4JKPH

Restricting hiv-1 pathways for escape using rationally-designed anti-hiv-1 antibodies
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
222
Chain Sequence
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRWGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords gp120
publication title Restricting HIV-1 pathways for escape using rationally designed anti-HIV-1 antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 42
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH01
5FGRA 3O6FB 2AJSL 5C0RL 4MSWA 4MJID 3U9UB 5D7IF 4OI8A 2RB8A 4GUPA 3MXWL 3E2HC 4MDIA 5DJDA 1QFWM 1U93A 4JKKA 1DBBH 3IVKB 3PHQA 4JJ5A 5I1IL 4L1DA 5IFJB 4K3JL 3P73B 1AGCB 1AR2A 2YMXH 4R96A 1KLUA 5SV3A 3MRBB 1F2XK 3KPQB 1Q94A 3KJ6L 3M17A 4RRPG 1NPUA 2X1PA 3BH8A 3GFUA 2OXHA 3OAYH 4MD0A 5IJKC 2MQ3A 1XIWC 1N2RA 3GGWB 5DRZB 5LQBH 1RUQL 5ICYB 1Z0MA 3NCYS 1ZLWK 3QG6B 3X11B 5JXEA 5FYKU 2AAVA 2EDTA 3RTQD 3IDMA 2IWGA 4OCXH 3G5ZA 2ESVB 3S34H 5TH2B 1T66C 4PJIB 4YQXH 2AJZA 2X1WL 2J8UE 3O4LA 2EE3A 4XPTL 1MVUB 1XCTA 5EUOE 3OXSB 2UVFA 2DN7A 3P3YA 4AL8L 5IMLA 1MRFH 1A0QH 1NGWA 1FG9C 3HE7B 4WI5A 4XPAH 2R2CA 3BSZH 2AJUL 4I3GA 2Z31A 4NRXA 3DRQB 1TNMA 5E2JA 2APBA 3MUJA 4ZS6C 1A14L 1KCRH 1S3KH 4V1DD 1EAPB 5BZWB 3MRNA 3S5LB 2QSVA 3PABA 5I1CH 5SWSE 4MZ3A 2X2YA 2PO6D 1D5MB 4KJQC 3QCTL 4Y4FB 3EO9L 3LPGA 1TQBC 3IKCB 3F7YA 1SYVA 5IHBA 2F19H 3IYLW 4UV7L 3B9KB 4L5FH 2A6DA 3U2SB 2P5EA 4ODHH 3MYJA 5FKPA 2PXYB 3DECA 5CAYB 1WWCA 3AREB 3B8SA 2IGFH 1T66D 3ILPA 4XNUL 1U8MB 4JZJB 1TITA 1OTSC 1NL0H 1OLZA 4NKOA 5EU7E 1J8HD 1JZ3A 1BZQK 5SX4H 3CNKA 4QXUH 1BQUA 1ZK9A 1XAUA 3TFKD 4ZOCA 2F5BH 4Z18A 3C5ZA 1C12B 3TESA 4DN3H 5I19L 2VLKA 4ZS6D 4JDVA 4YFEA 1KB5L 3BGFC 1FHGA 1HN1A 4M61B 1L0YA 2MTPA 3JWOC 1SEQL 1MAMH 3CPLA 4KJQD 2UY6A 1MCPH 1BD2D 4EI6B 1T21B 5ID1B 2EDQA 4LIQH 3UO1L 4TVPH 3H42H 2E9IA 1UEMA 3NN8B 1X3DA 2ATPA 4YPGB 3NCFB 2AJVH 1R0AL 1I3GH 4PJEA 1LD9A 5TQ0H 3GSNH 1MH5B 2GAZA 3O3DB 3EFDH 4YDVB 3MJ8B 4H88L 5A16B 4G9FE 5DRXA 4PB9H 3CMOH 4DEPC 4Y5XC 4XVSL 1FQ9C 3HZKB 3P0YL 3TA3A 5MERB 2XZQH 4R7NA 3NIGF 3DX9A 5F7EH 1TJGH 2V7HB 2DQJL 2I07B 4XTRD 4OTXL 1HH6B 5HDBF 1CVRA 1J18A 2FH6A 4I2XA 3D18B 3V4PL 1JZ8A 4Z7WB 1UWEL 3HRZB 2ZPKL 4KI5F 1C16A 3MLVH 1HHJB 1A2YB 5FDWA 4HUMB 4Y1AD 4C58B 3QT2A 3UBXG 2O5XH 4LP5A 4QGYA 3EDJA 1ZVYA 1JE6A 2ICEB 4MJ5B 2JJTA 5E8EB 4JO3H 4KPHH 2ZUVA 1YQVL 1KBGL 1BIIB 5H8DA 3O8XA 1FNGA 4OJFH 1ZHKB 1JHLH 4GFTB 1K8IA 4OBRA 2UY7A 4NDMB 4MD5A 4PJDA 3UMTA 2KKQA 4YUEL 2CH8A 5GJTH 3F5WB 2VXSL 4GXVH 1ZVSA 2WLYA 3W0WA 5E1AB 3U30C 4XBEH 4PRAA 5J13C 1N6QL 2R1YB 2XWTB 2XYCA 1Q1JL 4J3VA 1CYGA 5DUBB 4BK5A 4ACPA 2Y36H 2X4TA 4KKAC 4BFIB 3GK8L 1F3JB 3WKML 3QIUC 1YNLL 1CL7I 1H3XA 1LGVA 3QUZC 3MOQA 2EYSA 2J8UB 4PBXA 2Z35A 3WCYA 1OGAD 4EXPX 3VFOB 3TH4T 5EUOB 4N1EA 1M7XA 2I5YL 1KJVA 2XACC 4NN6B 4HAFA 1CWVA 1WFOA 4Q6IA 4C56A 3O4OC 3QA3A 4NZRH 3BPNC 4NN7B 3IDNB 4G9DB 5J11C 2MWCA 5FHAL 2VDNH 3ARBA 2HJLB 5AZEL 2DD8L 2LFGA 5ISZA 2B0SH 1HXMA 5DD6A 3SQOH 3IJHA 4MCYA 1OAQH 1QZ1A 2NPLX 5DHYB 3BUYA 5SWSB 1NAML 1OPGL 2JELL 4O00A 1WQVT 3OBAA 4NNXA 4R26L 4P3CL 1QBLL 2IANE 4NQTA 2D4DA 1ZLVK 3ULVE 3NBNA 4I9WD 2XNAA 1K8DB 3TCLA 5I73C 1D6EB 4O5LL 3RDTC 4UILL 4TTGA 5EORH 4CMHB 5F9JB 3QUZD 1I8KB 5EOCH 4KVCH 4QHMB 1NGQL 4WDIA 3GZKA 5T3ZH 1UWGH 1GGIH 1WUNT 3CJJA 3O2VL 4Y8DC 1UH2A 5IQ9A 2A2QT 3DYMA 4PLKD 3SKMB 5GJSH 3WS6A 1YN6A 3VGEA 2ILLA 2NYYC 5KSUB 4MWFB 3O2DL 1DP0A 4KV5F 3CDGA 4GRWE 1F5WA 4JDTH 4XCYB 4RX4D 5DSCB 1YNKL 4PD4K 4GG6E 3Q5OA 3ZDZE 2ITCB 2PYED 4Z76A 3L9RA 1CD0A 4RGNE 4P57A 1S5HA 4B7LA 4X5LA 3FB5A 3NABH 4M6NH 3VG9B 3KDMB 3UTSD 3U0PB 1DLFL 4S1RH 3BJ91 3MLXH 1ZTXL 4JJHA 2RHEA 1U58A 3PWPD 4OSUL 4OT1H 4HDIA 4U6HB 5AG9A 2QBWA 4UAOB 1KFAH 3RX8A 3WJLC 4QKXB 2BVPA 4XCEB 4IDLA 2XA8L 4JN1L 4LLWA 4GKNA 1A6UH 4JFFD 5CHNA 3RZCC 3PWUB 2BHUA 4F9LC 4MCZB 1GYAA 4NPYB 4G9FB 4ALAL 4HUXB 2H1PL 4JY4B 3RL1B 2UV3A 1YDPB 3VGGA 5IF0A 4HFUL 5F7DA 1ADQH 2NYYD 4EN3B 4Z77B 4G7VL 4P9ML 3RWDB 4K9EL 3O3EB 3VXUD 3ZE2F 4ZFZA 9CGTA 5EOTB 5H2BB 3KPTA 2VXQL 1BF2A 1B2WH 1A47A 1SY6A 2VXUL 5T1MA 3WJJC 4U1SB 3HNTL 3BKML 4DUXA 4LSVL 3FHQA 2QEJA 1HI6A 5EU3A 4AK1A 2ERJC 3SGEH 1VDGA 3QXDA 3MRMA 1P4LB 1INQB 3VFVB 4XH2B 5JDSB 1DBKL 1BBDL 2H6PA 4I1NB 4JG1H 1HDMB 5HY9B 1KB9J 3P4MA 2DL9A 1CGUA 3TF7C 2R23A 5ESVB 4HF5H 1Z3GH 3EOBA 3AB0B 3JV4A 4PJCF 4PREB 4OGXH 4ZD3H 3LH2H 1I9IH 2GTZA 4WI9A 3PWLA 3SDXF 4YHKL 3RZCD 4U6VH 1Q9WB 4JFXB 2A74B 4XVTH 1WIUA 3ZKNC 4JFPA 1OM3L 3PP4H 1N5YH 2P8PA 2I26N 1YEJL 1H3TA 4MNGE 4PG2C 2H8PA 2X89D 2Z93B 3X13A 4NHCH 2XZCH 5FUCE 3FT2A 1P4IH 1KJ2B 3W9EB 4YHNA 1FJ1A 1BGXH 4HPYL 2CUIA 2Z0BA 4TNWF 3LS4H 4P5TC 4XNMB 1AGEA 1BQHG 3INUH 5EULV 1VESA 1YPZB 4TSBH 3NZ8A 5IROC 3DROB 5IMMB 4WNQB 3SDCC 4JFOA 2VXVL 2Q3ZA 5FHBL 2EC9T 1BWWA 3CFKB 3GSXB 5DWUL 2VDOL 1YYMH 5D5ME 3BZFA 1I7ZB 4QT5B 1LP9F 1RIUL 2VLRD 3MLSL 2NY7L 5ESQB 1N64L 1M71A 4NO3A 5IJVA 4FZ8H 5IP4A 5I1GL 3ZMRA 1F58H 3A67L 1QPPA 5F7YC 4LOUC 1AQDB 3ZKND 3MLUL 3ARTA 1M7IB 3TBVA 1HSBB 5C8JA 3RBGA 3WUZA 1HHIA 2YRZA 1I1AA 4J6RH 5JA8B 4FXGA 2EKSA 5E6IB 1NQBA 4XNZB 1JN6B 1KN4L 4AEIH 7FABL 4X4ME 2YXFA 1WBYA 4XZUB 2IANB 1VFBB 2P7TB 5F1KC 1G9MH 3TBTA 4JZOB 2UZIH 5IEHA 5TF1L 5I1LA 5FGBC 5IM7A 1N4XH 3PL6A 5BRZA 4RMUA 4Z7VE 1NKOA 3VXOB 3VI3E 2B5IC 4HBCL 4LL9A 1IARB 5IHUL 3RIFK 1V7ML 3SDCD 3K4ZA 2X4QB 3O3AA 1VACA 3WIFB 3P2TA 3ARPA 3ARDB 4QYOA 3E0GA 5BS0A 4H8WL 2I60H 5IMKB 3UEZA 5I0ZA 4E42B 1QFWH 1FL3A 3LQAH 1CIDA 4XBPA 4GRWB 5LWYL 1DUYB 3TWCH 3GMMB 1CICA 5I1DB 1MHEA 3LDBB 1UA6L 1DBMH 3JWDL 3TO4C 1YEFH 1IC4H 1YY8B 4XMPH 1E4KA 2R4RL 3KLHC 2ZUQB 3MSPA 3FO9B 3MLWL 5IOPA 4HIXH 5F7UA 1OWRM 1TQCB 2AJSH 1NDMB 2AJ3B 3OGCB 1JJUA 4ESKA 2CKBL 1YQ2A 4NT6B 4UU9A 2A6IB 5C0EA 4BJLA 4JR9L 2XWBA 3P4NA 5I17A 4JY5L 5FXCH 4YXLH 5JPNA 3IS1X 4YNYA 1LEIB 4AEHL 1GC1L 4PP1C 5ETUA 2B4CC 2QSCH 3V6OA 4QHLA 2FJFA 1RSFA 3QRGL 5H94A 2P5EE 1OGTA 5DJZB 2HFFB 2BRQA 2XQYG 4I13B 4KAQH 3GM0A 1JPGA 1JTOA 2EYTB 4WI7A 1HILB 2CMRH 3WFHB 4F7EB 1RU9L 3TCXA 4FQJL 1G7HB 4GSDH 4M3JA 5IGXL 1TZGL 1D5BB 4WENB 4OZHA 2QR0A 3VFTB 4RDQF 1YEDB 3TO4D 1NMBH 4ENEC 3D85A 2H32A 3IFPB 4YBLB 4BQBA 5CLWA 4OV5B 4LSQL 5CIPB 1FDLL 4U1IB 1JGVL 3BKYL 4KHTH 3PIQB 3DBXB 2IMMA 1NLDL 4ZXBA 3BH9A 1KLFA 3OJMB 4XPFL 1E6OL 5C0JA 2W0KA 5FYJU 1HXYA 1BFVH 4LCYB 4NZTL 5EBMA 4IRSB 1TCMA 4JO2L 4Y5VC 2WWKO 3MYZA 2AJUH 3MUZ1 3WDJA 4GRLB 3EZ8A 3PV6B 1A4JB 4PP1D 3B4NA 5GGTH 2KZWA 2DLFH 1XCQA 3T0EA 2WWMD 1BQLL 1CT8A 4AM0B 5GS1C 1FNLA 4G6JH 3AFLA 1NC4B 1ND0B 3OMZA 5ICZA 3ILQC 2H32H 3SDAC 1KIRB 3VFSB 1KB5A 4M8QA 3QDGA 2J8OA 3SGJA 1S7RA 4WCYL 4N9GB 3JTTA 1HHGA 5KAQG 3WE6A 4KQ4L 3FQRB 5FO7A 2PUQT 2VISA 3OPZH 1LE5B 2IAMD 4O51A 4N1CA 3F7VB 3CFCL 1X6LA 4NQED 4LU5L 2NY3C 3NA4A 1KPVA 4G8GD 5ID0A 1UZ6F 2FH8A 5D5MB 1R3HB 4JFHE 3VGHA 3HMXL 3B9DA 3BXNB 2ZCHL 2VWEC 1CGTA 3L6FB 1M05B 1FNEA 4M7ZC 2BERA 1IKFL 4LMQE 6FABH 5FYLL 4R8WL 2A77L 1CIUA 2AJXL 4GUPB 2DYPD 2LTQC 4MDIB 4P2QA 5J06A 5DJDB 2CDEA 3PHQB 4JJ5B 1EMTH 1Q72L 1IJ9A 3OR6B 1OWWA 1WWBX 1FIGL 1T2XA 3ILQD 4P2RD 1QHOA 5J1AA 3SDAD 1T2QL 3UO1H 4W81A 4XMKH 1F3DJ 4R96B 1KLUB 4PJDE 5BV7H 1Q94B 3M17B 4KFZC 2EDYA 4MD0B 2FLBT 3D69A 5FOBA 1E28A 4UI2A 5GRVL 1Q38A 5GRYA 2F53A 4AQ1B 2VITA 1CE6A 1N2RB 1F4WL 3AM8C 3O6FC 4F7CA 1FGNL 5AUMA 2CRMA 2VJXA 3QWQB 3IDMB 3G5ZB 4OIIH 4EVNA 3SN6N 4DFHA 1T7WA 4NZJA 2AJZB 3O4LB 1UADC 1ZOXA 4OTXH 4MB3A 1XCTB 4CVWA 1J1XH 3EYQD 2N1KA 4LVEA 4S1QH 4P46B 1BJ1J 2D7QA 4C56E 5KSBF 1KTLB 1HEZA 1NGWB 2Q8AL 4JG0L 3WSQH 2V7NA 3EW3B 3MOAL 3SJVE 1Z9OA 2Z31B 1SM3L 4NRXB 4PJFF 2BX5A 5BO1L 3QZWG 5ISZE 3SDDA 2DLHA 5JO5A 4HUVA 3NA9H 1BP3B 1TTUA 1KBGH 5I15L 3PABB 2XTLA 3ESUF 4N8PA 5LKNA 4IJ3B 3VFPA 4Z7NE 1CFNA 4HS8H 1NGPL 1UWXH 3F7YB 1G7MB 1SYVB 2P8MA 4XRCA 3W11C 3FN3A 1EAJA 4X6DF 2P5EB 5FKPB 5F1OB 3E6FA 2VXSH 3L3DA 3I6KB 4HGKC 1U42A 2HLFC 4N90D 4UB0H 5I1EL 1JK8B 3TYFA 5C0DA 4Z7OF 2FO1A 3HE7C 4GAGL 4LEXL 3QIBB 1Q1JH 5ICXA 1NAMA 2DLIA 5E5RB 4NKOB 1OAUH 2DBLH 1V3KA 1NC2A 3HUJA 5HYJA 4L4TA 3TN0B 2WK2A 1RK1A 4N0YL 4Y4FC 5K9QG 4GG6F 3C5ZB 5TPWL 3ARSA 3B9KC 4LDLB 1MFNA 4WI6A 5DC9B 2Z4QA 2PXYC 1GGBL 4ELMA 3IDIA 5CILH 2CLZA 1U92A 5LGJA 3GSOA 1MCBA 1WEJH 3AREC 2A83A 5FHAH 4QTIL 5E7BA 3K8KA 3CPLB 4W6WB 1ETZA 5AZEH 4JZJC 1S9WA 2DD8H 4Y89A 4LSTH 3A6OA 2ZUSA 3O2DA 5HHPA 2ATPB 1P1ZA 5D2NE 4KRPD 1NAMH 3S6CA 2HLFD 3T2NL 1FN4A 2A9MH 1CFVH 3KJ4B 3HE7D 5J7CC 3E8UL 5H37H 4R26H 3ULUH 1QBLH 2GAZB 5JR1H 5CZVL 3L3IA 5DRXB 3QXVA 2EDRA 4CDGC 2MQ0A 4PYGA 3WXWL 3IAQA 2YA0A 4FS0A 4O5LH 2VKXA 4OF8A 4UILH 1RY7B 3TA3B 3T77A 2Y23A 1E4JA 4R7NB 1RVFL 3VG0H 1NGQH 3DX9B 1LEKA 2W0LA 5DGRA 2F8OA 4PGEA 3O2VH 4OZFG 4PG9A 5KS9E 2X5PA 2O5YH 4KKNA 1ZVHA 5BQ7A 3HAEH 3H3KA 1MHCA 2Y7QA 1C16B 2PXYD 1FL6A 2DLGA 5IB4A 3ARED 4BUGA 5FDWB 3ET9F 2C7UA 2VQUA 2BY0A 3KXFA 5ALCL 5JIPA 1JGLH 4HS6A 1RUPH 1U8OA 2P45B 4Y4HA 4M43L 5TE6H 1P53A 3P0VL 4L9LA 4X6BA 4GT7A 2AW2A 2GJ6E 3O8XB 3SO5A 1QLRB 1FNGB 3CC5A 1K8IB 3MROA 3JZ7A 4FABL 4MD5B 4PJDB 3D0VB 3NAAH 1CL7H 4HGWA 1FORL 3MLRL 4PRBA 3SCMA 2O61A 1ZVSB 3W0WB 1C5BL 2NX5A 3CX5K 3GJEA 4PRAB 4MA8L 3NIDF 4ALAH 1K5NA 5ITBH 1I9RL 5DHXB 2EXYC 3CXDH 2WBWB 3KYNA 2X4TB 4HFUH 4F33A 5E8DH 4G6KH 3THMH 2D3VA 4CKVX 2EYSB 2Z35B 1MCLA 2VXQH 1EGJH 1SBSH 2XRAL 3MREA 4GAJL 1YMMA 4LAJH 1QO3A 1KJVB 3QPXH 5HHXL 2C3WA 4HK3N 4Q6IB 4C56B 2J7LA 2DM2A 3QA3B 4LLVA 1OTTD 5DVNA 3CFDA 3D0LA 2D0FA 3LMJL 1GPOL 2FIKA 3SJVB 1JV5A 3ARBB 1BBDH 3G5YA 4N0RA 4MZ2A 4XP1L 5DMGC 2VZ3A 5ISZB 1PZ5A 2OJZL 3SKNA 4PUBL 1HXMB 5DD6B 5GISH 1QYGL 3L3GB 3IJHB 4Q9RH 4MCYB 3GIVA 3QUKB 4K7PY 1YEKL 3ARFD 4XCFL 4YHKH 1CGSL 1PVHA 4FN0A 4ZODA 2PYFA 4WW2F 4NNXB 5K9JL 4PJAF 2HAZA 1OM3H 5EU6D 1SVCP 4NN6C 2EXYD 3D39D 4PD4J 3TCLB 1CLZL 3JUZA 4Z7VF 3N9GH 5D93B 5BOZG 4NN7C 2APTA 5D7JA 5EN2A 5KSAA 5BRZE 3KYOA 1KCSH 5GPRA 4KROD 4WDIB 4ODVH 4D3CL 4HPYH 5I8EA 2A9NL 3I02A 4MX7A 4LLAA 3EYSL 3MCKA 4GQ9L 4YHYB 5IFAH 5IQ9B 4JFYB 1CGXA 1WAAA 4AZ8A 5BS0E 1YEGH 5DUPH 3RWGA 3CDGB 4JQXC 2YA1A 4QO1A 4Z0XA 1T80A 2DF3A 2VDOH 4U3HA 5DMGD 2J6EH 2GHWB 3K7UA 2GK0A 1RIUH 4L4JA 4WU5A 5J4MA 4Z76B 3E6HA 3L9RB 4P57B 3C6SA 3HNSH 3S36L 3FB5B 4CMHC 3VD3A 1DLHA 2XZAH 1U58B 2BVQB 5EU7C 4R3SA 3IDXL 3JV6B 4HDIB 1U0QA 5D2NB 3AMLA 4NO0D 1OHQA 5CGYC 2BVPB 5GGVY 1KN4H 2FO4A 4LLWB 1AHWB 4GKNB 4ZQKA 5E70A 5HBBA 3VI4E 4LBEA 1MJ8L 4JEGB 3HRPA 3ORJA 5FV2A 2CKBA 1KXVC 3VG9C 3OJ2C 4JHAH 1KJ3H 4HBCH 1I3RB 3IETA 2DKMA 3LEXB 4ZFZB 5MEQA 3BISA 2YPLE 3BP6A 1NUFA 3T3ME 2XY2A 2X4UA 5T1MB 5KS9B 5E24E 3K4DA 3ZE1E 5HI3D 4H8WH 4HUNB 1BMGA 1HI6B 4UAOC 2JJUA 5DT1L 5EU3B 2BNQA 3GNMH 3O6MH 4WUUA 2YD3A 4URTB 5CD5C 3QXDB 2YD6A 2E6PA 2ARJA 1X5LA 4NQCE 2H6PB 3KYAA 4G8EA 2EH8L 4XWOD 4YE4L 3S37X 5J57B 5DJ0A 2GSIB 3LAFA 3P4MB 2E9JA 3FFDA 3I9GL 4OZIA 2R23B 4I77H 3U46A 2ED8A 5CGYD 3EOBB 1UZ8A 3JV4B 3BP7A 4Y88A 3X17A 4EN3C 2GJ6B 4O02L 2GTZB 2R1WB 5C0CD 4S0SD 4QRRA 2NNAB 5ESAA 4JFPB 5GZNC 3T0EE 1OTUD 2C4FU 4JR9H 2P8PB 5T3XL 4OAWA 4GKZB 5EUKB 3B3IA 4AEHH 1T1WA 2H8PB 3X13B 3FT2B 1P7KA 5MEOA 3UTPE 1YUHA 1FJ1B 1X4XA 3FB8A 5FYJH 4FXKB 2DQGL 4PJXE 1AGEB 3RVVC 1PLGH 2A0LC 3AB0C 3NZ8B 4XP9H 4ODTL 5CD5D 1TTFA 1TZGH 3I3DA 3H9SE 3MRRA 3P9WB 4G9FD 2ZOLA 2FDBP 1QRNA 1V3MA 3BZFB 3FZUD 3QUYA 1FDLH 3HPLA 3K1DA 3BN9C 1NUDA 2GQHA 1M71B 3CK0L 4NO3B 5IJVB 3BFOA 1UXWB 4EN3D 4LKXA 1EVUA 3OAUH 5GZND 1S9XA 3PQYE 5C8JB 1IAMA 1HHIB 1I1AB 1PJ9A 4JO2H 4M6OL 4FXGB 4P2QE 3ZO0A 3S8WA 1QFUL 1OD7A 4C59B 1UM5H 1U95A 3HMXA 3MACL 1TVBB 2NY2D 1OAXH 4NQSA 1WBYB 5FKAA 43C9A 4ZSOE 2OZ4H 2X9YA 1XF3A 4PRDA 3L3HA 5IEHB 3MBXL 5I1LB 4U1HA 3RVVD 3PL6B 1FH5L 2IADA 5BRZB 3N06B 2F53E 3Q6GL 2D7TH 3FOLA 1KG0A 3UJTH 3WFEL 4WO4A 5J0BA 3L1OL 4JY6B 1VACB 2VDML 5TE7L 3RGHA 3QO1A 4WJ5A 1OVZA 5BS0B 2ITDA 2R9HD 3U36A 5E6IC 2DDQL 2BNRD 4ELKA 4XNZC 4XBPB 2EE2A 4LU5H 3RVXD 2FX7L 8CGTA 1HSAA 4P0DA 4NOFA 1MHEB 3LKPA 3MZGB 4G3YL 3MV11 4ZTPL 4X5WA 3ULVC 4CUCA 5FV1L 1TMCB 2DLTA 2J4WL 1MCNA 2BJMH 2HA1A 3V95A 2FATL 1E4XI 1DFBL 4IDJL 5IOPB 2X4OA 5FYLH 3CX2A 1C5CL 4OCSL 4PGBB 3VD9A 2MPAH 5DRWA 1UACL 3AS2A 4UU9B 4BSWA 4M62H 4JRWA 5C0EB 1PBYA 1GRWA 1EZVX 2NXYB 1AGBB 4WEBH 1FE8H 2F74A 3ARDC 3P4NB 5JMOC 5I17B 1Q72H 4Z7NF 3VFRA 4YNYB 4XXCA 3WNLA 5F21B 2BP3A 3QEGL 1H3PL 1MLBA 3EOTH 2FJFB 3LDBC 3GBML 4OCRL 5H94B 4W6XB 1OGTB 4JHBA 4LSSL 4FQIL 4RGNC 1IGML 3OAZK 4XVJH 4R9HA 1OP3H 5LJYH 3GRWL 1EO8L 2ZUQC 1JPGB 4H20L 3QQ9C 3RA7H 4P49A 3WN5C 1TQCC 1F4WH 3MV7A 4NO5A 5K9QI 1FGNH 3QR2A 4UDTB 1EIBA 1NEUA 4OZHB 2QR0B 3UBXA 1PW3A 4HLJA 3ULVD 1EUTA 4JRXE 4I0PA 1NCUA 3D85B 3FB6B 4AENB 5MI0B 3HUJE 1FC1A 4D94A 2BOCA 5E2VH 4YWGL 2R0KL 3RQ3A 3DVIA 1DSFL 1AO7D 4W6YB 3TBSA 1G6VK 3RGVA 4KMTH 4NQCB 5C0JB 1ZA6A 1B9ZA 5IW3A 5EBMB 1BBJA 1LDSA 3ARDD 4YXHL 4LPUA 4YLQT 5A2IH 5H35A 5E9DA 4JG0H 4OLWL 1T89C 1SM3H 5BO1H 5CZKA 1QBMH 2VERN 3KPPB 1IEAA 3IU4L 1XCQB 1RZFH 3T0EB 5LVEA 1CT8B 4DOHE 5DXWA 5K33A 4M5ZL 3QRFM 4YBLC 3O9WB 2NXZB 1U3ZA 5ICZB 3C6LA 3V5KA 4UINL 1PSKH 1OCWH 1TJIH 3BDYL 1KB5B 4M8QB 3QDGB 2DICA 5EC1A 1UCBL 1S7RB 4ZTOH 3ZTNH 4P4RA 3VXPA 1OAKH 3BRDA 1HHGB 3QEQD 2D0HA 4L4VD 4OCNC 4IRSC 1ROWA 5DMYA 2OR9L 4M7KH 5FO7B 4GAGH 2VISB 2YUXA 4CU8A 3GSUB 4GRLC 4O51B 2PTTA 4WHDA 1URLA 2Z9TA 4OKVA 1KPVB 5ID0B 1P9MA 4J8RB 4BQ9A 3K2UL 1VB9A 2BK8A 4QHUA 4JFED 1H8OA 4Y19A 1RZJH 5GRUH 2MCPH 2XPGA 3LPWA 5ANMA 3SE4A 1VEPA 4JM2F 3PXHA 3ARZA 3BWAA 5FUCC 3OKDA 5FM8A 5TPWH 3RX5A 5FAAA 2CK0L 1K4CA 2HTKD 3PQYB 3S88H 1YYLH 2OK0H 2HKFH 5C0AA 3S96B 1FCGA 4P2QB 4FQCH 3QHTC 2CDEB 1VCAA 1HQRA 1MAJA 3BAEL 4M1CC 5J1AB 1T7YA 4ZSOB 1LILA 3RY6A 1AKJD 1IAII 2HMIC 3LCYA 2RCSH 2DM3A 1IQWL 1Q9KA 4HZAA 4Z8FH 4NWUL 1XIWA 4IRSD 2CD0A 4GH7B 3D69B 3E8UH 3LIZL 4HX1A 2F53B 4GRLD 2VITB 5E6ZA 1CE6B 5FA3A 3U4BL 2AKRB 1NAKL 4J3WA 1A7PL 4F7CB 3IAPA 5AUMB 4QNPE 3GDBA 2ZOKB 3RIAK 2VLME 2F15A 1NC4D 3HNVH 3MV8A 4QXGH 4TYUA 4EVNB 2HWZL 1MCHA 1RVFH 3T8XA 1V3JA 4Z0BL 1EJ6A 4C83A 3AS1A 4N8CL 4JB9L 5CEZL 3GHEL 3GJFA 4KUZL 1YMME 3MRDA 3SKJH 4UIKL 1WSST 4F8TA 5CBAA 1G84A 3DGGA 2IH3A 4NBYB 2YS4A 2FHFA 1HEZB 5F9OL 4M1CD 2V7NB 5HGDA 5C9JA 1NGXA 2YZ8A 3VH8A 4GXUN 3SDDB 5F88A 5JO5B 5JXEC 4HUVB 1EHLH 4OV6F 2HMID 5MHSD 4X6CE 5I75B 3P0VH 1AGFB 4UT7H 4ZFGH 1H15A 4GS7B 3MC0A 1ACYL 3EYVA 1EFXD 4Y7MA 1CFNB 4FABH 4XRCB 2P8MB 2HT2C 1FORH 4PFEA 2P5WA 4P46C 3E6FB 1XMWA 4ONFL 4QTHA 4UTBL 2RFXA 3TYFB 4L29A 4OIAA 3H7LA 5C0DB 4MA8H 2FHBA 2FNBA 1OAZH 4HMCA 1I4FA 1I9RH 5ICXB 1AXTL 4JPKL 3PNWB 5FOJA 3ZDXE 3WLWC 4JRXB 1ITBB 3F7PC 3S9DB 1IC1A 1WAAE 1NC2B 3H2WA 3HUJB 3D87B 3QBTB 4AYFA 3ABZA 2R2BA 3ELAT 3STZB 2DQEL 3KPRA 4IJ3C 4BFGA 1OB1A 3NIFE 4OLZL 4XC1L 1O0VA 3C5SA 3WUWA 1H5BA 2IQ9L 2Z4QB 5JXED 3V6FA 3IDIB 5LGJB 3GSOB 3RWJB 4OLUL 3FMGL 3LMJH 2A83B 5IB3A 1MFBL 2KUTA 2VNCA 3O4LD 1ETZB 3QIBC 1FNSH 1GGCL 2R39A 4Q97A 5JTWA 1XF4A 5HD8C 5HHPB 2HT2D 3PDGA 4QEGA 1P1ZB 3V5DA 3RPIA 2C26A 1B88A 3TN0C 1IAIM 1IILE 2OTPA 3JTSA 5GGQL 1JUFB 1VENA 4GKSA 1BQHA 2NR6D 2Z31D 3C5ZC 4HUWA 3L3IB 5DVKA 2XY1A 2P43B 4UDUA 3X3FH 3ZE0E 4MS8C 3WLWD 3AVEA 5GRZA 1CLZH 3S37H 1NCWL 3ZZ1A 3T77B 4TUKL 3JWOH 4HWEL 4EDWL 2O26U 2V2WA 5SWZA 2EDHA 4WU7A 2EDKA 4PG9B 5L7XL 5L9DL 4MXWL 3CU7A 1T3FB 5BQ7B 2P5ED 1K3ZA 1FL6B 2AEPL 4XB7A 4R4ND 4WUUE 4EDXA 3KJ4C 1L6ZA 2YA2A 1X4ZA 2C7UB 4HXBL 1IE5A 2CK2A 3KXFB 3CX5J 3TNNA 4HS6B 4UIMA 3DXAD 1U8OB 2VUOA 4OZIE 3VGDA 3RNKA 3TA3C 1XT5A 4ZDHA 4L9LB 1DBJH 4F58H 5AYUL 3L5JA 3CC5B 4QRRE 1E27A 4TPRL 4GAYB 1QFHA 5EDXA 3MROB 3HS0B 1LK3L 4H1LA 3IDXH 4JFQA 4QRPA 3GSQA 4HGWB 3EDFA 4JHWL 4MS8D 5JDJA 1L7TL 2VLKD 3MLTA 3SCMB 2O61B 1A6WL 3CFBA 4DVRL 3GJEB 1J7VR 4Q2ZA 3LD8B 1K5NB 2IFGA 1ZHBA 4F7PA 4F2MA 4PJXF 1E6JL 5GS2H 2JJTC 2CIKA 3K1KC 3KYNB 4Y5YA 3A0OA 2CGRL 1CLOL 3QEHA 4ZNEA 3EYOA 1INDH 3P0GB 1UB5A 2RBLA 3O8XC 5CINL 1JBJA 3TVMA 3MREB 3GSVB 3ME0A 4F15B 1YMMB 5D6CA 4LQFL 4HXAL 1QO3B 3WD5L 4CMMA 1J0IA 4LSUL 3BPLB 2QQKL 4LLVB 3CFDB 1S7SA 3D0LB 5T33L 3TA3D 1S9VA 3AC0A 2FIKB 3VW3L 1A7BA 3G5YB 3TJEL 2F5AH 4QRQA 1MIML 2XKNA 1PZ5B 3I9GH 3SKNB 2VC2L 4JFHD 3V4UL 4X6CB 3GIVB 2NZ9D 3G08A 5EZOH 3DMMA 2PYFB 1QFOA 3QFDA 1T4KA 3UAJC 3VXMA 2W38A 3LEVH 5IW1B 1J10A 5F70A 2D7PA 4U3CA 3RDTA 4Q6IC 5M7QA 1XFPA 3EZJB 4MNHA 1NBZA 4WI2A 3GB7A 4LIQE 3P40A 4LCUB 2ZSWA 1TVDA 4U1GB 5D7JB 4LKCA 5EN2B 3KYOB 5A2FA 5F6IB 3O8XD 1JGDA 3ARBC 4NFCA 5I8EB 3I02B 4IIQA 3MCKB 3MOBH 2X40A 4FNLH 4CNIA 4XWGL 1QVOA 1U2HA 4FFVC 2BHYA 3DSNA 3X12A 1ZGLA 5BW7A 3W0WD 3RWGB 4QHKJ 2EDBA 3WYRA 5D2LA 3PHOA 4Z0XB 5C86A 5F7WC 5AZ2L 2E7MA 5CKAA 1BEYL 2GK0B 2ZSVB 3E6HB 1NCCH 3C6SB 1AC6A 5D93C 5KVEL 3T4AA 3N1MC 4Z7UA 4HUUB 1NFDA 4JFZL 1LO4L 1DLHB 4U1JB 4UUJA 3UAJD 4U0RB 1FCCA 1LO3L 3CSPA 4YHYC 2HJKA 3AAZA 2VZVA 4R3SB 1QFUH 4IMLB 5DZLA 4C56D 3IDYB 3OXRA 1GIGH 3WS6C 3UPRA 2FCBA 4UBDC 3GIZL 2FO4B 4OLXL 3MACH 1WCQA 5ADPL 4NUJA 1EK3A 4J4PC 4ZQKB 1EDQA 5T3ZD 3KPNB 3BZEB 4I48B 4XPBH 3ARBD 1MPAL 4LBEB 2HKHL 2ZUWA 5ISZD 2VOTA 3KS0J 4OZGF 1QQDB 2YEZA 4Y8AA 2CKBB 5DVMA 5CJ8A 2XICA 4YHOH 3SBWA 3Q6GH 5DDHA 3IETB 1FBIL 4XGZB 4YPJA 5DZOA 5MEQB 3O0RL 5E8PA 3BKCL 1FAIH 3GM8A 2V2XA 2X4UB 2OMNA 2GW5A 1S7WA 2VDMH 2AK4A 2W9EL 5D2NC 3Q48A 4WI8A 2BNQB 2DDQH 4N0CC 4FQQA 4WUUB 3DUSA 1AHWC 4EQ2A 5ECJE 4U4BA 4IEFB 4TSAL 5EWIL 5I8OL 4JQIH 4WFHE 3RZWA 2PCPA 3GRWA 3Q6FA 4WW1A 1A9EA 2ARJB 5B22A 1FPTH 5GGRA 2WQRA 1KSRA 3W39A 4G8EB 2W07A 4PY7A 5DJ0B 3CGTA 5IVXA 4OZIB 3D9AH 3U46B 4X4YA 4IDJH 5DD5L 5E9DE 3VDCA 3B43A 2OL3A 4KH2A 4OCSH 1S7XA 1T0NB 3C87A 1XEDA 4QRRB 1UACH 5ESAB 4P9HC 4FQPA 2WINA 1O7VA 3DX6B 1OSPL 3O81A 4OAWB 1TETL 2A1WL 1UVQA 2CJUH 2K9UA 3B3IB 1T1WB 2XIDA 3LV3A 1B90A 3CFEA 4TRPL 1P7KB 2X4RB 5MEOB 1H3PH 2DIAA 4JFDA 4ZS7H 1YUHB 5D7IA 1L7IL 3QXTA 3C9NA 4RQQB 2B2XL 4HW6A 1EO8H 4H20H 5GHWL 3KPSE 2HRPH 2FL5A 4YK4B 3RUGA 3SPVA 4JHZA 5C0NC 4JPWL 1JZ7A 1RUAL 3MRRB 4MQXD 5GIRB 3QDJA 2ZOLB 1H9VA 2DQDL 4L3CA 3NPSB 3WIIL 3QUYB 4Y19E 3OG6B 1REIA 2AQ1A 3HPLB 4NUGH 2HTLD 5ANME 2B20A 4PGZA 1UGNA 4LKXB 5E8OB 3RY4A 4X9BA 1MFDL 3QG7L 2UWEE 1RMFL 1S9XB 5DGQA 1JYVA 5HDLA 3DVNA 4LLMA 5I1HH 5C0AE 5CP7A 3GMQA 4UQ2A 1CLYH 3EIFA 1BFTA 3S3JA 5B8CB 1U95B 1YC7A 43C9B 5FKAB 4NQSB 5L88H 1XF3B 3K0WA 5DFTA 5DJ2A 4Z78B 4PRDB 4UT6H 4M5ZH 2O93L 3AU1A 4U1HB 2JK5A 5CCKL 2D9CA 4PB0H 4QXTA 4UINH 5E4IA 2EEBA 4F9PA 2F8XC 2IADB 1PYWA 1G0XA 3QFJA 3LS5L 3MJ6A 4UNTA 2LV4A 2ZG3A 1E4XH 1KUMA 4K7FA 4WO4B 2B1AH 4E41A 1I1AC 3QO1B 2OR9H 4WJ5B 4XBGA 2ITDB 2KPNA 3U36B 1EHXA 4ELKB 5HPOA 5GRVK 2M26A 5J6HA 1HSAB 2DTMH 1A7RL 2V5RA 3LKPB 4X5WB 5JUEL 5GS0L 2EC9U 5KANG 3GSRA 3TIEA 4PS4L 4ODWB 2VDPL 4R2GB 4YHIB 2GKIA 4G6ML 1BAFH 1TJHL 3PL6C 1KLGA 3LN9A 3QJHB 5IHZA 2X4OB 4NHUB 3RU8L 3FKUS 4PRHA 4P3WA 4X5XB 5I8KL 3ZYOA 2OTUB 5FIEA 5L6YL 2RGSA 3ALPA 5IBLC 1VGKA 2PN5A 3I6LD 2F74B 5EPMA 5DI8A 4ZUSA 1B4RA 1U8QB 4ZO6A 3BAEH 3MRJA 3VFRB 2R0ZH 3OF6A 2DQIH 5JIIA 5D70L 1MNUL 1PG7L 1C5DA 4P48A 2XOTA 2P5WE 1RIVH 4ZMAT 1E4KC 1I1AD 1S9KC 3QHZH 4EOWH 4X7EC 3MV7B 1QEWA 3OKOA 4NO5B 3ZDXF 1RHHA 3B6SA 5HXMA 2NXYC 1CXLA 2OLDA 2QQLH 3EOAA 2HWZH 4P2CG 5I16B 4HIIA 2QQNL 2BFVH 3PL6D 1HCFX 4Z0BH 3JUYA 4J3OC 4WUKL 3NZHL 3NIFF 5BRZD 4JB9H 3V6OC 4KUZH 3FTGB 3KPLA 2B4CH 4UIKH 4HCRA 3R8QA 1WK0A 4XP6H 1ZA6B 4KUCD 2GSGA 4WRLA 3WFBL 2ED9A 3NACL 3T2PA 1BBJB 4L3AA 3OKLA 1FO0B 1CD1A 5BS0D 4MJ6B 4HWNA 5FM4A 5H35B 2J5LB 5E9DB 5F9OH 3U4AA 3OZ9L 2BY3A 1HYSD 1JZ6A 1AJ7L 3O6KL 4OZFH 2WQ8A 1CICD 1IEAB 3U7YL 4GMSH 4PRIA 2X4PA 1FGVH 4J3XA 5HVWA 3DNKA 5MI0C 1IZKA 3C6LB 4M7JL 3V5KB 1ACYH 3BI9X 1VEMA 4X80L 3C09B 2IQAA 5EC1B 2IPKA 1GHFL 4FHBD 4P4RB 3VXPB 4OB5H 2NXYD 1HKLH 4UTBH 4CADB 3V7AE 4KDVA 1N6UA 5JQHC 5GRJH 3T0BA 1KF9B 2NY4B 3GMNA 5T5NG 1MI5E 2ZCLL 2VYRE 4OKVB 3CVHL 3T0EC 3TH3T 4QHUB 4AY0A 3MX0A 3F58L 3SHSA 5EB9A 4U1LB 4Y19B 5DD0L 2VDQH 1VHPA 3R0NA 2XPGB 3O9WC 2NXZC 5DUML 5ANMB 2J12B 5DJCA 3BWAB 4J2XA 3EAKA 3OKDB 1IAIH 4N0FA 2AEIT 4E0RA 1FLTX 3SGJC 1A7OL 1K4CB 1QSEA 2IQ9H 4ZFOL 4ISVA 4X7SH 5C0AB 2E7BA 1KIQA 4XAWL 4ONGL 4OLUH 3D85D 4ZPTA 3CDYA 5E7FA 1MFBH 2SEBB 1HQRB 1RULL 2IC2A 4M4PA 5F6HJ 2DQCH 3V6ZA 4ZXBD 3ZHLA 2X9WA 1J0HA 4R4FL 3U0WH 1C1EH 2LAAA 1HKFA 4ZUWB 4DCQA 1Q9KB 3SE3A 3CLFL 4HX1B 3MA7A 2XWJA 5FA3B 1SMOA 3R0MA 5FYKE 4PJGF 3BIBX 3X14A 1CDGA 1ULVA 4M3KB 4QWWC 3T0ED 1D6VL 1RFDL 4OD3L 3ZKMC 4ORGA 4MMZC 1I85A 3MV8B 4ZNEE 1ZA3A 3P73A 2DQHH 1AGCA 3GJFK 5T3XE 3T8XB 4TNVF 2AJYH 2EDLA 4EBQH 4C83B 3QDGD 3GJFB 3LKRB 3KPQA 3MRDB 3LRHA 4EUPA 5CBAB 1UXSA 2AEPH 5DR5L 1DUZB 2CDGB 3DGGB 3M1BB 4XMLH 2IH3B 1KTKE 4YX2H 4O58L 5LCVH 5JIHA 1A6ZA 1YY9C 3LEYL 4HV8A 1GVIA 5HGDB 5C9JB 1NGXB 2J2ZA 4I0KA 5KOVC 1IC5H 2DQUL 1NGZA 3AY4A 3VH8B 2ESVA 3UYOD 5IESH 4BZ2H 4PJIA 2AK1H 4LFHD 3IU3A 2Q7YA 1H15B 5AYUH 3DETD 3VXME 1SYSA 1LK3H 5IQ7H 4XNYL 3LKSA 3B2VH 2FD6L 4K2UL 4QWWD 2P5WB 3DRTA 2VLJA 3TV3L 3ZKMD 4P2QD 4QTHB 4DVRH 5INDA 4HQQH 1I4FB 1NSNH 1A3RL 3TO2A 3SDDC 5KW9H 3ARQA 2CGRH 1CLOH 4KRLB 1FLRL 4WHYG 1W72A 4Y4FA 5I75C 4RA0C 4PPTA 1AD9A 5C08A 1ZLWH 3UC0H 1KEML 5JHDA 1RZKC 2R2BB 4GS7C 4C55A 2PETA 3B9KA 1ORQA 5TQ2H 2NY1B 2VN7A 3U2SA 2VE6A 5LBSH 1FVDA 1OB1B 1A6AA 5DEFA 1F3DH 3C5SB 3WUWB 1H5BB 1RI8A 2QQKH 1UM4H 4EI5A 2DB8A 3WV0A 2HJFA 2XTJB 5IB3B 1NFDE 1R5VB 3J7HA 1IGCL 1T0MB 1RK0A 4NC0B 1QSFA 1XF4B 3MBEA 2VC2H 3DX8A 3L3KA 4AIZA 4PJEF 4QRTA 5DC0A 3V5DB 3OX8A 4CVZB 3RPIB 1WCBA 1P5UA 3MJ7A 1NCAL 4JM4L 1DE4A 3JTSB 4HPOH 4GKSB 1BQHB 4HUWB 4UDUB 1J0ZA 3C60A 4XCCH 4AT6A 3HCVA 4G80A 1BJ1H 4WWKA 2AEWA 4DW2H 1PEWA 4EI6A 4PJCA 3K46A 3SDXA 3EO1A 1FZMA 5C07A 3ZDYF 4UOW1 5F7MC 5SWZB 4WU7B 2EDWA 4XWGH 4BQCA 4H0IA 2V17H 2AI0L 1JNNL 1MH5A 3HZVA 5C6PB 1S7QA 1FNHA 2DM4A 2XG5A 4EDXB 3R8BB 5E8NA 3IFNL 3TBYA 4FFYH 2GCYA 3AMKA 3UJIL 3O2WL 1U8JA 1BEYH 3BT2H 3CLEH 3ROLA 2OI9B 2X1OA 3LN4A 3TNNB 3WL9A 5I1JH 4K94C 5KVEH 1CK0H 1NC2D 2ZWLT 3MTRA 5HYJD 4L4TD 2GJJA 3QH3A 1J9CT 1MCWM 1E27B 5AD0B 2EEDA 3L3JA 4H1LB 4JFQB 4JPIA 4QRPB 4KTEH 5JQ6L 2FB4H 1LP9A 3MLTB 5AWNL 1KACB 3CZFB 3GIZH 2BDNH 3QUXB 3LRGA 3CFBB 1MCKA 4KKLD 5CEYA 2Y07L 5D1QA 3EJYD 1EX0A 5E8EA 4F7PB 1S5IL 1ZHBB 1LNUA 3TT1L 5I30L 4F2MB 3MLPA 4PJ8A 5KVFL 3TEUA 4K9EC 5L2KE 4PJ7E 2CIKB 2FX8L 4Y5YB 3UTOA 2APWA 1BIIA 3HTLX 3QEHB 3NFSL 1FBIH 2BY2A 3EYOB 4L9LC 1S78C 5TDOA 3O0RH 3HG1A 3QCUH 1S7UB 4LVHB 1G9NL 3TVMB 5I74B 3DIFA 4N0UA 1I1YA 5D6CB 5CJBA 3QDJE 4E5XB 4CMMB 3OR7B 2FEDC 5E1AA 1D9KA 3SCMC 3T1FA 1S7SB 2OMBA 2YN3A 4AEFA 2UWEF 5DUBA 4X6EA 4IRJA 3LD8C 1H8NA 4NYLA 5DD1L 1F4YL 2FHCA 4QRQB 2XKNB 1J1OH 1AY1L 2OX5A 4RWHA 4JAMA 1AQKL 2J8UA 2R8SH 3RNQA 1WLHA 3DMMB 4RIRA 4TTDD 1T4KB 3VXMB 1D7FA 3NTCL 1DBAL 1OSPH 4OCYL 4F15C 5JA9A 3KXFD 2R0LL 3RWIB 2OTWA 4LQ1A 2A1WH 3BPLC 3IDNA 4G9DA 4Y4HD 4PIRF 3GB7B 4RBPK 1HHKA 2J88L 1Y6KR 2ZSWB 1EJOL 3TT3L 2EO9A 2HJLA 3QFJE 4XHJC 4YDKL 3VXSE 4ZO7A 5HJ3A 1JGDB 3MFGB 4IIQB 4JKPL 3HFML 4CNIB 1YNTB 2BC4A 4E41E 1QVOB 1QFPA 5GHWH 5SWSA 3VE0B 4FQXA 5KANI 4M48H 2EDDA 1KTDA 3SCMD 4BSJA 4O4YL 4JQXA 3X12B 1ZGLB 2NX5D 4JPWH 4KTDL 3PHOB 4XX1E 1LHZA 1QLEH 2DQDH 4DVBA 1K6QL 2P24A 3WIIH 2HFGH 4RFEA 2VL5A 2VLMD 4FFZH 1UYWH 5F9JA 4QHMA 5ADOL 5D7JC 3T4AB 4U1GC 3IF1A 4ZO9A 1NFDB 4PRHE 4AH2B 5F6IC 1R24B 2OP4L 3OTTA 4UUJB 3DI3B 1RMFH 5F89B 2HJKB 3AAZB 1MHPL 2DL2A 2DOCA 3B83A 5CEZE 3OXRB 2ICCA 2YKLL 5GRXG 3UPRB 1YEEH 1MY5A 5ITFA 5DSCA 4NUJB 1FYTA 1TLKA 2ITCA 4XHJD 4G42A 3BJLA 2R69H 1AFVH 3ARVA 2DMCA 4BZ1L 5FEBA 1MJJA 43CAA 4LP4A 1JF1A 3VWJA 2R2EA 2YEZB 1ZLVH 2BSRA 5DDHB 1NDGA 1YECL 3LS5H 2C4FT 3G04A 5E2UH 5E8PB 1MLCA 4XAKD 4UTAL 1IT9L 2V2XB 3MRPA 4U0RC 4U6HA 1NMCB 1S7WB 3U82B 2O5ZH 2DQTH 1MQ8A 4M5YH 4XCEA 2PW1B 4GMTH 3IDYC 5DK0A 4FQQB 3DUSB 3PWUA 2CPCA 5D7JD 2X10A 5KSAD 3ZTJG 3G6JE 1A7RH 1TZHA 2PCPB 3Q6FB 2V5YA 5GGRB 3MA9H 3W39B 5HHOA 5IFHH 3K80A 4H26B 5KN5A 4PY7B 5JOPE 5GXBB 4Z77A 4X4YB 3MJ9L 2MSPA 5EOTA 2OL3B 1S7XB 3NIGE 4JO1H 4P3DA 2BSSA 1ZGLP 4NQDA 5HDBE 2WINB 1DQML 3LKNA 5DJ6A 5CMAA 4KZEL 4KI5E 1LK2A 4J23A 4KKBC 1UVQB 5EOQL 3O6LL 3LV3B 4PJ9D 4ONHA 3CFEB 4OD1L 3QI9A 3PDOB 1HDMA 5F96H 2AV1A 2IBZX 4QRUB 2APXA 4LDOB 5D7IB 12E8H 3C9NB 3VA2C 5L2KB 3FCTB 1JZ2A 1CDIA 4PREA 2FL5B 1U8KA 3SPVB 3VMPA 1QTYT 5ENWA 2VZSA 3PE9A 4NFBA 3QDJB 1XR8B 3MRCA 4OCWL 4L3CB 4QHKI 4LARH 2Z93A 1T83A 1CVSC 4OM1H 4LRIC 4WUKH 1PKQE 2GFBA 1LO2L 4DUVA 5IKCA 4KMLB 1K4DB 2E9BA 3DVNB 3A6BL 1DZBA 4LLMB 1AD0A 3MUHL 4JVUA 2IMNA 5CP7B 3GMQB 1J0JA 3CDFA 2BNQD 3CVHA 4UQ2B 4KKBD 4NSKA 4YK4C 4WNQA 4WUUD 3UTQA 1PGRB 3GSXA 4X4XB 5JIKA 5E2WH 3U7YH 3RJDA 4QT5A 4MAUL 4LSRL 4KK6C 5DJ2B 1GH7A 1KIPA 1G7JA 5ESQA 3NPSC 1RQ5A 2JIXA 3AU1B 2K1MA 3QUYC 4PV9B 5KSBA 4M7JH 2IPUG 2JK5B 4QXTB 5E03A 3G6DH 4L8SA 4ZFOA 3OL2A 3S4SG 5E08L 3QFJB 4X80H 4PRPE 3U9PL 3K2MC 4PJFA 4QRRD 4YHLH 1KJ2H 1MFCL 2W9DL 1HINH 2L4OA 3OB0H 3QUML 1KPUA 4H25A 4E41B 3RWFA 5E6IA 3PGDB 1JN6A 2BHZA 4HC1L 4WV1B 5BVJB 3RVTD 1IEHA 4U1KA 5B8CC 5CJQL 2VL4A 2IANA 5KJRH 1U8LA 1XGQA 1F3RB 3ZHDA 1U91A 5J6HB 3F12A 2IPTH 3PV7A 4LASH 5HSFA 4FQ1H 3F58H 2KZ1B 1PDKA 5KVDL 4KQ3L 3TIEB 5HYEA 1J5OH 5IHLB 2MKLC 3TPKA 3QIWA 5F1IB 2F54A 1KLGB 1P5VA 3G5XA 5IHZB 3LQZB 1JP5A 3UJJH 4PRHB 4IMKC 2X4QA 1RJYA 2VDLH 1RZ7H 4WO4C 4Z95L 1VGKB 4KK6D 4XAWH 1KCUL 1QRND 5DI8B 4ZUSB 5HHME 3QUYD 5FO8A 3MRJB 1DUYA 1XGUA 3VGAB 4KV5E 4GG6A 2CUHA 1C5DB 1DDHA 4KJWC 1YY8A 1JRHI 4YJZL 3RHWF 4P2YA 3ULVH 3FO9A 4R2GC 2VLJE 1QKZH 5EO0A 3WN5A 2N4IA 2EXWC 4M7LH 1V7NL 4U31A 2AJ3A 4KRNA 4HJ0C 5E99L 5DVLA 4NT6A 1QEWB 2P48B 3OKOB 1PZUB 1RHHB 4YHML 3B6SB 1D6VH 3PWVA 1EFQA 1DEEA 3BDBA 3EOAB 5FYLD 1YEIL 4X7TA 4HIIB 4UV4L 5C08E 5JHDE 3MNZA 35C8H 5EU4A 5DMKA 1MFEL 4XXCC 5FCUL 1NBVL 4JPVH 1AP2A 4GRWH 5DJZA 1A5FH 1OARL 4WO4D 3H3PL 2GSGB 1RUKH 4LPVA 4FZEH 2EYRA 3OKLB 1CD1B 2HP4A 4OGZA 3NFNB 4L8BA 4FFWC 3ZE2E 3WHE0 1K2DA 1KCVH 4OV5A 4U1IA 3RAJL 4R2GD 2EXWD 1I8LA 2V5MA 2DI8A 4HJ0D 1LO0H 2ICWA 4JGMA 3BD3A 4WFGE 4DAGL 1P7QA 2FD6H 2IQAB 2IPKB 1CD9B 3RI5F 3HI5L 3L5XH 2D7MA 1MIEL 1IGIH 5D7LE 2J5LC 1J86A 2JCCF 1Q0YL 4K07A 4PJCE 4X0KA 4U33A 4ODUA 3SDXE 1A3RH 3GMNB 1WBXA 1CXIA 3MUGA 5C07E 3RWCA 5I76A 3FQUA 1DQJA 4MJ4A 4NKIL 5I9QB 3HZYA 3K4AA 4MNGA 4UT9H 4TOYL 1N6VA 5T5FL 3VFSA 3C6LC 5CJOL 5CIPH 3R1GH 3DLQR 4FFWD 3MV7D 4N0FB 3O3UN 4A6YA 2ZJSL 5EFIA 4E0RB 3C09C 3AROA 5I1KH 1T1YB 1F02I 1QSEB 2VDRL 1J88A 5JHLL 4ISVB 3AXLA 4Q0XH 1KV3A 5IT2L 1ZEAL 4I0PD 4ZPTB 4MA1B 1UJ3A 3U7WL 3UXFA 4KK5D 4LCIL 5L0QB 4TUJA 4YXKL 2NY4C 3AS3A 3PWPA 3V6ZB 4WFHD 4IRZL 1AC0A 2FGZA 2AABH 3RGVD 1P9MC 5DFVC 2FWOA 3GEWB 2YOCA 4U1MA 3Q1SH 2FECL 3L6FA 1JHTB 1LP9E 2W9LA 3IS0X 5IBTH 4DGYL 3MUY1 5ALBH 3S35X 5E9DD 4CRPA 1U2CA 3MA7B 2XWJB 3LKOB 4PRPB 3JV0A 1AE6L 1BM3L 4PJ7F 1F6LL 5EBWA 3VXTB 3X14B 3QNYB 3MNWB 3QP3A 4O9HL 5GGVH 3V7MA 4HH9B 1MJ7L 3OR6A 4ORGB 4I5BA 3ALXA 1ZA3B 1MHHA 4X4MA 3C6LD 3BRGC 3HG1E 4WW2A 1G6RB 2JKXA 4N0UE 2AERT 4FOMA 3RY6C 1OF2A 1T6WA 4EUPB 1UXSB 4K3EH 25C8L 4NNPL 4Z7VA 3IFNH 4TQEL 1A6ZB 3UJIH 4HV8B 3O2WH 4ZAKD 3MXVH 4U0QB 2EC8A 3FRPG 3PGCA 4PBWD 1NGZB 3GKWL 1SEBA 5DQDL 1IFHL 3ZKQD 4DKFH 5HHMB 2OSLA 1KCLA 4Y19D 5GSVB 3IU3B 3F65A 2Q7YB 1C08A 2UZYB 2YN5A 1SYSB 3BPOB 4QOKE 1GCFA 1UT9A 4P46A 2VIRA 3LKSB 3HE6A 4NJAL 1KTLA 1MRCL 3DRTB 5C0AD 2VLJB 4KY1L 3HC0A 1DVFA 4M1DL 5INDB 2X4SA 3U1SH 5J8OA 2AEQH 3TT1H 4HUKB 5KVFH 3I3EA 3TO2B 3ULUF 2FX8H 2R4SH 4YHZL 3RVWC 4JCLA 1W72B 1FVEA 4X98B 5C08B 1AD9B 4XB8A 1XIWD 3BKJL 3WBDA 5JHDB 5HYIA 1G7MA 3KVQA 3AGVA 4YDIL 4G7YL 1ORQB 4KDTA 4XCNB 3BPCA 2VE6B 4LRNH 3DHJA 1FVDB 5C92A 1A6AB 5DEFB 3RL2A 4ELMF 3I6KA 5D8JL 5EH1A 1ZANL 2NW2A 1JK8A 1MJUL 1U3HB 4FQ2L 4XXDA 4EI5B 5DJYA 3MV8D 2WBJA 1ZT1B 2HJFB 2VR4A 3QIBA 5DD1H 2I24N 5D7SH 1AIFA 5IV2A 1IGTA 4LPCA 1RK0B 4P5MA 1QSFB 2IG2L 3MBEB 5CGMA 3DX8B 3L3KB 4AIZB 4QRTB 5F6HI 3BZ4A 1Y0LA 3OX8B 3TN0A 1UH3A 4HKBA 2I9TB 2MMXA 1WCBB 3MJ7B 3P11H 3BQUA 5LXGL 1DE4B 1VFMA 1YZZA 4V2CB 1FYTE 1DBAH 2NY1C 1HZHH 4F57H 5JNYB 1AI1L 2R0LH 4NJ9H 1FFPA 5HI5C 3C60B 3LZFL 3MCLH 4AT6B 1H5BC 3HCVB 4G80B 4J3UA 3RVWD 4WWKB 2FEEL 2XTJC 3HC4H 5FUZL 4PJCB 5JXAH 2WUBL 1KGCD 3SDXB 3EO1B 1FZMB 5C07B 3U4EB 5E00A 2VH5L 1DQLL 1GAFL 3FQWA 4XC3H 1EUUA 5I18L 2P5WD 3HZVB 3LHPL 4RGOL 1S7QB 4O4YH 3TJHC 3GI8L 3G6JF 1TXKA 1X5ZA 1A7NL 4KTDH 5E8NB 2VAAA 3MODL 3TBYB 4TNWK 2GCYB 1OTSD 3G9AB 1U8JB 5E94A 3ROLB 3LN4B 4OLVL 5HHOE 3WL9B 3WXVL 4C4KO 1DQDL 2AGJH 4K3HA 3QNZB 4DKEH 4RWYH 4NM8H 3W2DL 1CF8L 1K3IA 3QH3B 2WV3A 3KPRD 3QCVL 4NQDE 4LVNB 1H3GA 3QDMA 4IOSD 4V1DE 2CUMA 1JHKH 3L3JB 4PJBF 4HGMA 1UZ6E 4JPIB 1MVFA 5HI5D 4B5EA 4CN4A 1LP9B 2YKLH 5JW3H 3IGAA 4ERSH 3OSKA 5CEYB 2Q3AA 2XTJD 4MA7L 5D1QB 3P30H 2D03L 2E5EA 1RHFA 1A1MA 3MJ9A 3RKPA 4Y16A 1LNUB 5A3IC 1INEL 1DANT 2OI9C 3BP4A 4PJ8B 3T4YA 4WGVB 5CWSA 3TJHD 3HMWL 1QLRA 4R0LB 5TDOB 2NCMA 4O2EA 2VSCA 3HG1B 3Q2CA 4HWZA 3D0VA 1J8HE 2YUVA 3DIFB 4N0UB 1I1YB 1WISA 2PNDA 4ZUTA 3BX7C 1E4WH 3KPOB 1D9KB 3T1FB 3QUXC 2XKSA 2GY5A 1L4IA 4ZFFA 1RUML 3WIHL 1QG3A 2NTFA 4X6EB 4IRJB 4NYLB 1SQ2N 4APQA 5TJWK 1YJDL 4MLIA 1FFOA 3FFCA 5SWZD 1R5IA 2YK1L 2W59A 4Y5YC 2VB5A 2E7HA 4JAMB 3WNKA 3RNQB 1HNGA 32C2A 1S8DB 5F3HB 5GS2D 4RIRB 1G7LA 1PFCA 1R3IL 4LVHC 3TVMC 1RZKL 5I74C 1HIMH 4OF6A 2C1OA 3UP1A 3TYGL 3FB7A 2OTWB 4YO0A 3QSKB 5EOQH 5KSBE 3U48A 1MEXL 3SJVA 1HHKB 1GL4B 3GHBL 4BM7A 1MQKL 5F7FA 5HJ3B 4P4KA 4PJFE 2YD4A 3GBNL 3L3GA 2C1PA 1D5IH 2JB5L 3EFFB 4NGHL 1L9NA 3QUKA 2BC4B 4QRPD 4FQXB 2IAMA 1I1FA 4ZOBA 1KTDB 3SE9L 4D9LL 1MUJA 1MCIA 2VXTL 2Y5TB 1JNLL 3VWKA 3DMMC 1EPFA 2CO6B 5B21A 1IGFL 1NMAL 4MQSB 1DJSA 1KPRB 4OCWH 4DVBB 4X6DE 2P24B 4KKAD 3QIUD 4RFEB 1A7QL 2VL5B 1IL1A 3CZJA 5HGBA 1G0DA 2Z8VC 2F54E 1MF2H 3QUMA 3DURA 1LDPL 3V52L 4Z7OE 1OY3B 3IF1B 5T3XD 4M1GH 2R29L 1IZJA 2H9GA 4HC1A 3TVMD 4IIQC 4JFYA 3A6BH 1WITA 4GAFB 2HH0L 2R0WH 5DA0B 4MXQC 4ODSL 1RZ8A 4J4PA 5D72H 5BW7C 5ITFB 5GSRA 1ZT7A 1FYTB 4G42B 4MAUH 5BVPL 1MJJB 1IM9A 43CAB 3G5VA 1NCDL 1JF1B 3VWJB 2R2EB 4JO4H 4YH6A 4K94L 2BSRB 1NDGB 3G04B 3EKCA 1OAYH 3QWRA 3DMMD 2W9DH 1F97A 2BVQA 1MLCB 2Z92A 3MRPB 3JV6A 1QBBA 1X4YA 5D2NA 3A6CL 1QNZL 1JFQL 1EHNA 3RDTD 1AHWA 3VH8G 1MWAA 1MCCA 5CJQH 1OGAE 5DK0B 5DS8B 2NY5L 4FTVA 1TZHB 4M6ML 1IM3A 1IKNA 3S7GA 4J3SA 5HHOB 5KN5B 3DSFH 3DX7A 4MNQA 3W5MA 4MXQD 4BH8A 2JLLA 1I3RA 5T1LA 3LEXA 3KLDA 3SBWC 5EZIH 1ZS8A 3W81A 4P3DB 3V0WL 2BSSB 5KS9A 4NQDB 3KAAA 5DMJB 4V1DB 3VFGH 2D9QB 3LKNB 1HE7A 1NMCC 5DJ6B 2E6QA 2BRRL 4JVWA 5CMAB 4A2LA 2CRIA 2PO6B 1ZSDB 1LK2B 1UQSB 4F37F 4XPHL 4JM2A 1B6UA 4ONHB 3QI9B 1UFUA 5EU5A 2OQJA 2AV1B 5FGSA 2GSIA 1I7TA 4C54A 1W0WA 1QOKA 1O5DT 2EDXA 3D6GA 3IJYB 1BOGA 1U8KB 2GJ6A 5D4QA 5E99H 2R1WA 3WUWG 3OHXA 2WP3O 3UYPA 4H0HB 4HEME 2NNAA 5ENWB 5HVGB 1J8HB 3ARWA 1CXKA 3DGCR 4OLYH 2Y06L 3MRCB 4S1DC 1VFOA 4GKZA 4P9HH 1SY6H 1YEIH 5EUKA 1F00I 3D2UA 3OB0K 1H3VA 4FMKA 4JKLA 4S0TD 1FVCA 2B1HL 4Q58C 5SV4A 1KC5H 4AG4L 1CGWA 4P59L 5FCUH 3S35H 1CDUA 1CZ8L 1NBVH 4K23L 4OD2A 2GFBB 3NIDE 4FXKA 5IKCB 1V8HA 2PW2A 5DMIH 1BPVA 3ZSTA 2HVKA 1AD0B 2AK4D 3KS0H 4OF7A 3V9FA 4NZDA 3CVHB 4FXLA 4ZO8A 4NSKB 5D1XA 4RZCA 4DGVH 3UTQB 1CU4L 3IJSA 3V7AG 1FRGL 4M02A 3PWPE 3NCJH 3UZEA 4GW4A 4D9QE 2YPVL 1KIPB 1G7JB 2JIXB 3QWOA 5KSBB 1UXWA 1MFAL 1IBGL 4JFFE 1IC7H 4X99A 4L8SB 4RNRB 4XNXL 1F90L 4ZFOB 1A3LH 1WICA 3QHFL 4DAGH 4PJFB 5HPMA 2FX9H 3WEXA 5MP6L 3HI5H 1VPOH 1KPUB 2MOVA 4H25B 4S1DD 3RWFB 4BKLB 4GLRH 4AQOA 3VXUE 1RURL 1Q0YH 4L8DA 3OKNA 1TVBA 2XXCB 4U1KB 4Q9QL 5EA0L 2BXYA 5DD3H 1U8LB 3OGOE 1XGQB 15C8H 1U91B 2AXGA 1G9EA 3F12B 4NKIH 4JFDD 4PLJC 4P5TD 4PJAE 1XGYH 2DM7A 2F58H 1MCOL 1V5JA 1QACA 1CR9L 3GMOA 2R2HB 3E1F1 1WF5A 2DS4A 3QIWB 4H1LG 2F54B 1CQKA 1VGEL 2YZ1A 5CJOH 4F9PC 3RPKA 1I9JL 3G5XB 3I2CL 1JRHH 5BXFA 2ZJSH 4POUB 1RJYB 4JE4B 2VDRH 4JY6A 2FGWH 3BVNA 4MB5A 1ZEAH 4XP4H 1LWRA 3WLBB 4LCIH 3WFCL 4WV1C 5FO8B 1XGUB 4LOUD 4NWTH 4GG6B 1VADB 3BYTA 3U7AA 1DDHB 3E3QE 5FO9A 4RGNB 2WUCL 4DN4H 1NLBH 4P23A 5EO0B 3WN5B 5J6GA 3O45A 4C57C 5C0RH 4PGBA 4K8RC 5CFHA 3MXWH 4OF5A 5HTSA 1AGBA 4BELD 4MJ2A 3PWVB 3T0DA 1MJ7H 3B5TA 4ODXA 4EIZC 1DEEB 5I1IH 4K3JH 5K59F 3FO0L 5HVFB 1QA9B 4X7TB 1AXSB 1OGAB 3V8CA 3MNZB 3VGAC 5FM5O 5EU4B 5LQBL 3B5GA 1S7VA 5DMKB 2E9WA 3QFJD 1EHAA 1AP2B 2VSDA 3KJ6H 3ZLQC 2VLRE 1YMHA 4DZBA 1EEUA 4E41D 3Q5YA 4NNPH 4OCXL 3S34L 2EYRB 5I8CA 2QQQA 1RUQH 5CEXA 2YPLA 1CFQA 4L8BB 2X9XA 2YC1A 1S9YA 4PY8J 4UDTA 1K2DB 4F7MA 1BQSA 4YZFF 1WV7T 4JN2A 2WZPD 4AENA 3FB6A 2P49B 1PG7W 1MRFL 4NRZA 1IEBA 3KLHD 3BRFA 4D9RE 4XPTH 4XPAL 1F6AA 3BSZL 4TN9A 2ICWB 4NQCA 4PRHD 5EU6A 3B5HA 1P7QB 4AL8H 3MRFA 3NCYP 1KCRL 1S3KL 1DTUA 4KY1H 2GIYA 5CEZD 1FG2A 3UTTA 4X0KB 3KPPA 3OF6D 3B2UC 5JW4N 4HULB 4ODUB 2X7LB 1MELA 2F19L 3OAZH 1WBXB 1A14H 3MUGB 4L5FL 3KWWB 3RWCB 2AQ3A 3FQUB 1DQJB 3ZYJA 5I76B 3BGAA 5JPMB 3HZYB 2W0FB 4MNGB 3O9WA 3QCTH 4KI5C 3EO9H 1JTTA 2YD9A 2IGFL 3JV5A 5HGGS 5I6XB 1CGYA 4YDIH 4UV7H 5A2LH 3ARUA 2Y72A 4A6YB 5EFIB 1NL0L 5D8JH 4JCMA 1ZANH 5IB1B 4PJXA 4ENED 3AXLB 3GMRA 1K85A 2EEAA 4XNUH 3QAZB 4NCC1 4OCMC 3GSUA 1A22B 1UJ3B 3VXRD 3H9SA 4TUJB 5DHVA 5EIVA 3UBXI 2F5BL 3QNXA 5DVOA 1FL5A 3PWPB 4J8RA 2VQ1A 4DN3L 2IG2H 3QDME 5FK9B 4M7LT 2L7JA 2FWOB 2YR3A 5I9QC 4U1MB 1RD6A 5JOPD 4RGMB 4JFFB 3EJJX 5FB8A 1MAML 3H6JA 1MCDA 5I19H 2QV2A 3PHSA 4LIQL 1AI1H 3PQYA 4TVPL 3H42L 2ADIA 5EBWB 1KB5H 3S96A 2AJVL 4PRID 1SEQH 1UB6A 1I3GL 1KIUA 5DZNA 5TQ0L 4PGJA 3GSNL 4Q7DA 4KI5D 1IGYB 4MA1C 4I5BB 1MHHB 1QP1A 3DWTA 5L0QC 3WO4B 4G6AC 4ZSOA 3EFDL 4WW2B 4PB9L 3CMOL 4PJAB 2VH5H 4UOJA 1R0AH 1OF2B 2Q7NA 2M1KA 3GI8H 5F97E 1MCSA 3SE3C 4Z7VB 4LHUA 1RV6X 4H88H 1FZJA 5F7EL 2X1XR 2AKRA 2NY3D 3PGCB 2ZOKA 4OLVH 4XVSH 3FFCE 3WXVH 1SEBB 3P0YH 1DQDH 4RCAA 5ACZB 1J11A 2OSLB 1I85C 3MLVL 1YN7A 2DQJH 2EE9A 4G43B 2O5XL 2DQFA 1CDYA 3QCVH 1C08B 3V4PH 5EIQA 3KPMA 1UWEH 4G8IA 2ZPKH 2VIRB 3HE6B 3WNNA 1QSED 3WIHA 4IOFC 4JO3L 4KPHL 4IS6A 4G8FB 3HC0B 4QHNA 4X83A 4MA7H 1DVFB 2X4SB 4OJFL 1UG9A 4G6AD 1JHLL 1HWGB 5E4EB 5CD3B 2NY6B 1P84K 2V9TA 3MRQA 3AY4C 4GW1A 5B3JF 1YQVH 3LKQA 3AUVA 2B39A 1AGFA 5GJTL 2FSEB 5K93A 4GXVL 2MHAA 3HMWH 1FVEB 3CFJA 4MMXC 1EA9C 2UVEA 4G8GE 2QHRL 3HLAA 3O6FD 1WZMA 4YUEH 3BPCB 3BPOC 3ROOA 1WC7B 3RL2B 5L2JB 2QKIA 2NW2B 1N6QH 4XXDB 5DJYB 2WBJB 2GY7B 3WIHH 4NBXB 1FO0L 3PNWA 1AIFB 5IV2B 1XH3A 4JRXA 1IGTB 3GK8H 4HWUA 4P5MB 5F7KC 2YK1H 3WKMH 3H3BC 1YNLH 3ZKSD 3BZ4B 4IOFD 1Y0LB 3F7QA 3P9LB 4HKBB 4NZRL 4P2RE 3STZA 2IJ0C 3CVIL 3ZTJH 3BQUB 5HVHB 2ICES 2N56A 1G7PA 2I5YH 2P42B 1RZKH 2CQVA 3LVEA 3DARA 3ARGA 3KHQA 4JGUA 1TCRA 1FFPB 3SQOL 3RWJA 1OAQL 4XX1G 1N3NA 1U3HC 2ESVD 3ZHKA 5HHMD 3RP1A 5JOEA 1B6DA 1MEXH 4EI5C 1GXEA 3KHOA 2A38A 1DR9A 1D5XB 3W11D 4JREB 4OFVA 4NGHH 5B39A 5E00B 3MBEC 2VWEE 3HAEG 1LMKA 3FQWB 1OPGH 2JELH 2VLJD 5EORL 5D1ZA 5D7KE 1JUFA 4P3CH 5EOCL 1XGPA 3PP3K 4X6FB 2VAAB 4I3SL 4FTVE 4YDJA 3NCEB 1ZHNA 1LEGA 1UWGL 5E94B 4TULL 5B4MC 5C09A 3C60C 4LVOB 4MNQE 4WWKC 3V52H 4Y4FD 2APFA 4JDTL 5JHDD 1KOAA 2R29H 2ATKB 4GBXA 3QPQC 3B9KD 3QDMB 1T3FA 4F80A 5EC2A 3S4SA 1I3VA 4HJJL 4YDLB 3O2DH 5C70A 5HHNA 4M6NL 3NABL 2V2TA 2ZUYA 3IGAB 1HH9A 3VD5A 4EI5D 4KDWA 1JI1A 1YNKH 4S1RL 2YD8A 5IIEA 3GMLA 1A1MB 3MLXL 2Z8RA 4Y16B 2MQCA 2BOBA 4OT1L 1QSFD 3BP4B 3MBED 3K8LA 4N90E 3T4YB 3RX7A 1DLFH 5CWSB 1CDBA 4K94H 1A6UL 1ZTXH 4GAYA 4O2EB 1WZ1L 3HS0A 3HI1A 1I3UA 4OSUH 4HWZB 2WMPA 1NFIA 4LVNC 1Y6MR 2AXFA 4WFGD 4HIHA 3RKDC 3RWHA 2GT9B 4S2SA 4ZUTB 3C60D 3V6BR 2XA8H 3OJVC 3P4OA 4JN1H 2ZUTA 1ADQL 4WWKD 2CLRA 3IFLL 2GEEA 4YHPA 1CBVL 4ZFFB 5D1QC 2H1PH 4TUOB 1OL0A 2NTFB 1B2WL 3QPQD 4APQB 5C07D 1FFOB 3FFCB 4PJ8C 1R5IB 1T7VA 1G7IA 4G7VH 4P9MH 4K9EH 1T04B 2VDKL 4KWUA 4KXZI 1W0YT 2FBOJ 5CGTA 5C2UB 4R0LC 2X70A 5IVZA 2VXUH 1BVKA 32C2B 3VRLE 2OJEA 3HNTH 3GSVA 1G7LB 3BKMH 2PTUA 4LSVH 4M93B 4HT1L 4MGXA 4JG1L 5CJXC 3U0TA 2C1OB 1JGUL 4DK3A 3FB7B 4PYHA 4YO0B 4HF5L 2UUDK 1WJ3A 1D9KC 1Z3GL 4OGXL 3LH2L 5HYFA 5KZCB 1I9IL 1DBKH 5DF0A 3T2QA 1E0OB 4XVTL 4P4KB 4IRJC 4L4VA 3PP4L 1N5YL 2C1PB 2EDNA 4X6CA 1U8PB 1NANI 4HKJA 2IAMB 1I1FB 3SGDI 5D2LF 1MUJB 4HJGA 1P4IL 4G8GB 5IW1A 5D1QD 3VWKB 1BGXL 2Y06H 4BUHA 4JFEA 1YEJH 3LS4L 4WVRA 4JKWA 1JPSL 2B1HH 4Z7UF 1IL1B 4LCUA 5HGBB 2XN9A 4TSBL 3QUMB 3DURB 3IXAA 2Q76A 4K23H 3PGFL 4QXWA 2H9GB 5D6DC 4NKQB 4CN1A 1JF5A 3WMSA 3BESR 1OP5H 4P2RB 4FQXC 1KENL 1RZ8B 1D9KD 4FZ8L 3QJFA 2VXVH 5FHBH 3OV6A 2D4FA 5GSRB 1ZT7B 5DWUH 2DTSA 1FYHB 4J7RA 3SOBL 2ZSVA 4IRJD 1GZQA 2YPVH 3MLSH 2NY7H 3JSSA 1N64H 4BA8A 4J6RL 1IM9B 3G5VB 5F7HA 5I1GH 3T2OA 1MFAH 1IBGH 3I50L 2DKUA 3A67H 3T3PF 1EV2E 4HUUA 1F90H 3BIKA 1ONQB 4EUPG 2G5RA 4AEIL 4U1JA 3MLUH 2ZNXA 3DUUA 1OSZA 1UEYA 2EO1A 3FQTA 1G9ML 2Z92B 3OKKA 4IMLA 2DBJA 2UZIL 1N4XL 1RURH 7FABH 3P77A 3N1PC 1MWAB 5D9SA 4Q9QH 3KPNA 5GS0C 1Y6NR 3BZEA 4I48A 4FTVB 4HD9A 3UCRA 3VA6A 5TF1H 1BECA 1VKXB 1JNHA 5IVXF 1IM3B 1MCOH 1QQDA 3ARRA 5HGAA 1DEDA 2EH7L 3L95A 4QY8A 2I60L 3DX7B 4MNQB 5GGUA 3VWJC 1VGEH 5SWSD 4BH8B 1QFWL 5IHUH 4FQXD 5T1LB 3LQAL 4XGZA 1V7MH 1BZ9A 1ZS8B 3TWCL 1DBML 2QHLA 1P7HL 4GG8A 3BE1L 1QHPA 5LWYH 4F7TA 4HIXL 1OW0A 4JM2B 1UENA 1WGOA 1I7UA 1UA6H 5EU6E 3JWDH 5EU5B 2OQJB 4OUOA 3D39E 2R4RH 2WUCH 3MLWH 1I7TB 5FYKL 1Q9LA 3RUGF 1W0WB 4YXLL 1BOGB 3MNVA 1Y18B 1T0NA 3OHXB 3UTTE 2CKBH 3K74B 5GS0D 2QSCL 3MV9A 1FYTD 3DX6A 3VJ6A 4LDEB 3DPBA 4JY5H 2FYYA 3FO0H 4LRIA 2PO6C 4KAQL 1JWUA 3D2UB 1T7XA 3FRPA 1GC1H 1IMHC 1JGEB 3VWJD 4U2YA 2C4XA 1MOEA 1FVCB 2CMRL 4CVUA 2X4RA 3QRGH 4GSDL 3QI9C 1DCLA 4OD2B 1BZ7A 2EZ0C 4PJGA 4RQQA 3S36X 4CU6A 5DFWH 1NMBL 2PW2B 1ZLSL 2HVKB 1RU9H 2HT3C 4FQJH 4KHTL 2H2PC 5IGXH 3DJ9A 5D1XB 2VMFA 4RZCB 4PP2A 3K81A 2VQTA 3IJSB 4DK6A 4Y0GA 4PV8A 2LAGB 5GIRA 3DI2B 1BFVL 4GW4B 4KRPB 4LSQH 5HHOD 1JGVH 3BKYH 4KI1A 1NEZA 2G9HA 3QWOB 2AQ2A 1T83C 5DQ9A 1NLDH 1SJEB 5IG7B 3TFKC 4MXVF 4X99B 5C6TL 4YAQA 5E8OA 4XPFH 1E6OH 1IQDA 5GGTL 2HG5A 4QGTA 5JZ7C 4F8QA 4NZTH 4NQDD 2DLFL 5HPMB 3WEXB 3STLA 3WNPA 5JLZA 4G6JL 2DI7A 4HKXA 1FSKB 4BFEA 1KELL 5B8CA 4L8DB 3OKNB 3BO8B 3B9AA 2J1KA 4AEEA 1TNNA 1BQLH 4Z78A 3UZQA 2AXGB 3QI9D 2EZ0D 2Q6WB 1SBBA 1TVHA 3GMOB 4BH7A 1JYXA 4CU7A 1PEZA 2A0LD 2HT3D 3OPZL 4OFDA 3U6RA 4L8SC 4IMKA 2H2PD 4OKDA 4WCYH 1HQ4B 5BXFB 3GSNA 3DXAA 1JVKA 3D5OF 4NKDB 5M95B 3BVNB 4KQ4H 2ADFL 3BN9D 5CBEB 2IBZY 4YR6A 3CFCH 1T0PB 5C0CE 1ZGLM 4XTRC 6FABL 5JZ7D 1W2KT 3HMXH 5FO9B 3QULA 1QSZA 2ZCHH 4ODWA 3SEPA 4YHIA 1K9TA 4MQTB 3IT8D 1ES0A 1IKFH 3ZT7A 3QIWC 3QJHA 4P23B 4NHUA 1EMTL 4R8WH 2A77H 5J6GB 3O45B 4WIQA 4X5XA 1F4HA 2VRAA 4X9IA 3SGKA 4R7DA 2OTUA 2AJXH 4M4RA 2Y25A 4XMKL 4JQVA 5BJTA 3VXNA 2P4AB 5BV7L 2H41A 1U8QA 4ODXB 4KGLA 1FIGH 2P8LA 4NQXA 2JIXD 4NKMA 1JCKA 1T2QH 2KQMA 1JIBA 1XR9A 2LU7A 1I1CA 5AYQA 1PX3A 1S7VB 2ICWJ 3VFNB 2AXHA 1HNFA 2EIZB 1YMHB 1UC6A 4DZBB 1KN2L 2WANA 4OZGE 3C2AL 4HS3B 3FO1A 4OIIL 5E6ID 5I8CB 5CEXB 2YPLB 1CFQB 2YC1B 1S9YB 2IAND 1J1XL 4F7MB 2OL3L 2Y9RT 4KGJA 4JN2B 4S1QL 3N85L 5I16A 3ARFB 4NRZB 1IEBB 4BQ8A 1OQOA 3QIWD 2F54D 1F6AB 3WSQL 4P99A 3FTGA 3L5IA 5EU6B 3D39B 3MRFB 3NA9L 5T1KA 1FO0A 4MJ6A 2Q8AH 2VUYA 3MOAH 1FG2B 2LABA 4KROB 5F44A 3UTTB 1TFHA 1A02N 2K3TA 3ULSA 2D31B 4HS8L 3REVA 2P46B 5ERWA 2NMSA 4X7CC 1M7DA 5I15H 2Z91A 4RGND 1LO5A 4UB0L 2BNRE 3QQ9D 1NCBL 1NGPH 3FOMA 4LGRB 4RDQG 4X8JA 1I8LC 2QHRH 2L7UA 2ADGB 3G9VA 3FAWA 3LN5A 4PJHF 1R5WA 1OAUL 4U6YA 4CADA 4PJXB 5DJAA 4E9LA 5I1EH 5C09E 3KPSA 2DBLL 3DV4A 3PG2A 3GMRB 1HK6A 5JORA 1YPZE 2APVA 5DYOA 4LEXH 1FO0H 3H9SB 5DHVB 3EYUL 3QNXB 1FL5B 2VQ1B 4I0CC 4NO0B 3CCHA 4PLKC 4U1LA 1AGDA 1BJ8A 5CILL 3B9VA 4N0YH 3CVIH 1WEJL 1L0XA 3O41A 2QL1A 5FUOL 4HHAA 5FB8B 5I6XC 4RMTA 2YSSA 4JVPA 1H0DB 4R90L 4LSTL 2UWEA 3I75A 1GGBH 2ADIB 1J0KA 1EEZA 2CRZA 1QUNA 4QTIH 1UB6B 3TPUA 2SEBA 2OM5A 3QAZC 2XFXA 2A9ML 1CFVL 2EECA 3KYKL 1UJ3C 2ZG2A 1ZXQA 4LLQA 1ZWIA 1P4BL 3ULUL 5JR1L 3BOVA 4B7IA 3NCBB 1RJLA 1P7QD 1F6FB 4ZUWA 3T2NH 3SKUD 1OD9A 1T22A 4U1NA 3B9EA 4EXKA 5E2TL 4RGMC 1AO7E 4LHUB 5CZVH 3VG0L 1FZJB 2OCFD 4I3SH 1A6TA 1S7TA 3JBG7 3WXWH 3BN3B 4TULH 4K8RL 3JXAA 1II4E 2O5YL 4PJIF 2FZ3A 1B3JA 4UZGA 4PY8I 3VRLF 3JVGA 1P84J 4CDHA 2ID5A 5C0CB 1YN7B 3WO4C 2DQFB 3LKRA 4WW2C 1FC2D 3KPMB 1ADQA 6CGTA 2VZOA 4G8IB 3C08L 1JGLL 4HJJH 2BVEA 5ACLA 1RUPL 1DUZA 4R4BB 2CDGA 3FRUA 3M1BA 3ZL4L 2KQNA 4IS6B 5DURB 5TE6L 4QHNB 4YBHA 3BHBA 5CSZA 1MSPA 5TFSL 5ALCH 4OBSA 4HLZG 2C5DC 3QEQE 3O3BA 4L4VE 3NAAL 1CL7L 3MRQB 4GW1B 4M43H 2WM0A 4D9QD 3MZTA 3LKQB 1GGUA 1G9NC 3V0AC 2MHAB 3CFJB 2FJHA 3OKMA 1A64A 5L8LB 2WSKA 1WZ1H 3OKYA 3HLAB 5ITBL 5GGSA 5F9WB 3E3QC 1B0GB 5CSGA 3MLRH 4JFEE 4RFNB 3CXDL 3ROOB 2AS5M 3HE6C 2QKIB 3GJFH 1C5BH 1XGRA 4OZGB 5E8DL 3S97C 4G6KL 4HCRL 3THML 2JB6A 3IFLH 4PBVC 2XN9E 1CBVH 1DVFC 1EGJL 5E4EC 1SBSL 3BW9A 1XH3B 2NY6C 2H45A 3QPXL 4Y2OA 2ENYA 3F6LA 3NGBB 3FQXA 1I1RA 2VDKH 1LQSR 3NCMA 2NY2B 2XRAH 4GAJH 3BEWA 1G7PB 4ZG1A 2GI7A 4HT1H 5HHXH 4KDTC 2JE8A 1N26A 3ARGB 1JGUH 3VFMB 1TCRB 5GISL 4K3GA 4Q9RL 3I3BA 4BSVA 1N3NB 1B0RA 1GPOH 4N9OB 1R5VA 5HHQB 4D0DA 2AV7A 2WBJC 1T03L 4XP1H 2BSTB 5E5MA 1BF8A 2OJZH 1T0MA 5DEGA 4PUBH 1QYGH 3WFZA 2XZZA 2CLVA 4Q74A 5B39B 4DOHB 1YEKH 4P46D 4WTZG 4CVZA 4OFPA 1WVZA 3HE6D 5FFLA 4YGAB 2BNRB 4XCFH 3N9GL 1CGSH 5D1ZB 1NFKA 4RFOL 5CKGA 5K9JH 1DVFD 1XGPB 3BQUC 1KCSL 1FFNB 1G7QA 5HVHC 1G0YR 2YD2A 4ODVL 4YDJB 1DL7L 3R06A 3EHBC 1ZHNB 5IFAL 1LEGB 4CVXA 2NY6D 2X4NB 5C09B 1JPSH 3UPAA 1YEGL 4CW1A 1CTNA 2IPUK 4Y2DA 5DUPL 3PGFH 2A9NH 4D3CH 1MI5A 3EYSH 4Z7WF 4GQ9H 4GBXB 4N5EC 1MCRA