2WUCH

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp and ac-kqlr-chloromethylketone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTINGTYIHWVRQAPGKGLEWVGGIYPAGGATYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAKWAWPAFDYWGQGTLVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 218
sequence length 220
ec nomenclature
pdb deposition date 2009-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wucH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wucH01
4HUVB 3QEQB 5I66B 1RQ5A 3BT2L 3WFZA 3HE6B 5HBBA 12E8L 3NOIA 3ARBC 1ZT7A 3NTCH 1OOAA 3IU3B 2DAVA 3P0GB 1KN4L 4HWBH 4JHAL 4N1CA 3VWKA 2EXYD 1MCOL 4JANB 4OZHE 4Q9QH 3M17B 3IDYB 1JRHH 3LKNB 2RB8A 1L0YA 5TDPA 4CMMB 2HVJA 1Q1JL 2NYYD 3MLXH 5MEOA 3O3DA 4R96B 3U4EB 5IFHL 1L6ZA 4XPHL 5A40E 4OZGA 4XVJH 2BY3A 3QQ4B 2YMXL 2WNGA 3P4MB 4MJ5A 1OAKL 2YD4A 5C08A 1KIRA 1B3JA 3C2AL 4H88L 4FFVD 1CK0L 4HS6A 4ETQB 4HIIA 2R15A 1CGSL 1ZS8A 1WZMA 2I27N 4YXHL 3NH7H 1IGTB 4YHZL 3PL6C 4CN1A 5KS9E 1FL5A 3NIFF 5IMMB 4XAWH 3BISA 3SDAA 4P46D 3OZ9H 3SE9L 2UZIH 1NL0H 5CD5D 4J2XA 1KUMA 1VEPA 2FX8H 2R56H 3FRPA 1W0VB 1JWSB 3TWCH 1CFTA 4DKEL 2JELH 5SV3A 3R06A 3WO4B 1K8DB 4QHNB 3HE6C 1I1FA 1RZKH 5CZVH 2AXFA 1S3KL 3GBMH 3ARBD 4J23A 4PRHA 1FL6A 1YEGH 3E6HA 1FGVL 1UM4H 4KV5F 5JW5B 3DRQB 1MJ7L 1S9YA 4XNYL 2VN4A 4L8CA 3IDYC 1EBAA 3BPOC 5AG9A 4Z8FL 1HDMB 5IJVA 4ISVA 4HHAB 5D6CB 1YN6B 3NVQA 3PWNB 5F7KC 4CVXA 3BN3B 4HPOH 5FGCE 1ZK9A 4G6ML 4OLVH 1FIGH 3RP1A 2O5YL 2X1QA 4PJHF 4RGNE 5DHVB 4MAYC 2O61A 5GPRA 5IV2B 2FEDC 3PWJB 1FJ1A 3UJJH 5BS0E 4PBXA 4MNQD 2AABH 3S88H 1CU4L 4U2YA 1LMKA 4NNXB 3QG7H 4Z7NF 1NDMA 2XFXB 1IQDA 4I13B 3PL6D 1Z5LA 4GRWE 1X6NA 4LSVH 3SJVE 3MJ9A 1EK3A 2IANA 4ZAKB 3RY4A 3FFCD 1U8OB 1RIUL 3TBWB 2DQGH 3CU1A 4JQIL 4Z7VA 1XF4B 3VGHA 5T5NG 3QEQD 4ORGB 4F7EB 1F11A 4YDVA 1REIA 1X4XA 2DN7A 5HYFA 3HE6D 3P40A 2VZ1A 1I4FA 4JFFB 4WHYH 4W4OC 4X4XA 1ZWIB 4WO4A 2G9HB 3K2UH 1VSCA 5C09E 2R2CA 3HE7B 5D7IB 4WCYL 4JEGB 5LQBL 1FG9C 3EAKA 1MRFH 3VI4F 3CUPA 3QHZH 4GW1A 4J3WA 5C8JB 1X5IA 3LPWA 3TBYA 5IVXB 1CF8L 3ZKND 1S7SA 2GT9B 1B0GA 2A0LC 4NC1C 5CJBA 25C8H 4LK4A 3I9GH 2DWEB 2ADIB 1NGQH 4OCNC 6FABH 3X3FH 3HRPA 4YXKH 1NUFA 2NY7L 5EZLB 1TITA 4F7PB 1MWAA 4LPTA 3TC9A 5I1IH 4MAYD 1H3PH 1JWUA 2ADGB 3OJMB 2FEDD 4OCXL 4DUWA 3CXDL 2NW3A 1DDHA 3DNKA 4R9HA 4Z7WE 4PY7B 3TO4A 3SY0B 2JKXA 1KN2H 4LLWA 5BVPH 2YRLA 3BDBA 3NFSL 4KJPC 3FT4B 2G2RA 3RDTC 3BXNA 1NLDH 4ZAKC 3U82B 3TJEH 5GGRY 1JWMB 3W0WD 4PJFF 5IB4B 1CGWA 2BOBA 3P9LA 4PJBF 4PG9A 1U91A 4YHNA 4ZD3L 2W9DL 5DHYB 2YC1A 5I15L 1CGXA 1S7RB 2Q8BL 1PEZA 2RBLA 4F80A 1JUFB 2YD5A 1Q38A 3HE7C 4A2MA 3F12B 4TPRH 3WSQH 4ALAL 4MX7B 3D25B 4I9WD 2IEPA 1WV7T 3DX7B 3PWUB 4OCRH 4X6BA 3CFCL 3LQAL 5D5MB 2EC9U 3UBXA 2W0PA 2ZUWA 1KG0A 4PRNA 1BGXH 4YNYB 4MS8C 4DWHA 2V2XA 3MRIA 1CL7L 2A0LD 3NA9L 1IC4L 1AR1C 5C6WH 3ZKSD 4WVRA 4LVOC 2KL6A 1F4AA 5F9OH 1Z9SA 1NBYA 5HI4C 1J1PH 5FECB 2VAAA 4JM2F 4U1SA 4I48A 1OP5H 3U79A 1PZ5A 3MBXL 1A8JH 4LDOB 4ZFFB 1ZVHA 3G08B 1ZT4A 3BMWA 3STZA 1T0NA 3WN5C 1QFWI 1I9RH 3L3IB 4M1GH 2OL3H 4YXLH 4KJPD 2JIXA 3JV4B 4GXUM 3RDTD 5F9WB 4OGYH 1A4JB 4X6DE 4ZAKD 5FOBA 2YD8A 3TT3L 5ERWB 3MUZ1 1ACYH 4Q58C 4ODUA 3VMNA 3HG1E 3EZJB 2NW2A 3IU4H 1Q0XH 4IDJH 3AAZA 5IQ7H 2BVPA 3LKSB 1M4KA 4RZCA 1RJCA 2BNRA 3HC4H 3TH3T 3OKDA 4JFFD 5ID0A 4GRMA 4O2FA 1AXIB 3WNLA 3GSUB 3HZKA 1NAMH 1R5IB 4ONHB 3HE7D 3TZVA 2ZUUA 4LVHB 5KSVA 1AO7B 1AGBA 4M61A 5GSRA 2BHZA 3GJEA 4JHWH 4XXCA 5E56A 4YAQB 4KTEL 3VXSE 4XCNA 4PJ7E 4QYOB 1FL5B 4OZIF 1YMMB 1LHZA 1U8IA 1T3FB 5EPMB 4O02L 5I1GL 1OT1A 3SO3B 4OI8A 3S36L 4UT6H 3PWLB 1MCPH 3UTZB 1AR1D 5HI4D 4HCRA 3QEHA 4EOWL 1NC2A 1GL4B 2NY3B 1D5IH 3MROA 2BSSB 5FYJE 2R8SH 1KACB 3UJIL 4GAGH 4Y19B 2VXVL 1A6PA 1QSVA 4WW2B 1P5VA 1F3JB 1Z9OA 3ZDZE 4ZOBA 2Y6SC 5J6GB 5SWSE 2V9QA 3VWKC 3GB7A 3UTSB 4AEHH 3FFDB 2NY0B 1N7ML 4DKDC 2UY6A 2W60A 3MLSH 3HR6A 1HQ4B 2IPKA 4AT6A 5BVJB 3GI8L 1BJ8A 5DJ2B 5ITBL 5F9WC 1MJJA 4PJGA 4XVUC 5C0JA 3R0NA 4JG1H 5B4MC 1AXTL 5FYKD 2DQHL 1MPAL 3ZSSA 4LCYB 4JKPL 4PGCB 5JHLH 3HZVA 1KBGH 1A6ZB 4KWUA 1WCBB 1TJIH 3LEXB 4FQQA 4TVPE 2V5RA 3KXFB 4LCIH 4EQ3A 1OSPH 4KDTC 4C56A 4KDVA 4JO3H 2WANA 3O9WB 4G43B 2B2XH 3EOTH 2D7PA 2OJEB 5E0QA 4LVHC 1JF5A 3LS4H 4JHZA 4B41A 1QLFB 2YPKA 4GKNB 4R26L 3CC5A 1MEXH 3K4AA 5GISH 2P5WB 1PG7H 3D2UA 5D7LE 4F9LA 4OZ4A 1KJ3L 3C6LB 4WGWB 5DK0A 3RIAK 4LHUG 1QO3A 5MEND 1QR4A 4NO2A 5K9JH 3GRWL 4OKVA 1VPOL 3QRGH 3X13A 4CMHB 1V3MA 2F5BH 5T1DL 2QQKH 1MCIA 4TSAH 3EYSH 2NY3C 2GK2A 1RUKL 4YWGL 1X5XA 2R2BA 5H2BB 4JVUA 3K80A 1NCWH 4V2CB 1Q94A 1MOEA 1PY9A 4M48L 4WW2C 4M7JH 2MWCA 3S3PA 2Y6SD 2C3VB 2CDEB 2I9TB 3G04A 6CGTA 5TJWK 3VWKD 1G0DA 4DTGH 5F71A 1DN0B 5E5MB 3SDXB 4IOSD 2NY0C 4PJIB 5DWUH 4KY1H 1BEYH 3OB0H 1QP1A 1UJ3B 3GGWB 4RAVA 1OM3H 5SWZE 3H9SB 4GG6F 5T3ZH 1XZ0B 4XVUD 5B4MD 5B38A 5IW6A 2HA1A 2GTWA 1A7NL 4DJMA 4M6AA 1IQWH 4JAMB 1HHGA 3FMGH 4PJEB 4R8WH 4EIZC 2IADB 3LQMA 4NHCH 1MWAB 3W9EB 2IC2A 5MEPA 2H9GA 3C6SB 4ZUWB 1ZLVK 3O9WC 3K7UA 5IEHA 1NMAL 5J89A 2DIBA 4HC1A 5E8PA 1AO7D 2I26N 4CW1B 4JREB 5EUOF 4N0YL 2P47B 5B39B 3C6LC 1E4WL 2ZZUT 2DBLL 4XPBL 2OR8A 4XHQA 1KJ2B 4HF5H 4AY0A 1I1YA 1TTUA 3Q5YA 4CMHC 5C0EA 4PB0H 4EXPX 4EUPA 3GSXB 4YHNB 1RMFL 1XF2A 1KULA 2NY3D 3KPLB 4JFQA 4MMZC 1A7RL 1MCBA 4Y19D 1D6VH 1FRGH 1NDGA 3KLHC 1W8OA 2MCG1 2Z93B 4PRHD 4X0KA 4U6TA 3UTSD 5GS0C 2NY0D 2E3VA 5J11B 3RNKA 2FLRT 1BQHA 3S5LG 2VIRA 4D2NA 4Z7OE 4OZGF 1ZA6A 3BKJL 1RZGB 3MFFB 5KTEH 4NO0B 2VLJA 1SM3L 4X7SL 4NM4L 2NY5C 3CX5K 3MRIB 3DVIA 3JV6B 1UEYA 4UIMB 4JKLA 3MMEB 3RA7L 1I9JL 2WWKT 3LN9A 4OGAC 1YNKH 4WEBL 5I1CL 1NCAL 4HLJA 3KXFD 3ZDXE 1G9ML 4L8DB 4NYLA 2AXGB 3O9WD 2C4FT 3HCVA 3EGSB 4R4FL 2BVOB 4HWZA 4NCC2 1SJVA 4K71B 3X3GH 3OBAA 3QYCA 4UTAH 5AAWA 4RMTA 5D1XA 3LKPA 3SKMB 3ZDYE 3IDIB 3C6LD 2IAND 4ODWB 2R0KL 4WI6A 1FSKB 5DJYA 1LD9A 3CDGA 4Z7UA 2BVYA 4M5ZH 3IDGB 1TLKA 1HI6B 4MCZB 4XXDA 3OKDB 2DQCH 2BDNH 1B2WL 3KLHD 1XR9B 2HFTA 3MLRH 3MLVH 5CUSH 3K74B 5D2LA 1J1XL 3HLAA 1VFAB 1EMTH 3D18B 5GS0D 5F6HI 5J11C 5DSCB 3C60B 4BZ1H 1CFSA 2ITCB 2XWBB 2C3GA 4L29A 3QA3A 3H9SD 2DLGA 5DVNA 3WKML 3LEVH 5J9PB 3IDUA 3IFPB 4K3DL 4ZOEA 4HT1H 1OP3H 5EA0H 3NIGF 1UZ6F 1F45A 1M05B 4OGZA 2GHWB 2VJXA 2Z9TA 3HS0A 4OGAD 2MTPA 4ERSH 2Z92B 1NC2B 1ORQA 3G9AB 3MROB 5HYJB 3ZYOA 3OSKA 1JPSH 3HR5A 4TNVK 3U4BH 3UDWC 1RU9H 4EZMA 4PG2C 4HK3N 3GMOB 4GS7C 5F89A 4WHYG 1VHPA 5KSBB 5ECJE 4AK1A 5CSBA 1NUGA 2YD1A 5FYJL 4WI2A 2FIKB 2P5EA 2G5RA 4Z7VF 4HS8H 1DSFL 2OTUA 3F58H 4MZ3A 3MJGX 3MRKA 2CXGA 3QFDA 2WINB 2EEBA 4PJ8B 5FA4A 4LSRL 5KSAA 3IFOB 3CNKA 4MCYB 4U6XB 4G7VL 1AJ7L 4IMLB 5IMKB 2KZWA 1YNLL 3MRGA 1G7IB 5I9QB 4IRZL 4MVBC 4XTRC 3L3GB 3QWRA 5IQ9A 3ULVH 4QOKB 3VXMB 1KYOK 1AI1L 2B20A 2YN5A 4HBQA 3PGDA 2B1HL 4LQFL 3KPMB 2P44B 2WZPD 3TZVC 4LMQI 1U2HA 1QKZL 4WW1A 4TVPL 4XXCC 5EU5A 4OBSA 4L4JA 1V7NH 3HAEG 3WHXA 3SE8H 5CGTA 4UBDC 5I8EA 3JWDC 4I4WA 4X99A 1FDLL 4K9EL 5DK0B 3ARFA 5JDJA 1M7IB 2GFBB 1I7TB 1MCPL 3P30H 3AU1B 1TNMA 5GGTH 3MNVA 3MUGA 1LE5B 3OKKB 3PHOB 1Q8MA 3GMPB 1JFQL 4QHLA 3GSNL 4LPYA 5IEKA 3GSVA 2VE6A 3WNNA 3THMH 1MCKA 5INCB 4UTBH 1KCSH 1R3KB 2GJ6A 2JIXD 2OP4L 1J8KA 4LL9A 3SDYL 5EO9A 2YPLA 4FQIL 4LHQB 1NFDE 4OV5A 5EO0A 2OCFD 5DJ0A 4OT1L 2VB5A 2W9LA 4X4ME 1N6QH 2YSSB 4OI7A 5EZIL 3H3PL 5I9QC 3M8OL 4MVBD 4X9HA 4XTRD 3BD4A 5I74C 1JZ7A 4U6VH 4I3RH 1A9EA 1DBMH 4L9DA 5T1LA 1UWXK 2MQ3A 3TZVD 2OMNA 4CU7A 2AS5M 5FO8B 1MCWM 5DC4B 5JXAL 5HHOB 1HHIB 4HH9A 4NWTH 2B39A 4UBDD 1UXWB 5DMKB 4KVNL 4NZRH 2Z31B 1XCTA 2CIIB 1RFDH 3R0MA 5L8LB 2VTFA 4RX4A 1P9MC 4D0DA 1KEGL 1JCKA 1MH5A 3DI2B 1NC2D 3AS3A 3KPOA 4TSAL 4PRPE 5CWSB 5HYJD 1FFQA 5KSUA 3UC0H 1HXYA 3FB8B 4OD1H 3X17A 4BKLA 1NDGB 3DHJA 3MYZA 5EUKA 3ZYJA 3P4OA 3VG9B 2JCCA 1NCCL 4XH2B 3F8UB 4QRUA 1RZJC 4F8TA 3AS0A 1T04A 3D3VE 1QHPA 1G7JB 1U9KA 3QIUB 3V7AG 2XY2A 1JNLL 3QUMH 5C70A 3RNQA 1QRNA 3MO1A 1MY5A 1UJTA 2BSED 3B5TA 3O6ML 2XZAL 4UUJA 4H8WH 1OAUL 4NP4H 1S9WB 1J5OL 3WLBA 4JM4L 4DZBB 1KGCE 5GRJH 2F54E 3BWAB 4LRIA 4HSQA 3UO1L 1IGCH 3I6KB 3EYQC 4C56D 3P4NA 4PIRF 1OB1A 3ARWA 4PFEA 3CDCA 1J1OH 4ZUUA 1WZ1L 5EU7C 3WL9A 5D93B 2W65B 1IC5L 3LKPB 4N0FA 3KYOB 2BNQA 4UDUB 5D4QA 1TPXB 5EU6B 3C08L 1FNEA 1SJEB 2A74A 3MRCB 1I8IB 2C1PA 3GSQB 3REWB 4FQ2H 3CDGB 5EBGA 2N7BA 4K7PY 4X7FC 4F33B 2IQ9L 1JI1A 1UB6A 1XIWA 3QEGH 4MZ2A 2HT3C 5DDHA 2UWEA 4PV9A 2HTLC 4OQTA 4M00A 5L7XH 4WENB 1AY1L 1WWCA 4PLJC 1DN2A 4OCWL 5FYJU 3HZMB 5C0AA 2VLRB 3TT1H 2ICCA 2ORBH 4EI6A 5ITFA 4L29B 4N8VG 4YGAB 3QIUC 1S9XA 3BH8B 3DURB 3NACL 5E99H 5BV7H 1OSZB 4JDZA 2J12B 1AFVL 4PRIE 3UTPD 3RWHA 4DK3A 4I2XA 4JRYA 1QFWL 1DJSA 1JHTB 5DI8A 1CZ8L 4X80L 3EYQD 5F89B 3O81A 2CKBH 4ZFOA 2VQTA 2FX7H 3HMXH 3HRZB 3CSPA 2QSTA 3VU2A 1ZLUH 4LCCA 5HHOD 4ZO8A 5IB3A 1T89A 4JY4B 4NKMA 1S8DA 1MIML 4Q9CA 1DFBL 4QNPF 5DK3A 3S37L 3E3QE 2C26A 1I7ZA 2RCSH 2X10A 3IXAB 2ITDA 4OBRA 1UQSA 5D2NE 3AS1A 2HKFH 1I3GL 4OV6F 4WTZA 3L5XL 3RWCA 1IAIM 2KPNA 3WCYA 4W4NA 1I3VA 4QT5A 1OP5K 1INEL 1QLEL 1SYSB 2HT3D 5DK2B 2BDNL 4LU5L 1BWMA 2X4PA 4IM8A 2HTLD 4JZJA 1J0ZA 3MLYH 1YMHA 1T20A 5CUSL 4PLJD 2EE2A 4QHUA 3KWWB 1RUML 3B9VA 4OUUB 4K3HA 4QWWD 4XGZA 4EDWL 4HFWB 4G6FD 3QIUD 2AGJH 2FJFB 1U3ZA 1KF9B 3BEWA 1FO0B 4LCWB 1NCDL 3H2WA 5EA0L 1DBKH 1YQVL 1R5WA 4PLKC 1BF8A 3NAAH 3IAPA 2XKNA 4KTDH 1OQXA 2XKSA 1G7QB 4OFDA 2IG2L 5AWNL 4XBPA 2X4RB 3DIFA 2E7HA 5ID1A 2AK4A 3GO1H 2P8PA 4LASH 3O3EA 3DXAE 4NZTL 4Q6YA 1EIBA 4FP8H 3CFKA 1G9EA 3LQZB 4LMQE 4M5YH 3F58L 3CIQA 4UNUA 5KSAC 2A6DB 4WFGD 3PXHA 4KKLC 2A1WH 5DQ9A 5DFVC 1SYVB 3NN8A 2VDKH 3QH3A 3FAXA 1QSEA 4M6OH 3M1BB 2NY6B 2LVCA 2WBJB 2GJZA 2A77H 2X4OB 1CD0A 3JSSA 5FM5O 2UYLA 3NA4A 3BPCB 1MAML 4DZ8B 4J3OC 5E08H 4PV8B 5IIEB 3O6KH 1EFQA 4KROB 1UKSA 5H35A 5C3TA 3BEVA 4IS6B 3VFGL 3WIHL 4U3XA 5GIRA 4YBQC 1PW3A 1YJDL 1FVDA 2P7TB 3VA2C 4PLKD 5E00B 2E9IA 5T1MB 3KJ6L 3UAJC 1CGTA 1MCFA 4L9LB 4NRXB 3ARTA 1T4KA 1ADQA 1K6QL 5DVLA 1J12A 4KI5C 5EIQA 2YD6A 4K94L 3BFOA 3RWDB 4I0CC 5I18H 1BZ9B 3CK0H 3NCYS 1JNHB 4N9GB 3DX8B 4HIXL 1R3IL 1V3JA 1I3RA 2C5DC 5FM5M 5J6HB 4Z7UF 1KSRA 1IEAB 2JTDA 3FB7A 5IFJB 1MCQA 3EFDH 5KSAD 4Z76A 1G7MA 1JV5B 5EH1A 3O2WL 1U8MA 3OV6A 4KKLD 3G5VB 1MHHB 5JNYB 5C0CB 5DFVD 4D0BA 1BFOB 2QJDA 5D2LF 1F90L 3NGBB 5IHZB 1IEBA 3QWRD 4F7MA 2NY6C 1FE8H 2PCPB 4JDTL 3MRMB 5KAQG 5I30H 2WBJC 3VXPB 5FKPA 2VDPH 2FHBA 4OZFB 3SKOB 4OF5A 3DV4A 4P2YA 1RK0B 2JE8A 4DKFL 5FDYA 3BE1H 3OB0K 4P5TB 1RK1A 4FOMA 2Y1VA 4KROC 3ZKMC 1AGEB 3K3QA 2LABA 2BVUA 2ZPKH 3MXVL 3O4LA 3PIQA 2UV3A 2FD6H 4YBQD 3MLUL 4P9HC 1BWWA 2WIMA 1CG9A 4GKZB 2R23A 4Y4KB 3V5KA 1A6WL 4L9LC 4OAWB 4NNYB 4Y4HB 3UAJD 5FCSH 4RFOH 1A3RH 3FFCE 4KI5D 2MKLC 5C0AB 1HHJA 3X12A 3JXAA 3OF6A 1QR1B 1TMCB 4QXTB 3QEQE 2GJ6D 3BYYA 4U6HB 2EDHA 3GMLB 1MUJB 4P4RA 3QDJA 1KJVB 5F97E 3WHE1 2NY4B 1DANU 4J3SA 4DGVL 1IGFL 4M1CC 4RMQA 1U3JA 5T5FL 1C16B 2XTJB 1CLZH 1OY3B 3MJ7A 4D9LL 3OR7B 4X8JB 4LOUC 3NGBC 5F3HA 4PJDB 4LRIC 5FO9B 4QHMA 2NY6D 5TE6H 4P57B 1QBML 4X98B 3W39B 1FAKT 2WBJD 4N90E 5DA0B 3HNTL 3WS3A 4IHOA 3BWUC 2XYCA 3ESVF 5DUMH 2GUOB 3RBGA 1I1AA 4G7YL 4KRPB 4ZS7H 3U6RB 3J8F7 3TP4A 2XZZA 4MHHI 4NJ9H 5KVDH 2ADJB 4P5TC 4L5FH 4LSPH 3I6LE 1BFTA 3AVEA 1ZEAL 5J1AB 3ZKMD 4YR6B 3KS0J 4OLWL 3CDYA 4KMTH 3ARGA 1KB5H 1HZHH 2BX5A 3V0VB 4RX4D 4S1SL 5FGSA 3T3PE 3L3DB 4Y4KC 4ELMB 1XF5B 1EO7A 1NAKL 2YKLL 4U1LB 2V7NB 4Y4HC 2VDQH 5IMLA 2R1WB 4HBCL 4KAQL 3C5SA 5DYOA 1OPGL 4HH8A 1BD2B 2XY1A 2BVQB 1V8HA 2VDOL 3KPQA 3S35X 1LO5B 1OF2A 2DQTL 3TO2A 1NBQA 4KK8C 1CLOL 1P5UA 4FXKA 3TT1L 3QO0A 1BIHA 2D2OA 3OKEB 2HJFA 4BQ9A 1FLTX 3O3UN 3O8XB 2NY4C 5DVMA 1QRND 3O2VH 4M1CD 5DMJB 2I60L 4ZQKB 2XTJC 3BSZL 3CFDB 3R1GL 3KYNB 3HI6L 3QCVL 3KLAA 4LOUD 4I9WE 5IBLC 1WBYA 1ZSDB 5A2FA 3VDBA 3DECA 5D9SB 2BVTA 1FVCA 3GKWH 1C8PA 5D1ZA 5DRXB 4R90H 3I75A 2ICWA 3ZT7A 7FABL 4NC1E 3PV6A 1VGEH 3FQNB 4XMPL 3KYKL 1QOKA 4XWGL 1FFPA 4P5TD 1H3TA 4LP5A 2PYEB 1SVCP 3VI3E 4L3CA 1GHFL 1D9KA 3QXAA 4M6NH 2NY1B 4IOIB 2I5YH 4PJCA 1KV3A 3D85B 3PGCA 4HJJH 2DIJA 1OP3K 2VSCA 3RVUC 4HQQL 2DTMH 1HXMA 1RZ7L 4L8SB 1IILE 4PJ5A 2A9MH 4KRLB 4Y4KD 2JCCF 2FNBA 4QLRA 4Y4HD 1TZGH 3S6CA 4NC0B 3SKNB 5MP6L 2EKSB 1GC1C 3MNWA 3EDDA 4BFEA 3TNNB 5C0AD 4LKCA 4KK8D 4QRSA 3T2NL 4JLRA 1LILA 3RUGA 2LTQB 2NTFA 2YK1L 3MGAA 3QJFA 4PJ9B 5C7XH 5KJRH 3O8XC 4JFFE 2NY4D 2GW5A 1IM3B 1ZVSB 5KVGH 2PTVA 5SX5H 4FQLL 3U0TB 3AS2A 3EYUL 5D7IE 5EBWA 2XTJD 4HIJA 2EEAA 5HDBE 3NAAL 5EBLB 3MACH 4HX1A 2QR0B 2AEPL 1U42A 4UU9B 5BQ7B 1P4BH 5IBLD 1DCLA 1TVBA 4KJQC 3E0GA 2DB8A 2EYRA 3GO1L 1P1ZA 2XWJA 4JRXB 5IVXE 5ADPH 5IKCA 5DRWA 3GHBH 2BK8A 1MI5A 4OM0L 2EDWA 2CIKB 4X6CB 2VNCA 2DMCA 5JW4M 3IT8D 3WNPA 3V6ZA 1TVHB 3LRSB 3F5WA 4RDQF 1VENA 4ETYA 3SDCB 1OL0A 1RJLA 1GGIL 2NY1C 3EHBC 1EHLL 4GKSA 3C5ZB 1FYTA 3P11L 3DVGB 5E1AB 2UWEF 1LP9A 3RVUD 5JXEA 1JI2A 4L8SC 4D0BB 3IDXL 5IWLA 2DM4A 1F02I 3SGKA 4UILL 1D5ZA 4JVWA 5DUBA 2XRAL 2BY2A 4YFDB 5JHDA 4FFYH 4JPKL 2HWZL 3NZHL 5E8OB 1NC4B 1N3NB 1C7TA 1XFPA 4FS0A 4X9IA 3QPXL 5DRNB 1YN7A 5I1LB 3U9UA 4PJ9C 2EYTA 2EDEA 4NZDA 5ADOH 3O8XD 4I77H 3HUJB 3O4LB 3MLZL 3AY4C 5E8DL 3PJSA 1DQLH 1J0HA 5LXGH 3CLFH 3U0WH 4LLVA 2X05A 1IRAY 5D5ME 2R0ZH 3VMPA 1TQBB 1W0WB 3I02A 5ILTL 4KJQD 4AEIL 2AK4D 5DJAB 5T3XH 4LSUH 3FB5A 4P4KB 3GIZL 1UH3A 1XEDA 5J12B 1UWEH 5KN5A 3C5JA 1WFNA 2DWDA 5BCAA 5GHWH 3MLTB 5GXBB 2E27L 4H0GA 2ZUQB 4WU7B 3SDCC 3BKCH 1ACZA 3OKOA 1E6OL 2NY1D 4X83A 5BZWA 3K8MA 3EHBD 3D87B 3C5ZC 3D85D 1BVLA 3HMWH 1BOGA 1SBSH 1GOGA 1YECL 1QSED 2XTLA 3BESR 3CVIH 1FE8L 4JN1H 43CAB 2OZ4H 3RJQB 3W9DA 3DMMA 2FATH 1ZTXL 5GJSL 5GRUL 3WJJC 5HHMB 5JR1L 3DI3B 3IJHA 4DVRL 3CFIC 3K4DA 4GQPH 4F58H 1CFNA 4PJ9D 5DGRA 5CJQH 4MQSB 1DBJL 3LY6A 2APFA 2J7LA 5A2IH 2PTTB 3B6SA 3VFRA 2P24B 4GMTL 1ULVA 1FZMB 4L3EB 2R2EA 4YBHA 5EBMA 1AO7E 3ORJA 4OLXH 2JB6A 1Q9OA 3LHPL 3S3SA 4J1UB 2VXSH 3PP4L 5FYLD 5TE4L 1J05B 5DYOB 1TQBC 1YMME 5JUEH 3T0EE 3S4SG 2G75A 4GG8A 4XB7A 5JW4Q 4JRXD 1X3DA 1UFUA 1JK8B 1T1XB 5J12C 3TO2B 4BH8A 2OTPA 4TUKL 5CS7A 1RIHL 4U05A 3B8SA 1KPVA 3X14B 5FM4A 4BFBD 4JFDB 1AXSB 2ZUQC 3SDCD 3NFNA 1FC1A 1ZKAA 3G6JB 3MR9A 4KPHL 1I9EA 3C5ZD 4QY8B 1PLGH 3QCTH 5SV4A 3Q0HA 4OZHA 3VXQB 1XR8A 4Z78A 1S7WB 3KJ4C 1FG2A 3UTSE 4MJ4A 2HG5A 1OHQA 2EZ0C 5EIVA 2EDXA 3MRHA 2FSEB 4HDIB 3BW9B 4HWEL 4TNWK 2B4CH 3KS0H 3QWOB 4OIIH 1QYGL 1Y6KR 4E42B 2F74B 4O58L 4PP1C 4KQ4H 1CXIA 4OFYD 1I1AC 1UKTA 2AK1L 4OSUL 3EUUA 2X1OA 5DMGC 1N64H 2W0FB 3HPJA 4LSPL 5F7UA 1NSNH 4U1HA 2WBWB 3O4LD 2K7QA 4PJCB 5EFIB 3PWPB 1KIQA 3AXLB 2X1XR 1UC6A 4UDTA 5KS9A 1ITBB 1XGPA 2ED7A 4CADB 2P5WE 1QBLH 4LPWA 5EU3A 2CLVA 4OLYL 2ZOKA 4H5SA 4XPFL 2DDQL 4NNPL 4ZYKB 5I8CA 4GLRH 3CSYB 5C2BL 3ARYA 3IYLW 4QRSB 1ZLUK 3V95A 3KR3L 3T77B 4DGYH 2ZG1A 3WFHA 5BMFL 4QTIH 2ZCHH 3B5HA 2IMNA 3QAZB 2V5SA 3HZYA 1F6LL 4N0UB 3AROA 4XI5C 3FO0H 3LEYL 2VSDA 3ULUE 3QZWA 2GEEA 4GJTB 3SBWC 3IETA 2EZ0D 4PJIE 3MJ8A 1X5FA 2B1AL 4LSQL 3LN4B 4PB9L 3H9SE 4M1DH 2VERN 1TJGH 5DD5H 4G8GB 4L4TB 4PP1D 5DRWB 5JOFA 5IKCB 3LMJH 1I1AD 1J0IA 1EDQA 3HUJF 1MFAH 5HHMD 3S5LA 3RVXC 5DMGD 4OCYL 1FIEA 4P2RB 4PJEE 3BPLB 3VXNB 3JVGA 5ESVB 3V9FA 1D9KC 3BOVA 1DBAL 1PX4A 4O4YH 4U1JA 5EN2A 4DN4H 4NFDA 2C7UA 3GRWA 2F19L 5KANI 1GGCL 4ZTPL 2EE6A 3D0VA 4L1HA 2BRRL 2RJMA 4APQA 4MD4A 3U2SA 4DCQA 3QXDA 2J88L 2A9NH 1BZ7A 2O93L 3SPVA 5L9DH 2P4AB 1A5FH 4NIKB 3F65A 1NJ9B 4LLQA 4U0RB 2DKUA 4HIEB 3HC3L 3IKCA 4YK4B 1YN7B 4JKKA 2WWKO 1SJXA 3OXRA 4IIQB 4RNRA 4GO6B 4TULL 4JFDD 1KNOB 3QAZC 3O41B 2X4UB 5C09A 1F8TH 4KXZI 8FABA 5GJTH 1PG7W 1KTKE 4QRRA 4XI5D 1Q9LA 3VWJA 3B8YA 4JPIB 4K23L 2X7LA 3I84A 4UT7L 4OD3H 4NC2B 3RGVA 3FOMA 1DR9A 2WBKA 3J7HA 3OKMA 5CGYC 2R69L 2OSLA 4GOSA 2YA0A 3G5ZA 2EDJA 3VE0A 5DEFB 3FO1A 3G9VA 4LAQL 4E5XB 3DPBA 2DWDB 2DQJH 2QBWA 3RVXD 2VITA 3BPLC 5JPMB 2DQEL 5IB2A 4M3KB 5TGBB 5IG7A 3BX7C 5J1TC 4WFFD 5F88A 1D9KD 4Z7WA 4QXGL 1Y6NR 5A43C 3PWVB 1F42A 4AEFA 2V17H 3HKFA 4Q74A 1U8QA 3C9NB 2ID5A 3V6OC 1UA6H 1GSMA 4YHKL 1GGUA 2VABB 4HMCA 4MD0B 2YOCA 3BAEH 2VWEE 1AHWB 1Q72H 2BJML 2KUTA 1FORL 4JFHE 3LKQB 5JORA 2EDRA 4DVBA 5CBEB 1KTDB 5SWQA 1G7HB 1OTUC 4M62H 1KELH 4RAUA 4OM1L 5F6IC 1LDPH 1IJ9A 2Y72A 1CLYL 1MHCA 2F5AH 4I3SL 3S96B 4S10A 4LEOA 1KLUB 1INQB 3JTTA 4M43H 5HGAA 2NNAB 5ANME 1YYMH 5CGYD 5FCUL 1XH3A 3SE3C 3WFEL 3MRPB 3KPSB 3NABH 3QUYA 2Z91A 3LSOA 4D8PB 3TN0A 4LRNH 4XVSH 4G8GD 3BO8A 1MI5D 1YEFH 2HRPL 4I5BA 5JO5A 2PR4L 2RFXA 3IXTB 4PJCF 5A2JH 4LCUB 2JJTC 4P5MA 4U1GC 1A14H 4LHUB 4DQOH 1YEDA 5BW7A 1DQDL 4LBEA 3QULB 4R0LB 5HYJE 3TBTA 1C1EH 3NZ8A 5EOCL 4GW5B 3PHQA 4IMKA 5CGMA 3FAWA 4NT6A 5IESL 5KSBE 5TDNA 1MHEB 3KHQA 3JV5A 3MX0A 4QHKI 4BUHA 4YDLC 4RIRA 3V6FA 4WHCA 4X6DA 4AENB 3V5DB 4YQXL 4OJFL 4U1MB 3KNBA 4JN1L 4EXKA 3RUGF 2BFVH 2ZCKL 3HG1A 4HKJA 1A6UH 1AHWC 3ZT5A 3IDNA 3G5XB 1FN4A 5E70A 2YD2A 5DEGB 1XGTB 3A6BH 2J4WH 4D3CL 3LQAC 1CVRA 5I1KL 4OTXH 35C8L 1OTUD 4Y8AA 4R7DB 3EOBB 4BSVB 5CJQL 3N1PC 4QOKE 2BOCA 1BQUA 4TOYL 2CUIA 3VXME 3CVHH 1CDHA 1BVKA 3I85A 2VR5A 3VXSA 2AV7A 3EJJX 5FXCH 4PJ7A 5AD0A 3GKZA 1T0MB 3DBXA 4U7MA 2A6KB 1A0QL 1ZVYA 4N5UA 4PR5A 3TIDB 4H5SB 3W81A 5HHNB 3KPRA 5FAAA 1QQDA 2GIYA 4KZDL 4HG4K 3Q6FA 3MUJA 1AQKL 1XGYL 5LGKA 5TF1L 1LP9F 5ENWB 3WFHB 4JFPB 4ODVL 4R0LC 1H3XA 1NMBL 1S5HB 5AUMB 3V8OA 2V2TA 4KJYB 1SY6H 4Y5XA 4EKXA 3QCTL 3SGJA 3QCUH 4KQ3H 3FQUA 3L7FA 4UI2A 5AYUL 2QHRH 3OGCB 3QXWA 4KK9C 1DQQB 1LK2B 1VFBA 2HJLA 1PYWA 3IGAB 3RWEB 2BZDA 2AVGA 4JQXC 3ULUL 3PNWA 1EUTA 4FQ1L 3MYJA 4YH6A 1CGYA 1IT9L 1KC5H 4GMSL 1TCRB 3ZT6A 3GUTA 5EOQH 3S5LB 3T0WA 1H3GA 1ZE3C 1DLFH 2FHFA 5GS3A 4Z77B 1YEHH 1S7TA 1N0LA 5CEXA 3B9EA 1J11A 3QHFH 1IKFH 4AZ8A 3HNSL 2NY5L 1G7LB 5BS0B 4PS4L 5B8CA 3DO7B 4UIKL 1U8JA 2MSPA 1INDL 1MLCB 4R2GB 5D7LA 3VH8G 4GRWB 1NGXB 3BGMB 4Y5VB 3SJVB 5GGSA 1CXHA 1JTPA 2XN9B 4CUCA 4P3CH 5HHOE 3LDBB 4O2CA 4PP2B 3MUY1 2Q7YB 3O3AB 4MHHG 3VFVB 1KTRL 3T3MF 1HSBA 3GSNA 4FHBD 2BMKA 3CDFA 4P2OB 1CDUA 3IFNL 1IEHA 1G6RH 4RNRB 3FQRA 1A3LH 4R3SB 2PW1A 1KJ2L 3NCJH 2O5ZH 3CH1A 3FO0L 3BYTA 5DR5L 1ND0A 1M6OA 2OYPA 1FAIH 1MQ8A 4PJXB 4XNUH 2PYFB 3TFKC 3DX6A 4Z7QE 4QTHA 5E94B 1CE1H 3FT2B 1QSFB 4KK9D 1MFDL 3L3KB 3ROOB 1KB9J 5E2VH 3CCHA 3P0YH 1F4XH 4XC3H 3EZ8A 1CN4A 1U3HA 3KLSA 4NPYA 3EDJA 2DM2A 2HFFA 4DN3H 4RGNC 4NKDA 2YRZA 4FNLH 5I1HH 4WHDA 3JVGC 2NPLX 3H0TA 4ZUSA 4Z7WB 2VDNL 4YUEL 1OGAE 3B2VL 3VFMB 3MV7E 5IW3A 4YPGB 2DQFB 3TCLB 1S7QA 4RQQB 3RTQA 3GSOA 4Y5VC 2BRQA 2ARWA 5GSVB 4KJWC 4Q0XH 3LDBC 4APQC 1PKQB 3MQIA 4N8CL 4EI5B 1U95B 4YDIL 3HI1A 3LN5A 5F7DB 2DM7A 5KZCD 1U93A 5D7SH 5EU6E 4LLYB 1WFUA 2Z4QB 1XGRB 4P2OC 4WWKB 4TUJA 5FA3A 1EGJL 4LNVA 1DP0A 4DVBB 1KCUL 4OZHF 2WV3A 2R4RH 5INDA 4MQ7A 3VXTA 4EIGB 1QLRA 3EFFA 3TFKD 1X5JA 4OF6A 2VLRE 2VZSA 3LS5L 4GAJH 5KVMC 4LLMA 1ROWA 2ED9A 5I8OL 4V1DB 4ZUTA 2Y4SA 3H42H 4YFLI 3NCYP 4FQJL 2JB5L 3ILQC 3JWOL 3ARPA 5JOEA 3HAEB 2R4SH 1F58L 1TJHH 4RGND 5CIPB 3TM6A 3O45A 5CD3B 5I1AA 2MQ0A 4HKXB 1OWWA 2BSTA 5KS9F 3FB6A 4YE4H 1WC7B 5BS0D 1NGWA 3PHQB 1CI5A 1AE6H 3BP7A 1A1OA 1MNUH 3TIEA 4Z0BL 3SJVD 2R1YA 1M7DB 1G9NH 4YZFE 2L0DA 4KJWD 1F4YL 4G5ZH 4APQD 1ORSA 4EI5C 1KEMH 3IB4A 2W9EL 1JPFA 3P73B 3T1FA 1BAFH 3MGOB 1JF1B 3ZE1E 1E27B 4CNIA 1Z9LA 2YS4A 1OWRM 4WWKC 1EV2E 4P2OD 5AEAA 1Q9KA 3QJHB 3RWGB 1JN6A 4X6EA 2ZSVB 5B21A 4PGDB 5MEQB 3C8HA 4M02A 1HCFX 3FOLB 2GK0B 2YPVH 4IRJA 1HHKB 1LEGB 2CJUH 3K81A 1WFTA 4XBGA 2ATPB 4XC1H 3Q1SH 5DJ6B 3MRFA 1T21A 3T65A 1OCWL 3VFUB 1QSFD 4EN3B 4M43L 2ICEA 2MPAH 2GCYA 5ESAA 3K2MC 5BXFA 3QUYC 1OARL 1AGDA 1YDPA 2VUYA 4R7NA 3TN0C 5C07B 1A2YA 3D0LA 4CVZA 5IM7A 2A6IB 3ILQD 4LCWE 2G5BA 3O6FA 3RL1A 2A73B 1ETZB 5F7LB 2KQNA 1YEJL 2OL3B 2YUWA 2WM0A 1JPTH 3CFEB 4HZLA 1Y6MR 1A14L 4PREB 3TNMA 4GRWF 4A6YH 5SWSB 1T66D 1H5BB 1C1EL 2J5LB 1R3LA 1RAMA 3EO9H 2GSIB 3WFDL 3ARDA 4G6AC 4KI5E 1SMOA 1U58B 5C0DB 4G6KL 5IFAL 2IAMA 2FBJH 1D5XA 4WHTA 4NO3A 5F96H 5JW4R 3T8XA 4ORZC 3MZTA 5DS8A 4C54A 5L8KB 4TTGA 4RWYH 2R2HB 4EI5D 3VXUE 4JFOB 1EZVX 5DO2C 3O2DH 1IGML 4ZUVA 1NAMB 1EFXB 3H9ZA 4WWKD 1NANI 3EOAB 4YC2B 3E8UH 1KCVL 5I17A 2WP3T 3G6AB 4ZPVB 1F5WA 1PSKH 4OQ1A 1TFHA 1CICB 5I2IB 5GRZA 3FQWA 2C4FU 1A7QH 1DLHB 4S1RL 1XGQA 3MXWL 3RWFB 1UWGH 2BC4B 4GUPA 3WIIH 5KW9L 1SEBA 1BPVA 3K8LA 3ISWA 2QV2A 1EAJA 3CZFB 4IDLA 4YGVB 3QUYD 3AB0C 4G8EA 1GZPB 5HYSA 4V1DD 3TN0D 5TQ2H 2Y07H 3RL2B 3RAJL 2AJUH 4WUKH 5FO7B 4Z7WF 4YO0B 4XNXH 2J6EH 3DTXB 5GGSY 1L7TH 1QNZL 4D0CB 4B7IA 4JFEB 4LAJH 3N06B 4HJGB 5C92A 4GSDH 5FV1L 4FQXB 4B0MM 2FWOA 5I73B 2J5LC 4XBEL 5DTFB 4CL7A 3TPUA 4YX2L 4E41E 4PGZA 4Y5XC 1SY6L 3VFPA 2QSCL 1K5NB 5FF6A 2FGWL 5F7EH 5DD3L 5SWZB 1D5MA 4Y1AB 4KHXL 2IPTL 4JJ5B 4CBPA 3KPPA 3CCHB 1W72L 3NPZB 3HG1D 1BX2B 5DO2D 3SQOL 4XP4L 3VFNB 3ECBA 5GS1A 4X4MA 3QUZB 4NBYB 4YC2C 4X4YB 1LEKB 3FONB 1EHNA 4N8VB 1DLFL 2QQNL 5C0CE 1RUAL 3HHRB 4QRPB 4NSKB 5DA4A 1PKOA 3BGFB 1FFOA 4K9EC 1J88A 5FK9B 1Q0YL 4ZFZB 3V4VL 1K4DA 1FVEA 2VL5A 3WIHA 5F1NA 4KUCD 3ESUF 3QI9A 1O0VA 2H2PC 3VD4A 1B0WA 3MRDB 5FOJA 3ARVA 4BZ2H 1RUQL 4PJAB 1B88A 3ET9F 1SEQH 3GFUA 3SDDB 5HY9B 4MDIA 2WLYA 3D39B 3BUYB 4ZSOB 1A21A 3L1OL 3FRUB 1CDCA 3ARUA 1VCAA 2N4IA 2ICES 4PRPA 5FYJD 5HHVH 3GIVB 1MFEH 1T03L 3GMQB 3QDGB 3VFTA 3NPSB 4FQXC 3UZEA 5SWSD 3U9PH 4L8BA 4X6DF 5I73C 1ONQA 4F37K 3TBVA 1DZBA 1VEOA 4OB5H 2FYYA 3RBSA 1R6VA 2HFEB 1XF3B 2X4NA 5E4EB 1OT2A 2VXQH 1CE1L 1N2RB 4UB0H 5GGUA 4UOW1 5FKAB 4Y5YB 2AKRB 3ZL4H 4NQSB 1ZGLM 5EORH 3LIZL 4F8QA 1WJ3A 5JIPA 1BQLL 3INUL 2HFGL 1EFXD 1U3HC 4TVPD 5D1QA 1N6UA 3QBTB 1ZANH 5GRVL 2X1PA 2XTJE 4KUCF 3ARQA 5DLML 4PJ7F 1R5VA 3BGFC 4G80A 2EDQA 4PJDE 4ODXB 3D69B 3L6FB 3QP3A 1NUDA 4WI4A 5KVFL 4WDIA 1CR9L 1P7KA 4AL8H 43C9A 3B9KA 3RKDC 1OGTA 3RTQC 3TV3H 2H2PD 2F58L 3AMLA 1IKNC 4NBXB 1GJIA 1KT2A 5ALCL 1A9BB 1T5XA 2X70A 3MGTB 3SDDC 5I19H 2Q8AH 4M6MH 3QNZA 5DJXB 3MRLB 4Q6IA 5CILL 1UB5A 3ZDZF 3G6DL 4KRMB 1HEZB 5GGQH 3IRPX 4FTVB 4JFED 1S7XA 3NCEB 4YIQA 3V79C 1DUYB 3NPSC 1PGRB 4PTTA 4ELME 4FQXD 5F1IA 1TNNA 1TDQA 4J3UA 1QVOA 3K1KC 2HKHL 1C5DA 3VFOB 1B4RA 4MA3B 1BD2E 1WK0A 3DUUB 2M1KA 3STLA 3L95A 2VXTH 2D9CA 5GGVL 5SWZD 1QBAA 4UQ2A 2ENSA 1CT8B 1T5WB 4Y5YC 5ESAB 1KPUA 3A67L 3LZFH 3QG6B 1YDPB 1Z3GH 3UJTH 2HYMA 3L7EA 3D0LB 3BDYH 4PRIA 1U3HD 1H0DB 2JK5A 3SO5A 3PP3H 5L0QB 3NFPA 1T2XA 5EIIA 1XT5A 3BN9C 1TJHL 1EBPA 3C8KB 2WUCL 3VRJA 4QRPD 4YHMH 3DSFH 4PRAA 1FO0L 1ZA3B 3RZCB 4XMKL 2AERT 4NQCE 4OCSH 4XP6L 1FV1B 1TETL 3DARA 4QRQB 3RKDD 3RTQD 2CLRB 3EO1A 1N4XL 4HUWA 1GIGL 1CXFA 3G5YA 3DX9A 4U6YB 5DT1H 3B43A 5E8EA 3SDDD 2PYEE 1FNSH 2VISB 5F8QC 5HGBB 1U92A 5D2NA 2Z35B 4LPVA 2GTZA 4JFXA 1TQCB 3QUXA 4O2EA 3DVNB 3MREB 1JGLH 4M7LH 4UAOB 2MQCA 3QDGD 4I8DA 3VW3H 4HFUH 3STBA 2BSRA 2YPVL 4LGPB 1T1ZA 4KUZL 2VZVA 4LVEA 2OQJA 4L4VB 3I3DA 4JPWL 1X44A 4PUBL 4PGBB 4P23B 3WUWA 2FRGP 1UT9A 4ELKA 3QQ3B 5CJOL 3MLWL 1ZHBB 3EYVA 2OS7A 1MIEL 1RUPH 2EIZB 3L5WB 3CX5J 4LIQE 5FYKH 2CMRL 2MHAB 4P59L 3SGDI 2Q76B 4FZ8L 3BZFA 3IDJA 3UZVB 4MD5A 3DSNA 4YHPA 4ODHH 5EZJB 2VLLB 5L0QC 1Q9WB 2UUDK 4O5LH 4U1NA 1U0QA 4F2MA 2N1KA 3BN9D 2K1MA 5D70L 5C0BB 1VACB 2H32A 2X4SA 5CJ8A 3WDIA 4G3YH 5F7HA 5DD0H 1EJOL 4CRPA 4HUXA 3GMMB 5FYLE 3BDXA 3RZCC 1UGNA 1MFNA 2LU7A 3QNYA 1DEEB 3EYOB 3RU8L 5IBTL 1FFNB 2D7MA 4NQVA 5HDQH 1XGUA 3O3BB 4HS3A 4X6CE 3FQXA 1JGEB 5J13B 5DRZB 3ZKQD 1NFDB 3MOAH 2OBGA 4H1LA 3TYGL 2XZQL 2ZNWA 2DI7A 5DURB 3MCG1 4AM0A 3PDOA 1FPTL 1CD1A 4OUOA 5FHAH 1TQCC 5JQ6H 2O5XH 4UAOC 5A2LH 2VXUL 5EO1B 1JPST 5LGJA 3DYPA 1D5BB 1FFOB 4Z7OF 5C0RH 5DFTA 1RIVH 1YEIL 4XPAH 4X9BA 3QDAA 3GNML 5F1NB 5DD1H 4LARL 1FC2D 3FT3B 1LO4L 4E0RA 1KCLA 5E95B 5JPNA 4P23C 4FXGB 2WUBL 2AJZB 4X9FA 5F7NC 5C6TH 3ZDXF 1MQKH 4ZS6C 5KBNC 4WTXA 5TH2B 3IVKB 4PGEB 3ROLA 5EC1B 4WUKL 4NUGH 3GEWB 2QQQA 1FZOB 1R3JB 1YYLL 2Q86B 4HK0B 5FDWA 3ZDYF 5IOPB 2CRYA 3RZCD 5DHXB 1XF1A 2EIBA 4MJIB 2PUQT 3REVB 3V7MA 1KPRA 3D3VB 4NGHL 3RIFK 1K4CB 1WSST 2X4NB 1FZJB 2GAZB 1Z2KA 5JDSB 5J13C 3ULVC 2FL5A 4XZUA 3HTLX 2D7TH 2FJGA 5GS1C 1CGUA 3PG2A 3QEUB 2H6PA 3VJ6A 2F54B 4GQ9L 3L9RA 1R5VB 1EXUB 3B3IB 3RX7A 1BBJB 1LO2H 3K46A 1T6VN 3QFJB 1HINH 4O9HL 1P7KB 3KYAA 3GSWA 3O11B 1QHOA 3OR6B 1AP2A 4XPGL 2ARJB 1JMXA 2H26A 1YJDC 2YXMA 2H1PH 3QI9C 4GFTB 2ZCLH 3QIBA 4XT1C 5B3JF 4G9DA 4P23D 3S35H 3EO0A 3T0AA 2YRPA 5HHME 1I9IH 4S0SD 1T5XB 5JTWA 4ZS6D 5C08E 4AMKH 2GYSA 1JGVH 1CIUA 2VDML 3BZDA 2MJWA 5IUSA 1U8PB 3BIKB 4C83B 1SJHB 4NDMA 5T33L 4L3EE 3VFWA 3P77B 1CD8A 3OKLA 1GVIA 3LKOA 3PL6A 4ZDHA 1CDGA 3FFCA 2ESVB 3MRRB 3QUMB 2PXYB 3VXOB 5LCVH 4HUVA 1LK3H 2VDLL 3QEQA 5IW1B 5DJ8B 5I66A 3K8KA 4LLAA 1UVQA 3H6JA 4YEFA 2NXYC 3MJ9H 3ULVD 5EG6C 4HIHB 1TZIB 2A2QT 3QR2A 4JFDE 5CAYB 3IU3A 4WUUB 1A6TB 4ODTL 3FN0L 4I3GA 3G6JE 5IHUH 4JANA 2V7HB 5IROA 1JZ8A 4NFCA 2X4QB 1WT5C 1JHLH 3M17A 4DAGL 3S36X 3IFLH 1JGUL 3LKNA 4XCYB 3I2CH 4CMMA 4RBPH 5LWYH 1NGYB 1MHPL 4IRSB 4LPXA 4I18B 4R96A 3U4EA 3B9KC 3P0VL 3QI9D 3WUZA 3QQ4A 1JRHI 3P4MA 1WVZA 4Y16B 5I0ZA 5DC9B 4NKOB 1Z0NA 5DVOA 4FFZH 1E4KC 3KYMB 1C5CH 2J8UB 5L6YL 4NKQB 1WIPA 2Q8AL 1T7YA 4Q2ZB 2ADFL 2PW2B 4ETQA 2CO6B 4LSSH 3BP6B 4M93B 4PRPD 3PWPE 1J8HB 5J06A 3V0AC 2J8OA 1IGTA 3GM8A 1MWAH 1KCRL 5IMMA 4F57H 5BJTB 1MJ8H 2X89D 1RZFH 2PXYC 4MJID 5BV7B 4LFHG 3D3VD 4H8WC 1W0VA 1JWSA 2VZUA 1JPGB 4ODSH 4ZO6A 1EHAA 1K8DA 4QHNA 2NXYD 4W4OA 1ZLVH 2BHYA 4XRCB 4D94A 2CGRL 2CKBB 2WAHA 4N0UE 5IT2H 5JW5A 2HTKC 2F54D 3DRQA 3GZKA 4LIQL 1KENH 3MRQB 1HDMA 3BKML 1NEZG 3SEPA 4P9ML 3QFJD 4HHAA 5D6CA 3DXAB 3PWNA 5C0IB 4I18C 3GI9L 1HCVA 1NGPL 3IAGC 1OVZA 1JGDB 3B9KD 4G8GE 4L4TE 4OLZH 4Y16C 1AD0A 5FYLL 3RVTC 4UV7L 4P2RE 5DHVA 3UCRA 3V0WL 4KVCH 5IV2A 1OAZL 4Y2DB 3PWJA 1H15B 3ILPB 1D6EB 2QSVA 3QUXC 4K7FB 4M93C 4NNXA 2XFXA 1OAYL 4LSTL 4XP5H 4J3VA 4UT9H 5HHXL 3TYFB 3V6OE 2HN7B 3O6LL 4ZAKA 2YD7A 1B4JL 1IGYB 4YHOH 1U8OA 2ESVD 5BV7C 2PXYD 4KGJA 1UXSB 1XF4A 4M7ZB 1HN1A 1BOYA 4JR9H 4ORGA 4F7EA 2XG4A 3CMOL 4ZODA 1P7QB 5MERA 2F8XC 3FZUC 3MCLH 2V2WB 4JFFA 3ZE0E 3HNVH 1ZWIA 1BF2A 2G9HA 2DD8H 1F6AA 3JTSB 3WFBL 3HE7A 1WBZB 5D7IA 1K3ZA 3ROLB 1J10A 4UINH 5FGBC 4UMGA 2HTKD 1QSZA 4TSBH 4YHIB 3KPTA 4MGXA 5C8JA 1G1YA 3KDMB 3EDKA 5IVXA 5HJ3B 1AD9B 4Y4FB 4RISL 2GT9A 1GRWA 1G0YR 1E28B 2MNUA 4LGRB 2W38A 4AH2B 2DWEA 2ADIA 4GXVH 3OAUH 3DHMA 1C5BH 5EZLA 1WEJL 2HJKB 3JWDH 4Y16D 1M71B 5CEZE 1G84A 2XI9A 5EWIH 3RVTD 3S4SB 4HPYL 4I1NB 4XCFH 2CQVA 4JB9H 2ADGA 5IGXL 3F7VB 4HUUB 4OFIA 1I8LC 5FB8B 4FABH 2I9LB 1P69B 4PY7A 1ZHLB 3VDCA 1MJUH 1N0XL 3SY0A 3QUXD 3RPIB 4HCRH 4R4BB 4JN2B 2OR9H 1GAFL 3SHSA 5ABDE 2DQDL 2W91A 3FT4A 4HXBH 3OXSB 4CVWA 2RGSA 3SE4A 4MQXC 3RGHA 2YWZA 4WEMB 4WEUD 2D3VA 2AI0L 1JWMA 1P4IH 3MA9H 5IB4A 4ONGL 3DOSA 2UY7A 4FZEH 5AZ2L 2YA1A 3QIBB 3U7WL 1I8KB 1U8NB 1IFHH 3T4YB 5DHYA 3EIFA 3FZUD 1S7RA 2BNRE 3NCCB 1JUFA 4RRPG 2EH8L 3BKYL 3BZ4B 3MODH 3MFGB 1UM6L 3AM8C 5CSZB 4TSCH 4TUOB 1A22B 2JF1A 4MX7A 3D25A 3DX7A 3PWUA 4ZNEA 1RULH 1CDBA 3EJYC 5D5MA 5CHNB 1KXQE 4GW4B 4Y4FC 2C3WA 4YNYA 3DXAD 1K8IB 3KPSE 4Z6AT 1ZT1B 2W0LA 5DQJB 1TVDA 3DGGB 5E2UH 3CSGA 4ZTOL 1UVQB 4S1QL 5FECA 2VQ1B 2G60L 1ZHKB 3I6GB 4DGIL 1FH5H 2CRIA 4EBQH 2WK2A 2P45B 4ZFFA 3G08A 3LD8B 1MF2L 2DQIL 3AC0A 2AJVH 3L3IA 5FUCC 2EIEA 3JV4A 1A4JA 5KVEL 4MQXD 1KB9K 1L9NA 1HIML 5ERWA 2ZJSL 4KTYA 4PJGE 5DUPH 3IJYB 5LGHL 1F4HA 1CFVH 3QIBC 1RZJH 1FGNL 2R39A 2P8MB 5IHLB 1P7QD 4X5WB 3LKSA 2EDBA 3AFLA 1V7MH 2GITB 5JA8B 4KDTA 3QHTC 3GSUA 1GXEA 1R5IA 2DYPB 4MAUH 4ONHA 1AO7A 1L9MA 5D8JH 1DE4B 3B9DA 4NRYB 4YAQA 5HPMB 5CLWA 1LEIB 1KLGB 3N85L 5I75B 3EJYD 5I1EH 4QYOA 1YMMA 1T3FA 5EPMA 4JO4H 3VRIB 4Y4FD 1MSPA 1R0AL 1A7PL 4NWUL 4HC1H 3PWLA 4Z5RB 3UTZA 3WD5L 3MC0A 4M9PA 4F9PA 4N1HB 1TXKA 4M7KH 2BSSA 1WAAE 4KKNA 4AG4H 3GBNH 4Y19A 3ULSB 4NZUL 2J3SA 4WW2A 1F3JA 1U2CA 1UWXH 5H8DA 5J6GA 3UTSA 1DBBH 3LD8C 2P8LB 3FFDA 2D03L 5IROC 4EUPH 4KDWA 1HKLH 1HQ4A 1BBDH 5BVJA 5J1SC 5DJ2A 2RAMA 5LAXB 2R9HC 5JLZB 2JJWA 5I1JL 2FIRT 2UZYB 3I50L 2ED8A 4LCYA 1KB5B 4PGCA 1A6ZA 4ZOCA 1WCBA 3QIBD 3LEXA 4IEFB 1AD0B 3KXFA 1KTLB 2FJHB 2QKIB 4NQXB 3U1SH 2CO7B 1L7IH 1U6AL 3O9WA 4G43A 1T2QL 3L3JB 2OJEA 1NLBL 2OJZH 4H20H 1QLFA 4GKNA 1R3HB 2CDFB 4N5EC 3PP3K 2P5WA 3FRPG 1MY7A 3R4DA 2KH2B 2YUZA 3C6LA 1EERB 2XN9E 3AGVA 2AJXH 3P9MB 5AAMA 3MRBB 2C1OB 1MRDH 1VADB 4KMLB 3WO4C 4K7PH 5MERB 4X7EC 5MI0B 4TQEH 5H2BA 5ISZB 3A6CH 1F6AB 1GH7A 2C3VA 2CDEA 3N1MC 2I9TA 5IMOB 5BZDB 1DN0A 3WJLC 5E5MA 3SDXA 2Y06L 3UPRB 4PJIA 3IJSB 4PJXE 3GK8H 1UJ3A 4PLNC 3GGWA 2EC8A 1DQMH 4N90D 3H9SA 2R9HD 1QSFE 4NN7B 1XZ0A 4X6FB 4Q9RH 4WWID 5ICYB 3VG0H 1IL1B 1C7SA 2DL2A 1OW0C 5DJDB 1I85C 3FO9B 4O51B 4XVTL 4W81A 4JAMA 5F7YC 4K3JH 4PJEA 3I6LD 2IADA 2IALB 3UYRL 2GSGB 4J3TA 3W9EA 4L3AA 4XP9H 1MFBH 2Z8WC 3C6SA 4ZUWA 3D9AL 3SKUD 4EQ2A 4CW1A 4N5ED 5EZOL 5CEZL 2A6JB 1AGFB 4YDKH 4Y2OA 5B22A 2XXCB 3JZ7A 4XNMB 4HXAL 5B39A 3S98A 3RPKA 1PKQE 1KJ2A 4IJ3B 4B50A 5I8KH 4YPJA 4NOBA 5DMIL 3QIWB 3UP1A 3CLEL 3GSXA 1X5HA 4Z0XB 4TTDC 5MI0C 4P3WA 1W2KT 3DUSB 2EE3A 3KPLA 4Z7UE 3AUVA 1U8KB 5TPWL 2YZ8A 2Z93A 5TFSH 9CGTA 3TA3B 4UV4H 5GRYA 2NR6C 3RVWC 4NQDB 3ZTNH 3SQBA 5CBAB 1IGJB 3W2DL 3WEXB 1GPOH 1HH9B 2NX5B 5FUOH 5EOTB 3LB6C 1RZGA 3MFFA 4MQTB 4GRLB 4NN7C 4NO0A 4G6JH 1IGIL 2DI9A 3QQ9C 3JV6A 4UIMA 2AJ3B 1NFKA 2NZIA 3SKJL 4V1DE 3MMEA 3MRNB 4GXVL 2OK0H 4PLOB 3HFML 2ZUVA 1YEKH 3E1F1 2QSQA 3T3PF 3GJFB 1E4XH 4K8RL 4L8DA 3UDWA 1IZKA 1CE6B 5E8NB 4S11A 2AXGA 4PG2A 4YHLH 3EGSA 2BVOA 2FB4L 1MCHA 5CEYB 4HKZB 5BRZB 5ESQB 1A7OH 4JFZH 3WXWH 1RURH 1IBGL 1EGJA 5ACZB 1MVUA 3SKMA 3IDIA 1WIOA 2P5EE 3ZZ1A 3SE4C 4NJAH 1I8MB 4ODWA 4Z18A 3T4AB 4IJ3C 5HYQB 3O0RH 1IC7L 3QIWC 15C8H 4TRPH 4FZEL 3S7GA 1LO0L 4TTDD 1JHKH 3IDGA 4MCZA 1HI6A 4JY6B 3MA7B 5EC2B 2H3NB 4LEXL 3UBXG 1S9KC 1QG3A 1XR9A 1JZ3A 2E7CA 2XQBL 2UZXB 2NR6D 3V52L 3RVWD 5K59E 1VFAA 2R0LL 3D18A 3S37X 5DSCA 1JNNH 2MCPL 3CU7A 3C60A 1CYGA 2ITCA 2XWBA 5DJCB 3T0EB 4K2UH 4HWNA 3LB6D 2DKMA 3VI3F 1MLBB 3K1DA 4MS8D 2YUXA 5J9PA 1HH6B 3IFPA 3EYFB 4PYHA 3QQ9D 4KK6C 1T1WB 1RVFL 1UH2A 3PGFH 3VH8B 1M05A 5C07E 5E2UL 4MNGB 4KZEH 1P4LB 1BECA 3FHAA 1CQYA 2Z92A 4MB4A 1T2JA 3QDMB 5HYJA 1M1SA 5FUZH 2P48B 5D71H 2WP3O 4YJZL 1E4JA 3NTCL 3GMOA 4MLSA 5KSBA 4HWBL 4MLIA 3TBSB 1T6WA 3ZYZA 5DZNA 3VRLE 2FDBP 4P9HH 5HI3C 2FIKA 4XP1H 4XCCH 4Q9QL 1KIPB 3MCKB 1JRHL 3S34H 3OWEA 3BH9B 2WINA 4PJ8A 2IQAB 4MJ6B 4KKBC 3MLXL 3MOBH 5I76B 3IFOA 2JJSC 4B7LA 2X4TB 3QIWD 4XVJL 4MCYA 5JIIA 3SOBH 4U6XA 4IMLA 5IMKA 5D7IF 5HDBF 2EYSB 1G7IA 2GY5A 3L3GA 1I1CA 4QOKA 5HSFA 3VXMA 3V7AE 5ALBH 2FEEI 3KPMA 1K2DB 3QXTA 4NQDD 5IVXF 5D8JL 2Y5TB 1NGZB 3VD5A 3NH7L 1L0QA 2NX5D 1VB9A 1L6XA 4NHUB 3T0EC 4RCAA 4XAWL 3SO3C 4NO5B 3OZ9L 4RBPK 2UZIL 1PQZB 1M7IA 1NL0L 2KZ1B 4OZFH 3ZHDA 1EA9C 2GFBA 4JQVC 4OCLC 1I7TA 4KK6D 5E7FA 4WNQB 2FX8L 2R56L 3AU1A 1P9MA 2AJYH 1EJ6A 4I0PB 3TWCL 3UPAA 2JELL 2YEZB 3SGEH 4F9PC 1CBVH 1LE5A 1RZKL 5CZVL 3OKKA 3PHOA 4JFEE 2BP3A 3GBML 4LF3A 3GMPA 4WTWA 1EX0A 5IJKC 2XXMB 1YEGL 5CP7B 1A1NB 1UM4L 1CWVA 3V2AR 1EEQA 5HI3D 3E6FA 5INCA 1R3KA 5K9QG 4Y1AE 5L88H 3VCLB 1YC8A 4D9QD 5F8RC 4OQTH 4KKBD 1UACH 3BHBB 5GRXG 3GMNB 5FHBH 4HPOL 3OJVC 1J0JA 4BK4A 4M8VA 2D0GA 4WU5B 4OLVL 4U1KA 2YSSA 2A83B 4FQPA 1FIGL 2E6PA 3OKYA 4OIAA 5MHSE 4QRPE 2DRUA 5D5MF 4LPUA 1BJ1J 4MNHB 2B0SH 4OFVA 5FO8A 3UJJL 2AABL 3S88L 5F7WC 3QG7L 5HHOA 3N50A 4FMKA 4GH7B 1HHIA 1YMMD 1UXWA 5DMKA 3T0ED 5HGHB 1ZHNB 2Z31A 4LSVL 2CIIA 1TTFA 3BZEB 1ZLSH 5DQDH 1JZ2A 2M2DA 2DQUH 2DQGL 4PJAE 1YNTB 1XMWA 3H9HB 2XA8H 3D39E 1YPZB 1ED3B 4ZSOE 4BJLA 4I0PC 5CWSA 3QDMD 3T0BA 1FBIH 3FB8A 4F7TB 3QDGE 3K2UL 1E6JH 1KFAH 3ULUC 5B38G 3MV9B 4YHYB 5T3ZE 2ICWJ 4BK5A 3VXRB 4MWFB 1MRFL 4XH2A 3DROB 3MBEB 4H25A 4HEME 3QHZL 1UJ3C 1G7JA 2PO6B 3QIUA 7CGTA 1EEZB 2HT2C 1GC1H 2Q1EA 3ARSA 5SX4H 3Q2CA 4BSJA 25C8L 5AG8A 1S9WA 3I9GL 2EKJA 4DZBA 1NGQL 1V5JA 6FABL 4XPTH 1M7XA 3OL2A 3X3FL 2ATKB 4YXKL 3WE6B 4LPCA 2EH7H 2F8VA 3BWAA 2H41A 4GXUN 5I1IL 3I6KA 3IAQA 4JRYE 1H3PL 1FNFA 1YUHB 3RI5K 2NMSA 5CMAA 4NM8H 4DW2H 3JUYA 2HVKB 4JREC 1KN2L 2P5WD 5E6IB 5BVPL 2W65A 4EUPG 4WY7H 1MVUB 2V9TA 4JGMA 2Q3ZA 32C2A 2CDGB 1NLDL 3KYOA 5J56B 4UDUA 5EU6A 2R0WH 3TJEL 1SJEA 2VLKB 3MRCA 1I8IA 3GSQA 2VC2H 3REWA 4WW2F 2N56A 4I0PD 1CDYA 4F33A 3WFCH 4FTVE 1BQHG 3C2SA 2R1XB 2QQLH 3ZO0A 3ULUD 3PDDA 4UV4L 5F21B 1UM5H 4TPRL 3WSQL 3HZMA 3IDMB 2VLRA 1DL7H 2Y36H 3MBEC 2V5YA 4OCRL 5DGQA 5ANMB 2ZP0T 3WXVH 1NCBH 5L2KB 1A02N 1DVFB 4OCMC 1OAXH 2PO6C 3BH8A 2HT2D 1BGXL 1G7PB 3DURA 4P2QB 2ZKHH 1ZV5A 1OSZA 1C12B 4FQCH 5IR1B 2EDNA 4PRDB 5F9OL 3UROR 5JOPD 1J1PL 2AAVA 4OLUH 3L3OB 1JHTA 1NPUA 3HB3C 4JPVH 1IM9B 2J2ZA 4OGXH 1ES0A 4X5XB 3FKUS 4PGJA 3HRZA 4K71C 1NBVH 5E6IC 1I9RL 4JY4A 4M1GL 3U0PB 2OL3L 4YXLL 1I1RA 4OLEA 2VWEC 4OGYL 3T0VA 1ADQH 3IXAA 1ACYL 3V4PH 5TDOA 1FSKC 1BM3H 3LH2H 1MREH 3IU4L 1Q0XL 1UCBH 4IDJL 3ULUF 3EDFA 5E2TH 5IQ7L 4XHJC 4QF1B 4RGOH 3U48A 3SDXF 1DUZB 1S7UB 4QXWA 3HC4L 5DJZB 1SYSA 1OAQH 4PJIF 5DK2A 4G8FB 5CCKH 1NAML 2SEBB 3MV9D 2ZOLB 4J7RA 4JDVB 4JHWL 3KWWA 3JWOC 1BFSA 4OUUA 2ZNXA 3C60C 3MBED 4L4VE 1VKXB 1DVFC 4HFWA 5KG9B 2PO6D 4PJEF 2FJFA 4NO0D 4WV1B 1MFCH 5HXMA 1S9VB 4UT6L 1FO0A 3V5HB 3PQYB 4LCWA 2YA2A 1DANT 1A6VH 3Q3GB 4G42B 5M94B 1D5IL 1G7QA 2FR4B 2R8SL 3B83A 4G9FB 4LF3B 3HB3D 4GAGL 5C0BE 2X4RA 2FZ3B 5EULV 4KKCC 4FA8A 4AEHL 5H94A 3U36B 3MLPA 1H8NA 3E6FB 5E6ID 3MLSL 2AJSH 4XMLH 3LQZA 2GKIA 3S34L 2APVA 1FFRA 5GZOC 4PJ8C 4JG1L 5HD8C 2VLKD 5C0FB 3ULVE 3MNZB 5F9JB 2A6DA 4JFHD 3CVHB 5JHLL 1KBGL 3BIBX 4U1KB 1TJIL 2OTWB 1SYVA 3T04D 4XHJD 3W5MA 4LCIL 3M1BA 3UTTB 3V4UH 1OSPL 3HPLB 4FQHB 4XB8A 1LVEA 2WBJA 3OAZH 4JO3L 5C9KA 2B2XL 3EOTL 2X4OA 3LS4L 1X9QA 1MEXL 5GISL 3C60D 1PG7L 3BPCA 1ERNA 4MA7H 4DZ8A 4HKBB 4PV8A 1YY8B 1DVFD 5IIEA 1EEYB 1FNGB 4WV1C 1XCQB 4ONFH 4XNQB 4P2QD 4IS6A 5K9JL 3MSPA 4KK5C 3QRGL 4KHTH 2P7TA 2F5BL 5IK3B 5E00A 2QQKL 4BSWB 1CBVL 3EYSL 5T1MA 4PY8J 4L9LA 4NRXA 5A16B 2R29H 1NCWL 1W72B 2QADB 2VH5H 1LO3H 4KKCD 4M7JL 4RMUA 5K93A 3UTQA 1TENA 3C87A 1U8LB 4DTGL 4JZNB 5CINH 3RWDA 2OXHA 4MJIE 4S2SB 1BZ9A 1WGOA 5DWUL 3RI5F 1JNHA 4H25B 1BEYL 4KY1L 4N9GA 1ZGLP 3DX8A 3BT2H 1OM3L 3PHSA 5J6HA 12E8H 1IAIH 1RHHB 1RPQA 1IEAA 3CFBB 4XX1G 5T3ZL 4PJ8D 5GZOD 2RR3A 5HD8D 5IFJA 3U46B 5B3NA 1KN4H 1BJ1H 4J8RB 1JV5A 4JHAH 1IQWL 2IBGA 3BJ91 3FMGL 1MCOH 2RIKA 3G5VA 1MHHA 4BQBA 5C0CA 5JNYA 4R8WL 1BFOA 2F53B 1VGKB 4NHCL 5IHZA 1QUNA 4XNZB 4QOKD 1OGAB 2PCPA 3VXMD 2EDOA 3GDBA 3MV7B 1HQRB 3MRMA 5ICZB 3VXPA 1H3WM 1Q1JH 2AEIT 4OZFA 5CMAB 3QFJE 3SKOA 5IFHH 3PABB 4XPHH 3F7YB 3TH4T 1RK0A 4C55A 2YMXH 2XZCH 2NXZB 1EHXA 1OAKH 4P5TA 2D31B 2Z31C 3BJLA 32C2B 3C2AH 4H88H 2ZSWB 1AGEA 4ZFOL 1CK0H 4HF5L 4EVNB 4HG4J 4KK5D 3R8BB 1CGSH 1N8ZB 4PB0L 5KSBF 2QL1A 4GKZA 4YHZH 3GMRA 4Y4KA 3RWJB 4G9FD 4OAWA 4Y4HA 2NLJB 4NNYA 1D6VL 1FRGL 2QADC 3S8WA 2IGFH 3SE9H 4KFZC 5E7BA 3VG9C 2ESVE 4ACPA 5IB1B 4DKEH 5D96B 1MAKA 4R6UA 4QXTA 1QR1A 3RHWF 4U6HA 5IBUG 3DRTB 3GMLA 1S3KH 3ES6B 1MUJA 2IF7A 5KTEL 1CS6A 1AKJB 1O5DT 1KJVA 2VKXA 5HHQB 3VDAA 1Y0LB 2B5IB 5D7JA 1FGVH 4WUUE 3P4LA 1T83A 1C16A 5E2JA 3LV3B 1YNKL 2EXWC 1MJ7H 2EDLA 4XNYH 3K0WA 3OR7A 4P2CG 4X8JA 1FZKB 1CXLA 4PJDA 4XNZC 5FO9A 4Z8FH 1NCNA 3UTTD 4MB3A 4P57A 4X98A 3W39A 2HLAB 1MCNA 1ES0B 1N6VA 3VGDA 5FEBA 4AIZB 2GUOA 1LE9B 1CQKA 4P5KB 4G6MH 5D93C 5T1KB 3X3GL 3U6RA 1I7UB 4UTAL 2NXZC 4RDQG 3BQUB 2ADJA 2Z31D 4MMXC 2O5YH 1TPXC 5J1AA 4YR6A 4JY5H 1DQJA 2J8UE 5TDOB 3V0VA 4HJ0C 3SCMA 1CU4H 3Q5OA 3L3DA 4M5ZL 4ELMA 1XF5A 1J8HE 4U1LA 2V7NA 2DQCL 2R1WA 3JBG7 2P46B 5I16B 2QADD 2Q87A 4ZPTB 1BD2A 3HI5H 1RIUH 2BVQA 2DTSA 3MLRL 1R24B 3QNXB 3MLVL 5HHPB 2AW2A 1UM5L 1LO5A 1EMTL 3KAAA 1RV6X 1DL7L 3OKNA 4BZ1L 2HP4A 2Y25A 3OKEA 1A4KB 4WGVB 5L2JA 3U7AA 4GAYB 3LEVL 3O8XA 2ZKHL 3CMGA 4HT1L 2B5IC 4WCYH 5LQBH 1NH6A 1WICA 4ZQKA 3CFDA 3RWIB 3KYNA 2EXWD 3T2QA 4ERSL 2I07B 1DQTA 5DZOA 1A47A 1JPSL 1OGAD 3U4BL 1MCCA 1RU9L 1ZSDA 3MV7D 1CF8H 1LNUB 5D9SA 3VD7A 3KPNB 5DRXA 1IAOB 1IAMA 5H94B 2FO1A 3FQNA 2NXZD 2NY7H 4HS8L 4WTZG 5K33A 2I24N 3VXUB 2PYEA 4EDXB 4QRTB 5EU6D 2P1YA 1VDGA 4IOIA 4OCXH 5E4IA 2FEEL 3CXDH 4HJ0D 3D85A 3LH2L 2VLME 4L8SA 3NFSH 4BUGA 3ULVL 3BVNB 3SKNA 2EKSA 4L1DA 4ZMAT 4MDJB 3TNNA 2VLRD 3IF1B 4ZD3H 1V7NL 3SE8L 4NFBA 2W9DH 1S78C 4B5EA 4PJ9A 5I15H 2Q8BH 1AKJD 4A6YB 1IM3A 1ZVSA 5F70A 3U0TA 3AY4A 3P30L 5HGDB 5I0DA 4ALAH 5M7QA 4PJHB 5GGTL 5EBLA 3CFCH 3LQAH 2XNAA 2BY0A 2QR0A 4UU9A 5BQ7A 4JKWA 4E41B 2VDRH 3FCTB 4P46B 3UTQB 4JRXA 2K7PA 3X11B 4HK3J 1CL7H 3NA9H 1IC4H 1S7VB 3VFSB 3THML 1A3QA 5T1KD 1HSAB 2CIKA 4UTBL 4X6CA 2APBA 3QISA 4HGWB 5CJXC 1KCSL 1TVHA 5IVZB 3LRSA 1II4E 2A38A 5C9JB 3MBXH 3ARBB 1J7VR 3SDCA 4Q9BA 4XAKE 3C5ZA 3DVGA 1ZGLB 5E1AA 4JJHA 3ZE2F 1N6QL 5K9OB 4QXUH 4M8QB 4HUMB 5FUCE 2IJ0C 4I3RL 4U6VL 2UVFA 1DBML 4C57C 5E5UB 3TT3H 5E8OA 2NYYC 1HNFA 3BP4B 3CH8A 1NC4A 1N3NA 2W1NA 4OFYA 1RY7B 3WJJA 2DJUA 3MV8B 2ZUTA 4NWTL 5DRNA 1S78D 3PUCA 2EIDA 5I1LA 4NZRL 1RFDL 2YZ1A 3HUJA 4LCWD 4WJ5B 3CFJB 1P7HL 3CAFA 4MNQB 4KTEH 1OTTC 3OJDB 3GMRB 2FX9H 4J4PA 4M9OA 3UC0L 4CKVX 4YZFF 1EH9A 2R29L 5I1GH 4OD1L 1W0WA 3S36H 3ALWA 5DJAA 4NRZB 2D4DA 4P4KA 3ZE1F 4UNVA 1WBXB 3QDHA 3QO1B 1F3DJ 1AQDB 4EOWH 3VXUD 3MLTA 2IH3B 3CD4A 5JIHA 1IAIL 4PJFB 4WU7A 3UJIH 4JGJA 2VXVH 4C4KT 2WLZA 3QUML 4PJBB 1FL3B 5D7JB 1IAKB 4H8WL 4NP4L 3GBLA 1N7MH 3U30B 5GRJL 4F3FB 3BD5A 3GI8H 5D6DA 5ITBH 5DD6B 3BPOB 1QRKA 1IGCL 43CAA 3KLDA 4LLDB 1AXTH 2DQHH 1MPAH 4A2LA 3DVFA 1J1OL 2M26A 2BNUB 4JKPH 4BFIB 1L0XA 2BCKB 1UKQA 2V5TA 2XZCL 3TVMA 4G8IB 1NEZB 4KROD 4MAYB 4HEPG 2W59A 1DQJB 2PTTA 1TZHB 1X5LA 2P24A 4L3EA 1FZMA 4JM2B 4FQ2L 3SCMB 4R26H 1FP5A 3VMOA 1OTTD 4GBXB 4KI5F 1P2CB 2XQYG 4J1UA 3DV6A 3QEGL 1KJ3H 3F62A 1J05A 4E41D 1CFQB 4UQ3A 2IGFL 5L7XL 2PN5A 1BIIB 3NCBB 3GRWH 3W0WB 5F3BB 1JK8A 1VPOH 1T1XA 4S0TD 1PX3A 4GRWH 3OKNB 5T1DH 5CJ5A 4RGMB 1WQVT 2ORBL 3LKRB 3X14A 1RUKH 4YWGH 4JFDA 1AXSA 5L2JB 4LLUB 5E99L 4M48H 4K3EH 5BV7L 4U3HA 3G6JA 1UZ8B 4QY8A 1CVSC 5D7JC 2XPGB 4CJ1A 3NCFB 1T83C 4HAGA 5A1AA 3VXQA 1S7WA 5C0CD 2IH1B 3U30C 3SBWA 4KRNA 1RJZB 5TF0A 4HDIA 2FSEA 3BW9A 1JMZA 3KG5A 4NQCB 1B6DA 3ZKNC 1RZ8B 1A7NH 1H9VA 2CKBL 3QWOA 3WKNA 2CR6A 4JZOB 4W70A 2F74A 2FX7L 3HMXL 4E42A 3HN3A 2NY2B 4OZIB 4BFGA 4KRPC 3MV8D 1NEUA 2W0FA 4ZO9A 1EVTC 2VOTA 2RCSL 4JY5L 1F3RB 4H26B 1X7QB 4C59B 5EFIA 1NMAH 3PWPA 3AXLA 3QQNA 3SCMC 4JM2C 4J12A 4C58B 2HKFL 1RZIB 4GBXC 4N0YH 4CADA 2FGZA 4X7TB 5HPOA 3OQ3B 3RDTB 3WIFA 3L3HB 1E4WH 1T22B 2DBLH 4XPBH 3HI5L 4LKXB 4ZYKA 2AV1B 3MLYL 3QUKB 3PF2A 2VR9A 3CSYA 1N59B 4RFEB 1AIFB 3DUHA 4RGMC 1RMFH 3T77A 2EO9A 2CLZB 4XCEB 1IZJA 2AGJL 1A7RH 4RFNB 4N0UA 5ISZE 4GLRI 4U1IB 4LFHD 1A6AB 1EZVY 5D7JD 4QRRE 1DBKL 4PRBB 4YDJB 4KTDL 2XNAB 1CIDA 5IF0B 4BH7B 3BKJH 2OX5A 4MSWB 5IB5B 2YBRB 3LN4A 1SM3H 4X7SH 4NM4H 4F7CB 1EVUA 4LASL 2HH0H 1WIUA 4G8GA 4L4TA 1RJYB 3NBNA 2NY2C 4FP8L 2Q3AA 4LVOB 3RA7H 1I9JH 4KRPD 1HILB 4WEBH 5I1CH 4W6WB 1EAPB 1NCAH 4P2RA 4M5YL 1G9MH 3VXNA 5ESVA 2EDYA 2VO5A 3Q48A 1Y18B 4R4FH 5GGRB 5K9KA 3SCMD 4JM2D 2A1WL 3HAEH 5E1HB 4GBXD 3V6OA 1AGCB 5CIPH 3WN5B 2VDKL 5I1DB 4M6OL 1AC0A 2WIIB 1BD2D 3BP5B 4IOFC 4U49A 2R0KH 2A77L 1NJ9A 2V6HA 4HULB 4HIEA 4ZXBB 4MB5A 4GG6B 4FRWA 2LTQC 5E08L 3Q6GH 4IIQA 3O6KL 1KNOA 4H0IA 3O41A 3WS6A 2X4UA 2D7OA 1B2WH 4RFNC 4PJDF 3IS1X 1J1XH 3L5JA 4JPIA 3UYOD 1NBZB 4NQDE 2XQYK 4M7LT 3CPLB 1V3LA 4BZYA 2NX5E 3WKMH 3SE3A 4NQCD 3EDEA 4YEEA 3FQTB 1U8HB 2VDRL 4NQEB 3OAZK 1QEWB 5MENB 4QEGA 5DEFA 4K3DH 5EUOB 1OTSC 4Y89A 5E9DB 5I18L 1WWBX 2NY2D 3BD3A 3CK0L 4E5XA 1LGVA 2JJTA 2CPCA 2PYED 3WO3B 4YFLF 4NN5B 5JPMA 2L7JA 5TGBA 1NFIA 1ZT7B 4ELMF 3W82A 3EFDL 3PWVA 4YBLB 3VWKB 1GOFA 4NOFA 3C9NA 5FYJH 3HC0A 5BRZE 4QXUL 4AQ1B 4MYWB 1DSFH 2VABA 2CSPA 4MD0A 1ZOXA 5TDPB 2HVJB 4M4PA 4RA3A 5I30L 1X4YA 4IOFD 1AHWA 1Z6JT 4LSRH 2VDPL 5MEOB 3O3DB 4D9QE 2IFFH 2JJVA 4OZGB 4ZXBC 4G7VH 1AJ7H 3LKQA 1QA9A 3FL7A 1YNLH 4MJ5B 3BE1L 4IRZH 5C08B 5CBEA 3TVMB 1KTDA 1G7HA 1KIRB 1AI1H 4H0HB 4NCDA 5JMOC 2ZPKL 3BIAX 4HS6B 4X7DC 2B1HH 4HIIB 4LQFH 4MXVE 1LDSA 2FD6L 1QKZH 4TVPH 1ZS8B 1ZLWH 2XG5A 3S96A 5T3XE 1WUNT 1F3DH 2E8YA 1KLUA 4HZAA 1INQA 2FX9L 4J4PC 2NNAA 3DV6B 1FDLH 4K9EH 3MRPA 3KPSA 4DFIA 5GS2D 3SDAB 4UQ3B 4D8PA 4RFOL 1A3RL 4P4KC 3QXVA 1OTSD 3KPRE 1HYSC 1CFTB 3IXTA 4LCUA 1EPFA 3IRZA 3R06B 4MNGE 2CK0H 1I1FB 4NN5C 5C2UB 2AXFB 2MFNA 3FTGA 3QDME 4LHUA 3NIDF 4R0LA 3QULA 3IKKA 1JFQH 1T7WA 4GW5A 3GSNH 4PRHB 1FL6B 1F2XK 4YBLC 1H8OA 3E6HB 3RKPA 1MHEA 5E24E 1CLZL 1S9YB 1ODAA 5D6DC 4L8CB 4AENA 3WDHA 3PDGA 3V5DA 2OP4H 4OD2A 5IJVB 3SDYH 4U1MA 4ISVB 5ICXA 5TE6L 2E9JA 3M45A 2EDFA 2M8XA 4FQIH 4JQXA 1PBYA 2JJUA 3G5XA 1NC4D 5DUML 4CVXB 5DEGA 4OT1H 3LVEA 1XGTA 4ZXBD 4ZS7L 5EZIH 4NJ9L 3H3PH 5KVDL 1JZ4A 3M8OH 3TVMC 3WDJA 4L5FL 4X5LA 4R7DA 3EOBA 4BSVA 2O61B 4KMTL 1KB5L 1HZHL 1FJ1B 3V8CA 5JXAH 4M03A 4U0QB 1T0MA 1NDMB 4DOHB 3H9YA 4D9RE 1IQDB 2A6KA 4J4PD 1Z5LB 4KVNH 2VDQL 3TIDA 3EBAA 3WIFB 4X6CF 2IANB 3SDAC 5HHNA 4NQED 4OF8A 4P4KD 2J1KA 1WTGT 4Z7VB 1QFPA 3C8DA 5E9DD 1MAJA 4HWBA 1KEGH 1HYSD 1F11B 1WAAA 4YDVB 5ENWA 4ZOAA 1I4FB 4JFPA 4X4XB 4P99A 4WO4B 4K3EL 1S5HA 1ZAGA 3F6LA 5AUMA 4KJYA 5M95B 3O2VL 4DEPB 3L5HA 1NCCH 4OKDA 3CUPB 3OGCA 5D7KE 4GW1B 5JW4N 1DQQA 1LK2A 3TBYB 3IGAA 3RWEA 3GKWL 1JNLH 1S7SB 1B0GB 3O6MH 2XZAH 4R90L 1OAUH 2Z8VC 1J5OH 1TCRA 4JM4H 1VGEL 5JOPE 4Z77A 5C08D 3TVMD 3UO1H 3ZKXB 1JWUB 3OG6B 4M6NL 1G7LA 5BS0A 3DO7A 2I5YL 2NW3B 1DDHB 4HJJL 5K9KB <