4JKPH

Restricting hiv-1 pathways for escape using rationally-designed anti-hiv-1 antibodies
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
222
Chain Sequence
b'EVRLSQSGGQMKKPGESMRLSCRASGYEFLNCPINWIRLAPGRRPEWMGWLKPRWGAVNYARKFQGRVTMTRDVYSDTAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGRGAPVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp120
publication title Restricting HIV-1 pathways for escape using rationally designed anti-HIV-1 antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 42
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2013-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jkpH01
2APWA 2LE9A 4RFEB 4XP1H 3VG0L 3TH2T 2CDFA 4PTUA 2VWEC 4Q9RL 3BN3B 2H26B 3IT8D 4JO2H 4Q2ZA 1UADC 2HJFA 2ESVD 4KKAC 4MJIA 5J6HA 3TJEH 4M8QB 2G9HB 5C0CB 4HC1A 3QQ3A 1O7SA 1RJLA 4JPIA 2BJMH 4OCWL 5FM8A 1YZZA 2BRRL 5CGYD 1ZA3A 3G5VB 1EX0A 4OZFB 3JVGC 1FFPB 3ILPB 2YPKB 4PJ7A 5I1AA 3C87A 3HB3C 2OI9C 2Q8AL 1RJYB 1MCQA 4QRRA 1UKSA 2LVCA 2NY1D 3L3KB 4KJYA 3FQNA 1OGAD 1UEYA 2OMBA 3IRZA 1U8NB 5MERA 3IYLW 4M1DH 3GHEL 4UAOC 4XVJL 3TBTA 1I1YA 5BS0D 5FAAA 3OKOA 1MFCH 3CZFA 3PHOA 2DWDA 4S0TD 2I07A 3EZ8A 1MCWM 1QRNA 3IFLL 1A7BA 1ZGLB 4G43A 4IS6B 3LS4L 4AENB 3SO3B 1FN4A 2IPTL 5DVOA 4CW1B 1WCBA 3LEXB 5C6TH 3P3YA 3V95A 4JHZA 4DEPB 3VD3A 2FATL 2FIKA 2N7AA 1KB9K 5HVWA 2FLBT 4RMSA 1PX3A 3TIEB 2I60H 5FUCE 4Z0BL 4JDVB 5E2TH 2OJEA 3X13B 4XWOC 2V2TB 3A67H 3RWEA 1JTTA 4S2SB 1RZKH 2OL3B 3O45A 4HEME 2JTDA 3D18A 4XC1H 3QEGH 2IG2H 2OMNA 4YDVA 1X6LA 4KHTH 3CK0L 4KPHH 1WT5A 2FL5A 5KSBA 4GRLC 1OF2B 4PRIB 2X70A 3TZVA 2X4QA 4URTB 4LDOB 5HHQB 2WIIB 1QFOA 4QRTB 1FAIL 3KPOB 3O3BB 4OUUA 4WO4D 5CJ8A 3OR6A 2Q3ZA 5BO1L 5I71B 1U3JA 2J5LB 1PKQB 3PWPA 4OZFG 1CFQA 4UQ2B 1IKFL 4JJ5B 4NC1E 1WC7A 5I30H 1MCNA 4P3DA 2C4FT 3E1F1 5H94B 4EQ3A 3TO4D 3QWRD 5K59F 2W1NA 1LE9B 4I18B 1SM3L 3BT2H 4OJFH 4IMKA 2H6PA 2J4WL 4RZCA 3QIWA 4BZ1L 4XP5H 4X6CB 2YRPA 1DEDA 4IM8A 4HPOL 4IRJD 4U33A 5FB8B 3M1BB 3CSYA 5CEZD 3L3DA 5B8CB 3ARYA 3DGGB 3FQWA 1OAUH 3PNWB 4UQ3B 4OTXH 3VRIB 3IDIB 2OR9H 1H5BA 4LOUD 4ZPVA 5C0EB 4G6ML 1YY9D 3BH8A 1QLEL 3O41B 1D5IH 3DSFL 5AYUL 1OAZL 4C56B 4YDLC 4BH8B 5L0QB 1UH4A 4YZFE 5E6IC 5FECA 5LBSL 5I1EL 5L2KD 1G7QB 1LP9E 5EUOB 5D7LD 4H8WH 4KI5C 4LARH 4PJCA 1SHMA 5DJZB 3TT1L 7FABL 1QR1B 3E6FB 4Z0XA 4OCXL 2DD8L 4PJXB 3KLAB 3RGVC 1EGJH 1HWHB 4P4KC 3HR5B 3EGSB 4Y4KB 1IM3A 3C08L 3I6GB 2CRMA 1NGXA 1TZHA 2Z31C 2XICA 4LPTA 2E7LC 3PWJB 3LRHA 5C6PB 25C8L 3FRPG 3LEVH 4FXGB 4CUCA 1G0DA 1J1OH 2ATKB 2EDJA 2WP3O 3MJ7B 1BJ1H 2G60H 4MHHG 5EA0L 2O5YH 1A14L 3UTTB 1CIUA 4U6YA 2QQKH 4NOFA 3NABH 4LEXH 5DMIH 3IXTA 1UJ3C 3OB8A 4KAQL 1V05A 4TVPL 2YSSB 1QFWH 1FYTB 4MA7H 5CZVL 1IQWL 1U6AH 1S7QA 4RBPK 1FNEB 4XBPA 5DEFB 1E4XL 5HGGS 4O9HL 4OZHA 4O2EB 4OQ1A 1WFUA 3QDAA 5JA8B 3LD8C 2OCFD 1VGKB 4WW1B 4JE4B 4NJAL 1A6UL 3T0ED 1I1AB 1G7JA 3A6CH 3MGTA 3MLVH 4KUZL 5FO7B 1ETZA 4QTHA 5C09D 1M6OA 5JOPE 4LL9A 5HTSA 3CNKA 3CH1B 3FO2A 3DXAA 1H8SA 1NFDA 3U7WL 4M02A 2VDPL 1GGCL 1HZHL 3OJDA 3W0WB 5E8EA 4DKEH 3QDJE 2DQUL 1JPFA 2NY3D 5ID1B 4M1GL 5IHZA 2ZPKH 2Z0BA 4NKMB 1KB9J 4PRNB 1RFDH 4MNGE 5I1KL 3HPJA 3EDFA 4NN5C 3L95B 3EOTL 2FJHB 1FV1A 2E8YA 3CDCA 4KV5F 4M5ZH 5HI5C 4LAJH 4GT7A 3ZTNL 3CMOH 2D7NA 3D85D 5DJAA 2H3NA 1MCCA 5FYLD 4L9LA 2Y23A 5HBBA 3T0DA 5JOPD 2F5BH 2VNCA 2XNAA 1G1CA 1OAYL 3QDJD 2P45B 4QXUL 3GBMH 1LQSR 4OLXH 4AG4L 3IU4L 1HILB 1J1PH 5CSGA 4KROD 1CK0H 4XNUL 2YKLL 1I3GH 4I1NB 1FYHB 4YO0B 1C08B 3MYZA 1EXUA 1JNHB 4PRAB 5E2JA 1ZLUH 4O58H 4JHAL 1LO0L 4JREB 2I24N 4HKBA 3SDYL 5ICXB 5EU6A 3LRSA 3QA3A 5KSBF 4M7LL 1QFHA 2BNQB 4HIHB 5A2LH 2HH0H 4X5WA 4WUKH 4J3WA 4AJ0A 3MFGB 1HCVA 4WEMB 2IF7A 1FZMB 1YNTB 3FQXA 1IAOA 4KRPB 5HYJD 5J12C 5I66A 1UWEH 3AM8A 3I75B 4F80A 5CMAA 4H0HB 2V7HA 5BMFL 4TYUA 2ZKHH 5HGAB 2AJYH 4APQC 2W92A 2O26U 2AJUH 1E4XI 2I5YL 5EBMB 1EPFA 3DVNA 2R69L 2B0SH 1FVDB 3TBWB 3CPLA 3KPMB 3ZKSD 4HXBL 4HZAA 5IFHH 4IDLA 3VFUA 4Y4HA 1MFDH 1QYGL 2IADA 5I8OL 4PP1D 1M7IA 3RWDB 3JTTA 2J8HA 3SOBL 5CHNA 5CBAB 2V2WB 3SE9H 1RIUL 5EB9A 2O5XL 1UM5L 5L9DH 4HIXH 1FJ1A 5DHVB 1H3WM 3L7EB 5MENB 3RWIB 2QSVA 3HC0B 1T0PB 2DJUA 4CBPA 2BSSA 4HS6A 5K9JH 3KPSB 3HNTL 4EI6A 4N0CC 4ZSOB 1LK2B 3RY5A 3X3GL 1RZ8A 4YHOH 2YD6A 3F5WA 2VXUL 2Z35A 3L5XH 1BOGA 1UWGH 4A6YL 5CGTA 2JJWA 4TTDD 3RNKA 3IB4A 4F7MB 1TCRA 2BSED 4K7PX 4MZ2A 3B5HA 4IMLB 4NZTL 4UT6H 5TDPB 5C7XL 3C5ZA 4PJCF 1J0KA 1UQSA 4OBRA 5IW1B 3MRRA 3MLTB 3IXAB 4P48A 2F9BT 4PGBB 3OAZH 4HQQH 1DQML 1DZBA 5FHAL 2HP4A 3AMKA 5TQ0H 4MDIA 3T3MF 3WBDA 3SBWA 3DX9B 1CE1L 3B9EA 1TNNA 4GAFB 4PG9B 2HWZL 4LPUA 2CKBA 4ODTH 5IM7B 3WIIL 2D31A 5BW7A 5IMOA 5J0BA 4N0FA 2OLDA 2VISA 2ADIB 4ODWA 3U46B 4H5SB 5KBNC 4AIZA 2Z92B 4XPAL 3GJEA 1FFNB 3EYVB 1HHHA 2YA0A 5DMKB 2RR3A 4X8XA 3UYOD 4GFTB 3O6FB 1HYSC 3QWOB 4Z8FL 5DEGA 1N6VA 2HT2C 4I77H 5JZ7C 4PRPA 3PWVA 3EIFA 4OZHF 3I6KA 5E6ZA 3TFKC 5JXED 2EDHA 2D4DA 1HHJA 2NY0D 5JHDE 2HFTA 3OF6D 4RFOL 2B4CH 1N59B 3FJTA 3VG9C 2EH8L 1PD6A 4M00A 4NBYB 4PJEB 5ERWA 5T3ZH 4O2FB 3DURB 4TSAL 1NGZA 5D7IE 3O6ML 2ZUXA 5H37H 2V9QA 1MRCH 3ETBF 1XF4B 3JV6A 2BVPB 2PTTB 5I8EB 1YEHL 3LN4A 4NN6B 3RIAF 32C2A 2FB4L 3DMMA 2V17H 4I0PC 2H2SD 4OFYD 5E8DH 5GGRY 3B6SB 5SX4H 5HYFA 3VXOA 5IP4A 2ED8A 4LVNB 1WBYB 3UC0L 1WBZB 1NKRA 4D9RE 3KPLB 1IAII 3ZDXF 5I1GL 1IC7L 1A7QL 5GSVB 3ZZ1A 3MLWL 3P9LB 1W8NA 4EN3A 2H8PA 1A6WL 1OW0C 3N85H 1A3RH 4X6DB 5C9JA 4RAVA 1MH5A 1P6AB 4Z7UB 5HHMD 5DK0A 4ORZC 1KYOK 4WU5A 4GO6B 3DO7A 4NFCA 1TCMA 3SDCD 5I17B 4WJ5A 3EFFB 4RGOH 4LQFH 3PDGA 4UZGA 3FT2B 4MQXD 4JZJA 1ED3B 4JY5L 1VERA 5I0DA 2IAMC 3RVUD 3MNWA 3B2UC 5E9DD 4HUXA 2EDQA 5ISZA 3HG1A 1CE6A 3VFRB 4DVBA 5LWYH 1R5VA 1YYMH 3FRPA 3P4NB 4L1HA 5E08H 1BD2A 4AT6A 1JP5A 5DK2B 5IMLB 4FFWC 5EO1B 2QSCH 3P73A 1G6RH 2R23A 3ZYJA 4NBZB 4R26L 5C08D 1YN6A 5J4MA 2EYRA 1OTTD 1CTNA 4K3DH 5BXFA 2X4PB 5C0BE 1OPGH 5FM5M 3RAJL 1JV5A 4F7EA 4ZQKB 1T1YA 3VRJA 3TBYA 3ARDB 4DK6A 4MXWL 3DV6B 2HRLA 5CS7A 3B2VH 3OL2A 3CVHH 2DKSA 2R8SH 2BRQA 2GUOA 3KLHD 1KGCE 1SVZA 4H88L 2JB5H 4OF8A 2DQEH 3WNKA 3QIWC 1S9YB 5FV1L 2VIRB 1U3HA 4X5LA 3OHXB 3VFOA 1GPOL 1BJMA 2AABL 4RRPG 1UXWA 4FTVE 3VGFA 2HFEA 3OGCB 2QQNL 3OKKA 5TF1L 1JCKA 4D9LL 3MV8B 3FO9A 4KY1H 1H5BC 1HIML 4K23L 3D3VB 1WITA 2A1WH 5K9OA 4K9EC 1NSNL 4C83A 1KLGB 4M43L 1T3FB 3AU1A 2NTFA 3H9SB 3VWJA 3F7RA 1KGCD 1MIMH 2EDBA 3BN9D 3DUUB 5T33H 1GVIA 3I9GH 4ZXBD 1BREA 3OZ9H 5KTEH 5FYKD 3GO1H 4TULH 4M7JH 1YECL 4KJWD 5DD1H 4K7FA 4ODUA 4LDLB 1WWWX 3BDYL 4BH7A 1MI5B 3LH2H 1FVEA 4PLKC 1S7XA 3D87B 4GBXD 4TOYH 2A83B 3HKFA 3U2SA 5K9QI 3HMWH 2OXHA 3IGAA 4JRYD 4EI5C 1I8LA 1CDUA 1L6XA 4ZFZA 3NH7H 1F02I 2EIZB 4I5BA 3CUPB 4JRXD 1JGUL 4CDHA 4R7NB 1PZUB 3IVKA 3CMGA 4EDWL 4F58L 3WUZA 3EYUL 1ZT4B 4HX1B 3ARFA 5HHOE 3E3QC 5IB4B 5DFVD 3PHQA 4U1GB 1SBSL 4U6TA 4Q9BA 5GS2D 4H20L 1I7ZB 1DQQB 1S7VB 2OBGA 2R39A 3VXSE 2D0HA 1F3JB 3HZMB 5GGSY 4G8GA 4PYGA 5D1QD 5EBWB 2EIEA 3RU8L 2Z93B 3KHOA 5SV4A 1OM3L 3S88L 3MA9L 4M93C 4YNYB 5EZJB 1NCTA 5HPOA 5E0QA 4Z95H 3X14B 3C2AH 1XH3A 3HLAA 1TVHA 2NW2A 3NZ8B 1DTUA 3QR2A 1YNLH 3T4AB 1KJVB 1IQDA 5KSAB 4ZOEA 4PLJC 5TPWH 2NCMA 2NY5H 3CU1A 5EU6D 1S7SA 3QB7C 3KPRA 3SCMB 3ARED 3UTPE 2QEJA 1UVQA 4JQIH 1N5YL 4OB5H 1FFQA 2F8XC 4OI9A 2WLYA 4PGEB 4MNQB 1U91A 5D1XA 4NO0A 3QCVH 3UAJC 2CXGA 1T22B 2RJMA 4O51B 1JHLH 3W11C 1W0VA 3FTGB 5SX5H 1B88A 2VAJA 1DN2A 4HCRH 1M05B 4OV5B 5T1LA 5D2NA 3QDME 4L9LC 2W60A 4JQVA 3HI6L 4S10A 1U8OB 3MRQA 1WK0A 1Z2KA 1KLUB 1N7MH 3WJJC 4NRXA 2BSRB 3KYKL 3V5HB 1U42A 5FDWB 1ROWA 1EIBA 4LSPL 4NNYA 3TA3D 4I48A 4YGAB 2FJFB 4XP6L 3QXDB 2ZCKH 2YXFA 1E4KC 3OXSB 1KPUA 1T66C 1DSFH 1JE6A 3T09A 4KHXL 5F96L 2JJSC 4LVHB 1IC4L 2ZJSL 5DLML 2FD6H 4JLRA 3HPLB 4ZS7L 5E56A 2IANE 2JIXD 5C0DB 3KJ6L 1BBJB 1BFOB 1UGNA 1XR9B 4NPYA 3FFCE 4OCYL 5HDLA 2QQQA 2VSCA 1JN6B 4GMTH 5TH2B 3C5ZD 3WKML 4F7CB 1A6TB 3DVGB 4E42B 4PGCA 1QACA 4LNVA 4KVCL 3AM8C 5EO0B 4TNWF 4V1DB 3LQZA 3O2VL 3THML 1OCWH 3RWJA 4E41D 1UA6L 4QF1A 4OLYL 4LCWD 4LHQB 4MD0A 1Q0YH 3MRBB 4WTXA 2Q86B 4IIQB 4Y4HC 3MLZH 3GMRA 4DWHA 3ES6A 5CZKA 5H37G 1R3JB 4XCFH 1MCBA 4J4PA 4P46B 1SQ2N 2WBJB 3CSPA 2R2BB 4WI3A 1IGYA 2W9EL 3HZVA 4PJBE 4DFHA 3O2WL 5INCB 1OB1B 1YYLH 4AEHH 5CJQL 3MCKB 4OM0H 2VMFA 4YXKL 5IOPB 2R1WB 5DJDB 3V5KB 1J05B 2JCCF 3NCEB 5TGBA 3GBLA 2F8VA 1ACYL 4NUGL 2XWTB 1J87A 1MHEA 3GBNL 1I7TA 2NY2D 2DQDL 2VLKB 1ZVYA 4JM2B 4UBDD 5C0CD 1TZGL 1KJMA 5DJXB 3RUGB 3LHPL 3OR7B 2B2XH 1OAKH 2OP4H 2JB6A 2OZ4L 1JGVH 4HKZA 4KMTH 5FA3A 4GG6B 1DLHB 3CLFH 3OQ3B 5C9KA 1PZ5A 5I1CL 1A1NB 3SKUD 5KVEL 5ACZB 1OGTA 1BVKB 4KXZI 4P5MA 4WI5A 3GHBH 4JKPL 1XCTA 3T2NL 4RWHA 4U0RC 1IC5L 3GSRA 4JFHE 4QNPF 3TESA 2AVGA 1A64A 3MRNB 1A6ZB 4Y16B 4TN9A 4U1NA 4PB0L 1P4BL 3QXAA 5DUPH 3SKOA 4XAWL 1EGJA 1LNUA 3MLSL 5IB2B 4XCYA 3ILQC 1MFAH 1XFPA 1XGYL 5BW7C 4GKZB 2ZUYA 4X99A 4QRUB 1FGVL 4RAUB 2ILLA 2NXYB 1DJSA 1T7WA 2P43B 1H8OA 1CR9H 1XF1A 2DQTH 1AP2A 5IK3B 1MLBA 4KDWA 2PO6A 4PRIE 1VACB 2VLJA 1MY7A 1CFNA 4L8SA 4FFYH 4FMFA 5F21B 4HS8H 3AXLA 4S1RL 5TFSH 1JIBA 3RL2B 1S8DA 4WDIA 3WLBA 4P49A 4GQ9H 2WLZA 4JZOA 2ADFH 1NCBL 1ZHBB 1BFSA 1YC8A 1CG9A 2X4UA 5DSCB 2R1XB 5I15L 3RIFK 1AGDB 1JWUB 5EWIH 3MA7B 3STLB 4XPTH 2A6JA 1UM4H 1BX2B 1VHPA 3HE7C 3QUMB 2CK2A 4M1CC 1AY1L 1BD2D 1MCLA 3M17B 5D71L 5BOZG 3HUJE 4OCNC 3BIBX 3W9EA 3DMMC 3MGOB 4ONFL 1WIOA 3MV9B 4XC3L 4MS8D 5HYSA 1ZSDB 1HYRC 2QADC 3GRWH 4RRPA 4JKMA 4U49A 5E7BA 3FCTB 1OY3B 1XGQB 5I1HL 1DUYA 1BVLA 4NN7C 1P4LA 4EN3C 1UB6B 4HFWB 5ITFB 5D7KD 5EU7C 3UYRL 5KANI 3HC3L 2N4IA 5AZ2L 4C56E 1R3KA 3VGBA 3L5WA 1EH9A 1LP9A 2IPKB 1S5IH 5GZOD 5KG9A 6FABL 4GKSB 5GISL 4F57L 2F54A 3G6AA 1ZVHA 1KPRA 5CLTA 5ELIA 2ICWB 2FBJL 2Q76A 1TFHA 1CGYA 1GOFA 4XMKH 4NQEB 4JZJC 3BE1L 3C60B 1KG0A 3OTTA 4PYHA 4HAFA 1FNFA 3ROLA 1TVBA 3B8YA 4OFPA 3W2DH 3BUYB 4WI8A 5IVXE 4M61A 4XVTH 4EOWL 2DMKA 1GC1C 2ZUUA 4UTBL 4KRNA 5FYJE 4C56D 2DI9A 2YWYA 4I2XB 3VWJD 5HHNB 3C09C 1HXMA 2R0KL 3EOAB 1AHWA 5KAQG 3K8KA 4R90L 5F1NB 4XRCB 3LKSA 1J8KA 4NWTL 4U1HA 3SJVB 2H9GB 3HCVA 4P4RB 1OARL 3V0WH 3WHE0 3NPZB 4PGJA 1FYTE 1NL0H 3FN3A 1NJ9A 5GRVL 3E6HA 1KTDB 2KH2B 4Y4KD 2HVJA 1KNOB 3ARGB 4MYWB 3BD4A 2HTKD 4YFDB 4N8VB 1JZ5A 2EIBA 5EORH 1C1EH 1GC1L 4O2CA 4FQLH 3BQUA 4L1DA 3IKCB 4POYA 2X4SB 5D93C 3UTTD 1U3HC 1GXEA 3BW9A 3VH8B 3JWOH 4HK3N 5B22A 3W0WE 3QUYA 4P9MH 3WLWD 1QSVA 5F9JA 3IETA 4XCCH 4MNGA 4KZEL 4G8GD 4E0RA 5HHVH 4EVNA 2V5SA 3ZKQD 3UTQA 4BFIB 4C55A 3ECBB 3L6FA 4PJ9C 3U0WL 3VFVB 1AD0B 3CFJA 1I1AD 1IC1A 1IAMA 1MCEA 3U83A 2YRZA 3LKQA 1T5WA 5E1AA 1YEIL 4O00A 1FRGL 1HH9A 3KPRD 1UYWL 2QKIB 3QFJB 3VI3E 3W0WD 4FFVD 4RQQA 3S35H 5F89A 1ZA6B 4WV1A 3DPBA 1A7OL 5DXWA 4W6WB 5ALBH 4G5ZL 3N50A 4N5EC 2BY1A 2R4RL 2BNUA 1QVOA 1CIDA 5GRUL 4B50A 1JGDA 1I8LC 5B39G 4S1QH 3QCUH 1RURL 1FVCA 3UJTH 4YHNB 4ZFOA 3ARQA 5DUBB 3W9DA 2HTLC 1S3KL 2VSDA 5IIEB 1NGYA 2OQJB 5C0AE 3F12B 1NEUA 3OKMA 1FG2B 5LGHL 2BNQE 3MR9A 1HXYA 5DRWA 2HRPL 2NX5B 2F15A 1G1YA 3SDXE 4RA0C 3D2UB 3X12B 2DOCA 4CADB 2XQYG 3SDDC 3U30C 3TO2B 3LZFL 3TN0A 5CD5D 1KFAL 5D1ZA 1RZFL 2XZQH 3RTQB 3EYSH 4JY4A 1RQ5A 1AR1C 3GMPA 3WNMA 5DRXA 1GOHA 5HY9A 5T3XE 4Z77B 1E27B 1QRKA 1ZTXL 2AXJA 2YS4A 2NXZB 4P2QA 3BKJH 1N3NB 3QAZB 3HE6A 2PKDA 3L3OA 1OWWA 1NAMB 4PRHA 2D9CA 3SKJH 4JDZB 1ZHKB 1NC4B 2IFGA 5D1XC 4TUOA 1AIFA 2EO9A 2PXYB 4PBVC 1K6QL 1C16A 1QSFB 2Y6SC 1VENA 2CLRA 4GMSH 4EXKA 1AGBB 1EEYB 4ERSH 2A6DB 5GJTH 3VD5A 5GJSL 1UCTA 4ZSOE 4JQVC 5IBUB 3ET9F 2Y36L 3PG2A 3PIQB 3WYRA 1SEBA 1AXTH 3P0YL 5KN5B 2UUDK 4O02L 4FG6D 4GAJL 5FIEA 1MCHA 1L0XA 5GGVH 3TWCH 5ADOH 1ODAA 1LP9F 3CFCH 3GMQB 1UG9A 4MA3A 3LY6A 4M8VA 2I9LA 2H32B 2CSPA 3VFTB 1LO3L 4RAHA 4PJ5B 4PREB 1ZGLP 5MEND 4JFPB 1IGJB 2HJLA 2QR0A 3QUXC 3KPSD 2COQA 2VDLH 3T1FA 1ES0B 1H15B 5AUMA 3V52L 1JGLH 2E27H 3KPPA 2APFA 1YMMB 1M4KA 1QLRB 1K3IA 3G6DL 1N2RA 3W5NA 3H9YA 3CX2A 5JW5A 4WWKA 3HRZB 1JPTL 5JORA 4MJ6B 3HR6A 4DZBB 4NQXA 1YPZA 4D2NA 5IR1A 1KN4L 4WTWA 3QFDA 5CJOL 1ORSA 2DIBA 5L7XH 1F90L 4XPBH 5AZEL 3WFCL 1CICB 2BNRE 4X0KA 2FCBA 5JR1L 1HCFX 1HN1A 1C5CH 1UH3A 4XMPH 1Q0XH 3GMOB 1U95A 4LLQB 1LO2L 5T3XH 1JK8B 5IW6B 2WP3T 3QH3A 4NHCL 5I1IL 1I3RA 2OJZH 3U7AA 4RMTA 3IDGA 3FONA 3CVHA 3HC4L 4J4PC 3CXHJ 5IBTL 3UEZA 5D7IA 2GSIA 5BV7B 1B4RA 4MB5A 2R1YB 3MMEB 4IDJL 1PYWA 1N4XL 5EOQH 4M7ZB 4JAMA 1QFPA 1XGRB 1V5JA 3PABA 1KB5H 3CVIH 2DQGH 2BDNH 3O6LH 3PQYB 5ID0B 1U8QA 1BEYH 1HQ4A 4ONGL 4Z7VE 3VA2C 4LASH 5HI3C 5I1LB 2YEZB 1XZ0B 3PGCB 4X6EB 1KACB 3D48R 2VDML 3QUZA 3S34H 5E24E 4KH2A 3NN8A 4UU9B 5K9KB 1YEJH 4XBGA 4YLQT 4U31A 4PY7B 5FOBB 1EEZA 4HJ0C 5LKNA 1CTOA 5M94B 1WEJH 4H8WC 3P11H 1MNUL 1HINH 3PV7A 2IFFL 3QIUA 1YEEL 1AKJA 3GGWB 4Z7UE 4LSSL 4DN3L 5DD3H 3KXFB 1XF3B 1I9EA 2ERJB 2DRUA 1AXSB 1Q72H 2ARJB 1B4JL 2X40A 5FUCC 1ND0B 2ITCA 1EHNA 4TUJB 4CDGC 1NBZB 3MODL 4MDJA 3MNVA 4XTRD 3PJSA 4V2BA 5E2UH 5MI0B 2GEEA 4DTGL 2WUBL 3RZWA 4XP4L 4QKXB 4P5KB 2BOCB 4OZIB 2J6EH 2PO6C 3QNZB 3MLYL 4YDKH 1QR4A 2F54D 3BJLA 2EC8A 2JELL 4PJIA 4F9LA 3FMGH 3PDOA 4R9HA 1RY7B 2QSQA 3I50H 4LLWB 1W2KT 4PRBB 1YY9C 3RHWF 4GAYA 5JNYB 3QEHB 3PGDA 5ETUB 4NC1C 5LCVL 1QHOA 2DM3A 5SWSB 4RFNB 5ESQB 4K07A 3NFPB 4N1HB 3REVB 2ZUWA 1F4XH 4P57B 2FJGA 5EPMB 3RWHB 4CVXA 4G8EB 4LF3A 1DBJL 4GLRI 5L88H 4ALAL 1T03L 3QI9A 4HIJA 1MFBH 2CIKB 5SWQA 4FTVA 4R0LA 5TDOA 3V0VB 3K4DA 5CEZL 3KPQA 5J1TC 3SE8L 4BSJA 1CVRA 4MVBC 3KYMA 4Q9QL 1FQ9C 4HCRA 3D3VE 4NZRH 2Y25A 2CGRL 3PL6A 3QHFL 4OF7A 5DHYA 3WXWL 1ZLSH 5I9QB 4J8RB 4KMQA 5EO9A 1FZJA 3D69B 2VJXA 4D0CB 1P7HL 1C5BH 4XT1C 1NBYA 5KSUA 3U1SL 5L6YL 4I3SH 1MIEH 2XOTA 4YDJA 1GJIA 1D9KB 2NMSA 4K94C 3MRGB 3UBXI 3QUYD 1LEIB 3PF2A 3MV8D 1BECA 5FO9B 2F5AL 3QO1B 2CIIA 1INEH 3GIVA 4I9WE 4ORGB 5F7LB 2CRIA 4R96B 2IQAA 3GM0A 2ENSA 3VXNB 3MX0A 4GG8B 4XB7A 3H9SD 4HWBH 1OTSC 5AD0B 3RVWC 4XHJC 4DQOH 3UROR 5A40E 4NZJA 2P24A 1U93B 5C0JA 5HHOA 5DS8A 1A4JA 2EC9T 2PYEB 3IRPX 2H2PC 3BPLB 1DQDL 4ZYKA 1MI5D 2YPVL 4K94L 5EZOL 1BF2A 1E28A 4JGUA 5C07B 3I6LE 2F58L 1JRHL 1FH5L 4WI4A 2UZXB 4HBQA 3MQIA 2A6IB 1R5WB 2FSEB 3V9FA 4JM4H 3HHRB 5MHSD 4L29B 2AV7A 1F4WH 4MD4B 1S9VB 4YBQC 4JHWH 4PS4H 3NPSC 5D7IF 3KHQA 5D70L 1B0GA 3O9WA 1TLKA 2ITDA 4WY7H 1C8PA 4X4YB 4FZEL 5ICYA 2CJUH 1EERB 1EEQA 4PJHB 4WFGD 5I19L 1CYGA 5BVPH 3L3GA 3MV7E 4OZGE 5H2BA 5TE7H 5CJXA 3S35X 5DQ9A 2YUZA 1QFWI 4D8PA 5I16B 4W81A 4HPYL 4KZDH 5D1ZD 3JUZA 4KTYA 1RZGA 4XXDA 4JO3L 4FQJH 3BP4A 3X11B 1KT2A 4U4BA 5IEHA 1QSEA 3QDMA 12E8L 3QIBA 3UDWC 5CUSL 5FYKU 3TNNA 2ZUTA 4U1SB 5KSAD 3SGKA 5IFJA 4D0DA 3D9AL 4P2QD 3MRLB 3SCMD 5T3ZD 4LSRL 5IGXH 1GGTA 3HTLX 1MF2H 2WUCH 2AJVL 1CDBA 3JV5A 4PRHD 1MPAL 3EO9L 4G42B 1DL7L 2CLVB 4MNQD 4WV1C 3MJ9A 3WFBH 1PJ9A 2J8OA 5EU3B 2ZG1A 3GNMH 2IPUG 5GGUA 2AEPH 5A3IC 2XWBB 5EUKA 5SWZA 3HAEB 3MYJA 2IANA 1M71A 5CSZA 4RNRA 1AC0A 1HHKA 1WJ3A 5I73B 5GXBB 2W0LA 5FOJA 3WD5H 4Q6YA 3L1OL 2NZ9C 3FFCA 5GGQH 2EXYD 1I85A 3V6FB 1VCAA 3QWQB 2IGFL 4JB9H 4M7LT 1M7DA 4F15B 4HT1L 3VFNA 3TVMA 3UJJL 5FO8B 3DARA 3TN0C 4HF5L 4L4TA 3RY4A 1Z9MA 4X7FC 3EHBC 3Q6FA 5E94A 3O0RH 4MJ5A 5I18H 1TQCC 3MCLL 5BRZA 3WE6A 1RIVL 1G7HA 1X3DA 1JRHI 5IWLA 2NY7H 3NTCL 5FV2A 4JFZH 4K2UL 4UINL 2M26A 4NYLB 3REWB 5IMMA 2IH1B 1K4DB 2ZOKB 1MCDA 1CZ8L 5DJ2A 5J6GA 1G7IB 4LSDA 3VRLE 3HE6C 3KPNA 1WTGT 3NCCB 5CZXD 4IRSB 2XRAL 1SBBA 1S7TA 2VLLB 4LKXB 3VFGL 1I9RL 5JXAH 4R7DB 1OAQH 1IVLA 4PJBA 4WU7A 4RISH 4G7VH 2P1YA 4GOSA 4LSVH 3OG4B 4ZS6D 1INDH 3B9AA 1H3GA 4G6KH 1NBVH 1S5HA 3IJSA 4V1DD 1NH6A 1QLFA 3GRWA 3GSOB 2E5EA 3JWDC 5FUZH 4PV8B 2X1QA 5H35B 5INDA 4D0BA 3LAFA 1SJHB 1FL3B 2NY4D 4NRYB 4RX4A 2VLKE 5DA0B 3OJ2C 3S36L 4J3TA 3L3IA 1KIUA 3C5JB 1D6VH 4U1LA 2VE6B 1DFBH 4GG6E 1KC5H 4AENA 4P46D 3VWKD 2HT4C 3QHZL 3WEXB 1P1ZA 2XTJE 4R4BB 4AH2B 2VR5A 3RX5A 3W81A 4ZD3H 3RDTB 4LU5L 4BJLA 3O3EA 1MFNA 1TZIB 1IGFH 1U2HA 1TETL 2IC2A 4K3JL 2MPAL 5J89A 4Y8DC 4Y1AE 2XIDA 2EDXA 1FC2D 3F7YB 3HAEG 4MMZC 3S5LB 3VXMA 2ATPB 3JWDL 5HGBB 2EE9A 2VLKD 4JM2D 1DANU 4X4XB 3BZEB 2NQCA 1ZT1B 3TCXA 3V0AC 4AQ1B 4XVSH 3MLRH 3MRPB 2XTLA 4L8CB 2JJTC 3ALWA 4MXQC 5J57B 1BHGA 4HWZA 4AEIL 5J1AB 2J88L 2JK5A 1KIQB 4NOBA 4JG0H 5EC2A 1OF2A 4ODVH 4BFEA 1IM9B 4PRIA 1KEGH 3AAZB 2BY2A 1XGUB 3RWFA 5T5NG 4Y16D 4ISVA 4AY0A 3O3BA 4YIQB 2QL1A 3SQOH 3TF7C 4N8CH 3DBXA 4BK5A 4OLWH 1U92B 4MAYB 1F6AA 2F19H 1V7NL 3JTSB 3AS3A 2VR4A 3VG0H 5DJ6A 3DUSA 1FE8L 4Q9RH 4JJ5A 5DI8A 4GSDL 1NUGA 4LPWA 3PWNA 2VL5A 3WHXA 1XCQB 1GIGL 3MRDA 4N8PA 2VXSL 1SEQL 3MRFB 3MREB 5DC9B 3HUJA 3T1WA 4OKDA 2W0KA 3TBVB 3BP5B 2OSLA 4YPGB 4OCWH 3SEPA 2YPLA 1JHKL 4JHBA 3MV9E 1NGQH 2AJZA 5LAXA 2V5MA 1SYSB 2A6KB 1CS6A 4R4NC 2Q8AH 3QUZC 1IAKA 2FR4B 1U8JB 4YC2C 1JZ4A 4HXAL 4MWFB 1K3ZA 1MAKA 5TF0A 3RP1A 3GHEH 1J8HB 1B9ZA 2XZCL 3VXUE 3GMNA 5DR5L 3VGGA 1OLLA 5T1MB 1OP9A 3HZYA 5DWUL 4WTZA 8CGTA 1G7PA 1HDMB 1OHQA 1A6VL 3IFLH 3OG6B 1F3RB 1MJ7L 2CD0A 1CXEA 3LS4H 3G9VA 1N8ZB 4P5TD 1RK1A 2QHLA 2IPTH 4L9DA 5IVXA 2BY0A 1T1XB 1FFOA 4K3EL 3MROA 2M1KA 4HAGA 1FL5B 1QBLL 2FATH 4OIIL 4F7TA 4XPFL 1A4KB 4Z0BH 4KKBC 5F7EL 2NW3B 1KJ2L 2GK0A 4K55A 4F9LC 1A6AB 3SKMB 4NQED 3ZKNC 4TUKL 1F13A 3U82B 1FYTA 3I02B 5EN2A 3LKNB 4QT5A 2ZUQC 1FNEA 3CK0H 2DIJA 2HN7A 1I3UA 4YHIA 3L7FB 2R29L 1IGCL 5J9PA 1BFVL 1D5MA 1FAIH 4TVPE 1JNLL 4ODXB 3C2SA 2DIAA 3EJYD 4LCYB 4PJBF 5BO1H 3T4YB 3QI9C 2GSGB 4R0LC 3CFKB 1A3QA 3CD4A 4NQDB 3SJVD 5M7QA 1IKFH 4U6XA 4PRNA 1RUML 1IZKA 4P2OB 5DRNA 4P2YA 2MCPL 3GIZL 3OKLB 3ARGD 4UIMB 4HUVB 1SM3H 1T21A 3WUWA 2ICES 4BZ1H 3VW3L 1S9XA 5JPNB 1OSZB 4TNVK 3RVXC 4P23A 4HPOH 3RVTD 5MEPA 1IEAB 4O4YL 4LLMB 3UTSB 3WN5C 4RGMB 5FYKL 1I8KB 2C3HA 3O9WD 1AI1L 5F7YC 5D7JA 4HMEA 3I2CL 4CVUA 4G6MH 2ICCA 5I74B 3QFJE 1U3ZA 3CX5K 3MRJA 1X5ZA 3RL1B 4ZUSA 1QLEH 2G5BA 1B90A 5F7KC 3FOLA 5AYUH 1OAZH 5J11C 1I8IA 1TPXC 2W65A 4JR9L 1KCRL 4M4PA 5CJ5A 4FQHB 5LBSH 3OGOE 4EXPX 5I1EH 5IBLD 5IG7A 3KNBA 2VQ1A 3VGEA 3WO3B 3QQ9C 4PRAA 1QSED 1NPUA 1TQBC 2P5EB 3EOBB 7FABH 5ICXA 5C0AA 3GSNL 4OCXH 5HYQB 3GB7B 3PE9A 2OR8A 2BNQA 2DD8H 3SKNA 2X4OA 3Q3GB 2VXVH 3QFJD 3SDXA 3MXVL 2OS7A 3C08H 1FZMA 4LLYA 4OAWB 4HJGB 3DX8B 4Z78B 25C8H 3PV6A 1JWMB 2AK4E 5FYJU 1BIIB 2FX8L 5EA0H 2AJSL 4BUGA 3JZ7A 5SWZD 5IUSA 1K5NA 2A9ML 3DYMA 4KAQH 1I1FB 1NCAL 4ZO9A 4Z7WB 2F53E 4AMKL 2X41A 2R2HA 5FA4A 1AGEA 3JV4A 4G6FB 1SJXA 1V7ML 2BMKB 5KS9B 3HUJF 5CZVH 1IQWH 3F7QA 4JFOB 1E4XH 1JZ2A 4O9HH 1QBML 1ONQB 2NX5D 4UI2A 4CGTA 5DUML 3D2UD 3K8LA 4QXTB 3O4OB 5CBAA 4U3HA 5CJXC 3C8KA 1ZHLB 4ZAKD 4NJAH 1A6UH 3IDYB 1IGML 5KSVA 3TNMB 1KB5A 1QSFE 3QG6A 3V6OA 5BRZD 4KUZH 1A1MA 1DDHB 4FXKB 3G08B 2BSTA 3FT3B 3QIBC 3UPAA 2HMIC 1GZPA 3U7WH 5HHPB 2VDPH 4LDEB 1GGCH 1HZHH 4LGPB 2OYPA 5CP7B 2DQUH 3EYQD 2AW2A 4FQXB 4G9DA 3FB5B 4TPRL 4M1GH 4RGND 1AC6A 4CU7A 3A6BL 1FGNL 5I1KH 3UZVB 3LPGA 3EOTH 5EIIB 1NC4D 5I2IA 3KYOA 2PXYD 3ZTNH 2XACC 1T1WB 4KJPC 4QRSA 4PGBA 2GITB 4PJ5E 5ESAB 2UUDH 1P84J 1MWAL 4X98A 3RWGB 1VADA 1CT8A 5IVXF 4N5UA 1OAYH 4CMMB 3BVNB 4DAGL 1T2QL 4JFFE 5IM7A 1YMME 4QXUH 4YDIL 5CD3B 2OI9B 1ZK9A 1I85C 3IU4H 1KJ3L 2J6EA 3K0WA 3TVMC 2YKLH 1I4FA 2KKQA 2OK0L 3ZYZA 1EHXA 5IQ9A 1AQDA 2ENYA 4BSWB 3ARTA 1IILE 1AFVL 5DMKA 2BNRA 3MJ9L 3GDBA 3QNXA 4JHAH 1LO0H 4PJ5D 5DVLA 3SDYH 5IWLC 4EEEA 3GSQB 5C0ND 4LSUL 1OP3K 4M7LH 4HUWA 4CVZB 5EFIB 5DJCA 3LKRA 1Z5LA 4PJDA 2BOBB 5IVZB 1LVEA 4XCNB 1QO3A 1YMMD 5KW9L 2ZCHL 2FHBA 4EUPB 4KKCD 4OLVL 2NLJA 2L0DA 2DMCA 1FNSL 1KCUL 3RZCA 2HJKB 3MACL 4HG4J 3NACL 5TE6L 4LCUB 4HV8B 5BMFH 4Y88A 2UYLA 1N6UA 3BPCA 4XPGL 3GFUA 1BZ7B 3CX5J 2VN4A 1TXKA 2I5YH 5I8EA 2W0FA 2R69H 4YBLB 2CLZA 1NMCB 4HXBH 3AUVA 2ADGA 1QYGH 5B38G 4GW5A 5HI4C 4YUEL 4Z7VA 3PQYE 5I8OH 4N68A 5GGTL 1S9WA 2GKIA 3SOBH 1X4ZA 3G04A 5D5MA 1V8HA 4GRLB 2NY1B 5GSVA 1RIUH 2O5XH 3MFFA 1U9KA 1UM5H 2GJ6D 3P9LA 3WFHA 3VFSB 4CN6A 1MCJA 5C86A 1E6OL 5JTWA 1AGFB 1HH6B 3SO3C 4XCEB 3VI3F 5J13B 5BS0B 3ARBA 4WHTA 4MCYB 1ULVA 3HNTH 4HGWB 4HKJB 4HUUB 3X3GH 2C7UB 2VXUH 1T7XA 4NT6A 3V79C 3KXFE 4DEPC 4A6YH 4JFXB 4KK5C 3O4LB 2YPLD 3LKOB 4IOIB 3PQYD 4NZTH 2LTQC 4QLRA 3FOMB 4AL8L 4E5XB 5C7XH 1BGXL 1UB5A 1V3MA 1RVFL 1LO5A 2YD5A 1DVFA 3CFDA 2ZCLL 4HWBA 1UKTA 5D4QA 1NDMA 2AK1L 4XNYL 1DQMH 2HFFA 3MO1A 3SDXF 4M9PA 4OZIE 4XPHL 1VFMA 3WNLA 1CE1H 3MSPA 2HWZH 5EO1A 1FO0B 1AE6L 1E4JA 1C12B 2EE6A 4PV9B 5GS1B 4Y5XA 1A9EB 1WFTA 5I71C 1MJJA 3D0LB 3RKDD 5C6WH 1RK0A 2J5LC 4JO1L 4XZUB 3AGVA 4XPAH 5E6IB 4KK6D 5HVHB 1I7UB 1R3HB 2OL3L 4NO2A 5C2UB 4Z8FH 4Y4FA 1FZOB 2C9AA 2QBWA 5T1KB 1FHGA 3WIFA 2XN9A 1BZ9A 3FRUB 3O11B 3WFDL 2W59A 1HKFA 3IDJB 4MNHB 2AJXL 1DP0A 3JWOC 5ANMA 3BEWA 3DIFA 5JOFB 2YC1A 3N9GL 1NC2B 3F8UB 3RGVB 4RFOH 1C5DA 2CRYA 2EH8H 1S7UA 1N26A 4G9FA 1QQDB 3BIKB 3LSOB 1W72B 4TSAH 4LAQL 3O6MH 2WWMD 2R0LL 1YEDB 5F7WC 5BCAA 3WNNA 3KGRA 5FKPA 2HLAA 1YEHH 5SWSD 5GS0C 4QHNB 4GW4A 5KVGL 5I1DA 4IRJB 3ARVA 5L0QC 4AYFA 2FB4H 3QZWG 1Q9KB 1RUKL 3DROA 4YGVA 3UC0H 1FZKA 5FGBC 5I1GH 4EKXA 1IC7H 1A7QH 4LVOB 1EMTL 4X6BA 3MLWH 3QEUA 1A6WH 1HNGA 4Y4KC 3ULUD 4JFQA 2HTKC 2A83A 4CNIB 1BQSA 5GGRB 4LFHG 3U6RB 3QG7L 4JANA 5GS0L 3U36B 4N90D 3B9VA 1F3DJ 2ICEA 4HH9B 4Y5VA 4O5LL 4HX1A 2J2ZA 3QCTL 2HKHL 5F71A 1OP5K 4JY5H 4Y89A 1D9KD 4PGDB 2PYEE 2C1OA 3R0MA 2NYYD 5E5RB 5K93A 1HNFA 1HSBB 5DHXB 3Q0HA 2EYTB 2Z93A 2QQLH 1NGWB 3BP7A 3IF1A 4P3WA 5FYJL 1KN2L 1RI8A 1TJHL 2VRAA 4LBEA 1JGEA 4R26H 4BM7A 1KCSL 2DS4A 5CJBA 4UILL 3QEQA 3HI5L 2RFXB 3MV11 2UWEB 5DTFA 3RAJH 1TVDA 5GZNC 3DOSA 3CAFA 4PJHE 3T8XA 3MV7A 4OZGA 4MXWH 5C07D 4XNMA 2OTWA 1BF8A 3MNZA 4Z7VF 1T22A 4O51A 1VKXA 2EDFA 2FH8A 4H88H 5C09B 3BEVB 4MB3A 1H3UA 3VFPB 1MCRA 4OZ4A 4PTTB 4WUUE 3MRMB 1CXIA 1ZGLM 3H7BA 4P23C 2FGWL 1PG7L 1GPOH 1RJZB 2AABH 3BRFA 1HEZA 2VZUA 3QO0B 2QQNH 4CRPA 5TF1H 3KVQA 4D9LH 1Q94B 4Z7UF 5D7JC 1HIMH 3OXRB 4K23H 2IEPA 1CFTB 4PY8I 2YUWA 1DBKL 1RD6A 5J12B 1BLNB 1F11A 5KOMC 1NSNH 4G8IB 3L9RB 1EFXD 3WFEL 4M43H 1YN7B 2VITA 1R5IB 5GIRA 2E7MA 1FP5A 3BO8A 3NGBB 5TDNB 4R97B 5F70A 1FLRL 4HK0B 1YECH 3KDMA 4GW1B 4K3HA 2R56L 1LD9B 1NANH 2EZ0D 1WTLA 3H9HA 2CDEA 5IHBA 2ORBL 4X7SL 1Y18A 1G9EA 2LAAA 2BVOA 1XIWB 2EH7L 1MHHA 1F4YL 2XKUA 1INQB 4JKKA 5A2FA 4OT1L 4KRPC 3DECA 1IZJA 1CDIA 1JGUH 4JFEA 4KQ3L 4EDWH 4F58H 2VO5A 3EYUH 4GRMB 4UIKL 5E8NA 2KQMA 4HKXA 5IF0B 5IFAL 3LN5A 1SBSH 4H20H 4OQTL 5HYJB 1DE4A 2FZ3B 4D3CH 3QEGL 5E8PB 1EO8L 4JY6A 3RU8H 4KHTL 2WBJA 5DJYB 1OM3H 3S88H 4JRWA 3MA9H 1HWGB 5DJ0A 1WAAE 3O3AA 3ALXA 5INCA 5ENWA 2X7LB 4MQ7A 4HLJA 1H0DB 2YWZA 2RGSA 1X7QB 4L3CA 2DQCL 3VXRB 1B2WL 5CIPB 3T77A 5GGSB 5B38A 2ARWA 2OTPA 2P46B 4C54A 1N5YH 1YMHB 4N9OB 3B43A 3WCYA 2NZIA 5E99L 2EECA 1OTUC 2CDFB 4PTUB 5HD8C 4YQXL 4ZTOL 5B3NA 4IRSD 5ILTL 2NNAA 3CDFA 4BFGA 5I30L 3IS1X 3HNSL 4Q2ZB 2HVKA 2HJFB 4D94A 5J6HB 1YEKL 3QQ3B 1RJLB 3K8MA 4Y1AA 1O0VA 3HI6H 4JPIB 2CK0L 1MY5A 5JLZA 5C71A 1MELA 1NCDL 1ZA3B 4X9GA 3JVGA 4MA8L 1A21A 1EAPA 4J3VA 5DMGD 4PJ7B 5I1AB 3KYKH 2YD9A 1GOGA 2FH6A 2X1OA 1NEZG 4QRRB 4LSPH 1EJOL 4XP6H 3W82A 5JO5A 2UVEA 3DYPA 3FQNB 4KJYB 4LRIA 3T0VA 5FF6A 5MERB 3VE0A 4KHXH 3TBTB 5F96H 1I1YB 4P2RE 3TP4A 1IC4H 3OKOB 4G7YL 2ZJSH 5DLMH 3O6FC 5JMRA 4ZS7H 3RDTD 3CZFB 2DWDB 4H0IA 2Z4QA 2CUIA 1G7LA 3OBAA 5F93C 1QRNB 4OCYH 3WS3A 5J3HD 1S7RA 1NMBL 4G43B 3B9KD 4YHPA 1N64L 2RQ8A 1FN4B 3FQUA 4DGVL 4Z9KB 3LQMA 3RZCC 3WKMH 4ZO8A 3RFZC 2R2CA 4F9PC 1WCBB 4KVCH 1T7ZA 2D3VA 1EVUA 4MQSB 4RDQF 5DD0L 3O2VH 3THMH 1EV2E 2G60L 2FIKB 3JBG7 1UA6H 1IM9D 3QUMA 4OLYH 4OZGF 5CEYB 4NN6C 3RWCA 3ESVF 3IJHA 4L3EA 3ZKMD 1U8KA 3RWEB 3KAAA 3O45B 2XPGA 2JLLA 5IKCA 3D18B 1BQHA 1B3JA 4YDVB 4MAYD 2FL5B 2W9EH 2X70B 3TZVB 3O2WH 5ITFA 5CJQH 1CFVH 2X4QB 2GFBA 4YXKH 3ARBC 2XN9D 1G7MA 2H1PL 1ACYH 3VXUA 4OUUB 3QZWA 4NUGH 4LMQE 4X9FA 3OR6B 1J8HE 3UTOA 1QPPA 3GBNH 4F33B 2DQDH 1JHTA 1CXHA 1TZGH 4GKSA 2P5WE 1H3PL 5GGVY 3LHPH 2C3XA 1CFQB 4DUXA 2DTSA 2OZ4H 3Q48A 1WC7B 4PJGE 3C60A 4P3DB 1RFDL 3PWLA 5HHMB 5I1CH 1UWXH 4DVRL 5KVEH 1DVFC 4HDIA 2DQJL 4L4JA 5ESVA 3W5MA 2NTSP 4PR5B 2H6PB 5D8JL 4JKPH 4RZCB 4NKQB 3QIWB 3T2NH 1OVZA 5DJ8A 4HGMA 5M95B 1IC5H 5E6YA 4YHZL 1LEKA 4QHUA 4WEUD 3D5OF 2ZOLA 3CSYB 3NMEA 5K9QG 2D03L 1C7TA 2VQUA 4PB0H 1P4BH 3FQWB 4UOW1 3O8XA 1AGCA 4XAWH 3MLSH 5JIKA 4K3GA 5F3HA 4ZPVB 5F9OL 1XGYH 3FQTA 3BH8B 3VD9A 4QYOA 1J0JA 2P42B 4Y5XC 4JZNA 1FGVH 1AO7A 5F44A 1CFSA 3HI1A 3EOYG 4NM4L 3PP4L 4L8BA 5FECB 3ARDC 3VRLF 4Y4FC 4J23A 1P7QA 3BPNB 15C8L 1EHAA 4PJCB 4UTAL 1F2QA 4UV7L 4QOKA 1X5FA 3F7PC 4S1RH 4Z0XB 2BVTA 3GJFH 2GTWB 4QCIA 1FDLL 5F7UA 4OGXL 5JW4R 1T1ZA 1I1RA 4P4KA 1IM3B 1MLCA 1NCBH 4UV4L 1A22B 1K2DA 4BZYA 1NGXB 1TZHB 2K7PA 2VC2H 2X1PA 4NQDE 3WO4B 4OF3A 1PY4A 5I15H 5IHLB 5AG8A 1UWEL 1XGTA 4KUCD 3WXVL 1EHLL 4FQ2L 2EDDA 3F62A 1AY1H 4U6YB 2H45A 5D71H 1X5KA 4YHML 3P2TA 1OQOA 1UJ3A 4ONFH 1AD0A 4GG6F 4XC3H 4RMQA 4NQCD 1ZV5A 4ZFFB 1XGPA 3VU2A 5JPMA 4XBPB 1S7QB 3ZE0E 2AXGA 3QEQD 5I1HH 3ULVD 2HLFC 3OAYK 1HSAA 1RV6X 4ETQA 4R8WL 1ZA6A 5AAMA 3HC3H 5AZ2H 1G7JB 1JF5A 1XF5A 2G5RA 4P2OD 3MGTB 1KIPA 4QTHB 5IEKA 1M6OB 4CAGA 3FO2B 3R1GL 1NFDB 6FABH 4K8RD 5GISH 1F5WA 4F57H 3OJDB 5E8EB 2FBJH 4FRWA 1RZIA 5CBEA 3UTSD 1JPFB 2H41A 4Y5VC 4G80A 3BE1H 4GBXB 5IHZB 3K1KC 2ARJQ 1AD9A 2XQBH 1WZKA 3U7YL 4OD3L 1J5OL 4A2LA 3ARXA 3HPJB 1CGTA 1FV1B 3N1GC 1BP3B 3LRGA 3TO2A 4EOWH 5DJAB 4UTBH 2H3NB 3QXVA 2AK4A 5F3BA 1EUTA 3RTQA 2V2XB 2J8UB 5BOPA 2R0KH 3O6KL 2XNAB 3P77A 1P4IL 1QHPA 4R90H 1DQLL 4DOHE 2P5ED 2F53A 4NWTH 4PPTA 4Z7WE 1OARH 3D25A 5I76A 35C8L 2AS5M 1GH7A 2VOTA 3AS2A 3BZFA 5GHWL 1NDGA 4HZLA 1ZHKA 3MLXL 2KBGA 1EXUB 3EFDL 2EC9U 3BKML 1FCGA 1GC1H 4HKBB 4Z76A 1A7NL 3WSQL 2QTEA 3H7LA 5EU6B 3LRSB 3VGAC 4BSVA 3QA3B 4JFED 4X5WB 5I1JL 2BZDA 1H3VA 5F7FA 3LN9A 3TEUA 3FQXB 4G6FD 2X2YA 4S1SL 4Y5YA 4KZEH 5I66B 2ZUSA 2VXTL 5CMAB 2V7HB 1QP1A 4K71C 4APQA 4U1JA 5EBLA 1R3LA 4QHKI 5F1IA 4HMCA 4XX1G 4MMXC 4R6UA 3U0WH 4F3FA 2X42A 5C2BH 4POZD 5D2LE 4A6YA 3CPLB 4LVHC 3SE4A 3VFUB 4Y4HB 1IGJA 1RPQA 3I84A 1T04A 3BKYL 2IADB 2X9XA 1FRGH 3V2AR 4KDTA 1M7IB 3JTTB 1UYWH 4JFFA 2YBRA 1QLRA 1WWCA 2Q8BL 4LRNL 5CHNB 7CGTA 2V7NA 3CC5A 3VXQA 3C6LA 1ITCA 1NEZA 3QDGA 2XA3A 2MOVA 1A7OH 1PQZA 4G5ZH 1KSRA 2BSSB 2R4RH 4HS6B 4EI6B 3OPZL 5GRUH 2BERA 1F58L 4HMDA 1RZ8B 3CXDL 3DETC 4LEOA 1Q9WA 1JYNA 2O61B 1CICA 1RURH 1U58A 3F5WB 2Z35B 4QRPE 4D9QE 1BOGB 1S3KH 4DUWA 3IDXL 3RNKB 1TCRB 5LGHH 3C5ZB 2HRPH 1UQSB 5IW6A 5MEQA 3HB3D 2Q1EA 3MRRB 3LZFH 4NNPH 2I9TB 1H9VA 1KFAH 3RY6C 1RZFH 3SPVA 5CLWA 2WBJC 4BZ2L 5E1HB 4U0RB 3RBGA 2XFXA 4DKDC 3MC0A 2ESVE 4MDIB 2VDOH 4MXVE 2VDQL 3MMEA 1LO4L 4UT7H 2CKBB 3MRKB 1ZTXH 5A43C 1MCPL 5IMOB 1E4WL 1G6RL 4N0FB 4NSKB 4ODWB 4K3DL 5BVJA 5EU5A 5A2KH 1KPVA 1F3DH 4AIZB 2VZ1A 2WNGA 3GJEB 1F8TL 1HHHB 2YD3A 2VDRL 2DICA 5DEGB 1K6QH 1PW3A 1OGAE 4ZPTA 3GSXA 2EDYA 2XTJC 2R8SL 2APBA 4JVWA 4N0UE 4PRPB 3D39A 2V5TA 3PWVB 4I3RL 4F7PA 5BS0E 3I6KB 2NY2B 3BH9B 4HLZG 1HHJB 2FX9L 1CGWA 1W0WA 5GJSH 5KANG 4NZUL 2Y36H 3P0YH 3FN0L 4L3ED 2Q7YB 1LILA 2XA8L 4O02H 4GAJH 1YUHA 2ARJA 4XWOD 2GCYA 1QBBA 2MHAB 3RPIA 5EZLA 1WVZA 5ERWB 3KG5A 1YY8A 2KL6A 1NGZB 5FFLA 3Q5OA 3JV6B 4GRLD 2NXYC 4LRIC 4ZMAT 1LO3H 1F00I 32C2B 2IH3B 2F8OA 1MCOL 4I0PA 2QADB 3VXOB 1ZLVK 3F58L 1DUZA 4BKLA 4AK1A 3PXHA 5J1SC 3TPUA 4KK9D 3G6DH 2X05A 4NN7B 4MCZA 1JPTH 3G6JA 3O4LD 2VLRD 5L8KB 1OW0A 4PJAE 2DTML 1KN4H 1MH5B 2R15A 5CJOH 2BHYA 3QEHA 5DK0B 5I8CA 4Q74A 1F90H 4WU5B 3HMWL 5AZEH 3DO7B 3WFCH 3NFPA 4GAGL 4LFHD 5JR1H 4WJ5B 3U4EA 4G6AC 3G5YB 1B0RA 1SMOA 5FCUL 5FHBL 4JZJB 1LO2H 5IT2L 1GRWA 3IFOB 3OKDB 5DEZA 2CO7B 2IAMA 4NHCH 5I1IH 3MNWB 2CDGA 3P9MA 4HUXB 4XXCA 5ISZB 3HC4H 4W70A 3HG1B 1EBAA 4WIQA 5IBTH 1AO7D 1CE6B 3CSBA 3P9WB 1R5VB 4GLRH 3HNVL 4IJ3B 1BD2B 3C09B 1Y6KR 5E6ID 1QSZA 4AT6B 3ZMRA 5T5FL 1PDKA 4IDJH 1J11A 4KI5D 1N4XH 5T1KD 5EU4A 3MOAL 1RZJC 1EDQA 3P73B 1BAFL 2R23B 4W68A 5CEZE 1YN6B 4QOKD 1EA9C 2EYRB 2DQHL 2CQVA 3QUML 5BXFB 3K1DA 4ONGH 1JV5B 5I8KL 5ACMA 4F7EB 2VABB 1NC2D 3DTXA 3VRJB 3RGVD 3TBYB 4P4KD 2VDMH 2FEDC 3C60C 5F7NC 2Z31D 4B41A 3TM6A 2GUOB 3UPRA 4JQXC 4YHYC 1MNUH 4ORGA 3G9AB 4BUHA 2VAAB 5L2KE 2IFFH 2VERN 1YEEH 4LSSH 1OAXL 4I8DA 4U7KA 5D7LE 5EBGA 3V4UL 3VXNA 4DN3H 1U3HB 1TENA 5E03A 5IB3A 2OX5A 4XAKD 5AD0A 1KIRB 3OKKB 1U8IA 2HFEB 1RZJL 1B4JH 3O8XC 3HMXL 4OLUL 3FO9B 3IKKA 3MLUL 2FO4A 3MODH 4BQ6A 5K9OB 4C83B 1UACL 3AU1B 2CO6B 4GRWB 4DTGH 2DJSA 2WUBH 3VWJB 4XP4H 5HGDA 1RU9L 2GIYA 4YK4B 4MX7A 4LPCA 4ZUWB 3MLYH 4K7FB 4ODUB 4W6XB 3VCLA 4Y2DA 1S9VA 2V9TA 4J6RL 2I25N 3TIDB 4BH7B 2JELH 1FVEB 2E9IA 2UVFA 5BZDA 4X4YA 3LV3A 3P4LA 2UWEE 4PIRF 1ZHNA 5LCVH 3IGAB 4EI5A 4ZNEA 5GS3A 4ZFZB 5HI5D 3WS6C 4I5BB 3T0EE 5D9SA 5GRXG 4TNWK 4FQIL 1TJIL 2PW2A 4WNQA 2JF1A 3DVIA 3IVKB 1I8MA 5C09E 2HT3C 3VXTA 4WUUA 1DBML 3ARFB 3DO3A 1WISA 1DBJH 4ALAH 1T03H 1UEMA 3PHQB 4NKOB 4X4ME 3EYFA 3RA7L 2FEEL 3MLZL 5CEZH 4Q97A 4XH2A 3U30B 4G8GB 3SE8H 3RNQA 1BM3L 4Q9QH 2W9DL 4WWID 3PUCA 2CGRH 3GUTA 5C8JA 3BWAA 1FPTL 4ENEC 3P30L 3QRGL 3QT2A 1XH3B 3HLAB 1TVHB 2NW2B 3QHFH 4NQVB 3WXWH 2P8MA 2CKNA 5FYLE 1KXTB 3VFMA 4M48L 4OGYL 1IQDB 2MNUA 5BZWA 1S7SB 2DM7A 4DKFL 3KPRB 5ICZA 4NUJA 3PP3K 3U1SH 5L6YH 1UVQB 3BKCL 1NKOA 1U91B 4OZIF 2DLFL 3H3PL 5D1XB 2Z91A 3V6FA 3DX6A 1YDPA 2DI8A 4E9LA 3MJ6A 2F5AH 1W0VB 3QJFA 4APQD 5T1LB 3G6JF 3GHBL 5D2NB 1EBPA 2ICWI 4NP4L 3DLQR 4A2MA 3RTQC 3MRQB 3LIZL 1V3LA 2QV2A 1JZ8A 4NRXB 3WJJA 5K33A 3OKNA 4B7LA 4HK3J 1K4DA 3E8UL 2EDTA 3VXPA 4M62L 2NXZC 3TC9A 1DQDH 3ROOA 1QA9A 4NNYB 4DGYL 2YPVH 4I48B 4K94H 5EZOH 2F58H 1JRHH 3QAZC 4OM1L 1FH5H 2CPCA 5HYJE 1E4KA 1KPUB 1XIWD 2BX5A 2ZSWA 2JJSA 1A6PA 1WAAA 2PXYC 1D6EA 4JLRB 2J12B 1IGIL 4N0CD 1F6FB 4CL7A 2PN5A 1BZQK 5CILL 3RJQB 5B4MC 4NPYB 5D70H 4M3KB 3VFWA 4FZEH 3IAPA 3QPXL 1EO5A 1YC7A 5I19H 3ZLQC 4J1UA 4OI7A 5I6XC 2APVA 3DYOA 4PGCB 4Y5YC 3SDAA 3TBSA 5IHUL 5IB5A 4TSBH 3BP6A 2FEEI 2G2RB 5EIQA 4HPYH 4KQ4L 3ZYIA 5E00A 4JO3H 1NAML 2FYYA 3RWJB 4R4BA 4GXUM 1N6QL 4QF1B 4HWUA 12E8H 3TYGL 1FG9C 1QBAA 4MD0B 5CUSH 5DD5H 2K1MA 1UKQA 3SE4C 2DAVA 2OZ4A 3GMRB 3V6ZA 4I4WA 3VXRD 3D9AH 4KDTC 5HGBA 4EDXA 1IGTA 3T2QA 4LSRH 3FB7B 3DNKA 4X4XA 1IGYB 4PJ7E 4MLIA 1MPAH 3EO9H 3C6LC 1DL7H 4L8CA 1HYSD 4H1LH 1DANT 4PRDB 2HT2D 2DQIL 5TGBB 4P2RA 1LGVA 1T0MA 4JKWA 3H8NA 3D39D 1MHEB 4MJID 1I7TB 5BJTA 1CICC 3TFKD 3TYFA 1KJMB 4FQ1L 4YHLL 3L1OH 2F74A 4KRMB 2JB6B 2IBZX 4HKZB 2XT1B 4HEPG 5FA3B 3TJHC 3AS0A 2IGFH 2Y7QA 2Y72A 4HT1H 3BHBA 3UJJH 1OGTB 4HF5H 4P5MB 4QRRD 5C92A 4JCMA 4PY8J 4QWWC 1XCTB 3GZKA 3B8SA 5DRZA 3MCLH 1FSKC 3GSRB 1RIVH 5BV7C 4KFZC 3NCJL 4PJHF 3NTCH 4KDVA 4U1NB 2UZYB 4ZFGL 3GJFA 2A77L 1U8LA 3E2HC 3QXAB 5LGJA 3SKOB 4K2UH 1RUAL 4HIIA 4UINH 1G0YR 1LNUB 1CLCA 4U1MA 4M7ZC 5DFWH 4U3XA 1ZWIA 1CZ8H 3O3UN 3MRCA 2IBBA 1FNLA 1QRND 1EZVX 4LP5A 5EOCL 5D72L 4XGZA 2XRAH 3VFGH 3FO0L 1I9RH 3GM8A 4XNQA 4TVSa 1G9ML 5DF0A 1AP2B 1JTOA 1MLBB 2FR4A 2PO6B 1XR8B 2VLJB 3CZJA 1F4AA 3BSZL 3FZUC 1T5XB 1CFNB 3CFBA 1DQJA 4L8SB 2W38A 5DGQA 1YJDC 3LS5L 3AXLB 5BV7L 4WDIB 3WLBB 4OSUL 2P5WA 4HH8A 1KULA 1WF5A 2WINB 4JZOB 1I7RA 3S36H 1CG9B 2LV4A 2X4UB 2IAMD 4OLZL 3ZHLA 3T2OA 3CSGA 3H0TA 3B2UD 3QJHA 1NMAL 3QUKA 4PJGA 3RKDC 5JOEA 5AEAA 1ORQA 1W0YT 3QHZH 2A6JB 5HHME 1CL7L 3HE7A 1NBQA 3UBXG 3TZVD 4F37K 5MI0C 4LU5H 3W9EB 3UX9B 1TETH 4K3JH 5DO2C 1NCCL 2MPAH 4FFWD 3T0AA 4JFDA 1YJDL 3JWDH 4MB4A 1A4KA 3E0GA 1DUYB 2DYPA 2MKLC 1BVLB 3PWPD 4LCCA 1P4LB 1N5AA 5E9DE 4N9GA 5JDSA 1I3VA 3VJ6A 4AEIH 1EEUA 1R3KB 2FX7L 2J88H 3LPFA 1A2YA 3OB0H 3L5WB 2QLVB 2A9NL 2X10A 1LP9B 1G0XA 5KG9B 2F54B 1RSFA 3G6AB 3QIWD 5JW3L 1KPRB 2Q76B 1IEBB 4PJCE 2Q87A 3RX7A 3EKCA 4MSWA 4ZG1A 5C08E 2FIRT 1WAAF 4LCYA 4YEEA 1KG0B 4NKIL 3UCRA 1TVBB 1V7NH 4XXCC 1KBGL 4ZUVA 4M61B 4NQDA 2IALA 1FE8H 1PG7W 4LSQL 2EXWC 1GIGH 4LHUA 5B3JF 1HXMB 1SEQH 3OKLA 2PETA 2VDKL 5GRJL 1AHWB 5I9QC 3LKSB 1BPVA 5JPNA 4U1HB 1JHKH 3HCVB 1GZQA 4PLKD 1NJ9B 3E6HB 1UFUA 4WCYL 3BGFB 2HVJB 4XP9L 4HXAH 3V7AE 1X6NA 1G6VK 4O2CB 2FLRT 3ULUL 3BQUB 5F1KC 5FYKE 1IARB 5EOTA 2XZCH 5FM5O 1GAFL 1MHPL 5DR5H 3U79A 1JPSL 2NPLX 4KJQC 4PGZA 5FKAA 1T4KB 5HYSG 4QEGA 3BW9B 1NFDE 5DWUH 1WZLA 4M5YL 1AQKL 4Y2OA 3QUYB 3K74B 1A6VH 4Y19A 4MNGB 2JCCA 4IOSD 4JPKL 1MJ7H 4EVNB 3LB6D 3UTQB 3K2UL 5GRYA 3L6FB 4JRYE 43C9A 4PJ9A 4ODSL 4K3EH 3CFJB 1Q8MA 4JRXE 1WFNA 3P4OA 1JI2A 3LKQB 1T5WB 1QBLH 5E1AB 4PLJD 4OIIH 4XPFH 2J8UE 4Y2DC 3DXAD 1HH9B 5F7EH 1ZLUK 1SJVA 4ZDHA 3H9ZA 2HG5A 1KJ2H 3ELAT 4RQQB 3RX8A 4QHMA 4TUKH 3V5DA 5F89B 3UJIL 4WV1B 3U9UA 3UAJD 3W11D 3U4BL 2BNUB 1QVOB 4LKCA 2JJUA 4MJ4A 4QXTA 2X9WA 1BBDL 4KK8C 43CAA 2A0LD 2R29H 1FIGL 2CR3A 1FVCB 2ADJA 2EDKA 1IGCH 1BFVH 4ZFOB 3W9DB 2WK2A 1JNLH 3HZKA 1NGYB 4AEFA 3GI9L 1DDHA 3F6LA 5EU6E 4W6YB 1YEFL 2WZPD 3OKMB 2EZ0C 3MR9B 3S97C 1HXYB 5DRWB 1T80A 5F9DC 3SDDA 3TN0B 1MJUL 1J18A 5D1ZB 2A2QT 1X5JA 1RUMH 2MCPH 2XG4A 1T66D 1BQUA 3GIZH 3F6IA 4JY4B 2CXKA 3VMOA 3GMPB 5DRXB 2MWCA 3CJJA 5D2LA 4PJGF 3VW3H 2ZG2A 4TNVF 3S3SA 3K4AA 4O4YH 4P2QB 1T83A 5FYKH 4PJ8A 1KYOJ 4YE4L 4JN1L 3U9PL 1AI1H 3HE6B 3L3OB 5I73C 4KGJA 3I2CH 4PRHB 2LAGB 1JFQL 2P8LA 3H6JA 1QEWB 2BVQA 2Y5TA 1AIFB 4PB9L 2Y5EA 4FHBD 3U48A 1C16B 4G3YL 2CLRB 4P9HC 2UZIL 4F15C 4JR9H 1KCRH 2EE3A 3C5SB 4S1DC 1CF8L 1B0WA 5FK9A 3FQRB 4GXVL 2E6JA 4HWEL 5TE4L 3OAZK 4QRPA 3V4PL 1SEBB 4J3UA 3GSQA 5FUOL 3GSNH 4L5FL 4Y4HD 3MBEA 3MXVH 1NANI 4KTDL 1Q9OA 2X5PA 3IFPA 5HDOA 2QJDA 4L4VA 4NO3A 4P9HL 2HJLB 2ESVA 2QR0B 3QUXA 2FX8H 4FABL 4E41E 3T1FB 5AUMB 2AJSH 4LCWE 2PW1A 1CD1A 4X8JA 2EIDA 2A9MH 1ZLWH 1NCAH 1N2RB 1ADQL 3H42L 1XF2A 1FBIL 3QXTA 4WWKB 3B3IA 3LVEA 3BXNA 4POUB 4AMKH 4GKNA 4ZNCD 5E95B 4KKLC 1V7MH 1YPZB 3QFDB 3HS0A 1QBMH 1ORSB 2GJZA 3I3BA 3UMTA 2D7TL 5DUMH 4U3CA 4NQTA 4XI5C 3SDAC 3BZ4A 1OGAA 3VFSA 3T0WA 3G5XA 3ZE0F 3ZYOA 1G6RB 4X0KB 1IGMH 2VH5L 4N0UA 4XCEA 4BK4A 1CFBA 4J3SA 5JMOC 2AEQL 1U95B 4MCYA 2NY4B 5C0CE 2YOCA 4HUUA 2GHWB 2OXGA 1CVSC 3QH3B 1Z6JT 3ILQD 4Q7DA 1OOAA 5ITBL 2AGJL 3CVHB 4TPRH 1G84A 3WIHL 1BOYA 2P7TA 2QHRL 3VWKB 4NCC2 3A6BH 5D7IB 2GSIB 4E5XA 1FGNH 3INUL 1ZVSA 5F7DA 3F7VA 2R2EA 1L0QA 4RMVA 3ZDYE 1WGOA 3UBXA 1PYWB 1VFBA 2VZTA 4JAMB 3PABB 4PRPD 3RKPA 1MWAH 3SY0A 5DVNA 1F42A 1MSPA 1U8QB 1HKLL 1HQ4B 1Y0LB 1NCUA 2B20A 4DAGH 1NCWL 1T2QH 4HUMB 3MV01 4YDIH 3QQNA 2D2OA 3QUZB 1I75A 5D96C 5E8OA 5HGHA 3NN8B 1KJ3H 2YA1A 4PJAA 4W4OA 1A9EA 3S4SG 1OD7A 1MEXL 4KMLB 4XZUA 4NGHL 5A16A 2OK0H 2PYFA 2DL2A 4Z7WF 3QIUB 1AKJB 3HE7D 1AFVH 2BXZA 4M1CD 5AWNL 3MJ9H 4QHKJ 3DMMD 1A9BA 4LSUH 4JFYA 4WO4A 2EEAA 2X4TB 2ITCB 2QADD 4ZOBA 5FEBA 2BC4A 4JFDD 3P4MA 3FB8A 4MDJB 2IQ9L 3GSVA 3MNVB 4NRZA 5IB1A 5KW9H 3PJSB 2ZCHH 3S36X 4OLVH 3PHSA 1FNSH 1KCUH 2L4OA 4EN3D 2N56A 1U8PB 3NCYP 3MACH 3NACH 5TE6H 1Q1JH 3TO4A 1ZKAA 4XPGH 3PWUA 1BD2E 2KUTA 2JKXA 3BAEL 3RQ3A 1AH1A 2BCKB 3MGAA 1SY6L 4ZUUB 3RGHA 5IQ7L 2FGZA 4PJIB 3DGCR 3S96A 5CEXA 3PDOB 5HDQL 1JZ7A 4DGIL 4YUEH 3QSKB 3ISWA 5GGTH 5D2LF 4WFFD 1CN4A 1PKQE 4GAYB 3STZA 3PGDB 5C0RL 4UDUA 2Q6WA 3IFNL 5ISZD 5D7KE 1UM6L 3HG1D 3QPQC 1E6OH 4OZFH 5F8RC 2FJGB 2VLMD 1KXVC 4XVUC 5L2KA 4X7DC 4CVXB 1R24A 4FQJL 1WWBX 5D7LA 4LF3B 5JA9A 3ARRA 4YWGL 3EO0A 4HIJB 4JPVL 1MQKL 5F7MC 2EEDA 1WBXB 4X6CE 5JDJA 5SWQB 1A47A 4QO1A 5TDOB 3MRHB 3ZSSA 1RZ7L 4OD2A 3CDGA 3KPQB 3GMMA 4MA1C 2VXQL 1MRFL 4LK4A 3KYMB 1NUDA 1ZANL 4P5TB 4AL8H 4LCCC 1BGXH 1RVFH 4PGDA 4R2GC 2ZCLH 1J10A 3PL6B 4U0QB 5DHYB 3O3DA 4UNVA 2PF6A 2AK1H 4GRWE 4NNXA 4XNYH 1RULL 1U8MA 5EO9B 1FZJB 1J0YA 2XWJA 3UTZB 1VPOL 5IV2A 4XPHH 1ZS8A 4NO5A 1NBYB 3ORJA 5KSUB 5EUOE 2YMXL 1U3HD 5DD6A 4U05A 4YDJB 3LQAL 1ZAGA 1D3CA 3OJVC 4MXVF 4Y19D 5J11B 4PJXE 1MCWW 4JO1H 2DF3A 2CIIB 2YR3A 3GIVB 2P44B 4J3XA 2HKFL 1YEGL 2IQAB 1WICA 2OL3H 2NY6B 3T0EA 5B39B 4LPXA 4G8FA 3BOVA 3WFDH 2APXA 4R3SA 5HYEA 2AJXH 3BGMB 5CWSB 1Y6MR 2P24B 1URLA 4RIRA 3UTTE 5C0JB 5HHOB 2J3SA 4AIOA 1KF9B 5DS8B 1A4JB 4X4MA 3N9GH 4EIGB 3MBXL 4ZYKB 1CDYA 1E28B 5DDHA 3NFNB 2LVEA 1Q94A 1LE5A 3CCHA 5C0FA 5DT1L 4FZ8L 4G8GE 1A5FH 2Z8RA 5I74C 4LAQH 2R0LH 3ULVL 5FGRA 4OCRL 2AV7B 3D85A 5KVGH 2Q20A 5KVDL 1Q9LA 1S78C 2GY7B 5SX5K 1RUKH 1B0GB 2HTLD 1Z9SA 2ITDB 3O9WB 3RI5F 3WFZA 4YAQA 1CLZL 3ARFD 5DVKA 3AC0A 4RBPH 5ICYB 3KPRE 4XNZB 5DYOB 4K8RL 3QDJA 2YK1L 4IOFC 3W39A 1EMTH 3L3GB 3C9NB 3K2MC 5H2BB 4H1LA 4U6VL 4D8PB 5EZIL 4LMQI 1DFBL 1KC5L 1KCVL 2WV3A 4G6JL 3BP4B 5ADPL 1L9NA 1KT2B 5IEHB 4NCDA 4FQQA 1QSEB 3QDMB 3G5ZA 3UDWA 3Q6GL 5HXMA 1AR1D 4PJAF 3QG7H 5D2NE 5GS0H 3TNNB 1QOKA 5IFJB 3AB0B 4D0DB 1NFIA 1F2XK 4O5LH 3QCTH 2HKHH 4HIEA 5IF0A 1D5ZB 3I3EA 3KJ4B 1UZ6E 1P7KB 1K8DA 3BESR 5D1XD 4NO0D 4LQ1A 2R9HD 4IHOA 3HFML 1FL6A 4YR6A 5GGUB 5E8PA 2Y6SD 5T1DL 2J7LA 4Z7QE 5JIPA 3TV3L 5EUKB 2B1HL 5SWZB 3JV0A 3MYJB 3DRTA 2IANB 1M71B 2EDRA 5T1LD 3IJYB 5CSZB 2XKNA 4RNRB 4POZC 2X7LA 1HHKB 1KOAA 2Q7NA 5FYJH 4B0MM 1MREL 2XQYK 3BWUC 3RVVC 4DN4L 1KN2H 1TJHH 3FFCB 5E7FA 3BDBA 1KELL 5KZCB 1JYVA 1KCSH 2C3VB 4UILH 1MUJA 1M7DB 4UDTB 3VFNB 2DWEA 4FQXC 4ZAKB 5CAYB 2VZVA 1L9MA 4L4TB 3Q6FB 5E94B 3DV4A 4MJ5B 1GGBL 5JQ6L 3WE6B 5BRZB 3WDHA 3MOBL 1G7HB 4YXHH 4OFKA 4NHUA 1ZMYA 1MCIA 4L4VD 2WAHA 3QUXD 1PEZA 3OX8A 4AIXA 5IMMB 5GSRA 1SYVA 4FS0A 5HHXL 2FGWH 1T20A 1PG7H 2G75A 3TH4T 5DJ2B 4EBQL 1T83C 5J6GB 3QNYA 5BQ7A 4PJ8C 2DJ4A 4RGNB 1JUFB 2GTZA 3KPNB 2YD2A 3DRQA 1NGQL 1S7TB 1PFCA 1DBKH 3PDDA 4PJBB 4WU7B 3WFEH 1GGIL 1CBVL 1I9JL 3KS0J 4M6ML 1S5HB 5MENE 3IJSB 1QLFB 5C0GA 3KPSE 4WGVB 1FLRH 5INDB 4D0BB 2CUHA 1DBBL 3ZSTA 1DLFL 2R56H 4X7TA 4YZFF 4AZ8A 1RMFL 2PR4L 3B83A 3L3IB 2ORBH 4DCQA 3MBEC 4X7SH 3MUGB 3SGDI 3WL9A 4F2MA 5MP6L 4U1LB 2AQ1A 2EH7H 4J4PD 1F4YH 3S4SA 3QRFM 1P1ZB 3CFEA 4XWGL 1QTYT 1P5VA 4OT1H 3O3EB 4GS7C 1R3IL 4QRQA 1R6VA 1FLTX 2E9JA 2UWEF 1DBAL 1VEOA 4KQ3H 1HHGA 3VXMB 4GUPB 5JXEA 4UIKH 5CEYA 4ELMB 4LLVA 2LTQB 2A38A 4YBLC 3LMJL 5IFAH 1YQVL 3OF6A 5CGYC 5HI3D 1NMCC 3LEYL 4S0SD 4P3CH 4OQTH 2X9YA 3MJ8A 3L5JA 2JJTA 4M6NL 2CRZA 4HWZB 1EO8H 4MD5B 4HJ0D 2JK5B 2NY1C 5EC2B 5CSBA 3N06B 1IMHC 1N0XL 3DHMA 1JYXA 2VLJE 3RWFB 5J13C 4OFYA 5I75C 4UUJA 2DQFA 5LQBL 4ISVB 2ICWJ 2DQCH 5HPMA 1B2WH 4LNRB 5JHDA 1T0NA 2ED7A 3DBXB 1RHHA 4OKVA 2E6PA 4F33A 4RMWA 4KK9C 2LQRA 1F6AB 3F65A 2GJ6B 5E99H 1MHCA 5DJ6B 3DUSB 3BPOC 2AEIT 2NR6D 2MQ0A 3C8DA 4YQXH 5DI8B 4ZTOH 5ILTH 2C1PB 1JJUA 1L7IL 2P8PA 3PWNB 2VL5B 4PJEE 3WHXB 1Z3GL 3HNSH 4EIZC 3MRDB 4X5XA 2VDNL 1FNGA 4X9HA 1RIHL 3EO1A 5MEOA 1YEKH 3HUJB 2PO6D 4XB8A 4PR5A 3SDCA 2VLJD 1JF1A 4QTIL 2OSLB 5DHVH 2CK0H 2YPLB 1GHFL 1NCDH 3KPTA 5LAXB 1OLZA 2AJZB 3MUZ1 4MA8H 2FWOA 3Q2CA 4FP8L 3FT4A 4U6HA 1CDHA 1X44A 1IAKB 5E9DA 4U1IA 5GS1C 4W4OC 4JN2A 1EAJA 1IL1A 1EJOH 4FA8A 4X6DE 2FO1A 1QFUL 1CDGA 4ZUTA 1MCFA 2WBKA 4OD1L 5HVHC 3GMNB 1T89C 4G7YH 3KWWA 4J2XA 1KJ2A 1X5XA 3HZYB 3QQ4A 3R06A 5IW3A 2X4RA 3T65A 5I0ZA 1G7PB 2F54E 4WO4C 5C08A 3NZHL 4LCIL 2DB8A 2RCSL 2YN5A 4HFUL 1NMBH 3L3JA 2GTWA 1A0QL 4MVBD 2VXVL 1N64H 1RK1B 4DGVH 1FO0L 5IVXB 1FFOB 2XZZA 3ABZA 5EH1A 4PJFB 3TO4C 5HJ3B 2DBLL 3MROB 2DDQL 5F6IB 3ZE1E 2UY6A 5DD0H 1CLYL 1HQRA 8FABA 4XNXL 4F7TB 4IRZL 2YD4A 5CKAA 3LKPA 1JWSA 1A1OA 2HFGL 3FB6A 4IRJC 2IBZY 2GK0B 1VFAA 5CINL 3T0BA 3A6OA 3QULA 3QXWA 4JCLA 5E5MB 5C0BA 4LOUC 1T2JA 1MVUA 1P2CA 4ZFFA 3FO1A 5EN2B 4QT5B 1HOCA 3GSUA 4FQCL 4LVOC 2HN7B 2OTUB 4YHIB 3R4DA 4JVUA 1J0IA 4ZXBA 5J9PB 4CU8A 1D5MB 2GT9A 2ZWLT 4PJ7F 1OTSD 2H1PH 3RVWD 1W72L 4NFBA 4XHJD 3ZKXB 1S7WA 1TJGL 4OF5A 4P2CG 4WW2A 1EZVY 1H3PH 2VZ3A 4ZOAA 4PP2A 2H2PD 3C6SA 1ZT7A 4X6FA 3MV8E 4GBXA 4U6XB 2D0FA 5DRNB 4DVRH 3D0VA 3TCLA 2DQJH 5HSFA 4JRYA 2ZSVB 1A7RL 1VESA 3LDBB 3U0TA 1A7PL 1T21B 3S37L 1HI6A 3WUWB 5L2JA 5D8JH 5F6HI 3H9SE 1S9XB 2GAZA 3L5HA 3RJDA 3FFDA 4JRXA 2Y9RT 4P23B 4YHZH 5MEPB 5E2WL 3GSNA 4YBQD 3WN5A 1UZ8A 4NKDA 3BQUD 3V8CA 2D03H 4B5EA 2AI0L 3NA9L 3QYCA 2V2XA 2J8UA 4WTZG 1D5XA 5D7JB 1LK3L 1U36A 4R4FL 2CMRL 5F9OH 3MRIA 4ZUSB 3MRJB 4NM8L 1MI5E 1QKZL 2G5BB 4UT9L 5D1QA 3FOLB 4Z5RA 1I8IB 5DQDL 1U8HA 2XXMB 1BWWA 2W65B 4NM4H 2A74A 3PP4H 5IG7B 5MHSE 3KNBB 5LG1A 2VQ1B 3T0EC 15C8H 2Y07L 5IJVA 4WHDA 4UTAH 1MJ8L 5EC1A 4UV7H 5D6CA 1MRDL 3IDMA 1KEML 5C0AB 1NLBL 3AREA 5JW4M 4L8DA 4KVNL 3SKNB 1FDLH 2X4OB 4OGXH 4QY8B 4WFGE 3SDXB 3EYOB 2NY3C 3VXSA 4UV4H 4LLYB 3PV6B 4PLNC 3WXVH 3V4VL 1EHLH 4FQ2H 4UMGA 3ULSA 5A3ID 3NVQA 5J8OA 4YHMH 3IDNB 1KTLA 1K5NB 3NGBC 4AM0B 4JDTL 3QISA 4R97C 2NZ9D 2R2HB 4FN0A 5FA4B 1AGEB 3JV4B 4NQSA 4P2QE 5T3ZE 3HN3A 1EFXB 4PRHE 3TA3A 1JNNL 4MNQE 3C8KB 4KROC 3Q5TA 4LPYA 3TN0D 3ZT7A 4R8WH 4H25A 3EHBD 1XIWC 5KSVB 1KB5B 3QG6B 3VD7A 1MWAA 3K4ZA 1A1MB 2PCPA 3WUWG 1K8IA 2BSTB 1IAIL 3R1GH 2A73A 5EOCJ 1DN0A 1GZPB 2JIXA 2O61A 1KUMA 2EKSA 3OKEA 1JPGA 5FYLL 1LDPL 1UENA 4HJJL 3FKUS 4ZO7A 4G9DB 4NDMB 5DQJA 2IPUK 2VN7A 3HE6D 3U7YH 3FHQA 4OD3H 4QXWA 1J5OH 2AXFA 4QHLA 2RB8A 4U1KA 5I2IB 3KYOB 2I9TA 4QRSB 3GSWA 2FHFA 1B6UA 4E41A 2D0GA 1HK6A 4DZ8A 4X98B 3O6KH 1VADB 1CT8B 4LCWA 1P4IH 3BJ91 4M6OL 3SGJA 1DQLH 1PG7X 3MRKA 5F9AC 2Y06L 4B7IA 1WQVT 5F9WC 5F88B 4ZTPL 35C8H 4PP1C 4NSKA 4Q6IA 5C0IA 2VZSA 1YPZE 3IU3A 3O2DL 1I4FB 5GHWH 3K46A 1AQDB 5IQ9B 2HT4D 3MLXH 4RFEA 2I27N 2O5ZL 3EFDH 2BNRB 3BKMH 3QNXB 2H26A 4V1DE 1A7NH 3WSQH 4NWUL 4HUWB 4M8QA 5DJCB 5GGTA 2G9HA 3LKRB 1Z5LB 5C0CA 4PJDB 4FFZH 3BH9A 5IROA 5I1JH 1QO3B 4TTDC 3CLEL 3M8OL 2LU4A 2AV1B 4PG2A 2Q7YA 2NLJB 1MFEL 4WWKD 3RZCB 3G5VA 1X9QA 4OZFA 1UC6A 4S1SH 1FFPA 3ILPA 2MHAA 2K7QA 2YPKA 5SV3A 4WW2F 1NFDF 2VXTH 3O81A 5J56B 4MXQD 1DEEB 2UYLB 3BPCB 1RJYA 1OT1A 4U2ZA 4ZODA 1LEGB 3JSSA 3MCG1 1E6JL 2W0FB 3L3KA 1HHIB 1U8NA 4QXGL 2IH3A 2CLZB 3WDJA 2EE2A 1TDQA 2ADGB 4GW5B 3BKYH 3BGAA 4OFDA 4Z7VB 4N0YL 3SN6N 5JHDD 1S9WB 5FGCB 4HC1L 3RUGE 1AJ7L 2Q8BH 3G04B 4LRNH 5D5MB