4JKPH

Restricting hiv-1 pathways for escape using rationally-designed anti-hiv-1 antibodies
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
222
Chain Sequence
EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRWGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restricting HIV-1 pathways for escape using rationally designed anti-HIV-1 antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords gp120
total genus 42
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH01
3CK0L 3RWFA 3I6KB 4LNRB 4WI9A 1TQBC 3VGDA 5KVMC 5ENWB 3HNSL 2NXYD 2FCBA 3MRRB 4M7ZC 2IBZY 1YPZA 4ZUTB 3ARGC 5ECJE 1MLCA 3QRGL 4X5XB 5I76A 5J56B 1JN6B 1BFTA 1IGJB 3EYOA 5JDJA 3L3IA 4JO4L 4KXZH 5MHSE 4JCLA 3MV8E 3U2SA 2D3VA 5L88H 1U91B 2BVUA 4PP2B 4YK4B 2IANE 3QG6B 1Q0XH 5DUBA 4LLDB 3MNZA 1RIVL 4GLRH 3ZHDA 2X4RB 5MENE 1MJ7H 3G9AB 2EDJA 4TSAH 3WDIA 3LH2H 4KUZH 4NUJA 2DLFH 1N7ML 3NFSH 4Y4FA 1SEBA 2CO6B 1JN6A 1I3GL 1NQBA 1MVUA 1UB5A 4NN6B 4UBDC 1R3JA 4JKWA 2NW2B 4G6KH 3ZT5A 3EO9L 4JHAL 4JM2B 4JO1H 4XHJD 5GGVL 4JAMB 4KVCH 1IKNC 1NLBL 2EDNA 4HJGA 4KMTH 3T2PA 4V1DA 5C0DA 2OQJA 1SYVA 1Z6JT 2AQ2A 1X4XA 1DUZA 3QXAA 3RQ3A 5AUMB 4BKLB 3FN0L 1F11B 5FUCC 4JM4H 4PRAA 3MGOA 1NKOA 4UZGA 1BWMA 3I50L 4QNPE 3MJ9A 3VXPB 1FNEA 3ZSTA 3WKML 3DO7A 3O8XB 5I17A 3V6OE 3VFRA 1NGWB 5LVEA 4NFDA 2YD4A 1IEAA 5EU3A 4WFED 5CEZL 5FV1L 5D72H 3WNLA 1UJ3B 2EYSB 4M1GH 2CH8A 5LJYH 1NCNA 3B6SA 3QNZA 4FZEL 1EHLL 3QDGD 3R8BB 3FCTA 1KTRL 2R0WL 3NN8B 2X09A 5CP7A 1E28B 1FGNL 4OF6A 5ETUA 1MRCL 3BPLC 5KS9F 4CGTA 3PWVA 5KSAB 2BSTB 5DD0H 4OFDA 3QIWC 5I1LB 5TQ2L 5B8CC 2P8PB 2VDPH 2FL5A 3OHXB 3T0WA 1GPOH 1A4JA 3QXVA 5INCB 3ZTNL 2AV7A 3EFFA 1AXSB 3GJEB 2OCFD 2HKFL 1YPZF 1GZQA 4ZUVB 4XCCL 2Q86B 4YE4L 1AD9B 3DLQR 5SX5H 2QBWA 2ZSVA 1MCFA 3MJ8B 3QFJB 2JIXA 3P40A 5DRNB 5I75B 5CGMA 4OGZA 4M93B 5FFLA 3L7FA 5JIKA 1FZKA 4HWBA 1WZMA 3IFPA 4WUUA 2BMKA 4DAGH 4EI5C 3TCLB 3GI9L 4NQDB 5J13B 1UH3A 4ZDHA 3UYOD 3VA2C 2X4NB 4QF1B 3E2HC 2BSRB 4LIQL 1HNGA 1G7JB 3FO9B 3K2UH 5C08E 2XG4A 4QRRB 1HHKA 3UTTD 2A6DA 1AD0A 3CSBA 3GMQA 1N5AB 3DECA 3UROR 2H2SD 3MV01 1QVOA 5JMRA 3ZYOA 3WFBL 5ABDE 4DOHB 2P5EA 2J8UE 2FZ3B 2YPLD 1KLUA 3AREB 2ITCB 5L2JA 2UWEE 1I1CA 1T7WA 4FABL 4LVNC 3UJTL 2V9QA 1UC6A 4NUGL 4NC2B 5BW7A 1I9IL 4TNVF 1YYML 3G6DL 5CEZD 4AM0A 5ADPL 2ESVB 4MD5A 2V2TA 3GSNA 2V2WB 2XQBL 2BCKB 4FRWA 5IBUB 3ZMRA 2GQHA 1F2XK 4W4OC 5AZEH 2N1KA 2XTJB 1GGYA 2Y07H 1Q72L 3G04B 3KXFB 4ORZC 5T1MA 5TH2B 1DR9A 2LU7A 2PYED 3VJ6A 1JPGA 3O3BA 1CI5A 4CVXA 2C1PB 1RIHH 4L1HA 4DOHE 4TQEH 4CVZB 2VLRB 1P7HL 4X9GA 3IS1X 3TNMA 4O5LH 3OKEA 5GGTL 2HYMA 3O81A 3W9DA 4OCWH 3V4PL 4QEGA 1YQVL 4MQTB 4CADA 3W0WB 3H7BB 1RZ8B 2O26U 4W4NA 4U33A 3O11A 1QRKA 3MA9L 2CXKA 4PJ5B 1MRDH 2ZUXA 3O3EA 1F2QA 4M8QA 3EJYD 2VQTA 3D85B 2P5EB 3ZKQD 3VWKA 5F1NA 4WI5A 3WNKA 1Z2KA 5DGRA 2VXTH 2YPVH 1VACB 1NFDB 2X7LB 3S35H 1CVRA 3JTSB 3EZJB 3FT4A 1E27B 4NBZB 4F2MA 3GMLA 3UBXI 4KTDL 2H8PA 1MHEA 1I9RH 1FCGA 2XY2A 2BMKB 1F6LL 4AEHL 1ZANL 1A1NA 4MD5B 3PGDB 5IROC 3QXDB 2UWEF 1VFUA 4WDIB 1E6OH 1WWBX 3T8XA 2FEDC 3QFJA 3V6OC 4R0LB 3OAYH 2AXFA 4OGAD 1DQMH 3AREA 1YNLL 4U0RB 5EO9A 2H41A 5DJCA 3O2VL 4ZO7A 4AQOA 5EPMB 3EFFB 2FO1A 3IDYB 1GAFH 2HT4C 4BSJA 2YEZB 3BD4A 4F58L 1C12B 3O6KH 1HOCA 3IDIB 1XCQA 2H32A 4KRLB 1UKTA 1AD0B 2A77H 4UV7L 4QRRA 3T2NH 4Z6AT 2VLKE 3BAEL 4JFFD 3IXAB 1YJDH 5JR1H 4LCCC 4U6XA 3RZWA 3TIDA 1KV3A 4WWKD 2L0DA 4HBCL 1MCDA 3WL9B 5KN5A 4MAUH 5JIPA 1LEKA 2IAMC 1TTFA 1U2CA 5CJQL 3ARGD 1CFSB 4UNVA 5DC4B 5DJ2B 2MCPH 4X7TA 3IB4A 1WT5A 2O61A 5TE4L 1SJVA 5E2TH 1UJ3A 4PJEB 4R26H 3GM8A 2KQMA 4OF0A 4NO5B 4JHWL 3LMJL 3AREC 5IB5B 4HGWA 1WFOA 4N90E 5I1GL 4PUBL 2NLJB 4QRRE 4WFHE 3P4NB 4OAWA 1FNEB 3IJSA 3EHBC 5B39A 3MFFA 5CCKL 2KBGA 4JRWA 4LVEA 4WEUD 4UT6H 4QHMB 1LDPL 2AXGB 1YMMA 4A2LA 1YEJH 4PG9A 3MUZ1 3V52L 3JWNC 1IGMH 5E2TL 4ACPA 5J6HB 5E5RB 1MSPA 1ZGLB 2D7QA 1B6UA 1QFWI 3ARBB 3TO4C 3NN8A 1I7TA 4NKMB 1BX2B 4ZS6C 1P4BL 4YHNA 5J9PB 3JTTB 4OLWH 4CMMA 1LE5B 4ETYA 3N85H 4K8RC 4OCMC 3BSZH 3O0RL 4LEOB 4QRTA 4LKCA 2Q87A 3MLZL 5GGRA 3HCVB 3VD4A 4NO0B 1X6LA 5EIIB 5GJTH 3KJ4C 3MNZB 3ETBF 2NY1D 2N7BA 4HGKC 1T1WB 4WO4A 2FJHA 3RGVC 1CE1H 5I1CL 5GZOD 1JRHL 4G80B 4M4RA 4AIZB 3HR5B 4ALAL 1H3TA 1U6AH 1YNLH 1IARB 1U8LA 3QXAB 4JZOB 2ORBH 1T7XA 2F5BL 3EFDL 1AJ7L 3DYPA 2J1KA 3WE6B 4AT6B 4ZUTA 2V6HA 2CK0H 1CG9A 4XPHH 3HZMB 4Q7DA 1DBBH 2DS4A 4LPUA 4WUUE 1KJ3L 4OUUB 3ULVD 1ZANH 2W0KA 2ZCKL 2R4SL 1R3JB 1PBYA 1R5IA 3RWFB 5BMFH 3TZVC 3DUSB 2EDWA 4XVUD 5DJYA 5DTFB 5HJ3A 2V7HA 4PTUB 3SDCA 3LKOA 5HI5C 4UT9H 3KWWB 5KVEH 1G7PA 2FD6L 1PSKL 3I3EA 3WIIL 3NZ8A 5KG9A 3P4OA 4EI5B 5IVZB 4Y5VC 5J6GA 5L2KB 3T0AA 1B4JL 5C0GA 4LSVL 5JIIA 5IM7A 3G6JF 3B9KA 4Q0XL 2JK5B 1OSPH 3M8OL 1FPTL 1OAYL 3O4LD 1OOAA 4UDTA 1MJ8L 4NZTL 1PG7H 3F12B 4LPWA 3BPOC 3SGDH 2ADGB 2MHAB 3V8CA 5IW6B 1QZ1A 2HFEA 4AZ8A 1I1AD 3QDJE 4CJ0A 2MNUA 4Z5RA 1R6VA 2FH6A 5DC9B 5ENWA 2IBBA 3KPRB 5HHXH 2YA2A 4G5ZL 4ODTL 4HK0A 4K3GA 4ZS6D 4OZ4A 1KCRL 5DEGB 4GRWF 1J0ZA 1HSAB 2VAJA 5CJBA 4CN1A 2AJSH 5BZWB 2YOCA 1JNLL 4IIQA 3BMVA 2R9HC 4L9LA 3LKNB 1H3UA 4G6FD 2A6IA 2VWEC 1YMME 3B9EA 2ZOLA 2DL9A 1JPTL 2F53B 4LLYA 1YYMH 3G6DH 4OGYL 5FKAB 4PJXF 2EE9A 1YEGH 2EKJA 2OSLA 3M8OH 4PJCE 1LHZA 1T2XA 1HDMA 4HHAA 1R3IH 4MYWB 3UBXB 5DD6B 5DMJB 1CXIA 3DYOA 4HK0B 3QCUL 2Y06L 3QIWA 4G9DB 1BD2A 3IDUA 3D2UD 4NQCE 4GAYB 1CS6A 4H25A 2VDRL 3WFHA 3QPXH 1H3PL 1TQBB 1KEMH 4ZO8A 4XCNB 1G7HA 4PJEF 1SJHA 4TN9A 4H88L 4M4PA 5I8EA 2ADGA 2MHAA 3LKQA 3C60B 1JRHI 3C6LA 4R90H 2WIMA 2ID5A 4BQ6A 4L4TD 5ESVB 2E27L 3QA3B 3VFNA 4LOUD 5HHPB 2F5BH 1G9MC 1JZ5A 2DQCL 4X6FB 2EYRB 4WJ5A 2JKXA 1IGIL 1LNUA 4MNGA 1A7BA 3SDDB 2DQJH 3U6RA 2E6PA 4N68A 3NABH 2FNBA 2ADIA 1MEXH 4G8IA 4B50A 5F9WC 3QHFL 5DTFA 1WZ1H 4TNVK 5C0CB 5B38A 2VLJA 3ULSA 2QSVA 1GXEA 3ARBD 2E7LA 2QSQA 2J2ZA 4TUJB 1GSMA 2VDPL 1FL3B 1RUAL 4KK8D 4LMQI 3GB7A 4NSKB 4XWOC 3WJLA 1F42A 3MUY1 3VWJD 1CICD 1NCWH 4JZOA 4WW2C 1TLKA 3IDMA 3CLEH 4HFWB 4JZJC 4NQSB 5DD3L 3MV8B 3U4BH 5E08H 1IGML 1XF4A 5AEAA 1ITBB 3V52H 5IK3B 3FO0H 1KXVC 4FP8L 5JOEA 3LEXA 5C0BE 1U8MB 1I9JH 4TUKH 4M1GL 1AO7B 1MWAH 2J12B 2WBJB 3CLEL 3GSVB 1AGDA 1CQKA 4JFPB 2D7MA 5IFHL 3EYFA 1ZHLB 2R29L 5KJRL 2X6MA 2UV3A 1XGRB 1XR9B 4I3SH 4M1DH 4YHNB 5FA4B 1MUJA 5CIPA 2V5YA 1WAAE 4PJEE 2QADB 5MERA 4YZFE 3G08A 4Y1AE 1FVDA 1LILA 4P5MA 2RGSA 4L4TE 1AE6L 2MCPL 2NNAA 3HE7C 3OB0H 4JQIL 1P84K 3LRGA 1U3JA 3CH1A 2F74A 4MX7B 4PG9B 1VESA 5T1DH 2A6JB 4CMHC 2EXWC 3VGHA 5J1TC 4YLQT 2AXGA 3WIFB 3C8KA 4X9IA 1MEXL 4QRSB 4YGVB 3QUZD 1DQQA 5B39B 1KYOJ 5C8JB 1UWEL 5D2LF 4Z7OE 1I4FA 5GRJL 2X10A 5C9JB 4G6KL 2P7TB 3RX5A 1XFPA 4UV7H 1T4KA 4NO5A 1VFAA 2A77L 4CRPA 5D7LA 3TBSB 1NGXB 2PW1B 1TFHA 4LNVA 1T20B 3VFGH 3H9SE 2B20A 1PFCA 4Z76A 3RWJB 5JXEA 2ZCHL 1N59A 4OBSA 5IW3A 3BQUC 3UZVB 4A6YH 4MAYB 1RUMH 4OBRA 5C0FA 3S7GA 4F57H 4I0PB 4HSQA 3GSQA 4LARH 4ZTPH 3RKDD 1NCBH 3WJJA 3FQUA 3CC5B 1IGCL 2VITA 3QIWD 1KN2H 3STLB 1F90H 2LE9A 2J6EH 1YEGL 1JPTH 1ZLWH 1NAMA 2BNRB 4HJ0C 4GAJH 3RL2A 4EI5D 4XCYB 5EO9B 1UADC 2BOBB 3TBWA 4RA0C 5HYQA 3EYUH 3L5IA 3SJVB 1FFOB 1AO7E 1EZVY 1G9MH 3VWKD 1KIQB 5LWYH 2R2EB 4L4JA 4Y1AD 3UJIL 4XNXH 3EOYG 3O4LB 4FA8A 4JJHA 2O5ZL 5EBMA 3QXDA 3TGXA 4HPYH 5C8JA 2DM2A 5KS9A 2NTFB 3MRJA 5INDA 3KLDA 4I2XA 5HHOD 2IALA 4NQDE 5JTWA 4ZODA 5IFAH 5FYJU 4XAKE 1GC1H 4RMUA 3QYCA 3P0GB 2Y7QA 5FUZH 2C4FT 1BF2A 1MJ8H 2FATH 1FVEB 2EE3A 2HA1A 3ULUL 1FAIL 1IC5L 4U1IA 4NO3A 3UCRA 2P24B 1JHTB 2J8UB 4RSVA 1ZHLA 4P59H 4M8QB 1AQDB 3W2DL 5J4MA 1T80A 3EYUL 3VFMB 3PHQA 4LEXH 5D7KD 5JO5B 3AB0C 4YK4C 2P5EE 4LKXB 4GAJL 4FXGA 1GYAA 3W0WA 3BPLB 2CLZA 4NNPH 2QEJA 3UC0L 1S7UA 2R56H 3BP7A 3NPSB 1FYTB 1XF4B 4P5TA 2BRRL 1YECH 2XZCH 1FNSH 3TNMB 3M45A 1NCBL 4GW1B 1G7QB 3MSPA 5ALCH 1JHLL 4Y2DC 3ZT6A 1KLFA 2ADFL 3VJ6B 5EFIB 3DX9A 5J11B 1VADB 5CINH 2YKLL 3KXFA 1P2CB 4LFHD 3U48A 3T0ED 2X42A 1A7RL 1FFNA 3WFEL 5D2LE 4Z7OF 5I2IA 2V2TB 3U7YH 5B38B 5LBSL 3BIAX 3OXRB 3GUTA 2A6KB 3L5XH 4XHQA 1FJ1B 4OF5A 2JELL 4XHJC 3W0WE 1J1PL 3DIFB 5TF0A 4DCQA 4GG8B 4G8IB 1PJ9A 3E8UH 1AXTH 5DDHB 4L3AA 4M6NL 4QLRA 3AUVA 4XT1C 3V5DA 4J12A 1RIUL 1KLUB 1BVLB 3KS0H 5FECB 5AZ2H 4NWTH 5GXBB 5D6DA 2NXZC 3TO4B 1OPGL 1JI2A 3V5KB 3FQRA 2D0HA 1S5HA 5IEKA 5DZLA 1N6UA 2BSRA 1OTSC 3HMWL 3WEXB 2R2HA 4JR9H 1S78C 1KB9K 3ARDD 4FFYH 5B21A 4WFFD 4WTWA 3VD3A 5DZNA 4IJ3C 1H5BC 1LO3H 3QDGB 5D70H 2WZPD 2HFFB 1WWWX 3RZCC 4H25B 1OF2B 1C16A 2AEQL 5L6YL 4NYLA 3EDEA 4IEFB 3N06B 4EDWL 5B38G 4BK4A 4TUKL 1EEYA 1A4KB 2DICA 3UYRL 4WEMB 5IEHB 3SDXE 1FGVL 1WAAA 2BZDA 4GRLB 3BUYB 2F53A 4LLYB 4R26L 2DYPB 3C5ZD 4XBPA 3QUZA 5D1QB 3CDYA 2BJMH 4NN7C 1TJHH 5GSRA 1T0NB 1AGFB 3QEUB 2A6IB 4M9OA 1CDCA 1QFWH 3LKNA 1VKXA 1QSEB 3QUYA 4LMQE 4QHUA 5B4MD 3SHSA 2E6JA 4MXQC 4YHKH 3P77A 5D96B 2CKBA 4Z0BH 4C57C 1UXWB 4PJAA 5CD5C 4P4KC 3K1DA 5F7MC 1UWXK 2Z9TA 1MCPL 3ROOA 4OTXH 3SKNA 4XPBL 2UWEA 2XT1B 1PG7X 3QI9B 1KFAH 5C92A 4GSDL 1WZ1L 1X3DA 2P44B 5DRWB 4Z5RB 4GW4B 2J88H 4YBLB 1I9EA 3KLAB 3FAXA 2QQNL 5JHLL 15C8L 3B6SB 4DEPB 1G6RB 3O9WA 1M7DB 3KHOA 4O51A 3F12A 5DHVA 4PY8I 3VGEA 4MJID 4R8WL 3OKNA 3SE3A 4V2CB 1EGJH 4XPTL 4JCMA 4NQED 3KPLB 3SDDC 5DVMA 4GXUN 5GZOC 3CMOL 2DAVA 4YBHA 3KXFE 4P48A 3VFPA 5KG9B 2AK1H 4JQVA 3P30H 1H3PH 2XN9B 4MCYB 4WI8A 3GJFH 2R69H 3WO4B 2VDRH 3AROA 4NRXA 3DNKA 4XZUA 5E8EB 4KAQL 2R1WB 2BERA 5JORB 1A1MB 1JGVH 5EO0B 3BD5A 1SHMA 4P3DB 3KYKH 2IPKB 1UB5B 3MCLL 2W0FA 4LPVA 3ULVH 3QUMH 1U8LB 4FFVD 3OZ9L 5FYJL 5CEXB 1N3NA 3BKJL 4G80A 2ZUUA 1TQCB 1DBJL 4S1SL 2VE6A 2Q7NA 4K7FB 2XA8L 4XC3L 3QZWB 5GRWA 1XH3A 2NX5E 3ME0A 4C4KO 3M17B 1YQVH 5F97E 1T89C 4P5KA 3WS6A 5GGTH 1YA5A 2G5BB 4JRYB 5J3HD 4KV5E 4PY7B 1U8HA 3BGMA 4UU9A 4YBLC 3L6FA 4HEPG 4LKCB 5F9DC 1OAQH 3P0VL 4WUKH 1NMAH 3S96A 5I76B 4O58L 1KPUA 1ES0B 4LLMA 2DQDH 4JFDA 5I1JL 4NKMA 2HFGH 5ANME 3JWOL 3SDXA 3V6ZB 3I6KA 1AFVL 1S3KL 4OIIL 4HC1H 1I8IB 1Z5LA 1JMXA 5FYJH 4KI5D 3KAAA 2I5YL 4S1RH 3QUML 1YMMB 5DWUL 2NR6C 2LU3A 4GW5A 5H2BB 3KXFD 4WWKC 3LQZB 4LSPL 3MRKB 1AGBA 3VFWB 3PWUA 3LHPL 1HH6B 3QZWG 3JUYA 5EZLB 1PEWA 3L9RB 1QKZL 4KK5D 3TA3C 4RCAA 1PSKH 3DUUB 3WFBH 4LGRB 1BHGA 1JIBA 4JE4B 1XGQB 2NY2D 2QQQA 5D1ZB 4ZOBA 2O61B 1K4DA 4HV8B 4RBPH 1NGYA 1A6TA 1Z9MA 4F7MB 3O9WD 3O6LH 4OGAC 3TF7C 3MZTA 5I75C 1MFEH 3G6AB 3JV6B 4JLRA 1EK3A 2OK0H 4YO0A 4POZC 4MMZC 2EDFA 1D6EB 4TSBL 2VDKL 3BIKA 1I3RA 4H5SB 4Z7VA 1CLCA 5I1KL 3IXAA 3WN5B 4ORGA 4IMKC 4L4TB 3PP4L 15C8H 4QXWA 4A2MA 1ZVHA 8CGTA 4MS8D 1KIRB 1ACYH 1XCQB 2H32B 5J1AA 4FFZL 4WFFE 4KI1A 3RNQA 3P9MB 3WUWA 1KENL 1FFRA 1ZLSL 3AFLA 1U3YA 2BOCB 3S96B 2G60H 2DI8A 4LU5H 1A9EB 2Q8BL 1EMTH 3MUJA 3GGWB 4U3CA 3BSZL 2CDGA 3ARTA 3EJYC 5JOFA 4M5YH 4C56A 1X9QA 3TPUA 1JGDB 4OLWL 2Z8WC 5CBAA 3VI4F 5F6HI 4K94L 1IE5A 1QBML 5IHBA 1A22B 3CSYA 5E2VL 1EAPB 1O0VA 2R0ZH 4JY4A 4PJFA 4RGOH 5AYUL 1C5BL 1TJHL 1U2HA 5F3HB 2VE6B 1D5XA 3LQAC 1DBMH 4X9BA 3QR2A 1N3NB 3GMMB 4OLYH 1BZ7A 4R4BB 4OLZL 4DZ8B 3HNTH 3FT4B 1YEJL 1WWCA 3UDWC 2KL6A 3MJ6A 2JTDA 2IPKA 3B5GA 2B4CL 4UV4L 2XTJE 5F1KC 5JORA 4PLKC 5DJZA 3QIUB 5BZDA 3BFOA 2CKBH 1AY1H 4P2QD 4E5XA 3LEVH 5C0BB 4NDMB 4OJFL 1D5ZB 4I4WB 3V95A 3VI3F 3ZYZA 2MPAL 3OKDB 4GUPB 3BISA 4M9PA 1P7KA 3U9PL 2ATPB 3DARA 2A0LC 4JKLA 3HZVB 2HRLA 4FQXC 1TVDA 2HT3D 2BNRE 5L8JB 1DBKH 3FN0H 1Q94B 3GHEL 4GOSA 4P2RB 3BI9X 5FHBL 2BY2A 1FLTX 1BGXH 3NH7H 4L29A 4JPIB 3INUH 1Y6NR 1BJ1J 1IGFH 3RTQC 3GEWB 4YHIA 5JR1L 3NFNA 2H2SC 2XG5A 4L3ED 4O9HH 4OSUL 3QCVH 5TFSL 2AQ3A 4ESKA 3CXDH 4H8WC 4YHLH 1FC2D 4IDLA 4KC3B 3QUMB 2E9WA 3PGCA 1SBSH 5ITFA 3T77A 3QDJD 1PEZA 4HGMA 3SKNB 2HVJB 3CFDB 3T65B 4U1LB 3LPWA 4FQJH 4L3CB 2Q8AH 3WO3B 1QNZL 4YBQD 1DQLL 2UUDH 3O8XC 2X4OA 3LSOB 4HAGA 4LQFH 2N56A 3TA3B 4ODBD 4ZS7L 1YEKH 2OZ4A 3E6HA 2DJUA 5ALCL 1WQVT 5JXED 2F58H 1W72A 3MREA 4WHTB 5BV7B 2FZ3A 3P73B 4HH9A 1A3RH 4NQCA 3RTQD 5HY9A 1FG2A 3ULUE 1QVOB 5IB2A 2NX5D 1FYTD 1G0XA 5GJSH 4YIQA 2C7UA 1CLZL 5IQ7L 1B9ZA 5I19L 1A4KA 4C56D 3W81A 3CK0H 5KSUA 2E9IA 1S7VB 4IM8A 5C08B 5JW3H 4YWGH 4R3SB 5DFWH 1HHIA 4RRPG 3AC0A 1G6RH 3VXOA 3IFPB 2DOCA 1GVIA 5DJ0B 5E6IA 3MLXH 1BVKA 1U41A 3OF6A 2PO6B 4N1HB 4QT5A 5FOBA 1GOFA 5IIEA 1IGTB 3S4SG 1K6QH 4XBGA 1I1YB 4EOWH 2PTUA 1JGLH 5HYSA 5C07B 4YIQB 2Q86A 3C5SA 3H9SB 4X5WB 2X1WL 3MRIA 5D7IF 1E4JA 5SWQB 4RMRA 3TT1H 1EFXD 1FNFA 2ESVE 5F70A 4APQD 3JZ7A 5KVGH 1I8KA 2FL5B 1U0QA 3HKFA 1C7TA 5I1DB 4YUEH 3ZKXC 2GIYA 3DSFH 3QH3A 3ZKNC 1Q9OB 1J05B 1RUPL 1HEZB 5CMAB 4YNYB 4P9HC 4E0RB 3OXRA 1YEEL 4QHNA 3CFDA 1SJXA 4PV9A 3KYMA 1HNFA 2VOTA 1JPSL 1H3WM 5ADPH 5DA0B 2ZPKH 1J87A 3QFJE 3UPAA 2G9HA 2AK4A 1OGAA 5AWNL 1VERA 4Z8FH 4AH2B 2VISA 3HG1D 4PD4J 5D7SL 4X9FA 3NFNB 3CFJA 3MZGB 3BP6A 1X5JA 3NA9H 5ACZB 4RMQA 3MO1A 4YXLH 3UZQA 1X5GA 4H0IA 1A7QH 5CWSA 4F57L 1F6FB 3FB5B 5JW4Q 3QNXB 4PJ9B 3S4SB 4LQFL 4OKVA 1IEAB 2AV1A 5E00A 3EYQD 4GRLD 4D0CA 4X4ZA 5CZKA 3BP7B 2JB6B 4L5FH 5I74C 2BY3A 3O8XA 5CJXA 2F5AL 4G6ML 4ZO6A 5IBLC 2CUHA 3O3UN 1IVLA 1CFTB 4I0KA 4XPFL 4XRCB 4DN3L 4Y19E 3PHQB 3OKDA 4QXUL 5IHLB 5K9JL 2X44D 5TFSH 3V4VH 5H35A 2OQJB 1G1YA 3D48R 5KOVC 5I8CA 1FVEA 2DWEB 1NAKL 3RRQA 4ZFZB 1ZLUH 4AG4H 5D6DC 2HMIC 5KSBB 2RCSL 1VEOA 3CPLA 1JK8A 5DUPH 3RTQA 3A6BL 2C3WA 4Z0XA 4BH8B 3PXHA 1KCVH 5IVNA 3RVVC 1S7SA 4U1SB 5DQ9B 1D5XB 4J3UA 2OR8A 2V7NA 4U6YA 2PTVA 4MAYC 4NM8L 3CDCA 2NY7H 1ZHBB 1GPOL 2R23B 2D31A 2Q7YB 5DUBB 1NC2D 4JY5H 3QG6A 3FN9A 2CRIA 4YDIL 4HIXH 3QAZC 3U2SB 1J0HA 2VLRE 4PJBF 2WM0A 3GGWA 5GZNC 4LF3A 5JPMA 4MQXC 4XPGL 2APXA 1CGVA 3I6LD 2B4CH 1I9JL 4XCYA 3D6GA 2YD3A 1FGNH 3CFKB 4JKMA 4BELD 4M7JH 3BPOB 1MHCB 4JPKL 4WV1B 1MAMH 3BN3B 4HMDA 2APBA 3ILQC 4OLZH 5J1AB 1XF2B 4OLYL 1RQ5A 2X2YA 3B5TA 5E08L 3UP1A 4MD4A 4F37K 4OT1L 4JFYA 3ZKND 1MFDH 1C5BH 4OZHB 1MLBA 3H42H 4KKCD 3L5WA 3PHSA 1RJLA 4NC0B 4WCYH 2B7DT 5CEZH 4G7YL 1KSRA 2WWMC 5A2JH 4LBEA 5EU6A 4FFVC 2PNDA 4LCWD 3JV6A 3MRBA 3RWEB 5L0QC 4GAFB 5BRZE 1LO5B 3JWDC 5EZJB 1MJJA 4JANA 2W0PA 1QFOA 4P9MH 1XT5A 3QO0A 4LU5L 5GS1B 1PZUB 3I50H 4JM4L 3F58L 2E7HA 4FTVD 4K07A 2IPTH 1ZT7A 3ZE1F 4H1LB 2EIZB 4AL8H 1NGXA 1U92A 1TVBB 1XGUA 5E0QA 3QULA 2GJJA 5LXGH 5BV7H 4X0KB 4CVUA 4PB0L 3L9RA 4KVCL 1I4FB 5DD1L 4MA8H 1UQSA 1A6PA 2OLDA 4UOW1 3QEQE 3LQZA 1F4HA 3CFEB 2E27H 4ENED 2R39A 3RA7H 2BNUB 2F74B 1FYTE 4MX7A 3HG1A 4KUZL 3V0VB 1MNUH 2NNAB 3HMXH 3IDJA 5C0ND 3NZHL 1NBZB 3SDXB 3BHBB 4R7DA 4X80L 5GRXG 3D3VB 1YEFL 5BJTB 5LGJB 4JG1L 1A02N 4JFHD 5FA4A 4KKCC 1TJGH 5JNYB 4R9HA 3QUKA 2VDML 4UTAH 3O8XD 1K5NA 4X6DA 4JFPA 4OQTH 1QLFB 3SKJL 3D69B 1G9NH 4QRPE 2XN9D 2Y6SD 4Q97A 1HCVA 2BY1A 1WK0A 2VLLB 4K9EH 2A38A 1QG3A 1HK6A 5GZND 1WITA 5D1XD 5CSZB 1DSFL 1S3KH 3FB7B 3OXSA 2CRZA 5E24E 3OL2A 3QJFA 4NZUL 4YFLI 3LQAL 5FO9B 1I8LC 4HF5H 5I1JH 5HVWA 1JNHB 1H8NA 3FONA 4PJ8B 1QYGH 1CGYA 4MAYD 2Z8SA 5EIQA 3GSWA 1WCBA 3HI5H 5F7YC 3QEGH 2FYYA 4MA7H 3SOBH 1NFDF 2A74A 5E8EA 1CFVL 5A3ID 4QWWD 2HMID 3NIFF 1DP0A 3WHE1 4KQ4H 5IKCB 2VQ1B 4PS4L 3ZE0F 1AKJD 1LK3H 1J8HB 4P46D 4R96B 2Q6WA 1QBLL 5C3TA 3WS6C 7FABL 5I1HH 1W8OA 3RBSA 4LSSL 1P6FA 1RSFA 4ZFFA 4RNRA 4IBLT 3ES6B 3EW3B 1DL7L 3ARWA 4G8FA 4Y0GA 3K2MC 3RUGE 1LO0L 1K4CB 3OR7A 2IQAB 1Y18A 5IBLD 3ZDYF 5C0JA 5BS0E 5FYLL 1ORSB 1EBPA 3T1FA 1P7QA 4N1EA 4RGNE 3SGJC 3QCTL 4AEIL 1IC1A 3GSWB 2SEBB 4HIEB 5I8EB 5J89A 1SYSA 3U36B 2VDMH 4FTVA 5DZOA 4BUHA 2JCCE 4GRWH 4ZNEE 4JFEB 1UYWH 5DRWA 4JO2H 2AK1L 3UX9B 2UVFA 3MBXL 4GKOA 1BD2B 4ZD3H 3ROOB 5BQ7B 4U1HB 4QTIL 5DD6A 3IXTB 3NVQA 3TJEL 4KGLA 5T33H 1Z0NA 4HHAB 1AJ7H 5MENB 1ZSDB 5F7EH 4Y8DC 2I26N 1U8IA 4HT1L 4OZHE 2RQ8A 3FT2A 1QSEA 3BW9B 4IOIB 1FAKT 1MFBL 2OR7A 2WP3O 5EBWA 4Y2DD 3KPMB 3MGTB 5EWIH 4HH8A 2C3GA 3I02A 4NCDA 4HUMB 1IAKA 5JDSA 3U0TB 3WJLC 2EC9T 1MH5B 3BUYA 5ANMB 3D3VA 3RDTB 4AL8L 4APQC 3QUXD 3FO2A 3ZE2E 1JYVA 1NBZA 4JVPA 3GSUB 3P4MA 3IVKB 3D3VD 1C7SA 3PV6B 2EDXA 4B0MM 1X5XA 1ZS8A 1T83A 3TESA 3DRTB 3VRLF 4KKAD 4YHKL 4LLUB 3PE9A 3FQXB 3N85L 1JWMA 5ID0A 5HGHA 5H8DA 4GKZA 2XYCA 4G7YH 1XGYL 1MIEL 2B1HH 3B43A 4OLEA 4LVHC 4MA3A 1I7UB 2HT2D 3LS4L 3KPRE 1HILA 1MCWM 4MJIA 4DUXA 5HVFB 1AI1L 1A6WH 4MSWB 5D93B 5I0DA 1KJMB 4UT6L 5K9OB 4PYHA 3P2TA 3B9KB 4PB9L 2WQ8A 1A3QA 2X89D 1AR1D 1ZOXA 4TRPL 1LO5A 3C6SB 3FFCD 4J4PD 5JXAL 3ARUA 1V3JA 3RVWD 1OAXL 3MR9A 1CN4A 1FYHB 2X41A 3UTOA 4LPCA 4NT6A 4YHPA 3B9DA 3CFBB 1PAMA 4HKJA 2EZ0C 1G7MA 4ZTOH 4XMKH 3DXAB 4L8SC 4YFLF 2A83A 2X1OA 5I2IB 4L8BA 4DEPC 1JWUA 5EUOA 5IFJB 3HZMA 4LDEB 2IH3A 2CR3A 3N0PB 3V2AR 3CFKA 5ISZE 1S9YB 4FQLL 1INQB 4R4ND 4P2RE 3X3GH 4FQQB 3FQWA 3KVQA 4XP5H 2F53D 5JIHA 5GS0H 4YC2B 4ZQKB 1ORQA 1G7QA 4Y4FD 3KS0J 3T2NL 2AERT 3PDOB 2ZUVA 5D7JA 2WV3A 1XCTB 5TF1H 1FQ9C 1T1WA 2CJUH 3ZE2F 5EC1B 4PGDA 3BRDA 1E4XH 4MJ6A 1T3FB 3VRJB 2YRLA 4FXGB 2FR4B 1QQDA 1DVFC 3K81A 1S7SB 4WU7B 5F8RC 4FQCH 1F5WA 4IRJD 3VXQA 1L0QA 3U1SL 5D8JH 2VAAA 1IJ9A 2ZZUT 4QRPD 4ODHH 3SQOL 3LN5B 1L9MA 1NGPH 3NTCH 2R4RL 1MCOL 5I1EL 1A7QL 1NFIA 4RAUA 5E9DD 2BSSA 4JM2F 4F7EB 3KJ6L 3MYZA 1Q9LA 2DKUA 4LRNH 1BBJB 2VR5A 3B9KC 1CFNB 4KTDH 1R24A 4WHCA 4Y8AA 4JZJB 4HCRH 5J6HA 3RIAK 2BRRH 5CJ5A 4RMWA 5DUML 4IMLB 3VXQB 1RURL 3NAAH 1CGSH 3VE0A 3OSKA 2NY6D 3ZKXB 4P5TC 4QHMA 5D2NC 3SGDI 4GFTB 2W60B 5T3XD 5L2KD 1LEIA 3ILPB 3QUXB 3K1KC 2CO7B 1M7IA 3QUYD 2FSEA 1LP9B 4QOKB 1S7QB 2R2EA 4NP4H 1G0DA 3MOBL 1A0QH 1P84J 4ODXB 5HPMA 5F9OH 2XXMB 1WFTA 3TBVB 1JF1B 2NXZB 2BOBA 3HN3A 5SX4I 1MREL 2FB4H 3F6IA 4JDZA 1JNJA 3MA9H 1S9YA 2XKSA 3RDTC 4APQB 1DANU 3MACL 4MVBC 43C9B 4AH2A 3ILQD 1OVZA 2DN7A 1KPRA 3C5JB 2VDNH 4LP5A 3V4PH 4FQ1L 1HQ4A 5JPNA 2OR9H 1NUDA 2UVEA 1X5ZA 3W39B 3C2SA 4S1QH 3H3PH 2E8ZA 3CC5A 4N8VB 4MXQD 4PV9B 2EDQA 4HZAA 4X4XB 4E0RA 1IM3A 3CVHB 4X98A 5DSCB 5EU7C 4YFEA 2Z31D 4HQQH 2R1YA 2BVYA 4HUWA 4IRSB 2QTEA 2XRAL 3QWOA 3EO1A 4PJHA 1C12A 3JWDL 3ROLB 1U8QA 3O4LE 3BZEB 3HA0A 1CLZH 2W07A 3NAAL 3V79C 5F1IA 3AU1B 1I1YA 3VFTB 4X4YA 1V7ML 5E9DE 5DHYA 1I7UA 5HHVL 1S8DA 3U4EA 2XTLA 2F58L 2H1PH 1PDKA 1A1NB 1OHQA 4M7LT 5E2UL 3R1GL 4UQ2A 1TZGL 3C8KB 2H8PB 1MCSA 4A6YL 3AS2A 2G75B 3VXMA 1S7VA 3IETB 3PV6A 4PREB 4CN6A 3KPQB 1IFHL 3K7UA 3K2UL 1B4RA 1SBSL 2OL3L 3BDXA 3VFGL 1T2QH 3EYQC 4XPAH 4G6AD 1IC4L 2IWGA 2VWEE 3MRPA 1K2DA 4JPVL 4NQVB 5GS0D 1WFUA 2IH1B 3N1PC 5B22A 5HY9B 3K80A 1TCRB 5F88B 1FE8L 1KCSH 4W6WB 2DLHA 5GRJH 1S7RB 2J6EA 4XVSH 4XP5L 3U30C 3IYLW 1R3KA 3LEXB 4Z77B 4L3CA 2BP3A 5GS2H 4MHHG 4YJZL 1F97A 2BVEA 3DHJA 4P0DA 3W5MA 4ELKB 4BH7A 3O3DB 1A7PH 1Q38A 3OKEB 4ZPTB 3ZTNH 1MHHB 2XN9E 4CVZA 3U9PH 3BESR 12E8H 3L5JA 2MPAH 3RHWF 4KPHH 2CIIA 2BHUA 1JZ7A 1QEWA 4JN1L 2D7PA 1YNTB 2PTTA 4PRBB 2W65A 5DYOB 2H6PA 1AY1L 4L9LC 5D7LD 3X13A 1PKQE 5HDQL 1ZT1B 3GIVA 4KKBC 1ORSA 4HUNB 4WTXA 5C0JB 1JI1A 4H26B 4C58B 4I18B 4U7MA 1K4CA 2YRPA 5C0CA 4D0BB 1X5YA 2BHYA 1HIMH 3BDYL 3SE8H 5TE7H 4QNPF 4BUGA 4PRHA 3ELAT 3GNML 1A7OL 2C4XA 3FQTB 2WIIA 3LPFA 1VFBA 4NRZB 3KLHD 5FKPB 1XZ0A 4PLJC 4Y19B 1JV5B 4RMTA 4R96A 5IQ9A 2Q6WB 3HPJB 4KROD 5F3BA 4N0FA 3VXUB 5IMOA 2VDOL 3MRLA 5EU5B 4LSDA 3QA3A 1P4IL 2RFXA 4XP4L 1N5AA 1RUAH 4WO4D 3OKKB 4NN5B 2YWYA 3TO2B 4I0PD 4W6YB 3RGHA 3IU4H 1ONQB 1G7JA 2P45B 1SJHB 3LKSA 4PJ5E 2VLMD 4CVWA 5BRZB 2Q3AA 4P3CH 3BPCB 4K7PH 3TJHC 3UTSA 1BZ7B 4R4BA 2Q20A 2GYSA 1NANH 2OMBA 3GSOA 3HE7B 3TCLA 3WFHB 1T0PB 3AS1A 3NABL 3SPVA 2YUVA 1KB5B 2BNQB 4OLXH 4MJ5A 1NLBH 4P9HL 5GGVH 3G5VA 2HVKB 1JGDA 2JIXB 4N0CC 3KHQA 1QSEE 4JPWL 1A3LH 2Y5EA 5ICXB 1W72L 4HWUA 4I48A 3SGEH 3TJEH 1F3JB 5C6TH 1JHKL 3F7RA 4R90L 3RI5K 4N1CA 1MJ7L 1NL0H 3LKPB 1CD9B 1X5AA 2GY5A 3IKCB 5D7IB 3ZLQC 5E5MA 3OHXA 2YN5A 3D39A 5IVXF 4PRIA 2DQUL 3QWRA 5DFVC 3M1BA 2IF7A 2IAND 5DEGA 1IT9L 5I1LA 1CD0A 4DFHA 2Y06H 3OF6D 5F1OB 1YNKL 1MFAH 2XWBB 3DI2B 5I18H 1UWXH 3H0TB 1AHWC 2IQ9L 4PRNB 1QR1B 1KEGH 1GGTA 5ETUB 3C2AH 1KTLB 5DMKA 5FF6A 1RZKL 5BXFA 3T3PE 1ADQH 3VFVA 4HWBL 2OL3B 2I5YH 4S1RL 4M6OL 5TDNB 3W11D 5EO1B 3D9AH 3HNSH 5JHDE 4ETQB 3LIZL 3BRFA 2DLTA 5K9KB 1MWAA 1F4WH 4BJLA 2C3HA 1U92B 3HB3C 2XWTA 5D7IE 4FN0A 3OAZH 5EA0L 1HHGA 4JKPH 1S9KC 4IIQC 3FQNA 3DMMD 1OAQL 3P0VH 2EXWD 2O5XH 5I17B 2DQFB 4P2OA 2NXZD 2VIRB 5L9DH 2X4UA 3MGOB 5T1KA 4I77L 3X12B 1L0YA 5F21B 1L7IL 3T0EB 3KWWA 3ZYJA 4MXWH 4CNIA 4NPYA 3DV6B 1YEIH 2V7HB 1X5KA 2EDTA 5I6XC 4FQ2H 5CGYD 3L5WB 3DURB 4U2ZA 3VFOA 5HI3C 1GGCH 4JFYB 5JHDB 4XNUH 1EEZA 3AMLA 3TYFB 3SCMD 3RNKA 4M6OH 3VG0H 3ULVL 3GSNL 2GAZA 3I85A 4P4RB 4QXTB 3H9ZA 3HI1A 2O93L 4Q0XH 1K8IA 4PJ9C 4R2GD 1CE6B 2FJGA 1B4JH 4O2FB 3UTSD 3BQUB 3RUGB 2IAMA 1T04B 3HAEH 1OAUL 3P0YL 1MAJA 4YX2H 1LGVA 4ZO9A 2HLAB 1VEPA 3P30L 2Q7YA 1XIWD 4PP2A 5BMFL 5KSBE 1RD6A 5EIIA 3D1MC 4AMKH 5L0QB 1NCUA 3VDBA 3MXWL 1GH7A 3O2DL 1IGJA 3ZSSA 4YAQA 2IGFH 4HIJA 5FAAA 1A3LL 2MQCA 4E9LA 4P4RA 1I8MA 4G7VH 2X1QA 1EGJL 4XPTH 5EO0A 3O9WC 4Z9KB 4XB8A 3KPSD 4EUPB 4F15C 2VL5A 2W59A 3ET9F 1S9VB 3NFPA 3WV0A 5LQBH 4NRXB 1M1SA 3KR3L 5F7HA 4ZSOB 2DIAA 3GSXA 2HH0H 2VKXA 4PJGA 5ESQA 4K7PL 4NPYB 2WWKO 5ITBL 3VWJB 1S7XB 5I73B 1WIOA 1NMBL 4X7FC 2FGZA 3CVIL 2I9TB 4M6ML 3EYVB 3D0LB 1RU9H 1EO8H 1AKJA 3OJDA 2AV1B 5E00B 1IAOA 3RWIA 1I1FA 2FEEL 1EXUB 3OKNB 1KACB 3TIEB 1TVHA 4X7TB 3DYMA 2P8MA 4HMCA 3VWKC 1A5FH 1A7OH 3VD7A 2I07A 2AQ1A 3CLFH 3IJHB 4BZ2L 5FGBA 1LDPH 2YD8A 1REIA 5DMKB 2GCYB 4D9LL 4F9LC 3VA6A 3WL9A 3RZCB 4WWID 2ARJA 5CMAA 2AP2A 5EZOL 4C83A 3VGBA 4NNXB 4ZUUA 3M1BB 5JZ7D 4N90D 5DD5H 3TNNA 4IS6B 4MNQB 2YA1A 5JA9A 3MRHA 2YD7A 4HXAL 2XKUA 1A5FL 3RPIA 4D9QD 3STZA 3F7VA 3AS0A 2FWOB 2YC1B 4HUUA 5GSRB 3X14A 1OB1A 4JFHE 4X6BB 4ZOEA 4PBVC 2E3VA 5C07A 3A6BH 1OPGH 3MCG1 4Y1AB 5FGCE 2RCSH 3L3HB 2VR4A 4QOKE 3EBAA 1QD0A 3HC4L 4MAUL 4HBCH 2HVKA 1BVKB 1N6QL 4NYLB 3REVB 2Z91B 4M02A 2EDRA 1BIIB 3WFCL 4XVJH 3SPVB 4IOFD 5GGVY 5F9AC 4DW2L 1NMBH 5SWSE 3OGOE 4R3SA 1IL1B 3L1OL 4K55A 4EDXB 3L5XL 4PJCB 2XPGA 4OD1H 3VXUE 1KNOB 1D5IH 3PL6A 3WFEH 3QWQB 1T22A 3HFMH 3V5KA 3I84A 3QEHA 3D2UA 2C7UB 2VXQH 1ZWIB 5E56A 3BZFA 5DVOA 4Y2DA 3FRUB 2XWJB 1ZGLP 2FDBP 1S9WB 4PRPA 3ESVF 4N0CD 5CILL 1S7WB 1HKFA 4OCYH 2NW3B 1BWWA 4U1GC 4NRZA 5E94A 32C2B 1UEYA 3O11B 4Z8FL 1FNSL 4P4KA 1NUFA 3IDXH 5ADOH 2PO6C 3GUTB 2CGRH 1FO0H 3I9GH 4TOYL 5E9DB 1UENA 1NEUA 5ITFB 3W9EB 3QUMA 4WEBL 3FFDA 3JWDH 4LEXL 1VGKB 1N2RA 4LLWB 3AY4A 3T0DA 4JM2C 1FDLL 5ISZB 1DN0B 5TH2A 4OD3L 1CLOL 3MC0A 4Z18A 4E41D 3HE6A 5C0CE 3SJVE 4MNQE 4OZGB 3T04D 1XF3B 3DVFA 4L29B 1ZVSB 4XWOD 5ICZA 4B7IA 1IC7H 3VD9A 1WZLA 4LHUG 1GRWA 3EO0B 2YK1L 2AJUL 1KYOK 3MUGB 2ZKHL 2ARWA 5D7JC 2ATPA 1EHAA 1UZ8A 1OTTC 1XR8A 4X6CA 3TO4D 2P24A 1R3HA 2IH1A 4JKPL 3FRUA 5C0BA 3I75B 3UJJL 3GO1L 4D3CL 5CD3B 5EA0H 3TVMD 4Y5YC 1WCQA 5DJZB 2Z35A 4NJ9H 3DBXA 1FNGA 3VRIA 3KPQA 1U58A 1UT9A 4DZ8A 1U8PB 1I9IH 3PWLB 5CBEB 3BKCL 3UEZA 4KMLB 4K94C 4JREB 5DR5L 3UTZB 4DKFH 2D9CA 3RVUC 5F6IB 3V0AC 3MRJB 5INDB 3SGKC 5T5FH 4WGVB 2B5IC 5KAQF 4ZS7H 1NDGB 2Z8RA 2V2XB 1IT9H 1LP9E 4LAJH 2W0LA 1VPOL 1FNLA 1OP5H 3SE4A 5LGHL 3QHZL 1KLGA 2D03H 5IB1A 3AU1A 1KELH 1PG7W 4LLVB 4FQCL 1DJSA 1P4LA 1FIGH 3CZFB 3MLSH 1RZJH 1Q9KA 1T21B 3UTQB 3F7VB 1U8QB 2GEEA 2JJSC 1CDIA 5C6TL 1O7SA 1J0YA 1JUFB 3BDBA 5HHNB 3RL1B 4KTEH 2X89A 3G5XB 5IHUL 2AK4D 5GIRA 5FGRA 3TNNB 5F9JB 3HMXA 2VABB 1RK0B 2AJ3B 1YJDC 4TUOB 3ZL4H 1CGUA 4GMSL 1I3RB 1JCKA 4PGEB 1OQOA 5GS0L 1IGFL 1IM3B 2CXGA 1G0YR 5J13C 1V3KA 1E28A 2HT4D 2YUXA 2BVPA 5IV2B 2MQ3A 4OFIA 4O2EB 3VMOA 4CAGA 4QY8B 1N59B 3V6BR 4OF7A 1WSST 5EOCL 5I15L 2P8MB 4XCEA 3TIEA 4KDWA 1J88A 4I3GA 2DTSA 2EYSA 3VXNB 2JF1A 5ACLA 4LPYA 1ULVA 4PGCB 5F96L 3UTTA 1C08A 1NC4B 3PGFL 3BH8A 5DJXB 4DZBB 5EU3B 5MEPA 2J5LC 4DVRH 1KXTB 2NCMA 2YZ1A 5JXAH 1IGYA 2H45A 4TRPH 3QUXA 2P48B 3AM8C 3MV7E 3BZ4A 1MWAL 2W60A 4UV4H 4XH2A 4PB9H 2HLFD 1MRCH 2KZWA 1NGQL 1F11A 2PYEB 4OI9A 4BKLA 4XNQB 5BOZG 3QISA 1D3CA 3DETC 3CLFL 3ARYA 3EOAB 1IKFH 4I13B 5JW5B 2R0ZL 3LRSB 3SDAD 5HYFA 5DD3H 4RAUB 3Q48A 1S9VA 1DQDL 3NFPB 1NFDE 3IFLL 3V4UL 4KY1H 5AYQA 1FL5B 4ZXBA 4UU9B 5F96H 4ZUSB 3TN0A 3WNNA 4JRYA 3BEVB 2GK2A 4R4FL 4ONHB 4P5KB 5ITBH 3PDGA 4P5TD 4HK3J 5AAWA 1R0AH 1W0YT 1I7RA 2YPLA 3BO8B 3S5LA 1KC5H 3IDMB 4ZQKA 2I60L 1CE6A 4JHAH 2XTJD 2Y5TA 1X7QA 4YDVB 4YZFF 2YXMA 4P57B 3PUCA 4JN2A 2XI9A 1FL3A 2MTPA 2BVTA 4GBXC 1N26A 5DURD 3QWRD 5SWZD 3ULSB 3ALXA 3VFOB 4JREC 4OIAA 5EU4A 4L3EA 2G5RA 4JFOB 3CFBA 3QQ4B 5EIVA 3MROB 1J1OL 3H9SD 4NM4L 1U3ZA 1V7NL 1G7LB 1VPOH 3MV7D 3ZDYE 1F6AA 3CNKA 3SY0A 5JLZA 1Z0MA 2YPLE 4R0LC 1RUKH 4RQQB 3DX6B 4ZPVB 5MP6L 4NHUB 4X6FA 3R06A 1UACH 3CIQA 1F4YH 2OP4H 1A9BB 5ESVA 3RBGA 3VG0L 4F7TB 1M6OA 4POUB 3WLWD 4XP1H 3C60A 2P8LB 3V5HB 1AFVH 1CU4H 4XX1G 5IP4A 1NEZG 4U6VH 1OM3L 1MELA 4HC1A 2P46B 4MXWL 4PBWD 2AXJA 2YD5A 5B3JE 4LVNB 4KQ4L 2HN7A 1AHWB 3QIUD 3CMGA 2ATKA 1QPPA 5FYKE 3KDMB 1RZFH 5LGKA 2JCCF 2XWBA 4QYOA 2WW8A 5I9QB 4CU7A 4G5ZH 4ODTH 1BM3H 1MRFL 1R5WB 1FFPA 4OD2A 1RMFL 2JJSA 2B0SL 1CT8A 2AEPL 1EFXA 4FQ1H 4DVBB 1FLRH 3UPCA 5ERWA 2P43B 1A9BA 1U3HD 1MI5D 2K7PA 4U4BA 1YN6B 4PY8J 1NBVL 3GBNL 4HLZG 4LRIC 3Q5TA 2NY0B 4DKEH 4HWBH 1ADQL 3WNOA 4D9QE 1RZKH 1HSAA 1FDLH 1G7LA 3MBEA 5SWZE 3NIGE 3NCBB 4QYOB 3QQ4A 4KZDH 4LSVH 3JXAA 4KAQH 5EU4B 3QFDA 3QEQA 4RGMC 3GJFA 5IOPB 3DX8B 5J57B 1YEFH 4TSCL 9CGTA 2HFEB 2B4CC 2H26B 5FO8A 4MJ2A 1FN4A 3IDNA 1XIWC 1KJ2L 4Y5YA 2ZCKH 2P8LA 3NMEA 1BAFH 1X44A 3B8SA 5GISL 3FQRB 1CLYH 3B3IB 5DVKA 1DBBL 3LS5L 3BO8A 1QLRB 3IS0X 5DLML 3WKNA 4PJ7E 2AGJH 4XB7A 1T2JA 1B3JA 1FG9C 2VXQL 5EG6C 3HPJA 5F3BB 3V5DB 3HFML 4ZFFB 2NY4B 5IVZA 2VN7A 4X5LA 4S1DD 3BXNB 2EH7H 5F6HJ 3BD3A 4M3KB 3LKOB 1XGTA 2J88L 1FL5A 4ZXBB 2EE6A 1G9NC 4JFOA 1ZT4A 3E0GA 4PLOB 5HI3D 2YA0A 4DW2H 4ELMB 3PQYB 1MCPH 4JG0L 1ND0A 3UPRA 3SKMA 2KKQA 3T4AA 1BD2E 1OARH 3L7EA 4XP4H 4CDHA 2LTQB 5D1ZC 4W6XB 1YNTA 2PTTB 3ORJA 3IDYC 1MOEA 2VDOH 4BSWA 2CIIB 1P4BH 3RWCA 4GRWB 1QFWL 4XNQA 2DQTH 1NDMB 5IWLC 3TM6A 4NO2B 3FB7A 3HC3H 2GSIA 3GNMH 2K3TA 5J06A 5D1XB 4L8SB 1H15A 4NC1C 4C4KT 3ARPA 1NBYA 2C3VB 4QRRD 3NGBB 3Q6GH 4XP9L 3W11C 3DVGA 3NCCB 3T4YA 3H3KA 5KW9H 4NQXA 1S7RA 5H37G 2DBLL 3VXNA 1QSFD 2NXYC 2NX5B 4JN1H 2Y4SA 4JHWH 4F7PA 3WIHA 4CU8A 1LO3L 5D70L 5J9PA 4KPHL 3FOLA 5ESAA 4EJ1C 6FABH 3BUTA 2BVQA 1ITCA 2ICWJ 3DX7B 5FK9B 4ZNCD 4TPRL 4ZSOE 1J7VR 2V17L 5DQDH 2D9QB 1MCWW 4YDKL 2IMMA 1D9KC 1URLA 4N5UA 1QRNA 3HG1B 4U7KA 1QOKA 4ERSH 3VH8G 2AJ3A 5SV3A 2BC4B 5A2IH 2D4DA 1OARL 3RL1A 3MRNB 1OT2A 1QHOA 2DQIL 2WBWB 3FOMA 5EU7E 1B2WL 2CRYA 4QGYA 3KYAA 1KCSL 2OZ4H 4DFIA 5C71A 1W2KT 2EDLA 4JDTH 1AXTL 1WF5A 3DO3A 4PJIE 4U0RC 5DJXA 1U8OB 3QULB 1P4LB 5K9JH 4QXUH 2IJ0C 2IEPA 1DUYA 3F5WB 5DS8B 3TBWB 2EH7L 1C8PA 4I3RL 4AENA 4GBXD 5DJ2A 4WVRA 2GJZA 3VGAB 1FH5L 1NDGA 2YS4A 5DJAA 4XVTL 3UZEA 1T03L 5E2WH 4QY8A 2OJEA 2WMPA 5IV2A 4UIMA 2R0LL 2HJLA 4KRPB 4YDJB 1LEKB 5IMKB 8FABA 2Y25A 4B41A 1Q0YL 3SO5A 5IB3A 5T33L 4MB5A 4WO4C 1KB5H 1WWAX 2D7TL 1D6VL 3SDYH 5DA4A 3DSNA 4WUUD 4XXCC 2AK4E 4N8VA 2PN5A 4GJTB 3VH8B 4TSCH 1OCWH 4WTZG 5D6CA 4YX2L 1BP3B 5DK3A 1KPRB 3C5JA 2GJZB 4CUCA 2YEZA 5J11C 4AENB 3HZKB 1MCLA 4JKKA 1T20A 2UYLB 4D2NA 2WUBL 3BE1L 3PJSA 1J8HD 4P46B 4Z7WE 3OR6B 3ZTJG 3CDGA 4KKBD 3GDBA 3MYJB 4EQ2A 3ARFD 3GSNH 2V2XA 3IU3B 3DVNB 2WWMD 2PF6A 3MRNA 5I30H 5C0RH 1MQ8A 1Q9WA 3BVNB 4F8QA 5JOPE 1CICB 1DQJA 4FQ2L 3PWLA 5CBEA 4IMLA 1QFPA 3QO1A 1MY5A 2W38A 3VRIB 1EGJA 1DN0A 3EHBD 5EUKB 1EEUA 1LO4L 4JEGB 2X7LA 3VFSB 1RZFL 2O5XL 5EUOE 4EKXA 1MUJB 4LCWB 4XNXL 5C1MB 3UJIH 2IBGA 2IMNA 4PJXA 4PLJD 3OG6B 4WI6A 4X6CB 3KLHC 1Z3GH 3LCYA 1TXKA 2FBJL 2K9UA 3WYRA 4J3XA 4QRUB 1AO7A 1DLFL 4KRPC 3MUGA 3VRJA 3H7BA 2HTLC 4Y16A 1SMAA 4JVUA 5GJSL 3MV11 4EZMA 3IAPA 4NUGH 1KN2L 4GKNA 4MXVE 4Y2DB 4PJ9A 1XF3A 4OV5B 1Q8MA 1RZIA 1RY7B 1Z9LA 4BFBD 1MCOH 3B9AA 3BP6B 2NY6B 2WAHA 1OW0C 4F15B 1U8NB 2EIBA 1V7NH 4TYUA 4QRPA 1HKLH 4NSKA 4U05A 1N2RB 4JG1H 2ILLA 4Q9CA 5EN2A 2CLVB 4HIIA 4XWGL 5F7NC 5I8KL 3HMXL 2OYPA 5C0IB 5F89B 3JWOC 1ZA3B 2ICWI 1YC7A 4YHPB 4KRNA 4Q9BA 1Q9OA 5DHXB 5HI4C 1FP5A 2A9ML 1KCLA 4ODWA 2ITCA 2NW3A 1VENA 2DJ4A 1P1ZA 1PYWB 3S34H 4G6AC 2OX5A 3TYGH 4KK9C 1WGOA 3LN4B 4K3EH 5HHPA 1KIUA 5T1KD 4J3SA 5A40E 1RHFA 4F80A 4HX1B 3MOQA 3RY6C 4C59B 4U1MB 2WBJD 1HINH 2EKSA 3BWAB 3FO9A 1U95A 3IDNB 5HXMA 1A47A 5B8CA 4IMKA 4LPXA 2ZUYA 4ZDHB 3IFOB 5GS3A 2J7LA 3JSSA 4Y16C 4MVBD 4OJFH 3C08L 4GKZB 1JWMB 3QFDB 2Z91A 3MBED 5CP3H 1DTUA 5DRNA 2VXUH 4QTHA 3MRMA 1IZKA 4ELME 4X8JB 2YZ8A 1AD9A 5F7KC 3MV7B 4NC1E 4JPKH 3BZDA 3LS4H 1T0MB 3I02B 2AV7B 3X14B 5INCA 2ZG2A 2I9LB 4DVBA 5D72L 4S2SA 4IHOB 4PJGF 5FYJE 3J7HA 3CFCH 1GCFA 1JGUL 4BFIA 2HAZA 5C7XH 1OL0A 4U1LA 3X11B 1V3LA 2ATKB 4IRJB 5HGAA 3T77B 3DGCR 5J12C 1A7PL 5A2LH 1KENH 1WC7A 4QXGH 2VL5B 3BEWB 3BH9A 2FBOJ 3QIUC 4KJWC 5HTSA 4XVSL 1WV7T 1HQRA 3DV4B 3Q1SH 1FE8H 5D9SA 3OKLA 4Y4FC 1Y18B 1AKJB 5DJ6A 5KVFL 2EO9A 4RQQA 3NCJH 3D0LA 1CK0H 4X7DC 1N6VA 3R0MA 5C0GB 5F9WB 5FYKL 3GRWL 2DIJA 3P4OB 4EI5A 3I3BA 4XWGH 5T1LB 3U83A 4H88H 1PW3A 3VXRA 3VG9C 1RIVH 5H37H 4LIQE 1KEML 1QBBA 2F5AH 4M6AA 1KELL 4WIQA 3EJZC 1Q0XL 1F8TH 2WQRA 3MNVA 3V7MA 2GAZB 4TVSa 5C0AD 2QR0B 3ZDZE 3IJYA 5GGSB 3TYFA 4PJ8C 6CGTA 2A74B 5I0ZA 2YD1A 4EUPA 1F00I 2BNQE 3EDDA 1SEQH 3NA9L 4TVPL 5D93C 5DMIH 5K59F 1UCTA 4AT6A 2X9WA 2VZSA 5D7SH 5HHVH 4RAVA 4YDVA 3DURA 5MI0C 5KVDH 3STBA 2ZSWB 1UM6H 3WFZA 4AIZA 4HC1L 4OZFB 3OXSB 4F7CB 7FABH 3JWOH 5CSZA 3ZDXE 1T1YA 4OZHF 3ARDA 2FRGP 2IFGA 4H1LG 2XACC 5F93C 4DK3A 3C60D 3QJHB 1HXYB 1HHGB 1NMAL 5F1SA 3MLTA 3O3AA 1LK2A 4LDLB 3QEGL 4PLKD 1L0XA 3S6CA 3THML 2J8UF 3QUKB 3S88H 3P9MA 5EB9A 1MFCL 4KJPC 1UG9A 4ZUWB 3LQAH 5JW4N 4NWUL 2DMKA 5E6ID 4YDLB 4X83A 4EUPG 3MACH 4LNRA 4E41A 1QR1A 3F62A 3H0TA 1JMZA 3D18B 3OKMB 2EDOA 4EN3C 3HS0B 2AJVH 5CJ8A 5T3XE 4U1NB 2WP3T 2KDGA 4JB9L 3WIHL 1MI5A 1TETL 5IWLA 3G6AA 2VIRA 4S2SB 5JW3L 1UQSB 3BE1H 5KSBF 4ZXBC 2PUQT 1CR9H 3FQNB 4WEBH 1A6TB 4XXDB 4HPOH 1T0MA 3LKPA 5MEPB 1DLHB 5IW1B 1QPXA 1EO7A 4G9FB 3MV7A 4AEEA 4OM0L 5JW4R 4X8JA 4U7SA 1MFNA 2DKMA 4LCWE 1CDBA 5IG7A 1PKQB 4LRNL 4MS8C 5K9KA 4NZJA 1D6VH 4MZ2A 3CUPB 5TDPA 2NY4D 2PYFB 3WMSA 4Q6IC 2A1WL 3KPPB 4FTVE 5JQHC 4KUCD 3CCHA 2VDQH 4OM1L 5L7XL 3AM8A 1AC6A 1M71B 4WHYG 5I16A 3TIDB 1M05B 3QUXC 4U6XB 4ALAH 4PGEA 1H5BA 2PCPA 2P5WD 1OTUC 5FDYA 1MPAL 4MNHA 3G6JE 1XF2A 1BBDH 4OCSH 1VA9A 3HG1E 1DDHB 4JFDB 4I0CC 4I9WE 4GSDH 1MHCA 5L8KB 1XGPA 4XVJL 5EPMA 1LE9A 1T21A 2J3SA 3WFCH 4R2GC 4UOJA 1RHHB 4P49A 1ZVYA 3O45A 4KK5C 4PY7A 5TJWK 4Z0BL 2I24N 4PGJA 4ODWB 4WFHD 4Y19A 4ZXBD 1P53A 3NIDE 5GGQH 2ERJC 1OSZB 2YHGA 4M00A 4WDIA 4ERSL 1TDQA 2RR3A 4N0RA 2Z93B 4D0BA 2D31B 1DBKL 4WNQA 2N4IA 3VD5A 3UBXG 1ZHBA 4EN3D 4F33A 2CLVA 4PJHE 1AO7D 1MHEB 2NZ9C 1D9KA 4XMKL 4KQ3H 3GMLB 3X13B 1N5YL 4U1SA 1JYXA 3LB6D 4QRPB 3RU8L 4KKLD 3GBML 4RDQG 4OZFH 1QEWB 5FYLE 4ZAKB 1CFQA 4I8DA 4MDJB 4PR5B 5EZOH 3DMMC 3DHMA 1UB6A 3IJYB 3FT3B 3OV6A 4PPTA 2ZCLL 4PJDF 5EU5A 3VW3L 4ELKA 2VZUA 3BGFC 5IMOB 1R3KB 5FKPA 4WRLA 3VXRB 3A0OA 1T5XB 2ZJSH 1KBGL 1MIMH 1QLEH 5E2VH 2GY7B 2GJ6D 1JFQL 2CK2A 1ACZA 3EO0A 3CFIC 4G8GA 1S5IL 3G5YB 3GMOB 4R7NA 5D7KE 5D7JD 5DUPL 1EO8L 3SO3B 5JHDD 5D9SB 1ZT1A 3GIVB 1Z9OA 3MLWL 3FB5A 2Q8BH 2BK8A 3WXWH 5FYKU 2W65B 3QDHA 1SJEB 1ZLVH 4Y7MA 2GUOB 4NKOB 1BLNA 2CDFB 3BT2L 4YHML 1JTOA 3I6GA 2JELH 1GL4B 1FSKB 3KLAA 3WLBB 3BEWA 5E8PA 2HH0L 2G75A 1KJ2B 3KPSA 4PRPE 1Q9WB 3GSNB 4FMKA 5SWZB 4PJIB 1W0VA 3O2VH 4NKQB 2Y6SC 3NCFB 3PWNB 2VDKH 1R5VB 3T0EE 5FUOH 4LASL 3IU3A 1ZMYA 3GKWL 2ZUQC 1FNHA 2H2PD 5B3JF 2YKLH 3WHXA 1T1XB 3SEPA 5L2JB 1MFEL 3VFTA 3VI3E 3LS5H 2UYLA 4JFEE 4WENB 3O6LL 1II4E 3KPTA 3BN9C 1JP5A 3O41B 3FL7A 4NRYB 1S9WA 2YRZA 3HNVH 3P9LA 2IFFL 3MRIB 3AY4C 5C0NC 3EO1B 3DMMB 4PJHB 2R56L 1W0WA 3B9VA 4PGZA 3P0YH 4S0TD 4OZIF 1JPSH 3WSQL 4ZOCA 1E6JL 1CR9L 5FOBB 3WJJC 3CVHA 4OB5H 5I66A 4DGYL 3W2DH 5IB3B 5IHZA 5CD5D 4MLSA 1BQUA 1AP2A 1T83C 3KPNB 3RWDA 4YDJA 1IC5H 4UMGA 1YY9D 3IGAB 1DL7H 2OJEB 1DCLA 2FATL 2VYRE 2Y36L 5KAQG 3VXSD 3WS3A 2ADJB 4OIIH 2ICCA 4APQA 4JDZB 2VZ3A 4G9FD 1FLRL 4G8EB 5EC2B 5IVXB 1YEIL 4R2GB 5K59E 4J8RB 1RMFH 1NFKA 1LP9F 1AXSA 1FG2B 3GJEA 4GKSB 4O58H 4EI6B 1FHGA 2XKNB 4PFEA 1A4JB 1BVLA 5LCVL 3E6HB 2CPCA 5HSFA 1EVUA 1G9ML 3RZCD 1CFNA 2D7OA 2ED8A 1KN4H 3MRDB 1SM3L 4W68A 3RVTD 2BVQB 5I19H 2R1XB 4DUWA 3IDGB 5EN2B 3W39A 4ZAKC 4FXLA 1D5MB 4MQXD 1MCBA 4JFED 3MCLH 1LDSA 2DI7A 1HHJA 2FX8L 3RWHA 3KYKL 4N0YL 5IB4B 4LSUL 5SWSB 4KXZI 4XCFH 2WLYA 3DVGB 3U82B 1S7TB 1EXUA 3HAEG 4NQUA 4OV5A 2KH2B 2VO5A 1IM9A 2X4TA 3RWGB 3DUHA 1RZKC 2EH8H 4LAQL 2DQUH 4FQXB 4X80H 2CLZB 4XNMB 4PRAB 2EECA 1AGCA 5C6PB 5FYKH 4QRUA 4QHLB 3WO4C 2MFNA 4LK4A 4GUPA 3CXDL 3JBG7 3NCJL 1AQDA 4LVHB 4JFXB 4JZJA 2PETA 4HWNA 2YSSA 4ZSOA 1HHJB 3ZKSD 3GMPB 4JPWH 1CTOA 4U1JA 3QDMD 3ZT7A 3PQYD 3L7EB 2UZYB 1EZVX 4MA8L 5BVPH 4N8VG 1JWUB 4G9FE 3IDGA 2NW2A 3A6CL 2VQUA 1R0AL 2VAAB 4X6EB 1OP5K 1SEBB 4XCCH 5KSAD 4P3CL 3ZKMD 4MCZA 4NUJB 3QEQD 3BP5B 1GIGH 1MJUL 1RFDH 1FVCB 5C7XL 5EC1A 3DVNA 2QKIB 1P4IH 3T0BA 4I3SL 3TN0C 4EI6A 3TPUB 1G7IA 3D85D 3CDGB 5TQ2H 2R29H 3OR6A 5DD0L 1K8IB 4Y4HA 4FQQA 2HJFB 1WEJH 4JFDE 3UMTA 1FZJB 2ADJA 4NZRL 4U0QB 3HNTL 2VJXA 3RNKB 3TV3H 5FDWB 5CZVL 5IOPA 1FGVH 4L8BB 5CKAA 4M7JL 3BMWA 1KJVA 4L9DA 2A83B 2VZVA 3BIBX 5HYJE 4I0PA 3CU7A 3BIKB 5IJKC 4K94H 5F6IC 3BKMH 2OBGA 3C08H 3X12A 3KYNB 1UH4A 3O2DA 4S0SD 3PP3K 4UIMB 2VNCA 5CLWA 5E2JA 4FFYL 3UTPD 4N5ED 3HE6C 3QG7H 4OKDA 1K4DB 4TVPE 1CIUA 1ZLSH 1HINL 1VHPA 4EVNB 4WY7H 3CXHJ 1XGQA 3REWB 1EFXB 1RZJC 1HILB 2PW1A 3LDBC 4RMVA 1CT8B 3CX2A 4D94A 4I5BB 3A6CH 3DUUA 1IM9D 2NMSA 4OZGE 4MA3B 2FX7L 1MCRA 1PY4A 5I1KH 5C9KA 35C8L 2AVGA 3PWNA 4JO1L 5TDNA 2OL3A 3EO9H 2OTWB 1HE7A 1W0VB 3IKKA 4L4VD 5TQ0H 3E8UL 4N8CL 5BXFB 2PW2B 3V4VL 5FA3A 5GPRA 4IRJC 4LLUA 4PRNA 4JFEA 2CQVA 5GGSY 3WLBA 5I71B 4JFFA 5F7DA 5DRXA 5I8OH 5DT1L 4CN4A 4EIGB 1J9CT 5GRYA 1IFHH 1ZLVK 1I3VA 5MERB 4L5FL 3D39B 5ALBH 1A7RH 4V2BA 3QPXL 3T1FB 5KTEH 2VXVH 1QP1A 1A1OA 1ZEAH 5CINL 2FEEI 3K4DA 3EYFB 3LEYL 3MNWB 4H8WL 1BJ8A 4CMHB 4PJ7B 3T4YB 3TH3T 2A73A 4Z78A 4JDVA 4KH2A 2E7BA 1YECL 2XZCL 4U1GB 5EBGA 3V7AG 3OB0K 1H8SA 2KUTA 4NFCA 3OGCA 2EYTB 4NNPL 4LCUA 3M17A 3HZYB 5T5NF 4O00A 4X6CE 3SDCC 4E42B 3KNBA 5T5NG 4WW2F 1NDMA 1NGZA 1YEEH 1J8KA 3HE6D 4UB0H 2ZUSA 2AJSL 3UTPE 4FTVB 3DSFL 3KYOA 4LGSB 5HHMD 5DEFA 2SEBA 4HIEA 1FAIH 1FZOB 4D9RD 4O4YL 2NY0C 5KOMC 4GAGH 1EJ6A 3T4AB 2FJFA 3G5ZA 5KVGL 2OTPA 2GT9A 3EDKA 2YPLB 4WNQB 4M5ZH 3OAUL 2A9NL 1GC1L 2FGWL 2JJWA 1J18A 3JUZA 4N0FB 4YQXL 3KJ4B 3GI8H 3RGVA 4JHBA 1DN2A 3HLAA 1PQZA 3BXNA 1MREH 1T7YA 2XA8H 3Q6FA 4PJ7F 3TN0B 4S1SH 2KZ1B 4Q6IA 4YPJA 2ESVD 4W81A 3EOTL 2Q3ZA 5HVGB 5T3ZD 4OFYD 4CW1B 3MMEA 1V8HA 3SDAB 5AG9A 1QLRA 3TVMB 2GT9B 4HWEH 3NPZB 2WUBH 1NKRA 2WUCH 5D1ZD 4MNHB 2WWKT 5DHVB 4Y5YB 2W9EL 3O9WB 3QFJD 2BY0A 4QRQA 2H26A 1EIBA 1G6VK 2CGRL 2VKWA 2DM4A 3EOAA 1BZ9A 1RI8A 1A6VL 1OCWL 1YQ2A 1NGZB 3QQ9D 2M26A 1OAKL 1DEEA 2D7TH 1ZE3C 4S1DC 3BZ4B 3CXHK 5I1EH 1IGYB 3MJGX 5GRUL 4LHUD 4DTGH 1TVBA 1XGUB 1C08B 1NC4A 2WLZA 3GKWH 4ZNEA 5EORL 4PRIE 5FUOL 4F9PA 4PGCA 3REWA 5IW1A 1FH5H 3ZO0A 1ZGLM 1TCRA 1N8ZA 5F88A 4CL7A 1Y6MR 1AGFA 1D5IL 3ESUF 4ONOA 2FLRT 3HC0B 4P23D 4ELMF 1WT5C 2RJMA 4O2EA 1AQKL 3MOAH 2JJTC 2OXHA 3OWEA 3V8OA 5E6IC 5GGTA 5FB8B 3MLZH 3CH8A 3C8HA 3KDMA 3D18A 2BNUA 2LVCA 1L4IA 1UCBH 1LD9B 2OTUB 3TCXA 4FQLH 3NH7L 4E41B 4JFDD 1OF2A 2F19H 5GIRB 5GHWL 1IAMA 1BQHB 3BJLA 3A67L 3N1MC 4BZYA 1Y6KR 4ZAKD 2V9RA 3H9HA 4KK6C 4G6FB 4GXUM 4X4YB 3TVMC 4LLVA 4AQ1B 5E03A 3C6LD 1U3HC 2BDNH 2Z0BA 3QJHA 4QWWC 5IESH 4OLVH 3TP4A 4NHUA 3PP3H 5CCKH 4EDWH 3BZEA 2X1PA 1U8KA 4G3YL 5FM8A 5T3ZL 4KI5C 4F7CA 2V5RA 1MCJA 4KRMB 1OGTA 5DQ9A 4TVPD 3GBMH 4O02L 2IBZX 3QNYA 5HJ3B 5FGBC 1N5YH 1RJLB 3C87A 3DUSA 1JK8B 1JYNA 4HS8H 3OJMB 2V5SA 1QFHA 2X4QB 5BS0B 4WHDA 1JVKA 3I75A 3BOVA 3QP3A 3MNVB 1FZJA 2F19L 1UWGL 1XR8B 1YY9C 1QUNA 4OFYA 4L1DA 2D0FA 1NC2B 1BOYA 2NY3B 1EMTL 3Q2CA 2OI9C 2ZG1A 4ODXA 4XRCA 3SDDD 1YJDL 2JCCB 1T66C 4HXBH 3NCEB 5JQ6H 4Z7VF 2OJZH 1J1PH 2NY5C 1T7ZA 4S10A 4D0CB 4KJWD 3TH4T 5FYKD 1CXEA 3HAEA 4HKZB 5DJ6B 3F65A 5ACMA 4CJ1A 4OKVB 4PJ5D 5EWIL 3BEVA 4OZGA 1UA6L 4RX4A 1S7TA 3VE0B 2DQJL 5JO5A 4MCZB 2VDQL 1R24B 4OM1H 1L7TH 5LAXA 2J8UA 3RWHB 5KSBA 4MLIA 5E8DH 1ERNA 4U1IB 4FG6D 2H2PC 3JTTA 1SMOA 2EEDA 1ETZA 2R2BA 1BAFL 5GISH 2R1XA 3UDWA 5HGAB 1I9RL 3GMPA 3B9KD 4BSVA 4QHNB 3NIGF 4PJFF 5EOQH 5C2BH 1IAIH 3PQYE 3RIFK 4AJ0A 2YD9A 2DI9A 2PYEA 4HPOL 5DO2C 4I2XB 1QKZH 3MFFB 1NMCC 3KPSE 2QQLH 4PGDB 2I9LA 1A8JH 1UM4H 3R0NA 1DQTA 4GRWE 4HMEA 2X4TB 3RWGA 4BZ1H 4JB9H 2X4PB 3QNXA 3BZFB 3C5SB 2CKNA 2Q76B 3NCMA 4DKEL 1I85A 4PJEA 1F4AA 1T22B 5C09E 5B3NA 2ZOKA 5FUZL 3V0WL 2BNRA 3O6FA 4PJCA 1UH2A 2AK4B 3L95B 4PJXE 2AEPH 1LK3L 1E4KA 2H9GA 1E4WH 4O5LL 1HHIB 1CGTA 3MRDA 2FIRT 1KCRH 5IHZB 4WUKL 1CL7H 2HLFC 4GAGL 1UFUA 1LO2H 3FFCA 3DGGA 4P2OC 4Y1AA 4Z7WB 1CGWA 4UB0L 2EZ0D 4U1KA 1NH6A 2R8SH 5D2LA 4KKLC 4MXVF 5HYJD 2GK0B 4NZUH 4P23A 3RPKA 2LAGB 4X7SL 4K3DL 4GKSA 3UXFA 3P73A 4RFNB 1PG7L 1Q9KB 3BKJH 4X5WA 1RZGB 3LV3B 1AR1C 1P1ZB 1PYWA 4G8EA 4NNYB 1KTDB 4IS6A 4MNQA 2J6EL 4K9EL 5KVDL 5IIEB 4LHUA 2E7CA 5DJ8B 1IILE 4NNXA 4K71C 2IAMD 1UM4L 2HRPH 2A2QT 1MCQA 5BO1H 4Q6YA 1P6AB 5IJKA 1HSBA 1DQQB 2HJKB 4QRSA 4K8RH 3WXVH 1AP2B 1GHFL 1F8TL 3IAGC 1TJGL 4Y5VB 3B8YA 3FAWA 3MA7B 5DF0A 5GRVK 3L95A 2UZXB 1IAIL 4FQIH 5C08A 5I66B 3MLUL 5FGCB 4RIRA 2ZCHH 1MHPL 2GUOA 4NKOA 3IVKA 4JZNA 1SJEA 2R4SH 3T0XA 2ZOKB 1NFDA 1QRND 1CK0L 1I1FB 4PJGE 5CD3A 1UJTA 3OJDB 3VWKB 3P9LB 3EAKA 3MREB 3O41A 4WHTA 5DD1H 2UZIH 35C8H 1B6DA 4R8WH 4Y16B 1AC0A 3HR6A 3U7WL 4PJ5A 4F37F 4Q9RL 2FX7H 4JFZH 1T1XA 2Y9RT 4KFZC 5LXGL 3HZVA 4Y5XA 3WD5L 3MRCA 3S35X 1DVFB 5FIEA 5BQ7A 1I75A 4PJXB 4PJIA 1RZ7L 5FCUH 4PJIF 2VLRA 1J0JA 2HKHL 4LCWA 5BZDB 4HFWA 4NQSA 1KPVA 3VFSA 3LOWA 4PR5A 4M1DL 4KY1L 3O3BB 4OFVA 1HWGB 1MAKA 1YPZE 3J8F7 1VGKA 5J8OA 4I18C 1A2YB 3ARFC 3C09C 2BCKA 3KPRD 4OI7A 1JPST 2QSCH 3FO0L 2R0WH 1FZMB 2BNRD 5DK2A 2W1NA 4ZFGL 5A2KH 2ZP0T 3ES6A 1YC8A 1MAML 3F8UB 2YD6A 1FO0B 5JOFB 2PYEE 1FORH 5E94B 5DRZB 3RUGA 2AABH 1WBXA 2QL1A 4Z95L 2DLEA 1J8HA 1BFVH 4PRPB 1NC2A 4UOW0 3C60C 4GRMB 4PJAE 3EKCA 3D2UB 3FN3A 3ARGA 1MQKL 3UO1L 2VR9A 4X4MA 4ZAKA 2PCPB 5EOCH 25C8H 3WN5A 1SBBA 3B5HA 1M05A 1KCVL 2EXYC 3GMMA 1PLGH 4PRDA 1OGTB 4NWTL 4QHKJ 2ENYA 5T1KB 4L4VA 4F33B 5DVLA 4KMTL 3RKPA 5GS2D 2PXYC 4OZFG 3S34L 1OWRM 1CD8A 3V7AE 2V5TA 5IBTL 5DJAB 3ZL4L 3R4DA 5DFVD 4KDTA 4Q2ZA 2B2XL 1QA9A 1TCMA 3K8MA 5GS1C 1CYGA 3D39D 4GBXA 5E1HB 3O45B 1AIFA 4G9FA 1JWSA 4N9GA 1SY6H 3O2WL 3QUZC 4XPFH 3U7YL 3SE4C 1FIGL 3MLSL 3RPIB 4OCXH 5A43C 2MKWA 5A1AA 3WNPA 1TQCC 2M8XA 3FHAA 1KIRA 2CUMA 3DTXA 3R1GH 1E6OL 4U1NA 1WTGT 1QRNB 4IOFC 3GM0A 5I16B 3QAZB 1JF6A 4M1CC 2RIKA 3CZJA 3DRQA 1TMCB 1V7MH 3TJHD 3FCTB 3VXUD 3UC0H 4UINH 2A0LD 2DF3A 4NJ9L 3EIFA 2F8VA 3MPCA 4X7SH 5D1ZA 4XI5D 4N9GB 1D5BA 4ZFOL 2WUCL 5HGGS 1TITA 4H1LA 4I48B 4P59L 1M4KA 1DLHA 2G5BA 4XXDA 4M8VA 3ULUH 1IMHC 5IM7B 2FX9H 2XZAL 4AIOA 4LSRL 1CL7L 2EDEA 1MJJB 2JLLA 4JANB 4MJ5B 3MRKA 4PG2A 3VWJC 2I9TA 1XH3B 1VB9A 5F7UA 3ARRA 5H2BA 4J7RA 2AJUH 1NLDL 2MCG1 5AUMA 5C0CD 3BPCA 4LHQB 3ARBC 3QI9C 1NCDH 4ONGL 2JIXD 4QRQB 1WTLA 2GTWB 3UYPA 3TBYA 1GOHA 3WUZA 1NJ9A 3O6ML 1HH9B 2D4FA 5C0RL 4MD4B 2WANA 5I30L 2Y36H 3ZHLA 4OFPA 4JM2A 4CW1A 2XY1A 4BZ1L 1Q72H 2XN9A 4U6HA 5IQ9B 1XGTB 1LK2B 4OB5L 3HR5A 4G43B 1H9VA 3M07A 1R3LA 2DIBA 3K8KA 1FO0A 5C0AB 5KVEL 3RGVB 5IQ7H 1CGSL 4H20L 4M7KL 5IR1A 2G2RA 5DK2B 2WBJC 2C3XA 1U91A 3HNVL 4OZFA 2IAMB 1INEH 5CJOH 4OCYL 2H3NA 1F02I 1BOGA 2MOVA 4Z0XB 1NEZB 4BH8A 2ZSWA 2QLVB 3NTCL 2VZOA 1G6RA 5FO8B 3WNMA 2ORBL 4BQ8A 4RMSA 3LD8C 3BH9B 1LE5A 1RJYA 4KDVA 4NHCL 1A1MA 4ZFZA 1U8JA 1EEZB 3ARBA 2MQ0A 3N1QC 3O3DA 5F8QC 1O5DT 1CE1L 4IDJH 4YHLL 2EYTA 5E70A 1DVFA 5EBLA 2DKSA 4BFIB 1YEDA 3GI9H 3DV6A 1L6ZA 3L5HA 4DAGL 3PNWB 2A73B 4Z78B 5JQ6L 5TQ0L 3B4NA 2R9HD 3EGSA 4LOUC 4MQ7A 1VKXB 3MNWA 3OPZH 3GFUA 3O0RH 4L8DB 1A1OB 5IB5A 1K2DB 2F9BT 4NQVA 5FXCH 3MJ9H 2NXYB 1FNAA 3O4OB 4JO3H 3SKOA 1HQRB 3MXVH 25C8L 1F58H 1M7DA 1AE6H 1EEYB 4O51B 2FLBT 4QTHB 3EOBA 4ZTOL 2DQGH 4PREA 1KG0A 4KRPD 4BFEA 2M1KA 1GGBL 1E0OB 4P2QA 5CGYC 5TGBB 4O02H 1WC7B 4UQ2B 3VW3H 5FO7A 1RPQA 1BFVL 5KN5B 4NQTA 1F3DH 2O5YL 4PUBH 3MRQA 4G6JH 4NCC1 4QHUB 1K3ZA 4FP8H 3RVTC 1UVQB 4IHOA 1UM5H 5M7QA 2AJZA 5HHOA 5C0AE 4ZFGH 1RZGA 1KUMA 3LV3A 4FZEH 4M61B 4NZRH 2IPUG 2W9DL 2QSCL 1OGAE 3GSRB 5HYIA 4OCRH 4XTRD 4RGOL 1VDGA 1TIUA 2DYPA 3BPNC 2GK0A 4CU6A 1HHHB 4XVUC 1MIEH 3BYTA 5E6YA 2C9AA 3ARFB 3C09B 5DDHA 2MMXA 1F6AB 2ICWB 5ICXA 3BN9D 4DCQB 3D5OF 2PO6A 2F8XC 1RFDL 5DO2D 1GIGL 1MJUH 5C0IA 3PHOB 4POYA 4UIKL 1C16B 1KB5A 2BNQA 4HIIB 4HUVA 1LVEA 3HPLA 3MOAL 5J12B 3WEXA 4P57A 5TPWL 1U8NA 1VADA 3DX9B 5A16B 5IEKB 2BXYA 3MLVH 5FM5O 3TBVA 3VXRE 4FG6C 4D0DB 5EORH 4NQCD 4YDLC 2OK0L 2X4PA 3PL6C 4DTGL 1S7QA 5FM5M 5F1NB 3LN4A 4Z7UB 4HBQA 3U0PA 4HFUH 4J4PA 1ZHNA 3VXUA 4NIKB 1LEIB 3MXWH 4QTIH 2IADB 1JV5A 2ICEB 2UUDK 4EEEA 5BCAA 5H94B 3NPSC 3TZVD 2NY2B 4HKXB 3L3KB 4ISVB 1NAML 4JRYD 4FQIL 1A6VH 2LV4A 5F89A 4X6EA 1T66D 1U9KA 1OAUH 4K8RL 3WXVL 3PGCB 3D0VA 1CDYA 2APTA 1X6NA 2VXTL 3IRZA 4HWEL 1NCCH 1EH9A 1IAIM 4CVXB 1P2CA 3WIHH 5LAXB 5T1MB 5EFIA 5FHAL 2IALB 3TC9A 1RZIB 1BQSA 1D9KD 4HCRA 4JPIA 2V2WA 1EEQA 4XH2B 5HDOA 4GKNB 1GZPA 4XNMA 2ESVA 5KS9B 4YQXH 3RVWC 5M94B 4FQHA 4F9LA 5K9QG 3S88L 4Z77A 1L7IH 4TTGA 3PDOA 4RDQF 4KWUA 4K8RD 1BM3L 4KROB 3VMNA 1CFVH 2GFBB 3SJVA 2AS5M 1RIHL 4I1NB