 5E99L 2FD6H 4XBGA 1E27B 4OFPA 3HZKA 1MOEA 4MXQD 4H1LB 3UTQA 4QXGL 4G6ML 4NKOA 2CDGB 4ZOAA 3C8KA 1NAML 1U8IB 5SWZB 4ZTPL 1JPSH 3HB3C 1MAKA 1RV6X 1WT5C 4V2CB 3DUUA 1NBVH 1ORQA 1XIWD 1FYTD 1TVBB 1DJSA 4LARL 2OTWA 4ZS6C 3HE7A 4G6MH 5T3XD 2DI9A 5ICYA 3TBTB 3W0WB 1NAMH 2GY7B 4XNMB 4OI9A 4OJFL 3HNVH 3QI9A 1K4CB 4P59H 4OQTL 2Q8BL 3TNNA 2VITB 3DX9A 4XP6H 3FZUD 2UWEF 3HR6A 3HC0B 4MD4A 3ELAT 1J8HE 2AJSH 2HH0L 3W11C 3OB0K 3U0TA 1T66C 4HJJL 3G04B 3BKYH 2UZXB 3H7BB 1SY6A 3U30B 4Y5XB 3N85L 3Q5OA 4MJID 4Z76A 2HN7A 1YEIL 3TNMB 5DJDA 4YX2L 3TYFA 1YPZA 1RZ8B 2ZOKA 1Q1JL 2QKIA 1T89C 1A9BB 3SQBA 3U36A 4ZNEE 1H0DA 4Y89A 4E0RA 1WFOA 3LOWA 1UVQA 3RWIB 4ZXBA 1JI1A 1G84A 1X5IA 2IANA 1S78D 4PJIF 4DFIA 2XXMB 2ITCB 3D0LB 1HXMB 1N8ZA 1NC2B 3WLBA 5C08A 1UCTA 5HDQL 5I1AB 2VOTA 3DWTA 4FZ8L 3RWEB 4YHLH 3AC0A 4WO4D 2VZ3A 5J57B 5E70A 4PJ8B 1JMZA 4H20H 2W60A 1UQSB 2N56A 3L3GA 1IAII 1BZ9B 3QUZB 5B38B 1VKXA 3DRQA 3SDXE 2AVGA 4I5BB 3CPLB 1XGUA 3RWHB 2XZQL 4K94C 3VJ6A 5HPMA 1QSEE 2NY1D 4WWKC 3BZ4B 1LO5A 4Y4KC 4JPKH 5C0CD 4Z7WA 2VQ1B 2IAMD 4LGSB 4JFHE 3HFML 3ARPA 4WUKL 1BP3B 3ZTJG 3GMRA 3P2TA 4UQ3A 5DZLA 1Q9LA 5JXEA 1X5LA 3EGSA 3SE4C 4KKBD 4M93C 4L8SB 3AM8A 4PJ9B 1KXQE 4F37K 4QHLA 4D9RE 3QUYA 3TBYB 5D96C 1RHHA 4QF1B 3TO4B 4JPIA 5HHVL 4JHAL 4JVUA 4PTUA 2UZIH 3NTCL 5FKAB 1I3UA 5IB1A 5FK9A 1NDMB 3X13A 5IQ9B 3FQNA 3IDNB 4C56D 5BS0D 3ULVH 1B0GA 5ERWB 2AV1B 3WDIA 1MCPL 4LPCA 4TOYL 5CBAB 2B2XH 1QSFD 3TJHD 5BJTA 3FO9A 3HLAA 2ARJB 1MHPH 3P4MB 3PL6D 5DS8A 2EYTA 1CBVH 1U41A 2X4PB 3P9WB 3WJLA 5JW4R 3QFJE 4Y2DA 4DN3L 3G5VA 2G5BB 2P5EA 5EFIA 1MCPH 1T0MB 5E8DH 4WFHD 5F7YC 2YSSA 3Q1SH 1FV1B 3QQ4B 3ROOB 1R3IL 1BJ1H 5C9JB 3UTOA 1X7QA 2OJEB 3T0BA 1CE1H 1QEWB 2R23B 4X5WA 1OD7A 3RQ3A 1LP9F 3C6LC 4JRYE 1DBKL 2AQ1A 5F8QC 1OTSD 4P2RA 5T3ZE 4I48B 3VFPB 3TA3B 4RDQG 1XF4B 3DO7B 3HC4L 4ODXA 1DQML 2JK5B 4WV1B 4ZYKB 1IILE 2JLLA 3GHEL 1C5CL 5IMKA 5JW4N 5B21A 3N0PB 1AR2A 5EG6C 3RU8L 3UTTB 5E03A 3HUJA 4LKCA 2AJUH 4PLOB 2IBZX 4OCYH 3EJYC 2GSGA 4U1KB 2OBGA 5F6IB 2DQCL 3GHEH 3ARBA 1C5CH 4M3KB 1G7MB 3FN9A 2QR0A 4GG8A 5CEZD 1G1CA 4G8IA 4JHZA 4OZGF 2OL3A 3UPRA 2WSKA 1PSKH 3QIWA 4KQ4H 5CSZA 4M62L 5JQ6L 4TUOA 1QFPA 2DQCH 2WIIB 1IEAA 3VXUB 5B3JF 4KI1A 3TCLB 1TXKA 4KU1A 2QADC 1GHFH 3BX7C 4JLRA 3PWVB 2Y7QB 5K9JL 3RP1A 4HS3A 4R0LC 4ZPTA 3A6OA 1VPOL 4Q9BA 1KCRL 1OARL 5J1AB 4EN3B 3WEXB 1U93A 2HJFB 3TVMB 3GI8L 2VAJA 4R3SA 3U6RA 1YYLH 1RU9L 2MNUA 3L3IA 4UILL 3WS3A 3E6FB 3MFFA 1VPOH 4C55A 4NC1E 3OKDA 2VXVL 1CE6B 1QD0A 2VXTL 3MRNA 1UB6B 1HQ4A 1RJCA 3EZJB 4WFEE 2IH1B 4UILH 3ZDYF 2P48B 5ESAB 1J87A 5FOBA 5C0BA 1V3JA 3TWCL 2H1PL 3LRSA 3EZ8A 5L6YH 4M6ML 1IM9D 5EUOB 1VEOA 2VXTH 1WIUA 3D18A 4XHJD 1J1PL 2BMKA 4PLKD 3ULUD 1P7KA 4K7PY 1MRDH 3DUSB 2FX8H 4GKZA 1C7SA 4P4RA 2AJYL 3QUXD 4RMRA 5FM5M 4WW2C 3TWCH 2H1PH 5IBUG 4N9GB 4NNYB 4M6MH 2UUDK 1EX0A 2NY3D 1RIUH 3THMH 1J1PH 1N7MH 5SWZE 1C08A 3BQUD 3KHOA 1G9ML 4MCZB 3BKML 2UZYB 2AJYH 3G5YB 4O2CA 4ZFZB 3LMJL 1S5HA 4RCAA 1BFOA 1UJ3C 4U1MB 2PKDA 2GK0A 4CKVX 3W0WE 3LN4A 1G9MH 1T0NB 3PWJB 2WZPD 2AEIT 4NRYA 3MV11 5LGHL 2J4WL 3ARDC 2VDOL 3P0VH 3H9SA 3MNVB 3QUKB 4XXCC 3CX2A 4I18C 1OSZB 1EMTL 1QSZA 4NYLA 3PDOA 4UV4H 3MRRB 3LSOB 3ALWA 3S37X 1AKJA 4YHKH 2R2HA 1AQKH 4HWZB 4MJ2A 1N0LA 4WEBL 2BC4A 1EMTH 1MI5B 1K3IA 1QA9A 2VDLL 4N90E 1OP5K 1NEZG 4U6YA 3I9GL 1C8PA 4XMPL 1OAXH 1HDMA 1QRND 1X4ZA 2HFEA 3QXAB 3TBWA 3VFGH 3RVTD 2GJ6D 4KUCF 3T77A 3WE6A 1E4JA 5CWSB 2NTFB 3H6JA 5FYJU 3LQAH 3KAAA 3MRLA 3ARTA 3BD5A 2PYED 2X89D 1L4IA 1OGTB 2YA1A 3O6LL 5J13B 1GSMA 5C2BL 5DEFB 1EFXB 5TDNA 5B39B 4S11A 3SKJH 1DQJB 2ATKA 2YUVA 1SMOA 4RZCA 3U4EA 3W39A 3VXPA 3GI9H 3P77A 2JJUA 4LCIL 4X9HA 5KBNC 2SEBB 2ZWLT 3C6SA 1ES0B 1AGCB 2X4UB 4WI3A 1TJGL 4XCYA 3MLSH 2JIXB 3O6KL 4DW2L 1BX2B 3FOLA 2VLJB 1FCCA 2EDFA 3TCXA 3WIFA 2ZUSA 5BZWA 5HYSG 3D69B 1DUYA 3KXFD 3MJ8B 1WGOA 4Z7QE 5KANI 1IC1A 2QSVA 1MQ8A 3LPWA 4K9EC 4R6UA 4PRNB 5CILL 3TGXA 2DKSA 3F7PC 1UM5L 2N7BA 1QZ1A 4Y16A 3HMXH 1EGJA 1FNLA 4GW4A 3AVEA 4H26B 3T1FA 2EIZB 4U6XB 1DN0B 1BZQK 4Z7UE 4P46B 4ZUWA 3CFJA 2BNRB 3VXTA 1WZ1L 4B7IA 3MLPA 5F7KC 1D6VH 5D1QB 5HVHC 4G3YH 1JGDB 4K8RH 3HZVA 43CAA 5I73C 3OJMB 2CKBA 4FQXB 1KJ3H 2Y36L 4PRBB 3HMXA 5C0GA 3IT8D 4NQCA 1FGNL 5EBMB 3UTPD 2CXKA 4P4KD 1ZE3C 5I30L 2D9QB 5JTWA 4TSAH 1FNHA 3S88L 4J1UB 2RB8A 2FSEA 3QXDB 3EO0A 4GG6F 1L9MA 4WFGE 4ODWA 3RL1B 5C0RL 4P2QA 3SKNB 5I30H 3G6DL 1DL7L 3S88H 5HGBB 4NDMB 1NAKH 1FVCB 5L2JB 5EWIL 1BEYL 1PYWB 4YZFF 4KTEL 4X8JB 1UM4H 1EVUA 2P44B 4GMSL 5IGXH 3NBNA 2QHLA 5JOFB 4A6YB 1DL7H 2BSRB 5IBTL 4WU7B 1BEYH 2DLFL 1WLHA 1UEMA 4TVSa 2CR3A 3IS0X 4GMSH 4OLUH 1FZMB 1I4FA 4ZAKD 3AUVA 2BP3A 2IJ0C 3VXUE 1XGYH 3FB8B 1U8KB 3QEQB 3F58L 3WLWD 2BSTA 2GI7A 2BDNL 3S96A 3MX0A 3BH8B 4QRQB 1G7IA 1OT1A 3I84A 4I9WD 1U8NA 1D6EB 3F58H 2ERJC 3MLTB 3WHXA 4DVRL 4X6CA 5DI8A 1S9WA 4G7VL 4BUGA 2R9HC 4K3JL 4NQSA 1ITBB 5SWSD 4G6KL 4MSWA 5GJSL 3RUGE 4RFNB 2HYMA 2F5BH 3HZYB 4HK3J 3TH3T 3ZT7A 3SO5A 4ORZC 1MIEH 4GKSB 1JJUA 4G7VH 1N5AA 4K3JH 5KN5B 4G6KH 1HHIA 3QXWA 5F9DC 4N9OB 4LHUA 1QO3B 5EPMA 1WCBA 3MYZA 3H42H 3MRQA 5EUOE 1NANH 4ELMB 3C87A 3LKNA 1MCBA 2C26A 2A83A 3O6FA 1C5DB 1FZKA 2XIDA 3UP1A 3BIKB 4PJAA 5DUBA 3JUYA 3QIBD 4G8GB 5E2JA 1IL1B 4U1SA 1DUZB 1CFNA 3SY0A 4DJMA 3RWFA 4NN6B 4I3SL 3DX6B 4LBEB 3G6JA 3VFVB 3DGGA 2BNUB 3MV7A 3MUZ1 3S3SA 3C5JB 5CJBA 4NUGH 3UYPA 3MRJB 5EZLA 4HUWB 4FTVB 2H6PB 2FX9H 1GAFL 3BHBA 4DUVA 1H5BA 1BQHB 4EI5C 5ID0B 5IR1A 1V8HA 2W92A 3LV3A 1RHFA 4NO3A 1Z9OA 1I9IH 4OLXH 4PLJC 1A4KA 5GS1C 1CU4L 2VH5H 5IROC 4N5UA 1NGQH 2J8HA 4HLZG 2PO6A 1GAFH 4Q6IA 1FL3A 4I1NB 3V6ZB 1T7WA 5BCAA 1V3LA 2ID5A 2W9DL 5HGAB 3C08L 1LQSR 3QHFL 4NC0B 5DRXA 2DLTA 3OX8B 3V52H 4L5FH 1MRCH 2KQNA 3ESUF 3OB0H 1KJ2L 3KLAB 1QACA 1MI5E 1NLDL 3B8YA 2DIBA 5A40E 3C08H 1P6FA 3GSNH 5BRZA 4BSVB 4ORGA 4AENB 3TFKC 4HK0A 5F7EH 4KDVA 1T83A 4KUZL 2ATPA 3CVIH 1NLDH 2DQDH 1M1SA 4PB0L 2BHZA 1M7IA 1QSVA 1J12A 1GGCH 2ED9A 4YFLF 5JPMA 1IGFL 4G7YL 1UB5B 3WFZA 4KVNL 5FHAL 1N3NA 1A6WH 4KJQC 2YXFA 2X1QA 5IFJA 5J6GB 2VO5A 4UUJB 4CMMA 4LLAA 3BW9B 4PB0H 2YRPA 3HE6B 2UVEA 3GSNA 1YUHA 5E24E 4L8CB 3ZE1E 3WYRA 1A7QH 5BVJA 2IQAA 3MV8D 1T1ZB 1T6VN 5AWNH 2ZUQC 1B90A 4KKCC 1DE4B 1MVUB 5J12C 3QEUB 4LVHB 1VFAB 5CD3B 2CPCA 4OCLC 4U1LA 2VLJE 1NGWB 3UPAA 1A14L 2I9LB 4YBLB 3IU3B 2C9AA 5E8EA 1T1XA 2IADA 4RISL 1CGWA 2A6KA 2HP4A 1ZMYA 1S9XA 4EOWL 1NCDL 4LCWD 3HB3D 3VFNA 4X98A 1A14H 2CK0L 2EICA 4OUOA 4ZUUA 2ICWA 2CGRH 2E9BA 2F5AL 4KY1L 3K80A 3Q3GA 3KS0J 4ZS6D 1IMHC 2B1AH 4J12A 5MENB 4EOWH 3DVFA 4GRWF 4XNXL 2BNRE 3IDMB 3CU1A 3MACL 4DVBB 4XAWL 2FB4H 1A6TB 1RZIB 3F65A 1T2QH 2OR9L 2C4XA 5C3TA 3HR5A 3IXTB 4FP8H 4XNXH 15C8H 3VFRB 2CD0A 3MACH 2G5RA 5F7DA 1UZ6F 4U1GC 3WIIL 4R2GC 4TUJA 3AREB 3SGDH 4JFDD 4YC2C 1MJUL 4N0RA 2H8PB 3RWDB 2CDEB 2APTA 1S7WB 2P8PB 4AEHH 1D5IH 1DP0A 3WIIH 1I8LA 4HUMB 4UT6H 5ICXB 2VERN 3AS0A 3KLSA 5ESVA 3PF2A 2OCFD 1S8DA 5TE4L 1J0HA 2I07A 4JM2C 4NFBA 4PGDA 2HRPH 5C1MB 2H26A 4KRPD 3L5JA 4N1EA 4XGZA 4CL7A 4HLJA 3I50H 5TE4H 1D5MA 5FA3A 2BVQB 1WCQA 4Y1AD 3SJVD 2WM0A 4OI8A 2GAZA 4HJGA 4YHYC 4RRPA 1MLBB 3TLRA 5JZ7C 3WKML 4JY4A 3F6LA 2HMID 3QEQE 3ARFD 4NHUB 1KEMH 1IFHH 3KVQA 4WWKD 3O2VL 4Y4KD 3EBAA 2HJLB 1U91B 3PWNB 4MAYC 1P9MA 3TT3H 3NA4A 1C1EH 1F11B 1RVFL 3WKMH 4CVZA 2UWEA 2W0KA 4V1DA 3O41B 2O61A 2V2WA 3O2VH 3MV9A 2DKUA 4PG2A 4AG4L 1YEDA 2HVJB 1ADQA 3Q5TA 5IOPB 4XPBH 1N4XL 5JR1H 3BP5A 5BV7C 3NGBC 3MFGB 5KSUB 4X6DB 4HC1A 3C60B 3CNKA 3MJ7A 5LCVH 4L3AA 2AV7B 3CX5J 4LL9A 3OAYK 4NC1C 5IHZA 3BP4B 1FFNA 1X5FA 5FYLE 4ELME 4KMQA 1N6VA 4YDLB 1NC4A 4OGAD 4JANB 4OFYA 4G8GE 3RZCB 5CBEB 1ZANL 3F5WB 5HYJA 1MLCA 4X6EA 25C8H 1OW0A 2I60L 2F53B 2HWZL 2ORBL 1CTOA 5D7SH 5CEYA 3T0DA 4K07A 3OKMB 5EO9A 4PJBB 5E08H 4Z95L 2EDOA 4NQDD 4HF5L 3C6LD 3M17B 4WHYH 2I60H 4IRSA 1RZKC 2W91A 4KGLA 2UUDH 5CFHA 4LOUD 4Z95H 5INCA 4LU5L 4HF5H 1R3HB 5HYIA 2B4CH 3SDXF 3UJIL 1JRHL 3D39A 3ZSTA 1CT8B 3REWA 3IKKA 1FG2A 4L9LC 5JDSA 5FGBC 1I1YB 4M7KH 5C6WH 3EOAB 2OSLB 5LGKA 3QDMA 5FFLA 2R69H 4XX1E 2LAAA 3UJIH 1I7TB 2DBLL 3FONA 3TN0B 2E7LA 3SOBH 5K9OB 5FO9B 3IDIB 4BSWA 2GITB 2BY1A 4Y5XC 2EDKA 4DUWA 2QSTA 2DMCA 2QADD 3VXSB 4IOIB 4DGIH 2RJMA 4KH2A 3VGBA 1HCFX 1UFUA 4JFYB 5ETUB 2DQGH 1G7LA 3L95A 4F7MB 1K2DB 5B8CB 2FRGP 1TCRB 2R0LL 4FHBD 3RBSA 5K9KA 5JHLL 5C70A 2V2XA 4NO0B 3TPKA 4HS6A 1OP5H 4LLDB 4D9LL 3B2UC 1MEXL 3D5OF 1ZHKB 4ERSH 1LP9A 4M6OL 4NQEB 1DANU 1DVFB 3HKFA 4LCUA 1A1OA 5JHLH 4KJPC 5JO5A 4P5TC 4D9LH 2LTQC 1U3HA 1MEXH 3RVVD 4JM2F 4M6OH 5DQJA 3IAGC 3TBVB 1Q0YL 4XB7A 3RKDC 2Y72A 1ND0B 3FT3A 1FJ1B 4G8EA 4MCYA 5EU6B 1CXFA 3C8DA 4F8TA 2AABH 3T8XA 2VDML 4HK3N 1M4KA 1ZT4A 3SCMA 1MH5A 4JFZH 1YC7A 3DSNA 3WD5L 4OZGA 5ALBH 4EI6A 1YN7B 4KZEL 4PRPB 1BVKB 4BZ2L 4L8SC 4PJ9C 4YXHH 3UZQA 3HHRB 5D7JA 5AAWA 2GT9A 3GZKA 1XMWA 5JHDD 4E41E 4U6HB 1FNSL 3TO4C 5DJAA 5F1NA 3QXTA 5IV2A 3U9UB 4RAUB 5HI3D 4KZEH 3HG1B 1T80A 3JTTA 1AGFB 1NH6A 5J3HC 1MWAB 4W6WB 3DLQR 4U1NB 1OAZL 3JWOC 3DVGB 3L3KB 4IM8A 4HWNA 2PCPA 3EW3B 3ARDD 3U7YH 1KV3A 3GSRA 4XCNB 3QJFB 2A74B 4MNHA 1GL4B 4PLNC 4NKMA 5HJ3B 3BWAA 1L7TL 1OM3L 1KIRA 4WNQB 5B22A 1MCWW 5TDPA 3L3HA 1OSPL 3SPVA 5C07A 4GXUN 5L2KB 3FQXA 3OXRA 2EH7L 2EIDA 4ZFOB 2MJWA 2AJZB 1L7TH 1T89A 1KELL 5KSBB 4LF3B 5IVNA 3CDYA 4LPTA 1OSPH 4JZOA 1EERB 2A9NH 5E8OA 3HPLA 4ZSOA 2NY2B 2NLJB 5TF1L 3KPQA 4JZNA 3TA3C 4P23A 1NFIA 4HWEH 4ONHA 3UBXI 1MELA 4XNQA 5DHYB 2NY0B 4IS6B 4OF6A 5HD8C 1MCDA 5FEBA 3O4LB 3Q6FA 1HCVA 1LEKA 3QPQC 3BRDA 3VD7A 1I7ZB 3OR6B 4HDIA 1YEJL 3TM6A 4DAGL 4N8VA 1RURL 3BP7B 4LASH 1PGRB 4WW1A 5DRZA 2K3TA 2EKJA 3EDJA 5LWYL 1D9KB 4GAFB 4XBPA 2E3VA 4GMTH 4IEFB 2WBKA 3NH7L 4YXKH 5IMLB 4WGVB 5F96H 3T09A 1BD2D 1R24A 1WAAE 4FNLH 4DKEH 4KROC 1ZT7B 2GFBA 3E8UH 3EDKA 1RULL 1NGPL 4ELKB 4OFIA 3NH7H 4IJ3B 5FYKH 1UKQA 4BYHA 4EN3C 3V4UL 3MOQA 3RPKA 3D3VB 3TVMC 1P53A 1MCJA 3DV6B 5DJ2A 2HVKB 1IAMA 5GGTL 2ICES 2ZUXA 2PXYA 1BBDH 3P0YL 4OD3H 4ZDHA 1PEZA 3V4UH 2HG5A 1A6AB 1QKZL 4NCC2 4QLRA 5JW3L 2BY0A 2DD8H 4PBXA 4YDKL 3U7WH 1DBAL 3MA7A 4JDVA 1EEUA 3NFNA 1BQSA 3C8KB 4PY7B 2OTUB 3WUWA 2NY4B 4UBDC 4ZTOH 1AY1H 1ORQB 2XTLA 5JW3H 3FJTA 4JJ5B 2R4RH 3VFUB 1K3ZA 4PRIA 5CUSL 5FV2A 2R1WA 1PG7W 5C92A 2GTZB 3JWDL 5TGBA 4PJBE 2VDQL 1VB9A 1F4YH 5D9SB 4XCCH 1KC5L 3TNNB 3B5GA 4O2EA 5CUSH 4JO4L 3JWDH 5TFSL 3Q0HA 1I7UB 2VDQH 3LB6D 1JTOA 5F70A 4Z7OE 5IHUH 3GIVA 5CIPA 1SY6L 3K4DA 3HNTL 3ZTNH 3MLVH 2HN7B 3NIFE 4GQPH 4WEMB 4JO4H 5E2VL 3RL2B 3M1BA 3VRJB 1NBQA 1NAMB 1KG0A 1BLNA 4TN9A 5E1AA 2ICEB 4WUUB 1BJ1J 5GHWL 4IDJL 3OXSB 4ZUVB 3HNTH 4DKFH 5CZVL 4YIQA 1ZLVK 5MI0C 4P3CH 5KG9B 3MMEB 4X4XA 5C08B 4KQ3L 1OAKH 3FOMA 3D25B 2UYLA 3IB4A 2EKSB 3STBA 4OZHE 3VXSE 4BH7A 1KYOK 4Z7QF 2QTEA 4FQ2L 4XP1H 4XNYL 2NW2B 2R15A 1GOFA 4JFFA 4XPGH 5T33L 3L3GB 1U8MB 5I17A 3HNSL 4JY5H 1HNFA 1IC5L 3OZ9L 4JN1H 3SDCA 1XGUB 2R9HD 4Y4FB 5HYQA 1MUJA 1RMFH 5FECA 3VJ6B 3L5WB 2XWBB 4NKDB 4RQQA 4FZEL 1A7RL 5DHVA 1IC5H 4Z7WB 3U0PB 3OZ9H 1NKRA 1LEIA 4X7FC 4GG6A 5J13C 4U2ZA 2G75A 4OM0L 2C7UB 1EHXA 5GJTH 1JGUH 4FZEH 3VMOA 2G60L 4DK3A 4PP1C 2A6JB 3STZB 1MPAH 4M7LL 5FCSH 4HIIB 4EQ3A 4HJ0D 5ITFB 5EU6E 1S9VA 1ZA3A 4R8WH 4WDIA 2YD3A 5DHXB 5GS2H 2XN9B 1BF8A 3L7FA 3B3IB 1H3GA 5CHNB 3PG2A 1U42A 1F02I 3AY4A 2DYPB 2IEPA 5F44A 3BUYA 5F9WB 2DIAA 4PRPE 4KJYA 5IT2L 1D5BB 1T21B 1B0GB 1HHKA 3CDGB 1UGNA 4WCYL 5JNYA 4JHWL 5C0AD 2Z8SA 4QRTA 4EIZC 3O6ML 3UX9B 1JCKA 4HSQA 2VJXA 4LLUA 1BFTA 5DS8B 3C5ZA 4PJHA 4MJ6A 1DBML 3WJJA 3G5VB 2NY6D 4OKVA 1NDGB 1TLKA 2YSSB 5GXBB 2QBWA 2HRLA 4U31A 1RK1A 4S1SL 1C5BL 5E00B 2J6EL 3RGVA 3DX8B 1MJ7L 2WIMA 3I3EA 1EHLL 4N1HB 2FZ3A 3K1KC 3ILQC 5IB2A 3ZLQC 3R8BB 4ZFFB 1K8IB 5EIVA 4ODXB 3LKQA 1PJ9A 1N6QH 3ECBB 1T7VA 4FQXC 3QB7C 5L2KE 2J6EH 4GAYA 4KTDL 4PTTA 4WWID 4XP5H 3HUJB 1JWMA 5KSBE 5FA4B 4DK6A 5IVZA 1B0WA 3OKKB 4IMLA 1ZA6A 5C09A 5I18H 4KTDH 3TFKD 1P7QD 4MZ2A 3QEGL 4MD0B 4JQXA 4TVPL 1HHJA 3VXRA 3TBSB 3OR7B 3OKNA 4H0HB 3FQRB 5DFVC 3F7YB 5C0NC 1F4WH 3O4LE 4NWTL 5EUOF 3S3PA 3QEGH 1K4DB 3OJDB 4KJQD 4TVPH 4N0YH 4ZPTB 1CG9A 4JFED 1CCZA 4HZLB 5EOQL 1N64L 4YHNA 4R3SB 3MNZA 5FUOL 1HHHB 3P11L 4KKCD 1IGIL 3UYRL 1MJ8L 4MXVE 1E4WL 5EOQH 3ZTJH 4LKXB 5DK0A 4LSVH 1QSED 4KWUA 2P24A 3T0EB 4F7PA 4Z7NE 3MRMA 1AR1D 1IGIH 3JV4B 4NUJA 2A6IA 1NSNH 1MJ8H 1UXSA 4JFHD 1NL0L 1WZKA 4ODVL 1A3LH 3VRLF 1NCBL 3D3VE 3LRSB 3H9YA 1FIEA 5DJYA 4DOHB 32C2B 4CAGA 4O5LL 2P46B 5JIPA 4PJEB 3PP4H 5KOVC 4Q97A 1NMAH 4RFNC 1JWUB 1JMXA 1QLRA 1PVHA 1YJDL 2OI9C 3PHQA 1NCBH 2DN7A 2QQKH 3CFIC 1ORSA 4FXKB 4S2SA 5BO1L 5IB5B 2F58L 3CMOL 4O2CB 5HHXH 5D1ZB 3PWPA 1S5HB 5TQ0L 5I1DA 4JO3H 1BFOB 1JRHI 5LAXB 5KVMC 1JNNL 3OAYH 4R2GD 5HGHA 3AFLA 2Q86B 1OGAD 1I3RB 4PJGB 2VB5A 3QDGD 5ADOL 5FIEA 4I0PA 3GMLB 2CRZA 4TUKH 5T3XL 3RNKA 1YNKH 3GBMH 4LGPB 2AKRB 5TQ0H 4DCQA 5AZ2L 3QFJD 1Y0LA 3BVNA 4M4PA 1JNNH 1ZGLA 5JIIA 3H9ZA 4NN6C 1CD8A 5DD0H 2EIBA 1ZEAL 5T3XH 2E6QA 5T5FL 5LG1A 5AZ2H 3RIAF 5GISH 3UTZA 5DJCB 5EU7E 1YPZE 4KI5C 3SDAC 1R5IB 2XNAA 3TIEA 3ZE1F 2D7TL 2GEEA 5J06A 4RIRB 4TNVK 5T5FH 1KFAH 5DQDH 4TPRL 3KPPB 3FMGL 2IANE 3LIZL 4F7CB 3PABA 4OCRH 4GBXA 1MAJA 1IAKB 1YDPB 2A73B 2DJSA 3SDDB 5C08E 2RIKA 4NCDA 5JZ7D 3T77B 3WE6B 4LPUA 4J6RL 3QA3B 1V7NH 2EH8L 4ZOEA 4M7JL 2YD5A 2UVFA 4HBCL 1NBZA 2F74A 3GSQB 1G6RL 3OHXA 1UT9A 2P7TB 1I75A 8FABA 4Q2ZB 5IFHL 2EH8H 5E5UB 1XGTA 2COQA 3FL7A 2ZSVA 4HBCH 3GBNH 2BXYA 3EYFB 1BM3L 3PQYB 1F4XH 3IU4H 4Z7WE 5DYOA 3N06B 4XCYB 5F71A 1RZ7L 5FM5O 3L5XL 4MD5B 1BM3H 4UIKL 1LO4H 4HWBH 3D85A 1CICB 3HE6C 4IIQB 2VDNH 1U8JA 1RZ7H 3QH3A 4NZTL 5ILTL 3ZDZE 2D7NA 2ZG3A 3L5XH 5EU3B 4UIKH 3DYPA 4ZG1A 2YZ1A 3VE0A 2XN9E 4KXZI 2N4IA 4GW4B 4ODBD 5I75B 1QFWL 2P8MB 3T1FB 4WI5A 4FQHA 4PGBA 2DQIL 3VH8G 3ZDXE 3I6LE 4WENB 2HTLC 5ILTH 2VDRH 3MRKB 4ZUWB 4AH2B 4KKAC 4YBLC 3BEVA 2BNQA 3VXTB 1ZSDB 2BOBB 3V8OA 1A3RH 5SV3A 4UB0H 4HWBA 4L8DA 1URLA 5IF0A 3CH1B 1F58L 5C0CA 4OD1L 1B4JL 4EVNA 1XF5A 4M43L 2A0LC 4L3EA 1OAYL 5L88L 2FIKB 4NO2A 5BW7C 1HKLL 3IDUA 4NN7B 1G0XA 4EI5A 5LGJA 2W0PA 1F58H 3DRTA 1JWSA 3JTSA 1YEHH 5BMFL 3L9RB 3RNQA 2FSEB 4QY8B 3ULVE 1INDL 5C3LD 1W72H 1OAYH 4X4YB 3WL9B 2AAVA 4XH2A 1FO0H 3D2UA 5J4MA 1JGLH 1XR8A 3OB8A 1PEWA 3ARQA 5F8RC 1E4KC 5EZIL 4RSVA 1INDH 3HUJE 1J8HA 5KANG 2D2OA 4MNQD 4PJ5A 2YMXL 4ZUTB 2JJVA 2EC8A 3OKLB 5SX4H 4EKXA 3U0WH 4X9BA 1YEFH 5CP7B 2XZCL 3BJLA 4ZNEA 1DBJL 1IBGH 3TIDA 2L0DA 4G42A 1A4JB 5CEZL 2CO6B 1U8OA 1GJIA 4N90D 4YHPA 5D2LB 3MRDA 2O5XL 1MCHA 4Y88A 3VMNA 2XZCH 3G5ZB 4ELMF 2BSTB 2C1OA 1Y18A 4BELD 4MQ7B 3M45A 3MGAA 3T0WA 5JW4Q 4HWUA 5TQ2H 5IJVA 4KJPD 1S9WB 2W0LA 4P5TD 3RVWC 5I74B 2FX7L 2XTJB 4F33B 4TRPL 4NQSB 4QRPB 1BVLA 4MSWB 1A1NA 1QFWM 5HHPA 1TQCC 2D31B 5D8JH 2VDKL 3T0EE 1U2HA 7FABH 1JPFB 4D2NA 1GC1H 1N5AB 2FX7H 4TRPH 3PV6B 3UMTA 4P5KA 4DTGH 1B4RA 3IKCA 2ADGA 3AAZB 4DOHE 1CXKA 3QWOB 2YRZA 4PJEE 3QT2A 2C3GA 2QQNL 1UH4A 2H41A 2A83B 3SQOH 3O6FB 5D7LD 1JF1B 3FRPA 3ULUL 5I8KL 1KB9J 1VGKA 1CFNB 2QQNH 2BSSB 3KPMB 3QIUC 4LSRL 4NRXA 1E4XL 1IGTB 2VLKB 5IEKA 4UQ2B 1VFBB 1A6PA 2VC2H 2N7AA 5DJZA 1MIMH 1HWHB 1OD9A 5I8KH 1KEGL 3VFWB 4KVCH 4HAFA 2WBJD 5D7KD 2R1YB 3WFCL 1BAFH 4Z5RB 4PJGE 4CDHA 5FKPB 3MSPA 1JP5A 5GGQH 1FVDA 2IBZY 2H32A 3MXWL 4O00A 1CFQB 2Q20A 3CU7A 2AGJL 1KCLA 4LCYA 3JV0A 3RX5A 2GCYA 3H9SE 2BVPA 4RFEA 1NCCH 3MGTA 2ZUUA 4ODHH 3EO9H 4RA0C 1OTUC 4YH6A 4XWOC 3FO0L 3QQ9C 4F9PA 3MXWH 4JM2A 3VWKA 1KULA 4Y4HB 2YD8A 3BESR 4A2LA 1J0YA 3H0TA 4XPTH 2HFFA 2AEPL 3OAUL 3S5LB 1PQZA 4IRJB 3GO1H 2B1HL 3TV3H 3RY6C 4R26L 2GIYA 4UNUA 3V7MA 2B0SL 4AT6A 1OB1A 3AXLA 3LD8B 4HKJB 3EYUH 1WISA 4QXUH 1LO0L 3KYNA 3EKCA 3P73A 4R26H 1Z9SA 2QV2A 2B0SH 4QHMB 2NY5L 1U95B 1RJLB 4RGNB 3O3AB 1QHPA 4Q9RL 3SGEH 1E6OL 3QG7H 2IG2L 4JVPA 5CGYC 3EYSL 5DR5H 2OXHA 3BXNA 5ENWA 3MRPA 1ZLVH 4KROD 4NPYA 4UTBL 4DEPB 1A2YB 4BQBA 3A6BL 3RY4A 3DROA 3FQTB 3PQYE 5DWUL 4AIXA 3ES6A 4LFHD 1FZOA 3S98A 1X5KA 3KG5A 2XA8H 3REVA 3X3GL 4LGRB 4U4BA 1KJ2B 2JELL 2WINA 3RI5K 5B8CC 3IDXL 2J3SA 4UTBH 1OLZA 2DTSA 5IFAH 1T1WB 4GRMA 4HCRL 2L7UA 4WHCA 1KB5H 5DDHA 3GSWB 5F7LB 2R8SL 1X5ZA 3CSGA 5E0QA 4L4TB 4X7EC 5FV1L 5C6PB 5I16B 2XT1B 1N26A 1AO7B 1JPTH 1QRNA 2A6KB 5I66A 1SEQL 5DVOA 1DVFC 2RAMA 5B38G 3ARRA 3VFSA 2G2RA 4HCRH 2XICA 4UBDD 5FO7A 3VFNB 4XPFL 2XY2A 2OZ4H 3WFHB 2C3VA 3INUH 5EZOL 2X89A 4ZOCA 1Q94B 1FL6A 1SEQH 1QBLL 4CW1B 3GKWL 4W4OA 2BVYA 3BN9C 3EO1A 4XPAL 1Q9WA 5HI4C 5CMAA 3LKPA 1GRWA 1KB5A 4ETYA 1KOAA 4FQ1L 1E27A 1L7IL 3W5NA 1EJ6A 1HHGB 2WW8A 3MNWB 4H1LA 1F42A 3GKWH 3NAAH 4XPAH 2CDGA 5FGCB 4Q9QL 5EN2A 1U8IA 2HFGH 3CDCA 5L0QB 5SWZA 2PW2B 4UV7L 4XP4L 5EOCL 2OZ4A 4BQ8A 1LK2A 1RZJL 1HNGA 4FQ1H 3PP3K 1FNEA 2Y06L 1N2RA 5HDBE 3SGJC 1JZ2A 5MHSD 4PBVC 1YY9C 3O9WC 4FRWA 3EIFA 3TBTA 3W0WA 4KK9C 4XNMA 1IM3B 3D87B 4XP4H 5DZNA 1VFUA 5E6IC 2RQ8A 5FGBA 4P9HH 5I1LB 1QVOB 2ZUVA 2GUOB 2VITA 4QRRD 1B2WH 3UTSB 4XGZB 3HC0A 1AFVH 5D70H 4KDTC 3O4OC 3G04A 4EUPG 1H8SA 1P84K 4Y5XA 1R5VB 3TNMA 4U1JA 4GRLB 4GAGH 1RZ8A 1CK0L 3MBED 4X6DF 1A9BA 1WZMA 2CXGA 2EZ0D 3SO3B 5HHQA 4POUB 4U3XA 3RWIA 2QSCL 4W4NA 5EUKA 5D2LE 2P8LB 5CGMA 2NY2C 1CGSL 4JY4B 3TH2T 3GUTB 3MUY1 3QRGH 4GKNB 4P4KA 3D0LA 1CK0H 2ITCA 1HXMA 1NC2A 1GYAA 4WFFE 5I1AA 5HDLA 3RWEA 4FQQB 4GS7B 1CGSH 5INDB 2JB5L 1IE5A 4PJ8A 4RGOH 1QFUL 2XTJE 3VW3H 3TYGL 4TTDD 4QRPE 3QUZA 4PJBF 4I5BA 3UAJC 3CPLA 4L4VD 3RWHA 2AI0L 1MCNA 3MJ7B 4LSPL 3TYGH 1SJVA 3BZ4A 4F15B 5GS0C 3KNBB 2VLJD 1P2CB 3VCLA 3B5HA 1XGQB 3O8XC 3TP4A 4ZAKA 3NIFF 4F9LC 1AI1H 1NLBH 4LFHG 1I3GH 4L8SA 5J56B 1BQUA 2LV4A 3TBYA 3RRQA 1MLCB 4X6EB 4QF1A 3TO4A 3VDCA 5KAQF 5BVPL 1YYMH 4OIIL 1Q9OA 2VLKE 1AGDB 4XMKL 3SDYH 1A0QH 1H15B 1MCIA 4JY6B 4F3FB 1NDMA 3MV7E 2LE9A 5IQ9A 2AXGA 2CJUH 4H8WC 2NY4C 2FBOJ 5ERWA 4NJAH 5DC4B 2AV1A 5F3HB 3V0AC 5CBAA 4G8FB 1X5YA 1EHAA 5GSRB 1JTPA 1CIUA 3SGKA 2ARJA 3B2VL 3P4MA 4Y19B 3D39B 4APQD 4OBSA 3QI9C 5E94B 3DO3A 1T0MA 1HKFA 5CCKH 1FV1A 3QQ4A 4MGXA 5C9JA 2OJEA 1CL7L 1DFBH 1QEWA 3H2WA 2Q6WB 1I1FB 2ZP0T 4I48A 3VFPA 3TA3A 3O3DB 5DFVD 1IJ9A 1XF4A 5HHMD 3DO7A 4OGZA 5C0ND 3FCTB 4K23L 1YC8A 4WV1A 5EU7C 4ZYKA 4KV5E 5IWLC 2YK1H 2JJWA 2VLRD 4QRUB 3UTTA 2HKFH 4LDOB 1NCNA 3VXMD 3B9VA 4JCLA 4K23H 1J86A 2YD4A 3BOVA 5I15H 5D1XB 2OX5A 4RGNE 3DMMB 1G7MA 3WIHA 3TH4T 2FECL 4MQXC 4M6NH 5K9KB 3A6CH 2O93L 2V2XB 3HAEB 4GUPB 1B0RA 4IOSD 2ESVB 5JA9A 5F9OL 1FGVL 1LK3L 3FAWA 2WIIA 3TCLA 2Z31B 3Q2CA 4P3DA 3LHPH 4Z77A 3TT1H 3PWVA 4JDTH 1A1OB 4FMFA 2DOCA 1QFWI 5F9OH 1FGVH 1XFPA 1YY8B 5J1AA 4EN3A 2ZCLL 3WEXA 3I85A 5I1KH 4FMKA 2J8UB 2HJFA 4Y4FC 3H8NA 1UWGL 3NACH 3TVMA 2NXYC 1HN1A 3MGOB 4PS4L 4BK4A 1G9NC 4UT7L 4XRCB 2BVEA 5C71A 3OPZL 3V9FA 2XQYG 3E6FA 4L4TE 5ISZD 3HN3A 2HT3C 1AO7E 1A7OH 1CE6A 5T1LB 4EI6B 5IB3A 5JXEC 4PS4H 1UB6A 1INEL 3AM8C 3OPZH 3V2AR 5ESAA 3QUYC 1AQDB 2IMNA 4W6YB 5FYLD 1D5XB 1J1OL 5KSBF 3TPUA 4D0DB 5IV2B 5EUOA 1P7HL 3L7EB 3BWUC 3JTTB 4LEOA 5IBLC 3T0XA 3DUSA 4YWGL 3ZKMC 4S1DC 3FB6B 2PTTB 2O5ZH 5ACLA 2PCPB 4N9GA 4FFYH 4NNYA 3L1OL 3KPSB 3MV8A 3T2QA 5FGCE 5ALCL 1EXUA 4MCZA 5EBWA 1D5ZB 5F7UA 3BWAB 5HHOB 3G5YA 4ZFZA 2ZSWA 1KIRB 5B4MC 2VZUA 4PY8I 5JUEH 4KI5D 3SDAD 4U1MA 3WJLC 5C07B 1KJMB 1QNZL 3T2OA 3ZT6A 3WBDA 4NJ9L 1T0NA 3LEXB 3PWJA 4IOFC 4LCWA 1HOCA 4FQJL 3R4DA 4MXVF 2B8OT 4GLRI 5JIHA 3HPLB 3UTSE 3ULVC 1VACB 5KVGH 2XQBH 1K5NB 4Z7NF 4FQLH 4MJ4A 4FQJH 5DMKB 2GK2A 3HMWL 4HX1B 5CSBA 4R4FL 1OSZA 1CLOH 1I9RH 1SM3L 1U6AH 3Q6FB 3VXQB 3MRRA 3LSOA 2P43B 4GH7B 4XMLL 4JFOB 3CAFA 3C9NB 4I13B 3HMWH 2FHBA 1FSKB 4OF0A 2BVUA 1LDPL 3QIWC 1UCBH 3LEYH 5JOPE 3VFTB 1RUPL 5IUSA 5T1MB 4K94L 2XZAH 5AD0B 5JW5B 3MRIB 5GSVB 5CWSA 1RZGB 2NTFA 3HCVB 4Y5VB 5CEXB 1A6VL 4J7RA 2DQFA 1LDPH 2VABB 3VRIB 4R96B 3MV9E 1IAOB 2NZ9D 4NFDA 5AUMB 4OT1H 1RUPH 1OGTA 4QHUB 4K94H 1DN2A 1LE9B 1NFDB 3DURB 5DEFA 1G6VK 1EFXA 1JE6A 3LH2H 4OLZL 1RSFA 1A6VH 5B39A 1DQJA 1E4XI 5IKCB 2FGWL 2F54B 4N5ED 2YRLA 4PR5B 2SEBA 1ES0A 1AGCA 4HS8L 2HG5B 2VISB 2X4UA 4Y5YB 2HTLD 1HE7A 2R56L 5DF0A 1MCWM 1BX2A 5I0ZA 4S1RL 3MA7B 1UA6H 4F8QA 3JVGA 3NFNB 4GSDL 1OAUH 3KDMB 1PG7L 3ARGB 3WUWB 3D69A 4HS8H 2I25N 3MJ8A 2XKSA 3BPCB 1A6ZB 4PRNA 4LEXL 3OTTA 3NOIA 2NXZD 5E2UH 4GSDH 3NPSB 4E41D 2XG4A 4J3OC 3DIFA 3DXAD 1FAKT 1T2XA 4H26A 1KLGB 2DL2A 3HI6H 1Y6KR 1DN0A 4P46A 4F57L 4OIAA 2BNRA 2V9TA 2HLAB 4LRIA 1VERA 1SJEA 3DYMA 1A7NL 1HQRB 1S7QB 3MC0A 3RDTB 2R2BA 3BMVA 5D1QA 1TZGL 2OJZH 5T1KD 1P69B 1JGDA 4DN4L 4F57H 4Y19E 5ID1B 3D39E 4RAVA 1S7TA 1BLNB 4PRBA 1FC2D 5E1AB 3T4YB 5HI5C 5EBMA 5BQ7B 1HH6A 4KPHL 4X5XA 4DN4H 4XAKE 4XC3L 3SE8L 3BD3A 4J1UA 2BFVL 3JZ7A 3QXDA 2BY3A 5CLWA 5A2FA 3W2DH 4X4XB 4JM4L 5TH2B 4NQXB 3FOMB 3RL1A 1FRGL 1LDSA 2UYLB 3SKNA 3QZWG 5I0DA 1J0IA 2LU7A 5HGBA 3CFCL 4NDMA 1FVCA 1FNGB 4JFFB 2IWGA 5JOEA 1PYWA 1UZ8B 4EIGB 4ZS7L 4WI2A 4X8JA 4HH9B 5JOFA 3CVHH 2FLRT 2FEEL 3UC0L 3ZDXF 4HUUA 4WU7A 4U33A 5FECB 1FIGH 5H2BB 2HT4C 4M1GL 3GSXB 1FZMA 2ESVE 5H94B 4XNUH 1ZK9A 4P2OB 5F1OB 1WC7B 3FB8A 3UC0H 1BIIA 1LEIB 2BRQA 4QHKI 2ICWI 4RMUA 1F8TL 4C83B 3BP6B 3GNMH 1A5FL 3IDYB 4UDTA 3BH8A 4XVUC 1H3TA 4QRQA 3MLTA 3BT2L 1KCUL 3PGFL 4Q0XL 2J2ZA 4HIJB 3UZVB 3ULVF 4QRSB 1F8TH 2WLYA 5I1JL 3DV4A 2YUWA 3S35H 2BERA 3FO1A 1QLEL 3L7FB 1RZFH 4IHOB 3LQAC 3QIUD 2P5WD 4OZGE 3BT2H 2P45B 4MB3A 1KCUH 4U0RB 1A9EB 1YQ2A 2DQEL 2E7MA 3M8OL 4GKSA 4CGTA 5DMIL 5DURD 5KN5A 4I8DA 1QO3A 1CDCA 1QLEH 5E9DD 1EV2E 3E2HB 4G9FD 5MERB 1IC7H 3CLFL 4CBPA 3IFLL 4PJHB 4Y16C 1WFTA 4ELMA 2DQEH 5EC2B 4Z8FL 3K74B 2AJVH 5DMIH 1C5DA 5I75C 3ROLB 3BIKA 1S9YB 3B6SB 5FF6B 4G8GA 4PV8B 2ILLA 3CLFH 3V4VL 3P9LB 1IL1A 4CN6A 1S7XB 3IFLH 1DUZA 4KRNA 3RGVB 1OTUD 4XWOD 3QQ9D 3DX6A 1I1AD 3CCHB 4K7PL 4LBEA 5HHOE 1F6AB 3VFVA 5DD6B 2BNUA 4ZQKB 1IRAY 5C07E 4YXLL 35C8H 3C5JA 4GJTB 3MRJA 4FQPA 3NCBB 4MXWL 4HUWA 4OLWL 1JWMB 4FTVA 2H6PA 5CP3A 4E42B 4ALAL 1BQHA 5ID0A 1FHGA 2MPAL 3PNWA 4BFIB 4NNXB 4MAUH 5C09B 5JHDA 5GGRA 2VXSH 2B39A 2FBJH 3V6ZA 2MPAH 4K8RC 1VESA 4ISVB 3TZVB 5HGAA 5E2WH 5CGYD 4PJEF 1J5OH 2FGZA 1YMMB 2CKNA 1I3VA 3OX8A 4NCC1 2FJGB 3KLAA 3DGCR 5E5MB 4HPOH 2Y07L 3EHBC 4BSVA 1RFDL 4AENA 2PNDA 2DB8A 5I19H 4K3GA 2FJFB 1R3JB 1V7ML 5DK0B 5DLML 3W82A 3GMQB 2Y07H 2ZCKL 3MRMB 5DXWA 4M5ZL 5LXGH 2WUCL 4PJGF 1UB5A 2A6IB 5TE6H 1NFDE 2OS7A 2MKLC 1V7MH 2CLVB 3MO1A 4KRLB 1A22B 4HMDA 5J6GA 4LLWB 4UUJA 4CVXA 4WEUD 4K9EL 4L8CA 2F54E 4M5ZH 2WUCH 4HFWB 5D2NA 5I1GH 4WI9A 3PHQB 1IQWL 1G7QB 1DE4A 1MVUA 1XF3A 5DRNA 3QEUA 3ZYOA 3BN9D 4QXTA 1MF2H 2A1WH 4NWUH 5CD3A 4NM8H 4PRHB 4J3TA 3E3QC 3P40A 2AEQH 1TJHL 1MFEH 2I9LA 4U2YA 5FYKE 3K46A 1IAIH 4UOW1 3VXOB 3O0RH 3WMSA 2L4OA 1A6UL 4LAQL 2HTKC 1OQOA 3O6FC 1BD2A 4PRIE 1ZTXL 4OI7A 4K7FA 5CJOL 5F7NC 2ENSA 1IKNC 3MOBL 5L7XL 2FEDC 3RNKB 1YECL 3ZSSA 5MENA 1CL7I 1YY9D 5ANMB 5J11B 3O9WD 1Y0LB 4MA8L 2MTPA 2X1XR 4KK9D 5ADPL 3IDMA 4B50A 4DVBA 3B9KB 5E6ID 5L7XH 1A6TA 1RZIA 4YFEA 5LQBH 2DQHH 2CRYA 3IXTA 5F1KC 1PLGH 3UTZB 4G5ZL 3VFRA 1TTUA 4NT6B 1KLUB 3P9MB 3AREA 1HSAB 4L4JA 1H5BC 5FOJA 1FH5H 4OUUA 4TYUA 2H8PA 4E5XB 1P4BL 1ACYL 3RWDA 2CDEA 5I9QC 5EH1A 2P8PA 1HI6B 2FECI 2X70B 1FYTB 3NA9L 5ICXA 5DMYA 1GGIH 1PZ5B 4UDUB 4HV8B 3VGAB 5C6TL 2FNBA 4OCNC 5I2IB 1WTLA 3U79A 4TQEL 1NBZB 4JFFE 3RPIB 3NA9H 4MA3B 3TEUA 4YK4C 3WO4C 2NX5D 1KIPB 5L9DH 3OHXB 1UYWH 1EEYB 1I9JL 2AK4D 2BVQA 3CUPB 1F45A 5CINL 1KPRB 1KBGL 2OQJB 3GM8A 1YEKL 4QOKD 4MJIB 5KAQG 1T83C 1IAIM 2E9IA 3UAJD 1MLBA 3NFPB 5DYOB 2JKXA 3EFFB 4UOW0 4RGNC 4U49A 1I7RB 4NHUA 4U3CA 1KBGH 4AEIL 3OF6A 1YEKH 1MHEB 2HJLA 3GK8L 1U91A 5DUPH 4FG6C 2NZIA 4ZPVB 4JR9L 1F11A 7CGTA 3O8XD 3IJSA 4OD2B 1U8JB 1N59B 2M2DA 3CFKB 3QH3B 3UXFA 1T5WB 3ZHKA 2NQCA 3GK8H 2HVJA 4WO4B 1WJ3A 2B7DT 2Q1EA 4JR9H 3MLXL 3O3UN 1JNLL 2NY7L 3QUML 4CADA 3EOYG 1FFRA 3AB0C 43C9B 5KSUA 3NCJL 1FORH 4X6DA