4JKPH

Restricting hiv-1 pathways for escape using rationally-designed anti-hiv-1 antibodies
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
222
Chain Sequence
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRWGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp120
publication title Restricting HIV-1 pathways for escape using rationally designed anti-HIV-1 antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 42
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH01
3LQAC 2HLFC 1U3HA 3UTPD 3H9SB 5L9DH 4OCRL 3K4AA 2DQTL 1MIEL 4KI5C 4B50A 4A2LA 5TDOA 4AYFA 3MC0A 3UC0H 1INQA 1AI1L 3BHBB 4WENB 2R1YB 1WLHA 4X6BA 2UVEA 3BGFC 2HT4C 4WI8A 3G6JF 4WCYL 5M95B 2PKDA 3QUYB 1P7QD 1H8NA 2Y5EA 1NBZB 1KB5B 3ZYJA 4DJMA 2VDNL 4OD1L 5IBUB 1U8LA 4DWHA 3QUMA 4YH6A 4G7YH 3VXOA 4LLAA 5JZ7D 2YS4A 1S9VB 1RZJC 5C0JA 1HYSC 4PGZA 5T3XE 1C08A 4KROC 4DKFH 1F6AA 4JFOA 3EDFA 3LS5L 2BCKB 4R4NC 4LARH 2AJZA 3UTSA 2EEBA 1FFPB 3SE4C 5FDWA 5BW7A 2FZ3B 3DRTA 5L88H 3TJEL 2P5WE 4YXKH 5J13B 5DK2B 3CFIC 3WS3B 2P5EA 3FQUB 3WHE1 5FUCC 4X6BB 4F7PA 2AXHA 3O6KL 1W0WA 3H0TA 3O8XA 4QOKD 3GKWL 3EYFA 4PG2C 1MCCA 3PL6C 2FJHA 4U3XA 3QUMB 1IQDA 2FX8H 4MZ2A 4TSBH 1AO7D 1NPUA 4Y1AE 3VXOB 1J8KA 3VD9A 4J3XA 5CGMA 3PGFH 5FIEA 1JGDA 2BRQA 1QRNB 1RJYA 3HTLX 3MV7E 2DDQL 5D2NC 4JANB 3CU7A 4BUGA 5KSAC 3LKNA 3LKRB 4JFOB 5EZLA 4D9LH 5GSVA 1P4LA 4HD9A 3UTSB 5BRZD 1OW0C 2JCCE 1T22A 1K4DB 3LRSB 4AEIL 3BD4A 4NZRL 1PKOA 1YMMD 4YXLH 4GW4B 4NQXA 2R4RH 4LPTA 4UUJA 1IEBB 4Y0GA 3SO3C 1RURL 2JJUA 1J1XL 2HTKD 5JPNB 2DIJA 5EBGA 4FOMA 2H9GA 1IGIH 1LILA 2P8PB 2Y72A 4OGYL 4S1DD 3BWAB 1FGVL 1IFHH 4P5TD 5EIIA 4OIAA 3HFMH 4GBXC 4I4WA 5DO2C 1W0WB 3H0TB 3O8XB 4GRWF 3EYFB 2NXZD 1NGQL 2OL3H 5AWNL 1A6ZA 2FJHB 3U83A 1RSFA 3GIZL 5KVDH 3I9GL 3B2VH 2DI8A 3TF7C 2B4CL 3P73B 3IFPA 3DECA 1JGDB 1UXSA 2F5BH 4Z9KB 6FABL 2XG5A 4G43A 2B0SL 3T09A 1KCKA 5J6HA 3S8WA 3SE8L 4RSVA 1G0YR 4K2UL 5EZLB 4YZFE 3ARFA 1RVFH 5KW9H 3Q5YA 3QJHA 5I19H 2H32A 5GRUH 1T21A 25C8H 4NQXB 3IETA 3VXTA 1J0HA 1Z0MA 4ZNEE 1Z3GL 4MCYA 1H3XA 4PGBB 3ILPA 4NOFA 1ZA6B 1A2YA 1ZTXH 2RJMA 4Z76A 5KSBA 4QRPD 3MOBH 3GM8A 3ULVF 2ILLA 4I4WB 7FABH 4UT6H 3NTCL 1BECA 1CZ8L 5DSCA 1A6ZB 3DHJA 3CXDL 3CFJB 5SWZE 2DQFA 4OV6F 2BY0A 5EN2A 1UXSB 2HVKA 1R3IL 2AEIT 3RNQA 1CGYA 4YR6A 1LEKA 3ME0A 1JRHL 4L4TD 1X6NA 4F9LC 5L8KB 4NNPL 4OLZH 3FB8A 3QJHB 1A7RL 5GGSA 2X9XA 3DX8A 2EDLA 4Y2DA 3VXTB 2DQDH 4WW1A 1EAJA 1NCWL 3WFDL 1FH5H 5IG7A 1A2YB 5ETUB 2OYPA 4UIKH 3HPJB 3MRFA 2P5WD 4CBPA 5F88B 3FKUS 1KB9K 4PJHB 1MHCA 3N85H 4FFZL 4ESKA 1HSAA 3WNMA 3SDAC 5IBTL 4GG6B 1HEZA 5I75C 2R9HD 2VABB 4DUWA 4PGEA 4FQHA 4J3OC 2DQFB 4F80A 5I66A 1TVBA 1ACYH 5J9PB 3PHSA 1LO4H 4OLYL 3OGOE 5EN2B 1EFXD 4OGXH 2MCG1 3M07A 4YR6B 1P5UA 2HJLA 1ZLSL 1RZ7L 4QNPE 1LEKB 5DFVC 4XCCL 4BSVA 1JGLH 1EXUB 5MERA 2IPTL 2FECL 5C0EA 5HD8C 5KZCB 5D7JA 3LY6A 4FFVC 3MV7D 3TO2B 2APFA 5GGSB 1NANI 2FR4B 3I6LE 1F45A 3U7WH 3HAEG 3KJ6H 4Y2DB 4MNQA 3UBXI 2JIXB 1K8DA 5IG7B 1XCQA 2AP2A 3TPUB 3S4SG 2Q86A 2EIEA 3DRQA 4P59H 5E6ZA 1DBMH 5LAXA 43CAB 1MHCB 3DMMC 4AMKH 1HSAB 3C6SA 2WQ8A 1MSPA 1HEZB 5JHDA 5FGSA 3IFNH 2IBBA 4GUPA 1KGCE 3L3JA 3MUGA 4FQHB 3TN0D 1TVBB 1LP9B 1SEQH 1PY9A 1FNGA 2CLZB 4B7LA 1WBXB 1T4KB 4WI5A 1RJLA 1MCIA 1U42A 3MXWH 1N64H 2F8OA 3OMZA 4BSVB 5FO8B 1MWAH 5MERB 1GYAA 2WWMC 2YA0A 1ZA3A 4DKFL 5K9JL 3GMQA 5F1OB 2VXTH 4X8JA 2QKIA 5C0BB 2V6HA 4LARL 5L7XH 5M94B 3DX6B 3ARVA 4K8RH 4F9PA 1K8DB 3AS1A 4X9HA 5C0ND 2E9JA 4NNYB 4PRDA 3QDHA 4YXKL 2IANB 1CR9L 2GSGB 1CTNA 1HSBB 3HS0A 2J5LC 1FYTE 4NQCB 4MYWB 3C6SB 1G1YA 4NZTH 3NN8B 5FKAA 4TVSa 4JRWA 3L3JB 1WBZA 3MUGB 1MF2H 3QG7H 4WO4D 4X6FA 1FNGB 2P4AB 4K07A 5I15L 4TSBL 3SQOH 3W82A 4HUMB 4LHQB 5I74C 2HMID 3L5IA 4WHTB 2FL5B 4X6EA 4GRWB 5I2IA 4G9FE 5E9DE 4D9LL 5KBNC 1TZGL 2QKIB 1KTDA 1AQDA 3W11C 4TUOA 2MMXA 4IIQC 1K8IA 4YDKH 5KS9E 4KI5E 5A1AA 2PXYA 2XXMB 1NMCB 4YGVA 3ZKSD 2Y4SA 5I1AA 4FTVE 4MA3A 3QYCA 2X4SA 1F6FB 2XN9E 3V79C 2NY6C 2DD8H 3T65B 5F7NC 3HS0B 5DVMA 5C0CA 2IALB 5CEXB 3BN9C 4FG6C 3VRIA 3HFML 3O45B 1CL7I 3ZE0E 3IDMB 2OL3L 4EI6A 3V4PL 5KVDL 1IAKA 4MJ5A 3M45A 2C4FU 2UWEF 3NGBC 5EUOA 1JTTA 2F5BL 4M61A 4E5XA 3B4NA 4X6EB 3TBYA 5I2IB 1WUNT 3IDYB 3LQZA 3C6LC 1B0RA 2EYRA 3EW3B 1RVFL 1RUPL 4TUOB 5H8DA 1K8IB 4JKLA 2IEPA 4QHKJ 5I19L 2E3VA 4X7EC 3B9EA 25C8L 4QRUA 2A38A 4YGVB 5B22A 2X05A 3MR9A 4ZFOL 5I1AB 4MA3B 1HXYA 2HTLD 4P9MH 3RJQB 1JYNA 4DZ8A 4HJ0D 5DEFB 3WLWC 2BVEA 1ZTXL 4RIRB 3X11A 3MA9L 4Z7WA 1HHKA 5E2JA 1TITA 4YDVB 3JWOH 3VRIB 3V8OA 5EPMB 4AEFA 7FABL 3QIBD 4UT6L 5L6YL 1DL7H 2M2DA 2VL5A 3MBED 5C0FA 2PYFB 5D2NE 1N8ZA 4R0LA 3GSVA 1J1PH 2NZIA 1KGCD 5FYKH 4PJGB 5EUOB 5HYJA 3S34H 3QNYB 5KTEH 4O58H 3WN5B 4N8PA 4RFEA 3KWWB 3VXRA 4X9BA 3TBYB 5JXEA 5EDXA 2DYPB 1INDH 2YD6A 1AGBA 2EYRB 1BVZA 1I3RA 1KPUB 1A02N 4Y4FA 4D0BA 5BOPA 4HS3A 4OLZL 4WTXA 3MRIB 4RWHA 1IARB 2W0KA 4UZGA 4ZXBD 5JW5A 3SJVB 4JVWA 2D0HA 2DQDL 2ZKHH 3R1GH 1MCDA 3ARDB 4WWID 3VXUE 1FH5L 2DM2A 4X7FC 1CF8H 3C5ZA 1N0LA 4AM0A 1HHKB 1N5AB 1S7QA 1E4XL 4NZDA 2DQUH 1PG7X 4UIKL 4DAGH 1I1AA 2MKWA 1IT9H 5FA4A 3TC9A 4CU8A 5IVOA 3S37X 4DKAA 3N85L 3BW9A 5DJZB 3RVUD 1KJVB 2C7UA 4KUCF 2EXWD 2IAMC 1N8ZB 4M9PA 1IGYA 4P2OB 5E0QA 5ISZE 3IF1B 3MGOA 1ACYL 5LG1A 1QP1A 5HYJB 5F9OH 3AY4A 4OGXL 2VXVL 3DO7A 2ZUWA 2XKUA 4RFEB 3RWJB 3VXRB 1KB5H 5HHME 1KC5H 1JGLL 4PJCF 2XG4A 2X4NA 1UJTA 5BXFB 1I3RB 4HS3B 4MJ2A 2OP4H 1BP3B 2VLKA 3PWUA 4N90E 1TNMA 3FQXB 4LVHC 5B3JE 3OR7B 3EOTH 5HHXH 3E6HA 2HLFD 4G9FD 3U7WL 2H6PA 3CSYA 1BJMA 2BXZA 3D3VB 4PJ8B 5CD5C 4KI5D 4GQPH 3JWDH 4XPTH 4AM0B 1R5WA 4P59L 5BV7B 5FA4B 4RQQA 1DBML 3BW9B 4AMKL 2ZCKH 2C7UB 2XN9D 1F58H 1FAKT 1A9BA 3BEVB 3IFNL 4XHQA 4NM8H 1MCHA 4XX1G 1PLGH 2ZOLA 3QWOA 2HAZA 4N1HB 5D1XC 1FFOB 5DJDA 1SEQL 3F5WA 3W9DA 3QZWA 1HYSD 1D9KB 1P5VA 4KJQC 4QLRA 5CSBA 5DYOA 4U7MA 1X5KA 1LK2B 2Z91B 4FXKB 2CR6A 3MXWL 1U91A 1IGMH 1N64L 1MWAL 3QUMH 1U3YA 3SE3C 1EO8L 4HK0A 5DQJB 5F7DB 2VLKB 2VC2L 4N8VB 1ROWA 2CO7B 3G5ZB 4B53A 5L7XL 3E6HB 4HXAH 1JV5A 4KKNA 4G6JH 4ZOBA 4K8RL 5J06A 3RI5K 35C8H 3TO4C 3Q1SH 3T1FB 4ODTH 3F6LA 3PNWA 5JPMA 1R5WB 2EXYD 1KPRA 2R2HB 1PYWA 2P7TA 1OD9A 1KULA 2ZNXA 3BKCH 5DEZA 4ZFGL 3PL6D 4NZTL 1SHMA 1A9BB 4G6KH 1JJUA 1MF2L 5FUOH 4Z6AT 2BP3A 3QG7L 2JK5A 1JPGA 4G6MH 3KLHC 4XX1E 3F5WB 4HUVA 2OI9C 3QZWB 5D7IF 5EWIH 5DYOB 5EU4A 5CSZB 1CLZL 5KSAD 1U91B 1UKTA 1NBVH 1CE1L 4TVPD 1CICA 1SJXA 3H9HA 3DXAD 3V4VH 3LPWA 8FABA 1QRKA 4HULB 5J56B 3O9WC 2J6EH 4P57A 4IMKC 4I3RH 5AUMA 1D5ZA 4WU7A 3BISA 4GMTH 5H37H 4QTIH 1G7IA 2BOBA 3ULSA 1KTLB 4FQ2H 4IOSD 3S96A 5JPMB 4DEPC 1KPRB 4AIOA 1PYWB 4GBXD 3VGGA 5DO2D 2DD8L 2P7TB 1YEIH 4OGZA 2KQMA 2BRRH 1WTLA 2VIRB 3OAZH 2IPKA 2GTWB 1KEGL 1A1MA 4OUOA 5CCKL 3BO8A 3WJJC 4HUVB 3OKMB 4MNQE 1P7KA 2PTVA 5FYLD 1S9XA 3RBGA 1NC4A 3WIHH 2CDFB 3AUVA 2YUXA 3V6OA 2HP4A 4M7ZC 3EDKA 1CICB 4FP8L 4WFGE 5TFSH 4RAUA 1MFAH 4J4PC 3H9HB 4NO0B 4LNRA 1EUUA 3IDGA 2F53A 2BSSB 1A21A 4WGVB 8FABB 1YEGL 1AY1H 1XF1A 4N0UB 4TULH 4YFEA 3L3DA 2XTJC 1D5ZB 2X4OA 3ZO0A 3D2UD 1G7IB 2CMRH 2BOBB 3T4AA 1OAYL 3VXMA 4P9ML 3S96B 1I1RA 3GB7A 2NY1C 1MAMH 5DZNA 5AZEL 3IU3A 1ODAA 1RMFL 2XA3A 4MS8C 4RGMB 1CU4H 3JWOL 3QDJB 5IVZA 4APQB 2VDPL 2GHWB 1A1MB 1XGRA 3GNML 4X6CA 1B88A 3CDCA 1DL7L 3BO8B 3DX7A 4O2FA 1P7KB 3NCYP 1J1PL 4GRLC 2B5IB 5K33A 1LEGA 2H2PC 4OTXH 4LMQE 3S34L 5KTEL 4O58L 5ACZA 1CE6A 4RAUB 3K80A 4J3SA 3IDGB 1Z5LA 2FX7H 1INDL 1YMHB 5HI4C 1WISA 2I9LA 1KCVH 1BM3H 1SYSA 3L3DB 1MJUH 4P48A 4H20H 2XWJA 3QG6A 4XCEA 1OAXH 3T4AB 2ZKHL 3R1GL 3GB7B 4N0YH 1PG7H 5JTWA 1CF8L 4LOUC 3UZVB 3C8HA 3NIFF 3IU3B 4MXVE 3ZLQC 3S37H 3SDAD 4DAGL 2DQUL 2SEBA 5F72S 1IT9L 3KS0H 3T8XA 1MI5E 5IVZB 1BFVH 4JFQB 1LD9A 4JFFD 1DR9A 5HVGB 3H7BA 3MRMA 4WEUD 4XBPB 3DX7B 1VKXB 1Q9OA 4JFXB 2GUOA 5DFVD 3VXSA 1LEGB 3ZYZA 1ZHNA 5F9OL 4MAYD 1MREL 3OF6A 1KB5L 2VZTA 1KC5L 2FEEL 1S5HA 4F7CA 4CDHA 1M7XA 12E8H 4PFEA 2UVFA 1F13A 2OP4L 1E28A 3FONA 1N26A 4U1SB 3PDOA 3QB7C 1SYSB 3RUGB 3A0OA 4ZO9A 5HHXL 2XWJB 4PLJD 1F11A 3QG6B 3VRJB 4PJXB 5MI0B 4JPVH 1KIPA 2EDJA 1FSKC 1AHWA 3JWDL 2YSSB 4GKSA 3RHWF 1QFWM 2JF1A 2SEBB 2EH8H 2EDEA 4Q6IA 4OF3A 3ZE2E 1XIWC 3ALWA 4P4KD 2A74A 2ZCKL 3GEWB 4XNQB 3HZYA 3U36A 3MRMB 5E8DH 1BJ1J 5JO5A 4F15B 4NKDB 4PS4H 4NM8L 2ZG1A 1PLGL 2GUOB 1OGTB 3P11H 1FGNH 4JLRA 3JTSB 3VMOA 4RMUA 2KH2B 5C08A 4WVRA 1IGML 4PJ9A 3QUML 2Y7QA 1R3LA 1A0QH 1MFDH 5I8CB 3FONB 3PDOB 3RGVA 4HXAL 2O61B 4G6JL 4GRWH 1QPXA 3VFPA 1KIPB 1JYVA 4KC3B 3HG1A 2W60B 5EO9A 4YLQT 35C8L 3OXRB 3CDGB 3Q1SL 2D0GA 4ODTL 4GKSB 3AM8C 3O41A 4FQXA 1CLOH 3T77A 3O6ML 4Q6IB 5TDNA 2XV6B 3FO9B 2A74B 3U36B 5CJQH 1HKLH 4NRZA 1DQJA 5J11B 5JO5B 4G6KL 4G6ML 2DQCH 3BPNB 4X7SL 4LCWE 4N8CH 1EBPA 5EWIL 5CJOH 5DVNA 5IV2B 3EJZD 3QULA 3ZT7A 4K94H 4Y4KB 5I1DA 1NBVL 4JFDE 1NCAH 1OB1A 4CAGA 1R3LB 3B3IB 1BIIA 5IFHH 2XKNB 3U4EB 2I27N 4GMSL 2V2XA 1P4BL 2DL9A 1DN2A 3VGFA 5E95B 2J6EL 2EDWA 2Z8RA 5EO0A 5A3IC 3VFPB 4K8RC 1FZJB 1ZLWK 2V5SA 5EO9B 8CGTA 1CD9B 5MENB 4GMTL 4QTIL 5DRZA 1KLGA 2NX5E 4FQ2L 2QR0A 3O41B 4FQXB 2DI9A 4FG6D 2W38A 3SDXA 5GRXG 2BRRL 4PLKD 3U4BH 3P0YH 5TF1L 4NRZB 4FS0A 2HN7B 5I73C 2FH8A 5SWQA 4MB5A 2HJFA 5IVXF 5FKPA 4J3UA 1EVTC 3LSOA 1KBGH 3KPSA 4X99A 3I2CH 4KV5E 3AFLA 4ZQKA 1EPFA 3QULB 4DGVH 5B38G 4PR5A 3F7VA 3C6LD 5TFSL 1MFAL 3DUSA 4X7DC 3U6RA 4AQ1B 1BIIB 1Y6MR 5IP4A 4PG9A 2WQRA 2J8UF 4U31A 4EI5A 4ZO7A 4JN2B 3HUJA 5IJKA 3KXFE 4TULL 4UOJA 1A6AA 5EO0B 3BIKA 3IAGC 4OM1H 4LEOB 1X5JA 4HS8H 4PRPB 3WLWD 1WAAE 4FZEH 2CMRL 1OTUC 4M7LT 5GRVL 2QR0B 4NWTH 5DJ6B 1CGVA 3X14A 4RNRA 1KCRH 4CU7A 5C70A 4KTYA 1GGTA 1CU4L 3WHXA 1OSPL 4YNYB 5SWQB 2BSRA 4NQDE 1GZQA 1O5DT 3KPSB 1T66C 4X99B 2E7MA 4NUJB 3RZCC 1JWMA 2FRGP 3NFPA 4PR5B 4WUUE 5J4MA 3F7VB 1P1ZA 1CDBA 2B2XH 4PRHE 4L4VB 3DUSB 2AV7A 4P2RB 3TYFA 4R7NA 2FX7L 1J0IA 3F7YA 4EI5B 3KVQA 3HUJB 2NY4B 2MQ3A 1A6AB 5CZVH 1BM3L 2R1WA 3BIKB 5GS0H 3QEHB 1MJUL 3CZFA 1IMHC 1QSEB 4WUKL 2VZUA 2YWYA 3D48R 3ELAT 5FGBA 5IB1B 1OAXL 3ARRA 1IAOB 1SY6A 2D2OA 3X14B 1WEJH 4M8QA 4N0YL 1PG7L 3KJ4C 5ALCH 4WJ5B 4YHIA 2IAMD 3VMPA 3S37L 5E8OA 3EIFA 4FA8A 3RWFA 1JI2A 2F58H 3JWOC 4P46C 4YDJA 3E6FB 3WHXB 4DGYH 2ZZUT 5FCUH 4L3ED 1HK6A 2X4PA 2VR4A 1S7RB 3MRNB 4HMEA 2B20A 4NDMB 5BV7H 5IHLB 1AJ7H 3T0XA 2ZCHH 4D9QE 1JWMB 3NFPB 5HDBF 3RWIB 1P69B 2MKLC 5IHZA 2XTJE 2AV7B 4UAOB 2FHCA 2Q7NA 1MNUH 3JVGC 5E5RB 4R7NB 5CP3A 1R6VA 2WWKT 3F7YB 3EYOA 12E8L 4U0QB 3CZFB 3HMXA 3OKNA 5CD5D 1ND0B 3LCYA 4PJAA 4R6UA 1ZMYA 1P4IH 1TVDA 2QQKL 5GIRA 5GS1C 4JPVL 1QQDA 3MO1A 3PQYA 4YPGA 1TJIH 2Z8SA 3WFHB 3ZDYF 2BY1A 3RAJL 4A2MA 2X4QB 5HHOD 4L9LA 4JCMA 4YHIB 4X6DA 3EO9L 5EA0H 1ADQA 2G9HB 1GZPA 3RWFB 1S7XB 4CRPA 5CP7A 2X4UA 3GMLB 5D1XD 2X4PB 5E8DL 1R24A 3KYKH 3O4LE 4PS4L 1AP2A 1Z9OA 2FO4B 1KOAA 3GI8L 4K71B 1X5YA 1L4IA 3NIDE 5C07D 1I8LC 3RPIA 4JGUA 2PTTA 3L3GA 3VXNB 4WFEE 1S7VB 5EC1B 1TQBC 4EUPA 5TH2A 3EYOB 5DC0A 1A0QL 2E27L 3TP4A 3GGWA 4U1KB 4HK3N 3GHBH 3K8LA 3CH8A 3D39D 3TO4D 3ULUL 1U8IB 2QADB 4PJAB 4Q9RL 5GIRB 4NNXA 3FB6A 1P6AB 5CEZE 1XGQA 2HFGH 3ARBC 2ARWA 1ORQA 3JWDC 2AK4B 4L9LB 4G8GD 4I9WE 1Q9KB 1CLOL 3D0LB 1BQSA 1J87A 4QRSA 3QHFH 1E0OB 4C4KO 5J13C 1HKLL 1U6AH 4U1LB 5CJXA 4YDLB 3ZT6A 1G0DA 2Q20A 1J12A 3ILQC 5FYJH 1OSZB 1XCTB 5FO7A 4N8CL 4IMLA 4NHUB 1FHGA 4ELKB 5JMOC 1HINH 2PTTB 4LVNC 1VHPA 2L0DA 4WUUD 1FN4B 4EUPB 5TH2B 2D7MA 3O9WD 2W91A 5IVXB 4HWZB 4WTZA 3TCXA 4HFUL 3BPLB 3JV0A 4IRSA 1XGQB 3VXSE 4H88H 4KRMB 4ZAKA 1ORQB 5C3LD 1KACB 3WFCH 3ROOA 4LPUA 4JFZH 4JO2H 1VB9A 5F93C 4TSCH 3MNVA 2OJEA 4P23A 1VFBA 1CGTA 4QRSB 3U4BL 3P0YL 3RWCA 2GJZB 1AC0A 1T3FA 5AYQA 4C83A 1MCJA 5MP6H 1KBGL 3QDGE 4J4PD 3KYOA 4DGVL 3O8XC 5B21A 1Z9MA 1JHLH 5EOCJ 3N9GL 4D9QD 4KQ3H 4I0CC 2FBOJ 3JUZA 1QO3A 5LBSL 5ESQA 1YNTA 1CIUA 5F7LB 3KPRA 5D1ZA 5D70H 4U1HB 2AQ3A 2AJSH 1K3ZA 3T3MF 1W0YT 1MHPL 1PKQA 5C0AA 4IRSB 4ZSOB 5I17A 2NY1D 4ZAKB 3BPOC 3IS1X 4J3VA 1Y0LA 4FZEL 3ROOB 4MS8D 3FFDA 3SGEI 3NPSB 1KCRL 2AI0H 4E41E 4LKCB 4HUNB 2AEQH 2OJEB 1VFBB 4P23B 5IB5B 3OJ2C 1ZGLB 1KFAH 2JELH 3RWCB 4U49A 4GRLD 2IC2A 4XNYH 4C83B 2H2PD 5CLWA 2JJVA 3MRHA 4G5ZL 1IM9B 3IKKA 3LV3A 1DEDA 4MNGE 3B6SA 2PO6A 5IJVA 4PRID 3HG1E 3ZKNC 5C9JB 2B2XL 5F96H 1MCRA 3NZHH 4ZFFA 4F8TA 1BX2A 3TH2T 3C60A 5DMIH 4EDXA 1HHIA 2IADA 4NO5A 1AGDA 1YNTB 4EVNB 3MRQA 4WFED 3QH3B 2K3TA 5F8RC 4I0PD 4UTAH 3T0DA 1NLBH 1PKQB 2V5TA 5C6PB 5GS0L 3SDDD 1EHAA 4ODWA 1W0VB 4LGSB 2APTA 5HSFA 5I17B 4LOUD 5JA9A 2VDRL 3EYSH 1JZ4A 4HIHB 1NANH 3BDBA 3BP7A 2NXZB 4UV4H 5ANMB 1ORSA 3IXTA 2FIKA 4R26H 5ALCL 2W9DL 3X13B 4WWKB 1M7DB 4HKBB 3BXNA 2F58L 1FL6B 4DGYL 2JKXA 5D2LA 4F2MA 5HGBA 5FCUL 4LPYA 1T2QH 2CK2A 2AJYH 4Y8AA 2OZ4A 2E7LA 2D3VA 5BV7L 1AJ7L 3LV3B 1KJ2A 2ZCHL 1YJDH 2PO6B 4GKNA 2APBA 3DGGA 5LGHH 5HHQA 3VFMA 4EXPX 3WO4B 1MLCA 4Z7NE 4ZFFB 3INUL 1BX2B 3C60B 3RU8H 1W72B 1AGDB 3ARTA 3MRQB 1T03H 3BRGC 3LKQA 4EDWH 3VFUB 3T2QA 1FPTH 2VXQH 5FECB 1I8IA 1CDIA 3HE7D 4NQTA 2WBJC 2VXSH 2IH3A 1XF2A 3V9FA 3BP7B 1BOYA 3MJ9A 3KYMB 3UO1H 3ZDZE 32C2B 2YUZA 3MROA 1XIWD 1F4HA 4Y2DC 5EA0L 3MUHL 5C09E 3BXNB 4QRRD 5HGBB 5D2LB 4F2MB 1HXMA 5D6DA 3LQMA 3M8OL 3OJDA 1CQKA 1J5OH 4AL8H 2YR3A 3KYKL 3NCCB 1Z6JT 3QUZB 4KJYA 1I7TA 5B4MD 3RJDA 2ADJA 3TWCL 3SDYL 2Y07H 5E8PB 4WY7H 2YPLB 4HAFA 3RNKA 1FC1A 3BD5A 1F90H 1NDMA 4HBCH 1U2CA 3ARED 4LCCB 5IR1A 3ESVF 5I1KH 1UKQA 2Z9TA 3GHBL 3GFUA 1IEAA 4JZJA 5EO1B 5CMAB 2FATH 2VERN 5IWLA 1XF2B 4QY8B 2HFGL 5B8CA 1WFOA 1UWXK 3MROB 2OTUA 3UTTB 3CDYA 4S1RL 2AXFA 2Y06H 3OSKA 4V2CB 5FYKE 1BEYL 1CFTA 5DS8B 4JRYD 1HXMB 1AXTH 4QHUA 3QHFL 4YBLB 3T0WA 2OBGA 4KJYB 5DEGA 3RVXD 1I7TB 3PWPA 4LU5L 5B39B 1B0WA 4WRLA 1MQKH 1ZKAA 2BVPA 1CL7H 4J6RH 2M26A 3RA7L 1K4CB 3I02A 4V1DD 3PP3K 1DN0A 2WP3O 2R4SH 3GSXA 1HINL 4BFIB 3NIGF 1NDMB 4BQBA 4L8BB 2ZG2A 4PREA 1CT8B 2MTPA 3QCUH 2IJ0C 4MX7B 4LLMA 1JFQH 5A3ID 3FQNA 2HRPH 3DUUB 2EIZA 4CADA 1G6VK 3ARQA 2V2WA 4K8RD 5A40E 3L1OH 1IEAB 2XRAH 3V6FB 1NFIA 2BNRB 4ELMA 1JK8B 4H88L 4KDWA 3EZJB 4NZUL 2OTUB 3WFCL 4BZYA 1WWAX 3QXWA 3LKSA 4JFZL 2ZCLH 4F9PC 1NMCC 1FDLH 4OZGA 4TSCL 1KPVB 2GW5A 4P2QA 4XGZB 4QHUB 5GXBB 3I6GA 1C5DB 4G6FD 1U93A 1RZ8A 5DC9B 3BH9B 5DEGB 1NC2A 3PWPB 2VLJD 4KI5F 4QTHB 5CBEA 4NN5B 5MP6L 1DN0B 4J3WA 1ZK9A 2YPKB 4JFEE 4K94C 2G75A 1YPZA 1JPSL 3EAKA 5EU3A 4X6DE 1SMAA 2R0LL 4M6MH 4ZDHA 3FQNB 4Y5YA 2EIZB 4CADB 2V2WB 1J8HA 2HYMA 1RJZB 4FZ8H 3IFOA 4JRXD 4ONFH 4TOYH 5JW4N 1FVCA 1OTUD 1NFIB 3QI9A 3IDYC 3OQ3B 3VGEA 4ELMB 2VLMD 1FZKA 4RA3A 3CUPA 2DLFL 3QIWB 2P47B 2B39A 1NAMA 2AI0L 5FO9A 3U2SB 1NJ9B 4OZGB 2AEQL 3MREB 3WKMH 4WTZG 1QLEH 5KJRH 1U93B 1KFAL 2JELL 3SOBH 5FXCH 3RZCD 4JPWH 4XNYL 5FDYA 2NMSA 2VE6A 4PJEB 3HHRB 1U3ZA 2XYCA 1OGAE 3WJLA 5D1QA 1QRNE 2UYLB 3EDDA 1BLNA 5BMFH 4L8CA 1YPZB 3RBSA 4QXGL 3PV6A 5F96L 1K3IA 4KHTH 1NGXA 4CN6A 4F7MA 1FIEA 5DMIL 4RMTA 4ZDHB 1IGTA 1J8HB 1INEL 3PHOA 5ICZB 3WN5C 4M4PA 2H26A 1FVCB 4BQCA 4U33A 1NLBL 3G04B 4EIGB 3MRRB 3D85B 1XGPA 3TEUA 3CUPB 3EYSL 4OCXH 1FVEA 3L7FB 3OAYK 2V9TA 4DZBA 1LDSA 1S7WA 5CFHA 2WW8A 3HCVA 4P46D 1QUNA 5T1LD 5FO9B 4QWWC 3PWVB 4R26L 1OAZH 1G7JA 3ARGD 2IGFH 5I8EA 3BZDA 4HLZG 5JHLH 3ARDC 1HH9A 1T2QL 5EFIA 4FMFA 1H0DA 2IPUG 3SGDI 4TNWK 3C9NA 1LO3H 1YJDL 5D1QB 3QDMB 2GITA 1N6VA 4NQED 2EDFA 3PV6B 3DIFB 4NC1C 5DD5L 4P2OC 1NGXB 2ZOKA 4F7MB 3MLSL 5CINH 3RU8L 2A6IA 1IGTB 3W0WA 1QD0A 2FB4H 1IC7L 1FV1B 1MPAH 4GAJH 1FPTL 2VXQL 3DI2B 5JXEC 5GS0C 3O6FA 4IHOA 5GGQL 4WFHE 1XGPB 3U9UA 4LGPB 4LLWB 2Y9RT 4DK3A 1F4YH 2VXSL 3O3BA 1S7WB 3UO1L 2FJGA 3HCVB 5MHSD 3HMXH 2UUDK 3H9SD 5DUMH 4PJ7B 1G0XA 4PJ8C 5DI8A 3MXVL 2YZ1A 1HH9B 2AS5M 3VWJB 5F97E 1G7PA 4AL8L 5CKGA 4H26A 5C0AE 3QUYD 3FTGA 1JF6A 1U8HA 2P45B 2BZDA 2Y07L 3LZFH 4WY7L 1DLHA 2XZQH 5BZWA 4FQPA 1F90L 2A6IB 4QHMB 4ZOEA 1D9KC 1R5VA 4K3JL 4JQIL 5D7LD 1GJIA 5I1KL 1HH6B 5L2KA 3O6FB 4UQ3A 4EUPH 2FATL 3IDUA 1DZBA 2VZSA 3X12A 2Y06L 3SN6N 4PJHE 1P2CB 2UZXB 3CFCH 1SBSH 4GG6E 3ILQD 1AXTL 2UWEA 3UYOD 1JRHI 3EJYD 3IJHA 1A6UH 4ZUTA 3MQIA 3N06B 1MQKL 4WU5B 1CL7L 4J6RL 1Q0YH 2J7LA 1DLHB 4JAMB 4MMZC 5CD3A 2WK2A 4U6XA 4ODXB 2R4SL 5CZXD 4PY8J 2VDMH 4MJIA 4DTGH 3G6JE 5SWSB 3DVGB 1QRND 1NDGA 3B5HA 5EORH 3QCUL 3CVHA 2I9TB 1IGJA 1JFQL 1E4KA 1BZQK 5GRWA 1WCBA 2XRAL 4UQ3B 3V5DB 1UEMA 2XQBL 3UTSD 3TH3T 5HDOA 1RULH 4HH9A 4MLSA 3NVQA 2FDBP 1FZOB 3M1BA 2DBLH 1RZIA 3QEQE 1EO7A 2ZCLL 1FDLL 1TVHA 2P5ED 4OBSA 3BEWA 1RD6A 2AQ2A 4H1LA 3AXLB 4OLWH 4BSJA 2BHUA 6CGTA 1J18A 4F7TB 1MRCH 3L95A 3EFFA 2FECI 3WO3B 3KPOA 3IJHB 5IW6A 1LP9E 1M7IB 3O8XD 1A7PL 1D5IL 4W4NA 4I18A 4JGJA 4Z7UA 3KNBB 3SKNA 3HI5L 5DJYA 3CVHB 4M6ML 3UDWA 3IT8D 3M17B 2RB8A 5F7EH 1CXLA 5C0BE 5C0DB 3MV9A 4TOYL 4ONFL 1UB6B 5MEPB 3BRFA 5DGRA 5E94B 2IANE 2EE9A 3VRLF 2KL6A 2OR7A 4XNZB 2BY3A 2D7TL 3HR5B 1UCBH 1TVHB 2DWDB 1F6LL 1I7ZA 1ZANL 1FLRH 3WKML 4H1LB 2JJTC 1QLEL 3VD5A 4LSTH 5KJRL 2F8XC 2GFBB 3EFFB 3OKOA 3DHMA 3CX5J 4YHOH 5IW6B 1VADA 1MIMH 4JPWL 3X17A 3ZKND 2ZUTA 2W0PA 3L7EA 4PJCA 5E4EB 4RGMC 2NY3B 4Z7UB 4APQC 5DR5H 4R97B 5SX5K 4O51B 3V0VA 5BMFL 1FO0A 4GRWE 5DJYB 4I48A 1MJ8H 4KHTL 1NSNL 2HWZH 4CGTA 2B5IC 1JP5A 1SJHA 4HT1H 4Y4HB 1UZ6E 4KU1A 3WDHA 1JGVL 3MMEA 5JQHC 1FE8H 2R29L 1UH3A 3U4AA 1W72H 3L3HA 4G80A 3F58L 4OCXL 1T1XA 5DA4A 4X4ZA 4F37K 1AIFA 4UV7H 1SM3L 4TNVK 1I1FB 1OAZL 4KRPB 4X4MA 1I7ZB 4S2SA 1H3TA 3QHZH 3QJFA 2IGFL 3ARZA 5JHLL 1SY6L 1CBVH 3OKOB 3HZVB 5TPWH 3UBXA 4JDZA 1PVHA 2H8PB 3DUHA 3QUKA 1X9QA 4XVJH 3TZVA 4NUGH 3L7EB 5LGKA 4GSDH 4PP2A 3ULVE 1LO3L 2E7CA 1GHFH 3V0VB 3PE9A 4OZIA 3E8UH 1FO0B 2BVOA 1TFHA 2FEDC 2GEEA 4PRBB 2VZVA 4MQ7B 4L3CA 3WE6A 5CINL 3ZKMC 1HZHL 5DA0B 4GAGH 5ID0A 3QPXH 3LKPA 5I16A 2FB4L 1MVUB 4J8RA 3MMEB 5KZCD 1MPAL 1NEUA 4GAJL 2WSKA 3T4YB 4DKEL 3CD4A 4NYLA 4TTGA 4G80B 1ZHLA 5CEYA 4UQ2A 4Y19E 1F4YL 4Y2DD 4NN7B 1XMWA 1T1XB 2JIXD 2GJ6A 3VGAB 1AIFB 1GCFA 5EU6E 3HMXL 3N1QC 4LCUB 5IHBA 3HE6A 3WFEH 4S2SB 2O93L 3QJFB 4L1HA 5IFAH 5MI0C 5DUML 2H1PH 5EB9A 1YNLH 3MJ9H 5D7IA 4AENA 1OAQH 5IQ7H 3FT3A 4HF5H 3QUKB 4HMDA 3TZVB 3WUZA 3D9AH 1ADQL 2XPGB 5GGRB 1I4FA 1UXWB 4PGCB 1J0YA 1YJDC 3MRDA 3OG6B 4OZIB 3LZFL 4JY5H 4F15C 3MV8E 4L8SB 1FNFA 2XZQL 4JM2B 3VCLA 1XR9A 4L3CB 4U1JA 5A16B 1CGUA 3LKPB 4O00A 1HNFA 3EOBA 5D7JD 2HLAA 3QFJA 3SJVE 1ZHLB 3GI9H 5C0BD 3DJ9A 5KSVA 4Q6YA 2BNQE 1U8MB 5TDPA 2QSVA 4OZHA 1C1EH 1GOHA 1A7NH 1LE5A 3TIDA 3D0VA 5HHVH 2IAND 1KLUA 5I1LA 1MFCH 4G42B 3CFCL 4F57L 1H3WM 1SBSL 2BHYA 1XZ0A 4MAYB 1EAPB 2XZCH 5BS0B 5J0BA 4NC1E 3PWJB 4NQCD 3FT3B 3DURB 4HIIB 3WLBA 5JHDD 1A6UL 1CD0A 4ODHH 2ESVA 4DFIA 4P3DA 4R2GD 4J3TA 1Q0YL 5J11C 4Z77A 2WBWB 5TQ0H 2QHLA 2VDML 1XR9B 2R15A 4JHAH 4U1JB 4DTGL 1I85C 4N8VG 1YUHA 3LHPH 3BPNC 4PJFF 4I77H 4Q58C 3BKMH 3EOBB 4GQ9H 1E4XI 4Y4KC 3SO5A 1DE4B 3LN5A 4OCYH 5TE7H 3QFJB 3MODL 1RULL 4ODBD 2DBJA 3D3VE 3NCBB 5TDPB 4UB0H 4OZHB 2MQ0A 3ZKXB 1LE5B 4OAWA 3TIDB 2DBLL 4PJ5B 5I1LB 1XEDA 1B0GB 1BVKA 3RVVD 1V7NH 1IQWH 3LMJL 4HGWA 5GRZA 1HWGB 2BVQB 1DQQA 3A67L 4OLWL 3RWDA 2WIIA 3HC4L 1BPVA 3B5TA 2I60H 3NA9H 2ESVB 4PJBA 3VDBA 4NQVB 4NQSA 1TCRA 4NKMA 2MWCA 4NM4H 4HUUA 5E5MA 4PYHA 4JVUA 2P24B 3ZL4L 3LN5B 4KGJA 1IAIM 1GAFH 4V2BA 3OKYA 1YC8A 3S6CA 1PJ9A 4Y89A 3VFTB 5AYUL 5HGAB 4Q2ZA 1X7QA 1I3UA 4QHNA 3W9EA 4OAWB 3B43A 2W65A 4ONGL 2Q8BL 3SGKC 2PYEA 4D9RD 3UPRB 1UCBL 1BVKB 4M48L 1B9ZA 3H7LA 4HGWB 1FJ1A 1FLRL 3CX5K 4LPVA 3NZ8B 4LSTL 3T0VA 4HPOL 4JZOA 2WIIB 4MSWA 5DJXA 3RWDB 4KKLC 4YHOL 2A9MH 4G9DA 1J10A 4EQ2A 4PJBB 4FQLH 4M1DH 4AG4H 2F54A 1XF5B 1A5FH 5DR5L 2W1NA 1LGVA 4Z0XA 3FT2B 4C54A 4XC1H 1ZSDB 1MJ8L 5E5MB 1A4JA 1OT1A 5GZND 1DBBH 4JKKA 3V6BR 4ENEC 2ADIB 2DYPD 3N1GC 4ZTPH 2H41A 1FE8L 4Q2ZB 1X7QB 4QHNB 4NFBA 2OCFD 1KIRB 4QWWD 5EOTB 4W4OA 3SJVD 5IJKC 3QAZC 3C87A 2NY4C 5EU7C 4UV7L 3ARDD 3WNOA 2W0FA 3CMGA 5FYJE 3D18A 4IOIA 3GUTB 3FFCA 3QHZL 3FO2B 1FJ1B 2NCMA 1JUFA 1QSFB 4RAVB 2B7DT 4XP5H 4UOW0 5TPWL 1BWWA 3GK8H 4XVJL 1FVDA 2A77H 1I75A 5GS2H 4NJAH 2F54B 3F7PC 1CG9A 1TJHH 4P2OD 1M71A 5JMRA 1GHFL 1ZGLP 2OZ4L 4OUUB 3ZZ1A 3E8UL 5HYJD 4J1UA 1A4JB 1KJ2L 3VXRD 3PIQA 5JXED 4GAGL 3EGSA 5GS0D 4N0UE 3REVB 2AKRA 4ERSL 4Y4FD 1LO5A 4UAOC 5ESAB 1WSST 3CFDA 5E2VH 5ENWB 4DOHE 1ACZA 1J05B 4KJWD 3W5MA 3HC3L 1YYLH 5I1EL 3KPNB 3NCJH 2CLVB 2W0FB 3D3VD 4PJ8D 2ZJSH 2GIYA 3WFEL 4RMRA 3OGCB 3C5ZD 3QDJE 4KFZC 4UU9A 2YRZA 2H1PL 1X4ZA 1YNLL 3MJ9L 2YBRA 1JF1A 4OB5H 1OAQL 5IQ7L 5ICYA 3SCMC 4JY6A 3ZTJG 4ZTOL 1NEZA 4HF5L 5A2FA 1DVFA 3D9AL 4XCFH 4U0RC 3FZUC 1TZIA 2MHAA 1A3LH 1D9KD 4JY5L 1CIDA 1OARH 1VGKB 4MVBC 1CTOA 1KCLA 1KCSL 1ZEAH 3SY0A 4Z95L 5JW4Q 3W39A 5JOPE 1JL8A 4K71C 5FA3B 3QO0A 3UBXG 1CVRA 4FABH 3PWNA 3RIAK 2RFXA 3S3PA 4KI1A 1ZHKB 2VLKD 3CFDB 3G5YB 3GI9L 4MAUL 4PB9L 4UOW1 3O11B 5BJTB 4H0HB 5C0IA 3RQ3A 1YEHH 2A73B 1ZAGA 1TCMA 1C1EL 1A7NL 2QADC 2X70B 4LASH 4N0FA 5JDJA 1DQDH 2YBRB 1JF1B 5JXAH 2XZCL 3K7UA 3T0EE 5ICYB 3F7QA 5DRXA 1J11A 4L9LC 1DVFB 1FP5A 3GMOA 4MA7H 4DK6A 4ODHL 3HNTH 2EE3A 1BFOB 2EE6A 4PV8A 2MHAB 4GW5A 1TMCB 3S36X 4NO2B 2RAMA 2J8UA 3SY0B 5TQ0L 3C8DA 4HWBA 1JYWA 3W39B 4MB3A 3LHPL 3QO0B 4GAFB 1KG0A 4I77L 4C58B 3MGTA 2X10A 3S88H 2RFXB 2EDHA 4GQ9L 3VWKA 1RFDH 3O2DA 4OCYL 5TE7L 1T0MB 2K1MA 3ALPA 4PJXE 3D6GA 1T2JA 1CS6A 1GIGL 2VL4A 3CVHH 3RGHA 1A22B 5C0IB 3KYNA 2QHRH 3GHEH 4UB0L 1FAIH 5DJ2B 1C12B 4LCIH 2HVJA 1UWEH 2VO5A 4N0FB 4JFYA 3OAUH 4K9EH 4LL9A 1F5WA 4DQOH 3UTZB 1V7NL 3S98A 1IQWL 3EFDH 2FEEI 4U6YB 4PJIF 2YEZA 4OIBA 3QUXA 4LGRB 3NA9L 2R2BA 3F6IA 4G6AC 4H1LH 4M4RA 3SDCA 4ZO6A 2Y5TB 3MRBB 3HZMB 3UTQA 1RHHB 2LU3A 2UZIH 2COQA 4NM4L 1CICD 2LAAA 4HKXA 4Q0XH 4NGHH 1OP3K 4NO0D 5D7IE 5DMKA 1GAFL 4C56A 4R4BB 4MD0B 4NZJA 5DK0A 2C3WA 4HCRA 3KYNB 5BRZA 1FFNA 1QFOA 4LSSL 4NPYB 4YFLI 4HXBL 4KAQL 4OI7A 4JB9H 5K59F 3QWRA 3HB3C 1VPOL 4M7JH 4JG1H 3BUYB 5E8EA 3JV4B 3VH8B 3RL2A 3BGMB 1MCKA 4ZAKC 1DDHB 1L0XA 1MFEH 4AT6A 3NPSC 3QDJD 2VQ1B 3PP3H 4APQD 5HYQB 4Z7VF 4P5TA 1DP0A 2JJSC 4P23C 3TBWA 5T3ZE 2VLRA 2R2BB 2EEAA 2CXGA 4FQLL 5FYLH 4X4XB 2N7AA 1A5FL 1N2RB 3UTQB 3WXWH 4BSWB 1G9NH 4HUKB 4WFFE 2W9EL 2EC8A 4XC1L 5KG9A 4S10A 1IAMA 4PGJA 5DMKB 4S0TD 5CJBA 5IGXH 1FO0H 5TQ2H 4ZTPL 5CGTA 3WBDA 2FSEB 5DFWH 3IFLH 5DK0B 5I8KH 3GJEB 1H3GA 1QA9A 5MENE 1FFNB 2Q3ZA 3BIBX 1TPXB 4U7SA 1IEHA 2Z4QA 3RTQA 1RJCA 3VXMD 4PGDB 3RL2B 3SPVA 4K3EL 3P4OA 4AH2B 1BZ7B 2GK2A 5DK3A 3DV6A 4NKIH 3H9ZA 4XP5L 2NXZC 3HMWH 5DQDH 4QRPA 5HYIA 5DHYA 4D3CH 4RFNB 1RK1A 4HUXB 3GK8L 4WWKC 5F8QC 3TBWB 2VLRB 5E99H 4NJAL 1UJ3A 1TJHL 4AEHH 3ZKMD 4RDQG 1NFDF 1IGCH 1GOGA 5I9QB 5KG9B 4YO0B 4CVZA 1LO2H 5H35A 4M7KH 4WHCA 3K74B 2PO6C 3VXPA 1FNEA 1PSKH 5IKCA 3WO4C 1BQHA 2FGWH 2X9YA 4L4TA 1AE6H 1IL1B 3C60C 5E2VL 4LSQH 4O4YH 2EDOA 3V5KA 1YYLL 3RTQB 4ONHA 3NCJL 3MLWH 2ICWB 3L9RA 4XMLH 2ZJSL 5HJ3B 5TF0A 3SPVB 1UZ8A 2DLGA 3P4OB 4HFWB 2G60H 4XPBH 4G7VH 4MD4B 4YHKL 4RISH 4MJ6A 5DHYB 3T2NH 2P5WA 2DQGH 3TESA 1VGEH 3DVFA 2FJFB 4PJDB 4K7FA 4LVEA 4GFTB 5I6XB 4KZEH 5D4QA 4XCFL 3HA0A 1UJ3B 2C1OB 4TRPH 3OB0K 5IBLC 4OKVA 1DJSA 2IF7A 4L4VE 1A3LL 1OARL 3QUZC 4CVZB 4P2RE 1ZEAL 3SDDB 5D5MB 3OF6D 4HDIA 3CXHK 2HT3C 3FAWA 4Y7MA 2PCPB 3VXPB 1EEZA 5L2JA 2GK0B 3FQTA 2VNCA 3QEUA 4X8XA 4Y1AA 5IKCB 4FABL 1QSEE 4HUWA 5F3HA 3F65A 3OAYH 4X0KA 3K4DA 1LK3H 3QRGH 3MV7A 2X4RB 1K2DB 2VUOA 4LCCC 4LHUG 3QQNA 1V3MA 4ONHB 1YEHL 3L9RB 5JOFA 4LASL 1FORH 1V3LA 1YY8B 4OF5A 3KHOA 2KUTA 1ITCA 5E6YA 1QFWH 1DQDL 1H9VA 4MNHA 3SBWA 4EN3A 4Y8DC 3C5JA 3CFEA 4O9HH 3FN0H 4K7FB 3TV3L 4MA7L 3HNTL 3RY6A 3S36H 1BD2E 1F8TH 2NY0B 4E0RA 1TTFA 3I3EA 4U1MA 3TN0A 2VXUH 4YBLC 2X1QA 3HE7B 5C08D 4ONOA 2DQJH 4Y4KD 3UYPA 4YEEA 4PJ9D 1EEZB 3EYVA 4WFFD 5L2JB 2QJDA 4RX4A 3QEUB 1MJ7L 3KLSA 3MNWA 3S88L 1NEZG 1QBBA 1RFDL 5F3HB 4AJ0A 4X0KB 2WANA 2VWEE 2AABL 3U30B 4OCRH 4QRRB 3CVHL 4OQTH 3MCG1 2QHRL 3GHEL 2DB8A 1FAIL 3MUJA 4LCIL 3HRPA 5MEND 1UWEL 4XXDA 1C7TA 2JCCB 3JZ7A 3EOYG 4WCYH 3OAUL 4K9EL 5GQBA 5SX4H 4FQXD 2CDGA 4DQOL 2BOCA 4OD1H 4G8IA 3EFDL 4MNHB 4ZNEA 3QDAA 4EN3B 3C5JB 3CFEB 1RU9H 4HPYL 4PD4J 1PEWA 3N1PC 3AREB 4U1MB 3BYTA 3QNXB 2UZIL 5E1AA 4ODUA 3LKOB 1P84K 4NN5C 3W81A 3KDMA 4Q0XL 2X40A 4MA1B 2DM7A 3TJEH 4U1NA 1HOCA 5EU5B 1LQSR 4AIZA 1CFNA 1QLRA 4L8DA 4FXLA 1FL5B 2CIIA 4MWFB 1T89C 1GC1C 2AK4E 4KDTA 1ZHBB 4PRPD 4UIMA 2A1WH 1OAKL 3LDBC 4M7JL 3MCLH 1WJ3A 1E6OH 3BP6A 4LKXA 4KKLD 4G8IB 1LDPH 2GQHA 1L7IH 2P42B 3QIWC 4LLYB 1MFEL 1KYOJ 5DRNA 1BQUA 1OF2A 4WO4C 3EHBC 1I7RB 2DDQH 4YC2B 5I71B 3G5XA 5DJAB 3KPSD 3WXWL 4U1GB 5C9KA 1G9NL 1OY3B 4YFLF 4ODUB 2NW3A 5EBWB 4ENED 2I24N 4UT9H 3JV5A 4AEIH 5SWZB 4HWEH 5IVXE 4L4VD 4NZRH 2IBZX 1AD9A 3UTPE 3HKFA 2N7BA 4P2RD 4W70A 4XWGH 1MY5A 1S7UB 4FQIH 4U1NB 1HOCB 5ESVB 3P4MA 4AIZB 1FO0L 3TJHC 4UNVA 1CFNB 5IGXL 5TQ2L 1YEEL 4EI5D 4ZYKA 1JGUH 3GMRA 3IFLL 2CIIB 2YHGA 4OGYH 4QKXB 4UIMB 2PF6A 1LNUA 3TNMB 1OLZA 3SGJC 2J8UE 3QIUA 4HW6A 4XRCB 4N9OB 3BP6B 4LKXB 5AWNH 1T04A 5IFJA 3PJSB 4YFDB 5DRNB 2X4TA 3FOLA 1F4XL 4MDIA 2B4CH 3HMWL 4MD5A 4PBXA 5DQDL 5LXGH 4PPTA 4YHNA 1KN4H 4D3CL 3Q6GH 4F33A 1TTUA 2I07A 2XZZA 4W68A 2NZ9C 4WW2A 5E99L 3NACH 1SEBA 5C71A 4K2UH 3RWEA 4KDVA 4JRXB 1BMGA 4BZ2L 2NW3B 4D0CA 5FGCE 1S9WA 5DUBA 4M7KL 5IB4B 3QXDB 4XNUL 3TA3B 5D1QC 3MNZB 4U1IA 3T1WA 3B9KB 1PSKL 1T1ZA 4WNQB 2FGWL 2VB5A 4ZYKB 3IJSA 4ZSOE 2DKMA 4LSQL 2HTLC 4O4YL 4QOKE 4B7IA 2I5YH 2IH1A 4GRMA 4YGAB 3CK0L 3QIUB 2EYSB 4R4FH 4XMLL 1T04B 5DD6B 1AO7E 3RWGA 1NUDA 4PUBH 5IFJB 2R2EB 5J7CC 2G60L 2X4TB 4XPBL 4G7VL 3FOLB 3HAEA 3QIBC 4MDIB 2XFXA 4MD5B 1X5XA 4RISL 3FZUD 3T2NL 4YHNB 2DQGL 2I07B 1BFSA 5IESH 5JW3L 5SX5H 1AFVL 5FM5M 4WW2B 4MVBD 3S4SA 5IF0B 43C9B 3RWEB 2FX9H 3OPZH 4TTDC 3VWJC 4D0CB 4F7EA 1YMME 2EZ0D 4ZUVB 5DUBB 1XH3A 3OKKB 4U1IB 2VQTA 1ZLUK 3WFDH 5HDBE 1JTPA 3KPMA 2QBWA 3IJSB 5HPMB 3L3OB 1LE9A 1XR8A 1YECL 1LK3L 3QRGL 3VD3A 4WV1C 3OKDA 2IH1B 5ANME 4XP9H 1QTYT 4G9FA 5E9DA 2GYSA 4FFZH 3V5HA 3PGCB 3AU1A 4G3YH 3O6FC 3S5LB 4D8PA 1IJ9A 1AGFB 2AK4D 2VYRE 4UT7H 5KS9A 1FORL 3HAEB 1QFWL 5D9SB 1BQHG 2E6JA 3F12B 4FTVA 3KPLB 3ZDYE 4XPGH 4O9HL 3FN0L 4JFHD 3KPTA 2XN9A 4XCCH 3RFZC 2Y36H 4KVCH 2VKXA 1CLCA 1FYTB 1F8TL 3FB5A 3BQUB 5E6IA 1XH3B 5DMYA 3LEVL 4CNIB 1B6UA 3MLTA 1BJ8A 1IKNC 3B83A 4XI5C 4QYOB 4M02A 4UDTB 4GG6F 3DYOA 2LU4A 2Y23A 1XR8B 5GS3A 2ZUYA 5GJTH 1U8KB 3MFFA 2NNAA 3GIVB 4OQTL 3O2DH 3K8MA 4WHYH 1A9EB 3AU1B 4TSAH 1DUYB 3MRJA 3TT1H 4DVBA 5IROA 5KS9B 5F3BB 2JB6B 1NUGA 2PW2A 3V8CA 3MRCA 4XP4L 4G6AD 1RU9L 4MHHI 5LKNA 4L4TE 4PG2A 5GGUB 2D31A 5D7LB 5CJ8A 3FB5B 1ERNA 5K9JH 2YPLE 4IDJH 1K9TA 3ESUF 5E6IB 3FRUA 3NCFB 2ED9A 3MLTB 2DQEL 2DRUA 4KROB 5D2NA 4K7PX 5DJ8B 4Z18A 4P4RB 1X5GA 3S35L 2A6KA 5F1IA 1UB5A 1OW0A 1U3HB 2VAJA 3K2UL 3VGDA 1CR9H 1LP9F 5DQ9A 3MFFB 3OWEA 5I1JH 2NNAB 3HB3D 3P9LA 1S7TA 4NO3A 5GGVH 2EKSA 5TDOB 4MCZA 4IRSD 1INQB 2P1YA 3UTTE 2AJVH 3MRJB 4ZAKD 2A1WL 2EXYC 4DVBB 2YK1H 3MCLL 1QBAA 4ZUSA 1X5ZA 4K9EC 2PW2B 1E6OL 2LV4A 1KYOK 1RV6X 1U8LB 2P46B 1MJJA 4YHLL 1LDPL 4P23D 1L7IL 4XH2A 4GBXA 4LBEA 5I15H 4XNZC 1HN1A 3VXUA 1GXEA 4WDIA 1N4XH 5C0JB 2D31B 3TBTA 3TH4T 3WCYA 1Y6NR 1C08B 1F6AB 3B9DA 1AR2A 1IM9D 3WV0A 2IBGA 5IB2A 1TZGH 3GSNA 3RP1A 2AJZB 1BF8A 5D2NB 5E2WH 3NH7H 2XOTA 5FDWB 3BRDA 4UT9L 5E4EC 4HWEL 5ISZA 1ZE3C 2NY3C 5LCVH 3DRTB 4OLXH 1DQLL 1U36A 4W6XB 2A6KB 4QXUH 4R97C 4XWGL 4FQIL 1WFTA 3O3DA 2VITA 3KPRD 2BNRE 2AGJH 1QSZA 3UYRH 1Z2KA 1JGUL 1S7TB 2VZ3A 4NO3B 2P5EB 2EKSB 4Y4HC 1CXKA 1G7HA 3Q5TA 1PY4A 4F7PB 4QF1A 3B9VA 5MEOA 3D2UA 3LN9A 5GRJL 2OMBA 3T3ME 5I76A 1QKZH 5HHNA 3V4PH 4H8WC 1IQDB 1MJJB 2EE2A 1UZ6F 2YPVH 4WWKD 5JIIA 1UGNA 3B9AA 5CZKA 1CI5A 4NKQB 3VXUB 5LXGL 1X4XA 1KN4L 3Q6GL 4WDIB 2BJMH 4KRPC 1RJYB 2Z92A 1A64A 1ETZA 4U6HA 5AD0A 1D5XA 2NLJA 3NACL 3LKNB 5J89A 3E2HB 5GSVB 1KXVC 2PO6D 1G9NC 3MACL 1P4LB 3GSNB 3VGBA 1RUPH 5IMMA 2FLBT 1T22B 1NMAH 2QTEA 4HEPG 1WIOA 5ISZB 4S11A 3BN3B 3LIZH 5C2UB 3C60D 3Q6FA 4UUJB 4F9LA 5EZJA 3K1KC 1OM3L 2P49B 3HR6A 4LPCA 1QFUL 2H9GB 2JB5H 1T20A 3MA9H 4MQTB 5FHBH 2I5YL 3WKNA 4OLUH 5EIIB 4IS6A 3SHSA 4MB4A 4R4FL 5L6YH 4PY7A 1DSFH 5T3XH 5HHNB 4PUBL 1V3JA 1YQ2A 4KY1L 4NHCH 4NN7C 5ECJE 5HGDA 1A7QH 4LF3A 5FCSH 3IFPB 1BBDL 3BGAA 4M5YH 5IBLD 2L4OA 5IESL 4G43B 1ETZB 4YAQA 5J6HB 3QUZD 5DJ0A 4Z0BL 1D5XB 2NLJB 2NYYC 3BZFA 1NBYA 3ARFB 2HT3D 3GRWA 2NR6D 2FX9L 4R8WL 3OPZL 1KF9B 1MCLA 2H32B 5SV3A 1FNSH 3GMMA 2YPLD 1RUQH 1T21B 3IETB 3Q6FB 2F15A 2F9BT 5EZJB 2ATPA 4MCYB 3UZEA 1FG2A 3FHAA 4L8SC 3RIFK 3ILPB 4JM2C 2KZ1B 2EKJA 3VI3E 1T20B 4Z76B 2R0ZH 4PJGF 5KSBB 5EUOF 5GJSH 2DJUA 1E4XH 4KZDH 4XP9L 4XXCA 5F70A 1R3HA 2R56L 3QEGH 2QEJA 4PY7B 1A3RH 4RGNB 2CIKA 4G3YL 2E6PA 2C3VA 4X9IA 5DSCB 1FIGL 1UM5H 1U41A 2E8YA 4UT7L 3UTTD 3DMMA 4ZFZA 1VFAA 5HGDB 3TGXA 1MHEA 4S1QL 2V7NA 4XP6H 4X4YA 5I75B 2HVKB 4XPGL 2VXVH 3STLA 3RNQB 4Q9CA 3MV01 4M1CC 2GAZA 4YAQB 1J0JA 3IDIA 4ZODA 3MUZ1 2Y36L 3QDME 4GH7B 4KVCL 1JNLL 4MAYC 3Q48A 3BKYH 4M5ZH 2L7JA 3FB8B 5DHXB 3DX8B 2ATPB 4WW1B 1FG2B 1II4E 2BNUA 3CIQA 4PLJC 4OFVA 5GJTL 1H5BA 2ZG3A 3MRFB 2FD6H 3IDJA 2BNRD 1R3KA 2DMCA 3O2DL 1R3HB 4XAKE 3KR3H 2CIKB 4TSAL 4BH8A 4LPXA 3TT1L 1G84A 4PGEB 5F71A 4P4KC 5I66B 4ZFZB 1VFAB 3G5VA 4JGMA 2A6DA 3UJIL 2V7NB 1KIUA 3NFSH 2HJLB 2GAZB 5EG6C 3PWPD 5E56A 1S9KC 5C0EB 1SYVA 5KANI 1N0XH 4OCMC 1EO8H 5D7JB 3LS4H 4IDJL 4UILL 1PQZA 3SE9H 5C0RL 4K7PH 2VC2H 3GSRA 5JLZA 4KXZI 4MNQB 4LLDA 2Z31A 5F7FA 5ICXA 4LLQA 5IT2L 2BNUB 4HC1H 1JNHA 2P8MA 4LSDA 1XCQB 4IIQA 1H5BB 2Q86B 3NIGE 3DRQB 5I1JL 4XMPH 5GGVL 5F1SA 5DD3H 5LAXB 1R3KB 1FNAA 5HVHB 4HGKC 4I1NB 4ZFGH 2AJVL 1Y6KR 5JHDB 3QIWD 4GUPB 2YK1L 5CSGA 3D69A 4QGYA 3FQRA 1X5LA 2DLEA 3EHBD 4R2GB 3HRZA 1NLDH 1UVQA 1JZ5A 1RJLB 1CLZH 1Y18A 4OZFG 1N4XL 1CE1H 1YDPA 1D7FA 1SYVB 2P44B 3EJZC 1ZA3B 1Z9SA 3UJTH 3Q3GA 1MI5A 1PQZB 3GMQB 2GT9A 4X8JB 5SWSE 3ECBA 5E2WL 3NH7L 5EC2A 4OJFH 3TJHD 4NRYA 3FT4A 5HVWA 2Z31B 2YN3A 5LCVL 3C6LA 4OLXL 3FO1A 4LLQB 3BKJH 5ICXB 1KN2H 4QXUL 3WEXA 1JNHB 2ZUXA 4PRDB 2W9LA 1J8HD 1SQ2N 3CGTA 2AGJL 3UYRL 4TUJA 1F3RB 3VD7A 2XWBA 3D85D 5FKAB 1KT2A 5C6TH 1KEGH 1WBZB 1MLBA 2A0LC 5CCKH 3WDJA 4PLKC 1QKZL 4X6FB 2YPVL 2NZ9D 2D7OA 5DLML 3VW3H 1CDJA 3AB0B 2NTFA 2DTMH 4JCLA 1TIUA 2AXGA 2RBLA 2BJML 1YDPB 4HMCA 4FP8H 3A6OA 3LVEA 4ZUWA 3AS0A 1JWUA 3Q3GB 3NGBB 4OT1L 1B2WH 1MI5B 4HBQA 4O02L 3U7YH 1YEGH 1KTDB 4RWYH 5D1QD 1AQDB 3QDMD 5EC2B 1NMAL 4MZ3A 4NRYB 1MEXL 2PXYB 1L9NA 1YYML 2CGRH 2C4FT 3LIZL 1RQ5A 5FUCE 5TE6L 2XA8H 3MOAH 1OAYH 1T6WA 3BZEA 2X4SB 4OLEA 2NY5H 3BMWA 3DLQR 4WI7A 2JB5L 3BP5A 5AZEH 1RMFH 4RBPK 5C0CB 5BVJA 3BH8A 5FHBL 5K9QI 4OLUL 2CRYA 5DURB 4MQSB 2VDPH 5AAWA 3GNMH 4GLRH 2BY2A 4EI6B 1DSFL 5T3XL 3MJ7A 2X89A 4XAKD 1JZ2A 4NHCL 1IAKB 2HT2C 4MJ5B 2NTFB 2VLLA 4TVPE 3OHXA 5GS2D 2IAMA 1A7QL 2B4CC 5DJCA 2AXGB 2PN5A 3DXAE 4M5YL 4M61B 4TTDD 3VWJD 1XT5A 4E5XB 3HAEH 3I75A 3LQZB 3DI3B 3CPLA 4HZLA 4YEFA 4OCLC 1B0RB 1T1WA 1T6VN 1GRWA 4X98A 1TJGL 4XAWH 3S3JA 1FNSL 1RUQL 4QRUB 3MR9B 4LCWA 3W0WD 1HXYB 2ATKA 1H3UA 5JIHA 4DZ8B 2ERJB 1EDQA 1WBYA 3X11B 5FAAA 2J12B 2R0ZL 2YN5A 4JFDA 4Z7WB 3O6FD 5GJSL 5JW4R 4KZDL 3BH8B 5DMGC 3SKOA 3ROLA 1ZVSA 3HI1A 3QEGL 3TPKA 4P0DA 1RZKH 1A3RL 4EEEA 2VL5B 5C0FB 5FYLE 4R0LB 1UM5L 4LEXH 1R3JA 3GSVB 3N1FC 1WWCA 1V8HA 4XP6L 5I1GH 5DJCB 2DQIH 1MREH 2NX5A 3IDXH 3I75B 2M8XA 2R2CA 5T5FH 3ABZA 1AGBB 3BKYL 4M5ZL 2XI9A 4Y4FB 4XI5D 1DVFC 4D0BB 2X1WL 4ORGA 4JFPA 4X98B 3VFOA 3PP4H 3STBA 4HIXH 5C07A 2WBKA 5JW5B 1X4YA 4X6CF 2B8OT 5SWSD 4LCWB 5ALBL 1B4RA 2ATKB 1UM6L 1K85A 1MCBA 2JLLA 4AZ8A 4H0IA 5TE4H 4CJ1A 3C5ZB 2FIRT 3GBNH 4JFDB 1S7QB 1I1AB 1URLA 4KMQA 2FD6L 3L5JA 1OVZA 1B6DA 3SKOB 3CFKA 3ROLB 4LLVA 3KR3L 1ZT1A 3KXFA 2K7PA 1IGYB 1KEML 3V52H 3L6FA 3MGOB 4G8GA 1F42A 1WAAA 4QHKI 1I9JL 3RUGF 1QHPA 2NX5B 3NFSL 3DO7B 3OB0H 1EERB 3BZ4A 2UV3A 4PJXF 2V9QA 5D8JH 1WIPA 3CNKA 4LHJB 2X4NB 3IKCA 1N0XL 2YUWA 3LS4L 4NOBA 4ORGB 1CDCA 5KSUA 3SE9L 4K7PL 3PWUB 5HI3C 2H6PB 3CSYB 2EH7H 4NQDA 5IMKA 3IVKA 1H3PH 1ED3A 2LVEA 2AJXH 1AH1A 2V2TA 4HC1L 4WUUA 1U95A 1XGYH 4GXUN 4RCAA 3O9WA 4LP4A 4PRHA 4FHBD 4O2CA 4QXWA 4IMKA 5B38A 1CFQA 3BI9X 1I8KA 4JFFE 3QCVH 1EK3A 1RAMA 4XMPL 3O6MH 4RQQB 5DD3L 1DFBH 1IM3A 1HQ4A 1ZT1B 4H25A 3ISWA 2HRLA 5C92A 2WM0A 5GGRY 3AMLA 5ACLA 4ZPVA 1WC7A 2ZOLB 3UTOA 3QWOB 5DJDB 5BS0E 2LQRA 3W9DB 4X7SH 1NLDL 1YEJL 1LO0H 4JR9H 1NMBH 4MLIA 2OK0L 3WJJA 4BH7A 3IKCB 4EJ1C 3UJTL 1HHGA 4HK0B 2YXFA 5FM8A 3CSGA 5KSUB 2NY3D 3MRGA 4LVOB 1G1CA 4GMSH 1P4BH 1CDGA 3JXAA 3QFDA 4J4PA 1REIA 2XNAA 4NQDB 1JV5B 2YA1A 3H2WA 5IB3A 4OJFL 5HBBA 4XCYA 5DMJB 4NSKA 3IVKB 5FM4A 3BKJL 3MZTA 1KN2L 3GSNH 1U95B 4G8EA 3NA4A 4Y4HD 3FHQA 4N5ED 4PRHB 4UMGA 2DKSA 3PNWB 5B38B 1CFQB 2NY2B 1F00I 3PWLA 5GSRA 1HQ4B 4H25B 1QBMH 5E5UB 3MCKA 5TF1H 3ARYA 1RIHH 4ALAL 5C6TL 2YRLA 1GL4B 1V7MH 3HI6H 4ZPVB 2JK5B 3RPKA 4KWUA 1JPGB 3ET9F 3D1MC 4KRPD 1TPXC 3VFWA 2CR3A 1U2HA 4CVWA 3VW3L 5EU4B 2DTML 3VRLE 5F89A 1UQSA 1T0NA 5CWSA 4BH7B 4OF8A 1QACA 4GRLA 2DL2A 1HHGB 1B2WL 2DQHH 5HGHA 3U7YL 4RFNC 3MRGB 4RWYL 3ZMRA 3QFDB 3O4LA 2XNAB 4JQVC 3VI4F 3KS0J 2YC1A 4P57B 4XCYB 4NSKB 5AUMB 2CGRL 4WU7B 3TCLA 2QLVB 4JDVA 2XA8L 3MOAL 4G8EB 4OSUL 1FFQA 4POUB 3ULSB 5I9QC 4HEME 5HYSA 2H32H 2NY5L 2AEPL 2PTUA 4ZFOA 5A2IH 4OF7A 4X80H 3LD8B 2IPKB 2DMBA 1QVOA 4ISVA 1OSPH 1MH5A 5LGJA 1NH6A 1IILE 1JPFA 1OL0A 2MOVA 4P3CH 5F9JA 3RTQC 1S9XB 1NC4B 1EV2E 1YN6A 2NYYD 1UQSB 5CWSB 4XBGA 4OKDA 4KK5C 3TZVD 4LNRB 2F53B 2BC4A 5HGHB 1JNJA 1D5MA 5L8JB 3O4LB 5FFLA 3SDXF 5I6XC 4C55A 4XAWL 1UJ3C 4CUCA 2X4OB 4JM2D 4WUKH 3TCLB 2EDNA 3GRWH 3BSZH 4I0PC 4X7TA 2EDXA 3VXMB 4YBQD 4LFHG 3SDDC 2CDEA 4KQ4H 5J12B 3SQBA 3RL1A 1U9KA 2XXCB 3MJ8A 4Q74A 1M05A 3RI5F 1QVOB 4NCDA 4ISVB 5F7KC 5J57B 1ONQA 1XGRB 5LGJB 4X6CB 1RZKL 3BAEH 4WEBH 4RDQF 1UENA 1QSFE 4O2FB 4LEXL 1JPFB 4P5MA 4M1CD 3HUJF 3L5HA 2BSTA 2WLZA 4XC3H 1ZT4A 1YN6B 5I1GL 2DQIL 5BS0D 5ACZB 3IDXL 1CE6B 4R90H 2WP3T 4ZG1A 4GS7B 4PP1D 5D72L 3DVIA 1Z5LB 2BC4B 5T5FL 1XF3A 4OLVH 1OTSD 4P2CG 3JBG7 3LN4A 2I9LB 3PP4L 3Q5OA 2ED8A 4HIXL 2NY0C 1ZS8A 2QQKH 4XCEB 3QDGA 3GSOA 1WF5A 2CDEB 3HE7C 3C09B 3RAJH 5LVEA 4JHZA 5TE4L 2WV3A 3QFJD 3EO9H 3GBNL 3MJ8B 4R96A 4OFYA 4O2EA 3T8XB 1LD9B 2ZSWA 1ONQB 2EC9U 3H7BB 3AM8A 3U30C 3V52L 4PJ5D 1Q9OB 4P5MB 3C2AH 3GI8H 3VXSB 2YXMA 3H42H 1A6PA 1ZHNB 1KTRL 5B4MC 1QBLH 3THMH 5D8JL 3GJFK 4E41A 1S5HB 4M3KB 2ITDA 3SBWC 1XF3B 4NIKB 3MA7A 4F7CB 2ESVD 5TGBA 1HI6A 2E27H 1E28B 3I3BA 3LN4B 4JJ5A 3OAZK 1MWAA 2LE9A 3ULUH 3AREC 2EH7L 4X5WA 1F11B 3EYQC 4Q9RH 1EVUA 2AAVA 5L0QB 4MNGA 4LRIA 3QDGB 1H3PL 4AQOA 2AJXL 3P0VH 5I0DA 1AHWB 1KLFA 1FZMA 1XGYL 3MRKA 4DVRL 4KRLB 5K93A 5JUEH 4R96B 4L3EE 4O2EB 3QCVL 5A2KH 4PJFE 1KJ3L 4MA1C 1DFBL 1HQRA 3HZYB 5HDQH 3N1MC 2J2ZA 1TENA 2IPUK 4FMKA 5D7SH 1DBAH 3O2VL 5J1AA 1HILA 4JLRB 3RVXC 1FRGL 4LDEB 4PJAF 1CWVA 5C08B 1LO0L 4JR9L 1NFDA 1NMBL 3EO0A 4E41B 4PJ9B 3P9WB 2ITDB 2XWTA 3WS6A 4IOFC 3DOSA 2P43B 2Y7QB 2VLJA 2VOTA 2BVUA 4JJ5B 2HFFA 3RGVB 1ZV5A 4HFUH 2H45A 4YC2C 1T0PB 5I71C 4HK3J 2BMKA 3T2PA 4QHLA 1FG9C 5HHOE 4AK1A 3HG1B 4U1GC 4O5LH 3GSNL 5E2TH 4HX1A 1BOGA 4CW1A 3T77B 3CVIH 5TDNB 4BELD 3WUWG 2A0LD 1TQCB 1N3NA 4PB0L 1HQRB 3VH8G 1MCQA 1QBML 4XVSL 1DQJB 1RIHL 1IZKA 3TBSA 3CLEH 1V7ML 3HI6L 3QRFM 2V5MA 3TVMA 5J1AB 5C07E 1HILB 2Z8VC 3BP4A 4KDTC 1UC6A 1AD0A 4GXVH 1QSFD 5D6CA 1NKOA 5I1DB 3N9GH 1MAJA 3H3PH 5F9DC 5C09A 1OB1B 4E42A 3D39E 4FFYH 2DQHL 2F54D 4WIQA 5LBSH 3X3FH 4KMTH 3DARA 2V2XB 4PIRF 3T04D 1MHPH 5IM7A 3JV6A 5J1TC 4G8GE 1DQMH 4BA8A 4NN6B 5DRZB 4CMMA 1KLGB 1NGPL 4HX1B 1HCFX 2APVA 4DCQA 1FQ9C 3TA3C 5GRYA 1N3NB 3SDXB 4BFGA 3DNKA 1RUAH 3B9KC 4X80L 1VESA 2CUMA 4LFHD 3MLXH 3TBSB 2HT2D 3L3KA 1WV7T 1JGEA 1JPTL 1XF4A 1NUFA 3TVMB 2HJFB 5DVKA 2X42A 5FKPB 3P2TA 3BP4B 4G5ZH 3LSOB 5FB8A 3FFCD 2HKHL 4UDUA 4P3CL 4ZQKB 3QIUC 3O4OB 5KVEH 3ORJA 5E2UH 5C09B 3FB7A 3U6RB 3CFBA 3P77A 4P5KA 4PG9B 2BVTA 1NUNB 1AR1C 3VA2C 2MCPH 3JV6B 3GRWL 2VDRH 1GPOH 3BSZL 4CMMB 3SKUD 2ZSVA 4RNRB 2WINA 5DMGD 4KQ4L 4M9OA 2NPLX 2NY5C 2W9DH 4YX2L 5GS1A 1CXIA 1DANU 3FCTA 4YHYB 2UZYB 4XPFH 1FCCA 3UJJL 3KJ4B 1C5BL 2BSRB 4OD2A 3ARGC 3BAEL 5F7HA 4WEBL 2OTPA 2G5RA 2GTZA 1GZQB 1T1YA 1WQVT 4M6OH 1MVFA 4UDUB 4H5SA 1VACA 2N1KA 3H9SA 5HYSG 4XC3L 1P1ZB 2YD2A 4R90L 2BHZA 3INUH 1DVFD 5GGVY 3S3SA 1UG9A 1F3DH 1KB9J 2APWA 2J8OA 2A2QT 3CFBB 3P77B 4P5KB 3TYFB 1WICA 5FK9A 4OLVL 1I8LA 1NBZA 5I1CL 1KB5A 2R1WB 1TNNA 1JN6A 4WGWB 1B3JA 1OOAA 4M00A 3BQUC 2ZSVB 4JFEA 3CZJA 4M8QB 4OFIA 5E8OB 3FCTB 4LDLB 3ARBA 4YDJB 1P9MC 2BCKA 1MCOH 3M8OH 2IBZY 3AC0A 5IEKA 2FZ3A 4PRIE 2FBJH 1EJOH 4H5SB 2MFNA 3C2AL 3TIEA 1VACB 3TWCH 3SDYH 3H42L 3LAFA 4PJDE 4RMWA 5DK2A 1T7WA 2NY7H 3WS3A 1PAMA 1WK0A 2ZUVA 5IHZB 1QBLL 3QUYC 3FQUA 3LRGA 3THML 3WL9A 1S7SA 3RZWA 5IOPA 5HI3D 1RK0A 1YN7A 2V5RA 2FLRT 2O26U 2QQNH 5FK9B 5D5ME 3TFKC 1G6RA 1JN6B 3OKNB 3I50H 1TQBB 1F2XK 1DBKH 4ZO8A 5D2LF 3DYMA 4HGMA 1QQDB 1OGAA 3IJYA 3MO1B 3PQYB 4YPGB 5E6IC 4JFEB 3P0VL 4I0KA 1QRNA 3VWKD 3NAAH 3QQ9C 1CFBA 4AEEA 4JANA 4S1RH 1CGXA 4X6DB 5JUEL 5BOZG 3PDGA 3LKRA 1O0VA 3BPCA 1GZPB 3ARBB 2D03H 1BEYH 1MCSA 5CP7B 2X4UB 3U79A 1U3HC 5HDQL 1K4DA 3LRSA 1R24B 5D7KE 5IEKB 1UT9A 1AP2B 3K2MC 5D7SL 4LU5H 4GW4A 5DVOA 1IEBA 1RIUH 3C08L 4JY4A 1DBAL 3TIEB 1YEFH 3QQ4A 3RA7H 4DN3H 3EJYC 5JPNA 5FHAH 2VJXA 5IROC 3RPIB 2P8PA 3C2SA 3L3GB 3WL9B 1S7SB 3IRPX 5IOPB 1RK0B 3BWAA 1YN7B 3RY5A 3QUXD 2ARJA 4P3WA 1OP5K 3SDCD 5CZXC 1G6RB 3GGWB 4LVNB 4OF0A 1ZGLM 3QPQC 4PJIE 4NNXB 1V3KA 3FB6B 1OGAB 3IJYB 3P73A 4O5LL 4NZUH 5E2TL 2E9IA 5T1KA 4QRRE 2J6EA 1IAIL 4C56D 5BW7C 2WAHA 3BPCB 3BDYL 3CVIL 5HYFA 5HI5D 3D25A 3GJFA 4ZUUA 3HNVH 2X44D 3QWRD 3CLEL 4HAGA 4JY4B 1U3JA 4K23H 3QQ4B 4NT6A 5FO7B 4PGBA 3QXAA 4IMLB 3WD5H 3WNNA 1ZA6A 4GXVL 3U7AA 3BJ91 2DTSA 5K59E 3NCYS 1JPSH 3H3PL 2ARJB 2R0LH 2VLRD 3WIHA 4R9HA 1IC4H 1FBIH 4FFYL 4F8QA 2QQQA 2ENSA 1GH7A 4KMTL 3X3FL 1KCUH 3B5GA 3QP3A 4WTWA 3CFJA 2BXYA 4Z7VE 1CVSC 5JIKA 4B0MM 3DETC 3JUYA 3E2HC 3F8UB 2DLFH 1CDUA 1DQML 5T1KB 1CYGA 1CCZA 2ICCA 2LU7A 4PTUA 1MFNA 1YEKL 4JRYE 2X1OA 4OCWL 3BPOB 2YA2A 3MNVB 3RRQA 1C16A 1RUAL 3D25B 1ZXQA 1X44A 3GJFB 4ZUUB 3MLXL 3MLPA 1OD7A 4LSPL 3RTQD 2F19H 1T3FB 4V1DE 1ZOXA 1CD1A 3FRPG 3VFSA 5KVFH 4NT6B 3DPBA 2F5AL 3QXAB 4KK5D 3KYOB 1AKJA 5ETUA 2CQVA 5KAQF 5KVEL 1DQTA 3HPJA 4ELMF 4QXGH 3MJGX 5E2UL 5F88A 5INDA 5AG9A 4JO4H 5CEZH 4PJHA 4RGOL 3MRLA 1QO3B 4ORZC 5ESQB 3ZTNH 2FH6A 4YUEL 4GG6A 1INEH 3KPRB 2VABA 5D1ZB 4OZGF 5DTFA 5J9PA 3WNLA 4OD3H 2NXYD 2A9NL 5C0AB 4RRPG 2MCPL 4QRTA 4DUXA 3ARFC 1GPOL 4ZOAA 1Y0LB 4PTUB 3FFDB 1EXUA 1NFDE 4PJEF 4J2XA 3G6JA 1JVKA 1QFPA 2WBJA 1AC6A 1C16B 5T3XD 1BGXL 1YPZF 4XPFL 3TO2A 2VLJE 4K7PY 2FR4A 4EXKA 4NBZB 2J8HA 1CD1B 2CJUH 4W6WB 3VFSB 2JIXA 4GOSA 4M6OL 3MRHB 5F7UA 5D7KD 3IAPA 3B6SB 1AKJB 5IJVB 4N1CA 1JHKL 4RGNC 4NQUA 3TPUA 3QEQA 5DD5H 3VI3F 5INDB 3QQ3A 1D6EA 43CAA 3MRLB 4WI9A 4U6VL 4EDXB 1HHIB 2IADB 3MLSH 4JRXE 4NO5B 3ARWA 5GHWH 2NY0D 1IC7H 1IBGH 2K7QA 5DTFB 2VLME 3UX9B 4OF6A 1LP9A 1X5IA 4ODWB 2CLZA 4QRTB 5GGQH 4RA0C 1WBXA 1T4KA 3WSQH 1IC5H 2P48B 5F9WB 4KXZH 4RBPH 5FO8A 2EECA 4Y1AD 1ORSB 3IXTB 2FIKB 2PW1A 3G6JB 2WBJB 1SMOA 2QSCH 3Q0HA 4I2XE 3ARPA 3HLAA 3S5LG 3L5XL 5C0BA 3MXVH 3LPFA 1MCOL 3DX6A 1MOEA 1KXTB 4KK9D 2FBJL 1EJOL 1KJ2B 4MJ4A 4XXCC 1K5NA 4GKNB 4NNYA 1JPST 2IANA 4POZD 5L9DL 3DGGB 5HHQB 2GSGA 3VFMB 1MLCB 2NY7L 3QEQB 4EN3D 3QQ3B 1D6EB 5AG8A 4XVUC 1E6JH 1HSBA 1VEPA 3UC0L 3ARUA 4NQCA 3NN8A 4RAHA 4KK8C 4K3JH 2QQNL 4JQIH 3EYQD 4DGIH 3LKQB 3KPPA 4P49A 1I8IB 4PJ7F 3I50L 1DBKL 1VENA 4G7YL 5D7JC 2IH3B 2DIAA 4RX4D 2VH5H 4BYHA 4WHTA 2FL5A 2PW1B 3NAAL 1NL0H 1CFVH 3HLAB 2D03L 2XT1B 5CS7A 1OWWA 5FF6A 3MLZH 3BUTA 3OJDB 1H5BC 5IBUG 2R8SH 4I3GA 3GBMH 1DTUA 5L88L 4NQEE 1RIUL 1GGCH 2ADJB 1K5NB 1YEFL 5HVHC 4X7CC 5HVFB 1HHJA 4DN3L 5EBLA 4IOFD 5FHAL 2D9QB 2ZUUA 3T65A 1HE7A 5EH1A 3RNKB 2IALA 5CEXA 4R2GC 3JSSA 1OTTC 1UFUA 4N68A 3T3PF 3O45A 5IR1B 4HIEA 4BUHA 3IDMA 3KPPB 3QCTH 3GKZA 4KPHH 5L8LB 1F3JA 2FX8L 2XQBH 4JZJB 3ULUC 1WWWX 5MHSE 3PGFL 2FO1A 3QT2A 3BT2H 5SWZD 4A6YA 4JJHA 5B8CB 3H9SE 5K9KA 1QFWI 1WZMA 3E1F1 2AXFB 2Z31C 4LK4A 1CFTB 1YQVH 4LQ1A 5FF6B 3HNVL 1JNNH 3RVVC 4WHDA 4YXLL 2FWOA 2R4RL 1A7PH 1D5IH 4K23L 2BVPB 5ACMA 4Y19A 1HHJB 3I02B 5EBLB 3WD5L 1VSCA 4MGXA 5EU6A 1IGIL 5DEFA 3GSXB 3VG0H 4RIRA 3BDXA 3MX0A 5D7LE 4YDVA 3HI5H 4PREB 1IFHL 1K6QH 4W6YB 3AB0C 5EPMA 4LLMB 4HIEB 1IC4L 1FBIL 2VSDA 1KCUL 2PYFA 4OGAC 1F3JB 2YZ8A 2IFFH 3B2VL 3BJLA 4DN4H 4PJGA 4UBDD 4A6YB 1RUMH 1F2QA 3QNYA 1JZ6A 4OIIH 3WN5A 5SX4I 3TA3D 5K9KB 3KWWA 5E03A 3B9KD 3MV8A 2D7TH 3LKSB 1BBJA 2PXYC 2DYPA 1KPUA 1OQXA 1ZANH 4P2QB 2EDKA 5CAYB 5KW9L 4YE4H 3I6GB 4Q9QH 3MRIA 1RZ8B 1T7ZA 5GRUL 1NC2B 3VA6A 2F19L 2FWOB 3QIUD 3SJVA 5KVFL 3JWNC 3I6LD 4L3AA 4Y19B 5CBEB 3ARDA 4ETYA 2BNQA 5HDLA 5EU6B 3ZHKA 1N5AA 3MOBL 2G75B 3L5WA 5EU3B 3ZDXF 1I9RH 2GKIA 5H37G 4JO4L 5CEZL 1NSNH 1Q9LA 5IW3A 5DJZA 1CDYA 1KJVA 2EIBA 4Y5YB 1AR1D 3ZTNL 3UTSE 1O7SA 2BK8A 4P2OA 3IFOB 1JGVH 3IF1A 3WXVH 5GZNC 2R29H 4OD3L 3QI9B 2R0WH 4KGLA 3F58H 1FZKB 4PV9A 3LH2H 3RWJA 5EIVA 3RX5A 3MV8B 1NAMB 2P5EE 1SM3H 1BBJB 5EIQA 2OQJA 5BXFA 4Z7UF 1DLFH 5D71H 1SY6H 1JYXA 2LTQB 3CC5A 4XTRD 3FQXA 2GSIA 3OR7A 2ERJC 2ZWLT 1UM4H 2CJUL 3IAQA 3OZ9H 2VE6B 2BNQB 2IG2H 3HN3A 4Q97A 3D3VA 4PJ8A 3EJJX 1CGSH 4M43H 4L8CB 1BLNB 1S3KH 4IRJA 4ODVH 3L5WB 4R0LC 1Q9LB 4UI2A 4KRNA 5GHWL 1HZHH 3BEVA 5J3HC 3PHOB 1FYTD 1EEYA 1IBGL 2H26B 2H2SC 3BQUD 4DKEH 4P99A 1A7BA 1FFOA 1LO4L 1D9KA 4PV9B 5CP3H 3WSQL