4HK0B

Uca fab (unbound) from ch65-ch67 lineage
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
QSVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Preconfiguration of the antigen-binding site during affinity maturation of a broadly neutralizing influenza virus antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords UCA heavy chain
total genus 42
structure length 210
sequence length 210
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hk0B01
1KJ2H 4P9HL 4YHKH 3H9SD 3NGBB 4J3SA 3VFRA 2YD3A 2XWJA 2EKSB 1RZGA 4Y4FB 4JGUA 2O61B 2O26U 5FYLD 4IDJH 4JHWL 3GMMA 1JK8A 2LU4A 1N3NB 2R0WL 5SV3A 4NUJA 2AV7B 1A2YB 3OKOA 4JFFA 1E28A 4DVRH 3C9NA 2H3NB 4NO5A 2EO9A 5FO8A 1HIML 2HT4D 3QPQC 3V8CA 35C8H 3SBWA 3TO4B 3FT4B 3VXRB 3WS3A 1T83C 4NT6A 1MCPL 4OB5L 4PY7A 4HBCH 4BSVB 3BWAA 2BOCA 3D85B 4Z5RB 5JORB 1IT9H 3IU3B 5FK9B 2I26N 5GRUH 2ZZUT 1YNKH 3KYKL 2Z8SA 2H41A 5JR1H 1LE5A 1V7NL 4JFEA 3WS6C 4CAGA 4YGAB 4KKLC 4OF0A 1NGZA 2NCMA 5ALBL 4MD0B 3VFSB 4WI3A 2YXMA 2ADJA 2VDNH 3V0AC 4I8DA 5KSBA 2DB8A 4JG0H 3UJJH 5HYSA 1J8HD 3GSNL 2X7LB 4XP4H 4U49A 5E8NB 1I7ZB 3BH9A 4WV1B 1N26A 5F9WB 5FKAB 3UBXG 3ULSB 1N64H 1K3ZA 2ZP0T 4Y4KB 5FOJA 1KEGH 3MGOB 3WNOA 3ZDXF 1KCRL 3ZHLA 5IMOB 2BDNH 4N8VA 1CIUA 1RJZB 2NY7H 5I15H 4KHXL 2Y25A 3GBNL 3QDGA 5FDWB 4MA3A 5FCUH 4LSQL 1X5FA 2C9AA 5ID0A 4M7LH 3SDYL 4LGSB 25C8L 4XAKD 2F19L 3HNSL 1BM3H 3GEWB 3WHXB 5KVEH 4HT1H 3ARSA 1U3HB 4ZTPH 3VXRE 1JN6B 5A2LH 2RHEA 1XIWD 1WAAF 2KH2B 4WWKB 3RIAF 1TFHA 2ZOLA 2IFFL 3S35L 4U6VH 5EA0H 3WFZA 2DRUA 2W0FB 2AW2A 4BJLA 4JM4L 1S9YB 1OB1B 3G5YB 2AS5M 3E8UH 1KNOA 3OXSB 3JTSA 4N0YH 4KTEH 3RDTD 4G9FA 2VLME 3QJFB 1ZKAA 4Y4HD 4PRAB 2V2WA 3HLAB 5K9QG 4WEBL 1QYGH 3BUYA 3IU4L 3CVHA 5C0EA 3PWUB 5DQ9B 1DQQB 2XQYK 1HOCA 5KSAD 2B1AH 2E7MA 4ZS6C 5HDQL 3N06B 3DWTA 4PPTA 1TVHA 3AU1B 2EDBA 2GCYA 3K2UL 4JJ5A 4MNQB 2JJVA 4Q6IC 4GRWF 4E41D 1GVIA 2BY3A 5EBMB 1F90H 4HZLB 3CX5J 3I84A 2IH1A 2X4QA 5IVXA 5EWIH 4DKFL 5D2NB 1ZGLP 3MA7A 4AH2A 3IU4H 2XG5A 4MXVF 4M5ZH 4A6YL 1R3HA 4ODBD 4O5LH 3ZE0E 4ONHB 4PJAA 5IMKA 1ND0B 3RI5K 3EO0B 3ME0A 4XXDA 3RTQD 1BF2A 2PYEE 5EIQA 4HCRA 1VPOL 2ZUXA 5DURD 3SGKC 1NEZB 3SE8L 4PRHB 4M1CC 2P5EA 5T3XL 2B0SL 4JM2A 1KXTB 2G60H 1QA9A 5D9SA 4MCZA 5JXAH 5D5ME 3IT8D 3EYOA 2H6PA 1WZMA 2ZUQC 4ZFFB 1X4ZA 2IFGA 3B2VL 4JPIB 5BRZA 3E1F1 2VABB 4HEPG 1QRKA 1NCWH 4ZD3L 8CGTA 3MV11 3MRCB 4QCIA 1NCDH 3PHSA 4GQ9H 4HK3N 1ACYH 1IZJA 3MJ8A 3MRRA 3UBXA 5J56B 5F1KC 1A7RL 4U2ZA 5FM4A 1AR1D 1I9IL 1U8MA 4WI6A 1IARB 1PEZA 3CSBA 3CK0L 5DHYB 5D70H 4X6DF 1JP5A 3R8QA 3ZYZA 5E8DL 2HMIC 5T1LB 5J13C 5EZIL 1N3NA 3FZUC 5I19H 3CZJA 3GIZL 4BQBA 1QVOB 5IBUB 2H1PL 3Q2CA 5TQ0H 3KDMB 5JW4R 2R2EA 3F7VB 3RRQA 4J3VA 2J88H 3BWAB 4U3XA 4OZIA 2E9BA 4RGOL 3KPQB 4YX2L 5TF1L 1FNSL 4LKCB 4DJMA 4RAUA 2IJ0C 5GRYA 1KLUB 2M1KA 4ZUUA 3OSKA 3EKCA 4V1DE 4JRXB 3W39A 3QCTL 1MCDA 3NCMA 2EO1A 4CMMB 3MJ7A 4MXWL 1MHHA 5KSBB 1K9TA 3MZGB 3NFNA 4U1GB 3V5DB 1H3PH 4QRSA 2NQCA 1LVEA 4WW1A 2ZSWA 2FYYA 5F7MC 3B9AA 1L0QA 4OZGA 3A67L 4MXQD 1GGYA 2NTFB 3HC3H 2ARJQ 2GAZB 5IHUH 4P4RA 2BOCB 3D85A 4N68A 3MCLH 3Q5TA 1YECH 1AGEB 4RMRA 1CFQA 1HHKB 4ACPA 1YEIL 1RIUH 2V2TB 1TJHH 4J4PC 5HGGS 4TVPL 4EEEA 1OP9A 2R4RL 1A8JH 4Y5YA 4JPVL 3QXDA 1HZHH 2CKBB 1UADC 3KXFA 4Y4FA 3WFBL 5JPNA 3C6LB 1JNNL 3B3IA 4G6KH 2FO1A 3QDMA 1NC2D 4ZSOB 4H8WC 1NMAL 1V8HA 2DOCA 3SDXA 2VMFA 1LK3L 2YA1A 1O5DT 1EAPA 3KPPA 4CL7A 3N50A 3GM8A 5FOBA 4PJ5B 5C0RL 4G9FB 1YA5A 2V2WB 3HLAA 4JREC 1CL7L 4WHTA 3RWIA 3QUKA 2VLKD 1OPGL 3PQYE 3U6RB 1P84K 2C5DC 4LNRB 3QCUL 3CH8A 2FL5B 4YO0B 1UM4L 2MHAB 2AJVH 3MRDB 2QSCH 4HKZB 4OF6A 4RQQB 3IXTA 5ANMB 1A3LL 5H94B 5DQJA 4HXAL 1BBDH 1D5IL 1ETZB 3VU2A 4NQUA 4U1GC 1XZ0A 1XF3A 1KIRA 4OJFL 2RCSL 3O3UN 5TDOB 4HIJA 4HW6A 5KVFH 1IGJA 4KKNA 3SKMB 3MLZH 1JZ3A 1QSEB 4WGWB 4WI5A 1PZUB 2DIAA 2LAAA 4JFHE 5DD0L 2A2QT 2EDDA 1AGBB 1NLDH 1YDPB 1A7QH 1QA9B 4JY6A 1HHIB 3KXFD 4GG6B 4UIKL 3EYFB 3VFWA 3VFPA 5FECA 4PJFA 1A9EA 4JFZL 5E6YA 5MEQA 5MENB 2LTQB 3OG6B 4QCIB 5T5FL 5DMIL 4HS6A 3DIFA 1KCUH 4YXKL 1G9NL 2E7HA 2DQGL 3OBAA 3ALXA 1DR9A 1PZ5B 3EGSB 1IC4L 3QH3A 2BNRE 1CD0A 2VQTA 5D70L 1MCHA 3UYRL 4P5TC 2AQ2A 4FABL 1TNMA 4WY7L 3GHEL 4QOKA 1KFAH 5D9SB 1R5IA 2HKFL 3DETC 1Y6NR 2Z9TA 3V4UL 3S98A 1QPPA 3G5XA 3UTSE 2UZIL 1VDGA 5JIIA 1XF2A 2GKIA 1KPVB 5CZVL 2AJUL 4M8QA 1GIGL 3U1SH 3QUXD 1AHWC 3OX8A 1VCAA 1FNSH 2P44B 1OT2A 1BJ8A 2C26A 2F8VA 5I6XC 2A38A 4HULB 4GXVL 4IRSD 3CVHL 3KYMB 1HNFA 2IC2A 4NZJA 2J5LB 1G7HB 4H88L 2BDNL 3REVA 2DYPB 3D6GA 1ORQB 4YAQA 4R90H 3DOSA 2DQDL 5J9PA 4M7KH 4UZGA 2ZCKL 5CJQH 5D8JH 3EDKA 4PJBE 1KIQA 1MRCH 3NZHL 5E1AA 4YHIB 3SHSA 1P6FA 5J1AB 4MJ6A 5TPWH 5ACMA 2CR3A 4Q9BA 2AV1B 1BFVH 1ZT7A 4CU6A 2NYYC 5T1DH 4JPIA 3TBTA 4YHML 3H9SE 4M03A 1HKLL 4M7LT 3C8KB 1JGDB 3BKCL 3W39B 4MX7A 5EO1A 4NQVB 5E94B 4D0DB 3VGDA 3DTXB 1FBIH 4P3WA 4Z7QF 1QSZA 1OAXL 2BSED 4N0YL 1MFCL 1OTTC 3N85L 1FPTH 3WHXA 1LQSR 3L7EA 3QO1A 3T65B 3QZWG 2EEDA 3BN9C 3NA9H 3KPRD 3O3DA 2GJ6B 3B3IB 4GLRH 5DVOA 1JFQL 3QDMB 2JB6B 5E0QA 2NNAA 4YBQC 4OZGB 1H3WM 4OGAC 1QFWM 3WBDA 1QO3A 4KUCD 1VACB 4G8GE 4XC1L 5BZWA 4BZ1L 3OJMB 3KPNB 1H3UA 3DUSA 2JELL 1WAAE 1MFEH 3WIFA 3QHFL 3GUTA 4Z18A 2DDQH 1N7ML 4JGJA 5IR1A 1FFNA 2DLEA 1DQQA 5IMLA 1T1YB 3C60B 2X9WA 5F1OB 1J1PH 1M71B 1W72A 4XH2A 4NO0A 1MRFH 2MTPA 3O6LH 4KK8C 3O4LD 3OR7A 3SDAB 2F53A 1ZHLB 2GJ6D 3PHQB 4KVCH 4KK5C 5F9DC 1N0LA 3IFLL 4I3RL 4RAVB 5IB4A 1MJ8L 1I9JL 2YXFA 4XP9L 4PD4K 3CNKA 3I6GB 5DJDB 3STLB 5J7CC 5F89B 4UBDD 3R8BB 1QOKA 4XPFH 1NMCC 3EO0A 1B0GA 4XXDB 5HI3D 3QI9C 4MB3A 5BS0E 1RIVH 4YO0A 3SKNB 2D9CA 3QDHA 1PKOA 2F58L 4KC3B 2WMPA 5BRZE 4NQEB 3HNTH 4Y4HB 4K9EL 5A3ID 4HK3J 1MLCB 3L3OA 1U36A 4NUGH 3TNMB 4NNYA 5I19L 3I6KB 3RU8L 2CRIA 3S5LG 4V1DB 3R1GH 4JFPB 1JV5B 4NQXB 1KLGA 4ZMAT 5A16A 5B8CA 2ZCKH 2B7DT 4KI5C 2IAMB 5HHNA 4D9QE 1HYSD 2COQA 2OTUA 3AMLA 3SY0B 3QIBC 5DUBA 3BHBA 3BKYL 1GH7A 1OP3H 4BH8B 4N0UA 4S1SL 5C71A 1CE6B 1WIOA 4HH9B 1BZ7B 1D5BA 4LSTH 1WLHA 4PJHA 5F3BB 4GS7C 2V6HA 4I13B 4WFEE 1FYTB 2XG4A 3FTGA 1AY1L 5C0CE 5KZCD 3O2DH 3V4VL 4FG6C 1FO0L 1X44A 5INCA 4YBHA 2DTML 4EXPX 3HZYA 4L4VE 1RURL 3FQRA 1MWAL 2VAJA 4G43B 1UWXK 1IGJB 1RVFL 1IGTA 1S3KH 4DN4H 4ZUVA 1NAKL 4NNPL 1FGVL 1IEAB 4CU7A 4WIQA 3OB8A 1FH5L 5AD0B 5L8KB 4MD4B 4QY8A 5BVPL 3L5WA 3PWPD 4PJ7F 2YWZA 1F02I 4XAKE 2NMSA 4K7FA 4MJIA 1V05A 1RZ7L 3QIBB 4MLIA 2HT3C 5E1HB 3O41A 3OL2A 4L9LB 1G84A 1UCBL 1MH5A 3RPKA 1ULVA 4U1MA 1CT8B 4EUPA 4X6DB 4XRCA 2IANB 5CMAA 4P2RA 2V5TA 3G5VB 3JV4A 4JFYB 2R4SH 4LU5H 1T0NA 2R56H 4UUJA 4LRNL 4OTXL 5EUOF 3QG7L 4HV8A 1JWSA 1XGPB 4XAWL 2ED9A 4PJ9A 1C1EH 1NMBH 2EDFA 1AKJD 2IADA 4PUBH 2X5PA 4CVZA 2QHRL 2N4IA 2RCSH 5FYLH 1BREA 2DQFA 4PJ5D 3PWPB 2P42B 4RIRB 3UC0L 3BDYL 5C92A 5SWSA 1UZ8A 3SQBA 1L7TL 3SDDC 3IFNH 2AJXH 3V0WL 4YAQB 3WJJA 1ETZA 4X6CA 3MZTA 2AV7A 3EFFB 5DJAB 4IRZL 2UVFA 3C9NB 4DGYH 4PJEB 5JIKA 4EN3B 5IEHB 4PY8I 3JVGA 2IBZY 4A2LA 4X4ME 2EZ0D 4P4KD 2YD7A 4ZTOL 3CFKA 4ELMB 1CD9B 5FGBA 1IL1B 4P49A 4RBPH 2P5ED 1NLBH 1T2QL 2EE9A 4QRUB 1FYTD 3FO0H 4JY6B 5DO2C 1N0XH 4UDUB 3LKRA 5DR5L 4ZYKA 1TENA 2C4FT 4M7LL 3SDYH 3ZE1E 4YUEH 2DQEL 2PNDA 1X7QB 1MLCA 3L3OB 5J1TC 1B3JA 4UNTA 4I0KA 1EVUA 3KS0J 5HYJB 4F2MA 3DUUA 4R97B 5J6GB 3MLTB 5FEBA 3EAKA 5B3NA 4KJWD 4JM4H 4NGHL 1OW0A 1DANU 3IETA 1IJ9A 4L9LC 4NKIL 1UXWB 4P2QA 4KTYA 1HHHA 3B9KA 3NACH 5IF0B 3QUXA 4YIQA 5I1IL 4QOKB 3L9RB 3B2VH 4M7ZB 5J6HA 3ULUE 2NY0C 3MRHB 4NQED 4PJDB 1HK6A 1E0OB 4NO0B 1CTOA 2MJWA 4YFLF 1NCBL 1G0DA 3CPLB 3HE7C 4OUOA 3WDIA 2X41A 4GAJL 1BQLL 1KB9K 3JV0A 2P8PB 1MY5A 5C2BH 2VDLL 3FJTA 3QDJA 3TZVD 1UYWL 3REVB 1SBBA 1IGTB 2C7UA 4ZUVB 2OI9B 3H3KA 3K2MC 4LCWA 1NFDF 1ADQL 1T7YA 4OZGE 1DBKH 4NRXB 1L0YA 5EU4B 1AQDA 1S7XB 2GSIB 2F8XC 3L5WB 1QR1B 4MNQA 3ARPA 3N1PC 3QYCA 2X4NA 3BAEL 4P46C 3ULVL 3C5SB 1AGDB 4YH6A 1X4XA 2AEWA 3GO1L 3REWB 3SE3C 1I8MB 1YNTB 4MXWH 4LDEB 2AJSL 4JKWA 4KHXH 1RZ7H 35C8L 5GXBB 4NP4L 1NCCL 3GBNH 1VEOA 3U2SA 1MH5B 2HFGH 2JJTA 4Z78A 3TZVB 3O3DB 4OZFH 1MFNA 4GKSA 4YC2C 5ITBL 4ELKA 5IB3B 1Y6KR 4E9LA 4E41B 4BFIA 3FQNB 5HJ3A 2R2HB 1RUMH 1IGCH 4U0RC 4P2RE 2PF6A 4YEEA 3FTGB 1BVLA 4H1LG 1CDYA 1OLZA 4CMHB 1UEYA 4M93C 3MJ8B 3MRRB 3UBXB 2DQEH 5LBSL 5FYLL 5C0BD 4OGXH 2DQHH 3KYAA 3MNWA 1I85A 2AJZA 4GH7B 4M6NH 2PCPB 1E4XI 3KLHD 4G43A 2NY7L 4RGND 5J12B 4TUOB 3E3QE 4Z7OE 5J06A 1DUYA 5CMAB 1Y6MR 2DKMA 4U6YB 1AD0B 2WW8A 4M5YH 4G3YH 4IBLT 4WW2C 1OP5K 3UJTL 3ULVD 2HJKB 1P1ZB 5B22A 5EWIL 3H7LA 4LKXA 1GYAA 1NAMB 4X6EA 1AJ7H 4JO3H 3GRWH 1QLFB 1CXLA 4LPYA 4LQFH 2FZ3B 2K9UA 3SGJA 1AD9B 3KPRE 4ALAH 2X9YA 1DBJL 5TFSH 3UTTD 3BD5A 1X5ZA 1J05A 4LPTA 3WN5B 5IHZA 1Z3GH 5D7JC 3EO9H 1T7XA 4U1MB 4OLUL 4LCUA 3SDCD 3TCLA 2EYSA 2CKNA 3MLZL 3GM0A 3PJSB 3AS1A 1ZA3B 2UUDH 1P53A 3EUUA 4LSUH 3VXUD 3JTSB 1KN2L 3UTZB 2E6JA 1CQKA 4K3EH 4L5FL 5IF0A 4YIQB 1U8HA 3GFUA 1VSCA 1ZLUK 5C1MB 1KB5H 5HI5C 2FHBA 2VDPH 5SWZA 1J0HA 2NY5L 4IS6A 2NY2C 1F6AB 1S5HA 2OXGA 3SQOH 3HRZA 5GISL 4QXGH 1TLKA 4EDWH 1GGTA 4ZFGL 3MRBA 3IB4A 3KXFB 4MLSA 2VDNL 2BZDA 3DUUB 3CPLA 4UV7H 1TIUA 1TJIH 5J6GA 2X4QB 5KJRH 3GSXB 1CICA 4F9LA 5C2BL 1T0MB 3MRJB 4RGMC 3QIUD 3HZYB 4QRRA 1ZGLM 2WIIB 5FOBB 4QHKI 5CJOL 4NN7B 2C7UB 4GRWE 5MHSD 2EXYD 2IG2L 2FJHA 3CFKB 3GGWA 4YR6B 5C0CA 3ZO0A 4GS7B 3CVHB 3HAEA 1QBAA 4WNQB 5LKNA 4DKEL 2IH3A 1G7LA 1YEEL 1UZ6F 1X5LA 5DQJB 1T3FA 3LRSA 2NLJB 5LBSH 4XPAH 5SX4I 4GXVH 4QRPE 4PBVC 4X7DC 1R0AL 4XP5H 4F58H 2PKDA 5TQ0L 5FIEA 1GZQB 4OTXH 1T89A 4LASL 3WLBA 3TFKD 1XR8A 3CXDL 2Y06H 3CU7A 1E6JH 3K81A 2XN9D 2D0HA 1YY9D 3IETB 2OQJB 3MO1A 1NC2B 4KTEL 4GAGL 4FFVD 4G6JL 4BQCA 4ETQB 1WF5A 2GSIA 5D6DA 3MXVH 4JDZB 2AK1H 4G6KL 5HD8C 2OL3A 1T0NB 2UVEA 5F7EH 3RWFA 5DSCA 2YBRB 4WW2F 4X9FA 2VZ1A 3ARYA 4X98B 2ZG1A 5DK2A 5TGBB 3I9GH 5ITFB 3WXVL 5CLWA 5FYKD 1N4XH 3HE7A 3REWA 1I8MA 3CAFA 2LVCA 4MAYC 4JVUA 3VXMD 3KHOA 2X44D 3NCJL 2Y72A 3T2QA 4U1HA 5CEZL 3VCLA 1U91A 4HLJA 3STBA 4U1JB 4A2MA 2PCPA 5FGSA 4NSKA 1YECL 1UM4H 4Z7WF 3V5KA 2G2RA 2CMRL 4DGVL 1UG9A 3W0WA 1ZLWH 4OAWB 2VC2L 1EEUA 4HAGA 4KUCF 3MLYL 3QIWB 2BJML 4Z7UE 3TV3H 1WCBB 3MJ9L 5SX5H 5KVGL 3NOIA 3KPOB 3R0NA 2CR6A 5CHNB 4NBXB 4DN3L 4ELMA 1XMWA 1OF2B 3GRWL 3EOBB 4YDIL 3D1MC 1AGDA 5JOFB 4ZUUB 1M05B 4FQXD 1YYLL 4JM2D 2AJZB 4EUPH 1RZIA 4N8VG 5BVJB 1DDHB 5FV1L 5DC9B 3BQUD 5CBEA 2HFFB 5IESL 1CGWA 1T1WA 4UQ3B 2APTA 3WJLA 2BVOB 2ATKA 2AVGA 2NY0B 5KW9H 4LCUB 5J1AA 3F12A 4GQPH 3ETBF 1RIHH 2NY2B 4FFZL 3IS0X 5HVWA 3L5JA 5FYKL 3SDXB 2ESVE 1U92B 3SDAD 3WNMA 1JF5A 1AI1H 1SMOA 3O4LB 2C3WA 3BXNA 4UAOB 3MLPA 4JKPH 2W9LA 1QLFA 3BYTA 1JUFA 3GSNH 3HRPA 1BQLH 3HC4H 3NIDE 3P9MA 3PGDB 4P5TA 5IBUG 3O3EB 1E4KC 4K9EH 2EC9U 4LNRA 4ISVB 3VXUE 5L88H 5KANG 2HA1A 5BV7B 5F44A 3HRZB 4WWKC 1J1OH 1QUNA 3MRBB 1WBXA 1KPUA 2GJ6A 2X10A 3UJIH 4OI9A 1QBLH 3T4YB 4P2RD 1MIML 3SEPA 4Y2DA 4U6YA 5BXFA 2HP4A 1CCZA 3FKUS 1T0MA 3MRJA 4AK1A 1MJ8H 1K8IA 2DTSA 4GAGH 4RNRA 1ZT1A 2X70A 3NPZB 2QKIB 4R4ND 2H2PC 3QDGD 5F96H 5B21A 4P99A 4UOJA 4OF8A 3EOAA 4E41E 1DN0A 2IH3B 2J4WL 3VFOA 5CEXB 4GG6A 2DQJH 3UTSD 1INDH 4UT6H 1J05B 4OCXH 1G6RB 3LV3A 2JCCB 3C6SB 1N6UA 4GMSH 3FN0H 3MYJB 2FEDD 1ZHLA 3JWDL 1KCSH 3PHQA 1KEGL 4I3GA 4PJDF 5D2LF 3VFVB 1LWRA 4HH8A 4HIJB 2E7BA 1PZ5A 2KKQA 3IF1B 3WHE1 1ZA3A 2CJUL 2VNCA 3LPWA 1B0GB 5HBBA 2OQJA 2HLFD 4WO4B 4ESKA 4C58B 4OIAA 2IBGA 4QRTA 1KELH 5IB5A 1EVTC 1R5IB 1NGXB 1ZT4A 5FHAL 3DLQR 3RL1A 5HJ3B 5DSCB 1N5AB 3BP5A 4NPYB 3K46A 4HUUA 4D9RD 1RJCA 1TTGA 4MDJA 2Z92A 4Z7WA 5L2KA 1BBDL 1BVLB 1I1AB 1JVKA 4F3FB 4E5XB 2ORBH 3JBG7 3MRLB 5JIHA 3U0TA 4X9HA 1DEEA 2VIRB 3VCLB 4ZXBB 3PV6B 4YXLL 5DK0B 1U8PA 3MO1B 1UKTA 2DIJA 3MRIA 2IPUG 2CUHA 4L8DB 3O6MH 1NAKH 1J1PL 2VC2H 3AM8C 1AE6H 1INEH 1DFBL 4O51B 4UT7L 5HHMB 1EZVY 4R4FH 2YBRA 2CLRB 4Z77A 4HIIA 5DRNA 4ONFL 5BRZD 3ZDYE 3HCVB 4X6EB 2NLJA 4RX4D 4TULH 4OKVA 2VSDA 3D39E 2Z31D 5E8OA 5C0AD 4U2YA 2ITCB 5FF6A 2IMNA 2QQNL 5L0QC 2FBJL 3VXRD 5I66B 3TO4D 3GB7A 1F4YL 4Q0XL 3VDCA 2F58H 1JMXA 1QR4A 4LCWD 2FWOB 4L5FH 2VLRE 3UP1A 43CAB 3WNNA 2BVOA 4JO4L 1BQHB 2DLIA 1FZJB 4R7NB 2QADD 3RVWD 2HYMA 1A47A 3O6FB 2BNRB 3E2HC 3DURB 3P4OB 1ZWIA 1VB9A 1TQBB 1UB5A 5EZJA 2NXYD 5HY9A 4JDZA 2UZIH 5BO1H 1MHEA 1WZKA 3HG1E 3PABA 3DXAB 3GNML 2WWMD 3GSRA 3QIWC 2FECI 4PJ7A 1AXSA 1XAUA 3PWNA 3HB3D 1T5WA 3C8DA 3QIBA 3GSVA 3NFPB 3SOBH 1Q0XH 5ICXA 3O41B 3OAZK 2VLKB 2HFFA 5C70A 4ZUWA 5MP6H 3W11C 3ILQC 2G2RB 1J12A 1NBVL 2VLMD 4QHNB 4QO1A 3HN3A 2FR4A 3G5VA 3K0WA 1F2QA 5I2IB 4OCWH 2KPNA 2ICWB 2NR6D 2X4PB 2NX5E 1FL6A 5CSGA 4JAMB 5F1IA 1NC4A 2OMNA 4OLXL 3HI5L 2OR7A 1I1FA 1QPXA 4L3AA 3WFBH 5I73C 2QQLH 5DD5H 4WI2A 5EU7E 5C0AB 3RZCD 2DQFB 1PKQE 3QO0A 3BP4B 1LE5B 1DUZB 4N0RA 4PJIF 1OOAA 5IMLB 3GI8H 3EZJB 5BVJA 4P9HH 1NCBH 1G6RA 5DJCB 4OCXL 1W8OA 5DYOA 4GT7A 1FIGH 4LAJH 4U33A 4X6CB 2DQUH 1CL7H 5CIPB 1PG7L 3MRFA 2ZSVB 2CIKA 5C07E 2X7LA 1AO7A 3HUJB 4JHWH 5FGRA 1A4KA 3IAPA 4GKNA 4OCSH 2O5ZH 4K94H 2D03H 4POZC 5FKAA 3VXQB 4H1LB 1A7OL 2VLRB 2AGJH 3E2HB 1YNLL 1RIUL 3LKPA 2F54D 3C08L 4WO4A 1DBKL 3BD4A 1WICA 3WFDH 2J8UF 3JWOC 1LO2H 1A6WH 4LARL 3FQUB 3UZEA 4ZO7A 2YD9A 4FZ8L 4WFFD 2D3VA 3BPLB 4JY5L 5DQDL 4NPYA 5B39B 1QFUH 1NKRA 3VA6A 1KJ3L 4NQDB 4UOW1 5F3BA 3TNMA 1MCEA 2VYRE 2KQNA 1FBIL 4E5XA 1FFOB 1U8KB 3K3QA 4GW5B 2JIXA 2ADFH 3O6KH 1NBZA 3H3BC 2DM4A 1OCWL 4GUPB 1KNOB 3MV8E 2VXQH 3SKOB 2OTUB 4KDVA 3OAYH 3BE1H 4Y8AA 4XVJL 3RWHA 4F7EA 3GMQA 3MX0A 1CR9H 3P3YA 1CU4L 4ZPVB 3S36L 5DQ9A 1AIFA 3GJFH 5CJXC 5ESQA 2R29L 4POUB 3T0ED 1I1YA 4B7IA 2L0DA 3NIGE 4M43H 5LCVL 5A2JH 1K6QL 3BGFC 4GBXC 1TCMA 1A7PL 5A1AA 4BSJA 5FYJL 1NBVH 3FN3A 4YWGH 3UZQA 4NZDA 4HWNA 4L8DA 5ADPL 5GJTL 2HLAB 2R1WA 4S1RH 5CINL 1CT8A 3TLRA 1D7FA 1U95A 4PRBB 4QRTB 4PP2A 1JHLL 4N5UA 3BZ4A 4Q9CA 2YD8A 1UB5B 5BS0B 1WSST 4JQXC 1NFDA 1VEPA 2XKNB 1IGIH 1HCFX 4PGEA 1OD7A 4LQFL 4HV8B 5BRZB 4NQEE 4JE4B 2Y1VA 3DMMB 1U8JB 3BYYA 4ODXB 5FHBL 2Z92B 1AXSB 1B2WL 3W2DL 5SWZD 2CK0L 2P7TA 1R3JA 4OZFB 5F97E 1PYWA 1HQRA 4FFWD 5F1SA 4KAQL 2DTMH 5IK3A 5TJWK 4FN0A 2J3SA 5DHYA 2HKFH 1WBXB 3VFTA 3OZ9L 4OSUH 3S7GA 3C09B 3ZKMD 4CW1B 4DWHA 4OUUB 2YMXH 5GS0D 4OI7A 1VERA 3KHQA 4LLMA 2ICCA 2J6EH 5C0GA 3VH8A 1BBJA 1XF4A 1A7NL 4P3DB 4PJCA 3MRNB 5GSVA 1XIWB 4J6RH 3TIEA 3JWDH 3BIAX 1JYNA 1BGXH 4DK3A 1XEDA 1JZ5A 4X4YA 2ARJA 2VDQL 4XNUH 5FUOL 5T3XD 4NQDD 4OBSA 3D69B 4TVPD 2R39A 3PWPA 1MCOL 3QPXL 5JDSB 5HHQA 4AEIH 4F9PC 32C2A 1TVBB 5CEXA 5C9JA 3HMXH 4DEPC 4HJ0C 3LEXA 4XC1H 5E99H 4G8GA 4P46A 3KJ6L 3S34H 3CK0H 3PNWA 3DRQB 1EDQA 4NO2B 3B43A 2FR4B 3O6KL 3V5DA 4Q7DA 2FWOA 5H35A 4Y4KD 4NQSA 2XN9E 2DDQL 5D1QC 1I9RL 3IGAA 2CXGA 2OR9H 1QBML 1J8KA 2CLZA 4NC2B 3C5ZB 2Q8AH 5I8CB 1TVDA 1DLFH 4X6BA 5A40E 1AGFB 5LJYH 1H3VA 1TJGL 2GW5A 3FQUA 1RU9L 4MNHB 1J8HE 4I77H 1UT9A 4HCRH 3BEWA 4KROC 1DQLL 4JR9H 2GYSA 4NN6B 2Q8AL 4HD9A 4LQ1A 3ELAT 3RKDD 1MCJA 1AO7D 1QG3A 3AAZB 5IGXL 4GKNB 1BOYA 3ULVF 5FUCC 3ZT7A 2Z8WC 4H1LA 4Y5XA 4Y16A 2W1NA 4NNXB 25C8H 3PV6A 1PLGH 3L6FA 3ABZA 3KYKH 4MSWB 4NKOB 4Y19A 5DK0A 2XPGA 1K4CA 3LHPL 3PGFH 3FQXB 1DEDA 4KKBC 4JY4B 5CGYD 5C0BA 4HPOH 4PRPD 3S37L 3IDUA 5CD5D 4ORGA 3QAZB 4HX1B 3L9RA 4DGIL 1G6RH 4YXHH 5ICYB 1GPOL 4W6WB 5BQ7B 4OZ4A 1U3HC 2HTLD 2R1YB 4N0FA 4PRIB 5CP7A 4PR5A 1RV6X 4FXGB 1IM3B 4OCRH 4XCCL 4JO1H 4HS8H 2P46B 3F5WA 3PL6D 2GITA 1X5KA 3T8XB 3ZKND 4DFHA 4JPWL 3IDXH 3O6FD 2AQ1A 1FSKC 3NVQA 1BMGA 1JZ4A 1FYHB 1RHHA 2XICA 3GMRA 4LCWB 4JZJC 1U95B 4PRBA 5E08L 4D0BA 4WNQA 3WFEH 1GGBH 1WWWX 1MUJA 5DHVB 5ETUB 4ERSH 1G7IA 3UXFA 3MRQB 4KPHL 4O5LL 5ICZB 1JIBA 5B39A 4PJFB 1Z2KA 3VMNA 4HFWA 1YEHH 3C09C 4Z76A 1MHPL 4KDTC 4XP6L 3FHQA 1C08B 3L3GB 3JXAA 4HLZG 1HQRB 3ARDA 1MI5B 5EU7C 2EC8A 3WD5H 4FXLA 2JIXB 3QH3B 4MS8D 3MNWB 4LF3A 1GAFH 4ZUWB 1I7TB 5F8QC 4X7EC 3OHXA 3RVUC 1JGEA 4AMKL 3TCXA 3AREC 2XWTA 1CTNA 2O5XL 3BZ4B 1AXTH 5CUSH 2DI8A 5DD0H 3VH8B 4UV7L 1NDMB 3UBXI 3O8XD 4NWUH 4EI5A 3MRNA 3FB5B 4HBCL 5C0NC 3UAJC 5MEOB 5DK2B 2MKLC 3DMMA 1C5CL 3EJZC 1IBGL 5HPMB 1OSZA 3OG4B 4YHZH 2OYPA 4QHMB 4JFZH 4A6YH 3FHAA 3GSOB 1RAMA 4K3DH 4HCRL 1CVSC 2QEJA 4UTAL 3HTLX 3KLAA 3WUWA 2IPKB 3ALPA 1YYLH 5JDSA 5HHQB 2VAAA 5IV2B 1MJ7L 2DQGH 3QNXB 4P4KA 1U8QB 2ADIB 5GZOD 1KYOK 1S9XA 5DS8A 4DUXA 4JFFE 3ARZA 5M95B 4NHCH 4WO4D 4EKXA 4YHPB 2PXYB 4HXBL 5JW3H 3IGAB 1WCBA 3RX8A 2AXHA 3NTCL 5GSVB 3RGHA 2X4RB 1ZOXA 3M1BA 4BQ6A 2ZCLL 4PG2C 1GC1L 5DRWA 1CFNB 1YPZB 3BMWA 3V6FB 4FFYL 5DJ6B 1RULL 1WC7A 4EQ2A 5C6TL 2ADFL 3BMVA 5F21B 3UTSB 1R3IL 5AEAA 2J5LC 5C07A 3HNSH 1I7UA 2IAMC 2APXA 4CVUA 3MUJA 4PJGA 3DGGB 4FQQA 5HHXL 3F6IA 3OMZA 4JQIH 3NFSH 1P9MC 3DVGA 4U6HB 2Z35A 2JJUA 4MAYA 5CEYA 2VZ3A 2MKWA 1S9WA 1MCCA 2CIIB 5D2LA 5C08B 3K74B 3I9GL 3V79C 3GSXA 4XNMB 4NNXA 3ARDC 1J0ZA 1F58L 4NKOA 3PWVA 1A9BA 3TN0A 2A9NL 1DCLA 4G7VH 5AAMA 2D9QB 3QQ4A 2Z31B 1FZKB 4TQEH 5J11B 3L1OL 5F6IB 4I18A 1JYXA 3BEWB 5BQ7A 5C6PB 5D7LB 3VI3E 1FHGA 1R24B 4AM0B 2HH0H 2XA8H 4UV4H 4PRPE 1AFVL 1T3FB 3V5HA 1J0IA 4K8RC 3D9AL 2OCFD 3SDXF 4OFYA 1N2RB 4HWZB 1OAQH 4L8SA 4MQ7A 5EC1B 1GZQA 4HPYH 4FQHB 5GS1B 3K1KC 2FJFA 3U48A 4H26A 4TSCH 3TJEL 3WSQL 4XNYL 1DLHA 2E3VA 2LABA 3HE6D 5I8OH 1H5BA 2XV6B 3SJVD 3EOTL 3RL2B 3BQUB 2I07A 5I0DA 3KPMB 1GGBL 4XNXL 1RJZA 2VTFA 3MOAL 1XGRA 5J57B 2OL3B 4PGEB 2NW3B 3QEQE 4KUZH 4QXUL 4E42A 3C5JA 4AG4L 1JYVA 5C09B 1Q94B 2P7TB 4V1DA 5F7DA 2R8SH 5F6HI 3WLBB 2ADGA 2A77H 4L3CA 4XPGH 1LP9E 4LF3B 4PB0H 3MRKA 1MVFA 2IPTL 1CGYA 1M7IB 3OKNB 4NM4H 3ARBB 2Y6SC 1CG9A 3T08A 3VXPB 3CFCH 4KJQC 3RGVC 2R0LH 5E24E 4IRSA 4BH8A 4X9IA 1VESA 3RL1B 3L7FA 1G7JA 2OSLB 4HUUB 1F4WL 3QEGL 2I27N 5MEOA 1NEUA 1SYVA 2P49B 4C57C 4XP1L 4X5LA 1F13A 3KGRA 5C0EB 1HXMB 1U8LA 2DF3A 4NN5B 3BEVB 1MCQA 2ATPA 4P48A 1CF8H 2VN4A 2RGSA 1K5NA 1PG7W 3IDGA 3RUGA 1YUHB 1T80A 2X89D 3PQYB 4NIKB 2VIRA 4NN6C 4XVUD 2GSGA 4WUKH 1S7VA 1OWWA 1JGUL 3FRPG 5D72H 3O81A 5CBEB 5KSUA 1F4AA 3NCYS 4OGYH 1RFDL 4FQJH 5I18L 5LGJA 2BRQA 4URTB 1KYOJ 1P2CB 3N1QC 4F7TA 5B4MC 2A6KB 3HZMB 5AD0A 4HUVB 5HYFA 5IHUL 1T1ZA 4GRMA 3C5ZA 3L1OH 2ED7A 1FAKT 1G7IB 3OPZH 4AEHL 4RBPK 2VUOA 4PJAE 2X1QA 3DO3A 3FOMB 2Z93A 3K7UA 5GRXG 4ODTL 3KLAB 3WE6A 4U05A 1S7WB 4KK6C 1JE6A 4MJIB 3QDGE 4RDQG 1WWAX 2XTJC 4FQQB 5GGQL 5HGHB 1QFWL 3S8WA 4F7CA 2NY3C 2CGRL 1F11A 4NYLA 3ULUH 5T3ZE 2FDBP 3D2UD 4H20H 1W2KT 3KS0H 3G9VA 3H9HB 2ZNXA 3VGFA 3AAZA 1JNLL 3MV8D 1A5FH 4JEGB 1AC0A 4ODUA 4PLKD 4JRYD 3F58L 4YHLL 4OCWL 5E56A 5KVMC 3CMOL 3P2TA 4D8PB 5BOPA 4RNRB 3V6OE 2X89A 5AZEH 2X4SA 5INDA 3D25A 3PWLB 4TQEL 5IG7B 4JY4A 2XZZA 3AY4C 3RBSA 3ULUL 3VWJC 4Z0XB 3EYQC 2R9HD 3RIFF 2WAHA 3LEVL 3ZKQD 1L7IL 1OT1A 1GHFH 5B8CC 2E9WA 2BVUA 4EZMA 1FN4B 4XVTH 4X6DE 5SWSB 4RAUB 1KBGL 5IV2A 3CCHB 4K7PL 1U8QA 2YPLA 4IM8A 3G6DH 3HAEH 3G9AB 4GW1B 1MCWW 2VLJB 4H5SA 4Q9RH 5IEHA 3NFNB 3OGCA 2A0LD 1J8HA 5D4QA 1WEJL 1J1XH 1SEQH 1LK3H 2I25N 5DMYA 3V0VB 3M17B 4XVTL 2VKWA 1GGIL 4OZHA 4FQLH 4D9LH 4IHOA 1MCLA 1KCVL 2GI7A 1P4LA 5I8OL 4FTVA 1SM3H 4P4RB 4PYHA 1G9EA 5IB5B 4DKFH 2VDOH 4HWBH 1J87A 1I3GL 4YHOH 1LILA 1YPZF 1MF2L 6FABL 1VKXB 2UY7A 4MDJB 3DVGB 4OBRA 1U2HA 3EHBC 5FM5O 2BP3A 3BDBA 4YWGL 4UT7H 3X13B 4R26L 1MHCA 3EDDA 4I3SH 4RFNC 4M3JA 5JHDD 2P48B 1SJEB 4U1KB 1LGVA 1NQBA 5T3ZL 1OTSD 1QQDB 1ONQA 3ARVA 1IAIH 4K3DL 3MRIB 4X4ZA 4ZFGH 3T77B 1RUPH 4HWEH 4Y0GA 1MSPA 1XGRB 1G0XA 3X3GL 1BLNB 1CU4H 1K2DA 1QSVA 1A7RH 4QRQA 1MNUH 1AKJB 4U0QB 1MAML 4MA1C 4W68A 5J6HB 3RNKB 4KVCL 2V9TA 3MLUH 4Q9QH 3GK8H 5HI4D 5DLML 1E4WH 3QQNA 2APBA 1IAIL 4EDXA 4LSDA 1K5NB 3IDGB 2IALB 3PIQA 4G6ML 4LIQE 2ADGB 1EERB 5IFJA 2ITCA 1SJVA 3KPSE 5DVLA 4KK9D 4XB7A 1A6PA 2XN9A 3QUML 3WN5C 4WU5A 2BHZA 1WTLA 4LMQE 1MRCL 3NZHH 1TXKA 2F74A 4R7NA 4D0CB 1HEZA 4R0LB 5I1IH 5DVKA 5ESQB 1U6AL 3QRGH 3NPSB 2JJSA 5DWUH 1F4XL 1NMCB 3DYOA 1MHEB 2EIBA 2ATPB 4KHTH 1WAAA 4NNPH 4IIQC 4R3SA 1E6JL 1MCNA 5E6ID 4LVOB 2NY1C 5FF6B 5FYJE 1NPUA 2F19H 3A67H 4O9HH 2F54A 3QCVH 2KUTA 4YDJB 5EU3B 3FT2B 4NBYB 4S1SH 4PLOB 1KCSL 2K7PA 2ILLA 3QHTC 1JGLH 4G6AD 4H0GA 4U6HA 4OD1H 1I9RH 4P5KA 3QIUA 3VXOB 4UMGA 1UJ3A 5J3HD 4ODUB 4M48L 3TNNA 3OKLB 1T1ZB 2I5YH 1RZKC 4PJ9C 2Q87A 3SO3B 1CGVA 4HUWA 1SM3L 3TYFB 3NN8A 1U93A 3V9FA 3PABB 4IEFB 3U46B 3WYRA 1R3JB 4GRWH 3QUYC 3E6FA 2FO4A 4X99A 3RUGB 5LWYL 5J0BA 2E9IA 2ZPKL 3OX8B 1VGKB 1WWCA 2FBJH 5D7LA 2GSGB 4MNGE 3O3AB 2PYFB 4UT9H 3VFTB 5E5UB 12E8H 1LO3H 5FYJD 5HDLA 5EULV 1CK0H 3ULUD 4LVHC 2DBJA 1FLTX 3MRFB 2CIKB 1TQCB 3HE6A 4F7TB 3FO2A 1CLZH 5EC1A 4LGRB 4I0PD 2W0LA 4K55A 1BQHG 1CXHA 2YA0A 3CDYA 5BO1L 2NZ9C 5D6CB 3ZDZE 1ED3B 5DJXB 5C3LD 1RSFA 1HHGA 1FN4A 4O02L 4HJJL 3TA3B 2A74A 4RGMB 1BFSA 3U36A 4LNVA 2UYLB 4LCYA 5AZ2H 1QP1A 4QT5B 1YEFL 3MV9D 4LEXH 5IHZB 3TH3T 2VZUA 1UM6L 1ACZA 1Z0NA 3B5TA 2D7TL 3KPRA 4HQQH 1CICC 3SGJC 3NIFE 1X6LA 1LEIA 3OGCB 4PJEF 3PE9A 1WTGT 1T21A 4PUBL 3W2DH 4KQ3L 2NNAB 4KFZC 1C7TA 1KULA 5I16A 5L88L 1MFBH 4M8VA 3VXPA 3I02A 4MNHA 1U6AH 5ECJE 5GS2D 5I1KL 1PSKL 1QBLL 3L7FB 2EDRA 3WNKA 1J5OH 3S4SG 1RZFL 2IWGA 5I18H 4PGCA 3BIKA 1NBYA 1AHWB 4YE4L 4NKIH 1FO0H 4WHYG 5IBTL 5DC4B 2H9GA 2O61A 1BFVL 4JFFD 2Y5EA 1FRGH 5T5NG 3QUYA 3NAAH 2HN7B 2O5ZL 1FQ9C 1K4CB 1XCQA 2B5IC 1I9EA 1T6VN 4JZNA 2OJZL 1CE1L 1JHTB 3QPXH 3FL7A 1FL3A 2C4FU 1KN2H 1U8IA 1OP5H 1BX2B 1P7QA 2VZVA 1OAUH 4WV1C 5F9WC 1KN4H 1RMFH 1AKJA 3VRIA 5DK3A 1D5XB 1XGUA 3IDNA 3I50H 2APVA 2V5SA 1B88A 3P0VH 3VWJB 2OR9L 1IGYA 4PP1D 4PJEE 2I60H 4OV5B 3FFCD 4MGXA 4DVRL 1Q9KB 5AG9A 2F54E 4EN3C 2APFA 3ZDXE 1R5WB 3MOQA 3V4VH 4AIXA 5CBAA 5L6YH 2OJEB 3WS6A 4AIZB 4XPBH 4XBEL 3AUVA 3HFMH 4OD3L 3QEQA 2PTVA 1SJEA 4U1KA 4PJXE 2NY4C 1QRND 4NFCA 4P5KB 4MQSB 3QWOA 5FUOH 3DX8B 3QRFM 4OUUA 3IDYC 5B38B 2XKUA 1T7VA 2CDEA 2RBLA 3JWDC 4AQOA 3VD9A 1IC7L 3KYNA 2CUIA 4PGBB 1FV1B 4PJGE 4RX4A 4Z76B 5L7XL 1MCBA 3IKCB 1VFUA 3BP7B 5ITFA 3IJHB 3MLXH 3Q6FA 1HXYB 5AZ2L 2AJVL 3G6AA 3PIQB 2H2SC 2Y7QB 5AAWA 3L5XL 5D96C 1Q9LA 2PYFA 3PWJB 5IBLC 1DANT 2AEIT 5CP3A 3P9LB 3WJLC 3DV6B 5ISZA 4OF3A 5D2NE 3FQRB 1UCBH 2BK8A 1ZVYA 1D9KD 4WW2A 5DD1L 4I2XB 3D39B 1N6QH 4H5SB 1WIUA 2C3XA 3BZEB 4OCRL 5KVFL 3GBMH 4HUXA 3OGOE 3SJVE 4GXUN 3GMPA 1CR9L 2MQ0A 4V1DD 5HYSG 5I8CA 5HYQB 3DX6A 3D3VB 4GW4A 2WBWB 4X6BB 1OL0A 3EIFA 1UWEH 1TDQA 4WRLA 4MD4A 4KKLD 1P4LB 5EOQH 1XGTA 1N5YL 2HFGL 3QJHA 3TWCH 5F9JB 3IVKA 1VGKA 5JUEH 5DD1H 2P8LB 4M6ML 3D9AH 1YEFH 3LEXB 9CGTA 2H32B 5ALCH 1GZPA 3LMJL 4GBXA 4OLZH 4OQTA 1I7RA 3B2UD 1RIVL 1NFIB 5D1ZB 2F5AH 1JL8A 2CLZB 2OXHA 3GI8L 3LB6C 4S1DC 1LEGA 2FLRT 1UJ3C 4X4MA 3O2DL 3MODL 2N7BA 4LOUD 1MFBL 4NUJB 2BX5A 2F5BH 4WENB 1IMHC 4QF1A 1R6VA 4DUWA 3WDJA 4LSPL 4YDVA 1TZHB 2ICEA 1NL0L 2KDGA 3CFJA 2R0ZL 4IOFC 5C2UB 1RK1B 2IFFH 4ZXBC 1SQ2N 2D03L 4ODVL 4PJGB 1BLNA 1K2DB 4P2OD 4G9FD 1UQSA 2P24B 3KNBB 5IIEB 5MI0C 3LIZL 3DHJA 4ZO8A 4BQ8A 1UZ8B 5C0DB 3Q3GB 2P43B 3RDTC 3O2WH 5F71A 3VXUA 3CFCL 4Q2ZA 4UTAH 3S96A 4WTXA 3LSOB 4L29A 1IKNC 2AEQL 2BC4A 4EN3A 5CJQL 5D8JL 3TYGH 5KZCB 1OWRM 3IAQA 4J12A 4S0TD 1UH2A 2FECL 3AGVA 1MFDL 3D18A 4NDMA 5C7XH 1D3CA 3JTTB 5LQBH 1W0WA 1KIPB 3DX9B 1FFQA 3S35X 4LKCA 1BIIA 2A74B 4MQXD 3RWEA 2P4AB 2ZKHH 2VXQL 5ICZA 4OCSL 4NZUH 4FP8H 2PUQT 3HC0B 4HKJA 4K94C 2O5XH 3AB0C 5MERA 1MPAH 4GMTL 2W60A 1KJ2L 1ZSDB 4NP4H 4YNYB 4U7KA 2ENSA 3S36H 1MI5A 4PGJA 5GGVL 5EBWA 2B39A 3BZFA 1VENA 1IBGH 1CLOH 5T1KB 1FL3B 1LDPL 4L3EE 4S0SD 4GAFB 1G7QA 5DQDH 3OR6A 3QULA 4PRNA 3S37H 3FAXA 5FAAA 3S5LB 1MUJB 1BPVA 4MXVE 4X0KA 5HHOA 4ODWB 8FABA 4FQ2H 3VWJA 4AY0A 5BOZG 4PGBA 1P9MA 2YZ8A 4OFDA 5D1XA 3ARGD 4D94A 4NHCL 1OSZB 1AR1C 2EC9T 2IQ9L 4QHMA 1VFBB 4TTDD 5F7DB 1I3RA 2AABH 2GCYB 4M4RA 4OZHF 4NWTL 2DBLL 3MUHL 2QTEA 2B20A 4XI5D 3HS0A 3PF2A 3QNXA 4ZNEE 4PB9L 1RY7B 3FZUD 1BJ1J 1JGUH 4JZNB 1NJ9A 4PJ8A 5C6TH 2ZWLT 4O02H 5DUPL 3INUH 4HS3A 2F53E 4HJGB 3BZEA 5IMKB 3QFDB 3P77A 2Y07H 1P69B 3QUKB 1FVDA 5DEFB 4LVNB 5I1LA 1YZZA 4XPFL 2FGZA 3TJHC 1QNZL 3FO1A 3SN6N 4MDIA 5I1CL 4Z7NE 4LCCC 4I0CC 2OBGA 3C5ZC 3K2UH 5HHPB 1JPTL 3WO3B 1HHGB 4KQ3H 1JPSH 2X4NB 5E2UH 1CFTA 3D85D 1WBYA 3UYPA 2UYLA 4RWHA 4QRPA 2CGRH 5HVHC 3EW3B 5FA3B 5CZXD 3QWOB 1P7KB 5ACZB 4XPHL 4NQCE 5D2LB 3P4NA 5C08A 3TO2A 5JHDA 5HYJE 2E7LC 1L6XA 4AG4H 4WFGD 4HKXA 2X4UB 1S8DB 5T1LA 2DWDB 2P8MB 5HYQA 2OZ4L 3FFDB 5TQ2H 4HDIB 4QYOB 4YJZL 2Z31A 3VFPB 4WEBH 5F9OH 1MREL 4JKMA 3FB7B 2CDFB 1KXQE 2YSSB 3VG9B 3F7VA 3EJYD 5DZNA 1JRHH 4HC1H 2YMXL 2YWYA 1XCTB 1IEBA 5B3JF 3FB8B 4KRPB 4I4WB 3D3VD 3PWPE 2CRMA 1FJ1B 2PXYD 4LP4A 4CMMA 1FNEB 4UIKH 2SEBA 1RJYA 4ZS7H 3NA4A 1K85A 1MHHB 2CH8A 1PG7X 2DN7A 2V7HB 2J8HA 3OAYK 1FL6B 4JAMA 2OP4H 4LLUB 3U0WL 5F7UA 5DMIH 5GGSB 5JO5A 4YFLI 2Z8VC 3C6LD 4IIQA 1TZHA 5DJ0B 2H8PA 1MVUB 2JLLA 2VOTA 5DTFB 1LNUA 3RUGF 2EIZB 4KKCD 4NJAH 5L9DL 1I85C 3NGBC 4U3HA 2DJUA 2VDOL 5D2LE 1XGUB 5HYIA 4ZS7L 2DLHA 1WIPA 1N64L 2ZG2A 5ITBH 4XGZB 2LTQC 3WIIL 5FKPA 3QP3A 5F1NB 5FYKH 2VXVL 3PUCA 2DYPA 1A6TA 1CFBA 3S4SA 3WN5A 2A6IB 1JZ2A 1NFIA 3HI6L 4QRRE 3O9WC 5DJYA 1AGCA 1J8HB 4AIZA 5D1XC 1YMMB 3MV8A 1GIGH 5GHWL 3U1SL 2NY6B 1B0RB 5IROC 3IDJB 4R9HA 5I8EB 1MI5D 5CFHA 2LFGA 4XTRC 2HKHH 3H2WA 1NCNA 1EAPB 1ZA6A 2VXVH 4Z7WE 3UTTA 2VE6B 4TYUA 3BGMB 1T04B 4K8RH 3MJ6A 4PJ5A 2FATH 5EA0L 3SCMD 1EHNA 2NXZD 1U8HB 2VDMH 5SWSD 5GRVK 1DQDL 2E7CA 1F6FB 4NQDA 4U31A 1WITA 5F7YC 2KBGA 5MEPB 1UB6B 1ZSDA 4YNYA 3GBML 3GRWA 5IJKA 3IXTB 5IT2L 5EBWB 4NFBA 5FHAH 2XNAB 1P7HL 4UILL 4ORZC 4X80L 1G9NC 2CO6B 2OL3H 1U3JA 2AJXL 1CGXA 4EI6A 1TITA 1VADB 3DV6A 1OAZL 3DETD 1JYWA 3HMXA 3TJEH 1YEGH 4CNIA 4Y1AA 3X3FL 3TWCL 3QFJE 4LDLB 4L8CA 3BPLC 2VWEE 1PY4A 1UVQA 2AEPL 2UWEA 1R5VB 4KY1H 1S7RA 1JWUA 4YXLH 1CI5A 1I1RA 3VD3A 1I1AC 4RWYL 1SEBB 2Z93B 4BZ2H 3U82B 3LRGA 5GS0L 5ERWA 4FMKA 2NXYB 1W72B 4CDGC 5CUSL 5HDBF 3PQYA 3FFCA 1CFTB 1CGUA 5MENA 2EDHA 4M3KB 4F33A 3T0BA 5EIVA 4X4XB 1PAMA 3UPRA 1KSRA 3LKSA 3TH4T 5IB4B 1YMHA 5E70A 1GOHA 5ACLA 4X7CC 1LO0L 1N7MH 2GTZB 4HWUA 3ILPA 1G7QB 5HGDB 3SQOL 5F89A 1MF2H 2VXTL 1FG2B 3QULB 1KTLB 4PBWD 3RY6C 3VG9C 1EH9A 1NCDL 4XHJD 4LLVA 5ISZE 4NO3B 1S8DA 3WSQH 4NCC1 3MFFA 5C0RH 3BJLA 2AK4B 2QSTA 2DM7A 4KRPC 3JSSA 4U6XA 2DS4A 5TQ2L 5IVZB 3TVMC 3MOAH 4TSAH 2X4OB 4QWWD 5CGTA 5GSRB 3RNQA 4YEFA 1K8DB 1X5GA 3TBSA 2PYED 3TA3D 3GZKA 2VXTH 4NNYB 2RJMA 3HNVL 3GIZH 3I6KA 1VFAA 5GZNC 3DV4A 4UIMB 5T1MA 2QLVB 5D7KE 1UA6H 3KNBA 4ETYA 3UO1H 3BRFA 5D72L 3M8OL 1P7KA 1FJ1A 3LKNA 1KJMA 5MHSE 3HHRB 2VLJA 5DUBB 3T2NL 2Y5TA 4TULL 5CWSB 5F6IC 1RIHL 5JZ7C 4ZFOL 1T22A 1U93B 3ULUF 5GGSA 5E1AB 2UZXB 5CD3A 3N1FC 4NT6B 2HWZL 1JJUA 4FTVB 3CVIH 3B9KD 4TUJA 1K4DB 2Z4QA 4I0PA 3MREA 5T3ZH 2EDLA 4Q6IB 4NHUB 4XGZA 4XP9H 2PO6B 5AWNH 3CDGA 1JGDA 3L3IB 1A3RH 4GSDL 4P9MH 1KC5H 3CVHH 1KT2B 5T5FH 4MD0A 5ALBH 2EDYA 4MD5A 4HKJB 3QPQD 5T1LD 4Q6YA 1E27B 1CGSH 3I6LE 3HE6B 3MRPA 4EI5C 3S35H 4PJ7E 4YLQT 2AKRA 3I2CL 4OCNC 2R23A 1AGCB 3OKEB 5E2VH 4FFYH 5IFHL 4TRPH 3T65A 2DQTH 4FXKA 1CD8A 5EG6C 1YEEH 3FAWA 1D6VH 2VXUH 1QRNA 5HDOA 2X40A 4RMQA 4H25A 5D6CA 2HJLA 3DBXB 3VGAB 4NO5B 4YBLB 1VACA 5CEZH 1BGXL 3I50L 1NGQH 5C08E 3EBAA 1AQKL 2XZCL 5L2KE 5I15L 3RY6A 3J7HA 5FXCH 3QDGB 3P9MB 5FK9A 1FGVH 4R96B 1CBVH 1EFXA 3EJJX 4X8JA 3BIBX 3WIFB 1LD9A 3AXLA 4GG8A 3BH8B 4OF5A 5JQHC 1ZEAL 4HIEB 5SWSE 1JN6A 5IFJB 2D7PA 2L7UA 3LY6A 2J12B 4X6DA 3RGVB 5HYSB 1Q9OB 2FX8H 1XGQA 2CRYA 2EIEA 5K9JL 4OT1H 3QZWB 4MCYB 5DI8A 3FQTB 4KKAC 4BSVA 1JWUB 1DTUA 4N8VB 3KG5A 3FQWB 3BE1L 3DI2B 3VFOB 4FXGA 3MBXH 3LQZB 4NBZB 4XPHH 3O45B 3OJDA 4YQXH 3Q48A 3QUZB 2JF1A 1J10A 2I5YL 2PETA 3HA0A 1ZLWK 3SE4A 1FAIH 3O6LL 3WFDL 1WGOA 4Y19D 5DJAA 4C56A 1YMMA 2EH8H 1WFUA 4LPUA 5EU3A 4QRPB 5BV7H 2HTKD 5KS9B 2DWEB 3LHPH 1KLGB 5A16B 2ED8A 4WUUB 1BX2A 4JQXA 1CN4A 3ZTJG 2JJWA 5HHNB 1ZHBB 2UWEB 4FQXB 4LLYA 2GK0B 4ZUTB 1XGYL 3QDJD 5F7FA 1YYMH 1S7UA 2VKXA 4PRHA 4PRAA 4Y4FC 1RUQH 3SE8H 1TZIA 4N0UB 4KJPD 3GKWH 1CE6A 3DROA 1OTUC 1CDIA 1REIA 4J8RB 3ARDB 4WHYH 3QA3A 3RTQC 3UX9B 5GGVY 2F54B 2R4SL 1NUNB 2XNAA 2QQNH 3FT2A 3L5XH 3O8XB 5JW4M 1XGYH 3U4AA 3MC0A 4HZLA 1MRFL 2GTZA 4GG6E 5CJBA 4R26H 2B2XH 1I8LA 4LHUA 3ISWA 2DQJL 2HT4C 4XCFL 1KEML 2CQVA 3GMLA 5KVDL 1S7TA 2CDEB 4RCAA 4MA7L 3KYNB 4RFEA 2VQ1A 1T22B 4TSBH 1EEQA 5AYQA 2VLJD 4U6XB 2WWKO 4LP5A 4JREB 3OKKA 2R0ZH 2XXCB 4JO2L 3I85A 2D4FA 1CXFA 4LSTL 3VRLF 3VXSE 4J1UB 1HI6A 3G6AB 3Q5YA 1RUAH 2C4XA 2R2CA 3SKJH 1KCKA 1VFAB 5ADPH 4TTGA 3QXAA 4ZUSB 4HF5H 4X4XA 3JWOH 5AWNL 1S5IL 3HAEG 3UPRB 4PJBB 3B8YA 2Y23A 4HHAA 4MWFA 3LKSB 4JCMA 3QUMA 2X09A 1E27A 2P45B 1U8MB 4K94L 1HKLH 1S7SA 4WEMB 3TN0C 4P4KC 3OKMA 1H3PL 3OKYA 4NQTA 4W70A 3MV8B 1OLLA 1OM3H 5EBGA 3ET9F 4YUEL 1PW3A 2EYRB 3G6DL 4F8QA 3JWOL 1X4YA 1Q0YL 4ZFZA 1H8SA 1OPGH 4XMKL 4UUJB 4U1SA 1X3DA 2QQLL 4KI1A 5I1JL 3DXAA 5ESAA 1UYWH 3HPLB 1I7UB 4OZIB 3FRPA 4DEPB 3KPQA 2J6EA 4N8CL 3BFOA 5SWQB 4UT9L 1YEGL 3T09A 3PHOA 4D2NA 1NBYB 4AIOA 3CFDA 3QXDB 2WBJC 1UB6A 1ZEAH 4Q58C 5E7FA 3IAGC 3UPCA 4UQ2A 1OSPL 4ELME 1PG7H 3DUHA 2OTPA 1PKQA 2WIMA 3OXRB 3WNPA 2XKSA 1FNFA 5K59F 1LP9A 1F3JB 1FGNL 4DTGH 1UM5H 2YD2A 4YHMH 5JPMA 1DVFB 4Y2DD 1FG9C 4J4PD 4WI7A 4XHQA 1JHTA 4KI5E 2PW1B 1C16B 3VXMA 3BGAA 4Y1AB 3ZKSD 1YEJH 3MR9B 1UWGH 3MCKA 3P40A 1MFDH 3VRJA 4R2GB 3MA9L 1U8NB 3CC5B 2GJZA 1F6LL 4KRMB 4NFDA 1R24A 4AM0A 1MRDL 2FL5A 4Q6IA 4QHKJ 3MRGB 3PGFL 1AHWA 2V2TA 5HHMD 1D6EA 2CLVA 4ZYKB 5JNYA 3GJEA 1FZOA 1U2CA 1D5IH 1BP3B 5CIPA 2JCCE 3CU1A 4JFDB 4GRLD 2YA2A 5BV7L 4OLWH 2DWEA 1LO4H 2BNQB 2R0KH 4XCCH 3ARBD 4LLWA 5DJ2A 2A6JA 4PJIE 5DI8B 2YRZA 5I1DB 3DX8A 3L3KB 5K33A 1IAIM 2I07B 3LMJH 1V3KA 4LLQB 4Z0BH 1QFOA 4ZAKC 5DZOA 5DFTA 3B6SA 2P5WB 1W0VA 3VFGH 2PO6D 1T83A 1EHLH 3FMGL 1EBPA 1C8PA 3O45A 3OJDB 1T5XA 3HC4L 3GKWL 3QUZA 4P23B 3IKCA 1CZ8H 3BH8A 1A9EB 5E08H 2V5YA 2WWKT 5JXEC 3Q6FB 3TBSB 3LPFA 5LCVH 2W91A 3K8KA 1H8OA 1KUMA 4X5XB 3T0VA 3ESVF 4L1DA 1RUML 2DI7A 4P5MB 1ITBB 4GUPA 1DBJH 1GJIA 3I3DA 3QEHB 3F8UB 4BUGA 4X0KB 2DQCL 1I75A 4X6FA 1FL5B 2VXSL 3KYOA 4XWOD 2W07A 1EZVX 2LAGB 3RVXC 5F9OL 3GMPB 4BA8A 3G5XB 4HK0B 1F6AA 1S5HB 2OTWB 3T0EA 2N56A 4WJ5A 3BP7A 4PG9B 1PSKH 2DM2A 3U4BL 1JF1A 1F3DJ 4L4VB 3G6JF 3RDTA 1WFNA 4IRJD 3IVKB 43C9A 4YHKL 4LVHB 4JFXA 4K3JH 3LQAL 4XPBL 3WO4C 3CLFH 3CDGB 2Q6WB 1DBAL 4PJBA 5DT1L 4AYFA 1YNTA 2E9JA 3O0RH 4Y1AD 1XF3B 4LSPH 1KIRB 5TDOA 4FZ8H 3R06B 4Y16D 5FYKE 3OJ2C 4X6CE 4OCYH 1S7TB 4HGMA 1OQXA 4MVBD 4JFDE 2CSPA 5EB9A 4JM2F 4LEOB 1G1CA 4P23C 4XNZB 3TZVA 5MENE 1IFHH 4ELKB 5CIPH 4MA8H 5LAXA 5CJ8A 3UTTE 3G5ZA 2EYRA 4L4VD 1PX3A 3BPOC 5ILTH 3WLWD 1OAUL 2HT2C 4MNGA 1HI6B 1S7QB 4LFHG 1XGTB 4QF1B 1XF2B 1TCRB 2ICEB 2JK5B 3NIFF 5I1JH 3WKMH 1DN2A 3SCMA 5DXWA 5JA9A 1AO7E 1FIEA 3MMEB 4JHAL 1RD6A 2WNGA 4UDTA 1P7QD 5I1AB 3AXLB 3KJ6H 3S34L 3GHBL 1DQMH 2YK1L 3WL9A 3OKMB 4UQ2B 2VDPL 1KGCD 4MAUL 3VFUB 4LHQB 4TUOA 3RBGA 3BKJH 4EBQH 4M43L 4HEME 1NH6A 1Q9OA 1UM5L 4LEXL 4NZUL 4O2FB 1Z9SA 1ZS8A 4UNUA 3VI3F 1IEHA 1R0AH 4PJCF 4YHIA 2XFXA 2B1HH 1FVCA 5IJVB 1KPVA 5M94B 1P1ZA 3HPLA 4R4FL 5ABDE 4R0LC 1N5YH 4HIHA 3H6JA 3T04D 5E2WL 1ZK9A 3SDXE 3KPSD 2ARJB 4S1RL 1UCTA 3SPVB 5A2KH 3S88L 3K4DA 4MAUH 2WINA 1JRHI 3FB8A 3GMNB 4OGAD 5JR1L 1KG0B 1D6EB 3WO4B 5GRJL 2WBKA 1M71A 5MERB 1EXUA 4Y8DC 4FA8A 4HFUH 4O2EA 5A2FA 4OZGF 4U6VL 3U30B 1NLBL 4OAWA 4FQ2L 1C1EL 2F5AL 1RUQL 4Q2ZB 2Z91B 1PJ9A 1HE7A 2XTLA 3SGEH 2CK0H 2NY6D 4PBXA 4IIQB 3TCLB 3S88H 1C16A 1HZHL 1R3KA 1FDLL 4OZHB 3VXMB 3I6GA 3STLA 3ZE2F 4FQ1L 5EO0B 5I1EH 1GGCH 5HVGB 3S36X 3MLRL 3D18B 4NDMB 3NFSL 3MQIA 1UM6H 5F88A 4NCDA 4JVPA 5E5RB 3KPNA 4CJ1A 3UTZA 2P5WA 4R2GD 4AT6A 1UACL 5EZLB 4K2UH 2VUYA 3HR6A 1AH1A 1N6VA 3VFSA 4OGZA 3LS5H 4NRZB 4M6OH 4O2CA 1T1YA 5HGBB 3GSNA 4LHUD 5DD3L 1DBAH 1DVFD 1CGTA 2DKSA 2GTWA 3LH2H 1GAFL 5IWLA 3QHZH 2WP3T 3F12B 4MNQE 2MNUA 4B53A 3UTQA 3O2DA 1E28B 4XWGH 2GUOB 1A6ZB 3QEQD 4NC1C 4G8EB 3FO0L 5FO8B 3VMPA 3WXVH 3EFDH 1B2WH 4R97C 5IB2B 2DD8H 4LLQA 3QEHA 3LS5L 4ONOA 2B0SH 4HS3B 4N1CA 3BHBB 1WZ1L 5HHOB 4RFEB 4JRYE 4HWBL 4ORGB 3MV7B 4NM4L 4X7FC 5LGHL 2A9ML 4L4JA 3G6JB 5IKCB 4LPXA 5IR1B 1TQCC 2Z8RA 1DBMH 3U4BH 3Q6GL 1SBSL 4KI5D 4KXZI 5EOCJ 1ACYL 4NGHH 1MPAL 1I3RB 3MLYH 4GMTH 1AY1H 2R2BA 3MNZA 4XC3L 3B83A 2A1WH 3L3JA 5FO9A 1TJIL 2MOVA 2MQCA 1WZ1H 5JHDE 4M62L 1HINL 5KTEH 4XNXH 5T5NF 2V2XA 5J12C 2QADB 5FFLA 4AMKH 2X05A 1WVZA 4WHDA 1B4JH 1DBML 4F80A 1FC1A 4JDVA 5EU6A 5C86A 3TYGL 3H0TB 4HK0A 3BO8A 5L6YL 3CVIL 4NWUL 3QI9B 5DHVA 5ETUA 3QNYA 2PYEA 4OZIE 1OSPH 2IPTH 1TCRA 5ADOH 1BZ7A 1D5BB 4D3CL 2AJ3B 1S78D 4WY7H 5E2TL 4FS0A 4FQPA 4JFXB 4Y4HC 1HH9A 3RPIA 1B4JL 4S10A 3MBEB 1C08A 3LKQB 4GQ9L 1VEMA 1B90A 1KB9J 5E03A 1QSFB 3X11A 3CX5K 5INCB 5KN5B 4PJAF 3TT1L 3MBEC 1OP3K 1DQML 1XF5B 4PGZA 4U1JA 3MROB 5DFVD 3U4EA 1OAYL 3ARFD 4HKXB 5DFWH 3QNZB 1QFWH 2BSTA 2HG5B 5IVZA 1IM9B 3QIWA 1GCFA 4LU5L 2X4OA 5I75C 3TH2T 3BRGC 4XAWH 2VABA 3CGTA 2FEEL 4TNVK 2CDFA 3MRCA 3VRJB 4DKDC 1NFDE 1CLCA 4M1CD 5I1AA 1KG0A 1HSAA 2VDKL 5GGUA 5H2BA 4DQOH 1A6VL 3KLDA 4APQC 5F1NA 1XR9B 3O4LE 3WFHB 4ZQKB 2CLVB 1R3HB 4GOSA 2Y5TB 4QRPD 3GJEB 3V0WH 4O4YH 3BPOB 3VWKD 4KMLB 3IRZA 1X5HA 3CZFA 2NTSP 4MA1B 5HI3C 5DJ8A 2BVEA 4U4BA 1BM3L 1J18A 4MCZB 1OGAD 2Z4QB 3MGOA 3SDDD 1G0YR 1MREH 2HMID 3HMWH 5IMOA 1QNZH 1R3LA 3TO4A 1Z9OA 4KROB 5CSZB 2W9EL 3GMNA 4NZTL 4XX1G 3UTSA 1FORH 3X3FH 4ISVA 4K7PX 3ARFA 3T4AB 3UJTH 2EDKA 4OFIA 2RIKA 1MAKA 4QRSB 2YOCA 1C5CH 2HLFC 3IS1X 1FZJA 1HYSC 5DD6A 2Y9RT 2EEAA 3QHZL 3O6FA 3SKUD 3W9EA 1CLZL 2OK0H 1NCWL 4ZD3H 5KSBF 4HPYL 4I2XE 1P4BL 2W0FA 3DBXA 1A6ZA 1CDBA 1LK2A 3IJSB 3O2VH 4ALAL 4XP6H 5C07D 2X1WL 3EFDL 1AGEA 2HRPL 1INQB 2W38A 3P11H 5IQ9A 1UXWA 1FVEA 3UDWC 5I75B 4MHHG 5EORH 3GSRB 3EOTH 3QJFA 1UXSB 1EO5A 2H26A 3MV7A 1IL1A 4LAQL 3G6JA 5IB1A 4RA3A 1WJ3A 4Y5YB 2VDQH 3WIIH 5J1SC 2VLKA 5L2KD 4RMTA 4TPRL 1NUFA 2YC1A 4JJ5B 4XXCC 1H3TA 1DBBH 3QDMD 1U3HA 1ORSA 5DUML 5I2IA 1F97A 2YUWA 1N2RA 4HWZA 4MQ7B 1DSFL 2AI0H 3SO3C 2NY0D 2GAZA 4ZS6D 4IOSD 1ND0A 4U1NB 5HDBE 1NKOA 3C2AL 1HCVA 4ZO6A 3GI9L 5F96L 5JW5B 4JJHA 3IDNB 4LASH 3BP4A 5EU4A 2Y06L 3B9KB 1UWXH 4JM2B 4NJAL 3QNYB 4QOKD 5ADOL 2AI0L 2HT3D 3TZVC 1OAKH 1TZGH 3U9UA 4G6JH 2XYCA 5F8RC 1A6VH 2OJEA 4O00A 1JTOA 4C83B 2ZSVA 3WMSA 3BJ91 4M6NL 1RUPL 3HUJA 4HWEL 2HVJA 4F2MB 1NDGA 3QUZC 5KN5A 1NAMH 2RAMA 4ZO9A 2IH1B 5IGXH 4LIQH 2HWZH 4EQ3A 1DEEB 2W59A 2J1KA 3WL9B 2EXWD 5IB2A 1CG9B 4JFQA 3UMTA 5B38A 4BM7A 4WHCA 3MSPA 3QCVL 1A3RL 4GSDH 4WHTB 3RWIB 2HG5A 3QUXB 1A7BA 2PYEB 3G08A 4NWTH 5BJTB 3GSWA 2P5EB 5I71B 1FVCB 3D48R 5MEQB 3RVTC 4DGIH 4PV8B 4OFKA 3NCFB 5H94A 2HRLA 4N5ED 1EO7A 3PGCA 1T66D 1QSFA 1U8OA 2I24N 2JKXA 3X11B 2EYTA 5K93A 3HFML 4OD3H 2VDKH 4DQOL 1BEYH 1KT2A 3BT2H 4P3CL 4C56D 3TBWB 1V7MH 5D71H 4Y7MA 3DSNA 1FFRA 1XH3B 4F7MA 4KUZL 4JPWH 1WV7T 4UU9B 1SJXA 5I74C 2AXGB 5T3XE 3F58H 4YHLH 3C8HA 1ZVHA 4P2QE 1JPTH 3ZT6A 3THMH 2OMBA 2UWEF 2ZSWB 3FO9B 4P2OB 3O9WB 3OKDA 5HY9B 5DMKB 4TSAL 4IOIB 5D96B 3ARGA 4OM0L 1NGPH 3ZYIA 2QHLA 1A6UL 4XPTL 3RPIB 1X5IA 2PO6A 4TPRH 2ARWA 4NZTH 4TUKH 2XZQH 2BMKB 1MCSA 3DXAD 1BD2B 1D9KA 2DLFH 4ZQKA 3T4AA 2W0PA 4JRXA 1F4WH 4F7CB 5EOTB 2E8ZA 4RMUA 3TGXA 1XF5A 5D1ZA 2R23B 5E00A 4HIEA 3IYLW 1WT5A 2GTWB 5DVMA 3IDIA 1Q1JH 4KMQA 5BW7A 2GY7B 2XA3A 4XT1C 4E41A 1BIHA 4R6UA 4M6AA 5DMGD 4G5ZL 2JJTC 1A21A 1A3LH 3QZWA 2D7TH 5A43C 1BWWA 5I1GH 1LO5A 2G9HA 5GS2H 3FMGH 3Q5OA 1EV2E 4M8QB 4KGLA 1KTDB 1IKNA 3HNTL 2KZ1B 4XBPA 1BQUA 2P24A 5IIEA 5JXEA 1CS6A 4ZOEA 3HE7D 1S9VA 4KJYA 3J8F7 1ZLSH 1HILA 4RQQA 2NY4B 4JO2H 5E4IA 3D39D 3OXRA 2QL1A 5DYOB 2CKBA 3A6CL 3VXUB 1BWMA 1YMMD 1KJVA 4C56B 4HIXL 2V9RA 1IT9L 4OFYD 1IC1A 2X1PA 3DMMC 4Y5VB 3SDCB 1D5MA 5EZIH 3JTTA 3RVVD 1T2XA 1P4IL 3TBTB 4YBQD 3FQWA 2DQDH 4G8GD 4P46D 3HI6H 1YDPA 3SO5A 2FIKB 3QIUC 3U6RA 4TNWF 3CMOH 3T2OA 1Q72H 3DROB 5TPWL 1VKXA 1M4KA 1L0XA 2M2DA 3QO1B 2FRGP 4MJIE 1H15B 4X7TA 5ANME 4JFDA 4CKVX 5MP6L 4HS6B 3T0XA 3RWDB 1J9CT 2A6DA 4RWYH 2OZ4A 2YUZA 1PBYA 1XZ0B 3H9ZA 5DRXB 5FCUL 1IFHL 4FQXA 1XF1A 1ZHNA 4HKBB 3KXFE 3RWHB 3B6SB 4F7EB 1F45A 5IBTH 5GGQH 2YEZB 3SKNA 2WP3O 4LL9A 1SHMA 4YBLC 4ZTPL 5DD5L 3MXVL 2YD6A 3OKKB 4N0CC 1IM9A 5HVHB 4RMSA 3MBXL 3X12A 1BVKB 5D1QB 3TIDA 4PRIE 5C3TA 5D93B 3EYFA 3VFWB 4C83A 5FECB 5E5MB 1I1YB 1A1NA 2DQIH 1OM3L 4EDXB 3TPUA 4ZUSA 1JV5A 3ZTNH 4FFVC 3HS0B 2IALA 3O11A 4JFOB 5EBLA 4RGNE 4F15C 3KYMA 1QYGL 4QRRB 2WIIA 4YHOL 5A3IC 1GOGA 5IP4A 5DEGB 2BNUB 2CMRH 1DQLH 3W0WB 1Y0LA 5F93C 3NH7L 5EFIB 3RKPA 1KENL 1IRAY 3C60D 1KBGH 3SGDH 3CZFB 5GGSY 3FB6B 1H0DB 1YY8B 5CJ5A 3WIHA 4WJ5B 3GSWB 3D0LB 1O0VA 3FO9A 3SDDA 3EDFA 3FONB 3DNKA 4QHUA 4DOHE 2FSEA 5B38G 3E6HA 2BY0A 4LSSL 3ROOB 3BOVA 4APQB 5CSZA 4LHUG 2HAZA 4XPTH 2EDQA 4UB0H 2Q6WA 4RFOL 4Y4KC 2CO7B 1RZIB 1RI8A 2Q8BH 2K3TA 3VRLE 1DDHA 5FGCE 3CFDB 1V3JA 3VFGL 3N0PB 4PFEA 3H42L 4NSKB 1XIWC 4JKLA 1OCWH 3T0DA 3P4MB 4PB0L 1J11A 1BHGA 5DLMH 2C1OA 1CDCA 3I75B 4ODSL 3VDAA 3DXAE 3FFDA 5D1ZD 4TSBL 5JPMB 3W5NA 1H5BC 1KC5L 4PTTA 5F7HA 4PJXB 3G08B 4GLRI 4ZFZB 5CS7A 3ZZ1A 5I1KH 1UA6L 5TDNA 3M07A 2FH6A 2E5EA 4PJHB 2QSQA 3ARGB 1T2QH 2G9HB 4KROD 5IUSA 4HMDA 2IPUK 2VLKE 5F72S 1KJ2A 2FHFA 1NEZG 3DVFA 5DDHB 4M02A 1U8NA 4G3YL 1T4KB 1QACA 5IHBA 3E6FB 2VXUL 1IEBB 4ODSH 3D69A 5KSAC 3BDYH 4JFEB 1MJJA 4FRWA 4POYA 2ENYA 3VFRB 1HILB 1U91B 3C60A 4Y5XC 4HPOL 1JGEB 3TT3H 2BVPB 5I8KL 2D0FA 2EDXA 4KKBD 4UQ3A 3GNMH 4QEGA 4DCQB 1FCCA 3T0AA 1UENA 3T3ME 1ORSB 5TFSL 1A2YA 3OKOB 1B4RA 2UV3A 4YK4C 2DD8L 4XCFH 2DMBA 3PL6A 1HDMB 4KMTL 4O9HL 4MHHI 4LLWB 3CLFL 5DJ2B 5DTFA 3O9WA 5JMOC 5HPMA 2XOTA 4BK5A 1YEKL 2PR4H 4G6FD 2D7NA 1EMTH 1JUFB 2VDRH 3AREA 1A7OH 3Q6GH 1BFOB 4LIQL 4KI5F 3TA3A 3ES6A 2X4TB 3TFKC 1LO2L 3VGBA 4GAJH 3AMKA 5D2NC 1KJVB 1H15A 4X7TB 1KPUB 2H2PD 3CXHJ 1RZ8A 3H9SA 1FRGL 3AC0A 1DQJB 1NGQL 1B0RA 3B8SA 3Q1SH 1NDGB 4XBGB 1GOFA 4Y4KA 2WUBH 3A6BH 1AE6L 3IFOA 2CJUH 1O7VA 3LS4L 1TNNA 2QQQA 2M8XA 3VXRA 2NX5D 3EO1B 4JPVH 5ELIA 1CK0L 2AERT 4LCCA 2GJJA 4QRUA 1BEYL 1RURH 1MRDH 2BXZA 4ODHL 4HH9A 3DVNB 1FP5A 5GGRY 1MQ8A 4LK4A 2EZ0C 1JF1B 4L4VA 2R56L 5LGKA 5CEYB 1QLEL 1VFOA 2CIIA 3V52L 3F5WB 2QJDA 3EFFA 5BXFB 3NBNA 2GUOA 3O4OC 1PQZB 3M45A 1N6QL 4OLWL 1SJHA 5D7JB 3BH9B 4XXCA 1S9KC 4P2QB 1QBMH 4U6TA 2MPAL 4KU1A 3ZSTA 3DYPA 4QOKE 1U3YA 1KLFA 3SY0A 2D31A 1H0DA 5E7BA 4FG6D 1II4E 4Z77B 4HGWA 3GHBH 4LPVA 4P2OA 2RR3A 3OKDB 2H6PB 3INUL 1F3DH 3WNLA 1F3RB 4ZFFA 1IAOB 3L3JB 1B0WA 4U1IA 3C6SA 4APQA 2YN3A 3MLRH 1ODAA 4I48A 5E8OB 5IEKB 4RISH 4K07A 1R5WA 4GKZA 4N90D 3RWDA 5I66A 2B1HL 5JQ6H 1OGTB 1BD2A 1D9KB 3MLTA 4CU8A 3WJJC 3MRLA 4M93B 5DC0A 4LPWA 2D0GA 2V5RA 3V2AR 1RUKL 4FMFA 4L9LA 4WCYH 3RIAK 1T03L 5ESVA 1RQ5A 1EIBA 3IKKA 4RRPA 1I9JH 3RL2A 3BQUA 2Z31C 3RY5A 4PJ8C 5HHXH 3KPMA 5EUOB 2VL4A 3QQ9C 1KCRH 1EAJA 2YR3A 4LCWE 3TO4C 3PQYD 3PWUA 2AJ3A 5E9DD 3E6HB 1K8DA 1ZVSA 1GPOH 3N1GC 3RAJL 4PLJC 5D1QA 5CCKL 1MIEH 4ELMF 4L8SC 3MMEA 4CVZB 1U42A 3MLUL 3TPUB 4OKVB 4JRYA 2YPVH 2WZPD 4F3FA 4LCIH 3TVMA 3GBLA 5DHVH 3FOLB 2X6MA 1MJJB 3ZMRA 5IVXB 3U2SB 3CD4A 3P30H 3LKNB 3LN4B 4Z78B 1JHKH 4LSVH 1G9ML 1MAJA 5GJSL 3RQ3A 5SX4H 3U83A 2IMMA 3PDGA 1J86A 2AJUH 4PJXA 2HVKA 4EUPB 5E2UL 1YY8A 3ZSSA 3WUWG 3SDCA 1C5DA 5LQBL 2EE6A 3HCVA 5L0QB 1T4KA 2LV4A 1UH4A 1DUZA 4AT6B 3VGGA 2YZ1A 2NR6C 3EYVA 1FORL 1BZ9A 4G7YH 2X4TA 1QRNE 3ZE2E 1A0QL 3MCG1 4OCLC 3NCBB 3NMEA 5LGHH 4KWUA 1RJLA 1A4KB 4G9DB 2VLLA 2NPLX 3P4OA 1R3KB 1UH3A 5FUZH 1P4BH 2NTFA 1CD1B 4HG4K 4XNMA 5DO2D 1AXTL 4LRNH 4P5TD 3KDMA 4RGNC 2ZNWA 4DKEH 5E99L 1NMBL 3LVEA 3WE6B 2CKBL 5FYJU 3NABH 4RGOH 4OQTH 4PJ7B 4UNVA 3NA9L 1VHPA 4FHBD 4D9RE 1T5WB 4ZSOE 1UGNA 4KDTA 3V6BR 1J0KA 4MXQC 5DURB 2R0LL 4BZYA 3X12B 5ANMA 4LHJB 2D4DA 1DUYB 5CSBA 4YXHL 3S97C 5L9DH 2VLJE 4XBGA 2DMKA 4OLEA 1GRWA 5GJTH 5L7XH 4UT6L 2V2XB 1CLOL 1DSFH 2P1YA 3CH1B 3UYOD 2CDGB 3KPPB 4HS8L 2IBZX 3QWQB 2FJFB 3BAEH 2BNUA 3SKMA 1T20A 1UXSA 1NAMA 2YPKA 3GO1H 4ZTOH 4X80H 2N7AA 4LRIA 2IF7A 2MWCA 5IOPB 3SDDB 4M5YL 1PFCA 4B41A 3OB0H 4NKMA 1IAOA 4XMLL 3GSUA 5K9OA 3HC0A 2F5BL 2J8UA 4M61A 4QTIH 1HH6B 3TM6A 4DVBB 3DIFB 1NL0H 5B39G 4Z0BL 1FSKB 1Z9MA 1FFOA 3PXHA 2ZCHH 3VXQA 3HI1A 3AY4A 1MLBA 2NXYC 4KQ4L 2YKLL 4IRZH 3IXAA 2FJHB 3P4LA 4N90E 2WUCH 5C0IA 2ZJSH 3HZKA 5D7IE 4IRSB 3BKML 5ALCL 4NRXA 4U7SA 3WDHA 4NZRH 4K71C 3ZYOA 4V2BA 1MQKL 1VFMA 4J4PA 4HXAH 4AEIL 1Y18A 4CDHA 2HVJB 5E9DB 1WZLA 2XY2A 3DI3B 3NCEB 1OGTA 1U8KA 5IESH 2A77L 4XPGL 1JZ8A 4FQCL 3PP3K 1KB5L 4ZG1A 5KW9L 1J88A 1ONQB 1XR9A 2NY5H 3L5IA 1MOEA 1G7HA 3SKOA 4S1QH 4WEUD 2EICA 4ETQA 1EA9C 3FRUA 2FX9H 3CUPB 1RK0B 3EYQD 2R9HC 4K7PH 4CJ0A 5DJ8B 4QRQB 5E6IB 2NW2A 5HPOA 1LE9A 1RZKH 3MLWH 1NCAL 3DPBA 1G7LB 5D7LD 4HGWB 1AIFB 5E2JA 2WSKA 2YD1A 2XKNA 4OLVH 4LKXB 3HE7B 2R2HA 4D3CH 5C0FA 2BHYA 3QI9D 3QXAB 2A9MH 3CFIC 1R3LB 1IVLA 3MLVL 3SGKA 3VW3L 3CDFA 1RVFH 3AREB 4W81A 2I60L 4MX7B 1HSAB 2QQKL 5E94A 4D0DA 3TBWA 4MZ2A 4IMLB 2ZUSA 1EJ6A 3U9PL 2V5MA 1IC4H 1RZKL 4JB9L 1NCCH 1FH5H 3GIVA 1QSED 3DRQA 2R8SL 5ILTL 4HIXH 2B8OT 3B5HA 4XP4L 4JDTL 5FA3A 5I9QC 3KR3H 1NC2A 4LRIC 5KVDH 1KIQB 4C56E 3H9SB 2JB6A 5CILH 2XQBH 5LVEA 5H8DA 2V7NA 1AD0A 5F9AC 2H45A 5BS0A 4IRSC 4OIIH 3AS0A 3ZHKA 1QLEH 1INQA 3QIBD 1IGCL 4QNPF 3QEGH 1DQDH 5TGBA 3MV7D 1A14H 3PWLA 5IG7A 4R4BB 4NQCA 5EO1B 4PRID 4Z0XA 2R15A 3IJYB 5KSBE 3QG6B 3PV7A 3PHOB 1J7VR 3E0GA 3TVMB 3VGEA 4YDJA 1SVZA 5JHLL 1GGCL 1ZLSL 2XWJB 1V5JA 2EKSA 3MXWL 4W4OC 2DLGA 2IG2H 1NGWA 3CCHA 2NX5B 1Z9LA