2WUCH

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp and ac-kqlr-chloromethylketone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTINGTYIHWVRQAPGKGLEWVGGIYPAGGATYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAKWAWPAFDYWGQGTLVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 41
structure length 218
sequence length 220
ec nomenclature
pdb deposition date 2009-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wucH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wucH01
1RZKC 2Y9RT 4NRYA 4MXVF 3C60B 5EU6B 2CLZA 2EXWC 4X0KB 3ROOA 2Z9TA 3U6RA 1MNUH 4U1KA 5D7JA 1PZ5B 2C3GA 2C3VA 5FYLD 4HS6B 3PL6B 2IJ0C 3QJHA 4HFUL 5C70A 5F7WC 4ZG1A 5I1LB 1CI5A 3GFUA 1NKOA 3L3DA 4P4KB 5C3LD 1TQBB 5JW4Q 3EOAA 2F5AL 1BVLA 3BH9B 4YXHH 1MIMH 3MODL 4PRPB 1FL6B 1BZ9A 4HWBH 5DLMH 3T08A 5EO9B 1HILA 1A1NA 3FHQA 1S3KL 5B4MC 5ICZB 1VEOA 5E6YA 3TBTB 2C4FU 1EUUA 1B2WH 3A6CL 2ITCA 3D6GA 3TJHC 1NQBA 4LAJH 1YECH 5E6IB 2HMID 4G3YL 3BP5A 2CMRH 3C2SA 4U4BA 4NZDA 1QRNB 5JHLL 4EBQH 2DDQL 4ZD3L 3C5SB 4O9HH 4OAWA 4M1CD 3RQ3A 2DF3A 4W6WB 4ZFGH 5BW7A 4G6KL 2X4NA 2FDBP 5T3ZD 4TQEH 4ZDHA 2GK0A 3U0TA 1BD2D 1CFSB 4OZ4A 1VESA 4XNUH 4QHMB 4LPCA 4MD5A 3BIKB 2MCPL 4TTGA 5KS9B 2CLRA 5TFSH 3LKQB 4JPWL 1J10A 4NQCB 2BSSB 4CVZB 4IRJC 4M3KB 3QNXB 1PBYA 5DD0H 2ADIB 2EDXA 1IRAY 4P2OB 3LV3A 1T0MA 1WCQA 4PV9A 5B22A 3HZVA 5SWQB 3V4VL 1ZGLP 1KNOA 1WC7B 1N7ML 4UIKH 3W0WD 1D9KA 1NC4D 1M05B 1T4KA 3QUZB 1CFQA 1MOEA 1V8HA 1VCAA 2EH8H 2ICWB 5D7IB 2Q7YB 3HNVL 3VXNB 1SVCP 5F7UA 1JWSB 4P3DB 3TVMB 5D2LF 5MENB 3G6DL 3WO4B 4YDIL 1PD6A 1CGSL 5IK3A 3E6HA 1FNGA 4OQTL 2R0KH 4L29B 1QNZH 1J8HE 1OCWH 2BC4B 3D0LA 5CCKL 3ARYA 5D9SA 3EDDA 4E41A 3KYMB 3MUJA 4IMKC 4YNYA 3S4SB 1ZA3A 4F7CB 1U58B 1DBML 4HBQA 2CO6B 2FECI 4NSKB 1KTLA 3UTTA 5D1QA 2J8UB 3RNKA 1CD1A 1W72A 4UTAL 3G04A 4DKEL 4JFPB 1TTUA 2CDEB 4YXKL 3ARRA 4JZJC 4PR5B 3MC0A 2YRLA 4Q9RL 1QBMH 4WNQA 4ZFFB 1T89C 1CIUA 1KENH 3K8MA 5JPMA 2ARWA 5DJ2B 4EN3B 3IU3B 2DM2A 2DIBA 4IOSD 5I18L 1CFNB 5E8EB 3RIAF 1ED3A 1FNSH 1GXEA 4FZ8L 3AB0C 3U7WL 1MCIA 2NR6C 1IFHL 1M6OA 4XBPA 3WKNA 5HVFB 1FAIL 4HIXL 3L6FA 2Q3AA 2CIKA 3DIFB 4KJQD 2D2OA 5HHOB 3O81A 4FQXB 1JWUB 5HSFA 1EZVY 1Z2KA 4Y4KB 1KLGA 1T20B 2XA8H 3HPLA 3VXME 2YRZA 4XAWH 3BKML 3ARED 5J1AA 4NQVA 3X17A 4Z0XA 4ZFOB 1H8NA 3MOBH 1QFHA 3V7AE 3HI1B 1CTNA 4JHWH 5DRNB 3PDGA 2NTSP 1JNLL 2IBZY 2CK0H 4KAQH 2YC1B 2MPAL 3GSNA 2EDQA 2WV3A 5F9WB 4YC2C 5HJ3B 1R6VA 4YHZH 3MX0A 5LXGH 4UV7H 3OGCA 4HWEH 3PWNA 5D2NB 4NN5C 5IBTL 5EU6E 1TZGL 5KVMC 2WP3T 3OAYH 3IDIB 2MHAB 4LRIC 4N5UA 4QNPE 3T0EB 1AGEA 5GSRA 1H3PH 1U93B 1HOCA 4Z7VB 1G7IB 2VXVH 5D72H 3LKRA 4MA1C 4XP4H 1BP3B 1NMBL 3T77B 1MH5A 4I5BB 3MGTA 5GGVY 3AM8C 4I2XA 4N0UB 2I27N 4GRWH 1X5LA 4HV8A 3BWUC 2FNBA 4XMLH 3OR7A 2R1YB 1IAOB 4U49A 3X3FL 1DANU 5BMFL 1BEYL 1XCTB 3IYLW 5LGKA 2XXCB 1QFUL 3LZFH 3S36L 4EOWH 3DO7A 1U8IB 3WS6A 2DM4A 1ZSDB 5F1KC 1MJJA 2BVPB 1NJ9A 3LQMA 3WUWB 2X89D 3BZ4A 5E2WH 3PWUB 1QRNE 3I6KA 4PJCF 1U8OB 1C08A 4BSWA 1SEBB 1YY9D 5C07A 2X7LB 3DYPA 4P5KA 1KN2H 4FRWA 4OZHB 5CHNB 5J1SC 3F58L 5ESAB 4OGAD 3GI9H 1PEWA 4MCZB 5FKPB 1MCOH 1A7QL 1GIGL 4F7MB 4P23C 2D3VA 2JB6B 4TTDD 5KS9E 5EA0L 5I16A 1AE6L 4IS6B 3A6BL 3DYOA 1DQJB 4NQCE 3V6BR 4OB5H 4PD4J 2Y5EA 1RHHA 3ARVA 4IRSB 5DRWB 3S98A 4IEFB 1NLDL 1A0QL 3WN5C 4LHUD 2DLIA 1HIML 1IC7H 1MJUL 4KKCC 3PGCA 2R29L 4PJ9B 1KJMA 2E6JA 2ZG2A 3QIWA 3ZKXC 4Z5RB 5MENE 3LVEA 2JELH 4HWZB 1C16B 2WIMA 3NFSL 1E0OB 5IBLD 5EIIB 2ZUVA 3V7AG 1NGYA 1U92B 3QWRA 4JM2B 1WICA 3HE7D 4OZIF 5BRZD 4LLUB 4YPJA 2ZUTA 2BOBA 4FQIH 2A74B 5F3BB 3MLZL 4F3FB 4UNUA 4XHQA 1OAQH 1FNHA 3MCLH 3RFZC 2VL4A 4PJFF 5GJTL 4X8JA 4AYFA 3EJZC 1T5WB 4DW2L 3PXHA 4PTTB 1JGUL 3U9UB 4OGXH 4F7EA 2RIKA 4WFED 3TPUB 4B7LA 1KPRB 3V6OE 3VI3E 1G7JB 2CDGB 2VLME 3M07A 4C56B 4TSCL 1AQDA 1S7QB 2Z8SA 4NZUH 3QCTH 3DVNA 4DVRL 5EU7E 3EJYD 3UPRA 1DR9A 4KXZH 2H6PA 1ADQH 1JYWA 4ODHL 1FVDA 4LCCB 4YHMH 3C60A 2H32B 4FTVB 4P57A 1T0PB 1EUTA 5IMOA 3U30C 5DEFA 4LRNH 4CDGC 4PJ5B 1IZJA 1PZ5A 2AJXL 5I8CA 2J88L 3STLA 3U9PH 5I15H 2VOTA 5HHOE 2HYMA 4MX7B 3V0WH 1X44A 2P5WD 5C0GB 1WIOA 1NCWL 5HVHC 4N9GA 4PRPA 3UTSD 4WUUB 2NY0D 4NC2B 4XCFL 8CGTA 1YNLH 5AG8A 3IDYC 2OJZL 2APWA 2NY4B 4FABH 1EEQA 1X5HA 5E6IA 1JZ7A 1XF1A 3FQRA 1X4XA 4ONHB 4YK4C 2VDLH 1VFBA 3V5KA 3W0WA 2AAVA 2YSSB 4Z7WF 1NC4A 1I3RA 4Z7UF 5D2NE 4GG6E 4O4YL 4QOKE 4YLQT 2VRAA 3IFOA 5EU5A 3U79A 4J2XA 4M9OA 3T0EE 4YXLL 4KK8C 2ADFL 4L9LC 1GPOH 5F7EH 4Z7VE 2X70B 2BVQA 1Q1JH 2ZOKA 4D0CB 4ZNEE 3SE9L 1CU4L 1YEIL 4ZUSA 5DEGA 3QUKB 5E8PA 1RZIA 2BSSA 1U42A 4N0UE 4CVZA 1GJIA 3N85L 1YEHL 4DZBA 3TEUA 4EJ1C 1GCFA 5IB2A 5EC1B 5I76B 1OAKH 3B8SA 5HHMD 3GMOB 5LBSH 4E5XA 3S4SG 1L9NA 1HHKB 3UPCA 5ABDE 1J11A 1BIIA 5BXFB 5IESL 5DMGD 1IC5L 3L5HA 4YHKH 1MFEL 5CP7A 1A22B 4AH2B 5E94B 1FVCB 1ACYL 5GGTA 4OZHE 1F90H 3HE6D 3C6LB 4XPFH 3VD5A 4OJFH 3BMVA 3IJHB 2BC4A 3ZMRA 3CDYA 1JFQL 4RFOH 3WKMH 1GC1L 3MFGB 5F71A 4I1NB 4K3JH 4PFEA 3S4SA 4F7CA 4DZ8B 5FDWA 4AL8H 2HT4C 1GGYA 1INEL 5FK9B 4NSKA 2Y06L 3DMMB 4XC3H 1U8MB 5DD6A 2AV7A 2CDEA 3AMLA 4M1GL 4EDWL 2VE6B 2V17L 1D5ZA 1FH5H 1X6NA 2YOCA 3AREA 4UQ2A 3BPNB 4OSUH 3MLPA 5D70H 3KLAA 1IE5A 5DJ2A 1DVFC 2FEDC 1J05B 3GNML 4MZ3A 4HWBA 1CFNA 3S35X 3GDBA 3TFKD 3QPXL 5HDQH 3KPRB 4JJHA 25C8L 1LK2B 3VD7A 1JP5A 5C0IB 4NBYB 2QSTA 4OTXH 4QRUA 4LQ1A 4Y4KA 4PB0H 1R5WB 1MWAH 3VJ6A 4TVSa 2CXGA 3R4DA 1IGCH 3LKPA 1KSRA 3OG6B 3WO3B 2HRPL 4Y8AA 3ARBC 4Y5XC 5DRNA 2HT2D 5C0AD 4RMVA 5FGBA 2CJUH 4G8GD 1K8IB 3MRBA 3G5YB 4G8FA 4HGMA 2VXQH 2YC1A 3HNSH 2IPUG 1AY1H 1W0VB 2VABA 3SCMB 1JPTL 4H88H 2UYLA 1Q9OA 4FTVE 5DHYB 3DSNA 2X89A 1A2YA 4PJ5E 1SJHB 1A6WH 4WV1C 4HSQA 2BFVH 1KIRB 5E0QA 3WUWG 1A02N 4JN2A 4Y1AD 3NFPB 4P48A 4WUUE 5B8CB 3EO9H 1IGYB 1CD0A 1MUJB 1JF1B 4XMKH 4ZAKC 1HDMB 2EYRB 2XN9D 2ZCKL 3ZL4H 3OKLB 3S97C 3MRQB 1YC8A 3V52L 1TZIB 2XTJC 2GJZA 1NCBL 3BP6A 1OM3L 3PUCA 3GMQB 5E5MB 3DSFL 4OF3A 4YFLI 3Q3GB 3WUWA 3PNWB 5A1AA 3JV5A 4HS8L 4JHAH 3DGCR 3QUYB 2WANA 1UENA 4CMHB 1RJLA 2X7LA 2X1QA 1AFVL 2Z31A 1MCHA 2FWOA 3BE1L 4IDJH 4JR9L 1UT9A 1B0RB 3OJMB 4GKZB 4XI5C 4JQVA 1LP9B 1AGBA 4Q6IB 2EDKA 3EYFA 3O9WD 2OM5A 5CZXD 4JFQB 3QIUD 4NKDA 1J7VR 1HHGA 3QG7H 1S8DB 2JB6A 4NO3B 1A6UL 5HI5D 3PWPB 1KTRL 1UYWH 1DQJA 2J4WL 1HH9A 3B2UD 4QRQA 5BRZA 1OP3H 5DMYA 1J5OH 5IOPA 2HFTA 3NA9L 5EU3B 1FNFA 3TYGL 3U1SH 4JO1L 4IRSA 2P47B 4ZPVB 1MLBA 4LLWA 4I9WD 1HSBA 5IW1B 3T8XA 5DK2B 4XPHL 1F4XH 2AJ3B 1NLBH 2LAGB 1YEGH 4FS0A 5IVXB 4M6OH 4OKVB 5GIRB 2OXHA 1AXSB 2X4TA 3GHBH 2B4CH 2KL6A 4D9RE 1C16A 1FCGA 4LK4A 4L8SC 2Y25A 2QKIB 43C9A 5GRWA 3SGKC 5B38B 3GUTB 5EIIA 3ZE1E 2O5ZH 4JM2A 4RFNC 1XGPB 1VKXB 4F3FA 1P4IH 1AH1A 3D48R 3SDAD 1BGXL 3EOYG 3IS0X 1KPVB 4PTTA 5DTFA 1BQLL 2W9EL 2PF6A 4RA3A 4G43A 3ZLQC 5C6WH 1U8JA 4GRLD 2P5WA 4YR6B 5TGBB 2OK0L 4QGYA 3UTSA 5E2UL 1RULH 4ODXB 4X7SH 2EZ0C 2LAAA 1WZ1H 3DVGA 4ZUVB 5JXAL 1RZKL 2BNQB 2L7JA 1MCRA 1AXTL 4MQXC 1AHWC 4XBGB 2XT1B 4WI6A 1LHZA 2ZG1A 2GTWA 4JO4H 3NPSC 4WWKC 1EEYB 3C8HA 4QYOB 3U7YH 4LU5L 2AJYH 1K4DA 1AGDB 2ZSWB 3RJQB 1SEQH 3KPRE 4XAKD 2Z91B 5CEYA 4LSPL 3INUH 5JR1L 2CRIA 3P30L 1RIHH 5JTWA 1U8PA 4F57H 3SBWC 2MWCA 2XFXA 4Y2DB 2EDYA 5GS0H 1PG7X 5C0GA 1J0HA 2YKLL 3LEVL 4R2GD 5DEZA 4GAYA 5F6HI 4NQTA 4ZODA 1S5HA 1T7WA 2CUMA 4PGCB 3WS3A 1P9MA 3PDDA 5GS3A 1RK0B 4N9OB 3L9RB 3CC5B 2HJFA 3NZ8A 4QRRD 1T22A 4H0HB 1I85A 2XV6B 2CRZA 1D6VH 3DUHA 4J3OC 1WV7T 2AXGB 2EDWA 2R8SL 1CIDA 3DVIA 1QSEE 4MD0B 2A6JB 5EULV 4HXBH 4JANB 1RUPH 2LV4A 4ODVH 5HHXL 1WQVT 4W4OC 4ONHA 3ZT5A 2AS5M 5EZLA 3QO1A 3JTTB 2VSDA 4QHKJ 3O6ML 4H26B 5EZIH 3UXFA 2GHWB 1I1AD 5I0DA 1A7RL 3HA0A 3VFNB 1IKFH 1H5BB 2OTWA 3GSOA 4DKFH 4DUXA 1UKQA 5IEKB 2DLFH 5DR5H 2NXZB 3TN0B 1Q94B 3BRFA 1L0YA 3G08A 1V3LA 5IMMA 4I18C 1IARB 3ARWA 4D0CA 4BUGA 2LU4A 2V7NA 4HUKB 4PY7A 3MSPA 1X6LA 4XP6L 1I3UA 4WUKH 4P3CH 4GQ9H 1D6EB 2IBGA 4ZSOA 3RDTD 3H3KA 1CGUA 3S34H 3RTQC 4E42B 1KCVL 5EC1A 2LTQB 3M17A 4JO2H 4WHTB 4UNVA 1LO4H 3T2PA 3TV3L 4FQ1L 2Q20A 5IHLB 4ZS6D 5IB1A 2D7OA 1NBQA 3IXTA 1HHKA 5DMKB 2C9AA 5C0JA 5KTEH 2RFXA 1CR9L 4LSUL 5L0QC 1AD0B 1G9MH 1U3HD 5C7XH 2P1YA 5DQ9A 5IWLC 5A16B 1KULA 2EEAA 3HI6L 1I8IB 3ABZA 5FGSA 4QF1A 3QI9B 3D87B 4LBEB 4MGXA 3C6LA 4HK3J 4BFBD 3D0VA 3MRRB 2K9UA 5B4MD 4AMKL 4PRID 1QRKA 1DQMH 1LP9E 5I75C 3L5JA 3MV8A 7FABH 2EDDA 3AXLB 4GUPB 1QO3A 4Y4FB 4S1DD 4MB4A 1ZA6A 5D2LB 4GXUM 1C1EH 4P5TB 4QY8B 1KC5L 3WSQH 3PWPE 5FK9A 1XF2A 1YMMD 1ADQA 4YDKH 3I02A 1U8MA 5AAWA 4UTBL 5M94B 3D39D 1ONQA 1NCUA 2X41A 1V5JA 5SV3A 2XQYG 3K1DA 4YBHA 3MRFA 1HHHB 3AROA 3UAJD 2D7TL 1F42A 4ZUUA 5GGUB 3BAEH 3QG6B 3KR3L 3O4LB 2RAMA 5IVXE 5HD8D 4LAQL 5GRXG 3RHWF 2HG5B 1UVQB 5C0AA 5D96C 4IOFD 2DQJH 4QHLA 1NGZA 2EO1A 4UV4H 3IDMB 4UDUA 4MLSA 4HAFA 3OJDA 5IW6B 4FZEL 4IRJD 2VQ1B 3BD3A 4KQ4H 3FQUB 2UWEE 3PHSA 2QQLL 1U8HB 3CUPB 3OG4B 4OCNC 4OCLC 1KIQB 3I6GA 1Y6MR 4ZTOH 1IC4L 2FBJH 2I26N 2YA2A 2H3NA 2F58H 1J9CT 5D1ZC 3RX8A 3MRKB 3T2OA 5J13B 4KUZL 1WBXB 3T0DA 4N68A 1OL0A 1R24A 5GS0D 2EKJA 4HEPG 4HF5L 3G5ZA 4ACPA 4JREC 4Y1AA 1LO5A 1KJVA 1MCJA 4NKMA 3FCTA 4TUJB 5IV2B 5JORB 4OIBA 4O58H 4QRTA 2BNQE 1TCMA 5H2BB 3PHQB 2XN9A 1FE8L 7CGTA 4HJ0D 3EDFA 2OZ4L 1A14H 5EOCH 3SCMA 5ADPL 1EO7A 4XGZA 4YIQA 4C83A 2P45B 3F7YA 4XWOD 5HVGB 3LKSB 3GIVB 2NXYB 4EKXA 2QR0B 1IEBA 2COQA 4PRHB 2CKBL 1L4IA 3OAZK 4HUXA 4JG1L 4U6VL 1WJ3A 3ALPA 4M7JL 3BGFC 5HI4C 3FRUB 2DTMH 4ELMF 3WDIA 5L7XH 1OGTB 3I9GH 4XH2B 5AG9A 1NFIB 4MXVE 3HAEA 1MHCB 2VDRH 2HVJB 3O9WA 5B8CA 4WDIB 1IGYA 1MUJA 1JF1A 4KHXH 4KGLA 2EYRA 1CICD 2BXYA 1RIVH 4NPYB 1XGRB 4BUHA 3BT2H 4A6YL 2P24A 4QWWC 1JZ6A 4GLRH 4JAMB 5JHDB 2HJLB 2WIIA 3NCYP 3Q3GA 1RIUL 4R4ND 3IGAA 3PNWA 1UXSB 2KKQA 3NZHH 5ICXB 5HYJE 4R7DB 4K9EC 5TPWH 4OBSA 4J1UA 3FT2A 5DUML 1D5XA 2IPTL 3S3PA 3BJ91 4JDZB 1KCUH 1IJ9A 4FNLL 4TOYH 5GGSB 3SKNB 4LPYA 4WO4D 1YYLL 4PJEA 1KEGH 5LWYL 1NGQH 3FO0H 4PJCB 4NO3A 3TA3D 4L4VB 1MAMH 2OCFD 4U33A 2B1HL 4WFFE 2DLEA 3MLSL 1UJ3B 2IBBA 4OI9A 1OHQA 4PJHA 3MGOB 4OGZA 5DS8A 4GSDL 5FM5O 5ERWA 5B38G 4NRZB 3SDAA 3W11C 2UZYB 2H1PL 2DQEL 5IB3A 5JXED 3OJ2C 5IW1A 2AEQL 1F4YH 3QIBD 3VXOB 4NP4H 4PGBB 1S9YB 3MLTB 5DK2A 3NABH 3GSVB 3R06B 3RVVD 5IGXL 4M48L 4NO5B 4GRLA 4G6MH 1MWAA 2HTKD 3V7MA 2DBLL 1AKJD 4Z9KB 5I19L 2A0LC 1Q9WB 3PHOA 2A73B 1UC6A 1T66C 4M00A 3V6OC 3T1FA 5F1IB 5B38A 5IHZB 4PJBF 1LDPH 2ZUUA 5EUOA 4JFFB 5I8OL 1AP2B 1F97A 3BH8B 3QNZA 3VXSD 1RVFL 3HR5B 5D6DA 3RKPA 3GGWA 4YUEH 5JOEA 1HI6B 4KKLD 1B4JH 5D2LE 5DRXA 4XXDB 5FV1L 5EU7C 3MZTA 4HS3B 4UU9A 5KSBF 4F9LA 1ZS8B 1ZT1B 3PQYD 3BHBB 2DQFB 2FBOJ 3KPOB 4GH7B 1F11B 3NIGE 2IGFH 4OZIB 1EHLH 3EYVA 1OTTC 3WFDH 4DTGH 2WLYA 4I0CC 4EQ3A 5DA4A 2DDQH 4ZD3H 3H3BC 5F9JA 4BQ6A 4PJFB 1TTGA 4B5EA 4MXWL 3O4LE 4CVWA 1OB1B 1V3KA 4XBGA 2W60A 1ZVHA 3P9MA 1EEYA 1G0YR 4QYOA 2LQRA 3D5OF 1N0LA 5FFLA 6CGTA 4FXKB 3JUZA 1Y0LB 3T65B 1JTTA 3B83A 5EPMB 4UT6H 5CZVL 3N0PB 3WHXB 1J8KA 3O3AB 4X99A 4DKDC 1B90A 3MJGX 5L2JB 3ULVC 1L7IL 3HC0B 3K2UH 1EV2E 3OPZL 1F4WL 5E7FA 2Q8AH 1NDGB 5I1JH 1T80A 4ZOAA 1RMFL 3O0RH 5TJWK 3VGDA 5I1HL 4KDTC 1BD2B 1INQA 2JCCF 3D69B 1VA9A 1OAUL 3QULA 1YN7B 5L2KE 4N0YL 1V7NL 4WJ5A 1UJTA 3C6SB 1OPGH 1F3RB 1F3JB 2W0KA 3B3IB 4GG8B 5D93C 2AXGA 3RDTA 5IG7A 4MD0A 1DQLH 3UBXG 4TUOA 1S9KC 1ETZA 1IGTB 2PTTA 1XGUB 3FO2A 4UT7L 4EIZC 4OM0L 2CXKA 1WLHA 4XPGH 3IETB 3CD4A 2E9BA 5IEKA 2VO5A 4OBRA 3TN0A 4PRHE 5EBWB 1Q94A 4IIQB 4OLYH 4JRYB 5I1DB 3TO4D 2O26U 5I9QC 3HZMB 4WCYL 5LAXB 3UBXA 1EEZB 5JOPE 1TETH 3I75B 4Z7UB 4Z7WB 2LU7A 2Y36L 4H25B 3OKMA 1AC6A 3BZFA 4MVBC 4HK0A 4DUVA 5HGBB 2WLZA 4E42A 5FHAL 3P4LA 1S9VB 2NY5H 3V5DB 4ZUTB 3W2DL 1BZ7B 4NCDA 1JRHH 5CGMA 3QEUA 1YMMA 1CN4A 3RI5K 3SJVD 4PRDB 4PJDA 5DFTA 3MRMB 3R1GH 1HINH 5JHDE 2I07B 3D39A 4S1RH 2NY2D 4MQTB 3T04D 1PLGL 1AD0A 4Y88A 3P4NB 3MLRL 5A16A 1JZ3A 5KN5A 2PCPA 5MEOA 1UM4L 3CDCA 1JK8A 3CMOH 4LBEA 1D5MB 3RWJB 4HQQH 3O3EA 4ZFZB 1Y18A 5TE6H 5DJCA 3ARGC 1FYTB 1P6FA 2FJFA 3AXLA 3P73A 4GUPA 3NBNA 5ALCH 4PJCE 5TF0A 5KSAC 4L4VE 3BX7C 4HKZB 2O5XH 2EDNA 1MF2L 3LH2L 3EYUL 3PXJA 3C87A 5IHUH 2YUWA 2BHUA 5FCUL 5CBAB 1DQDL 3CLFL 4XMPH 1XIWD 4ODTL 3RBSA 1Z9OA 3PGDB 5F7MC 1U9KA 3VWKB 5L88L 5FYKL 3MLVL 1UB5A 1RZ8A 2ENSA 2RCSH 4NNPH 1JHTB 1ZLSH 3J8F7 1FFPB 4M6ML 4UBDC 5LQBH 2AJSH 1C5BH 2JJTC 3OKOA 1N3NB 1TJIH 4LDOB 1YPZA 2PYEA 4HPYH 1UH3A 3IF1A 3CFBB 1RZJL 3ULUE 2I60L 5IW6A 1OAYL 2L7UA 3ZE0E 5DD5H 3CUPA 5TDPA 4FQHA 4JFFE 1KIQA 1YC7A 1U8KA 3SKMB 4YDVB 4FMFA 4R26L 3KPTA 1JHKL 3OSKA 2G75B 2MTPA 4HXAL 4QKXB 5E9DD 1KXQE 3JWDH 2X9WA 1E27B 1Y6NR 3CFDB 4FQLL 3SDYH 4FHBD 2Y6SD 1YUHB 1IEAB 5DWUH 4DVBA 2MOVA 1WZKA 1FGVH 43CAB 2YWYA 1I7UB 2EE2A 3QUXD 4PJFE 5EORL 5IV2A 3MA7B 3PDOB 3H8NA 2R0WL 2HRLA 2FGWH 3V6ZA 5H2BA 4FQ2L 1MCPL 1CICA 4L5FH 3CFCL 2HT3C 1CT8B 3VH8A 3LRGA 2P44B 5F6IB 1SBSH 3VGAC 4F7TA 4JKKA 1T83C 2YEZB 5D7SH 5ESQB 3STZB 3NCBB 2IADB 4ORGA 4OZGA 3QUML 4RGND 5MEPA 4KI1A 1B6DA 3EHBC 1LK3H 4ERSL 5HGGS 3BJLA 3FRUA 3BVNA 4U3HA 2NY6D 4XH2A 3TT1L 2Z8VC 3RY6A 1MHCA 2HVJA 2PN5A 1EBAA 5T3ZE 1QZ1A 3FFCB 3FN3A 3EW3B 1XGTA 5BOPA 1BD2E 3TA3A 2J8OA 2NY3B 3LIZL 3TNNB 2AK1H 1FPTL 4NPYA 5TDOB 4GQPH 3VGEA 4JAMA 2A1WL 4S0SD 4XWGL 3RY5A 1HZHH 4LSTH 3O3BB 2JIXB 2VXTH 3HCVB 5IQ7L 3MBXH 3CVIH 3VRLF 5JXEA 1TVBB 3MBEC 5EZJB 1NSNH 4R7DA 3QIBA 1IGIL 5EO1A 3UP1A 1AO7D 4ODSL 1YDPB 3TCXA 1ORQB 2NY1B 3ORJA 4PJ8B 3T2NH 2DTSA 1NBVL 4OD2A 4I4WA 3SDCC 4S11A 1AKJA 5ADOL 3SKNA 3OQ3B 1LO0L 3RVWD 1KJ2L 3K2MC 3IAGC 5MEQA 1HWHB 4HKJA 4LCWB 3QDHA 1ZLUK 5ISZB 4Z7WE 4Z7UE 2X4PB 5C1MB 1CXKA 1N2RB 2DQIH 2A6KB 2BSRA 2HLAA 1H3XA 4U1NA 3VXSA 1I9RL 1T5XB 1CE6B 4NRZA 4AK1A 1IQWL 3E0GA 4NM8L 3PQYA 2R1WB 1KLUB 1MI5B 1S9YA 4GW5A 1YEKH 3DTXA 3GSVA 3LQAL 1A64A 4MSWB 3P0YL 4A6YA 1EGJH 3EYOB 3W82A 4JGMA 5EBGA 4L1DA 3HR6A 4KTEL 3UTPD 5FEBA 4XNQB 4UINL 4QTHA 1Q9KB 2EDOA 1DLFL 4PREA 3PP3K 2YMXH 3VG0L 1NCWH 3RVXD 1OARH 4APQC 1E4XL 5FO7B 5TF1H 4RZCB 1Z9SA 1FYTE 2A9ML 3VXRD 1JIBA 4PJXE 3RVUC 2J8HA 5AWNH 1FO0H 1ZS8A 1ZT1A 2VIRA 2K3TA 3MNWB 5FECB 1BM3L 2Y5TB 4OZIA 3E1F1 1O5DT 1R3IL 3OX8A 2XNAB 4NKIL 1KACB 4ZTPH 3HKFA 4LLQA 3WXWH 1EHAA 4K71C 5EZOL 2FJHA 1P69B 5F8QC 1F8TL 1WUNT 4Y16A 4NJ9L 4XI5D 4EI5B 3OB0K 3L7EA 3L3OB 4GBXC 5I74B 3TJEL 2A6IB 5GS1C 4FFVC 4CRPA 1DJSA 1MELA 1M1SA 3DX6B 4P5MA 3C09C 5ELIA 2ICEB 1Y0LA 4JFOA 5EC2A 5I1IL 2V2TB 5C2BH 4JFEB 4LOUC 2X1PA 3WHXA 4I3RL 2AP2A 2XIDA 1FG9C 4KFZC 1U95B 4I0PB 3BIAX 5A43C 4X6CF 15C8L 1WFNA 1UWEH 4Q6YA 3IDGB 1U3JA 3M45A 1W0YT 3QNYB 4HGWA 4ONGL 1FYHB 4HPOH 5EBMB 1AQKH 1FP5A 3V4PH 2VDMH 2IMNA 3OJVC 2FLBT 4Z8FH 3OKNA 2ZKHH 3TH4T 3TO4A 4RGMC 3RWFB 4UILL 1FZJA 1UXWA 1PDKA 2X4SB 3UJIH 1F3JA 4G9DB 3GMLB 5EOQL 4AIOA 4D3CL 2EDRA 4MAYD 1GGIL 2O61B 1WBYB 4GRMB 1XGUA 4LEXH 2VLJB 5DD3H 5I73B 4S1QL 2PW2B 3VXPB 4B7IA 4G7VH 1M7IB 3SJVA 2H2PD 4LVOC 5HHMB 1S9WB 4KI5C 1YEFL 1DE4A 3DX8A 2ZUQC 4KKAD 4PJIF 1MCNA 1MIEH 1LEKA 4NDMA 2GT9B 4JVWA 1RFDH 4NZTH 4UUJB 3SPVB 4JRYA 2IAMD 2R9HD 4XPBL 4ZXBC 1G9NC 4XNZC 4OUUB 1A9EB 3BUYA 2ATPA 1EEZA 2VJXA 3ARSA 4PGEA 1OGAB 4ZS7L 4H25A 1WISA 3RWIA 2AKRA 4AEIH 1JUFB 4JM4H 4HJGA 1HNGA 1NDMA 5DJXB 5FO9B 3FFCE 4LPUA 1RSFA 4NWTH 5BQ7A 2JK5A 4HBCH 3H9SD 1UACH 4Q0XL 4X4ZA 4ZUTA 1BZ7A 2CIIB 3FQTA 1KELL 3BP4A 5DZOA 5BVJB 4JHZA 1VACB 1HEZA 1XIWA 5DYOA 2P7TA 1FO0B 1UQSB 1MHPH 2DQUL 4NCC1 2OYPA 1MFNA 3ARDD 1A6ZB 1E4KA 4XP5L 1XF3A 1FCCA 2CR6A 3QAZC 1J1XH 3MRHA 1IBGL 5D1XD 1S9XB 4ODWA 4YDLC 4DCQA 1SQ2N 4XPTH 3OHXB 1QQDA 3S88H 4LCWE 5C0RH 5KBNC 1NMAH 1PQZB 3KYOB 5F1OB 3SQOH 3WUZA 2WM0A 5CBAA 5BRZE 1KFAH 4UZGA 5DJ0A 2V2XB 3PGDA 4F2MB 4OV6F 1MCEA 4X5WA 1P4BH 3QHFL 3PWJB 5E56A 3ZDYE 5CGTA 3ZYOA 3REWA 1IKNC 2W65B 4MJID 1CL7I 5EUKB 2YK1H 1KB5H 2DYPD 2IG2L 4KVNH 5E95B 4EQ2A 3DHMA 3EO1B 3GKWL 4NZRL 4NHUB 5B39B 1MCWW 4WFEE 2XYCA 3B8YA 4HLZG 2AERT 5CEXA 1N3NA 5GRJH 3KPSD 5JPNA 1A3LL 1N0XL 4MHHG 4AIZB 2H45A 1VGEL 5ID0A 1CFTB 4S2SB 5GJSH 5C09D 1MRCH 4W68A 1CFBA 2CPCA 4GXVL 3SKMA 4KQ3H 3O41B 4YDVA 4WTZG 1MVUB 1GL4B 1WF5A 4K94L 1QR1B 2ZCLH 3MRJA 1I7RA 3KJ4C 5T33H 5JW5B 4MDIA 2EYTA 3KJ6H 1UM6H 1GHFL 4Z7QF 3VG9B 2P5WE 43CAA 3AU1B 3QJFA 1I7UA 5D7JC 3MA7A 2KQNA 3HZYB 4LF3B 4WTZA 4XTRC 2VITB 4KRPD 1KPUA 3SOBH 3BRGC 4YHIA 1CE1L 5CUSH 3GJEB 3L3IB 4QRSA 4LARH 3JZ7A 5D6CA 5BV7H 1M7DB 3L3KA 1QLFA 3JTSB 3REVB 5ETUA 4JFEE 4LLVB 4NRXB 5ESQA 4NO0B 3VXQA 2DS4A 4PYGA 5FUOH 1AO7A 1KCSL 3NA9H 4OCWH 4GW1B 2QHRH 1TPXC 4P9HL 3ZDXF 4M61B 4ISVB 1FVEB 3NCJL 3QIUB 4PPTA 4OD1H 3TNNA 1CDBA 4LCIL 4RRPA 1C5DA 3AY4C 2HTLD 1ULVA 1M71B 5K9JL 4LASH 5BW7C 2LE9A 4ELMB 2F19H 5J6HA 4HUVB 2JIXA 3HCVA 2J6EH 3HS0A 1TVBA 2VLJE 4FA8A 2BDNL 2XWBA 1JNNH 2JTDA 3OZ9L 1LNUA 1YDPA 4Y7MA 3QHZL 4X80L 5HHME 2DWEA 3T3MF 1T2QL 3F5WB 5E08L 2VZ1A 2BVYA 4JY5H 4ELKB 4G80A 5J6GA 2NW2A 1QUNA 2F74A 4OIIL 3QXVA 1D9KC 4OFIA 4XCNB 2AQ2A 5IJVA 2VQTA 2WQ8A 3CXDH 3MXVL 4PUBH 5ISZA 2P42B 1HQRA 3QUMA 4DGYH 1OGAE 2IH3A 2EXYD 1N2RA 2JLLA 2Z35A 4YQXH 4YEEA 3JWNC 2HFGH 1Q38A 4FQCH 3DHJA 4HH9A 3BPCB 3VXRA 3H0TA 1DQQA 3ARFB 1WWBX 2OR9L 3RUGA 3DETD 3VGFA 4AT6A 3B9KB 5GGSY 2VDQH 1KLUA 1MI5A 1R3LB 2ESVD 4NQDD 5F8RC 5C0EB 3QDGD 3QDMB 4XXCA 4MSWA 3HG1D 4OLVL 3RZCB 5EN2B 4GW4B 2WBJB 3VWJB 2NLJB 2EH7H 1TVDA 4BZ2H 5C0DB 3O2DH 3WL9A 3THML 5D1QC 2M26A 4Y4HB 4PP1C 4F9PA 4KK6D 2PTVA 2YUXA 5DRZB 5DUPH 2B5IB 4TVPH 2FSEA 5GSVA 1WEJH 1IGFH 5ESVB 1NFDE 3LOWA 3HLAA 4KHTL 3PV6A 1QSFB 4QRPA 4XVTL 2AJVL 4GMSH 4PS4H 1VGKA 5LCVH 3FQNB 5BV7B 4KKNA 4PJBB 4UOW0 3VFWB 1ZHLA 1MRFL 2UVFA 4KROD 5FF6B 3GO1L 1FFOB 2VDOH 1QA9A 3E6FB 1KCKA 4YHOL 3C8KB 4NUGL 4H8WH 4LPXA 1PKOA 5KSBB 4QHNB 3P9WB 3AVEA 5EG6C 4EI5A 4PTUB 2V5MA 2BNUB 3KVQA 1NAMH 5JW4M 3L5WA 1FBIL 2R23A 3OKDB 5BS0B 2HKHL 1WT5A 4G8GE 5DJDB 2ZOLA 2X4QA 2VZSA 4NJAL 3DX7B 2BSTB 4OCSL 1BX2A 4FFZL 4QTIL 4KMTL 4E0RB 3QNYA 1FGNL 3HFML 4PBWD 4OF6A 4K7PH 2IAMA 1JHLH 5DSCA 4JPIB 3RWFA 2AEPL 5DQDL 2UY7A 2A0LD 2J1KA 5KVGL 1HE7A 5E4EB 3O2WL 3GMLA 2HH0L 3MJ7B 1LE9B 1EAPB 3TBVA 3U0WL 4M93C 2KPNA 4R9HA 4P9MH 4XCEA 4OCRL 3H9SA 4MJ5A 4L3ED 3P4OA 2JCCB 35C8H 1NGXA 2OQJB 2XN9E 4M02A 4IRZH 5DFWH 5EOCJ 3S6CA 5HTSA 5K9OB 4J4PD 1G6RH 4L4JA 2EDFA 1J12A 2R4RH 3QRGL 4OUUA 3L3GA 4I48B 3DRQB 2IC2A 1EGJA 1FC2D 3ARDA 3LMJL 4N5EC 4OLZH 1RURH 4QHUB 3VFSB 3WIHL 4DAGH 5I30H 1A3QA 1JUFA 4AQOA 3D2UD 3A67L 3F7VB 5D1XA 4LPTA 1YQVL 2B1AL 4LGPB 4HG4J 3QBTB 3QCUL 1MHEB 2CIIA 2D03H 4W6YB 2E7MA 5K33A 1QLRB 2V2WB 1SYVA 3KXFB 5BVJA 3P0GB 3PIQA 1Z5LB 1DLHA 1S7RB 3QFJB 3S37H 4U1GC 4MJIA 2Z92B 2NW3B 3GHEL 2W9LA 4LKXB 4HIJB 2VISA 4ETQB 2DYPA 1J1OH 1HWGB 3G9AB 3CXHK 3C2AL 4LSRH 2VNCA 5DC0A 3RPIA 3JV6A 1QD0A 3TPKA 4X7FC 5L9DL 5H35A 3OHXA 5IBUB 4MZ2A 5B39G 3QQ3B 3KWWA 5JIIA 4IRJB 4PY8I 4Z95L 2JB5H 2R2BB 3FB6A 3KYOA 4P3WA 5SWZD 1U41A 4PJHE 3ULUC 2WW8A 5JW3H 2ZUWA 1KBGL 1VPOL 3PWJA 4YGVB 3SKJH 5F7NC 5F9OL 1ZVYA 2DI8A 3C9NA 3DV6A 1I8MA 1EXUA 1XMWA 5DFVC 4POZC 3QDME 2GCYA 3G9VA 5F1NA 1G7QA 2IANB 4D94A 4JFZH 4M7LT 1KTDB 5TE4L 4AIZA 2BJMH 1G7PB 4LQFL 2O93L 5FKAA 1XH3A 3MV9D 1NCDH 3PP4L 2HKFL 4KUCF 5DMIL 4JB9L 4O5LH 4JO3H 1MVUA 1QSFE 4PJAF 2P8LA 1EFXB 4XAKE 5IMKA 1PG7W 3QDJB 2ERJC 1DSFL 3LPWA 1CZ8L 1DDHA 2YBRA 5JW5A 4JZJB 1G6RB 2XZCH 1RZFL 3X3GH 1DEEA 2BRRL 4AG4H 3WFCL 2EIZB 1P7QD 1NH6A 1WIUA 4ZYKA 1I7ZA 5KSBE 2VITA 1IGJB 1OF2A 4M1CC 4XPAH 4WEBL 2B2XL 3HMXH 3LRSB 5J57B 5T1KD 4LP4A 1DANT 5BO1H 1YYLH 4QRRE 4ODBD 2BOCB 3AB0B 3BO8B 3O6FD 4U1IA 3OR6A 3OKEB 1YNKH 2QSQA 4R7NB 3GJFH 2DN7A 2OL3H 1LE5B 3NGBC 5IR1B 5FB8B 1MY5A 4NO0A 1OAZL 4GSDH 4QNPF 5HGDA 4XVSH 1LVEA 4OF7A 2H1PH 1I8KA 2NX5D 2YD1A 4P49A 2FD6L 4JFXB 3TIEA 2EDLA 3W9DB 4M61A 4KMLB 4UBDD 4WFGE 2Y7QB 1G7LB 1V7ML 4JRXD 3KPMB 1JNHB 3HN3A 1KT2B 3W9EB 4DGIL 3D3VB 4M43L 4ELMA 4P4RB 1TCRB 1MCWM 3HZKB 4HUVA 4M5ZL 1SY6L 4YC2B 4LSVL 1FFQA 5D7LA 4M5YH 2I9LA 2JCCE 4MDJB 4NN5B 2BCKA 4JE4B 3TBSA 2ESVA 4N1HB 3ZTNL 3WFBL 5IEHA 4G6JH 4D9LH 1IAIM 1H9VA 2PR4H 3HG1A 3F5WA 2VC2H 3S96A 4M8VA 2XRAH 4ELKA 4MNGB 5INCA 3LN4A 4K3DH 1KB5A 1CVRA 2XQBL 4NC0B 1YJDC 1T04A 4MA1B 3VD4A 2E8ZA 2B0SH 2ADGA 3BWAA 2CKBB 4IMLA 3PABA 2A83A 4DN4H 4PG2A 2IWGA 4FP8L 1ZGLB 4ONFH 4PRIE 4Y89A 3UO1L 3UC0H 5SX5K 4R4BB 2ZCHH 3UJJL 4AY0A 1QFOA 1N64L 4BSVA 1XT5A 1F58L 3B9KA 4TVPE 5HHVH 1FRGH 1A6PA 3RGVD 5AZ2H 1FL3A 2R69H 1FFNA 2AXJA 4BH7B 5ID1B 3KXFE 5FA3B 5JQ6H 1NMCC 3H9ZA 3TZVA 4M8QA 5HYQA 1WBZB 3GIZL 5FXCH 1KIPB 2EE6A 5CD3A 1E28B 3TCLA 5KVEL 3CK0H 4KJQC 3RI5F 2GJ6D 1ZHKB 5DRZA 4Q9CA 1RU9H 1NAKL 4V2CB 2ICES 4UNTA 1A47A 4P23B 3T0WA 1S7UA 3AREC 4U1JB 4MAUH 4ZOBA 1JTOA 1N4XH 3UTOA 3FQNA 4U1MB 2WINA 1UWGL 4BH8B 4PJBA 3MREB 3LSOA 4X6DF 4TULL 1A7PH 3IDJB 5SWSD 1XR8A 4M62L 1LO3L 2OL3B 3VA2C 3MMEB 3WN5B 2A9NH 1QLEH 2E5EA 2H9GB 5I8EB 4JFHD 4JG0L 1NCAH 3VI3F 3CFKA 2P5ED 4K3EH 3C8KA 3MLWH 1MREH 3SDCD 3KYKH 3LS5L 1OVZA 4PTUA 3ZKXB 3W39A 2OTUB 2IANE 2D4DA 3QR2A 4X4YA 1ZLVH 2ATKA 9CGTA 5BS0A 2FEEI 1FL5B 4JFDD 4LVHC 5GGVL 2W0LA 5C6PB 3TIDB 5J0BA 1LMKA 2V5SA 5FGBC 3O45B 1DUZB 1WZLA 4FXGB 3MJ8B 2J6EA 1RK1A 1KF9B 4Y19A 4J4PA 3U7AA 4PJ7F 1ZLWK 4HIHB 5T3XL 3QDJE 4XRCA 2ED7A 1C5CH 3OXRB 4JPIA 3VFPA 3MOAH 5JUEL 1EDQA 5B21A 3WNMA 2XZQH 2BP3A 5HGAB 4GKSA 1JE6A 3D2UA 3RWGB 1YY9C 2IEPA 2X4UB 5F7DA 3ULVF 2OMBA 1BOYA 3FB7B 4EVNB 3DXAB 3WDHA 2Q7NA 2UZIH 4OGAC 1JV5B 4ESKA 1G9NL 1DBAH 2BHZA 4NN6C 4CNIB 1HQ4A 2VDNH 4R96A 4GG6F 2P46B 3U30B 4DFIA 3Q5TA 2FX7L 2W38A 1K6QL 4L8BB 5K9OA 2AI0H 4TTDC 2ITDA 2R4SL 3H7LA 4RIRB 4GMTH 3B9AA 4WU5A 4I48A 3CZFA 2BNRD 4OZGE 1G7HA 4N0FA 5HVHB 2CD0A 3HUJF 3FRPG 3PWLB 3GM0A 3O2DA 2PO6D 4PJIB 3WFEL 3L1OL 1JGVH 4MA3B 4PRAA 1GGCH 3BDYH 5BVPL 1EPFA 4S1SL 3IDYB 2HAZA 2Z31C 3LPGA 4XT1C 3K7UA 3EO0B 3PGFH 3GMRB 4NNXB 4XNYL 4JQVC 1QLRA 2YPKB 2WUBL 5SWZA 2FYYB 5IBUG 2AGJH 4NN7C 4YK4B 1S7RA 4HZLA 1S7XA 3QFJA 1XZ0A 3P3YA 1IGML 3FB5B 5IBLC 1TNMA 4JFYA 4MA8H 3LHPL 3HE7C 4HT1L 4XNXL 5I66A 1DBKL 1ORSB 3WIIH 4L9LB 3TWCL 2EKSA 4TNVK 2QQKH 3MUGA 2WAHA 4FFWD 4F58L 3VRLE 2J12B 2VDKH 4WW2A 3HMWH 5AUMA 5T3XD 3LEXA 1FDLL 3BW9A 4YWGH 1NAMA 2R2BA 1MJ7L 1KEML 3IFNH 4RNRA 1RUKH 4R97C 3GSXA 3MRCB 4XP1L 3OMZA 3G6JF 1YMHA 1FZKB 3FT4B 4NT6A 4XZUB 3ZYJA 4R8WH 1Q72L 5K9KB 1A1MB 2VR9A 4RWYL 5E9DB 3SE3A 1VFMA 1T1YB 2FX8L 1HXMB 1GAFH 3EJYC 3RWDA 3JV4B 1CWVA 1T6WA 2DQCH 1CG9A 2OS7A 2X44D 5FA4A 3AC0A 1A6VH 2ADJB 2FJGA 3KPNA 5CSZA 4XP9H 1QKZH 4LSDA 1BFOB 4LHJB 1CF8H 4U1HB 5C0CB 4HDIB 1YN6B 4JDTL 3DNKA 5ICYB 1Z3GH 3CLEH 1BF8A 4BFEA 3DUSB 3O6FA 2VL5A 1YY8A 3BDBA 5CINH 2NY0C 3TP4A 2R56H 3OBAA 4OV5A 1FIGH 3DBXA 3MACL 2XKNA 3BN9D 3T4AB 3VCLA 2I24N 3DI2B 1XF5B 1XR9A 3IRZA 2EYSA 3VFGL 4JZJA 2NX5A 3JVGA 5ILTL 3FOLA 1G6RA 1IGIH 2MNUA 5I1KL 3IDUA 5KSVB 2EIZA 1Q0XL 1ZANL 3MFFB 4JRXA 1DVFB 4HX1B 5DJ6A 1GOHA 1CGWA 5DMJB 3MQIA 4X6EB 1U36A 3K4DA 4L3AA 4J3UA 2NNAB 2DQGH 4X6FB 2VLLB 2DQTH 5IROA 1NGWB 1UZ8A 1CLOL 4HW6A 4P46A 2VWEE 4R7NA 2DJUA 1UCBH 3B2VH 1LE5A 1P9MC 3I2CL 4LIQL 3P11L 3QO0A 3WYRA 5IR1A 2FH8A 4Z0BH 5DJZA 2XPGB 1C7TA 3C5ZD 5E2VH 1I85C 3VGBA 5H94B 1X4YA 3EAKA 2GK2A 3VXUD 4XVJH 1K4CA 2CUHA 3SDDD 3W9DA 4CAGA 2ORBL 2RBLA 2ARJA 5FYJH 2YZ8A 1DUYA 3ARBB 4Y5XB 1X5XA 3W9EA 3DGGA 1QG3A 5GRUH 5AD0B 1I7TB 2ICCA 1REIA 3D3VA 1T1ZB 1I9JH 2IFFL 4P4RA 5DMGC 3BQUA 1F6FB 5E24E 4XNMA 1BBJB 1QFWI 5DI8B 3EFFB 1F6AA 1LD9B 3BD5A 3HE6C 3DXAE 2PXYA 4RMSA 1CYGA 1LEGB 3RGVA 2FEEL 3IXAB 3SJVE 4FFYL 3CDGB 4IHOA 4C57C 1FJ1B 2GSGB 4F33B 5DDHA 5HHNB 4FN0A 1BM3H 4WV1B 4HMCA 4LPVA 3FAXA 1BVKA 2B8OT 3E8UH 4V1DD 3O3DA 5D7KD 3U36B 2MQ0A 3TM6A 5EO0A 3LEYH 3NH7L 2VDPH 4K3GA 1A7NH 4XTRD 3O6LH 4ZAKB 2V5TA 2WBKA 2Z93B 1X7QB 3MJ9H 1ZWIB 3P4MB 1MFBL 4H1LH 5LVEA 2P8MB 1DN0A 1QSZA 4YAQB 4AQ1B 1QFPA 2XTJB 1FLRL 4FQQB 3CFEA 3T4YB 5I1GH 4Q2ZB 1EH9A 4TNWK 3TFKC 1W72L 4NQEB 3Q1SL 1TJGH 5CGYD 5EFIB 3T1WA 4RFEB 4CMMA 2YPLD 4YX2L 1IL1A 5F44A 1J1PL 3BFOA 4HIIA 1BJ1H 1AIFB 4NQXA 1RZGA 2IQ9H 1F2XK 1QBLH 1MJ8L 4U1SA 4N8VB 3LS4L 3O8XD 4D0DA 3G5VB 4P23A 4WW1A 3JWOL 4YHLH 1GGBL 4KZEH 4JFDA 2FZ3B 2C7UB 2OI9C 4MNQD 2X10A 2ZNXA 1ZHNA 2YZ1A 5MP6H 5IF0B 3VRJB 2HT2C 3GJFA 4WTXA 5IFHL 2F8XC 1RZ7H 2OL3A 5F3HB 3F6IA 3T0BA 1K8DB 1E6JL 4M1DL 1NL0H 3QXTA 5E9DE 5GZND 1I1CA 3WE6B 4NOBA 1S7TB 2NYYD 2G60L 2XZZA 1N6VA 2OTUA 4LEOB 3VW3H 3V79C 1D9KD 3ECBB 4C4KO 5GQBA 1MFDL 1ND0A 1GC1C 3P77A 3WNOA 4L8SB 4GJTB 4RFNB 3U4EB 5TH2A 2MSPA 32C2B 4CN1A 3GSNL 4R90L 4P59L 4X7TB 3O45A 1ZTXH 5ACZA 2AXFB 5CMAA 4FXGA 3MRIB 2JJSA 3TBYB 1DBJH 4F15C 1VFAB 3EOBA 4BJLA 3FQWA 4LSSL 5KVDL 1BHGA 3SQBA 2E6PA 2VH5H 2YS4A 2AJUL 1R3HB 1X5AA 2BNRA 2OJEA 4CL7A 1IAIL 2B20A 3MROB 2F53B 5E99H 3ARQA 4X6CA 5HGHB 4L4TA 3ES6B 2PO6A 1YYML 3L3HA 1FG2A 1AHWB 3ALXA 2CDFA 2X4UA 4XVUD 3RY4A 2ZPKL 5FYKE 3GRWL 3NPSB 4WWKB 4EVNA 5MI0C 3HC3H 4JPVL 1E6OH 5C0BD 1A4KB 4CNIA 3O9WC 5CZXC 3TT3H 3N9GL 5HPMB 4Z7QE 4H1LB 4WFHE 4TPRL 3IFLL 5HI5C 3GBMH 4AEHL 3FT3A 1X5ZA 3B2UC 4RIRA 1OSPL 4GAGL 2ZSVB 3A0OA 1AO7E 3NIDE 4K2UH 4NM4H 3QZWB 1NANI 3PWLA 2QADD 4PJIA 3MV7B 1L7TH 4FQJL 2QQNH 2GAZA 3IJSA 3ILPB 4KI5F 3PE9A 4HJJH 1DFBL 4ZOEA 5DZLA 2X1XR 4BKLA 5KVFL 2I5YH 4PRBB 5IQ9A 4AENA 4NC1C 4QXTA 2NTFB 2FB4L 5LGHL 4UOW1 2PETA 1GVIA 2WNGA 3ZDXE 1EO8L 4OT1H 3FTGA 3FB5A 4OZFH 4M7LL 1TXKA 3WNKA 1EMTL 3H2WA 1I3GL 5CJXA 5KAQF 4Z6AT 3GMNB 1BBDH 4RAVB 1TJHL 1MRDH 1QEWA 4NKOA 1CLZH 3S35H 4C58B 3SDAC 2R0ZH 4I18B 3KNBA 3LQZB 4G8EB 1QVOB 1OSZA 1LP9F 3UTPE 1DBBL 1OW0C 3ZTJH 3ZE2F 3KLHD 2QSCH 4QXUL 4GRLC 4HFWB 4PGDB 2F54B 3CSPA 3MRCA 3RTQB 4GAJL 1OAXH 4J3SA 2R1XA 5BZWB 3VFMB 3IJYA 1J8HB 4PP2B 5I17A 3LN9A 3NAAL 1T1WA 2J5LC 2YD5A 5BCAA 3TLRA 5JOFA 1QOKA 5TE7L 3SE8H 3RUGE 5KSUB 4KVCH 2XZAL 2UUDK 1U2CA 5BZDB 3FB8B 5D6DC 5FYLL 1GRWA 1UGNA 3FN0H 5L0QB 5EIQA 5A2LH 4NQEE 4GKNB 1IQDB 2HFFA 4G7YH 2JJWA 2V6HA 1CFVL 3MCKA 3MLXH 1I1YB 5DUBA 4F9LC 1NC2B 3MLUL 5CJQL 1S7SA 4YBQD 4O02L 3DROA 4U6XB 2YD9A 2HLFD 5F1SA 1AD9B 2UWEF 4BELD 5C07D 5I75B 1NEZA 2DKUA 5D71H 1YEEH 3NCJH 3DUSA 1NPUA 5T1DL 3WNLA 2E9JA 4PJGA 2HJKA 4K7PY 4K9EH 2YUZA 3DRTB 3C5ZA 5CJ8A 5CJOL 3Q5OA 1XF5A 3VXUA 1T03H 1JGLH 1U3YA 3SDDA 2A6DA 3V0VA 2PYFB 3QHZH 5T1MB 4NGHH 3ZYIA 4PJAB 5E08H 5J11C 3AAZB 4NQUA 1I1AC 1UA6L 5IMLB 5FGCB 5LGJB 5D96B 4LKCB 5J06A 3DURB 4YE4L 1NGWA 3SGJA 4J6RL 1RUAH 4ONOA 5HYSB 5I1CH 3QIWD 2PW1A 3IU4H 5F89A 1FNLA 4R0LB 1KJ3H 5HPOA 3QFDA 4Z77B 3BEWB 5F88B 5I1EH 2HFEB 5J3HD 2FR4B 5KW9H 3IDXL 5IB5A 2ZWLT 4JJ5B 5D1ZB 3RDTC 4ZPTA 1BOGB 2W9DL 4OZFB 1JPFA 1FN4B 2VZVA 5GZOD 1HSAA 1P84K 3QISA 5D5MA 4U2ZA 4Z78A 1G7MA 2W0FB 3WLBA 4KJPD 4V1DA 5IM7B 4G9FD 4ZS6C 4Y5XA 4JREB 1LEIB 2F53E 2VLRB 3VXMD 3RWCB 4O2EA 4LNRA 1JGDB 1SYSA 2EEDA 3S9DB 4UT9H 2RJMA 1I7TA 2K7PA 3RNQB 3THMH 1CD8A 4OUOA 1U3HC 3MNVB 3FMGH 5MERB 3MRNB 5CKGA 5DJAB 2R2EA 3PWVB 4JY4A 4MMXC 1LD9A 3O4OC 2H26B 4IJ3C 2B4CC 4WI3A 3P0VL 5FYJU 1PYWB 1EX0A 1YJDL 3CPLB 2MMXA 3BP7A 1H15B 5AZEL 5E2TH 1W8OA 4S1DC 2GSGA 3RAJH 3GI8H 5DT1H 5HHNA 3EGSB 4E9LA 2YPLA 5KJRH 3C60D 5EU6D 3BGFB 5SV4A 1XF4A 4K23H 1MEXL 3B4NA 3S5LB 5GGTL 4A2LA 3PL6D 4XHJD 3O8XA 4Q9QH 3M1BB 3UAJC 4PB9H 3MV7E 1FORL 4P2QB 2K7QA 4KPHL 3MRPB 4P4KD 3P2TA 4LLYB 1IM9B 3KPLB 5EU4A 4FMKA 4OLWH 4PV8B 3ULSB 4RGOH 4PRPD 1N8ZB 4N8VG 4YAQA 5HD8C 3FO9A 4MNQA 5IKCB 1CD9B 4MJ6B 3ULVH 2HKHH 4IOFC 1I3VA 4LLDA 5EFIA 3V0AC 4HKXB 5E6ID 1MNUL 5HY9B 4Q97A 3VFRB 3L7FA 1QRND 1N26A 4HKBB 1R3KA 2MKLC 1UB6A 4YXHL 2WQRA 4MWFB 3KPSE 4HWBL 4JRWA 1YEDA 2G9HB 2P48B 3B5TA 5DLML 3D18B 4YFEA 4R4FH 3OB8A 2GSIA 5HYIA 1DEDA 5GS0C 1CL7H 1MCBA 2C7UA 1B2WL 1H0DB 5C09E 5DA0B 2F54E 1F5WA 3U0WH 3I50H 3FO1A 1N59A 1PG7H 3K46A 4NFDA 1YECL 1U8QA 4W70A 4G5ZH 4OCRH 1FV1B 4NQCD 3VD9A 3NIGF 5C6TH 1KCRH 1KG0A 3NACH 2CMRL 2LFGA 4O51B 2KQMA 4HJ0C 4EBQL 1P4LB 3LY6A 5JO5A 3CIQA 1JYNA 5IFAH 4XWOC 4NOFA 5EBLB 4LEOA 4X6DB 1RUML 4ZFGL 4WI7A 5DQJA 3QUZD 1MCQA 3FQXA 4X4XA 4JKPH 4TQEL 4GOSA 1CLYH 1W0WA 5IT2H 5TQ0H 4XNUL 3VFVB 2HVKA 3QXAB 4WY7H 1IEHA 5TFSL 32C2A 3TVMD 2FO4A 5D4QA 3A67H 2KH2B 4HD9A 1R0AH 2OP4H 4M7KH 3X12B 4OKDA 5C0BA 1NCNA 3E3QC 1QYGH 1VADB 1F00I 3NFNA 5DD0L 1JGEB 1F6LL 3CFJA 1K3ZA 4Y5VA 4WI9A 1VFAA 5K59E 1ZVSB 1CICC 2FL5A 4XCCH 4UIKL 4FQPA 3HRZA 1NCCH 3BYTA 4PRNB 4H1LG 4RMWA 2IPKA 4MD4A 2NY7H 4L8CA 1F4AA 2EH8L 1BAFH 1XCQA 1ZLUH 2WBWB 4R4NC 5HDOA 3CH1B 1AHWA 3LKNA 4PJAE 1F3DH 1O7VA 3WHE0 4PJ7B 1B0GA 3QZWG 5GISH 5FGCE 2VLMD 2X4RB 2HN7A 2R0KL 1QNZL 4NO2A 1PEZA 3RY6C 3CSYB 3MJ9A 1GZQA 2Q6WB 2LVEA 1HH6B 5HPMA 4WO4C 1H3UA 1GSMA 1QP1A 4EN3D 5F7HA 4WU7B 3TA3C 1T0NA 1M7XA 5HHPA 1R5IA 4Y5YA 5JDSB 4UIMB 3HPJB 2ZSVA 2BVOA 1PY9A 5FUCE 4M6NH 3PP3H 3VFOA 4GG6B 4CADB 1R5VB 5JXEC 3GMMA 4QOKB 3EOTH 5HHOD 1B9ZA 3QIBC 4FQXD 4UQ3A 8FABA 2FX9H 1QBML 4DN3H 5IP4A 1S7WA 4Y4KD 2ZJSH 4RAUB 3RVVC 1A4JA 1KENL 2VUYA 2VLRE 4DEPC 1K5NB 3X13B 3IDNB 5DD1H 5D93B 4RISH 4PRBA 2HTKC 3RL1B 3O11A 3BGMA 4P2RB 3EIFA 4XC1H 3HUJB 3I84A 3Q6GH 4LCUA 5C0FB 4W4OA 1YNTB 1NKRA 5GRVK 1FNSL 1OLZA 1AI1H 2M1KA 4KJYB 3W5MA 2Y07H 4NQSB 5E03A 1BQHB 4HK3N 1HNFA 1X5GA 3GRWA 5E5UB 2RGSA 2H32H 4UOJA 5FUZH 2ESVE 4NQDE 3TNMA 3UYRH 5C71A 5GGRB 3QDGE 4XCYA 4F37K 4KKLC 3OB0H 2SEBA 3KPQB 5I9QB 2XA8L 3D25B 4XAWL 3WJJA 1C8PA 3O6KH 1MFCH 4LSQH 3T0ED 1EAJA 4HHAB 1TMCB 1SJEA 4ZO6A 4HFWA 3MOBL 4JHWL 4PLNC 4TYUA 4P2QE 1G0XA 1T7YA 3CSBA 3EYSH 4N8CH 1J8HA 4PP2A 2XWTA 2CK0L 4KAQL 4PLJD 1A1OA 4BZ1H 3WXVH 4YHZL 1ERNA 4UV7L 4HWEL 1X5YA 4F8QA 1ES0B 4UB0H 4D8PA 3IKCA 4R6UA 3G6JB 4RQQA 3ZYZA 5IWLA 1JPGB 1MCKA 3MXWH 3AMKA 1H3PL 2Y72A 3QQ9D 1P7QB 2VXVL 1DL7H 5SX4I 5D72L 1QBAA 3BGAA 4H0GA 3ULUF 4XP4L 4KDWA 3X11A 3TYFA 3ARGB 3MO1B 3ZE0F 1IM3B 5T1KB 3VFUB 4NBZB 4U1LA 2CSPA 2Z31D 1E4WH 5I1AB 3V8CA 4XMLL 3QCVH 5CD5D 5KSAB 1P6AB 2VZ3A 3BZEB 4Y16C 5GPRA 2CR3A 4QXGL 1SM3H 2D7MA 2Z4QB 3WIFA 2VWEC 3LZFL 5INDB 3QXWA 4EOWL 1JPSH 3UZEA 2DD8H 5JNYA 3FFDB 4S0TD 2DAVA 5E2WL 3ZTNH 3KAAA 5T1MA 3HNTL 1KXTB 3AS1A 5IFJA 1JN6A 4G9FA 4IRSD 3BIBX 1BFTA 1KN2L 4J7RA 5IMLA 3IVKB 4L3CA 3VXMA 4OZFG 4X6DE 5DK0B 5L8LB 4PBXA 3GI9L 4PJ9D 3VXTB 2GFBB 1MCOL 4CJ1A 3TO4C 5JLZB 1HHJA 2CLVA 3X14B 1XGQB 5EWIH 4D0BB 4R0LA 1Z0NA 1SJVA 1T1XB 1UZ6E 1WWCA 1MFAH 4L3EE 3CCHB 1IAKA 1WWWX 3DV4B 4OB5L 2AJZA 1ZT7A 4JM2D 3ZTJG 1F58H 5DJYB 1I8LA 1U8LB 4WEUD 1N5AA 5EU6A 2IQAB 4MNHB 1IC7L 4X0KA 1CK0L 1LEIA 3WD5H 2DQHH 1P2CB 3MRDB 3LCYA 4HS6A 3RNQA 3PL6A 2NY2C 1Z0MA 3SO3C 3MNVA 5I1LA 2GY5A 5HHQB 1ZK9A 4JZNB 5DJAA 4G42B 4P4KA 2JELL 5DHVH 3PWVA 4PJ7E 3BH9A 5CSBA 4J8RB 1FL6A 2YD7A 3S5LG 2DLGA 3QP3A 4C56D 1WK0A 1PX4A 5EO9A 2WUCH 3U82B 5EOTB 3GSUB 5ICZA 1FZOB 3TBTA 3VGAB 4FQIL 4M7ZC 3KDMB 1OAQL 3V9FA 3MCLL 2XY1A 4POUB 5C08B 2EE9A 3C5JB 4FTVD 3ULVE 2EICA 2KZ1B 4OGXL 3BMWA 4XBEH 4PJ5D 1QRNA 1XIWC 2EC8A 4K7FB 2DKMA 5DVMA 1NBZB 1PW3A 3CVHH 3C5SA 3RWHB 1F02I 2IALB 4U6YB 5F96H 4U0QB 2BY1A 1EJOH 4PV8A 2FIKB 5IHBA 1N8ZA 5ALBH 4WUUD 1E4KC 4NZUL 3QCTL 4D9QD 4G8IB 1FZMB 4YPGB 1CFSA 4MJ6A 4OCYL 4QHMA 4P2RE 1PKQB 1ADQL 3BIKA 3HUJE 5KS9A 5ENWB 3LKQA 1OD9A 3F62A 4HIEB 3DWTA 4YHML 4NQCA 3MBEB 3SGDI 2NY4D 2VLKB 3QNXA 4LRNL 4OFYA 1AGFB 2ADIA 4P2OA 4WWID 5HY9A 2P5EB 3U9PL 5I15L 5SWQA 3SDCB 2XG5A 1WC7A 3V0WL 1M05A 2VZOA 5E8OB 2DWDB 3QUZA 4MWFA 3GSQB 3Q0HA 1A5FH 5AEAA 1WWAX 2APFA 2ICWA 5D7IA 1J0KA 2C5DC 2Q7YA 1NGPH 3VXNA 2Y6SC 1FHGA 2O5YH 1JWSA 4P3DA 4PJXF 3TVMA 1YNLL 1GOFA 4YJZL 5MENA 1ZEAH 4OLUH 1BLNB 4XX1E 4FABL 3QUXC 3MV9E 2D9QB 2VSCA 4L29A 4TNVF 1LO2H 2R0LH 1WIPA 4O51A 5ACMA 3KYMA 2VDLL 1G9NH 1Q8MA 4DGVH 3NN8B 5FHBH 5CP3H 1U58A 1PX3A 1BWMA 5J12C 5CBEB 4HCRH 4HC1H 1EHNA 3QQ4B 3G6JE 2J8UA 5K9QG 5FO8B 1GPOL 3V6OA 4JFPA 5F7EL 3OXSB 1OP5K 5GHWH 3L3JB 1Q1JL 4RGNC 3HC4H 3ZDZE 4APQB 4D9RD 2WSKA 4PR5A 3RWEB 1OLLA 4EDXB 2NY6C 4TSBH 2Q8BH 5HYEA 4ZFFA 2W0PA 1VADA 2AV1B 5DHVB 3GSRB 1JGEA 3C6LD 1D5IH 5CWSB 4EN3A 3IU3A 3OAUH 3ZKMD 1RJZB 1BZQK 4UDTB 1ZVSA 5DJ8B 5E8EA 12E8H 3MV8D 1OAKL 3D9AH 5E1HB 4G6AD 3NCFB 2GTZB 4LLMB 5T5FH 2VXUH 5LBSL 1KN4H 4I3SH 3GBLA 3DMMD 4K71B 1RUQH 1I1RA 2EDTA 2RR3A 1WCBB 3DIFA 1RZJC 2J7LA 5HHOA 1UH4A 4FQXA 1JWUA 4YHKL 4GBXB 1R3JB 5GS1B 1T20A 2YUVA 1F90L 3CVHB 2X4RA 4XPFL 3SN6N 4OJFL 4PGZA 3C09B 3MTRA 4RFOL 1BIHA 1HXYB 4WEMB 1HKLL 4W4NA 4ZFOA 3NIFE 3RVWC 1N6QH 4K3JL 3HI1A 4WENB 4AL8L 3QEQB 1WFTA 3EFDH 1QSEB 3KYNB 3KPRD 4YHNB 3TC9A 4QCIB 4XC3L 3FONB 4NIKB 1MQKH 4OI7A 3AS3A 5HJ3A 5CSGA 3V5HB 2XKSA 3IAQA 5D2NA 1BQHG 4RGMB 2DI7A 1FH5L 4U6HB 2YR3A 4OSUL 3IDIA 4RAUA 2MHAA 5D70L 3T0EA 1U93A 3C8DA 5HDLA 3BKJH 4Z7VA 4ZNEA 1BFVH 1G7IA 3R8BB 2FIRT 3T77A 4I5BA 3SKOB 5HDQL 4OGYH 4N0UA 2KZWA 3HB3D 3RVXC 4LVOB 4X4ME 4YHPB 2R1YA 1IAOA 4X5XB 5T1LB 4WVRA 4XX1G 3WBDA 2ZUQB 4DQOH 3UTQB 1Q9LB 4P2CG 1XCTA 5TQ2H 4OTXL 5CEZH 1S5IH 3RA7H 5C08E 4ZXBB 3SCMD 4PB0L 3KPQA 1MWAL 4XNZB 4RCAA 1U8IA 2GYSA 3D25A 4K8RH 1ZSDA 2BVPA 5C8JB 1IGCL 4XXCC 4JZOB 3PWUA 3ESUF 1PSKL 2EDEA 2VYRE 1U8OA 5CLTA 2IMMA 2YWZA 3U0PB 1SEBA 5JZ7D 3JWDC 1U6AH 2GJ6E 1ZANH 1ZHBB 2CJUL 4OZHA 5CHNA 4QEGA 1OD7A 1VFOA 5E8NB 4KTDH 1IT9H 4F9PC 2V7HB 2VXQL 5ESAA 4YHYC 4MCZA 5FKPA 3HNSL 1PY4A 4YDJB 1AY1L 4F7MA 3ZDYF 1PKQE 1RJYB 1A6AB 4X7DC 1ES0A 4IS6A 4OF8A 4IOIB 1CDUA 4H88L 5SWSE 2Y4SA 2VLKE 1JPGA 3G6AB 2AK4B 1MHHB 2HWZH 1A6WL 2AEIT 2P5EE 4JQXC 2FATH 5DRWA 4MCYB 2BFVL 5GGQH 3QAZB 1BJ1J 5ANMB 1A9BB 3MO1A 2C1PB 4YDLB 4TNWF 4PJ9A 2JF1A 1FSKC 5E4IA 3EO9L 3H42H 6FABH 4XMKL 3SDXE 1A7OH 3ZL4L 1U91B 4Z5RA 4UAOC 2IFFH 3LQAC 4HWZA 3N1FC 4ZUWB 3V4UH 2UWEB 1U92A 3PWPD 4RBPK 4MAYC 1WT5C 4LLUA 2A74A 5F3BA 4JHAL 2W07A 1ACZA 1HCVA 1OWWA 2H2PC 3K8LA 3LAFA 4IDJL 2AABH 1T5WA 2G5BB 3LKOB 3CFIC 4KKAC 5J7CC 3SY0B 3U9UA 3TPUA 1KPRA 2IAMC 3F12B 2R9HC 5DVKA 3QG7L 1K85A 3QDAA 1G7JA 2CDGA 2GITB 4C56A 1UYWL 1TVHB 3L5IA 3CCHA 4H20H 1DTUA 1S7QA 1J5OL 1MQ8A 4X6BB 4LCCA 1QPXA 2YPVH 3MOQA 1FFRA 4FTVA 2H32A 4OI8A 3KJ4B 2WZPD 4MNHA 5E1AB 4NRYB 1LQSR 1F4XL 2CLZB 3BKCH 1NLBL 2H8PB 1YEGL 2ENYA 4PJ5A 1P2CA 4M6OL 4P0DA 3ME0A 4JCMA 4KY1H 1CBVH 3U6RB 4U1KB 5D7JB 3GHBL 2B4CL 2C3VB 3SO5A 3H3PH 4MX7A 3KLDA 1X9QA 3L3DB 1AJ7H 3EOAB 1BVLB 3ARDC 4WUUA 4JQIH 2O5ZL 2X09A 2BNQD 1HILB 1A1NB 4I77H 1P4IL 3KDMA 5D1XC 3RU8H 4KTYA 2ITCB 3BKYH 3QEQE 3JSSA 4N1CA 3BP5B 1TPXB 1E6JH 5HYJB 2YSSA 5GRVL 3GZKA 4K8RD 4TUKH 4EI6B 4Y2DD 1RULL 4OAWB 4U6YA 4X7SL 4CN6A 2ZUSA 5F9DC 1WZ1L 3ALWA 2FIKA 2X4NB 5T3XE 3CJJA 2X70A 4JO4L 2GK0B 4ZDHB 3U7YL 2AJYL 4MD5B 3QUKA 1DP0A 2CLRB 3MBEA 1SEQL 2VQUA 4KJWD 3INUL 4KI5E 1RIHL 1CDHA 4F57L 3VMNA 5I76A 2Y23A 1WAAE 1T0MB 4PV9B 1WVZA 5GS0L 3HZVB 2X4OB 1KNOB 3BSZH 3GMOA 1D9KB 1ZV5A 1OP9A 1T4KB 1CFQB 4U0RC 4ALAH 4NBXB 3F7PC 1TZHB 5BXFA 3GK8H 2NXZD 4KK5D 3TN0D 5DURB 1NFDF 5I6XC 1NBYB 4AH2A 5E94A 1FVCA 1D6VL 4WFFD 5IK3B 4CU7A 3E6HB 4AJ0A 3IJHA 4HXBL 1FNGB 1RUPL 3UYOD 4ODVL 4KRPC 1U2HA 1TENA 2OX5A 4E41B 4N0CD 2UV3A 3ZE2E 3RJDA 4DZ8A 4YNYB 1ZA3B 5EZIL 4KZDH 2RHEA 1XGYH 1IKFL 5CZKA 4DKFL 4JPKL 3DMMA 4RDQF 5JDJA 3UTTB 5D1QB 5DR5L 2AK4E 3EKCA 3RNKB 1W72B 2VE6A 4LVNC 1OQXA 5ANME 1I9IH 4I13B 1JYXA 4WUKL 2VXSH 4P3CL 4GQ9L 3QI9D 4CUCA 2AV1A 5DHVA 3GSRA 3S34L 4S10A 5JPMB 1J05A 4KRMB 5KVFH 5DJ8A 4UDTA 4JO2L 1LO4L 2HTLC 5I8KH 4Y4FD 1ED3B 2YA0A 3KPRA 4LLMA 4B53A 1LK2A 4P5TD 3MNZB 1ITBB 1Q0YH 5C0IA 2D4FA 5KTEL 1G9ML 5C7XL 3L6FB 3NCYS 2CIKB 5FM8A 5FUCC 1R5WA 5GS1A 4DOHB 4J3WA 5SX5H 1KLGB 5D8JL 3HPLB 1RV6X 2ICWJ 3O4LD 1DQML 5J1AB 2EO9A 3ULUH 4NQVB 1JZ4A 7FABL 5L2KB 4TSAH 4Z0XB 4K94C 4X9FA 5F97E 2PYED 1C1EL 3WSQL 4GAJH 4OD3H 1K8IA 2EXYC 3G5YA 4YDKL 3M8OH 3I6LD 3FONA 3O2VH 5AAMA 5KZCB 3GSNB 5M95B 1W0VA 5L6YL 3D85B 5TE7H 3ZHKA 2A77H 3PWNB 4MA7H 3DETC 4JN1H 5C9JB 4JVUA 5DHYA 1QFWH 1A3RH 3BAEL 1TFHA 5JQHC 4OCXH 5CEZE 1SJHA 5GSRB 1MPAH 4M93B 1HOCB 3MLYH 2DQJL 1KIRA 3MA9H 3K80A 3HI5H 4UV4L 5E8DH 3LKRB 3NFPA 3CX5J 4KK6C 3MGTB 2IF7A 5E5RB 5KAQG 4I2XB 3S3SA 4HV8B 4OM1H 4X5XA 1HDMA 1J0ZA 3OR7B 2CGRH 1KGCD 4PG2C 4ZTOL 3UTQA 3U4BH 4RSVA 4P9HC 1V3MA 2FBJL 3OKLA 3MRQA 2F58L 3B9DA 1SMAA 5JIKA 1TZIA 2F5BH 1YEJL 3GMQA 4OLXH 3DO7B 5E5MA 2NXYD 4LIQE 1NJ9B 4JZOA 4L1HA 4KROC 3BZ4B 1RPQA 1INDH 3QUYA 1JWMB 4PJEF 4J23A 3BPOC 3TZVC 3I6KB 5T3ZH 1C08B 3NTCH 4PBVC 1UM5H 4BSWB 1JRHI 3UJTH 5JOPD 2DIJA 2N56A 4O58L 1B0RA 2YXFA 4GKZA 4PJHF 1LP9A 4Q6IA 4JFQA 4YDJA 1B88A 1A14L 5EOCL 1S8DA 3KS0H 1ZLWH 1A6AA 4U31A 5CILH 3PWPA 5AYUH 5I16B 4U1GB 3GBNH 5HYFA 2D7PA 3G6AA 1MHHA 5IVZB 3OL2A 5EU3A 3BPLC 2I25N 2E27H 1RHHB 2OSLB 4ZPVA 3WHE1 3MPCA 1EZVX 1L0XA 3L5XH 4QLRA 2DTML 5L7XL 2C1PA 3I9GL 4EXPX 4MB3A 2AJ3A 2VDRL 3PGCB 5EUOF 5IVXA 4OKVA 5GIRA 1KJMB 1AXSA 4KHXL 4RAHA 2D0GA 2X5PA 4HFUH 1RIVL 3BT2L 4PG9B 2QKIA 4C4KT 2F5AH 2UWEA 3MYJB 3GUTA 4BQCA 3MODH 1NGYB 1IKNA 4LFHG 1S3KH 1XGPA 1VKXA 2BOBB 3NZHL 2XACC 4E41E 5KOVC 1JTPA 3A6CH 5AZEH 5TPWL 1KPVA 4DFHA 3SY0A 4G3YH 1KCUL 4A2MA 4J4PC 4TOYL 3UTTE 1GYAA 5A2IH 4F7EB 3F12A 4YR6A 5TGBA 5JHLH 1KEGL 5JA9A 1NGQL 3FO0L 1MAML 4ODXA 1TVHA 3VI4E 4ZUVA 1AQDB 2BNQA 1JF6A 4G6KH 4KK9D 4JFFD 3DVNB 4X6BA 5B3NA 1BQUA 3ILQD 2H6PB 2ERJB 1AGDA 2MCPH 4MQSB 1F4YL 2ZSWA 4JPWH 4NP4L 3GM8A 5E1AA 4CVXB 3NABL 2Z91A 4P57B 5IMOB 2H8PA 4J3TA 3FJTA 3MR9B 5DEFB 2DB8A 4G6ML 2QHLA 4RX4A 5I8CB 4Y2DA 3STLB 4RMUA 3V4VH 4ENED 1J0JA 1N7MH 1JI2A 4DOHE 5FIEA 2DBJA 5F93C 1LDPL 1F3DJ 4N9GB 5DGRA 1JVKA 4Y16D 4PGCA 3HNVH 1NANH 4RMQA 4YUEL 5IUSA 1RK0A 3NGBB 3L9RA 3CC5A 3G6DH 1B4JL 4YDIH 1HYSD 1S78D 4MYWB 1G9EA 1CGSH 2XKUA 2A6JA 4JANA 4OQTH 3FQRB 1EHLL 2IGFL 4HLZH 5CCKH 3WFDL 4DTGL 5HYJA 1M4KA 3JTTA 3CSGA 1VFBB 4H26A 4EI6A 3V5KB 3W0WB 1I3RB 1NC4B 3VFNA 1DBMH 1H5BA 1X5JA 1H3TA 3AY4A 5IJKA 1RUMH 4GS7C 3IFOB 4HH8A 5EU5B 3TO2B 1E4XI 1OT2A 4UTAH 4DKEH 2BVQB 2ZOKB 4YXKH 4H8WC 3EUUA 3F6LA 4ZUSB 5DEGB 4PJDF 4Z18A 5E8PB 4Q9RH 4HUNB 4UT6L 4WW2C 1RZIB 2P8PB 1D6EA 4I2XE 2CRMA 1MCDA 4DZBB 1EJ6A 1QSVA 2ID5A 5IB2B 1HK6A 4WHTA 3DECA 3FAWA 5I18H 3SGEI 5I2IB 3K2UL 2X4OA 4FZ8H 3U7WH 2Q8AL 5DMKA 3SE3C 5I1JL 3O0RL 4E5XB 1D5BB 1IFHH 1TZHA 1BIIB 1FAIH 3CH8A 2VKWA 4HIXH 4JRYD 1NBYA 3LD8C 1OPGL 1I8IA 5C07E 5CP7B 3QI9A 3UMTA 4F37F 2FRGP 5J9PB 1DQLL 3MRRA 3BKMH 3GB7B 4Y4FA 4PJXB 5D2LA 1NMCB 1TLKA 5DVOA 2X1OA 4P5TA 4QY8A 3O6FC 5FDWB 4XPGL 3VU2A 4BFIB 2H2SD 1JNLH 2DIAA 4WI8A 2MPAH 4OLYL 5DD6B 5ITFB 2AV7B 1YPZF 1HHHA 1OTUD 1TETL 3HHRB 2CQVA 3JVGC 5GGUA 5IBTH 1D5ZB 3QG6A 4HUWB 3AREB 3O4LA 4UQ2B 1TZGH 2AVGA 4HZAA 3RL2B 3KLAB 2HG5A 4U7MA 1UVQA 2NY5L 4X7CC 1FYTD 4LCYB 3IDMA 1JRHL 1NMBH 3OV6A 5IROC 2VQ1A 3R1GL 3N06B 1HINL 4NNYB 2R2CA 3FQUA 1U8HA 3MNZA 4P46C 4M9PA 3CAFA 3P40A 5HI3C 4S1RL 3X3FH 3QXUA 2KUTA 3FN9A 5BMFH 1BEYH 1HN1A 1JBJA 3VWKD 2X40A 4HULB 3MRKA 3RGHA 5EH1A 4QRUB 3BESR 4G9FE 1QFUH 3CMOL 1BMGA 3S36H 3VJ6B 1WBXA 4HQQL 5FOJA 1X4ZA 5TE6L 5FYLE 1JMXA 3LKPB 5L2KA 4LVHB 1CGTA 5F9AC 5ALCL 2J3SA 3T0VA 4TUJA 2O5XL 5JORA 5IHUL 1KOAA 3F58H 3MRBB 3T3PF 3PHQA 4G8FB 1ZE3C 3BQUC 3Q6FB 4XMPL 1MCCA 1V05A 4OZGF 1A7QH 4AZ8A 3D85A 1GIGH 1G6VK 2VABB 3PV7A 5C9JA 2PXYC 3LKSA 4NNPL 2RCSL 3GIVA 1AE6H 5EA0H 3RGVC 5ACLA 3A6BH 2UYLB 1Q9OB 2QR0A 1ZLSL 1PAMA 4PRHA 5LQBL 2GKIA 2AJSL 1C5BL 1A2YB 1I9EA 5F7FA 3K4AA 1TJIL 2BZDA 5JA8B 4HPYL 1NLDH 1A0QH 1OGTA 1T3FB 1NFIA 4JN2B 1HIMH 3NCCB 5DD5L 1MJUH 4WDIA 2R29H 4PRPE 4G6FD 4NN6B 3U48A 2NZ9D 1XGRA 5L8KB 4QXGH 3JWDL 5MHSD 5JHDA 5B3JE 4LDLB 3NFSH 2HJLA 4W81A 2GJZB 3BP6B 3SDYL 5DWUL 5HVWA 1UXSA 5ICXA 1JWMA 2F8VA 3MLZH 5I71C 3HNTH 1FGVL 4LHUB 1RJLB 3W0WE 5GJTH 3RBGA 5HDBE 2Z31B 2FWOB 3RKDD 4DW2H 4JDZA 2EC9U 2FGWL 5GGSA 1JGUH 4L5FL 1AGBB 3EYFB 3FFCD 4NKDB 4PJCA 4NN7B 2NY3D 1HHGB 1QR4A 4L4VA 4BK5A 5JIHA 4YZFF 1SBSL 1UJ3A 4TSCH 1HH9B 3HE7B 3MGOA 4QRQB 5D7SL 5BRZB 5IVZA 3LDBC 5FGRA 2JIXD 4DVRH 1B6UA 2DKSA 5IOPB 2OSLA 5H37H 1LK3L 4CJ0A 4ODHH 1MLBB 2N7AA 4J3VA 5FAAA 4LLWB 3VXOA 4PGBA 1HSBB 1UH2A 4PY8J 3MLTA 3R06A 3T8XB 1UWXK 3LN5B 2NY1D 2XTLA 1CK0H 4NO5A 4PJ8D 1MY7A 3LRHA 2YD3A 3E2HC 5D7IE 2JJUA 2AJXH 2X4TB 3CU1A 2J88H 4R97B 2AK1L 1Q9WA 1G0DA 1OOAA 2A73A 4LCWD 4PG9A 5F1IA 5ISZD 3MYJA 5IHZA 43C9B 1HZHL 4LSTL 3AS0A 4JFFA 3SE4A 1AP2A 2VXTL 2DI9A 4UMGA 3BH8A 3MBXL 3CVIL 3HR5A 1NSNL 2VZUA 4XCFH 1HI6A 4MS8C 2OJZH 4XXDA 2B39A 4HS3A 3T2NL 2JJSC 3BHBA 2DQFA 1MI5D 3NCEB 5DTFB 3KPOA 1F11A 2J8UE 4J3XA 1VSCA 4G43B 3VA6A 3GKZA 1U8JB 2P5WB 3KLSA 3V6FB 4O4YH 3OGOE 4PJFA 1S7VB 3ZT7A 3UTSB 2DQIL 3GSWB 3IFPB 2NY0B 3RPKA 1OB1A 2PO6C 5HXMA 3DVGB 1L0QA 1F2QA 4YXLH 2ADFH 4MXQD 4RWHA 4BM7A 1H3GA 4GRWB 2GTWB 2W91A 4OCYH 3SE9H 1CU4H 1YEIH 3BOVA 4FXKA 1K4DB 3T65A 5EPMA 4JKMA 1YEKL 4CVXA 1EHXA 4QRPD 3MR9A 3N85H 1YEHH 3O3AA 1EGJL 5CEYB 2EIDA 1U8PB 5L2JA 1CXFA 4WI2A 1WTGT 3HC0A 2XFXB 2FECL 4OFKA 2YMXL 1NDGA 2C1OB 1OARL 4WI4A 4GAYB 1BD2A 3D69A 4YEFA 5TF1L 4EI5D 4POYA 1S5HB 3MRGB 4U3CA 1YN7A 3WS3B 5IESH 2UUDH 4FFWC 3BXNB 3C6SA 3PJSB 3UZVB 1IC5H 3UROR 2W59A 1MFEH 2HJFB 3NZ8B 3ZKSD 1T22B 1P5VA 3NCMA 3B3IA 4GG8A 5AWNL 1FO0L 1ACYH 4JFED 1IGTA 1JFQH 4I0PD 5ITBL 4ZTPL 1GC1H 3J7HA 5EZLB 3QO1B 3WXWL 3IETA 1INEH 4NYLB 5CJXC 2OTWB 4KV5F 1MAJA 2Y06H 3GSOB 3TO2A 5EBWA 4IIQA 4P99A 5I1DA 2X6MA 3HZMA 3G08B 5LAXA 5IMMB 4M1GH 4EDWH 3I75A 4Z7WA 4Z7UA 5K9QI 4X8XA 2V17H 2V7NB 4PY7B 3HE6B 5C2BL 2P8PA 2QLVB 2IFGA 1EA9C 4ZSOB 5HGBA 3B5HA 2R15A 4JKLA 5FV2A 1S9VA 3V5DA 1UWEL 3GNMH 2VLJD 1ZKAA 1G1CA 3M17B 5I2IA 4HPOL 3EYQD 1AQKL 4PRDA 3V4PL 2VDML 3MRMA 3QPXH 4ZMAT 2I07A 25C8H 4Z8FL 4F8TA 3BN9C 5IB1B 1LDSA 1ITCA 2ZKHL 3GJFK 4C59B 1ZGLM 3IXTB 1D5BA 1CCZA 5C0JB 2C26A 2RFXB 3P4NA 2D31B 1ROWA <