2WUCH

Crystal structure of hgfa in complex with the allosteric non- inhibitory antibody fab40.deltatrp and ac-kqlr-chloromethylketone
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
220
structure length
218
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTINGTYIHWVRQAPGKGLEWVGGIYPAGGATYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAKWAWPAFDYWGQGTLVTVSSASTKGPSVFPLAPSSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HEPATOCYTE GROWTH FACTOR ACTIVATOR LONG CHAIN
publication title Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 218
sequence length 220
ec nomenclature
pdb deposition date 2009-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wucH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wucH01
4PJHB 3VJ6B 4D9LL 1S7TB 2AJUH 4CVXA 4RGNC 3FO1A 2O5ZL 4QTIL 1LK3L 4O4YH 4XPHL 5F88A 1BIIB 4HJJL 1ODAA 1XGPA 1QFWL 1DBAL 3DUSA 2OJZH 4DN4L 1WBYB 5I1LA 1MCJA 4XPBL 1IAII 3B43A 4EI5B 5JW3L 1K2DB 4X9GA 4ETQA 3S36X 3MNVA 1F4HA 1MHHB 3ROOB 1V5JA 3DX6A 3GSNH 3OR6B 3EFFA 4HKBB 4XP1H 1DQDH 1IGJA 1XF3A 3WMSA 1FQ9C 1FC2D 2G75A 4JY5H 4IIQC 3MGOA 3RDTC 5C0CA 3OJVC 3U0TA 3F7QA 4M43L 4OD2B 3ZE0F 5I1DB 2NY5C 3WFEH 3SDXE 1OCWH 1T7YA 1G6RH 1S78D 5FOBA 2ERJB 1E6JH 4HMCA 2YUWA 4IIQA 4XHQA 3RDTA 2YD6A 4MS8C 1FAIH 5BVPL 4JRYD 1CTOA 2AK4B 4FFZH 5D1ZB 1G9EA 3CFJA 4TQEL 2VXQH 2X40A 5DD1L 3TN0C 1U92B 1Y6MR 5D1XC 5GRVK 3U2SB 5J1SC 3MJ7A 2JJUA 1F45A 3L3OA 4FOMA 5GJTL 1DVFB 1KB5A 1W0WA 3TN0A 5DGQA 1NCAL 1V3MA 3QH3B 5JPMA 1M7IB 4WIQA 5MHSD 5I1GL 5HYJE 1AGDB 1NGWB 4GW4A 4QGTA 1RUKH 2VERN 4P3CH 2OR7A 4NYLA 4WHCA 5KW9H 1B6UA 3WXWL 5DA4A 3RWEB 5BZDB 2JELL 3PXJA 1FE8L 4P4KD 2BHYA 4YHOH 1T2QL 4YDJB 2ZNWA 4EN3D 4U6XA 5JHDB 4KK6C 4LVHB 1CDBA 1UYWL 1JGVL 1KFAH 1CL7L 3BAEH 1FNFA 4UUJA 1GC1L 4ZO8A 2F9BT 4X98B 1AGEA 2XTJD 1I9RH 5HGAB 2BP3A 3SN6N 4OLWL 2PTVA 4JO1L 5T3ZL 1T4KB 4H1LA 1CF8H 3FO0H 3QZWG 5I66B 4N0UA 3LDBC 1P4IL 3EKCA 5I1KL 4U6YB 4J6RL 2W9LA 4GW5A 1AQKL 5DUPL 3TO2B 5FV1L 5HY9B 1U8IB 4Y5VB 2O61A 2WQ8A 3MOBL 2JB6B 4JQIH 4K94C 5FFLA 2MKLC 2QKIB 2DWDA 2OX5A 3HMWL 4IBLT 5CEYB 1U3JA 3WFCH 3TYGH 1JYVA 3D69A 3BH9A 4PRID 5ADPL 4L9LC 1BQHB 3RWHA 3VMPA 4PTTA 2ZKHL 3IU3B 3E2HB 1DUZB 3U6RB 2F5BL 5I15L 3TJEL 3SKJL 4L9LA 4S1RH 4NGHL 3CUPB 5GZND 1IM3B 1KEMH 2V9RA 2X1WL 4XCEA 4NCC2 1R3HA 1U3ZA 3HUJA 4WGVB 4ZSOA 2FH8A 1FLRH 1FYTD 3MJ9A 5GSVB 2MHAA 1KIUA 1CGYA 4NN7C 4NQSB 3CD4A 4QHUB 5SV4A 3FB8A 4XNXL 3DVFA 1X9QA 2OTUA 1T7ZA 2I07B 3UTTA 4M7KH 3GKWH 1KSRA 3NOIA 3D48R 5ISZB 5KANG 1U8LA 3DRTA 1CE1L 1RULL 4JKPL 5JORB 1UENA 3QQ9C 5FDYA 1OSPL 1S5HA 1A1MB 1F5WA 2BDNL 1TJGH 5DGRA 4F2MB 5EULV 3LKOA 1MY5A 2DDQH 2UYLB 1JWMB 3MLPA 5IBTH 3CJJA 2UZIL 3VFNA 3O0RL 3IJSA 4ODTL 1WCQA 2PXYD 1G9MH 3LAFA 1JMZA 2AEQH 4JFDD 3GRWA 4XH2A 5F1NB 5BZWB 1YJDH 2ZCKL 4KJQC 1YQVH 2HG5B 4WRLA 3BEVB 3WO4C 4GAGH 1KJ2B 1GGIL 1I9IH 3KDMA 4RMTA 1EZVY 3LEYH 1CGSH 3TIDB 4QRRA 1NUFA 1BFVH 1SYSA 3RVVD 1YMHB 3DMMB 2V2XB 5C71A 1N3NA 1F8TH 3E6HA 5JLZA 4OFIA 2YC1A 3RVXD 4IS6B 3SDCB 5BVJB 3EOAA 3EOTH 5T5FH 5J13B 3BUTA 3FQRA 1BZ9B 2AJYL 4MJIB 1VEPA 4LF3B 2VDML 1IEBB 1UXSB 1I7UB 4WY7H 3WFHA 4TRPH 1C12B 3GMPA 5IW1A 2KUTA 4YXHL 3GMLB 1LO3L 3S34L 4OV5B 4QT5A 5HHME 3RTQD 4LSRL 3BN9C 2HT2C 3QNZA 1KT2A 5LAXA 4H0HB 4YGVA 1ONQA 4LVNB 3NABL 5KN5B 2DF3A 4NQCE 1RIVH 4DAGH 3BO8B 1NC4D 3HE6C 2Q7YA 3TO4C 2ICWJ 3C6SB 1U3HB 2H1PL 5I30H 1EIBA 4MZ2A 1Q0XH 3JTTA 2BHUA 5LWYH 4EUPG 3RPIA 3NFPA 3HE6A 3TO4A 5FF6B 5C1MB 2O5XH 2AJXH 2OCFD 5MEQA 4CVWA 4M03A 3NH7H 2CDEB 5JUEL 4Y2DB 1RZ8A 1OAXL 3CVHB 2APWA 1IAKB 5I18L 4WDIA 1HH9A 4PRPB 1JZ6A 3VXUB 3MRKA 2A0LC 3OPZH 1HHGA 3WSQH 4PLJC 2HKFH 1H5BC 4PRAB 1H3UA 3LOWA 1RUML 1IL1A 2OTWB 4U6HB 4MYWB 5EU7E 1BFSA 1CIDA 4JGMA 4KTYA 3ARFC 2B1HL 4HWEH 2AJ3A 4XXDB 1QEWB 2GSGB 4DVRL 5AWNL 1NCCL 2D9QB 4OCYH 1H5BA 2AV1B 4RMWA 5ITBL 4ISVB 1FSKB 4S11A 4M1DL 3DURB 5CILH 3P4NB 4GKZA 1WZ1L 4HC1L 3O3BA 3ARFA 1F4YH 1IKNC 4HH9A 4QHNB 4JZNB 4ZUWB 3L95B 1AP2B 4BFBD 1NFKA 4LLQB 2ESVB 3MCLH 3SQOL 3CFCH 4YR6B 2EE6A 1HXMA 4GOSA 4W6YB 1FCCA 3GJFB 4XC3L 4CU6A 1TPXB 4LSQH 1UVQA 5ECJE 3TNMB 4F80A 1IKNA 4BH7B 4OLVL 2Y72A 4JHAH 3NFNB 3CFDA 1BEYH 3DNKA 4PJCF 1I3RB 4LRNL 4O5LL 2QBWA 2HFFA 3WHXA 4OZ4A 3WYRA 3NZHH 4WI5A 4X6DF 5BW7C 1T3FB 1FNHA 3VXSE 5HHMD 3ZDZE 1KUMA 1JRHI 3BPNB 1INQA 2CIKA 2ZNXA 4WJ5A 1FNLA 3VG9B 5JMOC 1MLCA 1AO7A 5KJRH 3BDXA 4HF5L 3QG7H 1KLFA 3QWQB 4PREA 1G7QB 1MJUH 5I2IA 4K2UL 5BW7A 3P4OB 3GDBA 4PRHE 3VFUB 1JNNH 1NC2B 4N1HB 3AY4C 2PW2B 4FTVD 4LAQL 3NVQA 1VKXB 3BPLC 5L9DL 1EJOL 1YY8A 2R0ZL 8FABB 3VI3E 1NCBL 1VACB 4TOYL 3QQ3A 4EXPX 3BP4A 2YN5A 1XF2A 3RUGA 1A7NH 15C8L 3QEUA 4ODSL 2ZSVA 2CPCA 1FAKT 1KB5H 4KVNH 3UTSA 1PKQB 1Z6JT 2W07A 4NKIH 4MQTB 5IMLB 3AY4A 2CDGA 3SKMA 2VRAA 5DQDH 1ZA3A 5HHXH 2BJMH 2YXFA 3C60C 5IMOA 2WIIB 3IVKB 1SMAA 4JPKL 4KTDH 5CFHA 4YO0A 2F8OA 5ENWB 1MFCL 5F7WC 3WKNA 1KIPB 4XCNA 1RFDH 5DT1L 4L3EA 3GEWB 4Y89A 3GK8L 4UDTB 1IC5L 5E2JA 1BQUA 4OZGB 4LCWB 3PL6D 4PB0H 1SMOA 3JWNC 4BFGA 4E5XA 1KV3A 5FYJD 3MLYH 1I85C 4S2SB 3LH2L 3Q6GH 5KZCB 2VN7A 5HI4C 2CMRL 3UTPD 4R4FH 4QRUA 2MFNA 1FH5L 4MNGE 3RWJB 5KS9E 1KACB 1HYRC 4Z0BH 3VXQB 5HI5C 5HYQA 1AGFA 3JUYA 4ZS6C 1X4XA 3UJIH 5DC4B 1UWGL 1MJJA 1I85A 5C0GA 3RIFF 4X7TA 3AB0B 3OTTA 4UILL 1OAYL 3T0BA 4TSCH 5E94B 2A6DA 3HCVA 3D2UB 3H7BA 2UV3A 2H9GA 2X4SA 4A2MA 5HPOA 1S9VB 2WUBL 2X89A 4OIAA 3KYKL 1BLNB 3FJTA 3A67L 3RP1A 1I7ZA 2GJ6B 1D5MA 5C9JB 1V3LA 4HPYL 3G5VA 3QUZB 3KS0J 4HV8A 5EC2B 1P4BL 1H15B 3QDHA 3V52H 2HLFC 3VXSD 2FECI 5D7JD 4JFFB 2VDOL 4PGCA 4DVBB 1KELL 1MNUH 1FL6B 3S9DB 4K94H 3LKQB 43C9B 1R5VA 5FUOL 4KDVA 4LKXB 2NY4B 4YXLL 2DQDL 3L9RB 1MFEH 5DUML 1VEMA 2R8SH 3DI2B 4MA7L 3BW9B 1QBMH 4HZLB 1ZSDB 3G9AB 1MCNA 2V2WA 4RFNC 4FP8L 4P5MA 4U1LA 4UT7H 1B2WL 4YUEH 3C08H 2XA3A 3MLZH 3X14A 1N26A 3JWDH 1JHTB 4Q9QL 4X9IA 1NSNL 4M8QB 2O93L 2H26B 1KGCE 5JXEC 4KRNA 3MLWL 5IMMA 1DBBH 2RBLA 3NPZB 2RIKA 1TZHB 2XZCH 2N7BA 5H2BB 4XBPA 2VXUL 3BUYA 2FGWL 4QRPA 4S0SD 4PY8J 1ACYH 3Q0HA 1XH3B 4CMHC 2BVOA 4QXGL 1F11B 1IGTB 1M71B 1MRFH 3UJTH 3H3BC 3R06B 2LU3A 1OTUC 2X41A 1TETL 3KYOA 3ULVC 1HKFA 3T1WA 3DVGB 3CXHJ 1MIEH 3VD3A 5BRZE 4GG6E 2P5WB 2UUDH 5I1HL 1IC4H 2EYTA 4XB7A 3Q1SH 1UWXH 3CDGB 4C4KT 1Q0YH 1MCOL 4ZPVA 4TSBH 2CO7B 3EYUL 4FN0A 4JR9H 1MCIA 1P5UA 4Q2ZA 2CIIB 3N9GH 3W11C 1ORSA 5IM7B 4XWGH 4EI5D 5HSFA 2XN9E 1HSBA 2WK2A 4UT6H 1FZMB 2XYCA 3FN9A 1CQYA 1JF5A 1WBZB 1P7KA 1GZPB 5EOCH 1KTDA 1S7XB 4EDXA 4OLUL 2HJKB 1A6ZB 3TGXA 2J7LA 4MSWA 1PKOA 5FK9A 2ARJA 1KC5L 2FEEI 1R5WA 1EGJL 1NAML 5SX4I 1U91A 3O3EA 5DJ0A 3E8UL 2ZSWA 4Z7UF 3QQ4B 4BQ8A 1RMFH 3MJGX 3IAPA 3UO1H 2DD8H 5DD3L 2X09A 2FIRT 2IH3A 1KPRB 3LB6D 3EIFA 5F9OH 2AK4D 3K74B 3LS5L 4DGYL 4KRPC 1E0OB 3OQ3B 4EXKA 2R29L 1CS6A 1G9NC 5F7NC 4AEFA 3GSXA 3V5KA 1NFDF 5C92A 5IQ9B 2K1MA 5C0BE 3UX9B 5E9DE 5INDA 3TIEA 1RJLA 2HH0H 1NCDL 4LSVH 3W2DH 4YXKL 2C4XA 5FHAH 5KVDH 1UH2A 4UDUB 5MERB 1UWXK 4M4PA 1RUPH 2B0SL 1QOKA 4NKOB 1KGCD 5DR5H 3MBXH 4WUUA 3V4UH 4XC1H 2Y5EA 1QHPA 5EU6B 5IP4A 3OJ2C 4Z7OF 5C0AB 1S7QA 2VDNH 5ICXB 2ATPA 5T33H 3FHAA 4YHLH 1OSZB 2OSLA 2G5RA 5HGBB 3BKMH 3ABZA 4WUKL 2GKIA 3OG4B 4E0RB 4F7TA 5CD5C 1RHHB 1MJ7H 2KQMA 5BRZD 4QHLA 4ZFOA 5CWSB 4PJIE 1G1CA 2IBGA 2OR9H 4MNQB 4AZ8A 1HEZA 2NY1C 2PO6D 3MNZA 4UIMB 3VWKD 1YMMA 3SGJC 4X6BB 2GY5A 1YEDB 2YA1A 3RU8L 5L6YL 2VAAB 5IIEB 2XN9D 1KYOK 3ECBA 4O58H 1MHPL 5B39G 2IFFL 4JVPA 2CKBB 1BD2E 4Y5YB 1LEGB 3QZWA 3MA9L 4I0PB 4JFYA 4OGAC 3HI1B 3SGJA 1KN4H 2Y07L 2IQ9L 2HWZH 1MLBB 4R7NA 4MXVF 3LS4L 1AY1H 4J1UB 2DLFL 1FRGL 3KWWB 4M6NH 4EDWH 1RJYA 3GUTA 3FZUC 2HTKD 2FSEA 3QFJE 3RA7L 2B20A 2AJZB 4PGEA 4JAMA 3HFMH 4XRCB 1FJ1B 4JHWL 3NCCB 2C1OA 4I9WD 1HHJB 1SM3L 4YBHA 3G04A 3KPTA 5EFIA 3DBXA 4P23C 5MP6L 1B90A 3FTGA 1HNGA 3REVA 3SE8H 1QHOA 3QIWB 1Q72L 1K8DB 5E9DD 1EVTC 2RJMA 3ZTNL 2GEEA 3G5XB 4CU8A 4ZS7H 3WJLC 4XBEH 4AH2A 4EBQH 2P45B 1ADQL 1WAAF 2HRPH 4I2XB 3CH1B 5FYKH 1BWWA 4P9HL 4CKVX 4IRZL 3BZFB 4QYOB 4I48B 4LARH 3QXWA 4OCRL 4H0GA 2C5DC 5J12B 2ZCLH 3WJLA 4MJ2A 1D5IH 3SPVA 5KG9A 4NO0B 1WISA 1YNTB 3I2CL 1EA9C 1KB9K 32C2A 3QCTH 4D0DB 4WW2F 1L7TL 1CK0L 3DXAE 1QSFB 3PWUA 1JPFB 5HBBA 5CZXD 5T1LA 1IVLA 2BNQA 5TE7L 4CN1A 4OCWH 5JXAH 2V5SA 4MD5A 4PRDA 4HKJA 3QEQE 2DQIH 4WW1A 3UDWC 1MI5E 3GIZL 3THMH 1TITA 4NNPL 1RZKC 1DN2A 3BGAA 3KPSE 5ANME 5EBWA 4J3TA 4K7PH 4MAYC 5DUBA 1FNGB 3SGDH 1ZA6A 3UDWA 5BQ7B 4U1HA 2R1YB 3PIQB 5EU3B 4JO4H 1MPAH 3V7MA 3PV6A 4Y1AA 2ZUVA 1MSPA 1UJTA 2RHEA 5CCKL 2DB8A 3H42L 3X3FH 4HIHA 4MAYA 4XPTL 4BKLA 3VWJB 4TPRH 3S35H 3K1DA 4QY8A 4OZHE 3VRJA 4FQPA 3TJHD 3SDCD 3BQUA 4NRYA 1KCUL 2F54A 3IAQA 5L2KB 1KEGH 2X4NB 4HIIA 2GK0A 3CU7A 5INCB 5KVGL 5F7EL 1MCFA 1C8PA 5JR1H 3NBNA 1MFDL 5F96H 1V7NH 2R0KH 5GS2D 2R4SH 1UCBH 3RNQA 2BOBB 3FT3A 3K46A 3HZYA 5KVFL 3A6CH 1CU4H 1YEKL 3C8KA 2QR0A 1IGYB 1F2XK 2CLRB 4FS0A 4FQIH 4DOHB 3C2AL 4I3SL 4X5WB 2K7QA 1P1ZB 4CUCA 5FM5M 1YN7A 1ZAGA 1AD9B 2W91A 4QWWD 4HIJA 3S37X 1HCVA 2X4OA 2WIMA 3FO9A 1X6NA 5LXGL 4JN1H 4PJXE 4RDQF 4AJ0A 1HI6B 4OQTA 2OZ4A 3VXMB 4L29A 5D6DC 4PV9B 1LP9E 1YEEL 3O6KH 3ZYOA 4PBWD 4H88L 5EZOL 1MVFA 4JKLA 1KN2H 9CGTA 4OCXL 4R2GB 4GFTB 2H2SC 4Z7QF 4EUPA 1O0VA 3NAAH 3VXUD 1YYML 1CFVH 5D6DA 4XVSL 4OAWA 1DQQB 3T2PA 2M8XA 4FQJH 3QEQD 4KMTH 5CJ8A 1P84J 1QR1B 2YUZA 3TH3T 1JZ2A 4O00A 3ILQC 4P2QE 1GCFA 5JQHC 3GSRB 3B3IB 4UV7H 3KPSD 3RWGB 5I75B 5CKGA 3C8HA 5GS0H 2WV3A 1PY4A 3D9AH 3LZFH 4D3CL 1HYSD 2K7PA 4ERSL 2IPKA 4PJCB 2R69L 3L7EB 1RURH 4JDZB 3OB0H 3BD4A 1LE5A 3MLUH 4X6DB 5C07E 3QIBC 3NA9H 4QOKA 1BF2A 3NFSL 2ESVD 3H2WA 5I76B 3ULVH 3IU4L 4GQ9L 3P0YH 4G7VL 3GHBH 1KIQA 5DURD 3OAZH 4O02H 4P57A 5IESH 3GO1L 5D70H 1E4WH 3U9PH 4KHTL 1Q1JH 3FQUB 5H37H 2X6MA 5LCVH 4NO3B 4WV1B 4RA3A 1B9ZA 1DQJA 2NY0D 4LK4A 2ZWLT 2VDRH 3ILPB 5TF1L 4LCYB 2GYSA 4Z7VE 1J7VR 1FO0H 2BC4A 2VLME 5E6IC 1EDQA 2VXTH 5SWSB 4PJ5E 3BWUC 2Q8AH 5DVLA 1TQBB 2AEIT 3HUJF 4L8DB 2DLIA 1N59B 2DQFB 4KI1A 1OAQH 2QHRL 3ULUE 1OB1A 1XR9B 3VMNA 3L3DB 2GIYA 5E6IA 1AFVH 3VD5A 3VH8B 4U1SB 2AXGA 3DVNA 5D7LE 1WC7A 2DQCH 1KJ2L 4QXUL 4WCYH 3IFPA 1EK3A 5DDHB 3GJEB 5EUKB 3UCRA 4AY0A 4YPGA 2J88L 4RMQA 4RWHA 1B0GA 2HKHH 4N0RA 4PLNC 2HFEA 3GSNB 3OB0K 4IOIA 3M17B 1A9EA 3SDAB 2P4AB 3OKLB 4UAOB 3PDOB 4LCUB 5DJDB 4MXQD 5IHZA 5IVXB 3WKMH 1TVBA 3L6FA 2RQ8A 3C09B 2VLJB 3OAZK 2PR4H 4FQXD 4PD4K 1G6RB 1NANH 2YA0A 4NQVB 5CJBA 5F21B 3AU1B 4Z95H 5E7FA 1YNKH 3SDXA 4PRIA 4Z77A 1CN4A 4DN3L 2CLZA 3IJHB 5K93A 4G6AC 4RISL 4BA8A 3ZHDA 2A1WL 5DA0B 3UBXG 3D18B 2C9AA 1BQLL 2NZ9D 1V7ML 4PP1C 3AS2A 1TXKA 5D7KE 5C07D 3DGGA 2N1KA 4PJ7E 3W9DA 4IJ3C 5E8PB 1GOHA 1JV5B 4X6FA 2QADB 3U4BL 1JTTA 2XQYK 1UB5B 1BJ8A 3KVQA 3QPQD 3D2UD 5D93B 4KHXH 5TQ0L 3V0VB 1CI5A 3NIDF 2PCPB 2IG2L 3VXTB 1QLFB 1NKOA 3CVHL 2DQJH 1T1YB 3LKRA 4J3UA 4MCYA 1D6VL 1GOFA 4UQ2A 3S6CA 2ICEB 3AM8C 5HYJA 4BQ9A 1F58L 2VDLL 4U1MB 1MCWM 4ZMAT 4IRJC 2VLMD 2XFXA 4NQTA 5GZOC 3HLAA 2YBRB 4AENB 3QR2A 3LN4B 4JJ5A 1A8JH 5DFTA 1QKZH 5KSVB 3AM8A 4S1DD 1YNLH 3IFOB 5C0EA 3GSVA 5K9OA 2Z91A 3ULUD 5B3NA 4M43H 1TFHA 4IRJA 4XPGL 3V5HA 1X5JA 2NNAA 1XIWB 2GFBB 1BBDL 3E1F1 4OV6F 1ZWIA 3HAEB 1ZT1B 1UXWA 5DZLA 1F02I 1M7DA 2H32H 4OCSL 3UMTA 1CXHA 1U8MA 1XF5B 5BVPH 5HVHC 3QFDB 4NN5B 4HJGA 5IB1B 4M02A 2XXMB 4TQEH 5ALCL 1EXUB 3HN3A 3LQZA 3HC0B 3ES6A 4MWFA 3S36L 4YGAB 1XGYL 5A43C 4JZOB 2VDQH 2R1WB 3RVXC 1V8HA 4LGRB 4ZTOL 1MHCB 2WQRA 3T08A 2HT4D 2DRUA 1FVEB 1NDMA 1NCAH 3CH8A 4QNPE 2OM5A 1J1PL 2OI9B 2VLLB 4K9EC 5FO7A 2DIAA 1JZ7A 3LQAL 2YPKB 4NHUA 4L3AA 5I1GH 2MMXA 2NXZB 2DL2A 5IHBA 4NM8L 3WS6C 3BXNA 2FWOB 2BCKB 2VQ1B 4OI9A 3LRSB 4WWKD 3WXWH 1I9JH 3MZGB 5FECA 2JELH 2R23B 1FE8H 3FAWA 3DLQR 5F7DA 3O2DH 4Z7UB 1IZJA 1T2QH 3RTQA 5C7XL 4RGOH 1XR8B 3AMLA 4ZYKB 1UYWH 3QNXA 2FO4A 1GC1H 4LPVA 4NFDA 1A14L 5F89A 3QXAB 3EUUA 3KLAA 2NY3D 3MJ8B 5A16B 1NC4A 1G1YA 4GSDL 3RZCD 4JO1H 1O7VA 2ITCB 5T3ZH 4L8BA 1NFDB 1NMCC 4A6YL 4KAQL 3V2AR 1X4ZA 4YHIA 1AQKH 5DUPH 2CK0L 1FDLL 3BEWA 3IDJB 5D96C 4XI5C 5SWQB 1P2CB 4F3FA 1MOEA 5TDPA 1SJHB 3MOBH 3LPGA 2X5PA 4TN9A 3GSUA 3SCMD 4FRWA 3HMWH 4HIEA 3CZJA 3HNVH 5D72L 5C0JB 4X7FC 4R0LC 5ADPH 5E2WL 4AQOA 4MB5A 2VLKB 3RUGF 5DFWH 2H3NA 5HDOA 3VGDA 3S96B 2F5BH 4R0LA 4YK4C 3TJEH 3O4OC 3I84A 4NGHH 4Q9RH 3MC0A 4JY6A 4XP6H 2CH8A 4J3XA 2GY7B 1TIUA 4YIQB 4LBEA 4R9HA 4ODUA 1JPGB 3I3BA 5I1JH 3BYTA 4AIZA 5EOTA 3H9SB 3B9AA 3NCYP 1HKLH 4ZNEE 1WFTA 4EQ3A 2P8MB 5DFVC 2ZG1A 2D7PA 3RGVB 3CC5B 4R7DA 3L3GA 5CSZA 3ZZ1A 4G42B 4YNYA 1T7XA 5ESQA 1JNLL 1C16B 2AI0L 2VL5B 3ZT6A 3ARBB 3MRLB 3QHTC 4ORZC 4LU5L 4D9QD 5JOPE 3VRLE 3ELAT 1OSPH 2FCBA 4DW2H 5DHYB 4LLWA 4GUPB 4JFQA 4YHML 4YBLC 1XGQA 3GIVA 4D8PA 5F7LB 4Q7DA 1NCNA 4I0PD 2UZIH 3O0RH 4X83A 4ZPTA 2ZPKL 4JFEB 1IGIL 2EDTA 4ELKA 2FRGP 5DK0B 3OKDB 3P9LA 4ZXBB 2KQNA 2DLTA 4X0KA 4WVRA 5DRNA 5B39A 3JV4A 2ZCKH 1YEJH 3HZKB 4WI2A 4E42A 4C56E 4G8GE 3PHOA 5JMRA 1F3DH 4E9LA 4FA8A 5DK3A 3HPLA 1JF1A 1GHFH 1MRDH 3CIQA 5DK2B 5B3JE 5DMJB 1FVCB 5EPMA 2VXVL 4BFIB 1MWAA 2BNRB 5EU7C 5IW6A 3WNKA 4LPWA 2D7TH 4LVOC 4Q74A 4M7LL 4H5SB 1N6VA 4N0YL 4HWBL 3SDDD 4WW2B 1Z0NA 1AGCA 1URLA 1T83C 1OPGL 3X13A 4CVXB 1T2JA 3FO1B 3BWAB 1C7TA 3S34H 5GGQL 2IQAA 5F88B 4MA1C 1XGPB 4XPAH 3N1MC 4M62H 2HVKA 4HAFA 3CK0L 3NABH 4JQVC 4RGNB 4ONFL 3TPUB 3MRFA 5H94A 2AS5M 5I1LB 2W59A 2H1PH 5JDJA 1QYGL 4ETQB 4GXUN 2P8PA 3MNVB 1J18A 3DX6B 1A6WL 1WJ3A 3EFFB 4JQVA 4FG6D 1XF3B 1IGJB 4JFXA 2L4OA 4KY1L 1F4XH 2G75B 3ZL4L 4Y88A 3SY0A 3MGOB 1F3JA 1SQ2N 1MCEA 4K07A 3U0TB 1A3LL 4BELD 4B7IA 5JOPD 3LCYA 4GO6B 3ULVF 2QEJA 1OAXH 3VXSA 2EXWC 5D7JA 1R5IA 5FOBB 3MUHL 12E8L 3GHEL 4IIQB 3QXTA 1MVUA 3RDTB 4BUHA 4X6EA 1FVDA 5F1OB 2CR3A 2C3HA 2XZQH 1RUMH 3CFJB 2X4UB 1WIOA 1QFUL 4PRHA 4NIKB 1X44A 3INUH 2VE6A 4JFHE 3MLVL 4ZO7A 2L7JA 1T04A 4FFVD 3SKOB 3ZMRA 1QUNA 3MJ7B 3L3OB 4P2OC 1NCCH 4QGYA 1MQ8A 4FFYL 5ITBH 4XNYH 1KB5B 3C5JA 5D4QA 4J12A 1DQLH 3ZE1F 1GRWA 3TN0B 1X5KA 1WZ1H 4HK3J 2FX7H 2Q87A 4YC2C 5JPMB 5CSBA 1G7HA 1OW0C 1F6LL 4P2OA 2ED9A 2YWZA 2NR6D 4GW4B 3SQOH 4W81A 4KU1A 2DM3A 3OKOA 4JDTL 4NYLB 4Y7MA 2BFVH 2DJSA 4XC3H 3M8OH 2AXHA 1OW0A 1JHLL 4U6XB 4HK0A 4C57C 2M2DA 1LE9A 4UUJB 4O5LH 1GGTA 3O6LL 1AGEB 3SDYL 4XNZC 4KZEL 3WDJA 2CKBL 4HS6A 3CFIC 4H1LB 4U7KA 4D9RD 3T4YA 4HF5H 4NZUH 4MNGA 4N0UB 5KS9A 2CQVA 4R2GD 4K2UH 4HWZA 4K3GA 4GW5B 2I5YH 3CXHK 4RMVA 3U46A 1ZT4A 2RCSH 5BV7C 5AG9A 5SX5H 2O61B 3OB8A 5L9DH 1EJOH 1EUTA 1DSFH 4I3RH 1NCBH 3PWPE 2DWDB 1D9KD 1JN6A 2EZ0C 4ODSH 3RAJL 1PG7W 3D69B 5J3HD 1OGAD 3BH9B 3S5LG 3QDGE 4DZ8A 3GKZA 5IFHL 2G60H 4PTTB 1JHKH 3EO9L 5FO9A 2E3VA 3WIIL 1NH6A 3GMOA 3QAZC 3HB3D 4GKSA 5FGCB 1CE6A 3HR5A 2JB5L 3GFUA 4JG1L 4BQBA 1IC5H 1WWCA 1SBSL 4L9LB 4K9EH 1YUHA 4JFHD 4XCEB 1R3HB 3HUJB 1I1AD 4NKDA 4ZSOB 2YKLL 2MHAB 5IG7A 4U05A 5DVMA 2HP4A 3BKCL 1FH5H 3FB8B 4L1HA 4FABL 2OTUB 3T0VA 4Y4KC 3V4PL 4I1NB 1UZ6E 3TFKC 5C0DA 3NCMA 3J8F7 2CRYA 3FQNA 1U8LB 1OAYH 3LHPL 3BISA 3HZVB 4NN7B 3CSBA 1MCKA 5AZ2L 1BZ7A 5JHLL 1FG2B 4YDKH 3DSFL 2WUBH 4Y4KA 5SX5K 1I3VA 1S5HB 4YX2H 4K8RL 4POZD 2DQUH 5CINH 3RRQA 3LKOB 3VWKC 1A3RL 4HPYH 4URTB 4U49A 4ODVH 5BRZA 4UT9L 4GG6A 3IJSB 3QULA 2LAGB 4XT1C 3VDCA 2YUXA 3FCTA 1CLCA 4R4NC 4JY4A 5HHNA 5I17A 4M6ML 3RIAK 3VWKA 1UWEH 1U42A 2KKQA 1EPFA 2DQDH 4XH2B 5D7SL 5E4EB 1QR4A 2XN9A 5F7UA 1KIRA 5FXCH 4YE4H 5B8CC 3GI9H 4NNYA 1UM6H 2Z0BA 3KDMB 5EUOE 2HTKC 4FP8H 4KGJA 4QRRB 1PBYA 1BVZA 1SYSB 4HCRL 2VLJD 2VDPH 1CD9B 2X44D 2WLZA 3ZDXF 3WO4B 3E6HB 5B8CA 5JLZB 3QUKA 2YC1B 5DVNA 1NSNH 3EOAB 1X4YA 5DZOA 1HHKA 3FQRB 2EIDA 3QDGD 3O6MH 1KTKE 4KC3B 4C59B 3WFHB 3LVEA 4LQFL 4TUOA 2VXUH 4UNTA 5IW1B 4B7LA 1FC1A 3T77A 2WLYA 4P3WA 1ZKAA 1JPST 5EIIA 1JWUA 3QNZB 1KT2B 4DKDC 4KI5E 4YGVB 1ONQB 3V6ZA 4P9ML 1JGUL 1TETH 3UBXA 1K4DA 4P59L 5ACZA 5E9DA 3LN9A 1CFTA 3BIKA 2ZP0T 4G5ZL 2XWJB 1M1SA 3N06B 1J10A 4XX1E 4GMSL 3EYUH 2P5EE 2DYPD 3T8XA 3WIHA 3JTTB 3RPIB 3NFPB 3HE6B 3TO4B 5MEQB 4G9FE 3M1BA 3P0VL 1BM3L 4GBXC 1RIUL 4LCCC 3O3UN 4L8CA 4M6OH 1RZ8B 4H25A 4P5TC 1PVHA 3A6OA 4WDIB 2AP2A 1HH9B 2DI9A 2R1XA 4ODHL 4X8XA 3MRKB 2WUCL 5FIEA 1MWAH 1PY9A 4N8VG 1EGJH 2W92A 1HHGB 1GH7A 4GBXA 1J0ZA 1RZFL 1II4E 1XIWD 1LQSR 3E8UH 4LCCA 4X8JA 2EE9A 1ZLVH 4XMKL 2QLVB 1IL1B 4PJIA 4FNLL 4MHHG 4EEEA 4P5TA 5DD3H 4HULB 3T3PE 4GT7A 4HUMB 3TZVD 1S7UA 5HDBF 4CL7A 2AJ3B 1DDHA 4DGYH 1H5BB 2FH6A 4YFEA 1BVKA 1XCQA 1Z0MA 3NCEB 5FYJH 4JPWL 4M5YL 2YRPA 1GYAA 4GKZB 1IT9L 3U79A 2J2ZA 5EU4A 2MOVA 1BD2A 3O3BB 3ARFB 4HH9B 4DKAA 4AT6A 3V4VH 5E00A 1JI2A 4S10A 1EMTL 5I0DA 5D7IE 1CBVL 3JSSA 4HUUA 1DTUA 3BGFC 3KYMA 5I1EL 1EJ6A 2B5IB 3EZ8A 4X4XA 2YD1A 4UOJA 1UVQB 1K6QH 2B0SH 2NXZD 3VGBA 5TJWK 3D25A 4X9BA 3RI5K 4MX7A 1XGRA 2E7BA 3CFDB 3QFJA 3ZKXC 3TYFA 2HFFB 3WHXB 1TVDA 4OZ4B 4TTDD 2EDWA 2EDFA 2QSVA 3G6JE 2MSPA 1A7RL 2ADFH 5FOJA 5K59F 1U8KA 1INQB 2CIKB 2OJZL 1T22A 4WJ5B 2X1PA 1SVZA 1MLCB 1VGEH 1AO7B 3BZEA 5K33A 2ZCHH 4PREB 3LKNA 3Q6FA 3L3JA 1QSEE 1OWRM 3REWA 3QUXD 5BS0E 4Y8AA 3ME0A 5F3HA 1ZLVK 3JVGC 3GSNL 1FV1A 2Y7QA 4M48H 1DQDL 5IGXH 3DYPA 1YY8B 3ARDD 4KXZI 4FFWC 3KG5A 3RU8H 3QQ3B 1EEQA 3BP4B 1XF2B 3RUGB 1EVUA 3QEUB 1MEXL 1MHPH 2ZSVB 4Y2OA 4UTAL 2IFFH 3UTSB 2XPGA 3V0AC 3WFEL 3MA9H 1UKTA 1ZHLA 1G6RL 3QO0A 3DXAA 3BPLB 2CDGB 3SKMB 2Y07H 5DHVA 1ZA3B 3CX5J 3ARED 3L1OL 5IMOB 3DGCR 1PSKL 2XKNA 3O11A 4YO0B 1FFNA 5HVWA 3QEQA 4JQXC 2DLFH 1FRGH 4L4VD 1MI5A 3WLWD 4XCNB 4KK5C 5EORL 1JNHA 4L3EB 3I9GL 4Z7WE 3SOBL 3W0WB 3S88H 3KPSA 5MEPA 5ANMA 4KZDL 2B1AH 3O45A 4JHWH 4E5XB 2FGZA 4JQXA 1JUFA 2W0LA 5MP6H 4AG4L 4IEFB 4V2CB 2A73A 5HYQB 3ZTNH 1AGFB 1MJJB 5C0GB 4X7TB 4P3CL 2BVEA 2NTFA 2NY0C 4OZHA 3RGVD 4JB9H 4P9HH 2OS7A 2DQEH 2A6DB 4IRZH 3C5ZD 3HCVB 3H7BB 2R2HA 2H9GB 5DJZA 1HWHB 3SDXF 2VL4A 2WBJD 2X4SB 3O3AA 1FN4A 1KFAL 4KMLB 3BAEL 4YFLF 3X12A 1I7ZB 3I2CH 1D5MB 3G5VB 1B3JA 1CK0H 1I9RL 4HV8B 4XHJD 3VA2C 3ARGC 3HZMB 3EYSH 4PGCB 2WAHA 5A2JH 1AXSA 4JEGB 1KPUA 3B9KC 1DL7H 1CF8L 1IKFH 1BQSA 3H3PH 3GIZH 4HWNA 1R5VB 1N8ZA 4KQ4H 3T3ME 5KTEH 4F7EA 3KYNA 4PY7A 5BS0D 4KGLA 2OXHA 3P11L 5KSBE 5FCUL 3B9KA 3CLFH 2V2WB 4AIXA 2VXSH 4PJXA 3HC3L 1EUUA 4MD0B 3KPRE 4M9PA 4P5MB 4U1LB 3G5YA 1LP9A 3TYGL 3NA4A 3X14B 5CCKH 3V79C 3TF7C 4XPTH 4PRPE 2OBGA 2X4RA 2DI8A 4LVEA 4RFNB 5IMMB 4MQXD 1LO2H 1EX0A 1KCUH 3I02A 3BUYB 4K23H 2JJTC 4LNRA 5KVGH 5F7EH 2BVOB 3O9WC 2NZ9C 2V7NA 4FQXA 4P2QA 1KEML 2FO1A 5D2NE 3KYOB 3EW3B 2WNGA 4TULH 2VTFA 2IPUK 1FFOA 2EDBA 2P47B 2JJTA 4C55A 2EYTB 4LQ1A 1YEKH 1HINL 4CMHB 2R0WL 3O9WA 4ZPVB 1J1OH 4I3SH 5C07A 4Q2ZB 1AD0A 3BRGC 3GKWL 1ORSB 3NACH 2J5LC 3EYFA 3SJVB 4N90D 5CJ5A 2Y1VA 4JO3H 3VFGH 1A4JB 1P7KB 4GLRI 2BVQA 3ALWA 5FAAA 1DE4A 4WU5A 4EDXB 5KOVC 4PJ8D 4MSWB 2H8PA 5C0CD 5FK9B 2ARJB 5EZOH 4L1DA 1R5WB 2DDQL 2OJEA 3P4MA 2YK1L 4NQDE 2B8OT 1N7ML 1U91B 1YEHL 3O3EB 3F12A 4JN2A 2ZSWB 5DJ0B 4UI2A 4Z7VA 2ZUXA 1CVSC 4NKMA 1MCQA 3ULUC 1IEAA 3G6DL 3MRHA 4KRMB 4YPJA 4MNHA 3V5DA 3PABA 4XVSH 5I74C 3RDTD 1IEHA 4PJ5A 4B53A 1G9ML 2IH3B 3DUHA 5IK3A 2I9TA 4OZFG 5J11C 1YQVL 4DZBA 3EGSB 2Q86A 2VISA 4KK9D 4GAGL 3GSXB 4GKOA 3DJ9A 3V5KB 1BGXL 3LEYL 1NGXA 5D7LA 1JYXA 2F8XC 4WI7A 5INDB 1BFVL 3TIEB 4TVPL 4Z9KB 1S7RA 1RJLB 1J0JA 3KPRD 4KRPB 2HN7A 4OJFL 1FHGA 2D3VA 1MQKL 5CSGA 3MV8E 4M7JH 4WFFE 5D1XD 5EZIL 2E7MA 1J9CT 3DWTA 4Y5XC 2AXFA 4ESKA 4EZMA 4LIQE 5CJQH 3IU4H 4WUUB 2AQ2A 4G7VH 4TRPL 1ZHNA 3QA3A 3N1PC 4XP4L 1NPUA 3F6LA 7FABH 4OFKA 1S7QB 4I8DA 4Y5XA 4L4TE 4PGBA 2ATPB 3OF6D 2OSLB 2J8UE 5GISH 3KHOA 2BY3A 4U1KA 4DAGL 4F7TB 4JCLA 2DQHH 4QHLB 2BRRL 4ZFOB 5I30L 2NY3C 3U7YL 3QHFH 1Q0XL 4G6MH 3MNZB 1DP0A 1BF8A 2CGRL 1LILA 3MRBA 1YMMB 4FXGA 4PJ7A 3LKSA 5LWYL 2QHRH 4XX1G 4NZJA 1TZIA 2AJXL 3ECBB 4U1JA 1QO3A 4NZRL 2B2XL 5EOQH 2FD6H 3G5ZA 3GMQA 3QZWB 4QXUH 1N5AA 2WWKT 4JFYB 5HHOE 2GJ6E 4WNQA 4NWTL 3U7AA 4R7NB 1HE7A 3HKFA 4IHOA 3C8DA 2J88H 5BMFL 3JWOH 5DEGA 3SCMC 3WSQL 2HKFL 4NQDD 4WTXA 4M93B 5IJVA 1RJYB 3GUTB 1FFRA 2FSEB 2ID5A 4NCC1 1JTOA 1GVIA 3RKDC 5E5MA 4PGEB 4JAMB 1T5WB 5IVOA 2C1OB 1OD7A 4LCIH 3SCMA 4XVTH 5GS2H 3CCHB 3G04B 4OCYL 5EFIB 3DBXB 3BE1H 4YHZH 3CSPA 4UIKL 3S5LA 3E0GA 3FTGB 1U9KA 3REVB 5CILL 3BJLA 4UV4L 3KLSA 1U8PA 2W65A 1AKJD 1F4YL 4NQXA 4YEEA 2OLDA 4RISH 2A1WH 4RFEA 3P2TA 4AH2B 4HWUA 3CFCL 1V7MH 4L3CA 5MEOB 3RVUD 3QP3A 4WFFD 1PQZA 4TNWF 4LSQL 3UTTD 3IRPX 4NBYB 4EIGB 3U4BH 3QEGH 1HQRA 1NAKH 3M07A 1L0QA 3SPVB 5KG9B 3DI3B 4P49A 3WFZA 3NZHL 1A7PH 1UGNA 1W72A 32C2B 3EDKA 2IADA 3GBMH 3PWUB 1JGEA 4L4TD 1D7FA 3FOMA 3CVHH 3DROA 5T1LB 1F6AA 2X05A 2BNQB 1R3KA 5F9JA 1U8QA 4PRDB 5KJRL 5DVKA 1GGBL 4EVNA 3QG7L 1G84A 4HKJB 4WW1B 1E4XH 1NLBL 2P7TA 3KLDA 1JRHL 2VDLH 5ESVA 3GMRA 3QQ9D 4QTHA 5F7MC 3D6GA 2NY5L 5EBWB 4Y4FD 1YDPA 1A6AA 2NY6C 1QFWI 2ORBL 3OZ9H 2Z35A 1ZA6B 2X70A 2YSSB 4U1HB 4CW1A 4G6FB 2WWMC 4F37K 3LQMA 3D0VA 5IHLB 1KB5L 4Y1AB 1Z9SA 1TVHA 2KL6A 4XCYA 3BN3B 4HIHB 4BKLB 2YEZA 3T0WA 5DQDL 5HHXL 2KDGA 5HHOD 1TTFA 1R3LA 5H35A 4KTDL 4QY8B 1F97A 3VRJB 1L9NA 3T65A 3BQUB 4NRYB 4HH8A 2F54B 1RFDL 1DUYB 2GK0B 3HG1E 4HIIB 5D2LE 3ZDZF 3S36H 3ZKSD 5JNYA 4EOWH 1XGYH 4JFPA 2QQNH 1FL5A 4RA0C 3ARWA 5FB8A 2HVJA 3SDDC 5HD8C 4R90L 4F9PC 2ZUQC 3RNQB 4LKCA 4EQ2A 3MLYL 3FT3B 3WUWG 3HZYB 3LV3A 2YD9A 3Q6GL 5CGYC 3K7UA 4O51A 3C8KB 2QR0B 4R4FL 3SDDA 4F9PA 5CEXA 4ODWA 2Z4QA 3VI3F 4ZUUB 1NUDA 3BN9D 3BX7C 4Y8DC 1YN7B 3K8MA 5IFJA 1NBZA 4HIJB 1CFQA 2VNCA 2X4OB 1KLGB 3U36A 3BP6A 3FO9B 4NQEE 5C7XH 1CGWA 1RQ5A 2VYRE 4L29B 4ZUSA 4LSUL 5DJCA 5C0AE 2VZSA 3NPSC 3AAZA 2FHFA 4GSDH 1KJ3H 5CJOL 4ZNEA 4POUB 4EUPB 1MNUL 2IALA 1FNSL 1U8HA 4K94L 2LU7A 4G7YH 4OAWB 5DYOA 1MHEA 3BI9X 5EN2A 1CL7I 3PHSA 1FDLH 3OHXA 4S0TD 1EFXA 5C08E 1MFEL 4CN4A 2R8SL 3FMGL 3GJFK 4AYFA 4N8VA 5KS9F 3G6AB 2APTA 4UT7L 1J12A 1F42A 4UBDC 4P0DA 2IPKB 3MLZL 3RVWD 3MJ9L 3T4AA 1GGCH 3JWDL 3CLEL 1LE5B 3ARSA 4FXKA 4NNXA 4HT1L 4HHAA 3VGAC 2AJVL 1HILA 4LHUD 1JGDA 3IDYC 1Q94A 4AIOA 4ZG1A 1KIQB 5EBLA 1BHGA 4U1GC 5HI3C 4P57B 1RI8A 2EXYC 3HG1D 2E9JA 4C56A 4CMMA 4G8GA 3HS0A 2IEPA 2Z93A 2F8VA 4M4RA 3UJTL 1WWWX 5ICYA 5D5ME 1DQJB 4XTRD 4FQHA 5EZLA 4JVUA 4WHTA 3Q1SL 2BC4B 3DV6A 4M7ZC 5C8JA 2YPLE 2JJVA 4JR9L 3B2UC 2J4WL 3IDIA 1JNLH 4I2XE 2AI0H 4G8IA 5HGHA 4OLXL 1OB1B 4UT6L 5E6IB 5CBAA 2A77H 5C0RL 3EOBA 3ULUH 2AXGB 3DVNB 1WC7B 2SEBA 2Q7NA 3IFPB 1JZ3A 2AKRA 4YHMH 3B83A 1KPVA 1ZV5A 4FQ2L 4YPGB 3PWLA 3UTSD 1B0GB 3EYVA 4NOBA 5KOMC 2A6IA 2HJLA 2HFEB 4MA3A 3RKPA 3IXAA 2ZPKH 1VCAA 3UO1L 1A9EB 1I8KA 4WI9A 1OT1A 2EECA 2FEEL 1CGUA 1DANU 1XMWA 1IGCH 4BSVA 1N6UA 1D9KA 1TVBB 4L3ED 5TPWH 5L8KB 3L6FB 4GG6F 1J0KA 5C08D 3C60D 3HB3C 2D2OA 1KJMA 4LPYA 5EIQA 2VXVH 1LWRA 3ALXA 4YHYC 4PRIB 4Z77B 2CLZB 1GAFH 3T0EE 4Y16C 5DC9B 4G8FA 3D3VE 4LSVL 3W2DL 5KVDL 4N0YH 4HWBH 2F5AL 3DGGB 3TA3D 3W9DB 1CFSA 4NP4H 4P4RA 4MCZA 3MBXL 4Y16A 5HI4D 4NFCA 4XC1L 5DRXA 3PGFL 1G7IA 1I1AA 4NPYA 2IANE 1IGFL 3S3JA 1FYTB 4ZS6D 4YHLL 2X89D 4IJ3B 4MQSB 3LKRB 1U8OA 4MCYB 1XGUA 1NAMA 5HYJB 5HYSG 1OL0A 1WUNT 2DN7A 4POZC 2OR9L 3MODH 3QCVH 2XFXB 3UEZA 2YPLD 8CGTA 3HLAB 4JJ5B 4MJ5A 5AEAA 3QI9C 3ZL4H 3AVEA 2HLFD 2I9LA 4R6UA 5EO9A 5C0EB 3GSVB 1A3LH 1T7WA 5K9OB 2Z91B 4O58L 5JQ6H 4IRJB 3V5HB 2ICES 4OUUA 2NNAB 3IETA 2DTML 1ZWIB 1W0VA 3MRMA 3QI9A 1KN4L 1UXWB 1F90H 12E8H 3GHEH 1M7DB 3VFRB 5FKPA 1U8MB 1WV7T 1PG7X 4Z0XA 2EE3A 4HJGB 4M6NL 3ZKNC 3LQZB 3ES6B 4MWFB 4GAJL 3SKNA 2XACC 2Z9TA 3MZTA 3TBTA 3MLVH 4PY8I 5E95B 2X4QA 1SYVA 4QRPD 3FN0L 4ZQKA 4FFYH 3PWPA 3RWFA 3UTOA 3MRIA 1NDMB 5JXED 4PJIF 1W72H 1WICA 3GMMA 3FL7A 2NY2D 1J8KA 1NMAL 3MRGA 2O26U 4O9HL 4NJAH 5FO7B 4WHYH 1Z5LA 4NHUB 3QDGA 1KCRL 5JW5A 2BSTA 3BXNB 4ZS7L 3T0ED 2PW1A 3BIBX 1CZ8L 4JDTH 4XBEL 1ITBB 1U41A 3O4LE 2ADGA 5FECB 1OTUD 2IBZX 2Y25A 5F7DB 1UZ8A 3RTQB 4LARL 1XAUA 3VFVA 1S7SA 1S5IH 3QNXB 1Q9LA 1OTTC 1A1OB 1JIBA 2FO4B 2YMXL 3JUZA 1D5IL 4MQ7A 1NDGA 1VENA 2GAZB 5F89B 2KH2B 3DPBA 5CEZD 5GRYA 4KZEH 1NC4B 2IAND 1Q9WA 3W11D 4R4BA 3B9EA 1ULVA 4L8BB 3KPOA 4OCWL 5C2BL 2DYPA 3I75A 4YHIB 1BIHA 3BEWB 1JPTH 1J0IA 1UADC 2GSIA 3AXLA 1IE5A 5JA9A 4F3FB 5TDPB 1NMCB 5DJAA 3MUY1 3GSUB 2FX9L 1IC7H 1LO5A 2PYEE 4K3JH 4HIEB 4P3DA 3TZVC 4JO4L 1UT9A 3PP4L 5D96B 4HDIA 3I6LE 3K8LA 4BZ2H 1REIA 4OSUL 3U30C 4HLZH 3X3FL 4MDJA 2FHBA 3QWOA 3JV6A 2OTPA 4TPRL 5IFHH 4KRPD 3EO9H 5C0ND 2R56L 4OZFA 2H3NB 4JDVA 3TZVA 3MQIA 5IBUB 5LJYH 3JTSA 1JVKA 2XRAH 2F74A 3K4AA 1EAPB 4R0LB 2GI7A 2JB5H 2QJDA 4JG1H 1HSAA 3BHBA 1MHHA 5F1IA 3ROOA 3V0WL 1SBSH 2DWEA 5I19L 5IVXE 3DHJA 5J06A 5DWUL 1OQXA 2R4SL 4WFGE 1L4IA 1UCBL 4LBEB 5EUOA 4ODUB 1N2RA 4AIZB 4YK4B 1NGPL 5EOTB 5F6HJ 4OQ1A 3X11A 4LSTL 3O4OB 4F15C 3BKCH 4R7DB 3L3GB 5CSZB 3SGEI 2JJSC 1KYOJ 1EH9A 1QQDA 4YNYB 3V4PH 3HI6H 4YQXL 5ESQB 3EO0A 4KI5C 2UWEE 5F71A 3LHPH 5KAQG 1DVFC 1ND0A 4NRZA 1EO8L 5JHLH 5L7XH 2JJSA 3DSFH 4OFPA 5HHMB 4JN1L 3MCG1 1ZHKA 3MGAA 3P77A 3O81A 3OV6A 3P30L 4LLWB 1H9VA 4K8RH 4JFQB 4GRLC 3O6KL 1XGQB 3MYZA 4OZHF 5E6YA 3GIVB 4D8PB 2NY1D 2VOTA 3ARDC 2EDDA 1H3PH 4UT9H 4NFBA 4HK3N 5DRWA 3QUXA 1UB6A 3HRZA 1MY7A 4K71C 4ZPTB 4CVZA 1ZEAL 3NAAL 5DVOA 4GS7C 4ELKB 1KCSH 4RIRA 4GRLA 4YBLB 5JOFA 2P5EA 4X0KB 1AHWC 5DRNB 3ARDA 5B39B 2D0HA 4KMTL 3JV4B 1PJ9A 4S1QL 4O2EA 4E42B 4OGAD 3PHOB 1EERB 4G9FA 3BSZH 5DEFA 3HPLB 1JF1B 4PS4H 5EA0H 3WLWC 4YH6A 3W82A 5EPMB 1M6OB 4OB5L 4CJ0A 1AHWA 4OGYL 3LZFL 3UTZA 1MWAB 2Z92A 3AREA 2J8HA 5IW6B 3EJJX 3FZUD 2PYED 2GT9B 3TC9A 1IILE 5A2LH 3RQ3A 3EJYC 3U9UA 4JRXE 3MLUL 4L4VA 4NUJA 1AGCB 2EDXA 3NA9L 4PJXF 4DGIH 3OG6B 3X13B 3ULVL 3RX8A 4P23D 1LP9F 2ILLA 3ZYJA 3O6FD 5I1CH 5GGSY 3CX5K 3QDME 4LVOB 4MJ6A 2IQAB 4O02L 5IESL 5BO1H 2NPLX 5D70L 2WP3O 3U9PL 2D7NA 1BPVA 2HVKB 5EBMA 4P9MH 5CEZL 3GM0A 5LCVL 1KXVC 4P59H 2WBJC 4HG4K 4WFGD 3MRFB 5H94B 5FGSA 2HTLD 4ONOA 3MFFA 3E6FA 4G5ZH 3B5HA 4MA1B 4LEOA 5D7IA 3NCBB 4GMSH 3C5ZA 3MCKA 4XHJC 4JFXB 2Q8AL 2WBJA 1A47A 4Q0XL 1IMHC 3SY0B 3PDDA 3DARA 1F3JB 5IQ7H 4I4WA 4RMUA 1RIUH 3VXSB 5I1AA 1IM3A 1NEUA 3BFOA 3G6JA 4WCYL 5D7JB 1R5IB 4G6FD 1MVUB 3EYQC 4Y1AD 4X6EB 1FVDB 1RZFH 2ZUTA 3NCFB 1MCSA 5GSVA 5CIPA 3STLA 3H0TA 2HKHL 4MAYD 1G9NL 1TJHL 1QSEA 1PYWA 1DLFL 3TV3H 5BS0A 2PUQT 5J7CC 1FCGA 5J89A 4NJ9H 2VE6B 3IRZA 4ZFFA 3AFLA 3K3QA 1T04B 3KPQB 5FGRA 2I25N 1Q8MA 3TLRA 4MQXC 3WKML 2EYSA 3VD7A 1SHMA 4Z7VF 3C5JB 4JPWH 1WTLA 2PR4L 2C3VB 1QBLL 1IT9H 3PDGA 4JREC 4JHBA 2NX5E 4Z95L 3K2MC 2Q76A 3DRQA 1G7HB 3V95A 4P2OB 5JW4M 1MFBL 3DO3A 3BGMA 5TE6H 3ULUF 5I1EH 1PW3A 2FB4L 4ZFOL 5MI0C 3K81A 5F97E 3FQWA 4JRXD 4J8RA 4YC2B 2PTUA 2EO1A 2BVTA 5JPNA 1OQOA 2JE8A 5GRZA 3WUWA 4HK0B 4Z7WA 1T0MA 2D03L 5SV3A 3S3PA 3KPMA 1LE9B 2WBKA 2Q8BH 1AXTH 1S9WA 1DEEA 2F58H 1KTRL 4KHXL 1XF1A 1A7RH 3BEVA 3KNBA 2EDLA 3UXFA 4HS6B 1F2QA 4CDGC 1BX2A 2DQJL 3T4YB 3H7LA 3HNSH 4MNGB 3OAYH 1P69B 5KS9B 4PFEA 3P4LA 3Q3GA 4HWZB 4PJ8C 4XNZB 2VR9A 2WW8A 1C08A 4IS6A 4N9GA 1UH3A 3U46B 5AZEH 1JZ4A 4OZIE 2BY1A 1EEUA 1R3IH 4PGDA 3R1GL 4WENB 4PGZA 1IAIH 4W68A 3RPKA 1KBGH 1QKZL 1NMBL 1JN6B 4PJ8A 1YNLL 1MEXH 2H2SD 1JCKA 5E1AA 1AH1A 5CMAA 4UTAH 2IMMA 1U3HC 2JK5A 1WGOA 3WNPA 4JFOA 5BV7B 1IQDA 2ADIA 1OP5H 4PJ7F 5F44A 4DZ8B 3L1OH 4KK9C 4I0KA 3W9EA 3MXVH 1X5HA 3ILQD 1PSKH 5FO9B 3GMOB 3C6SA 3JBG7 4NZTL 4GKSB 5DJYA 1CE6B 5EORH 3EDJA 3HR5B 3P9MA 4QOKD 3I9GH 3SOBH 1J8HE 4IDLA 2VDQL 4FHBD 4KZDH 1LK2B 5KSBA 3LMJH 1YUHB 2C7UA 2Y6SC 3VRIA 1ED3A 4NKDB 4NO2A 2LVEA 1NCWH 1RUQL 3QAZB 4NT6A 3QIBD 1H3WM 4AG4H 3KPRA 5IG7B 2N4IA 2FLRT 4LAJH 5D1XA 4G6JH 3CSYA 4PRPA 2P44B 4ZTPH 1A5FL 2HT3C 5C0DB 3I6GA 3OAYK 3B2VH 3F6IA 4OF3A 5D2NC 3FQNB 3LD8C 5IB4A 1I9JL 5DMYA 4N5EC 4KH2A 3U82B 1FSKC 3TVMC 4LHQB 3UYRL 1M05A 1BZ7B 3MJ6A 3O2DL 5FCSH 3NTCH 4Y4KB 1CGXA 5F93C 4RGOL 5AG8A 4CDHA 3OF6A 1OM3H 1VFBA 3CFBA 5HXMA 1QEWA 5E6ID 5D2NA 3IFNH 1TMCB 4YJZL 3TVMA 4KJPD 1RZKL 5BRZB 4GG6B 3RIFK 4H20H 3TBSA 2E7HA 3D39E 3RY4A 1MAMH 3HAEH 5FV2A 2PO6B 1OP5K 4QHNA 5ADOH 7CGTA 3QULB 3FCTB 4WEMB 4JPVH 4PD4J 5HHNB 3VWKB 5I17B 1CGVA 4YR6A 3L5IA 2XN9B 3P11H 1KIRB 4YHNA 3BPCA 1B4RA 5FCUH 4QNPF 4NNYB 4J23A 1RZJC 2BY0A 5FM8A 1U36A 3HC3H 4APQC 4QCIA 1I3RA 1FZOB 3HNVL 1EBAA 5HHPA 5B8CB 4NQDA 3CSGA 3QUKB 3UTQA 1DFBL 1HHKB 4BM7A 4APQA 2LE9A 3SE9L 5TF0A 3OXSA 4TUOB 1G7QA 3QRGH 3P4OA 5GGVL 3NGBC 1OLZA 3T77B 1UFUA 4OF6A 5EIIB 1JWUB 1TCMA 4G6AD 4Q9RL 3SE3C 4XP6L 3RVUC 3MV9E 3UBXB 1AKJA 8FABA 1K4DB 4OQTL 2OZ4L 5I1JL 4PP1D 5F6IC 4YHPA 5ACZB 5E9DB 1CFTB 3BIKB 4OFYA 3UJJL 1HINH 5FYLE 1HKLL 2R0WH 4NC1E 4HFUL 3F7RA 5GGTA 3SE3A 3MV8A 5LG1A 4A6YA 1NEZG 1T7VA 2X9XA 3T8XB 5HYJD 5JIHA 1SY6A 1U95A 3ULSA 2DBLH 3M1BB 5LQBH 3FRUA 4W4OC 4L8CB 4UINH 3IS1X 4H25B 4L4TA 1MH5A 3VFTA 4DW2L 3CMGA 1RK1A 5HYSA 4Y4FC 2R1XB 3KR3H 2J8UA 4IRJD 4YDVA 2YK1H 4GBXB 3TCXA 1GXEA 1N7MH 1YEHH 4LCCB 5GZOD 4X8JB 4W4OA 1T0PB 2DKSA 3G6DH 3IAGC 4PJIB 4CNIB 3D39D 1RZ7L 3QIUC 4P5TB 4MB3A 2UY7A 4Y4FA 3ARRA 2J6EA 1S7UB 3CVIL 4PTUA 1DDHB 1YEJL 4ZO9A 1BVKB 1XCQB 5E99L 3S37H 3VXRE 1CDHA 3F5WA 3C6LC 3MV7E 3QIUA 1GHFL 1BGXH 1MRDL 5EU4B 1ERNA 1BD2B 4AT6B 5E00B 4TVPH 5K9QI 1J5OL 4AEIL 5HHOA 4OJFH 2GJ6A 1MQKH 2D7TL 3D0LA 4HUUB 2GUOA 2VQUA 5EZIH 3C6LA 5GGRA 4X4XB 3OKMA 3VRLF 4X80H 5CD3A 3WNNA 4MX7B 1XGRB 5CP7B 3QFJB 2AGJH 4YHKL 3OJMB 3TYFB 4XP4H 3BGFB 3L9RA 5E5UB 4P2YA 3IYLW 4XPAL 4M62L 1U8KB 4C83A 1T22B 2IF7A 4H8WC 2ZOKA 2IGFL 2BNUA 3MV9D 4N0CC 2D7QA 3BZEB 1ZGLP 2OXGA 3IFLL 3BPOC 3LKNB 3Q6FB 3L3JB 2BRRH 5D8JL 2GJZA 3REWB 5CIPH 5FYLD 5F3HB 1JHTA 3U7YH 4M8QA 2R2BA 1FV1B 3B9DA 3F7PC 1BOGA 2Y7QB 5B3JF 2CGRH 1F4XL 1QNZL 1TZHA 4HPOH 4U0RC 3ZYIA 5H2BA 1BAFL 1OAUL 4NZRH 2B2XH 1LDSA 1TTGA 2A2QT 1KENL 3MRPA 2XPGB 5CJXC 1WK0A 1XH3A 5EO1A 1K4CA 4OT1H 2MPAH 1ZHLB 1F6FB 5GGVY 3QO0B 3DXAB 3R06A 1U58A 4NWTH 2ITDA 4KJWC 5DHVB 5BMFH 3DVGA 1T66C 4XI5D 2XKNB 3O11B 2EKSA 1FFNB 3ZDYE 1R0AL 2XZQL 3QEQB 5CJXA 1OLLA 4NCDA 1MI5B 4KQ3L 1GZQA 1JNHB 2MTPA 1K8IA 4UNUA 1BZQK 2FATL 3RVWC 2V17L 5EZJA 3KPSB 2CIIA 2PNDA 3INUL 5MEPB 1A2YA 4RWYL 3O45B 4KK8C 3PNWA 2F53E 2XKSA 3QXDA 1B4JH 5DC0A 3J7HA 1JUFB 4XNYL 4GQPH 4R26H 4UIKH 1DQLL 1QP1A 3UPRA 3ZHKA 4UV4H 1U2HA 2VSDA 5HHQA 2XXCB 2WBWB 2A73B 4Z78A 3MV7D 2FX7L 3UC0H 2XIDA 2FIKB 5HVGB 3GBLA 2V5TA 4LHUA 3PF2A 5TE4L 2NTFB 3QXVA 4OZHB 4ORGA 3RJQB 2BFVL 4XTRC 4UU9B 5DURB 3WS3B 5K9KB 2R2HB 2BY2A 3M8OL 2DAVA 2DMKA 5DJZB 3U1SL 4I0CC 3HG1A 5D2LA 3BOVA 1RV6X 2R2EA 3MLXH 3O3AB 5F7YC 5CLTA 1FN4B 2FBJH 4ZDHA 2A9ML 5DFVD 4WTWA 2NY0B 3BKYL 3P9WB 1VFAA 4HS3A 4FQ1H 1MF2H 2FJGA 1KPUB 2APFA 5D71L 3WHE1 2OR8A 4NQCD 1GGBH 4NZUL 4LEXL 3FB7A 4TSAH 1N8ZB 3HTLX 1NLBH 4MVBC 4FZ8H 1JRHH 4F7EB 3KYNB 4GMTL 3RHWF 3IDMA 4HMDA 2W60B 2DQGL 2I5YL 2NY5H 3N85L 5ESAA 2RCSL 4OLYL 3DIFA 3B9KB 2ORBH 3WNOA 2G2RA 2PKDA 2Y06H 1DSFL 4I3RL 2FR4A 1HWGB 4NQEA 4PJXB 4NN6C 3G5YB 1LP9B 3GNMH 4P5KA 5C0AA 3RZWA 4G8EA 4KKNA 4DKFH 4X99A 5GGSA 1IAIM 2X4RB 1N0XL 4LLUA 1WWBX 2G60L 1JHKL 4M8VA 3GZKA 4UOW0 3FHQA 3P40A 3FFCE 2XWBA 3I02B 3FT2B 1D5BB 4MXWL 1QBBA 4LNRB 2QL1A 2YXMA 4UMGA 1SEQH 4Y5YC 5C08A 1DR9A 3ALPA 1SJXA 4K9EL 2V7NB 2M26A 3C60A 4FQXB 4Y0GA 4R90H 3VFMA 1P5VA 4LLYA 3TA3C 5C9KA 2CUIA 1FORH 1A7OL 1FFOB 1G7PA 3DUUA 1VERA 2E6QA 1O5DT 3EAKA 1GJIA 4PJAE 4XCFH 3R0NA 4PIRF 4RMSA 5C07B 5DJ8A 1AD0B 3TA3A 4H1LH 1UEMA 3O2VL 1FZJA 3EYFB 1F3DJ 4HMEA 5DJ6A 5IB3A 1NUNB 4YDKL 2BVQB 1DE4B 4MAUL 4WU5B 3AS1A 4KUZL 1EAJA 4YX2L 2J5LB 4LSUH 2H8PB 1JTPA 2DQUL 5CINL 5F8RC 2EDEA 3IJYB 3P4MB 2OJEB 4V1DE 5D5MA 5B38G 3F12B 4JN2B 4ODVL 2B4CC 3L3HA 1FIGL 5CJOH 4Z6AT 2AVGA 2NTSP 4Z7VB 5JOEA 1DBML 1IBGL 4M3KB 1IEAB 4JPIA 1S7VA 2X9WA 1FNSH 3MRHB 4MNHB 3V5DB 1QA9A 3PABB 1O7SA 2YPLA 5FYKE 5ABDE 2AAVA 1YECH 5IK3B 1UWEL 4AK1A 1SJVA 2BRQA 3BKJH 2I9TB 2EXWD 4YDLC 4PRHD 4DZBB 1X5AA 2VISB 3FMGH 2Q86B 4NBZB 2ARWA 3GI9L 4YE4L 1I8IA 1UM6L 3BP7A 1WFUA 5I74B 1UH4A 5MENE 1NGXB 1UZ6F 5DI8A 1S7RB 1LO0H 4XB8A 2VDPL 3PQYE 1S9KC 2HN7B 1YNTA 3X17A 5J11B 1A21A 2UY6A 3MJ9H 4ONGH 2GQHA 3CLEH 1JPFA 2AXFB 4HT1H 4P2OD 2NY2C 5GIRA 3O6ML 4NUGL 5CHNA 2OK0L 2F19H 2NW3A 2AJVH 4F7PB 5FEBA 2A38A 1DQTA 1ZHNB 4LIQH 3QA3B 5ID1A 3W0WE 3T0EC 4Y5XB 4U3CA 2YR3A 4PGBB 5JXEA 4G3YL 4PP2A 4LNVA 5DJXA 5I8KH 4Z8FH 3ZKMC 2Z8SA 1EO5A 3QT2A 5HTSA 3IDNA 3AS0A 3PE9A 4U1KB 1QLEL 1FNEA 1QFPA 4WI3A 3T0EA 4WWKB 3D3VA 4MZ3A 5JDSA 5IUSA 1F00I 5F7FA 3S3SA 5KVMC 5E2VL 3STZA 2BMKA 2J4WH 1RUAL 5EUOF 4M1CD 3G08A 3MRBB 1NLDL 4PJ7B 3LKSB 4OLXH 1YPZE 5A2IH 1TZIB 3GRWH 4WO4D 2DTSA 3O8XC 4U1JB 1QO3B 5HJ3B 5I8OH 5C0RH 2NY3B 4JHZA 6FABH 3GMQB 4M6OL 2IANA 4HEME 1H3VA 4U2ZA 1N5AB 1U0QA 1MCPL 4X4ME 3DECA 3RZCB 1QTYT 4HCRA 4WNQB 4FQ2H 4HFWA 3BP5A 4IHOB 1MWAL 5CUSL 3O8XA 5DEGB 1UQSA 3B8YA 2Y9RT 1HH6A 4P2RE 1AXIB 3MV11 2YD2A 2HAZA 5EIVA 5IJVB 1EHXA 2EZ0D 4KI5F 2J3SA 5E5MB 3FN3A 2Y36L 5SX4H 3MV01 3QDJE 1OVZA 4DEPC 3U0PA 4GRMA 3SCMB 1Z9MA 1FIEA 4G43A 5C0NC 1DLHA 1IFHH 3S5LB 5FYJL 3FONA 3RY6C 1IQWL 4ZFZA 5I6XC 1XF4A 1U8PB 1QSVA 4ZOEA 4HXBH 4NQXB 4L4JA 5MEND 3V4VL 4ZUTA 2CJUL 4RFEB 3BYYA 2UUDK 3C5SA 2LTQC 3RY6A 4L3CB 4LFHG 1PQZB 2F5AH 1K6QL 4LMQE 4KDTC 3UPAA 3T04D 1HQRB 4XP5L 3K80A 3PGFH 4K55A 1OARL 4AMKH 1IGFH 1W72B 2VLRE 2IADB 1TENA 4X6CE 4Y4KD 3TWCL 5DS8A 1FFQA 2ADFL 1JGEB 3TFKD 3GSWB 3BH8A 3T2QA 3DROB 4B41A 1LHZA 1F6AB 2DS4A 1R3KB 3T3PF 5F9JB 1U8QB 1VGEL 2ZJSL 1OAKL 4EVNB 4DWHA 1EO7A 2ZCHL 1VFOA 4JRWA 2P7TB 4Y19E 4WWID 4YAQA 5ESVB 2L0DA 3Q5YA 4QTHB 1E27A 1C5DA 3AGVA 1KF9B 1IRAY 2VKWA 1YDPB 3O4LA 4M48L 3SJVE 5IGXL 1BBJA 2Z35B 4PG2C 4LHJB 2X70B 1T1WA 2NLJA 4CW1B 5JZ7C 1A1NA 3KXFE 5DD5H 2EEAA 5D7IF 1NL0H 3D0VB 1KXTB 4D0BA 4XAWH 4JM2C 4KROD 1HK6A 2DTMH 1TVHB 2NY6B 3VMOA 4XCYB 4IOFC 4R4ND 2YEZB 5DD0L 4PG2A 3CX2A 1R3LB 5H35B 3O2WL 1NBQA 1RK0A 3T65B 5T3XE 4JM2A 4P2RD 2EE2A 5JNYB 4I5BA 3G6JF 4GAJH 1CD1A 5FA3A 1FL5B 5E2UH 3S88L 5FB8B 2HVJB 2JLLA 2B1AL 1N59A 3FN0H 1H0DA 4LKCB 4QHMB 3KLHC 1UG9A 1L9MA 1X5LA 3LV3B 2PYEA 3O6FC 4O51B 1WIPA 1NMAH 4O9HH 1B6DA 4K7FB 4M00A 3SDDB 5EO0A 3SDAC 2ZUQB 5C0BD 5CEXB 4ODWB 1KCRH 2Z4QB 3B5GA 1KNOA 4WEUD 3MUJA 4WEBL 1CZ8H 4LSSH 4P23A 3VFOA 3IDXH 3O6FA 4JB9L 5IFJB 1NBZB 2DQEL 1CFQB 2HTLC 5IB2A 4D2NA 3NCJH 3BP6B 3SDAA 2QQKH 4PR5A 4ZUSB 2YMXH 5DJDA 5DJCB 5F72S 2DMBA 5IVXA 1H3XA 4LSDA 4RAHA 5F9WC 5TDNA 5TGBA 3QPXH 3ARZA 4PJFE 1NEZA 1SJEA 1G6RA 4NQVA 3HC4L 4XGZA 3EYSL 3AU1A 5BV7L 2CR6A 3GMNA 4Z7WF 5A3IC 1DL7L 2IALB 2P8LA 3WFBL 1U8HB 4EJ1C 4OI8A 2QADC 1IKFL 1ORQA 1INDH 4GBXD 3AMKA 5C2BH 3H3PL 5DYOB 1MHEB 4U4BA 5KTEL 4KQ4L 3NPSB 5EN2B 2X7LA 3OHXB 1CLZH 1EFXB 4Y19D 2UWEA 4P5TD 1Z9OA 3ZE2E 1IJ9A 3CLFL 2NY7H 1VADA 4N8VB 2FX9H 2VXSL 2FHCA 4WI4A 3QWRD 3GI8L 2A6JA 3EDEA 3PP4H 3KXFD 2BX5A 1FGVH 4U6VL 2YS4A 3T4AB 1BD2D 4OSUH 3H9YA 4TVSa 3LEVH 3SGKC 2H41A 1JPSH 4NNXB 1J88A 3CZFA 2R56H 4HHAB 1UEYA 2A83A 1E6OL 3K0WA 1LO2L 1Q94B 3K4ZA 4YDIL 3QSKB 5EBLB 4K23L 5T3XD 3HRPA 4GAYA 4OTXH 1WZMA 4X9FA 3ZTJH 3V0WH 4ZAKD 4CMMB 4G8GB 3HS0B 3MUGA 3SGKA 3PG2A 3QFJD 4HBCH 5I19H 2DJ4A 3W81A 5DWUH 1B0RA 3VGAB 4F8QA 5ICYB 3IDYB 4TULL 5C6TH 4FQHB 1NGPH 3T3MF 3O41A 5EZLB 4WHTB 5F70A 4LSTH 1X5YA 3RWCA 3DV6B 4AEHL 5C8JB 5KSBF 1J1OL 4JRXA 3IDIB 1X5XA 4YQXH 3NACL 5C3LD 3QCUH 2EEBA 5GJSL 4G8IB 5DLMH 3TNNA 5HGHB 4U7MA 4XBGA 4JO3L 3VFGL 2YD3A 4M7ZB 4R8WH 1EO8H 1MFNA 5CBAB 2W0PA 5ERWB 3QDMA 3EOBB 5JO5A 5DMKA 2SEBB 2OI9C 2R1WA 3EO1A 3P30H 3RWDA 2AKRB 2YD5A 1MHCA 1KPVB 5SWZE 1S8DA 2A74A 2R39A 3W5MA 2YN3A 3EYVB 3F7VA 2A6IB 2HJLB 3DXAD 4MA3B 3IXAB 1QRNE 1ZEAH 4FFWD 1T5XA 1I8KB 1DQMH 4EI6A 1D3CA 1UCTA 4S1QH 4BSVB 1MI5D 4M6AA 1D9KB 2RR3A 1PZ5A 4F58H 1J1XH 3FQTA 4X9HA 1LDPH 1AIFA 3QJHA 4I77H 5BXFA 1KJMB 4OB5H 3DO7A 1OGAB 1YYLL 2BVPA 4OGYH 4P46D 4LASL 1PX3A 5J4MA 3HA0A 1S9XB 4KK5D 4U1NA 5IFAL 4G8FB 4H26A 1I4FA 1JE6A 5A16A 5T3ZE 4N68A 4M7JL 1KULA 4YHYB 4LDEB 1P4LA 3HE7D 5CJQL 5HYIA 1CFSB 4P4RB 4MCZB 4Y16B 3WIHL 5DRXB 1G7IB 3HR6A 1I1AB 2Q1EA 4NPYB 3QIBA 7FABL 4JO2H 3DSNA 1WITA 5CEZH 1SJHA 5GISL 1G9MC 1U8OB 2NX5A 2R9HC 1XGUB 2IBZY 1NAMB 2FJHA 1YJDC 2DQHL 4BK5A 4YFDB 1CDIA 3L7FA 4IDJH 3QHFL 1PFCA 4KJPC 4G6ML 4L5FH 4Q0XH 4MJ5B 1DN0A 3GSOA 2X42A 5T1MA 1I1CA 3S96A 3ARGD 3O3DA 2VH5H 5EOQL 3B9KD 2UVFA 2FD6L 4X7SL 4MA8L 3IETB 4Y4HD 1NCUA 1W0VB 3MRMB 1A6TA 3C9NA 1G7JA 3KYAA 3RGHA 5SWZD 4HKXA 3JWOL 3DX8A 2AW2A 4U3HA 3ARBC 2D0GA 2KZ1B 3BT2H 5E03A 1MCRA 1OOAA 1G9NH 2P8MA 1TJHH 3SO3C 1DLFH 4HUKB 3TBWA 4F7CA 2E5EA 5ILTH 3SKNB 3TBTB 4OZIA 2J8UF 1BFOA 2X4QB 1BVLA 1C16A 1SYVB 4LCIL 4XVTL 3PWPB 3RWFB 1XZ0A 3OKEA 3MRRA 4YHZL 3BE1L 3MRIB 1N4XH 1FPTH 4P2QD 3GMMB 1B88A 1QBLH 5FKAA 4L9DA 5HYEA 3DX7A 1CICC 3MRGB 1YEGH 4QRTA 5HDLA 1Z5LB 1GGYA 1ZANH 5BCAA 3QDGB 4ZXBC 5JW5B 2BSTB 1MFBH 4JRYE 2PW1B 2FB4H 3O9WD 3BVNA 5T3ZD 3AROA 2Z31C 2ADGB 1CICA 1UZ8B 5EWIH 1G0XA 2IC2A 3F65A 3VFVB 3QEGL 2D03H 1S7SB 1J8HA 4ZXBA 1VDGA 1Q9LB 4X7CC 1NAKL 1D5ZA 4MQ7B 1NDGB 2CKNA 1AC6A 4KMQA 4EKXA 1A7PL 4CGTA 2Z31A 3VI4E 3MRNB 3RY5A 1Q9WB 3GBML 3N1QC 1TCRA 4WW2C 2XT1B 4R4BB 2EH8L 5MHSE 3KPOB 1UM4L 3A6BL 4XWOC 2DYPB 3I75B 4ZUVA 1E4XL 3H9HA 4PJBE 1DBJL 2GSIB 3AXLB 4XMPL 5AUMA 4PJ5D 2W38A 4BJLA 1ROWA 3R1GH 3OZ9L 1WBXB 5DJAB 3PWJB 3M45A 4R96A 2MCPH 1CVRA 4LLDA 1LO5B 5B38A 1NMBH 1HNFA 3BWAA 2E9BA 2XTJE 4P3DB 4E41E 1Z9LA 4QEGA 4HDIB 1VPOH 5D7LD 1YA5A 4G9DA 2ENYA 5C0FA 4MDJB 5IMKA 3QWOB 3JV6B 2X4PA 3TPUA 5KSUA 3D39A 5H37G 4OZFB 4JDVB 3TZVB 3JTSB 1D5XA 4NZTH 2F74B 3WFDH 1HSAB 3BHBB 5F1IB 4KV5E 3U30B 4KTEH 4EOWL 3V6FA 2QQNL 2DWEB 4LL9A 1UACL 4YLQT 5EUOB 1RUQH 2XQYG 3QO1A 1N2RB 2I24N 2NXYC 4OIBA 3VGHA 3X11B 4HBQA 4PRIE 1SEBA 1QQDB 5T1DH 4K3DH 3B6SA 1A5FH 4AL8H 3EO0B 1NFIA 1FGNL 3PGCA 1PLGL 1ND0B 3I6KA 1MCBA 4NRZB 1NGQH 2CSPA 4F15B 2PTTA 4FQLL 3UYRH 2X4UA 1C5BL 5D7KD 3QBTB 1KTLB 1ZHKB 3P77B 4DK6A 4NC1C 3SKOA 1NGZA 1N64L 3WS6A 3MLSL 4RZCA 3MV9A 1FYTE 3VW3L 1DBKL 1RZKH 5DRWB 1KJ3L 1L7IH 3QUXB 1UB6B 3HRZB 1WEJH 5D2LF 3RNKA 3KGRA 4CVZB 2OQJA 1AE6L 1ZVHA 4NDMA 2PETA 4RIRB 4GRLB 4G7YL 5JOFB 2P5EB 1CR9L 3KJ6H 3ARDB 3IXTA 4KDWA 4O2EB 1CYGA 2IJ0C 4XVUC 4PPTA 4G9FB 4K71B 4PJDE 5I8EA 5DEFB 5AAWA 35C8H 1T1ZA 4GS7B 3U4AA 2I27N 4U3XA 5KAQF 4UQ3A 1FL3A 1CD8A 1I1FA 1AHWB 3UTZB 2Z92B 1MFAH 3AREB 3NMEA 3VG0L 1RD6A 4E41D 3RKDD 1GGCL 3U9UB 4L4VB 1DFBH 5BOPA 3BD5A 1FZKA 5GRJH 4NUJB 1ZLSH 4R3SA 3SE9H 1MCLA 5A40E 4JFDE 1WLHA 5IW3A 3TBVA 5GGVH 4HSQA 4MJ6B 2QQQA 4KUCF 4ODXA 1FG9C 5EBMB 5TDOA 2D31B 2JCCE 3VXRA 3QNYA 3MV7A 3KAAA 4OQTH 2OZ4H 3S97C 2D9CA 1H8OA 2EH7H 2ENSA 1K3ZA 3MFFB 3E6FB 4PUBH 3UJJH 3PJSA 2MWCA 3UPCA 4HFUH 4LEOB 1HZHL 5D7IB 5J1TC 1JP5A 2AERT 3C5ZB 3MACH 2P49B 3MCKB 4EUPH 2DLHA 2WBJB 5I9QB 1S7WA 3MXWL 4ELME 2LQRA 5T1KA 4I4WB 1RHFA 2FZ3A 5DRZA 2A77L 3JWDC 3U83A 3ULUL 5I1AB 3G6JB 1A3QA 3VFSA 1P7QD 2XWTA 4QF1A 4NQCA 3OJDA 1AJ7L 3WIFA 3B8SA 3VCLA 5CIPB 3I85A 3STLB 2NY6D 3H0TB 4H0IA 1RZGA 1QSEB 3MBED 1PYWB 3QUYC 4ZNCD 1ZT7A 3ARXA 5BS0B 1RZ7H 3MREA 4PJEE 1JYNA 2HFTA 2WWMD 4ZFFB 3CVIH 3HI5H 5B21A 5D5MF 1IGCL 4XNMA 2EICA 2EYSB 5TPWL 3HZVA 1GPOH 1I75A 3ESVF 5E99H 3QUYA 1FG2A 2P1YA 1M4KA 2Q76B 3DRQB 1A6VL 1D6EA 1J5OH 4AEIH 1GAFL 2WZPD 3BGMB 5E4EC 1J05A 3EYOA 3NZ8A 2CUMA 1MIML 5HD8D 4JREB 3FQWB 5IEHA 4J8RB 1ETZA 5JPNB 1A7QH 2D4DA 2WANA 4NP4L 3WUWB 4Z7WB 1T0MB 5CGYD 4YHKH 3KPMB 4GG8A 5KSAC 3H8NA 1J11A 1S9WB 2V5MA 1DEEB 2F53A 2GITA 5MI0B 3KNBB 3BD3A 2WINA 1T83A 3DUSB 1NJ9A 4U7SA 1BX2B 3U48A 2IGFH 2FX8L 5L2JA 2P42B 2YD4A 1XEDA 2OL3A 3IFLH 3KPNA 5KSAA 4HXAL 5TH2A 3Q3GB 1GGUA 5IWLC 5D8JH 5I8CA 4IMKC 1PGRB 4V2BA 3MODL 1C08B 3QCVL 4N9GB 1JYWA 1MAJA 2NW2A 5F8QC 1OWWA 1QNZH 3MRJA 4PGDB 1BAFH 1ES0A 1EFXD 4X5LA 5IWLA 3FT4A 4PJ8B 1OAUH 2IAMD 5C0CB 2BVYA 5E1AB 4IMKA 5CMAB 5JQ6L 1KENH 3QUMA 2JK5B 1F4AA 3RL1A 2DIJA 4JFOB 1IQDB 2ADIB 1CDGA 3ZYZA 5C09E 1F90L 3W9EB 1CG9A 2VR5A 3D87B 1R0AH 2VZVA 2XWJA 5DJYB 5I73C 4KQ3H 4PJGE 3MSPA 2IWGA 4PLKC 3P9MB 2FATH 1EBPA 4F7MA 3HPJA 5J0BA 4FTVE 2V17H 3CDCA 3F7YA 4RWYH 5HGDA 4UBDD 4MB4A 3V8OA 5KSBB 2C7UB 4M1GL 4RNRA 5IHUL 2BHZA 3VRIB 1ED3B 4NO2B 4NT6B 1W0WB 4C56D 3KPRB 4G8GD 3GGWA 1W72L 1NQBA 3N50A 1QLRA 4Z5RA 5D1XB 5D1QC 4J4PD 4NJAL 5E4IA 3VGGA 3CSYB 43CAA 1Z3GH 5DQ9A 4LLVA 5HI3D 5K9JH 3I6GB 5E8EA 2EXYD 3PWVA 4OD3H 4Z7NE 2W9EH 5TE4H 5IB4B 4B5EA 4XP9H 5JIKA 3FFCA 1M05B 5AYQA 3MYJA 5D1QA 2XQBL 3U1SH 1MCWW 5I71C 3MO1A 5GHWH 1VFBB 3CFBB 1S5IL 5FYJE 2A9MH 2I26N 4NOFA 5D2NB 4GRWE 3LD8B 4M1CC 3U4EA 4PRBA 3BKYH 1HHHA 4QRSA 3UTPE 3B2UD 3TVMB 3T2OA 4F8TA 4WO4C 2B5IC 3TBSB 4WI8A 2EKJA 4OD1H 5D71H 1T20A 4NWUH 2W9DH 4PJAA 5JW4Q 3EJZC 4LEXH 2I60H 4TUJA 2MKWA 1J86A 4GMTH 5DMGC 2DQGH 3N85H 4WO4A 1JPTL 2DM7A 4YHNB 4KJYA 1UJ3C 3BPCB 4OLYH 1CT8A 5L8JB 5C0IA 3IB4A 3LDBB 5E6ZA 1IC7L 3QHZH 4QCIB 5GRUL 4M7LT 4K3JL 5CZVL 4KKAC 1MUJA 1UJ3A 5HHPB 4C4KO 4BZ2L 4V1DA 4NQDB 3UTQB 1N0XH 5IB5A 3RWHB 2J12B 4Z76A 4PB9H 5B22A 4APQB 5C09D 3HMXA 3OXSB 5HPMA 3W5NA 2XRAL 1QPXA 3CXDL 4MXWH 1LEIA 2BERA 4QHKJ 3RX5A 4Y16D 3V8CA 5FGBC 4JKWA 1AKJB 1A7OH 5MENA 4DKEL 4JM2F 4JKMA 4YHPB 4HGWA 3NGBB 1HIML 4NRXA 3PQYA 3W39A 4MJ4A 5ETUA 4NC2B 1LMKA 3MV8B 2HFGL 5FGBA 4WHDA 5FYLH 4A6YB 1PEZA 1HHIA 2P46B 4UOW1 3UTTB 3HI6L 3O2VH 5LGJA 3C2SA 5CBEA 5FDWA 1U95B 3ULSB 3WLBA 5F6IB 3FRPG 4PJHE 3DRTB 3MRCA 3P3YA 2DM2A 3WD5L 3MLRH 1I1YA 5FUCE 4AM0A 3FRUB 5L7XL 4MAUH 4BFEA 3W0WA 1AGBA 4KUZH 2DI7A 4L4TB 1MH5B 3JV5A 3VFTB 1RK1B 5HYSB 3LRGA 1CD0A 2J8UB 4YDVB 1CLOH 3SEPA 3CFEA 1H3PL 5I16A 4JVWA 1FIGH 1KG0A 4ONHA 1S9YA 1ZS8A 1DBMH 1J87A 3QI9D 1IBGH 3FAXA 3VFNB 3UZQA 3VA6A 4KROC 5IVXF 4Y4FB 1KCSL 2HRLA 1HDMA 2E9WA 2ZOLA 4ZD3L 4M9OA 4PTUB 4N0FA 1NGYA 3T1FA 4OF5A 2AEWA 1EHNA 3IF1A 4HQQL 1YPZA 3F8UB 2QSCH 1CLYH 3QG6A 3F5WB 4PJ9D 3BSZL 1CGTA 3QIUB 4PS4L 5EA0L 5FA4A 2E27H 2Q3ZA 1I7TA 3WNMA 3WUZA 3L5JA 4XZUA 3PWPD 4FQQA 3WEXA 4X4MA 1IM9A