4JKPH

Restricting hiv-1 pathways for escape using rationally-designed anti-hiv-1 antibodies
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
222
Chain Sequence
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRWGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restricting HIV-1 pathways for escape using rationally designed anti-HIV-1 antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords gp120
total genus 42
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH01
4UUJA 4PJAA 4I77L 3IFNL 4M03A 1F02I 1D9KD 4ZTPH 3PGCB 3V9FA 3U0TB 1CE6B 2XNAB 1PZ5A 3UYPA 4WV1B 1QBMH 1WICA 4V1DA 5GZND 3SEPA 5MHSE 3GMOB 3QDJD 4YO0B 3D6GA 1WFNA 3PWPE 1S9XA 4JDTL 4Y4FA 1E4KA 4M3KB 4PJFB 3MR9A 4R8WL 5IEKA 1NUNB 1OGAE 1BBDL 5EORL 5GRWA 1ZEAL 1W0YT 5MENA 2XQBH 3PWNB 4LPXA 1K4DB 3U0PA 4TVSa 3ES6A 3SO3C 3WJLA 2J4WL 3SKJL 2EYTA 5C0ND 3S4SA 5T5FL 4BZYA 1MCCA 4QTIH 3O6LL 3VGEA 3RWDB 3IVKA 3ZKND 4JZOB 5DDHA 3STZA 1RIVH 1CL7I 1NC4A 1EGJA 1BM3H 1A2YA 3MBEA 3RWJA 5DEGB 3DYMA 1WZ1H 3X13A 2YA0A 2A77L 1BAFH 1BFVH 4H8WC 3DSNA 5FK9B 5JPNA 2VDOH 2XZQH 4JFPA 2OP4L 4ZUUA 3ZKQD 3FRUB 3C6LD 5IQ9B 2IEPA 2R1YB 2UZXB 3FOLA 2IADB 3MREA 5J9PA 2OX5A 2CXGA 5AUMB 2DI8A 2JJVA 1OT2A 4U1JA 5MP6H 3KPOB 1JYNA 1BQSA 1EHXA 1F58L 2IH3B 3IETA 2IANB 1V7MH 3MV8E 4TUJB 4YHZH 5T3XL 3WNLA 3MV11 4NP4L 4D8PB 3H8NA 4C58B 4GJTB 4W68A 5I1LA 1I8KB 3AAZA 3KPSD 5F9OH 1JMZA 3BYTA 4YK4C 3H7BA 3H6JA 3QG7L 5HYFA 1DUYB 3O8XA 5HHVL 4JPIB 5LG1A 4G7YH 4CDHA 3FMGH 5I8OL 4X5LA 4FQ1L 3TPUA 3UJTL 3UTPD 1F3DJ 1T7YA 4PJGB 4XCCL 5DUML 2NY5L 4XTRD 4O4YL 3ZYOA 5KVGH 1A6WL 3KPMB 3U2SA 3L3OB 4RX4A 3R1GH 4MA3B 4NKMA 1CLOL 4NM4L 4MXVE 3QI9C 4Y19E 5JW3L 2W65A 3O41A 3RWIB 2NY3D 2YK1H 1C08A 2X70A 3PQYE 1X6NA 2QTEA 3G04A 1F4XL 4WO4A 5BV7B 4PJDB 5JQHC 4OCXL 1NBZA 1UXWA 1LO3H 1FFNA 5H8DA 2VLRB 5CJXC 1FAIH 4MA8H 1A4KB 1U8HB 1H8NA 1MRFL 1F2XK 3RZWA 4J3OC 4RMWA 4YHYC 1BIHA 4K8RC 3MBXH 1P7QA 4W6XB 4GSDH 4JY5L 1CFBA 1DE4B 1OHQA 3WKNA 2LV4A 5KG9A 4WEBH 1JZ8A 4S1DC 1MHEB 4CDGC 1BOGB 3MV9B 1M6OB 2JJSA 4CUCA 1N8ZA 5C0IA 5BMFH 3WXWL 4J3SA 3DBXB 2ZUVA 5C8JB 2CLZB 2F53A 3TNMA 4PGCB 2AQ1A 2H2SD 5AYUL 4LVOB 1JPSH 1FORL 1T22B 1V8HA 2QR0A 5DRZB 1WBXB 2NXYB 3BKCL 5C0GB 1BZ9A 4G9DB 3GRWL 2ZKHL 4QY8B 1GZQB 1HK6A 2QQQA 1G1CA 1U3HC 3QCTL 4AEIH 3VFTB 1BGXH 4QT5B 1TFHA 5E6YA 2HFFA 1IAIH 1RUPL 2CIKA 2NZ9D 4IRSD 3QUYD 1FNEA 1WC7A 2GJZB 4PRPE 4PYHA 1FPTH 4LAQL 1OAQL 1EPFA 1DQJA 4J2XA 5CKAA 4HUXA 3WIHH 5J06A 3ARBD 4X9FA 1M4KA 3FO1A 3B83A 4JRWA 2XG4A 3BPLB 5I1DB 1G7JB 1OAUL 5D2LA 2C3GA 2VITB 3QI9A 1DLHB 1G9NL 4BUHA 3MJ9A 5D6CA 1UC6A 3HE6C 5IBTL 2AGJH 4X8JB 4NQVA 3LKSB 1IRAY 4P9MH 3ARQA 3QPXH 3EBAA 1FNAA 1OB1A 1DDHB 4QXTB 3PGDA 1P84K 1P69B 3VA2C 4RWYH 1LO2H 4JB9L 5I76B 2AI0L 2W0FB 4HJJH 2LQRA 15C8H 2JK5A 1TPXC 3C2SA 4D9QE 3EJJX 1S7QB 4WFGD 4XPGL 3MUHL 2UUDH 1Y6KR 1VGKB 2IG2H 2PYEB 4LNRA 4KKNA 2C3WA 3LRSB 4Y4KB 5EG6C 1EO8L 1NCTA 5I15H 2D31A 4XAWL 1IC5H 2F8XC 1L0YA 5C3LD 2AJXH 4QRUA 4HHAA 1YNLL 3ZL4H 1QLRA 4PR5A 4YHPA 2BDNH 4C4KT 3QRFM 1EV2E 3S3SA 4JDVA 1TLKA 4P3DA 4LCYB 3QH3A 1BQLH 3MA7A 4WFFE 5JHLL 2VDQL 5DSCB 4QXUL 3FTGB 2DQIH 2OR7A 1QFWL 4MA1B 4LSRL 4NQDD 4ONOA 1HI6B 4H0HB 1I7UA 4NQCA 4OUUB 2VAAB 2NY1C 3QEQE 3G6JF 3VH8G 5CLWA 3GB7A 5IJVA 3OR6A 1MUJA 4LSUL 2NX5D 1OTUC 1JZ6A 4JFZH 1QQDA 1CXEA 2CLVA 1HHHA 1SBSH 4NHCH 4WWKB 3PNWB 1J8HB 1I8MA 2P44B 4MQSB 5CGYD 2MSPA 1XF4B 1IC1A 3PV6A 4M62H 1N6UA 4NZUL 3D0LA 2P5WD 2ICWA 5JW4M 2ED8A 4NKDB 5E6IC 4P4RA 3K8LA 4EVNB 1ZKAA 4F7PB 1NAMH 1NEZB 4PLKD 4CJ1A 2P5EB 4O2EB 4H25B 4OSUH 5F1IB 3GI9H 5DXWA 5JUEH 3KGRA 1D6VL 1J7VR 3KJ4C 4Q0XL 4TUKH 2I9LA 3Q6GH 5E8EB 1SY6A 1OW0A 2A9MH 4MCZA 4HF5L 5IJKC 1DVFD 2A74B 1U8QB 4PJHE 4FG6D 4X6FB 4F33B 1QRNE 4ZUVA 3SDCB 3RU8H 1RK1A 4P46A 4OZ4A 4UOW0 3TBYB 3TP4A 4LCYA 3B9VA 3GKZA 4KMTL 3TM6A 1ZLSH 4I4WA 2EEDA 4JDVB 4NCC1 5LGKA 4IOIB 2VQ1B 4QRRA 5L88H 1KJ2H 5LQBH 2ERJC 4PJFF 3PQYA 4JG1L 4X7SL 1P53A 4RMTA 4XRCA 4OCMC 2D31B 5SWZB 1YEEL 4XNMA 4PTUA 3LRSA 5DC9B 1Y18B 3EJYD 2FX7H 4Z0BL 1HILA 5EU6D 5CP3H 2XZAL 1HQ4A 3WHXA 4J7RA 2IF7A 4NT6B 1MELA 4QOKE 5HGAA 4H1LH 3CFJB 4DFHA 1F5WA 1OCWL 1OF2A 5DMGC 4NNYB 4U1LA 1G0DA 4RBPH 2X1XR 3RDTD 1KIQB 3IXAA 3ARFD 2VXQH 3PGDB 5E8DL 1UXSB 3MRBB 4UV4H 3JTTA 3MLUH 4IRJB 2C3VA 4M4PA 3OR7B 4XCNB 3H7LA 1KLFA 3PP4H 4L8CA 3ZHDA 1X5XA 3TJHC 4BH7A 5IV2A 2CDEA 1M71A 3CIQA 1ZGLP 1KXTB 4GT7A 4LL9A 1DQJB 1S3KL 4AENA 2FZ3B 1ORSB 4P2RA 1FNEB 2GJZA 1KN2L 4K2UL 5C09E 4R0LB 5TDPB 4J4PA 4QT5A 4TN9A 3SKOA 2KPNA 3DX9B 4WEMB 4P5TA 2B1HL 5L2JA 2FO4A 2GFBB 2HWZL 4QY8A 4O2FA 3OAUH 2R23B 4N0RA 5E6ZA 2X7LA 1WBXA 5AG9A 4M93B 4ZAKA 2FZ3A 1M71B 1GGUA 3EOYG 4OF6A 1FSKC 4JDTH 4U6HA 2CD0A 1N8ZB 3ARFA 1ZTXL 1JGLH 3AS2A 1JZ5A 5DJDB 5EORH 4RFOH 1A1NA 1RSFA 2C7UA 3NZ8A 5E2VH 3IKCA 3TH2T 1DE4A 5CINH 3VJ6B 3ELAT 1SYVA 3QHFH 1P7QB 4BK5A 3R0MA 1GHFH 3R0NA 1P6AB 4JRXA 5J4MA 4F7MA 1FL3A 3BGFB 1T04A 3RBGA 5GGRB 2FO1A 1OF2B 4NQEB 1U2HA 4TQEH 5B22A 3MCG1 4F15C 3F7VA 1RU9L 2WUBH 1C16B 4P5MA 4OD3L 4P4KC 4YAQA 5F71A 3O4OC 3LS4L 3H0TB 4KVCH 4ZO9A 3FB8B 2Y9RT 1P9MC 5FUOH 4Z0XA 4WW1B 3NAAL 4PIRF 5IMKB 4P3CH 3TNNA 3QQ4A 3WEXB 4POZC 2BVTA 3NBNA 4ZOEA 2LE9A 3U4BH 5JO5A 4LQFL 3ABZA 3QUYB 1A9BB 5IFAH 4EKXA 4E41A 4JPIA 3TWCH 3O3BB 4GRWF 2ZUUA 3QDMD 1MJUH 3DV4B 3SOBL 1QZ1A 2FGWH 4LLVB 3CC5B 4G6FD 4Y4HA 4LVOC 2Z91A 2QEJA 4NC0B 1RK1B 4K3JL 3V8OA 1ONQB 4X4ME 4F33A 3RBSA 3MRKA 2IH3A 3IETB 3QWRA 3DVNA 3SDDB 5GS0L 2O61B 4PB9H 1ZA3B 4XP6H 2XOTA 1JN6A 4OCWH 4CMHC 1A6WH 4XZUB 3HAEH 3R1GL 4NM4H 1YECL 4O51B 4G3YL 1CVSC 4OCSL 5I75B 4HK0B 3G9AB 1UB5B 3SDXE 4XP9L 1X4ZA 3DLQR 4N5UA 5IVZA 5E5RB 3GJFB 3UTZB 3RWDA 1PW3A 2ICWB 2F54A 5DURD 3SDDD 4JJ5A 3IFLL 3RVWC 2HG5A 4YHOL 1G7LB 2NY1D 4I8DA 4DJMA 5JXEA 2DLTA 4IRSB 1WCBA 1LEIB 4GS7B 3ES6B 4G43A 1QO3A 3AGVA 4L8SC 1QTYT 5EO0A 5DC0A 2DWEB 4XTRC 3LB6D 1QQDB 3D2UB 4ONGL 5C09B 5JIIA 1MCWW 1T89C 3GBMH 4QHKI 5SV4A 3ILPB 2HFTA 4UT9H 5GSVA 3BJLA 5L7XL 1KCUL 2A1WL 3CPLA 5D93C 3TEUA 1M7IB 2P7TB 5EFIB 2X1PA 3UTSA 2ZPKL 5TQ0H 3UPRA 4QO1A 3HZKB 4AEEA 2XXMB 3G6DL 1RUQH 4LCUB 3D3VD 4PUBL 3EO1A 1MLCB 3B9DA 1IEHA 5DHXB 4I0PA 4XNXL 1KTDB 3BX7C 1IGJB 3EOBB 4EQ2A 5K59E 3VXQB 4OF5A 4MHHG 2JLLA 3X11A 1ZT7B 4U4BA 3WIHL 1YN7B 1AE6H 2DQEH 3ZTJG 5EUOE 3BZEA 5F7NC 4LLQB 3VRIA 1OTTC 3N0PB 5J6GB 4WCYL 2Z31D 3ZYJA 1V3JA 1NUDA 4WFHE 4C56E 4MLSA 3WIIL 3LH2L 2DLHA 1AGBA 2P5WA 4Q97A 3HC3H 2JJUA 4RFNB 4X6BA 5DGQA 2P1YA 1EA9C 3N9GH 4UNTA 3VWJB 3SDDC 3V6ZA 2IPKB 5JOFA 4WFED 1MAJA 2PO6C 1U8LB 2Y5TA 4YFLI 3IDGB 5E9DE 3T0EB 2VISB 4I5BB 1TITA 1MCFA 2XKUA 3JVGA 4DZ8B 2G75B 3WFZA 3VD7A 5HHME 4BYHA 1ZT1B 4RDQG 4N8VB 1E4XI 5EOTB 4YGVA 3VA6A 4MDIB 1W2KT 1CLZL 2VLKB 1UWEH 1QRND 2KZWA 1U41A 4PRPD 3HMWL 2NMSA 1YYLH 4XC3H 3BGMB 1RZKH 1KJ3H 1JBJA 4ONFL 3W9EA 2HRLA 1DL7L 3E3QC 1RZ7H 1EO8H 2Y4SA 4G7VH 2X4TA 3NIGE 3UTQA 3V2AR 4LLAA 5IHUL 1KBGL 1WF5A 4MD0B 4OZHF 4P48A 5EU6A 1ZHLA 4ISVB 4L3EE 4JDZB 5HHPB 3HR5A 3VU2A 3ARWA 5DRNB 1KB9J 2IFFL 5CHNB 1IM9D 3O6FA 1S5HB 5JHLH 1CDHA 1PY9A 1OVZA 3FONB 3UAJD 1GJIA 2FJHB 2CGRL 2ORBL 5JORA 3QO0A 1BQHG 5KVEH 1KT2A 5GGTL 1O0VA 1UWGL 4XHJC 2OYPA 2W60A 4KKBD 4Y4FD 3QUXD 3ZE2F 4HS8H 4N5ED 2QHRH 2BHUA 4UAOC 4KFZC 1N6QL 1KG0A 4MJ6A 1HWGB 2ADIA 4W4NA 3LY6A 3RGVC 4K71C 5CILH 3KYMA 3RDTB 2P8LA 5KJRL 3OHXB 4NHCL 2ZCKH 4U6YB 2D7PA 2H2PC 3AMLA 2BVEA 4E41D 2Y07L 1LO5B 2CRIA 4G8IA 2MKLC 4I9WD 5GGUA 3H9SD 1JPTH 2BVYA 4OD2B 1DEEA 5ENWB 2H3NB 5ELIA 2VN7A 3LCYA 1DCLA 2F54D 4WO4B 1FJ1A 1ZVSA 3B9AA 3TT1L 1PVHA 1CQKA 1GGBH 5AWNL 3MLWL 2QLVB 3U36A 4CMMA 5KSAD 3PGFL 1ZT7A 3M1BA 4EBQL 2O93L 3H3KA 4QYOB 5IQ7L 4Q0XH 4TUKL 2DKUA 4C4KO 4XVUC 2AEIT 3UJJL 5JOEA 2BFVL 5J11B 2A9NL 5D72L 2YUVA 1I7ZB 1BHGA 4QRRE 4U7MA 4ZQKB 5F96L 2HTLD 3BFOA 1Z6JT 3UPRB 4OI8A 3O8XB 5D7JD 2UVEA 3O4LE 2P7TA 3RU8L 4Z7QE 3BH9A 3EZJB 1MF2H 1KB5B 4ZPVA 1DR9A 4G6JL 3ZE1E 2IPTL 3BIAX 3RL2B 2BVPA 1HH6B 3TYGH 4GKZB 4X6CF 1JFQH 3GMPB 1EAPB 5FDWA 4HUVA 4QRRD 3HR6A 4Y2DA 3ZKXC 1D5XA 2AS5M 4XVUD 1A6TA 3FB7A 1T0MB 2YA2A 4M6MH 5D2NC 3QIUC 3WIFB 4GW1A 4GAGH 5FYLL 2OJEA 4ZFGL 3CFEA 1CZ8H 2HJKB 3KXFE 4MGXA 4ZS7H 5FYKL 3E3QE 3KPNB 4KUCF 1Q72L 1C5CL 3U1SH 2XZAH 5ILTL 4PJ7F 1PX4A 3RVTC 5B8CA 3KHQA 4HS3B 4PJCF 3KPSE 3LKRA 2FWOA 1F3RB 3SGDI 1QNZH 4CJ0A 2Y7QB 1K8IA 1PX3A 5AYQA 3MLSH 1UQSA 5ACMA 5BV7C 3C5JB 3Q1SL 4YDJB 5IF0B 1MCJA 3QDME 3PWPD 5D7JA 3HC4H 1NC2D 4YC2C 3VD5A 3G6AB 3SY0A 2OJEB 1T3FA 3K4AA 1NEUA 3KPRE 3T0XA 3QWQB 4G6KH 4RZCA 3S9DB 3AB0B 4LDLB 4OTXL 3MLUL 5HYQB 1YEHH 2V5RA 1TJIL 4HIJA 4OLYL 5I8CB 3K74B 1D5XB 1IEAA 3QEUA 4MXQC 1NBQA 4G6FB 3G5XB 5K59F 5C0BB 5EIIB 4LHUD 1VFAB 3CLEH 4NQSB 2BXZA 1ACYL 2CDFB 3QXTA 3TVMA 3BQUA 3S5LG 5FO7A 2WV3A 2MHAA 2RJMA 3DSFL 4U49A 4OCLC 5DRXA 2HN7A 4FG6C 3IDNA 3SJVA 3U0TA 5SWSA 3AC0A 3EYFB 4DQOL 1KIPB 1UKSA 3ZTNL 5IG7B 3OAUL 5B4MC 5GGVH 4P2CG 3KPTA 3NA4A 3GK8L 3DNKA 3MRHB 4PS4H 1RURH 4ESKA 3TCXA 3MLPA 4WW1A 5SV3A 4Z0XB 3T4AB 2O5ZH 4CVZB 1IGTA 4HS6A 4WEUD 2FSEB 5FF6A 4PGDA 2BSSB 5IBLC 2P8MB 5D93B 4PRPB 4BQBA 5IB3B 1IJ9A 4X6EA 2G60L 3BH8B 4NN5B 4D2NA 4OD2A 5EUKB 3B9KA 2YZ8A 3PDOA 1SJHA 3F5WA 3MLVH 4MNHB 4NFBA 1J1PH 2QSCH 4Y5VB 3O3EA 5JQ6H 3REVB 3RIFF 3VJ6A 4HC1H 5C09D 2YMXL 2ZOKB 1RU9H 2WUBL 3ZHKA 3EKCA 1KPVA 4LDOB 2GEEA 4KVCL 4POUB 4E5XA 2Q20A 5D2LE 3TBVA 5HGDB 1R24A 3LEVH 1BFTA 1EXUB 4B7LA 1YY8A 3AFLA 3L3IA 4K8RD 4P3CL 3KWWA 3MV7E 4YBQC 4PP1D 4QF1B 4J3UA 3IXTB 1KPUA 1RUML 1AP2B 3D18A 4OV5A 1YUHA 4U1GC 1WLHA 3EYUL 4JCMA 3S8WA 4F7TB 3DX9A 3LIZH 5CJBA 4N1HB 1IBGL 4O02L 5IB5A 3D3VE 4QGTA 5DJZB 2V5TA 2OL3H 3C8KB 3SOBH 4EN3A 4FABH 4AENB 3C9NB 4PRHB 4LRNH 1WWCA 4P2QD 5CBAA 3HTLX 5FM8A 4X0KB 4Y19B 2Z35A 5IIEA 2YPVH 1Q9WA 5IT2L 4XP6L 2XKSA 4OFYA 3RPIA 5JDJA 4R7NB 5A2IH 5JZ7D 3JTTB 1K9TA 4J1UB 3X3GH 9CGTA 4X9HA 1ZT1A 1NMCB 1KIQA 3QG6A 4H5SA 1YECH 2YWYA 3PWPA 3MRIA 4NNYA 4U1LB 3T0EA 2PO6D 1D5BA 3CFJA 4DUVA 1PG7X 3KS0H 2MMXA 3V6ZB 35C8H 3WHXB 1TENA 1TZHB 1CL7H 2EDEA 1UGNA 4GQ9L 4YHOH 1JGDB 1KJMB 5E03A 3PJSB 1G7MA 4P2OB 4XMLH 1JHTA 3GSNL 3OG6B 1Z5LB 1ADQL 1NKRA 4XXDB 4Z7UA 4OZFG 4POYA 2CKBB 5D1QB 1VEMA 1GSMA 4YLQT 1A5FH 2DI9A 5FO8B 4ZFZA 2VQ1A 4QRRB 3EO1B 4X4ZA 2V2TA 4LCUA 4UT9L 2R69H 4L4TD 5CEXB 4E42B 4FQLH 3SDAC 5IR1B 5CCKL 3LN5A 2E27L 3TYFB 5M95B 3BPNC 1F4HA 3DGGA 1YNTA 3T0WA 1CR9L 2FJGB 2DIJA 3RY5A 5I9QC 4APQD 5E8EA 1C8PA 5D7IA 1CK0H 4MAYC 3U4EB 4OGYL 5HJ3A 3R06A 2VQTA 3MROB 3OGCB 3NACL 4DN4L 1NEZA 3ISWA 4YE4L 4A2MA 2JB6B 4NCC2 2X6MA 1QLEH 3HC3L 3GUTB 4KJPD 4P4RB 4HMCA 4WW2B 4Q9BA 4S2SA 2F54B 4AL8L 4JFDA 1SJEB 5J1TC 5F7FA 4UI2A 4LLDB 5DWUL 1HH9B 3SDYL 1TJHH 1UJTA 3PNWA 2JTDA 5I8EA 4HK0A 2NY0B 4YDVB 3H3BC 5BRZD 2Z8WC 2OMBA 4X6DB 1J0YA 2AJVH 5D5MA 2X10A 1EBPA 3I9GL 1MUJB 1UWEL 3BISA 1X6LA 5E4EC 4L9LA 1SMAA 5EC2B 4I77H 4ZUTB 3JV6A 5IESH 2FRGP 1XF1A 1ZLVK 1FN4B 4GXVH 5A16B 5C0DB 1K8DA 1RZ7L 1QBML 1RZ8A 3C08H 4LKCA 4M7ZB 3KXFA 1MOEA 1MREL 3SDAA 4Z7UE 1J9CT 3L5WA 2VL5A 1HIMH 2GK2A 4P3DB 3OB0K 5GS1C 3IS0X 1ED3A 4Y1AD 3JZ7A 3QXUA 2FIKB 4L8DA 1BBDH 3QEGH 1VFBA 5CSGA 4GRLB 2DLFH 3WDIA 4HHAB 4MZ2A 2H26A 1AH1A 3P0VL 1U8MA 5DJYB 1A47A 4HW6A 3TN0A 2AQ3A 5GGTH 4KUCD 4LU5L 1L9MA 2DWDA 4KZEH 5GGSB 3AB0C 5DYOA 1NGXA 4HS8L 3O6LH 3U30C 3V4VL 3AU1A 2SEBB 4EDXB 4QHNA 4YAQB 3EHBD 1RIVL 2ATPB 5ICYB 2AK4E 4P5MB 1JWUB 4LKXA 5HGHB 4J3WA 2I60L 4NQEA 2Z92B 3MRJA 1NGXB 5HYIA 1MSPA 5GPRA 1S8DB 1T04B 1BFVL 1HQRB 2XZQL 1UM5H 4QCIA 5D9SA 5H94A 5J1AB 4X98B 2ITDA 3W39A 3KR3L 1LQSR 1CG9A 4ERSL 5DFVD 4QHUB 1RJLA 5DI8A 1VFBB 4O58L 1MJ7H 5DJDA 3LHPL 3BKMH 4NP4H 2G9HB 4LIQL 1WAAF 3TT1H 2VITA 1IGIH 3C60A 3QI9B 4DEPC 3DUSA 1V3LA 4XHJD 3RAJL 3C8DA 3T2NH 5BRZE 3TF7C 1YPZA 1CDGA 1XGYH 4WGVB 5J0BA 1INQA 2L4OA 4EBQH 4X5WA 5J57B 3I50H 1JGEB 4JLRB 3RTQA 4FQ1H 3UJTH 4OD1H 4M3JA 5LJYH 2NY5H 1F8TL 4CU8A 3INUH 4O4YH 5KSBB 2OTWB 3CX5K 2PXYB 5DR5L 2XTJB 1S9YB 3GSVB 2NTFA 3HZMB 1MF2L 4UOJA 4LPVA 4PRID 4P5KB 4F57L 4NJ9H 1NDGA 5IWLA 1KJ2B 1M6OA 4IOFC 1T20B 4JZJA 4LSPH 1MHEA 3L1OH 2YD1A 4PJBA 5CJOL 5KG9B 1DFBL 3WFCH 3QDJA 2VXSL 2YZ1A 2PW1B 3ZDXE 4PBVC 1JNHB 4OT1H 2VR4A 5C0AE 4G9FE 2E6PA 1IFHH 4IS6B 3R06B 2J7LA 4H88H 1ZHKA 1F11A 1IM3A 4KVNH 1NBZB 1UXWB 4PJHF 2VOTA 1J87A 3FFCB 4U6XA 1DQQA 2G5BA 3HI5L 2P24B 4UT7L 5I19H 2VUYA 1LEKA 1WT5A 2FJGA 4K71B 3MODL 1JZ7A 3QZWG 4LHUG 3BJ91 3LQAL 2FHBA 5I1IH 3SGJC 4ZOCA 3GMLB 3GRWA 4FFWD 4ZYKA 3L7FA 3VXSD 1CI5A 1T5WB 4TRPL 2D4FA 5CEXA 1JVKA 1JGUL 1TJIH 3QCTH 4ELMF 1TETH 4S1RL 3K4DA 4JO2L 3HMXL 2B5IC 5CZKA 4WI9A 4YXKL 2MJWA 5F1SA 1E4JA 3WIHA 2PW2B 5CS7A 5INCB 4OZ4B 4TTGA 2HT4C 1UKQA 1BX2A 5EU3A 2DD8L 3DSFH 3TO2A 4LHQB 1CS6A 1S7WA 4WI4A 2VLLB 1I7TB 3QQ3B 4ODSL 4XX1E 4UQ3A 3LOWA 2VE6A 4MS8D 2FB4L 4M8QA 1ZSDB 3NFSH 5E2WL 3LN9A 5HTSA 3IRPX 3GMRA 3PXHA 1HKLH 5FK9A 2EICA 1A6UH 4JFFE 2IJ0C 2EDYA 1U3HB 1MIEL 2BSTB 1ZANL 3BP6A 2F19L 2D03L 4O2EA 2P5EA 1NCDH 1JPFA 4Z8FL 2GKIA 1IKFL 5BO1H 1ND0B 3MTRA 1QKZH 2A38A 4EVNA 4JZNA 5EBLB 4HUKB 4UBDC 3QXAB 2ZSWA 3MNWB 2XRAL 2OR9H 1ZXQA 3CAFA 1RJZA 3ZT6A 3FT2B 4KU1A 4IIQB 4GAJL 1NLBH 1P4LA 2VDLH 1LEGB 5ECJE 1KJ2A 2XACC 4XAWH 1FRGH 4WWKA 5D1QD 4DTGL 4L1HA 3PWNA 5T33L 4HD9A 4PRHA 3V0WL 4HFWB 1A7RH 3LDBB 4F9PC 4HKXA 1H3VA 4ODVH 4M61B 4L4TB 2HLAB 1OQXA 2WBJB 1LP9A 4FTVB 5L9DL 4TPRH 3GSNA 5C0CB 4N8VG 3TN0D 4BFBD 3RWCB 5IFHH 4ODTH 4HMDA 3LEVL 4HULB 1LE5A 4QXUH 1NGQH 3RTQB 2X4QB 2KQNA 3JWOC 3U4AA 1RUMH 4Y7MA 5DHVB 4B7IA 2NNAA 3K8MA 3FTGA 4LGRB 1EXUA 4HLZG 1R24B 3L95A 4X9GA 1P5UA 3FRPG 5ISZD 2NW2A 3SGKA 3OKNA 3MGOA 2E6JA 2EDXA 2OL3L 3VRLE 3E1F1 1CWVA 4FFZL 3JTSB 5DI8B 3VMOA 4OQ1A 4LSQL 1LVEA 3SE8H 4OZHE 4HH9B 4LMQE 5H94B 5J1AA 1MRCL 1I4FB 1EJOH 5I16A 4PY8J 1RVFH 4RMRA 1X9QA 1HHJB 4LFHG 4GRWB 1DEDA 3VH8A 4LKXB 5HGHA 2UWEE 4PJDE 4YHIA 2IBZY 5EZJB 4BFGA 4WJ5B 1R5VA 4MQXC 3HE7A 4N0FA 4HKJB 3SDXA 5DYOB 1H8OA 2X1WL 1HDMB 4DUWA 2CLRB 4JFEB 4KRMB 2DWDB 4XGZB 5F7YC 4RGMC 2CR6A 1B0RA 4YBHA 1D6VH 3MYJA 2ZP0T 4I3RH 2PR4H 2YKLH 4HQQL 4JPVH 4RAVA 3KPSA 2EDLA 1H3PH 3IAQA 2ADGA 3W9DA 3O3UN 3NCJL 2Q76A 1A6AA 1A9EB 3BQUB 2RCSH 3DXAB 4HBQA 2JELL 3PWUB 4P4KA 2ITCB 1A5FL 3HC0B 5BQ7B 2VDKL 3KYKH 5I1GH 3BEWB 3GJFK 3REWB 4WU5B 3ALPA 2V9QA 4BSWA 4XWGL 3D9AL 4HIJB 4X7SH 3BWUC 1SEBB 1T80A 3EFFB 4RAHA 4X6DA 2E27H 3BIBX 4Y1AA 1NGYB 1OM3L 3MLXH 2LU4A 3H9YA 2FX7L 1I3RA 1S9VA 3BP7B 1OP3K 4HIHA 7FABL 1N64L 3QCUH 2LVCA 4OGYH 1CXFA 3S5LB 5IMLB 4ZFFA 3LMJH 1T1YB 4JFDE 4LCIH 2P46B 1B3JA 3DROA 5SX5H 1Q9LB 5HPMB 1XGTA 1TVBB 1UJ3A 3IFPA 3OPZL 4OLXH 4GLRI 4MCYA 2FLBT 5T1MB 4DN4H 2CDGB 4ALAL 4G8GD 3DX7B 4WUUE 2DM2A 3F12A 1ES0B 1DQTA 3BD5A 3PG2A 3MROA 1L7TL 3BESR 4K3GA 1U8JA 2X41A 4JHAL 5IOPA 4UTAL 5DWUH 5F3BA 4L4TE 1RIUL 5EZLA 4O5LL 5CLTA 1HYRC 5T1LB 2Y6SC 1UFUA 4LQ1A 2EDFA 4DKAA 4EN3C 3GKWL 2P5ED 4PRIA 3L3OA 4HLJA 4KTDH 1T7ZA 5DGRA 5ESQB 4HWBL 2GT9A 4NPYB 3IDJB 5FA4B 2UWEF 1LK2A 1ORQA 5L6YH 3STLB 4ZFZB 4RGNC 4PRIB 2P49B 3P11H 4KHXH 1SMOA 5HYSG 2XQBL 5L2KE 4CKVX 2CKNA 4XCEB 5L8KB 2W9EH 4G8GA 3FFCE 3OJ2C 4D94A 1WEJH 1XIWC 4MAYB 2FR4B 1BLNA 1TZIB 1Q1JH 1UWXK 4UU9A 3U30B 4AEHH 4PJ7E 4ENED 3MOBH 5HGBA 1JUFA 1UZ6F 3HZYB 2WBWB 2IADA 3MREB 5AAMA 3DX7A 1GHFL 5HY9A 2YS4A 2C3HA 1JK8B 4GG8A 4X9BA 3O6ML 2COQA 3MRIB 1BAFL 3GSOB 5DEGA 2P8LB 3V4VH 1BIIB 3S96B 2OP4H 2R29L 4RFNC 4OD3H 1KG0B 5DMKB 4EI5A 2I60H 1L7IL 1FVCA 5IEHA 1GRWA 4G8GE 2W60B 3EDKA 1IKNA 4TTDC 4V2BA 2QL1A 2BERA 1KCRL 2EC9T 4N1CA 5T3XH 4YHZL 1UA6H 2PXYD 2FCBA 4RQQB 2HTKD 1F6LL 1EEUA 5KOVC 1T0NA 4Z95H 5CZVL 4ERSH 5DD3H 4LQFH 4EZMA 2IBGA 4ZS6C 3LHPH 2AKRB 4U3CA 5DJZA 3SE9L 1JTOA 5HHVH 1IGIL 4ISVA 2EKJA 5GZNC 4LP5A 3UTQB 2NY0C 3GNML 1FC1A 1FYTE 3QRGL 1B2WL 1E28B 4PJ9A 4M1DL 3I50L 3QO1B 4PJXF 1A6AB 1A9EA 2PETA 5BZDA 5JW5B 3DV6B 4GG6E 1CE6A 4PB9L 5LWYH 1IM9B 4E5XB 1F8TH 1DUZA 3G5YA 3MRQA 1ZWIA 3QZWA 4LHUA 3D39D 5DR5H 4OCXH 5D1XB 4Z7NE 3TIEA 4XGZA 3L9RA 2ZOKA 5GGRY 4K94H 2EDNA 3MV9D 3M17B 3RKDC 5EZJA 2CUHA 4LSPL 2E7MA 3RGHA 2BVOB 3WE6A 3MMEA 2PNDA 4WEBL 4RISL 3QUML 4QOKB 1CDBA 2PYFB 1M7XA 5GRUH 1I4FA 1S78C 5SWZD 5BMFL 3BQUD 3MJ8A 5FYJU 4KHTH 3T4AA 4ETYA 1YN7A 1ACZA 1JPSL 4XBPB 4Q6IC 5IBUG 3S35X 3VXQA 2J8HA 4AMKL 3GBML 3CMOH 2X05A 2VDNH 4AEIL 4NWUH 2YC1A 4MXWL 4ODXB 1KCUH 2A1WH 1IAIL 5EOQH 1RK0A 5L2KD 3UDWA 1T4KA 3QEHB 5INDA 4ZOBA 5DMIH 3LKOB 5E99L 4M7LH 4PUBH 5GSVB 4JO2H 3GSNB 5C0CA 3ULUH 3LSOA 3ARDA 2HLAA 1OAKL 2AKRA 2X2YA 2WZPD 1AE6L 2DQEL 4HCRL 5HYQA 5F7UA 2XY2A 4DZBB 1KGCD 3QFJA 3LH2H 1LEGA 5EH1A 4LLUA 2VRAA 5EIVA 4LLYB 1LO2L 2OI9C 1MCKA 3C5JA 5IF0A 5H2BB 4K94C 4QHLB 1PG7W 3N9GL 3VD3A 4NM8H 4HJJL 4HGWA 2EC9U 3MUY1 2VIRB 4OZGA 3FQTA 3RVXD 4N1EA 1JHLH 4NZTL 3C6LA 2FNBA 3HAEB 2I5YL 1A6UL 1LD9B 5F1NA 1A7BA 1ZANH 3VFGH 4EDWL 2Z9TA 5KVMC 4U05A 1QKZL 4QHMA 5DK0A 4Z6AT 1FZMB 3BEVB 4Q6IA 1JN6B 2AJXL 1YYLL 1P6FA 4UMGA 1R3KA 2H45A 4PJFE 1YNLH 3FQRA 5ISZB 3MV01 3GDBA 2O61A 1J10A 2C3XA 2J8UB 1U91B 3QISA 1T1XA 3O2DH 3P4OA 4LEXL 5EU3B 5DVNA 3C5SA 3WCYA 3TBSB 4EXPX 1IKNC 1AFVL 1N4XH 5I30H 1EAJA 3P9LB 1GC1L 1C12A 3NPSC 1BEYH 3V4UH 4ODVL 4KQ4H 4OUOA 2DTMH 1NFKA 4GG6B 1RMFL 1I7ZA 5ID0A 3GJEB 3EAKA 4X8XA 2YPKA 4LSSH 1IGML 4YR6B 2R2EA 5KVEL 3MOQA 4FQHB 4MSWB 3RQ3A 2NR6C 3BO8A 4R7DB 2R2HA 4L3CB 4YNYB 2HKHH 4WHTA 2QHRL 3H0TA 1C5BL 3TV3H 3BDYL 1WBYA 2P24A 5F3BB 1OQOA 3M07A 1T2JA 2KL6A 2GYSA 4YHKL 4TSCL 2XQYK 4IS6A 5E4EB 1JF1B 1K4CA 2F5AH 4F7MB 1KB9K 1NAML 5FKAB 4PBWD 4J3XA 2FX8L 5ACZA 4Z18A 1A6VL 4U0RC 2VZUA 3TO4C 2F9BT 3BPOB 3GI9L 5JUEL 4PJBE 2ATKB 5T1LD 2DYPB 1G1YA 5TE6H 4PJ8B 4YGAB 2GW5A 3SQOL 1AGDB 1W8OA 3MLWH 4L3EA 4AH2B 3BKYL 3BP7A 4HF5H 3WL9A 1BFOB 4JM4L 3MXVH 3VXNA 1NGYA 1FVDB 1HHKB 4OCRH 5IW6A 1FGNL 3QDHA 4KJWD 3EFFA 3TZVA 5HD8C 2GTWB 4PP1C 2X7LB 4JRXE 3B4NA 4KKLD 1KIRA 1EEYA 1UH2A 2BHYA 3UJJH 5C6PB 3BGFC 4KMTH 1ZK9A 3K2MC 4WU5A 4JLRA 5SWQB 5I1KH 3BD4A 4ZG1A 4P2RB 4BFIA 5C0JB 1I8LA 1U42A 1KPRB 2AK4D 3QQ9D 1XGQA 3RGVA 2X4TB 4U31A 3OF6D 5LKNA 3B8SA 3TYGL 4KGJA 4UDTB 1YEEH 2Q76B 4M6NH 3SPVB 4Z0BH 1I9RL 2WBJC 3BGMA 5CFHA 1HYSD 1EFXA 2C3VB 4Y4KD 4IRJA 3VDBA 5IBLD 3VWKD 3ARGA 4JY6B 4F7CA 3WFHB 2APBA 2EIBA 4MB3A 3QPQC 4JO4L 1HXYB 2ICCA 1CZ8L 1X3DA 4LSTH 5FDYA 4G8EA 1CT8A 4Y1AE 2VISA 3MUJA 1J0IA 3VXUE 2IH1B 4R0LC 5E2TH 4WJ5A 1U8LA 2Y5TB 4JKPH 5DT1L 3EOAB 3QCUL 3ET9F 2VZOA 4JGMA 2FEEI 4O9HH 4Y0GA 4GG6F 3ULSA 3VWJA 4OLZL 3WN5A 3O3AB 3RTQC 3VXSE 3RX5A 4DGVH 1Y18A 4PJ9C 2IQ9H 1X5FA 5I16B 5ITFA 2MQCA 1MCHA 5LGJB 4KMQA 3MJGX 1IEBA 1R3HA 4TUOA 1YEHL 1MCQA 2MWCA 4XPBH 5GZOC 1IL1A 1S3KH 5IB4A 2VDRH 2OTUA 4GO6B 4NKOA 2C4XA 4UDUB 1RIUH 1G7IB 2G5RA 3I75B 4ETQB 3UTTA 4ODWB 2NXYC 3G08A 4WO4D 4Q58C 2D3VA 3TBYA 2NY2D 1A1OB 4UB0H 2IPUK 3WKMH 4U33A 5DK3A 1E27B 4BSVB 1OLZA 5A16A 5BS0E 4CU6A 3RZCB 3JV5A 3ZTNH 3WV0A 1U8IA 3GK8H 1IGFL 5B3NA 4M61A 3MRFA 1S7RA 4MNQE 4U2ZA 3E6FB 5F1IA 4R4NC 1FH5H 1I8IA 3DVGA 1EMTH 2R2BA 3QHFL 3IDMB 2IQAA 1WQVT 1F4YH 4WTWA 1YQ2A 1DLFH 5D1ZB 1KCSH 4PLNC 5FIEA 4AEHL 1UB6A 2XN9A 3MOBL 3QXAA 3UTZA 1ZVHA 1MCOH 3QXDA 4AEFA 4XB7A 2E6QA 3UJIL 4BM7A 4POZD 2JB6A 3LKQB 1A22B 2IQAB 1VENA 2HLFD 3O6MH 1U2CA 2EDHA 3RNQA 1HSBA 3NAAH 4HC1L 3QUXB 3WLBB 1D9KC 5DJAA 3NFPA 4GXUM 3MRFB 5KANI 5DUBB 1IT9L 4BK4A 3U4BL 2DQCH 1U8KA 4UQ3B 1WSST 4OM0L 5IJVB 2R39A 1SM3H 1A0QL 5FM5M 4E0RA 2AXHA 2AJ3A 5IFAL 2BNQE 5AZ2L 3TVMD 1AD0A 1U95B 3D39B 3ZT5A 5HYJE 1HNFA 3QFJD 1W0VB 4W4OC 3PL6C 2PKDA 5DD3L 1IQDA 1IGCL 3S36L 2ZOLA 4HBCL 4KK6C 3VGFA 3ME0A 4IDJL 4G80A 1W8NA 5KBNC 5F8QC 4OF3A 1JJUA 1CDIA 1LWRA 1I9IH 3RVTD 2IBZX 4D9RD 4OBRA 2XKNA 2AV7A 5IW3A 1LP9F 1U8NB 4TSAL 3A6BH 2EE2A 4OCWL 2DQHL 5EC1A 1I8LC 4XCYB 1SYSA 5HYSB 5K9OB 2FX9H 3WNMA 2RAMA 3CDCA 5E1HB 5T3XD 2NY1B 1MEXH 2MCG1 3QAZB 3K2UL 3ULSB 4RMQA 1N2RB 2G5BB 4P2QE 4C56A 1S7SA 4YDKH 4KRPD 4U6VL 1KCVL 4K94L 5EBGA 2Q8BL 4L8SA 1OARH 1BMGA 4ODHL 1N0XL 2NX5A 5ITBL 1A64A 3TJEH 1HZHL 3FB6A 4YWGH 1OGAD 3BZFA 2D9QB 2BNRB 2QQKL 4PJEA 4KRLB 3HB3D 3IJHA 3PHOA 3KPRD 1RZJL 4CADB 3QUMH 1KUMA 1OAYL 3SGKC 2P43B 3GSNH 2XZCH 2V5MA 4P2RD 5MHSD 1MH5A 1OP3H 1QFUH 1NUGA 3S6CA 5L7XH 3FO1B 2VYRE 4UV7L 3FQWB 1FZKB 3QHTC 3C2AL 4K3DH 4P46C 5I66B 1FDLL 3LEYL 1I3GL 3Q5YA 4O2FB 1WTLA 3BSZL 3G6DH 3M45A 1MFCH 4GFTB 1B6DA 3VCLB 3DTXB 3KDMA 3T8XA 4G8FB 3QDGE 5CCKH 4X5WB 1CICA 4JY4A 5T1DL 4OFPA 2CDEB 4GRMB 5HBBA 3ULUL 2Y36L 3RWEB 4DKEH 2WIIA 1YZZA 4KK9D 1OAKH 4PJ8A 5DF0A 4JQVA 2FBJH 4WU7B 5EU5A 2W9LA 3NZHL 2GHWB 5J11C 4PTTA 3IDYB 3KHOA 2ZSVB 4NO2A 2ITDB 4Z7VE 3OMZA 1NAKL 1ZHNB 4Z78B 4PLOB 3GGWA 4RA3A 3OKDB 2WLYA 1CYGA 4GRWE 4NM8L 3ZTJH 4H26A 1XCTB 4HWZB 4L1DA 3BWAB 2F8OA 3IJYB 4ZSOB 4P23C 3SDYH 1HXMB 3GM0A 3G04B 2YRLA 4L4VD 2I5YH 3V6OC 1CTNA 4W6WB 3QWOB 5CEZL 1H5BC 3SJVD 1RZKL 2V2XB 2DQGH 3NIFE 3VFGL 4PLKC 4JO3L 1NCAH 4XCYA 4MA3A 1F3JB 4I1NB 4U1IA 1TXKA 2AJVL 1J1XL 1ZGLM 4U2YA 4JFFD 3DOSA 4G7VL 2DMCA 1V3KA 3QPQD 3HG1A 4PJGA 3CU1A 5IESL 5L0QB 1KBGH 5TQ2L 8FABB 3HRPA 2ESVD 1NFIA 4GXVL 1PYWB 2WLZA 4L9LC 4LEXH 2AV1A 1T5XA 5I0ZA 1N4XL 3AM8A 5I30L 3VFPA 3IU3A 5FHBH 2FJFB 4Y16A 1W0VA 4MVBD 5DMGD 4F7EB 3O4OB 1EX0A 4D0DA 1CXKA 2BY2A 5ICXB 4JANB 1FN4A 4WW2F 3MFGB 5C08E 2WW8A 3QEGL 4JKWA 1VFMA 4HEPG 4OZIA 2AK4A 3CDGA 1XH3A 1SEQH 5D71H 5DUBA 3VG0L 3TIDA 2XWTB 3W0WE 4LVNC 5I74B 2EYRA 5F70A 1HSBB 4FFWC 1CF8L 4X80L 1QSED 2HRPL 3BHBA 4JFFA 3FQTB 3MUGB 4HS3A 2Y07H 4OLEA 4JFDB 5GISH 1JPTL 2HT3C 1FLRL 3ULVH 2E9JA 3KYNB 5GGQL 4Y2DD 1JTTA 4Y19D 4Z7WA 3QFJB 4MJ5A 5D6DC 2R2BB 2BNQB 4Y4HD 3EOTH 2BSRA 5BZWB 1ZS8A 1I85C 4Z7OE 3KYOA 1L4IA 1YMMA 4O58H 4QWWD 5FOBB 1U8IB 1TQBC 3SJVE 4MNQB 3RIFK 1OL0A 1S9XB 3ZE1F 3CZJA 4YXLL 3UTSD 4MMZC 5J56B 4KROB 3ARYA 4IJ3B 3MXVL 1XGYL 2MPAH 3TBWB 3S4SG 1G6RL 2ICWI 4JFEE 2GCYB 2FBOJ 1U58B 4G6JH 3C87A 3VGHA 2Y06L 3MXWL 4M5ZL 5EN2A 3UTTB 3INUL 4WTXA 1JFQL 1FHGA 5DFWH 5FO8A 1FP5A 3PIQB 4J6RL 2OTUB 5J1SC 2H6PB 1IEBB 4AQOA 4KROD 4NJ9L 3QUYC 3PJSA 1F42A 2A83A 1ZGLB 1JGDA 4M6NL 3L1OL 5E5UB 4ZS7L 5FYKH 1C5CH 1I1AB 3U1SL 3EO9H 5DTFA 3O9WC 1DFBH 1ZLUK 1LO5A 4P9HC 4DN3H 1QNZL 2LAGB 3LV3A 4OLVL 1U8PB 2ZG3A 5EPMA 25C8H 4HV8B 3EDEA 4H88L 5DD1H 3QZWB 4JKKA 4LHUB 2BRRL 5E8OA 1QPXA 4K9EH 1OB1B 1YJDH 4NN7C 5E5MB 3LKSA 2X9WA 3ECBB 5E94A 1J0HA 1TCRA 4QLRA 4F8QA 5F9AC 1ZHBA 2P42B 2B2XL 5A40E 2FH6A 3QB7C 3MV8B 5CBAB 5ESVA 3CLEL 5I1DA 1CGTA 3MGTA 4MVBC 4XPBL 3BPCA 4NJAH 4KRPC 1H3GA 4BFIB 2RQ8A 5JA9A 4JVWA 1T7WA 3HNTH 2AEWA 1N0LA 1A1MA 3LN4B 1ZLWH 4UNUA 3MRRB 4F7TA 3BPCB 4MQTB 4NDMB 1LO4L 4PJ8C 2VDPL 3CFDB 5GS1B 3IXTA 2DD8H 3ZSSA 1QHPA 4KROC 4XMPL 3UYRH 5D7LD 4NRZB 5D1QC 1DBJL 2DBLL 4FQJH 1BFOA 3F58L 4I13B 1FVCB 3DBXA 4ODSH 4PB0H 5C8JA 1CFQA 3W82A 4B53A 2HMID 4XBEH 2XA3A 5C0IB 4BQ6A 3V5DA 4YGVB 4G42B 1KPVB 2XIDA 3NGBC 4Z77A 2EDKA 2G60H 1AJ7H 4LARL 2D03H 1NCDL 1FO0B 1S7TB 4GG8B 4YHNB 5FKAA 1PEZA 5GS3A 5FYJH 1DLFL 4OKDA 1MIMH 4PG9A 1U8HA 4ZXBC 4UU9B 2YMXH 1MHPL 1PAMA 5FV2A 2FR4A 1WBYB 4M9OA 5B38B 4JAMB 5AEAA 5FYJE 4G8GB 4NKIL 5L8LB 1FRGL 5J6GA 5B38G 2W65B 2CR3A 1Y6NR 3GM8A 3NTCL 1YDPB 4B0MM 2XPGB 1X5HA 2EE3A 3KPLB 4KXZH 2W59A 3MRHA 3KPMA 3STLA 1KJVB 5DJ8A 1ORQB 1LK2B 4TPRL 4HJ0C 4OM0H 3GJEA 4WIQA 2PN5A 1U58A 5TPWH 2AXGB 1SJXA 3S3PA 5CP7B 4K23H 3O6FC 4Z7VA 3QXVA 4RX4D 2RFXB 3ILQC 2CDFA 1DTUA 3RUGB 3DMMB 3I3BA 3C5ZD 3O8XC 4ELKB 4Z76A 5DZNA 4QRSA 4A2LA 2IANA 1MWAH 3QEUB 1OGAB 4FFZH 5LGHL 2LVEA 4LASH 3KPOA 1H3XA 1Y0LB 4KDTC 3RX8A 3P77A 2VKWA 3O0RL 3SE8L 1BZ7B 1QSFA 4HZLB 3SBWA 1WCBB 4KMLB 4OLWH 1EJOL 4KDVA 1S7UA 1G7LA 3TCLB 5CD3B 5F1NB 3WXVH 1A2YB 1Q9LA 5KSBF 3HE6B 2Y7QA 3K2UH 4PY8I 4OI9A 3MUGA 3S5LA 5IMLA 2FWOB 3N1QC 4RAUA 2X89D 2G2RA 1QFPA 2WIMA 4HIHB 3IVKB 1KCVH 1VACA 2JE8A 2RIKA 5H2BA 3KPNA 4JKLA 4UNVA 1OARL 4LLYA 3GIZL 2XWTA 2ID5A 4U7SA 4UTBL 2Y6SD 4HEME 3MLZL 4YWGL 1FFPA 1VKXB 3S34H 1TMCB 1FNSH 1Y0LA 4OGAC 5MENB 5IM7B 1CFTB 1TPXB 4NO0A 5JZ7C 4N5EC 2I9TA 4MJ2A 5KS9E 5BQ7A 2CPCA 2BVPB 3PWVB 3WNKA 2OQJB 4YDLB 2EO1A 1MAML 5TFSL 3ILQD 4UV7H 4X6DE 4D9QD 1EHNA 1REIA 2P5EE 1NCCL 2I27N 2VDKH 1X5AA 3KYKL 2R1WB 3O3BA 1N3NA 2AXGA 2VWEC 4ODXA 3QUYA 1LMKA 4MD4B 2ERJB 2DDQH 2DL2A 4UUJB 4XPTL 1P7HL 4O2CA 1T03L 5JO5B 2EIZA 1KCLA 1ZMYA 5D2NA 1NGZB 3M1BB 5AZEH 2WWKO 3MLXL 2C4FU 4Y5XC 1CGYA 2CQVA 3SBWC 4K8RH 4LLWB 3UROR 5HHXH 3V7AE 5LCVL 3K46A 1N64H 3BMWA 3A6CL 4ZXBD 5CAYB 1I7RB 5K9QI 4JO1L 1AGCA 1GOFA 1KTLB 3WUWG 1WITA 2EZ0C 2XFXB 4ELMB 1FYHB 2H1PL 3TA3B 4X7TB 3SO5A 5BV7L 1UADC 1L7TH 3JUZA 4R3SA 3VFNB 3KYMB 3TIEB 1JWMA 3QIUB 1ZWIB 1D6EB 3QIWB 4ZUSB 3I9GH 5F9WB 3UPAA 2DQUH 1WWWX 4JM2A 4ZS6D 4HIEB 3L3GA 1EUUA 3PDGA 4HKBB 2A6JA 4U6TA 3WSQL 1CIDA 5BZDB 4OGXL 1CVRA 4K3EL 1J1XH 3ARGC 3CFDA 1E28A 4PJ9B 4KK8C 4HXAL 3QUMB 3UBXI 1KTRL 3BD3A 1HIML 1S7VB 4YDIH 4X7DC 1YEJL 4U1SB 1NC2A 2JF1A 4R0LA 3FJTA 1J18A 4HCRA 4GRWH 5KW9H 3P11L 5TDOA 4XNQB 1QFWI 1JGVL 2YPLE 3E6HA 2W9EL 1B90A 5T3ZD 5IMOB 3VMPA 2J6EA 4XI5C 4CNIA 2ZNXA 3MRPA 1KLUA 2UZIH 4FQIL 1EHLL 3VXRE 3W9EB 3FT2A 1DBMH 1U3YA 5D71L 3RX7A 5DMKA 3RTQD 2VXVL 3FN0H 3T1FA 1JPFB 1FFRA 3V5HB 3KJ6L 5H35B 3BP6B 1GPOH 5DS8B 4FQXB 5FO9A 1CTOA 1JK8A 5JOFB 5GJTH 1V05A 3IU4H 5GISL 3QHZH 5GGQH 3ROLA 1HHIB 4AM0A 1NDMA 3MV8D 12E8L 3BDXA 3VMNA 5JLZB 1RFDL 1UA6L 2OXHA 1MJ8L 3DHJA 1MHHA 4N0CC 4XCEA 2BMKB 3VRIB 1U8NA 3RAJH 2QV2A 1HCVA 2H9GB 4RNRB 2NQCA 3Q48A 1Q0YL 5I6XB 2PW2A 1XF2A 1KTDA 4M7JL 3VXUD 1DVFA 5F72S 1GH7A 1ADQA 5MERA 4YXLH 2ZOLB 3DX6A 4NZRH 1RUKL 3RP1A 5KVFL 1HKFA 1G6RH 2JKXA 3GMNB 3BVNA 3HCVA 4V1DD 3CPLB 4FQQA 3PHQA 2EIDA 4A6YB 4RMVA 2OXGA 4Q7DA 2P4AB 4HIIA 1LEKB 4FA8A 4J3TA 2GSGB 5C09A 1E6OL 3HI6H 4ZNCD 3U9PH 5IOPB 2D2OA 3K4ZA 1EEZA 3GSUB 3D39E 2DTSA 1F11B 1ZS8B 3B9EA 4JFHE 5EO9A 3IDIB 1AD9A 2V17L 3F12B 2GTZB 4J3VA 3B9KD 5HHQA 4OT1L 5BVJA 1FV1B 3PXJA 4KZDL 1GVIA 5FYJD 5CUSH 3ZDZE 1AI1L 4TVPD 3CZFB 4R4FH 2GAZB 4RISH 4ZFFB 4RGMB 3QUXC 5BJTB 5GRUL 1T20A 4JZJB 1DBKL 2B4CH 4LAJH 3N50A 1UACH 1W72L 5ANME 1I3RB 1S9VB 25C8L 2NTFB 3PL6D 3E6FA 3LQAH 1VHPA 4Y1AB 3TIDB 2A6KA 3CD4A 1IAOB 3OGOE 1SEBA 4Y2DC 4M6OL 5J6HA 2X44D 4AIZA 4TRPH 4HX1A 3CDGB 3ARPA 4PRDA 4S1RH 4GBXC 1NSNH 1YYML 3MRKB 3SDDA 3WD5H 4YXKH 1XEDA 3JSSA 4R96B 3BEWA 4D0DB 1JGEA 4U1MA 1ONQA 3U46A 2W07A 5JHDE 1P9MA 2ARWA 5DMIL 7CGTA 1ODAA 1G9ML 3VGAC 4Y5YB 3B3IB 2QKIB 5HHNA 2UY6A 3DXAD 4JRYE 4WHYH 1QLRB 4XNUH 5JW4N 5IB4B 2W92A 4QHUA 3HG1B 1LO4H 2GJ6B 2J88H 2EO9A 4NQDE 5EWIL 2XWJA 4EQ3A 5IB2A 4OCYH 5D70L 4XMPH 2X4PA 5E2WH 1HEZA 3QDMA 3ZZ1A 4FQJL 3RVUD 1HKLL 2V2XA 1VGKA 1AR2A 1BD2A 4HKJA 1K3IA 1MFAH 1JWUA 1IKFH 1DQDL 4QRPA 2PTVA 3DI3B 1JHLL 5JTWA 3RL1B 2BC4A 3PABA 3AU1B 1T89A 2VDML 1BD2B 3P30H 1NCWH 4UT6H 43C9B 2OR9L 3OKDA 1JI1A 3BUYB 4RFEA 5CMAA 4GAJH 5IFJA 1J5OH 1F90L 3TN0B 3NCFB 5I75C 2B4CC 3OAZK 5I2IB 4IMKC 2C7UB 3NZ8B 4KAQL 1A7RL 4X8JA 3HE7C 3BAEH 1RULL 2GSIB 2IFGA 1RIHL 3MGOB 4UOW1 3ARFB 4NKIH 2FYYA 1QLFB 3VXMA 4ODTL 1XGQB 3L95B 1AFVH 3EFDH 5F89A 2NNAB 5DHVA 2H32H 3L3DA 1BEYL 5FM5O 3V4UL 4DEPB 2CIKB 4R96A 5C71A 4CL7A 2DTML 1TTUA 1BZQK 5KTEH 2IALB 5TPWL 4LEOA 4MX7B 2NY2B 2BOCA 2B8OT 4PJ7B 4L4TA 5GRVK 4L5FL 4BQ8A 5I66A 4LSVH 3T2PA 2QADC 5FGCB 5HI5D 4XB8A 1C5BH 2GITA 1TDQA 4YUEH 3MV9A 1T83A 1KC5L 4KC3B 1HH9A 4LLDA 4HUNB 1RJZB 4NN6B 5BOZG 5DRWB 4APQC 4YHKH 2DQTL 5BS0D 6FABH 3IJHB 2X4UB 2AQ2A 4DFIA 2N7BA 2OS7A 5GS2D 3VDCA 3TA3D 5DEZA 4DW2L 1PLGL 1DN2A 4PLJC 3NA9L 4HUUA 4NUJB 1HINH 1VCAA 3OKLA 1KF9B 4L8SB 1JF1A 3QQ9C 1CE1L 5I18L 4FXLA 3EYVA 3QIUD 2QSQA 5HVWA 1EERB 5EA0L 4PJIE 5HGAB 5TE6L 3T04D 3PWLA 5FGBC 1M1SA 1N2RA 3SQOH 1JF6A 2PR4L 2YKLL 1HHGB 5DJCB 1FZJB 4RGNE 3P4NA 4HJGB 2EXYC 3VXSA 2BZDA 1CICD 4WHTB 1YNTB 3AXLB 4UZGA 4JM4H 3DYOA 3PHQB 1XF5B 4PTUB 4XC1L 5C0FA 1FGNH 3LN5B 1A7OH 1BX2B 1Q0XL 2VC2H 5ICZA 1LK3L 3I6GA 4Z7WF 1MCNA 2JELH 5MERB 4NO0D 3WFBL 1PG7L 4ZD3H 4KH2A 1DVFB 3FQNB 1QSZA 3UXFA 3L6FA 3VFWB 3TGXA 4N0UB 3P9LA 1JPGA 3S37X 1T1WB 1IQDB 1MCIA 1BD2E 2HJFA 1T5WA 1NCCH 1T1XB 3D39A 1MCPH 4OF7A 5FECB 1XF5A 3QDAA 1OM3H 5D6DA 1I9RH 2BY3A 4ZSOE 1FZJA 1FZMA 5FV1L 4GKSA 4RCAA 3LMJL 5L2KB 3FFCA 1WWBX 4LSTL 5EB9A 2BY1A 1WIPA 1WGOA 3EYOB 3W11C 3OPZH 2M2DA 3KPPB 5HHXL 3LAFA 5H35A 3ARED 4XBGA 2OLDA 4MJIE 1NC4B 5I71B 1BVKA 3TBTB 1A3LH 2IBBA 2PW1A 4NKDA 4HGWB 4R7NA 2XN9B 3DHMA 3RPIB 5DRWA 1JMXA 1JIBA 1XZ0B 2R0LL 3KNBB 3FRPA 2IQ9L 4UILL 4CNIB 3C8HA 2GITB 2Y25A 1UH3A 3MCLL 5IMOA 5F6HJ 2N4IA 4P5KA 3WYRA 1HHHB 4G6ML 1YQVH 2E7BA 1P84J 2WWMD 4JFOB 5DA0B 4ZODA 5HI4D 3MR9B 4PJFA 1XAUA 2DQUL 2BOCB 2CIIA 4XNZC 2YRZA 4N90E 5HD8D 4UB0L 1FG2A 2VLKE 3WS3A 1TNNA 5INDB 4V1DB 4OGXH 1H3WM 1RK0B 1JHKH 4K3EH 4J12A 1INQB 3HFML 5F89B 1EDQA 3L3IB 2R4SL 4FMKA 4K7FA 1CQYA 4WW2C 2VXUH 5HYEA 1MPAL 3O6FD 2EXWC 4ETQA 4Z7NF 1WFOA 1EO5A 4P9HL 1WEJL 3TO4D 3KPQA 4NKOB 1ZEAH 3ARDD 4TSBH 3L7EB 2D0FA 1JGVH 1U3ZA 2VN4A 3CVHH 4K55A 2J4WH 4Y4KA 5T5FH 1SJHB 4LNRB 1Q94A 4MQ7A 2XQYG 3MO1B 1WT5C 5E95B 4X6EB 3PABB 2R29H 4H8WL 2VXVH 2BSSA 2V5SA 2EC8A 4LLMB 2QSTA 3QI9D 4EDXA 4HWNA 4LVHC 2X9XA 3KJ6H 4U0RB 3TO4B 5CBEB 5T3ZE 5F9WC 4G8EB 3QDMB 1HEZB 5FUZL 2VNCA 3RWHB 5FB8B 3L5JA 4IIQC 3H9HA 2DQCL 1F6AA 1NLDH 4DOHE 4NQTA 1KXQE 3OJMB 1GGCL 1FIEA 4KJYA 4GRLA 3SPVA 5ETUA 3P2TA 1KN4H 1RZIB 4PJ5B 1F13A 3QO1A 4YBLB 2HVKA 1IGCH 3S36H 3QRGH 3CFIC 1YEIL 4LKCB 3OAZH 1Q0YH 3BP4B 1WC7B 1RAMA 1EZVX 4KKAC 5C0DA 3IDUA 1JF5A 1ZT4A 5T3ZL 5HVFB 3GEWB 5LWYL 4ODUB 3U0WL 4L9LB 5EC2A 4ZUTA 1TIUA 2YN5A 3FB5A 2C5DC 4TSAH 4TVPE 1IAKB 1Z9MA 4HKZA 1RHHB 2RB8A 5B21A 2DQHH 1BZ9B 1FGVL 1LNUA 1CLOH 2OK0L 5MI0B 4PJHA 3VXNB 4Z7VF 4QGYA 5JW3H 4YDJA 2XWBB 3UEZA 1WZMA 1MEXL 4EI5B 3NOIA 4OI7A 4PJIF 2WANA 4QRTB 1OAZL 4GW5B 3FKUS 5B39A 1SJEA 3VFRB 1JRHI 1AXSB 3RA7L 3B2UC 2DB8A 4EEEA 3A67H 5ACZB 4ODHH 1N0XH 4HFUH 1AY1L 5ERWA 1LGVA 3S97C 3KVQA 4KZDH 3VFMB 4KHTL 5F6IB 1AI1H 1TZIA 1BJ8A 1G7HA 3RVXC 5C0RH 3OXSA 3RWGA 3X17A 2X89A 2W0KA 3IS1X 5MEPA 4Y2DB 5FHAH 4GKZA 4MA7L 2XZCL 3CMOL 1C08B 4OZGF 1UACL 5DHYA 4ZNEE 4NWUL 4QXGL 2BOBB 3TYFA 4FQHA 4MSWA 5DQDL 1A3RH 5EZOL 5ACLA 1FDLH 3C09C 3HPLB 3GRWH 2ZKHH 1I3GH 1NFDE 2LAAA 4ZUWB 4MD5A 4HIXH 2IPUG 5E99H 1EH9A 1BFSA 2V2TB 2IC2A 1UM6L 4D9LH 3AY4A 4CVUA 3U9UB 2JJTA 4QEGA 1KJVA 1G7QA 1XF2B 5DK2B 3UZEA 3EYSH 3GSRA 4JFXA 4ZO7A 1OAQH 3BQUC 1G9EA 4HCRH 2F5BH 4LP4A 3VI3E 3MBEC 4F9PA 2WUCH 2CUIA 1QRKA 5AD0A 5HVHB 3TLRA 2CJUL 5EUOA 3BW9A 5BS0B 4LFHD 3OZ9L 2PTTA 1NAMB 4JQXC 4YH6A 4F2MB 2AGJL 3FQRB 5ISZA 1U8JB 5F3HB 1AKJD 5D96C 4CN1A 3ARZA 3CGTA 4D0CB 5I0DA 1Z3GH 5KSUB 3B8YA 2W0LA 5C9KA 2CDGA 4KI5F 1D5BB 2W91A 4EN3D 4XMKH 1UJ3B 1S7XB 3DROB 2Y23A 4OJFH 2YHGA 1R6VA 4H20L 4Y4KC 1DQDH 3P3YA 3STZB 2VL4A 3ULUD 2UVFA 4J1UA 1MLBB 3Q5TA 2Q86A 2VDMH 3GSQA 1T66D 4M7KH 5KANG 1NCWL 4UT6L 3IAPA 1A6ZB 1ZA6B 1LNUB 1AO7A 4KI1A 3QO0B 3O2DL 4PRBB 4XNQA 1NL0L 3VG9C 3FHQA 1H15A 1NEZG 4NDMA 4KAQH 4KI5E 1GC1H 3O6FB 3ZL4L 4EN3B 3CFBB 3BAEL 5F7LB 5ALBH 5IEKB 4YPGB 4KQ4L 3CFCH 2BDNL 4PRAB 1NC2B 1UWXH 5F9JA 1RMFH 2H41A 1BQLL 1FNLA 2HVKB 3QUMA 5HHOE 5CJXA 4JM2F 5GGVY 1AP2A 4RRPG 1XR8A 1FG9C 2I25N 3QQNA 3T3PF 5FYKU 2HA1A 3KWWB 2XNAA 2FD6H 3KLHC 2L7JA 1QSFE 1G6RA 2C1OB 5HGDA 3PGCA 1AHWA 2HKHL 1M05A 1F6FB 5K9JL 4R2GD 1VADA 1SEQL 4LSUH 1CXIA 1QP1A 5EOTA 4NN6C 5E8NB 3VG0H 2QQNL 4JFEA 3X3FL 2G75A 4FXKB 5EBMB 3HNVH 1SBSL 4OIIH 2PF6A 2DJUA 3HPJA 3V5KA 2FH8A 3V6OA 1GGIL 3L3JA 5SX4H 4LLMA 1J8KA 4Y5VA 2XFXA 3VI4F 2FX8H 1X7QB 4GBXB 4OB5L 5EUKA 3NCEB 1A6VH 5KSAB 1FLRH 3ULVL 4XNZB 1KENL 2XYCA 4DW2H 5LBSH 4WI7A 3VE0B 5FF6B 3M17A 3L5IA 5DVKA 1YMHB 5D7SL 2RGSA 1CU4L 4LLWA 3K3QA 3V8CA 2YD4A 2HAZA 3Q5OA 3ORJA 3X11B 3MLRL 4AT6B 3PIQA 2WMPA 1G9MC 4O2CB 5HDBE 3HUJB 1DUZB 5EN2B 2A9ML 4LCCB 4JPKH 4P0DA 5J12B 4X4MA 4JR9H 2MPAL 4L4VB 4ELME 1FBIH 1MCSA 4OFIA 3DIFA 5EFIA 5IKCB 1A7OL 1GXEA 1OD7A 3TVMB 43CAB 1CD1A 3LRHA 3X14A 3OSKA 4MJIB 2UZYB 5JA8B 3RWCA 2BVQB 5EIIA 2ZUYA 2CIIB 1PG7H 1G7PA 4ZD3L 1WIOA 2YOCA 3FL7A 3G5XA 1BOYA 5E56A 3OKOA 5CKGA 5HDOA 1CGVA 1IEAB 5L88L 1XCQB 2FIRT 3HS0B 2BSRB 4UIKH 5BZWA 1WAAA 3DMMD 1CGUA 1W0WB 3ARXA 3NCMA 4R90L 2BNQA 4RZCB 4G43B 2N1KA 3F7PC 1X5GA 4JO4H 5EDXA 1ZA6A 1OTUD 3A0OA 3KYNA 5E2TL 2MCPH 4DN3L 4P57A 1MFDH 4Y16D 1ND0A 5L8JB 4UIMB 5E8PB 3HE6A 4OLVH 2MQ0A 4Q2ZB 5MEOA 1T2XA 4DGVL 1HOCA 2EYRB 1XIWA 2D7TH 2EH8L 4JQIL 5L2KA 4XZUA 1BJ1H 1A3LL 2F8VA 1IAIM 4GW1B 4UV4L 2VE6B 4ZO6A 4OZIB 4C83B 5HVGB 1QFWM 5CEYA 2VDRL 4FNLH 4F2MA 1KB5H 3S37H 4MXVF 1EAPA 5FDWB 5HI4C 4HUVB 2J2ZA 3RL2A 4Y16B 5GSRA 5HYJD 5CZXC 3LDBC 4G6MH 1KB5A 4ZPVB 1R5IB 4M00A 1T5XB 1LDPH 1VDGA 2BNQD 4Y4HB 4X99A 1KYOJ 5C3TA 3FOMB 3DV4A 3HNTL 3KLDA 5DK2A 4DKDC 5DJ0B 3FQNA 4ZQKA 2GY7B 2AJZA 3HKFA 4X9IA 2AERT 4IMKA 4ZUWA 4R4BB 3EW3B 5ICZB 3PL6A 1IGFH 4QYOA 1JHKL 1YDPA 3HFMH 2DBLH 3DURB 1C5DA 2ARJA 2VLMD 5GJSH 2VZ1A 5F7MC 4XBEL 4IRZL 2R8SH 1FJ1B 1FVEA 1F4YL 1TCMA 1ZVSB 5IVXF 2P5WE 5MEPB 4RFOL 5J3HD 1F97A 3IJSA 4LARH 2BXYA 4Y5XB 4OV6F 3RI5F 1FIGH 1IZKA 3GGWB 5ERWB 4PREB 5IP4A 3O81A 4HUUB 2B39A 4U6YA 1JNHA 4XI5D 5FYJL 1Q9OB 2AK1L 2LABA 2WQRA 2NZIA 1YY9D 1FFOA 3VXRB 2JJWA 3G5VB 1LE9A 1XGTB 4C59B 2Z93A 1N5YH 4PJBB 2W9DL 4H8WH 1K5NA 4GW5A 4X7EC 2Y1VA 2B0SL 3EO0B 1FL6B 5BOPA 5JXED 4GRMA 1SM3L 3GBLA 2X40A 5FUOL 2Z8RA 1S9YA 3VFVB 1AQDB 1KELL 1INEH 1MVUA 3QJFB 4PRHD 4JFDD 3T4YA 3VXPB 5L2JB 2V5YA 4M02A 4PV8B 1RJYA 3JWDC 2NPLX 4GAFB 4IDJH 3JWNC 3HR5B 1MJUL 1JZ4A 2PYEE 5BRZB 1DANU 3PWUA 5EU6B 3KPRA 4EUPA 2DLGA 3RDTC 4GUPB 4ZDHA 5ESVB 1YEIH 3T65B 4ZO8A 5HHMB 3I84A 2G9HA 3BIKA 5DJ6A 2GSIA 5FAAA 5FXCH 4H0IA 4GBXD 4PJ5A 1RZIA 2B1AL 5D7KE 5T3ZH 5LGHH 4PJDF 3GHEH 4YHMH 1F6AB 3NIFF 1S5IL 5HI3C 1FO0L 2EXWD 4HUWA 4RMSA 1BWWA 3BKJH 4YDKL 3BUYA 5CP3A 4RMUA 3UC0L 4OCSH 2DQJH 3WXVL 3BN9D 3QR2A 3UCRA 4Y8AA 3SGEI 5ITBH 1BVLB 1HZHH 2EH7L 4NT6A 3BT2L 3P0YL 2IPKA 2VLJB 3B6SB 2LTQC 2QQKH 4R26H 4G5ZL 1CGSH 4M43L 3IFLH 4PJXB 3I6LD 3RA7H 3GSWA 3GIZH 1DBBL 2A83B 3GBNL 3S34L 3QFJE 1U8MB 5DJYA 1PDKA 4FQ2H 3IGAB 1FNSL 3C2AH 3D69B 5IVOA 3WMSA 4KRNA 3RZCC 1HWHB 3ESVF 3LEYH 4MA7H 5ID1B 4I4WB 1P7KA 3UBXB 1MFCL 4QXGH 4OGAD 3BXNB 1YC8A 2OL3B 3TT3L 3UTSB 1SJVA 2HLFC 3SDXF 3O2WL 4Z7WE 1AD0B 1U95A 2DRUA 2L7UA 4MZ3A 5T1DH 3TBWA 3T0AA 3WUWB 3QT2A 3WHE0 1IQWH 4HIXL 4YBQD 4WFHD 5C0EB 5FYLE 1P7QD 4PRDB 1UM6H 1NANI 4D9LL 4I18B 4K07A 5J6HB 4XNXH 2A6KB 3EYSL 3NZHH 4JREC 3VRJB 3RUGE 1FNGA 2DQDL 5DC4B 3WS6C 1BQUA 2V7HB 5LCVH 4IRSA 1P4LB 1LEIA 1UZ6E 1NAKH 3A6CH 5D7LE 5F7KC 2GAZA 4KTYA 4JJ5B 2ZSWB 1TQCC 2FHCA 4JO1H 4WW2A 1NMBL 4GRLC 4JFFB 3CXHK 3L3KB 4XP4L 2CRYA 2NY4D 1J8HA 1B0WA 5EO9B 4JO3H 3H9SA 4H20H 4NWTL 4P2RE 2NXZD 4PJCE 5IMMB 2AW2A 1AGFA 1TNMA 4M7KL 4XC3L 5TQ2H 1ZA3A 3CXDL 4JGUA 1URLA 2N56A 3O2VL 4R2GB 1UT9A 2DM3A 4MAUL 1I7UB 1RZFH 2R1XA 1S9KC 2FJFA 1RJCA 2HJFB 4KI5C 1XF3B 1CGXA 5C70A 5INCA 1JPGB 2AV1B 1U92B 5FHBL 3IRZA 4ODWA 1YEJH 1PJ9A 3VFWA 2YUWA 4AG4H 5ID1A 2NW3A 3L6FB 5ALBL 4YHPB 1DP0A 5DQ9B 2CKBA 4Y4FC 3THMH 4PJEE 3IGAA 5T5NG 1Z5LA 2CGRH 2BMKA 2ORBH 4IMLA 3O6KL 4U1IB 5F1KC 3SKJH 4M6AA 1PBYA 3F7YB 3VGDA 1UG9A 1KNOB 1H3UA 3N1GC 4XT1C 3VXRD 2IMMA 4X80H 2VB5A 4K7PX 3DXAE 4JRYD 2R0WL 3O3AA 4PJIB 4N0YL 3CVIH 3ZKXB 2HRPH 3PWLB 2YPLD 3OTTA 1SY6H 3S88H 5A3ID 3HUJF 5TH2B 3FQXA 1NCBH 5KJRH 1WZ1L 5JPMB 3C5ZB 1AQKH 1FL3B 4MB5A 5F7DB 3T1FB 3HA0A 5JOPE 1F4WL 1GIGH 4S1SL 1EZVY 4PTTB 4EUPG 2NY7L 4M93C 1KCKA 1ROWA 2Y72A 1KLGA 12E8H 5D6CB 5LBSL 1V7ML 3HE7D 4L4VE 2HTKC 4PRHE 1DLHA 3T65A 1GGBL 4U6HB 1CU4H 5AWNH 3E6HB 4F37F 3UTTD 3U79A 4Q9RL 4HUXB 5C0JA 2IAMC 1N7MH 5BRZA 3KJ4B 3FAWA 3IYLW 4HDIB 1RJYB 3DTXA 3KDMB 3FMGL 5C92A 4GAYA 2A9NH 5D72H 2Y06H 3MXWH 4HT1L 4AZ8A 1RUKH 1EEYB 2X4RB 4JR9L 3T4YB 1YY9C 3D18B 1FBIL 1UVQA 5KVGL 5TDPA 1X5KA 2X4OA 5C0GA 3T2QA 1AQDA 2ZUQB 4BA8A 1CFVH 1FZKA 5JHDD 4EI6A 2A0LD 3T3ME 2H2SC 3D87B 4PJ9D 4M1GH 2IPTH 4JM2B 5E6IA 1FL6A 3OKEB 4NO5B 1F4XH 1E6OH 4NRYA 5DVMA 1K5NB 3HI6L 2VLJD 5I1AB 2DYPA 3DO7A 1GZPA 2F58L 1FAIL 4MA8L 1FFOB 3BZFB 5FCUH 4KKBC 4R90H 3W39B 1EJ6A 3DO3A 2F53E 3GSXB 5K9QG 2NX5B 4MNHA 3MJ9L 1HQRA 2DF3A 5HYJB 3C5ZA 5CUSL 3MRJB 2VLRA 2GQHA 5DMYA 1MFDL 2BRRH 5JIKA 3HE6D 1R3JB 1YJDL 1TJGH 2HT2C 4MA1C 3MNZB 4R7DA 1U93B 3CX5J 3DURA 1FORH 5D2NB 5E4IA 3BKCH 3U2SB 2XWJB 5IB2B 4G6KL 1R3LB 3ZMRA 1RD6A 4YHLL 1I1RA 5IG7A 2H26B 4H1LG 1F45A 4ZMAT 4N8CL 1BGXL 1YYMH 3FFDA 4A6YH 2ED7A 1D3CA 4IOIA 1RUPH 1FNFA 5HHNB 5E7BA 1WFTA 2Z4QB 1FPTL 2AAVA 4IDLA 1OPGL 3SCMC 2XV6B 4V1DE 4JREB 4X6CE 3ZDXF 3U46B 2ADJA 1G9NH 2H32A 3O11A 3UYRL 1KOAA 5JXEC 4CMHB 4B41A 2E8YA 5J13B 4PB0L 3CDFA 5B3JE 1G84A 4CVXA 3ZHLA 3O9WB 1K2DB 2I9LB 5EWIH 5TDNA 2R1YA 1CD8A 3H9SB 4NQCE 1FE8L 3NFPB 5CSBA 5EZIL 3VXUA 4RWYL 1AJ7L 3SE3A 3NIGF 3RNQB 5GS2H 1Z2KA 4YDVA 1VESA 4TYUA 2G2RB 1E4XH 3I2CH 4MWFB 4FQPA 1MIML 4XPGH 3D0LB 3ARUA 2IG2L 1KIUA 3VI3F 1N26A 5D5ME 2XI9A 5EULV 1NCNA 3GUTA 1F2QA 4AK1A 3S4SB 3CFEB 2ESVE 3G9VA 3PWJA 5DLML 4AJ0A 1NC4D 3GFUA 2E7CA 2GTZA 1J05A 3T77A 3NTCH 1A6TB 3IB4A 1OGAA 1S7RB 3UTTE 3FO2A 3JWDH 1YA5A 2B0SH 3GMPA 1G7PB 4ELKA 3KXFD 1VPOL 3DGGB 3DJ9A 1MNUL 1QFWH 2P48B 3WUWA 4LSRH 2RFXA 4OUUA 4KY1L 3JV0A 3BVNB 1NGPH 1N5AB 4WHCA 3GMNA 4Z7VB 5C2UB 1I1AD 3W5MA 3FT3A 4L4VA 4FTVD 5KS9A 4E41E 4OZGE 4LBEB 2V9RA 3RJDA 5JIHA 1MY7A 1MWAL 4UDUA 3FHAA 3S3JA 5CD5C 2JJSC 4XBPA 2XPGA 1WZLA 4FABL 1IL1B 3BI9X 1S9WA 4LRNL 1R3HB 4TUOB 3RVVC 1I75A 1D9KA 3O0RH 3DX8A 2AJUH 1MHHB 4Z7UF 4NC1C 4PJEF 4JAMA 5B38A 4HK3N 5TE4H 3WUZA 1KC5H 2HT4D 2PYFA 4K7PY 5IT2H 2H3NA 1MI5D 4NZUH 2DQTH 1AO7D 5ENWA 6FABL 4U1NB 4YZFF 5KSAA 2HH0L 5GGUB 4PG9B 5BW7A 4JZJC 2YEZB 1PLGH 3I6KB 3CH1A 3C6SA 3OHXA 1CT8B 4OIBA 4OSUL 3GJFH 1I1FA 3IDXH 4R4ND 1O7VA 5EA0H 3ARSA 2ADIB 4CW1A 1EGJH 3BT2H 3P0YH 2J3SA 2XY1A 3Q6GL 1IAMA 4G5ZH 5C08B 1CFQB 1EFXB 1M05B 1H9VA 4GQ9H 3MJ6A 4NNPH 1DBBH 5B8CC 3VFOB 5FUCC 4NRZA 3E2HC 5DJ6B 2Z35B 3GBNH 4NBZB 1XR8B 4XXCC 3VXOA 4F37K 3RGVB 5TFSH 3C9NA 5FYKD 1AC6A 4MXQD 1CLYH 2YR3A 4JG0H 3ROOB 4PRAA 3QAZC 2HFFB 3LN4A 3CSPA 5A2JH 2WAHA 4PFEA 4URTB 1YN6B 3RPKA 4JE4B 4Q9CA 4MD0A 2R69L 5LQBL 4YJZL 3VXPA 3I85A 2DDQL 4FFYL 4XAKE 2E5EA 1T03H 4FQLL 1C7SA 4XAKD 3K1DA 3VFVA 1ZHBB 5AZEL 3VFOA 3CLFL 3TNMB 3RY6C 4PGBA 1Z0NA 4L3EB 5TF1L 2E3VA 3OF6A 5E1AA 2VLKA 5E8OB 4UBDD 2EDOA 2NXZB 2PYED 4I0CC 3WJLC 3GSOA 3VXRA 1BVZA 4OAWA 2V2WA 2DQDH 4YE4H 4YC2B 3V4PL 5FGSA 1QYGH 2VXQL 1WUNT 2ENSA 1QLEL 4PRNB 3B9KB 5BV7H 5D1XD 5HI3D 3WO4B 3BH8A 2MNUA 5F3HA 4C55A 3UTOA 4AL8H 4X6BB 2PTUA 2I07B 1XGPB 1HSAB 1KTKE 2R0LH 4PY7A 1NMBH 1NAMA 4UILH 4GKNA 3PP4L 2FSEA 4X83A 1IGTB 3MCLH 3QNZA 4HZAA 4LLQA 4B50A 5D8JL 4F58H 2VABB 6CGTA 5DURB 5HHOD 4NKMB 1H3TA 5DHVH 3UZQA 1G7QB 4N9GA 4K2UH 3PL6B 3ULUC 3E2HB 3LQMA 1HN1A 5FA4A 3U6RB 5KAQG 1KIPA 5ID0B 3P0GB 2AJZB 3O2VH 5ESQA 5JNYB 4XVTL 3I6LE 3FT3B 4PGEA 2GCYA 5DJ0A 3SO3B 1NH6A 1RZFL 1MREH 3RVVD 3ULVF 2YD3A 3EDDA 2P8PB 2FECI 4U1KA 3C5SB 2KH2B 5C0BA 1MPAH 3AS1A 3DUUB 4AG4L 1ZTXH 1JGLL 3BGAA 1EHLH 4ZTOH 4NO0B 2DLFL 1R3KB 2DWEA 5IM7A 1J05B 4TSBL 3T77B 5I8CA 4C83A 2NY5C 3THML 4ZFOL 3P0VH 4M1CC 3H3PH 1ES0A 2HFGH 3FOLB 3OAYK 3VFSA 5I6XC 3CVHL 3O6KH 3Q6FA 4P59L 3V52L 4ZNEA 5T1MA 1V3MA 3QNXB 1AXSA 1JV5A 2EE9A 5D96B 2JIXB 3C6LB 3GJFA 4UIMA 3SCMB 4LPUA 3EUUA 4MWFA 4QRQA 4TOYL 3LS4H 2N7AA 5JMOC 5I17A 3EJZD 1JV5B 3RRQA 1FL5A 4PJHB 3VXUB 5CZXD 3SDCC 2EYTB 1MJ8H 3CUPB 4HZLA 3HMXA 1EVTC 3O9WA 2NY7H 1NLDL 1T0MA 3MYZA 2ENYA 2GK0B 1XCQA 3S35L 2XN9D 1WFUA 4QRSB 3BKML 5ICXA 3UZVB 2H32B 3O11B 3BP4A 3LSOB 2ITCA 3HC0A 4Q9RH 1QSVA 4YO0A 3T2NL 2EDDA 3P9MB 3MLTB 3N1MC 1N7ML 5DZLA 4WV1A 1PYWA 4LOUC 1OT1A 2X1QA 1T6WA 5KAQF 4OZIE 3HRZB 4JFQB 2QHLA 2YC1B 4J23A 4M5YH 3U6RA 3KPSB 3TH4T 4Q9QL 3MA9L 2A6DA 1MFBH 1FGVH 2JCCB 1YPZE 3KPLA 5GS0C 1F3JA 1HDMA 3U36B 4CMMB 3PQYD 3DRTB 3MJ8B 2BK8A 3QWOA 2D4DA 4N0FB 5GIRB 2R15A 3CMGA 3QEQD 4HPYL 4HK3J 1HXMA 1OAZH 1CD9B 3RY6A 5D2LF 2I07A 4WY7H 4H26B 5E2UL 5CJOH 4JGJA 2F58H 2OJZL 4XP5L 3WFCL 2VXSH 3QIWC 4PRNA 4HFUL 5HSFA 2HFEB 2IAMD 1S7TA 4ZPTA 3MJ9H 1BQHA 2WINB 3V5KB 1IFHL 2F15A 2VLRD 3RDTA 3JTSA 5C0RL 1NFDA 3AS3A 1WISA 3ARRA 4G42A 4IRSC 2WIIB 5FHAL 2I26N 4UT7H 5EU4B 4NO5A 1L0QA 1VGEL 1A4JB 3MODH 3SKNA 2PCPA 3QA3B 1G6RB 3DV6A 5I1IL 4JY4B 1CICB 5DQDH 5EZOH 3VXTA 1QR1B 5JORB 2FECL 2R23A 1LE5B 1JGUH 2D7MA 2VLJE 1Q8MA 4P5TB 5B39G 3W2DL 1D7FA 1YN6A 2DBJA 5CHNA 3VI4E 4LCCC 3T09A 4OKVA 2FLRT 1FAKT 4JN2A 1K6QL 1QPPA 3FZUC 5GHWL 4HKXB 3CFBA 1ZHLB 4XNUL 2ZUQC 2VSCA 3QULB 3U48A 2F5BL 3MV7B 5IV2B 3ZLQC 4TNVF 4WCYH 5BXFB 2E8ZA 4OCYL 5D70H 2VUOA 1MI5B 3P4MA 2OCFD 1AO7B 2HT3D 4DAGL 4W81A 1TCRB 1B4JL 1CXHA 4CADA 3ECBA 3OR7A 5IEHB 4KQ3L 4M9PA 1C1EH 5C08A 1MFAL 4FFVD 1PY4A 3VGBA 3QFDA 2EDBA 1IC4H 3NFSL 4XBGB 1MCLA 5JPMA 2F19H 2M26A 3MACH 4HXBH 4S1QL 1T1ZB 1I9JL 4BZ2H 5TH2A 4OJFL 1S7SB 4NKQB 3AS0A 2Z8SA 1F90H 3BP5B 3RVWD 3MJ7A 3I2CL 1EFXD 4S1DD 2X42A 2JB5H 2EDWA 4KDTA 4M4RA 4X7CC 2WM0A 5C7XH 4U1NA 5SX4I 4R2GC 1U36A 4IBLT 1TTGA 5FECA 5IHBA 1NLBL 2H8PB 2VDLL 1DL7H 3BW9B 5DLMH 5BS0A 2K7QA 2OBGA 3CK0H 3HLAB 4GXUN 3DX8B 4P46D 4HWEL 2H6PA 1CIUA 5T1KB 1NL0H 5EUOF 1S9WB 3AREA 3EFDL 5I1CH 3CCHA 3GSRB 4JFXB 2R4RL 1MWAB 2YD5A 1QBLH 3ARVA 5EU7E 2IFFH 2VMFA 2NZ9C 4LBEA 1R5WA 5BVPL 1TVHA 5IFHL 4ZAKC 2GT9B 4PJ5E 1MNUH 1YEGL 3V0AC 1XF3A 1OTSC 4MNGB 1PSKH 4M48H 3L7FB 4L5FH 1NGPL 3ZO0A 4BZ1H 4MLIA 3LEXB 2XG5A 4LSVL 1U8QA 3F7QA 2FD6L 3V6OE 2YWZA 4LIQE 4MCZB 1GC1C 1AGFB 3F62A