4FQJL

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSASGTPGQRVTISCSGSSSNIGTNYVYWYQQFPGTAPKLLIYRSYQRPSGVPDRFSGSKSGSSASLAISGLQSEDEADYYCATWDDSLDGWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 38
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjL01
4OAWB 4NHCH 4GRLA 2UZIL 1V7NH 3DNKA 3W9EB 3DUSB 4WTWA 1U3HC 5D70H 1P7QD 1F4WH 3MLZL 4H0GA 4CMHB 5ETUA 4Y5YA 1TZIA 3KS0J 4RISH 3FB8B 3MFFA 3OWEA 5IJKA 3FMGL 4OZFA 1I7TA 5EU5A 5CP7B 2GCYB 5DK0A 2FZ3B 2YPVH 1SYVA 3CFKB 3G9AB 3UXFA 4LPYA 1SHMA 1RZ7H 3QI9B 3I84A 1NAKL 4DCQA 3LKPA 4PRIE 4RX4D 5EOCH 3WNMA 2UV3A 3DGCR 2PXYD 4RAVB 5IHLB 4WTZA 4H26B 3BP7B 4U7KA 3X11A 3UJIL 3SJVE 3V6OA 2XKSA 5I8KH 5F6IB 5BS0E 2UWEA 1NEZB 3PJSB 1XGUB 2FGWL 2J6EL 1HKLL 3CNKA 2HVJA 1YPZB 2VZSA 5IFAH 1NJ9B 2R4RL 3DBXA 1UQSA 4P0DA 1R0AL 3L7EA 1GJIA 2Y07H 2J7LA 5L88H 1N6UA 3C8KB 4Q9RH 3BZFB 4I77H 4U3XA 5AUMB 2BRQA 3MX0A 4YDIH 3S37X 5A2KH 2H6PB 3ARQA 1U8NB 3E6HB 3EYSL 2D2OA 3U4AA 2IBZX 1QPXA 2LU4A 4RNRA 2OTPA 1MNUL 1G9NL 3ROOB 5I1LB 5ILTL 3ARSA 5AD0A 5DD6A 5GS0D 1IC5L 5FECB 4G6ML 5F9JB 1EHAA 3K4DA 3T4YA 1FFOA 5D6CA 3GSOA 4DW2H 4YEFA 3FT3A 4YE4H 4TQEL 3CDFA 4LIQL 5TJWK 5DFTA 5D2LA 2DLFH 4PRDB 4Q9CA 5GRVL 5IVOA 1GHFL 4KH2A 1T89A 4NBYB 1HNFA 1DQMH 2BNQB 3EDFA 1KG0B 3MRDA 5MERA 3GO1H 3BIBX 3EOBA 5F7DA 3TVMA 1SMOA 3QUZB 2VXTH 4M62L 4M02A 1MHPH 1QSZA 5GS2H 3WJJC 1U3HD 4I5BB 3RUGA 1WQVT 2YBRA 5FYLH 4TULH 4OV6F 4N8CH 3NABL 3UPRA 4W68A 1G6RB 2IFFH 4HW6A 3HUJE 4MNQE 1ZHKB 1EAPB 5J0BA 1QSED 3H7BB 4PLKC 1NUDA 3FQWA 5FYKU 4POUB 1IAIL 3K1KC 4P46D 3TCXA 4M8QA 3VFRB 1IMHC 1ED3A 3MRRB 2W07A 4HPOL 1JNJA 5DHYB 3HR5B 4M6NH 3T8XA 2YUVA 4HUNB 1U3HA 1NFIA 1K4CA 4M1DH 4Y1AE 5C0DB 1OWRM 2VLJB 4CMMA 4AIOA 4IIQB 3PV7A 2X10A 3O41A 4KJQD 3D39E 4FFVC 1TZHA 3E8UL 4OZFB 5KVGL 4KHXH 3MLRL 4ZFFA 4OGXH 1L0XA 1T0NB 4GOSA 5EFIB 4S1QH 3U36A 2B1AH 4JFOA 1IGYB 2JB5H 2WBJA 4O4YL 3VRLF 1MF2H 4WHTA 5J1AA 4OF6A 4OZGB 4J6RH 3WDJA 1UH3A 4YDLB 5EBLB 4NN7B 2D31A 4X4XB 5J6GB 2LV4A 1ES0B 2BNRD 3VG9B 5IHBA 5E6ID 4LPCA 1AJ7L 4ZYKA 1BOGB 5D71H 4LLVA 5I0ZA 1WBZA 2Y6SC 5I75C 2HKFH 4RX4A 2XN9A 1R5WA 2BXYA 3DBXB 3VXUD 2OTUB 5C0BB 4IBLT 1AC6A 1AO7D 2AEWA 5DVMA 3RVWD 1SEBB 3D69B 1RSFA 5T5FH 1ZLWH 4BSWA 4OUUA 5CEXA 2VN4A 5ERWA 5C0CD 1U41A 4J3OC 1EZVX 1YEIL 1T03L 1ZEAH 3AGVA 4Y16D 3C9NA 4OD3H 2V2XA 1FL3A 1FPTH 2I9LB 2ZOLA 1IAIH 4PBWD 3RFZC 1NBZB 5DK0B 3WIHA 3RX8A 2XWTB 2EC9T 3MJ9H 5F9JA 4NN6C 1VADB 3S88H 3FT4B 5IQ9A 3ZDZE 4LF3B 4Q9QL 3ZKNC 3VG9C 3MXWL 1U42A 3Q5OA 3O2DH 2MQ3A 4JKMA 1NGQH 3GGWB 3K7UA 1NGYA 4PJ9B 1JGEB 1C12B 4CNIB 2P24A 3W0WB 4UNVA 4QOKB 1EBAA 3TT3L 4MLIA 4HDIB 1CVSC 5IWLC 3LMJL 3QHFH 2PW1B 5J57B 1U3YA 3SBWA 1IFHL 1DEDA 1KIPA 3AREA 5IM7A 4OUOA 3KLSA 3C60D 4Q6YA 3GBNH 3MOAH 3BDYH 4R4NC 2J8UE 3EJZC 1F2XK 3T0AA 2YSSB 3MBEC 2HMIC 2JCCF 4HZAA 4XXDB 5FFLA 4EDXB 1CLYH 4RRPA 1L0QA 1IGFH 2ZJSL 4J12A 4PREA 4YDKL 1FNGA 2AKRA 3BDYL 1CFQA 2I60H 4EN3D 4PRIB 3L5JA 3UPAA 3P73B 43C9B 3U83A 1D5ZA 5DMJB 2UVFA 5FIEA 1U3HB 3LZFL 4QXGH 3QUMA 4CVXA 1FP5A 2DAVA 2X4RB 2EH8H 2JB6A 3U0PA 4N0UB 4W70A 2APFA 4JO4L 3D2UB 2AERT 3HI1B 5E5UB 4NN5B 4LSRL 4FXLA 4NCDA 3MRMB 2GQHA 3VE0B 1MCEA 3TVMB 4ENEC 3BE1L 4XMKL 1YUHA 2F53E 3PWJA 4KKCD 4LSQL 1LE9B 1OGTB 2VABB 4YGAB 2CKBH 4KPHL 1AGEA 4OZGA 3IJSA 3QDJB 4KV5F 4PJAB 1WITA 2AK1H 3MXVL 3CVHL 5GZOD 2F54B 1MJ7H 1B4RA 3L7FB 4IOFC 5DJDA 1MFAL 3CGTA 1GOHA 3TIEA 3L5IA 3BZEA 5DJ8B 4MDJA 3AB0B 2ZZUT 2YS4A 4JY4B 4JHAL 2AJVL 1MHHB 1A1MA 3MYJB 3KPTA 4P5TB 3ARDC 2OX5A 2M8XA 1HINL 4PGDB 2UZIH 5EUOF 4BFBD 2B5IC 5E00B 3H2WA 1F6AB 3KWWB 4E5XB 4WI9A 1ZMYA 5H94A 3KLHC 5MEPB 1ZGLP 5F93C 4IOSD 4IIQA 1EO8H 2CJUH 1PLGL 3L5WA 2Q8AH 1E28B 3FRPA 1KCSL 5CJXC 4ONGH 1QUNA 4GXUN 3MGOA 1DJSA 2E7CA 4H1LH 1LEIA 3D85D 1RZGA 1I8MA 2ESVD 2ESVA 4PP2A 4CADB 5JOPD 3U1SH 1N6QL 1X5XA 2ATPB 2W38A 3QAZC 3WV0A 5F1IB 1KGCE 3V0WH 5TDNA 1IAII 3S36X 2HRPL 5C92A 4NHCL 1CK0H 4YK4C 3UC0L 4HG4K 2W9EH 3DVNB 1U93A 1L7TH 4MJ4A 5IB1B 4KZEL 3P9LB 3P4LA 3SBWC 1DN0B 1MWAA 4AYFA 3S35X 5F3BB 1M7DA 1BD2D 4EQ3A 1S9WB 3O3BB 1JHKH 5JUEL 3S6CA 1UM4L 2GYSA 4LCWB 3BQUC 4P2RE 2EIZB 3OL2A 4ZUTA 5J4MA 3QISA 4YXKL 4V1DE 4YXHH 3GJEA 1K8DA 1KIUA 4KKCC 1WEJL 4EI5C 3S4SA 4K3JL 3T1FA 4R8WL 4BFIA 2YXFA 4KK6C 1OGAB 3N85L 4RCAA 1EFXA 1VHPA 4FA8A 3E6FA 1CXFA 5ACZB 4TVPD 3V6BR 3PWPD 5E8OA 4LF3A 2O93L 4WWKC 2YKLH 1FFPB 2JCCA 2J8UF 2DQFB 4O5LL 3ZDXF 5E7FA 5HYJA 5SX5K 2IBBA 3MLTA 4Z9KB 4Z7OF 2C3VA 3WIFB 4XAKE 4NC1C 5D7IA 2GI7A 3CLFH 3PQYB 4XX1E 4P5KA 4HJGB 3O11B 4BQBA 1EAPA 4J7RA 5HVFB 1IT9L 3PWLB 3B9KD 2CRMA 1CFVH 1RIHH 3D18B 5DD1L 3IDIB 4I2XB 4L3EB 4YFDB 2F74A 2DYPD 4JFHE 3VW3H 2FL5B 5EU3A 5BXFA 4KRPB 4PJAE 2NY5L 5EUOE 1T20B 3O0RH 5DJDB 3ZKMD 2EIEA 4X6DB 3WUWG 3NACH 4Q6IA 4AJ0A 4HS8L 5F6HI 2GSIB 3MRLB 2YN5A 4N8VB 5E8EB 2NXZD 5C07D 3C6LA 5ADPL 2LU7A 5BVJB 4OZIE 3MRFB 2VDOL 4ZS6C 1NBQA 4RWYL 4PB0L 3M1BB 5KN5A 1HYSD 1UJTA 5CZVL 1U91B 1XIWD 1CBVH 2ED7A 5GRWA 2QSCL 2NMSA 2W9EL 1WLHA 5D7IF 3V0WL 1OGAD 1F90H 1IGTA 4C55A 3CSPA 3QXDA 4H5SB 4MD4A 1IGCH 4V1DB 5D1XC 4ODTH 1I9JL 3ESUF 4R90H 5HDLA 1BFTA 4LCUB 2AJZA 2IADA 2DLEA 1IE5A 5D7SH 2HH0H 4HWUA 2NNAA 4JY6B 4PLJD 1B0RB 1RURL 1P84K 4POZC 4YDVB 1P84J 2IANA 3TIEB 1VDGA 4XCEB 3BRGC 1RZIB 4L4TE 3GRWA 2Q3ZA 3CC5A 1SM3H 3BIKA 4Y5XA 2NY3D 1OAYH 3X12B 4GW5B 5SWSB 3RGVC 3QIBB 1R5IA 1OTSC 2IQ9L 4L1HA 4ZTOL 4OCRL 1JZ3A 2MCPL 3NTCL 3T0BA 3V5DB 1CBVL 2UYLB 4HFWA 3S36L 4XTRC 5GHWL 1HKFA 4TUOB 2C26A 4KK9D 3TM6A 4ZFZB 2AI0L 5IVXF 5GRUH 1IZJA 1EGJA 3MRNA 2H3NA 2W92A 4LLUB 2R0KL 2JE8A 3WMSA 1Z0MA 1GOGA 4TNVF 4YPJA 3I9GH 4G8FB 1NMBH 2A77H 4OFYD 3BHBA 1JFQL 2DQFA 5HYJB 4WU5B 3L3OB 1MCBA 3CPLA 1U93B 2FECI 2XTJC 2V17H 5LXGL 1QRND 3HI6H 1UXWA 3OBAA 1A4JA 4P2YA 1HHHB 5E94A 3OB8A 3TPUA 2O61A 4KKNA 5K9OA 1T1XB 1T5XB 4N0CD 3L95B 1KJ2L 1A3QA 3S35H 2NLJA 2KZ1B 1CR9L 1AE6H 1X7QA 2IH1A 3AS1A 3BP4B 3DJ9A 4NZUH 3R06B 5IJVA 2QR0B 2X89D 4KJPD 3BGMB 3DUSA 4DVBB 4YO0A 3PDOB 2D9QB 2YD4A 3LS5H 5B8CA 4JREB 3MRLA 5C07A 1RU9L 1S9XA 2WW8A 4OLXL 4HEME 4WI3A 4W6XB 3O6FB 2D9CA 4P46A 1AGDB 1S9VB 4KI1A 4NRXB 3H42H 4QTHA 1T6VN 2MFNA 3TBYB 4XI5D 3F7RA 1A7BA 4YBHA 2X89A 3AUVA 4JKPL 4KJWD 3GIVA 3RVXD 4EI6B 3EO9H 4Q58C 1XR8A 3GBLA 2A0LD 1T5WA 2X4UA 3PQYA 1H3GA 5KAQF 1ORSB 3NH7H 4P4RA 1DBAH 3ABZA 5BZDB 3VI4F 1K4DB 4ZAKC 2Y06H 3S5LA 2BHYA 4HHAA 3O6KH 3BW9B 1MY5A 1NDMA 1N0XL 1JRHH 4GRWH 3RWHB 2UZXB 1T20A 3UBXG 1IM9B 4J4PD 2BRRL 4O9HH 4LNRA 2E8ZA 3K81A 3FQRA 5T3ZE 2DQCH 3LVEA 1PAMA 3GEWB 3I2CL 3WSQH 1CLCA 3BD3A 4QNPE 3GRWL 3BPNB 4KKBD 3KYOA 3HRZB 4HGWB 5H35B 5F9DC 5JQ6H 1TMCB 1FFOB 5D6CB 4CADA 5FGRA 3MLWL 3KR3L 1UG9A 1S8DA 4PJHA 4P2RA 4N5UA 1FV1B 1I8LC 3DHMA 4HUKB 5HI5C 1U8QA 5I18L 4YFEA 4NKQB 3ULUL 1C5BH 5ICXB 1NMCC 4OM1H 1VFOA 5KSAC 2RIKA 1LDSA 4JRYE 5FUOL 5A3IC 2GITA 1EVTC 2NY4D 3MLSL 2Z31B 1MWAB 1N64H 4YZFE 5F3BA 1ZVSA 2RB8A 4Z7OE 2D03H 4GFTB 1EO5A 3V7AE 1E4JA 2R8SH 1E6OH 3FHAA 2E3VA 4P9HL 4NN7C 4NM8H 2VR4A 1TIUA 4G7YL 3V52H 1AGFB 1VKXA 3R1GL 5HDBF 4OTXL 1FO0L 1K8DB 4C54A 2XZQL 1SEQH 5FGSA 4IRJC 1RZFL 2C1OB 4FS0A 4MQSB 3BEWA 5AD0B 1JPSL 3SGKC 5DD6B 1MFBL 3BOVA 1ZA3B 5FO7A 1RUKH 5BCAA 1QSFA 3DWTA 3QUXD 1RHFA 1OP9A 3PDOA 5B8CB 2ZNWA 3PP4L 1C16A 4WI8A 1XF3B 3AAZA 1PYWA 1CD1A 3ZKMC 1QP1A 3VXTA 2ADIA 3L1OH 1JPGB 4KI5D 5J13B 1I1AB 2D4DA 1WZMA 3UTSA 3O11A 3CDGB 3UBXA 5IQ7H 5F7HA 3ECBA 4N1CA 4U1MA 4OQ1A 1G7LA 3CVIH 4OKDA 3QHZL 1H15B 1IC4H 4DOHE 3MLPA 3FJTA 5CIPB 1A7QL 4OAWA 2R1WB 2BNUA 1GZPB 5D7LB 2QEJA 4Q6IB 2XXCB 2AK4E 3HR6A 1E4XL 4HT1L 2QHRH 3S5LB 4ZO8A 5IEKB 4U1GB 1UEYA 3PNWA 1ROWA 5C0BA 1DVFC 5DHYA 1ONQA 3NCMA 1TQBB 3VXRB 3ILQD 2FZ3A 4PG2C 1WK0A 5KJRH 4C83A 5KG9A 3BRDA 2IPUK 3LRSA 3RZCC 3Q1SH 1N5AB 1KFAL 4EUPH 4XVSH 5DUML 1YQ2A 4IDJH 4P4KB 4FQXB 5C7XL 3TESA 2UY7A 1CDIA 4ZNEA 2X41A 1QFOA 1MH5A 2FB4L 3IDGB 4PJXA 5EIIA 1RIHL 1WBXA 1S9VA 1NMAH 1Z5LA 2R29L 4QRSA 5KS9E 4YUEL 3I6GA 3I85A 2PYFA 2HTLD 5F3HA 5I74B 4ZAKD 3DROA 3V5KB 1JPFB 3HC0B 2VDKH 3MJ8A 1HN1A 5AZEH 1T5WB 2X4UB 3QUXB 4QOKA 4LARL 2XA3A 4L9LA 2G2RA 4M48L 1FL5B 2ZJSH 1UXSA 1FCCA 1N5YL 2PR4H 1DVFB 2H8PA 3SKNA 1KIPB 1I4FA 5ESAA 2VZTA 3ZYJA 4HIJB 5GJTH 4OI9A 4PJEF 3MJ7B 4Y19B 3X12A 5IMOA 2YSSA 4NM8L 5B38G 4KY1H 2AXHA 5LWYL 5CILL 5FV2A 5J3HC 3T2NL 5JIKA 4Z7QE 4XXCC 4EIGB 4MZ2A 1YEFH 5I9QC 2DDQL 1FZMB 1CFQB 2I9LA 5D2LB 3RU8H 4ZUVA 1TETH 1A6PA 3KNBA 4XP9L 3OKYA 2XTLA 3F5WB 5CJ5A 2C3GA 5D7JD 2P5WA 1DEEA 4JAMA 5FGBA 3EOBB 3ESVF 1N8ZB 3QUZA 3FFCB 4FFYL 4NPYB 4IOFD 4MLSA 4TUKL 2GJ6E 2VUYA 1FV1A 3UO1H 5CUSH 4GG6E 5DQ9A 4PGEB 5F1OB 4MJ6B 5I1CL 3UPRB 5EZIH 1NDGB 3KVQA 4LCCB 5K59E 3VWKB 4M7LL 4DQOL 4HZLA 4YPGA 4G9FE 1CQYA 4FQ1L 5J1TC 3WKNA 5TE4H 1YN6B 1A7RL 1IILE 1UEMA 2SEBB 3WBDA 5HY9B 2F54E 1M7XA 4JJ5B 3TLRA 2W60B 2VDKL 4G9DB 1R3IH 3QEQB 2JLLA 1UM6H 3UTSE 4MDJB 3PGFL 5DQDH 3WFBL 2VDLH 2R1YB 5EWIH 4R0LC 5DJZA 1GGIH 5KSAB 4L5FL 1CXEA 1NMAL 1NMCB 4WHDA 43C9A 3HMXA 1JNLL 4C57C 3QUMH 2CLZB 3VH8G 2R2CA 1JF6A 1HHJB 3D39A 4OCXL 4WFGD 3F7VA 3Q3GA 3OHXB 1W72L 4JFOB 1XIWB 5CD3B 2OZ4H 3VFMB 2DQDH 5DVKA 1OTUC 1TJHH 5IVXB 1AXIB 2CO6B 4Y1AA 1TCMA 4K7PX 4QXWA 5CAYB 3V6ZB 4HQQL 3DRQB 4X80L 1CL7L 3RL2B 3RA7H 2EO9A 5KVFL 1NAML 1P5UA 1S7QB 4UV7H 2P5EA 2EYSA 5LAXB 2LU3A 5B3JE 3QXTA 3ECBB 4QXUH 5GSVB 5F7KC 4U6VL 5BZDA 2HWZL 2IC2A 4LCWE 1T89C 2D7QA 4FXKB 5HHNB 1H15A 4KUZL 1UH2A 4LGPB 2HT3C 3PGCB 1NL0H 2J5LC 3NN8B 2ATKA 4JRYA 4S1DC 1G7HB 1G0DA 1UVQA 5EO9B 2WWKO 1TJGH 4ELKA 3WUWB 3CX2A 2R0WH 1HWGB 1TVBA 3MGAA 1X6NA 3QIBD 4N8VG 5T3ZL 3ZZ1A 1YNTA 1AI1H 3RWDB 1XMWA 4I3RH 4PJHE 1NGPL 1JI1A 2BX5A 2W59A 4U6TA 3MROA 4LVEA 2O5ZL 3QULA 3BKYL 2V6HA 4XNZB 3GJEB 1VGEH 4KXZI 4NWTL 1EX0A 4B53A 1MIEL 4HIEB 1RK0A 4XHQA 2VLMD 3ARGA 3C60A 2EH8L 1A7NH 2UVEA 4KTYA 4TQEH 2JK5B 3QQNA 4AIZA 2ZSWB 1Z5LB 1BREA 1DEEB 4FMFA 3GI9L 2DRUA 1M7IB 2COQA 4IDLA 3QBTB 4YHKL 5GRUL 4F9LC 3WFHB 1RAMA 3PXHA 2Z4QA 3GHBH 4DKEH 4PJ5B 2E7LA 1V3MA 4NPYA 4FQIL 5IV2B 1ZVSB 3MV01 3UTPD 2YPLB 1YQVH 1YECL 3V5HB 3BN3B 2XPGA 1ZT1B 5D1QC 3PXJA 1JFQH 4NN6B 1CGUA 2BY2A 3PWNA 1F97A 2NTSP 1FSKB 4U0QB 2DJSA 3GKZA 3H9HA 3P4MA 4U49A 1YMMA 1BZ9B 1MSPA 3VGAB 4ZO7A 4X4YB 3HTLX 1U8LA 5FKAA 3S36H 1DTUA 1BP3B 5L2JB 4MSWA 2E7LC 1QSEA 4FQCL 3C5SA 1XGTB 1IC7L 3C6LC 5HD8C 3FRUA 3HE6D 5DHVB 5FYJE 4OM1L 5IR1A 5HGDB 3GK8L 2I07A 4PJBA 4EDWL 3QNXB 4NKDA 4CGTA 3FN0H 2V5RA 3QYCA 1MCOL 4LVHC 5DDHB 3V4VH 5JNYA 1FZKA 2IPUG 3INUL 3L3DB 2IEPA 1KCRL 3RWIA 4X6EA 1OSZB 4QO1A 4Z7WE 5IOPB 4FP8L 1IEBA 1D5XB 2V7NB 4U6VH 4D9LH 4JPVL 5D5MF 4MD4B 2PW2B 4ONFL 2VDQH 3MR9A 5DS8B 2NR6D 2FYYA 1WWBX 8FABA 3V8OA 2YMXH 4PRHD 5AZ2H 2YHGA 4K7PY 5EA0H 1L7IL 1AI1L 1CF8L 1WZKA 1GSMA 2LABA 4Y89A 1R6VA 5FK9A 5IVXE 5I1AB 3ULSB 5DMIL 5HHNA 1A3RH 3OF6D 5F6HJ 1R5VA 4NWUL 5HXMA 1HSBA 3CXHK 3SKJH 3PGCA 4MXQC 1WFTA 5T33H 3VFVB 2ATKB 3NN8A 3HPLB 3VCLB 2PYEA 3RWJA 4KMTL 4WNQA 4N0YL 3EJZD 3X3FH 2WQ8A 5DA0B 5TGBB 1KB9J 5GGUB 3FQUB 4Z0BH 4ZXBC 4XXCA 3WD5L 1JYNA 4GW5A 1NC4D 1BD2B 4OIBA 4M1GH 5KSBA 3NAAL 1UWXH 1CFNB 4ZUWB 3EYQC 2NY2B 3MUGA 4UT9H 5HHXH 3LN5A 1U92B 3NFNB 3MROB 3CMOH 5FUZL 2UYLA 4HFWB 4GW1A 1CXHA 2CRYA 3EYOB 4KUCF 4N9GA 1CL7I 4MAYA 3TN0A 2EICA 3OJ2C 5F97E 4ZFZA 2NW3B 3ARGD 4HXBH 4MDIA 1EV2E 1LK2B 4FHBD 4HF5L 5TQ2L 3X17A 4WEBH 4YWGH 3PABB 1C1EL 2WWMC 5CEZE 3AXLA 3NCBB 3ARRA 3G08A 5I66A 4PJFA 4O5LH 1D5IH 1KJ2A 3QQ9D 1U2CA 5DD1H 2CR3A 4G8FA 3RTQB 3GBMH 1BWWA 5IMOB 4PYGA 1MJ8L 4LOUD 4ELMA 1AC0A 5T1LA 4HKBB 3BJ91 2DB8A 4JRYB 3EDKA 2PR4L 1L6XA 2R0LH 4LKCB 3RX5A 4ORGB 4KRPC 5GJSL 3ZYIA 3UP1A 5TDOB 3QXAA 1CGSL 2BSRB 3VWJA 4MMXC 3MRBB 3ZHLA 4DAGL 3WNNA 4OKVB 5K33A 5I1LA 1IQWH 1N3NB 3WLWD 2FBOJ 1ZANH 5I19H 3ULUF 1CFBA 4LMQE 1DBJL 25C8L 3NFPA 4XX1G 1SJEB 4JO1H 4Y4KD 3WIHL 2VLKA 2V9QA 2AAVA 4JPKH 4ZFOB 4G7VH 2FD6H 2IPKA 3MNZB 4JPIB 1HH9A 1T04A 1KCKA 4HBQA 4K94H 4O51A 4HS6A 1JE6A 5DQ9B 3LPGA 1HNGA 3S3SA 3TIDA 4MNGE 5C0GB 1FORH 4Q7DA 3GSQB 4NJAL 5HI3D 4PD4J 1IAKB 1OT2A 4QRPE 2NX5D 4PJ5A 1LILA 1XH3A 4ELMF 1NUGA 4EI6A 1Y18A 4TOYL 2XPGB 5JIIA 1V5JA 4P4KD 1MREH 1CGYA 3EYUH 4F58H 2CXGA 4PRHE 3VJ6B 3B3IB 4JE4B 5K9OB 4L29B 4V2CB 4LPXA 1CLZH 4DFHA 4GKZB 2BVEA 4FZ8L 1QKZL 1H0DB 4WFEE 2V7HB 2IH1B 1NCCL 1FRGL 4H0HB 1AD0A 3MRFA 3UTOA 1T22B 4JHAH 2D4FA 3QUKA 1IEHA 5IG7A 4APQB 1U91A 1X5LA 1XF4B 5FO9A 5SV3A 3EAKA 5EZLB 5IFJB 2CJUL 4LVOB 5IEHA 4Y2DC 4D9RE 4F9LA 4Z18A 4ZDHB 3C5SB 3LKQA 4ZOEA 4QRQB 4HULB 3LN9A 1E4XH 4HT1H 4LNVA 5EZJB 4F57L 3EIFA 1QHOA 2VERN 2AK1L 3C08L 3BDBA 1YEDA 4X0KA 4NSKB 3ZE2E 2CKBL 2AGJL 4KPHH 5HDBE 5FA3A 1F4AA 4ONOA 4MAYB 2EDXA 3RNKB 4JQIL 5JNYB 1U95B 5DEFA 1OW0A 2EE2A 4JFHD 4MNGB 3V0VA 2AVGA 1QLFB 1QO3B 3MV8D 4XZUB 3AMLA 4Y4KB 2KQMA 4XRCB 2FJFB 1SY6L 2FD6L 4KTDL 1QA9B 5D2NC 4PY7B 2MQ0A 2I60L 3IT8D 1EFXD 4J3WA 1R5WB 2V9TA 2Z35B 5HVGB 1RMFH 1I8KB 4FFWD 3E0GA 1HSBB 5T1LB 4UINH 4J8RB 1NFDE 1B3JA 3PP4H 4X7DC 5JOEA 3NCEB 1FNLA 1QFPA 1JGVH 1NKOA 2QTEA 4S1RH 4OFVA 4X5XB 3VFPA 4I3SL 4JHWH 5E4IA 5EO0B 1S3KL 4JO1L 1RK0B 2O5XH 2VITA 5ID0A 4W81A 2Q3AA 4OTXH 4DZ8A 1I9IL 4LLUA 3HNVL 5F6IC 1FH5L 5JR1L 5ISZD 4N9GB 1OM3L 2WBKA 1CD9B 3WFHA 5JORB 3QHFL 1A7OL 5B39G 4JGJA 4Z5RA 1TJHL 1BQHG 4HUVB 3MFGB 1JHKL 4HMCA 5JUEH 1EUUA 3D25A 1Q38A 3IGAB 1WJ3A 2A9NL 4E41D 5DURD 1RZKL 1ZT1A 2CXKA 4Y0GA 5HGBA 3O4OB 5BV7C 1HHHA 2QQLH 3RTQA 3X14A 3EJYC 1ZLSL 4JVUA 3RNQB 2RFXB 5JDSB 4OSUH 4HKBA 5K9QI 2OLDA 4YNYB 3SKJL 3QNYA 1BQLH 3T0EB 4KI5C 1WT5A 1J8KA 3BGMA 4XP5H 3S37H 3C5JA 1ZHNA 2C9AA 2W1NA 1AHWA 4K3HA 4D0DB 3K4ZA 3BN9D 4N0YH 4PJIE 2XFXA 3QXWA 4MD5B 3ZMRA 4OKVA 1UACL 4MSWB 3I6LE 4PRPE 4GG6B 4OCSL 1CI5A 2WK2A 3O3AA 2XTJD 4K3DL 4ODSL 5BOPA 1WC7B 1OAXL 2IGFL 2Z92B 4JGMA 3FB7B 4UUJB 4X7EC 2EZ0C 3F7QA 5I1CH 5I1GH 2WV3A 4ZQKB 1FNEB 1XF4A 2HKHH 2W0FA 3RBGA 4PJBB 1A8JH 4PJ9C 3ZKXB 1Q1JL 1H3PL 5CSZA 1XF3A 2GTZA 1NQBA 1EHLL 1B4JH 2EDRA 4O2FA 5EIIB 2FRGP 4K3DH 4ODSH 3SDCA 3W9DB 5JMRA 5J12C 3NCFB 1FNHA 1LO5B 3DMMD 4HC1L 2BP3A 1H3PH 3HI5L 1KJVA 3QG7H 4YHIA 3VRLE 1ERNA 5DEGA 5C0EA 5L7XH 3CDGA 3U1SL 3FN0L 4HAGA 3VFGL 2VABA 3V4UL 3KPSB 4P3CH 1IM3A 3ULVL 4LPWA 1T1WA 4NQCD 3BPLB 3LIZL 3B8SA 1CIDA 2VLJD 1Z9MA 4D9LL 3QNZB 4QXTA 3H6JA 4GBXB 4AEFA 4XRCA 5L6YH 3WJJA 3EOAB 4W4OA 1MCLA 4QHLA 1LO2L 5DC9B 5C0AB 1M4KA 5GZND 3PWUA 4BH7A 1PW3A 3FQRB 3RKPA 4NUGL 1QLRA 4BQCA 3PHSA 2PTTB 4DGIH 4JZNB 4E41B 2FO1A 2X4QB 4B7LA 1I8KA 1N26A 4WIQA 5B39A 1A02N 3VH8B 3MUGB 2APTA 3MMEA 5EU7C 3H0TB 4PFEA 2R4SL 3MNWB 1XEDA 1QEWA 4JZOA 4CN6A 1LNUA 2P8LB 5JOFB 4AENA 1JPTH 4CN1A 5HYQA 4YHLH 5MEOB 5EO0A 4GKNB 3U4BH 5LCVL 2ED8A 2ORBH 2X70A 2WM0A 5BQ7B 3H42L 4MA1C 4QRUA 1VFAB 2FBJH 1GHFH 4IOIB 3TO2B 4YBQC 2WANA 1JPFA 4FZEH 2PNDA 2L7UA 1R3LB 4PRBA 5FHBH 3O81A 1KEML 2Z31A 4OZIF 4KJYB 4K8RD 1SM3L 4KVCH 3ZKQD 1TITA 5FB8A 4I0PB 5DUPL 4OLEA 3VRJA 4JDZA 4F7CA 1DVFA 1F3DJ 2H8PB 1I4FB 1MRFH 2HFEB 5J89A 4KMLB 4X7CC 4HH9A 5CJQL 4XPAH 3ARDB 1NUNB 5K9KB 1H3VA 3LY6A 2BNRB 4ZPTB 3JTSA 3VXSE 5JW4Q 2W65A 5HVHC 1N3NA 1IGJA 3ZDYE 2NXYC 2AJSH 4ZUTB 1D9KD 4C56A 1ZA3A 1ZWIA 3NTCH 2ZCHH 3K2MC 5FUCE 1IKNC 3B83A 1AGBA 4I18C 4I3GA 1HXYA 4KRPD 2DKMA 2Z31C 5GRJL 2ADGA 1BBJB 1JPGA 4JANA 1FN4A 4MVBD 4P2QD 2R0KH 1FNEA 2W0FB 3JUZA 4ODHL 1HIML 3FFCA 1I1YA 3SOBL 3SN6N 2DJUA 4XNQB 1JZ8A 3LKSB 1JI2A 3ORJA 1BQSA 4EUPB 5DLMH 1RK1B 4QTIL 1E27A 3W11D 1I3RB 3IGAA 3DHJA 4MD0A 3U7YH 1AP2A 3BPOB 4NO5B 5LAXA 4RRPG 4NRYB 4U1LA 1WBYA 4G6KH 4MNQA 4J2XA 3MLZH 3QCVH 1JTTA 1U8IA 1AQDB 4N90D 2CLRB 5I8KL 4G8GA 4QHUB 3RRQA 1ZHLB 3O8XD 2FX7L 3O2VL 3MJGX 5KBNC 4BYHA 2QSQA 1P7KB 4HIHB 3QDGE 3V6FB 1F2QA 3CMGA 3ES6A 1MVFA 2MPAL 3PWUB 1RZ7L 2GJZB 3ZKND 4HK0B 5JW4R 5KSAA 5C0AE 5ANMA 2D3VA 3B9KB 5AWNL 1BFOA 3IDGA 2OP4H 2XACC 3VWKD 1ZLVH 1Z0NA 3SDYL 1JUFB 4MJID 3EOTH 1OD9A 4NC1E 3T1WA 1YYMH 3PHQB 3EOYG 2HT2C 4IRJB 4ZQKA 4P2OA 3CJJA 4ZXBB 5FA3B 3VMPA 5FOJA 2PO6C 3ZHKA 2V9RA 2PYFB 4FFYH 4S1DD 3ARYA 3BI9X 3RY6C 2J88H 5TH2A 3REVA 2IMMA 2Y72A 4KU1A 1IGTB 4GRLB 1FIGL 3NPSC 2AQ3A 4F33A 3DUUB 4Z7UA 5HHMB 1BECA 4HGKC 5E1HB 4XVJL 3R0MA 1D5MA 3DX8A 3K8KA 5HYSB 3VXMB 1TQCB 1KT2A 2APBA 1YPZA 4Y4FA 5C0NC 5HYJD 3BWUC 2RHEA 3BEVB 4JO3H 4TULL 3JV6B 5FB8B 1ZK9A 3QPXH 4XNUH 3VGAC 4XPTH 1GGBH 1MAML 5C3LD 3VRIB 1JF5A 4ZPVA 5BS0A 4LPVA 4LRNH 4F2MB 3SJVB 4RMSA 4ZD3L 2EKSA 1AH1A 2N4IA 4NBXB 3QIWD 4XB7A 4YHNA 4IRSA 3LDBC 4OZHB 1FO0B 2OSLB 2X2YA 4L4JA 1G7IB 3O6MH 1HDMB 3KYMB 3AS3A 3TEUA 4F7TA 3DRTA 3OGCA 5D1QB 3FT3B 4QTIH 1J05B 1XCTA 3CMOL 3QIUA 5MI0C 3ARGB 4WWKB 4PG2A 4MWFB 2R39A 3ARDD 4A6YL 2FGZA 5DT1H 5CEZD 2GK0B 5KZCD 2E27H 5DZLA 1NDGA 1C7SA 1VEOA 2CLVA 5GJTL 3SDAA 1JTPA 3QO0A 5CINL 3BHBB 43CAB 3DV6A 2ARJQ 5E8PB 2RFXA 5T33L 3L6FA 3LKRB 2VL5B 1ZGLM 5HY9A 4I0PC 3NBNA 4FFVD 2ERJB 4JFPB 4KJQC 3O45A 5DJYA 5DWUL 5IB4A 4Z8FL 3MLXH 3QDME 2DQUH 3QXUA 5IBTL 3LH2H 1P2CA 3ZE1E 4TYUA 4I0KA 3H9SD 1P1ZB 5IW6A 4OZFH 3PWPB 3R06A 5DJXA 3ARWA 5IJVB 4PJGF 1CF8H 3VXRE 3FB7A 4MA8L 2BFVH 1U8KA 3GSRA 2HLAB 2DYPA 2WIIB 1L9MA 1CDUA 4XVSL 4DZBB 2PO6A 4XNZC 4FQPA 3QEQE 4AH2A 4LHUD 1H3TA 1YEJH 1FZJB 5KVEH 1IC4L 1CLZL 2Z8WC 3UEZA 1CFNA 5DRXB 1QBML 1T0NA 3OAZH 3OAYK 5BOZG 4HFUH 5GZNC 1MFDH 3FQWB 5BV7B 2W91A 2I07B 4J1UA 3OX8B 1VESA 3F12B 3QDJE 1GPOL 1BAFL 5J7CC 2FATL 4IMKA 4ESKA 3WO3B 4OCNC 3LPFA 3IDNB 3HKFA 1OT1A 5CLTA 5E5MA 1K4CB 3MV7A 1FLRH 2AJ3A 4GLRI 3QNZA 4QXTB 3GHBL 5I66B 4M4RA 1YEEH 5DURB 2FJHB 3VXQA 2A6JA 4HCRH 1HE7A 2CLRA 4XPHL 5ENWA 4QHUA 5JQHC 3LEVL 1KEGH 3S5LG 4H8WH 1BVZA 1JPSH 1HHKA 3CZFA 4L9DA 5J1AB 3WIHH 4PUBL 4JPWH 4WVRA 3DI2B 1J7VR 1LE5A 4DWHA 1V7NL 4CN4A 3MRBA 3IF1B 3VGEA 1A21A 1QFUL 4LHQB 2OI9B 2GUOA 1IGIL 2WQRA 3DO7A 3DV4B 4OFDA 3B2UC 1HDMA 2AXFA 2YUWA 2P5WD 1JP5A 4RMQA 1VADA 4YDKH 1RZFH 3RAJL 4X8JA 3TV3L 4JQXA 1CIUA 1UCBL 4FG6C 4PJ8D 1S8DB 3QWQB 5D2NE 3SDDD 4PRBB 4ODXB 2HFGL 2Z0BA 5KOMC 4DKFL 1LMKA 2BVPA 4UBDD 2FBJL 3O4LE 4LASL 1RJLB 2Q87A 3T65B 1N64L 4QXUL 1O7SA 2R0WL 3DYMA 1MAKA 1GPOH 1NBZA 5ADPH 1ZT4A 5LGHH 1C5BL 3DV6B 4OZ4B 2XKNA 1XH3B 4Z8FH 2NYYC 4HUWB 3FQXB 4PJCF 5HBBA 3BIAX 4G3YL 1IGCL 2ZWLT 3QIUD 2EXYD 4WI4A 4ONHA 4PJCB 4ZPVB 4FABL 1LDPH 3QDMD 1J9CT 1DBML 3KLDA 3IXTB 1NCWL 2ZUSA 4S0SD 5DZOA 1KNOB 4GXUM 1YEHL 3U2SA 5KSVB 2C1OA 3H9SE 4MA8H 2VZOA 3NCYS 1WAAF 3MBEA 1INEL 5DD0L 5CBEA 5HYIA 4WFHD 3E3QC 4YAQA 4D8PA 4JN2A 4DVRH 4NO3B 2NZ9C 1OAXH 5JXED 3PWPE 2JTDA 3QQ3A 2VL4A 5DHVA 4ZUSA 5ISZE 2OZ4L 2BMKB 3VXUA 4Q2ZA 5IFJA 3CFJB 1CD1B 2WMPA 4UAOC 5IESL 3BZ4A 4QRQA 5GPRA 4PRPB 4X9BA 4DVRL 3E3QE 2NY5H 3TN0C 3L3HB 3KHOA 5E6IA 4UDTA 1YEDB 3VW3L 1AQKL 5CEYA 2KUTA 3RDTA 4JCLA 5JTWA 1GGYA 3EYVB 4CU6A 4R2GD 43CAA 5FV1L 3B43A 3P4NB 5C6TH 3QDJA 1AQDA 4OT1H 3TNNA 1MPAL 2QQLL 3MO1B 2YD7A 3IDNA 1JJUA 1Q1JH 2DI9A 4CRPA 3ARGC 1UGNA 4PV9A 5ESVB 3MV9A 4JDVB 4QHMA 5C8JA 3PIQA 2P8MA 3KXFA 4D3CH 3ZYZA 5M7QA 3S3JA 4LSTH 4NQSA 4PJ9D 1QD0A 4LQ1A 5E2UH 4DGVH 3GMRA 2Z35A 5BV7H 3VXRA 1A7RH 2XTJE 5HGGS 4U4BA 1I9IH 4QRTA 3QUKB 1HI6B 3U9UB 1ZE3C 1U92A 3NFNA 1I9RH 3ARUA 4NQDA 4KTEL 5E6ZA 3TZVB 1YEFL 1YY8A 4WW1B 2W0LA 2MOVA 3VMNA 5L8JB 4Q0XH 5IBUG 4XBGB 3TCLA 1ZGLA 2V2WA 5TH2B 3REVB 4YXHL 5JW5B 3GIZL 4TUKH 4S1RL 1QBAA 3KYKL 4MGXA 1TFHA 4JFFE 5EO1A 4EN3A 2FIKA 2XIDA 1JGDA 2BY3A 3I6GB 1ZHBA 2DDQH 2EDLA 2UZYB 1IC7H 4EQ2A 5D8JH 4XBEL 3VXMA 1U95A 5DEFB 2WUCH 3PF2A 4FQCH 1AHWC 4XGZB 3VU2A 5E5MB 2X4SB 4CL7A 5F7UA 2E7BA 4XZUA 4Y4KA 3FQTB 2MCG1 1GC1C 4MQXD 3G6DL 1UB6A 3VRIA 4X7FC 4Q9RL 2A6JB 3UAJD 3WO4B 1BEYH 5CWSB 5ICZA 3IFNL 4QY8A 1QKZH 5CJOH 3U7WH 4AG4H 1DLHB 2EKSB 3LQAH 5IMMA 1QVOB 2VLRA 5DVLA 3UCRA 4PJGB 4XWGL 3SO3B 1I1AC 2EDDA 4G80B 4Y5YC 1ORQA 4Y5VC 3DSFH 3GMLB 5J13C 1KULA 1SBSH 5E99L 5DD3L 1F5WA 4NM4H 5MEQB 4OF5A 1R3HA 4JR9H 4ZUVB 1E6JH 3SOBH 1AXTH 3KNBB 1NBVL 1RURH 5I1EH 3WHE0 1QBBA 3VI3E 1C5DB 2YPLE 4XMLL 2CDEB 1FIEA 3C5ZC 4L8CA 5EPMA 3UTQB 4JKWA 1S9WA 1JL8A 3O3BA 4GSDH 2VIRB 3SE4A 2DN7A 4LEXL 2Q6WA 4KI5F 4RGOH 3LKRA 4NWTH 2VZ3A 1NCAH 1Y18B 3HE7D 4WU7B 2QQKH 4DW2L 4YX2L 1R3KB 3SO5A 1INQA 5ESQB 5IB4B 2MSPA 1F02I 3MSPA 5A2LH 2F5BL 4R90L 5GXBB 5FKPB 3LDBB 3CUPB 1J12A 2GT9A 1OGAA 2F54D 1LGVA 3BPOC 3EYSH 1SJHB 1ZHNB 3RY4A 2DTML 2WP3O 5C0AA 4OQTA 4D0DA 1OAKH 4UIMB 5FO9B 3BKML 4LCYB 1I3GH 2R1YA 4Z95L 1A6TB 2A1WL 3TFKC 4WTZG 4AK1A 1J1XL 3FMGH 4O2EA 4JFYB 2A2QT 4WHYG 4D8PB 4S11A 4NO3A 4TSAL 4I0CC 2Z92A 3M1BA 1FZOB 4CDGC 5KN5B 4MJIA 3D5OF 3VH8A 5DSCB 2HJKB 4JM2D 5CD3A 5IFHH 5CJXA 3VI4E 3CFJA 4Y4HA 4PLJC 4HJJH 4HG4J 1T83A 3SDCB 3W9DA 3QRGH 3LEXA 5E9DA 3O2WH 1IGFL 1YMHB 3QFJB 1UWXK 2P5EB 4Y5VB 4GAJH 1NC2A 2WNGA 1ETZA 5FM5M 1P7HL 3H7LA 3RDTB 1NLBH 3FB8A 2FX8L 4H1LG 1T2QL 3FFDB 4Z76A 3ZTNL 1EXUA 3A67L 4XGZA 4M61A 4YH6A 2NNAB 2AJXL 4MYWB 3VXPB 1YMMD 2X4PB 2VQUA 1PKQB 4PR5B 4H20L 1NKRA 4U1IB 4YC2C 3RZCA 2R8SL 2PTTA 4FRWA 5ICYA 4UQ3B 1L7IH 4P2QA 4B50A 4JKKA 3DV4A 4H20H 4NUJB 5F96H 3S8WA 5H2BA 3IJYB 4P23C 2EH7H 1EJOH 2ID5A 3F6IA 4NKOA 4G6FD 4HS3B 3C8KA 1ACYH 4Z5RB 4OD1H 3O9WB 5CEZH 2OP4L 2H6PA 2EYRB 3BQUD 5SWSE 5HHQA 1AQKH 5GQBA 5EU6A 2BDNH 4NQED 3BIKB 1ZHBB 1C1EH 3UAJC 3UTQA 3MLRH 2BC4B 4KUCD 1R3JA 2ICWI 4Y2OA 3K0WA 1TPXB 3GRWH 2XKNB 3GSNH 3HG1D 4NQCB 3S34H 1A1OB 1MQ8A 2ZCKH 2L7JA 4JFDA 3PQYD 4MQ7B 3VRJB 1HINH 4KQ3L 2FLRT 5IMLB 3MRCA 1KCRH 5GGSY 3UYPA 5MENA 1UA6L 4NKMA 3MRHA 3WFDH 1MCOH 3V0AC 3G5VB 2BSTB 3D85A 4KY1L 5L0QB 3WD5H 3H9HB 2IQAB 5IKCB 2PXYA 4PGCB 4MS8C 5EC1A 3O6KL 1IGMH 3NIFF 5F96L 3OKDB 5I1IH 3RDTD 3C2SA 3GMLA 3VXRD 1KPVA 2E6QA 2MKLC 1U8OB 4KHXL 1T83C 1ZTXH 2DM4A 1DBAL 5HHOA 3TA3B 1YDPB 3RL1B 2B1HL 4Q2ZB 4TSCL 1A5FH 1IJ9A 3M17A 5FCSH 3U30C 2ZUQB 1HZHH 2BOCA 4JFYA 4C59B 5JW3H 4J3XA 3ULUC 3HNVH 4LLWA 1JUFA 1FN4B 2BY0A 4BUHA 5FYJD 5T5NF 4ZTPH 1MLBB 5IR1B 4JO4H 4O2CA 5F7WC 4ZXBA 4X6DE 3VFUB 4GBXD 1PG7X 3KPSA 4OZGF 2FX8H 1UWEH 3QHZH 4O02H 3IYLW 5I9QB 4GAFB 4ZSOE 1OY3B 2RCSH 3ULUE 4WUUE 1LDPL 2G9HA 2QQQA 1JVKA 5L2KD 1J0YA 4N8CL 4XCCH 1OARL 5GS1C 1PSKH 2R69L 4Q9BA 2AJYH 4QF1B 1PY9A 1G7QA 1UM5L 3TBVB 3WFCL 5TQ0L 3TYFA 2EDQA 2AEPH 2J6EA 3BVNA 2OMNA 2R1XA 4X4MA 4NRXA 1S7XA 3OKLB 4HBCH 3RJQB 4HIHA 3V6FA 3GI8H 4K94C 5GRXG 5EOTB 3T0DA 4BFEA 3I3EA 5I17A 3MNWA 1S5HB 1RUKL 5ELIA 3IRZA 2HG5A 2NY1C 1EA9C 2OR7A 5CZXD 3GI8L 2C7UB 4G43B 4G6MH 2XZQH 4IRZH 1B0GB 2AI0H 3ZTJH 1QBLH 7CGTA 2EDWA 3B2VH 4K3EH 4WUUB 1A6WH 2OK0L 2Y25A 4FQLL 2C3HA 5C0FB 3S96B 3P40A 2B1HH 3IU4L 4K9EH 5JZ7D 4KTDH 4P2RB 3LHPL 4TSBL 3MA9H 2PCPA 4F3FB 4YHPA 3NIGE 1FJ1A 3UJJH 2E9IA 3QJHB 3ZKXC 5C09E 3N50A 2BY1A 4L4VB 4NUGH 5DRNB 3SGDI 2XNAA 4J3SA 2MNUA 5AAWA 2AGJH 3BWAB 5GGRA 5I76A 4KHTH 1F4WL 4MNHA 5HD8D 3QFDA 4TPRH 5D7SL 4FXGA 1LEGA 2HVKB 2K7PA 4KTEH 1JZ5A 3B6SB 4C56B 3FOMA 4XNYH 1UB5B 5GGTL 1CGVA 4OFPA 2OR9H 4XMPH 4HQQH 4JFED 1ZSDB 1MJJB 1ZEAL 5ICYB 2PXYB 3HPJA 4IRSB 4OZHA 3CDYA 5JZ7C 1FO0A 3V9FA 3KHQA 4TTDD 1AJ7H 1IQDA 1ZLUH 2OJZH 4UT6L 3BKCL 4WY7L 5T1DH 1N0LA 3CU1A 2HKHL 4NQTA 2CK0H 4CU8A 1C16B 5AEAA 3T09A 4JPKL 1HH9B 4XP6L 2G75B 1OHQA 4APQC 1B4JL 5IGXH 3Q6GH 1BQHB 4M1CD 2ITCB 4XP1L 3O4LD 2DQHH 1J0HA 3HA0A 1OSPL 5D1ZD 2Z93B 1JZ7A 1YEKH 2XA8L 4HGMA 3PL6D 3RA7L 4NRYA 1DFBH 4OI7A 1IAKA 4OJFH 4U1LB 3QG6A 1ND0B 2HJFB 3O3DB 4NJAH 1J5OL 4PJ7F 2W9DH 4K23L 3ALWA 4OCMC 2VL5A 1CDBA 3FB5B 2R2HA 2N7BA 4LEOB 4WUUD 3KPNB 4MAYD 5D7KE 2J4WH 4LHUA 3SDXA 1P7KA 4K7FB 1PZ5B 3P0GB 5D7LA 3QUML 3CSYA 4X6CA 2FJHA 3ZL4H 3N9GH 2JJSA 3ZSSA 4EXPX 1RUPH 3MRKA 3MV8E 1PEWA 3PP3H 3PWPA 5DHXB 4PJDA 4FNLL 4BH8B 2BERA 4QHKJ 3RIAF 2VLLA 1T22A 4U6XB 3WXVH 2WINB 5TE6L 3WNPA 3QPQD 4BZ1H 4HPYL 5GS0H 1S5HA 3RL1A 1MVUA 3SE8H 1LE5B 2AS5M 5CJBA 2BSED 2XG4A 2EKJA 4NNYB 1KBGH 3V7AG 5I15L 4E42A 4JFZH 5DYOB 1G7JA 2QADC 1T1YB 2O5YH 1RZ8B 1T3FA 3TZVD 2YKLL 3BZEB 2BNQD 3N1PC 4OCWL 1OWWA 4BZ1L 3OX8A 3VFUA 2YWZA 2DWEB 5C6TL 5C0FA 1A1MB 3MYJA 4IRSD 2F8OA 4MNGA 1MCSA 4JFZL 3HZKB 4M61B 1QSFD 3QUXA 3OR6A 4LVOC 5T1LD 1ITBB 4NQEA 3NCJL 1EEYB 2ICWJ 4GMTH 1SBBA 1ZA6B 1FGNL 1TZIB 4N0FA 4WV1A 2YD3A 3BAEL 2C4FT 2NX5A 1QR4A 3RQ3A 3QDAA 4OI8A 4UOJA 3C09C 2HRPH 3JZ7A 4B0MM 1Q0XH 1F58L 4OJFL 4NUJA 4F80A 3BXNA 3B9DA 4S1SH 3KYMA 3NPSB 2XZAL 2OJEA 3HLAB 3IJYA 4X5WB 3BKCH 4WY7H 5KVDL 2ENSA 3CVIL 4YBQD 1BVKB 3DVNA 3X11B 4IS6B 3MGTA 5ID1A 2NY2C 3X13A 2DLTA 5CGTA 5EU6D 4Y19A 3SDYH 2CMRL 4PV8B 3VXUB 1M7DB 5C0BD 5KANI 2VDRL 3JV4B 2CDGA 1T2XA 3W2DL 1JWUB 4KKAD 5C0CA 1QQDB 2BHZA 5L88L 5GHWH 3BESR 1FFQA 2BK8A 2OS7A 3LKOA 4JM2C 4K8RH 5I1HH 3QFJE 1KELL 5M95B 5DR5H 1KCUH 4HC1A 5E5RB 5IIEA 4OZHF 1YN6A 1C5CL 3G5VA 2X1PA 2CIKB 4NO2B 1B6UA 2VXVL 2VZ1A 1OAYL 1L6ZA 4PV9B 3MREA 3OKDA 4ZMAT 2P48B 5CP3H 2H2SD 2XTJB 1TNNA 5I1EL 2DF3A 5C08B 3QEQA 5KVMC 2AJSL 4RMTA 2DS4A 3WNKA 2DKSA 2GFBA 5DD3H 1JGUH 2C3VB 3WIFA 4Y4FC 5J6HA 2X1QA 4P3DA 5I6XC 3FB6A 4FN0A 3MRQA 2JF1A 1REIA 4KROD 1HHJA 3D39B 4GS7C 2CSPA 3MYZA 2QSTA 4GLRH 1FGVL 2XY2A 5DJ6B 1F4XL 1AIFB 3UMTA 1QBLL 1YY8B 2BMKA 1FC1A 2F74B 4WCYL 3PV6B 5A43C 4M7LT 2BHUA 5FM5O 2PYED 4EUPG 3RPIA 5SWZA 3GSUA 4KDWA 3U46A 4U05A 1WAAA 5C0JB 1ZT7B 1RZJL 5HPOA 4Z7WA 3TYGH 2DWDB 1CD0A 4M93C 4EN3B 5ETUB 2H2SC 4HJ0C 3MCKB 2NY7H 3B8YA 3UTTA 4C4KT 3P0YL 2CKBB 1MFCL 3HR5A 3GI9H 1EFQA 3TT3H 3FB5A 3WIIL 4TTDC 1S9YA 4RGNC 2X4SA 1WFNA 2UUDK 5I18H 3FQTA 4CMMB 3MV9B 3BAEH 3J8F7 4JDVA 5C8JB 4AL8L 1Q72L 5ECJE 3WE6B 5C9JA 1QRNA 4GXVL 3GBNL 3MOAL 3FO1B 1UJ3A 4P57B 1EEQA 3DRQA 4KVCL 5AAMA 5SWZD 4LU5H 1KF9B 3DUHA 4OB5L 4TUJA 4OGZA 4ZD3H 1K5NA 2UWEF 4OFIA 4I3RL 4YWGL 4G43A 4HUXB 5EN2B 4O00A 4L4TD 2CR6A 4NJ9H 5DTFA 4NP4H 3I75B 2ENYA 4HLJA 3AMKA 4M8VA 4FXKA 1N2RB 4NKIH 3TA3D 5T1KB 5I73C 1DVFD 2RCSL 4JY6A 2FO4A 3MJ9L 3BT2H 1A5FL 3W9EA 4QGTA 1YJDC 1NPUA 1KLUA 1W8NA 1S78D 3T65A 3TO2A 3U9PH 4YHMH 1YPZE 2NY3C 4R97B 4QEGA 5HHVL 2GCYA 2BCKB 5HYSG 1DSFH 3RWDA 4NZRL 3BDXA 4PG9A 4MNHB 2ADJA 1JHLH 4R26H 4UQ2B 3NH7L 4Z7UE 2Y5TB 3CH1B 3EBAA 1U58A 1G1YA 2J8HA 1A3RL 3WS3A 1YA5A 2E6JA 4JFXA 4UZGA 2ZOLB 3LKOB 3FQNB 2IWGA 2CKNA 3MACL 5FDWA 5EOQH 3LD8B 5TPWL 4ONFH 2JK5A 4LSUH 3RWCA 3NA4A 4OLWL 5E4EC 4F15C 1J8HD 3L3GB 4JVPA 3L9RB 5FYKD 5JHLL 1OP3H 1M7IA 2PXYC 3BXNB 2V17L 4LLDA 3OTTA 1XGUA 2ZUQC 3WHE1 2OJEB 5CBAB 1IQDB 1HSAA 4WRLA 2EDBA 1K85A 5I1DB 3DMMA 1UQSB 4X83A 3JWOH 4KFZC 1W2KT 2ZNXA 4BK5A 4LU5L 1V8HA 2B1AL 5E08H 1IVLA 4OD1L 5CD5D 2VR9A 5DMYA 1KJMA 1W72A 5EC2A 4NZJA 4J6RL 1BQHA 1FZOA 1M71B 5IB5A 3OKOA 2OJZL 2ZUVA 2VE6B 3CK0H 1AIFA 3TPUB 2Z93A 1E4XI 2O61B 4PYHA 5K9JH 1KTDB 4S1QL 4KC3B 4XNQA 1ED3B 3MRRA 2X5PA 2NY7L 3LKSA 1GCFA 3TWCL 4FTVA 4TNVK 1ACYL 4R4BB 3SPVB 5HGHB 4D0BB 2IF7A 1ETZB 3KXFB 3G9VA 3RP1A 4PRDA 3KPOB 3O41B 2GSGB 2B2XL 4WW2F 2ZUXA 1KENH 4U1GC 5GRZA 2AJXH 1QSEB 4GAJL 2NQCA 3TH2T 1YEEL 1EGJH 3OJDB 4LRIC 4YGVA 3OKEA 4URTB 4P46B 3U9PL 4BH8A 3U36B 1JF1B 3EFFA 1U3ZA 4I4WA 4K55A 4CKVX 5BRZB 3RWJB 3U48A 3FO1A 4P57A 3TZVA 4U7MA 1UKQA 4AZ8A 1A6TA 3VGHA 4WFED 1LD9A 2MPAH 1T21A 3VXOA 3JTTA 3ALPA 5ANMB 1NCDL 1BFOB 4PJXF 4E42B 1G0XA 5J1SC 2WZPD 4WI5A 5LXGH 4WFFD 3VFOB 1GAFH 3IJSB 5H2BB 4QT5A 3I3BA 5EUKA 4LIQH 3RWGB 4UOW0 3QB7C 2FEDC 1CXLA 3NGBB 1KPRB 1KIQB 3QEHA 5C0IA 4OV5A 1PG7W 4KJPC 1NFIB 4OIAA 3GSUB 4NRZA 5JOPE 4C58B 1LO0H 5BW7C 2GJ6A 3O4LB 2XWJB 1MHHA 4WV1B 4N0UE 1QNZH 3OB0H 4WWKD 2BCKA 3QUYB 5IHZA 5TQ0H 3UJTL 4MCZA 4HS8H 3OXRB 1A7QH 4B41A 1A1OA 3MA7B 3E1F1 3WN5B 4PJGA 1IGYA 3DX9B 3QEUA 2E5EA 4M3KB 3B5HA 2F19H 4YHZL 3PG2A 4TNWK 2WSKA 3IDJB 1WWWX 4NT6B 4OZHE 1R3HB 5HYFA 1P6AB 1SYSA 1JN6B 3HZYA 1CICB 1RULL 2C1PA 3MZGB 3EO0A 2F58L 3GDBA 1UA6H 1V3LA 5GISH 1EJ6A 4H1LA 2ZPKL 4CVZB 1I7UA 2PKDA 3L3JB 4NO0A 4UV4H 7FABH 3LH2L 1VFBA 1UH4A 2D7NA 4LCWD 3MRJB 1A7PH 3C2AH 1MCNA 2OQJB 1W72B 1F3JA 5EC2B 3I50H 2EYRA 3SDCD 5IB1A 3MXWH 2OTWA 3JVGC 4OLUL 4HEPG 1FORL 1F3DH 5C09D 1FCGA 1B2WH 3QH3A 3TO4B 5I2IA 1DQDH 1GGCH 4KAQL 5KW9H 2QV2A 5F8QC 4E0RA 1RQ5A 3BEWB 4FZ8H 3MUZ1 4NQCA 4RDQG 3CH1A 3JVGA 3RGVD 4L3EE 1EDQA 3HS0A 2FX9H 3EYUL 3DTXA 3KPOA 3ILPB 3QPQC 5IROC 4YHLL 1PBYA 3WNOA 4CNIA 3W0WA 3D2UD 3D2UA 3LS4L 4HS6B 3IAGC 5FXCH 5F7YC 4QWWC 1X4YA 3KJ4B 3BVNB 2G5BB 3NACL 1A0QH 3WEXB 1BZQK 5C0GA 3U7WL 3EFFB 4LLDB 4TVPH 5CBAA 2A74A 2K3TA 3X3GH 3ZDZF 3UBXB 1S7TA 3RU8L 1OGTA 4JQVA 5D1XD 5GS1B 4WHCA 2AK4B 5SX4I 4PJIA 4X4ME 1WUNT 4MZ3A 3WS6A 4Z7VE 1MJ8H 2Q86A 2VRAA 1RZKC 1T80A 1S7SB 2DKUA 1LHZA 2R2EA 1EJOL 5DD5L 1FNGB 3TBWB 3STBA 3LKNA 4KRNA 3PDGA 3AY4C 3IDIA 4L3EA 4O2CB 1GL4B 4ZSOA 4EN3C 4PJBF 4NQCE 1K9TA 3ARED 3DVIA 5F89B 5DD5H 2P4AB 2H2PD 4OV5B 4PGDA 1EXUB 1IBGH 3T2NH 4X6DA 3GMNA 3QZWG 5F9OH 3FO9A 1ZS8A 2IAMC 1KYOK 4YQXH 3MJ6A 1LWRA 3TA3C 2H9GA 1EHLH 1TXKA 3KPQA 4M7KH 4HIIA 1QACA 2AJVH 1MLCA 1RVFL 1WBXB 5DXWA 2VLJE 2X44D 3ZL4L 1QSFE 5LWYH 1RZGB 2RR3A 3OB0K 3U7YL 4BM7A 3AB0C 3F7YB 3ARFB 4G8IB 3GSXB 1AGEB 1FVCB 4KWUA 5A16B 4D3CL 2HYMA 5TDNB 1T21B 3VXOB 5I30H 2FX9L 1JN6A 2ZPKH 2VZVA 3HZYB 4M6MH 3SE8L 5IBUB 1BBDL 1HOCA 2FO4B 3LV3A 2VITB 3C2AL 5ID0B 15C8L 1RI8A 2WIMA 1NFDA 1BLNA 4M5YH 5KAQG 5GGSB 5KSBF 1Q94A 2FJGB 4WHYH 5C2BL 2ZG3A 3U0WH 3P11L 2R29H 1B2WL 4DUVA 4GG8B 5DMGC 1PFCA 1A6AA 4JO2H 4YC2B 1MCKA 4HWZB 3Q48A 2R4RH 4XCEA 5SWQB 5CHNA 5LBSL 3N1QC 2ICWA 4QXGL 4Y16A 3SGJA 4L8BB 2NXYB 4JFXB 4PJFF 5HHPA 1BVLA 4GAYB 3WL9B 1FVEB 2AXGA 4IMLB 3QUYA 1ZVHA 1TQCC 3I6KB 5JDSA 2VWEC 1I8MB 3FQXA 3EHBD 5JPMA 4PP2B 3QIWC 1AXTL 2LTQC 1F45A 4NM4L 4K2UL 1KPVB 2LE9A 3QEGH 3H9YA 5DRWB 2CPCA 1FRGH 3DSFL 1ZSDA 4G6JH 1KNOA 5F7LB 3OAUH 4XBPB 5IVZA 5L2KA 2EDKA 3G5YB 3AREC 2G5BA 1CDCA 5CJOL 1CR9H 1SJVA 3VWKA 2E7MA 5DGRA 3D6GA 4Z7NF 1MLBA 3V8CA 1GAFL 4XMLH 4KZDH 3SQOL 3OXSB 3RVUD 4Y2DA 3MLVH 1XZ0B 1JYVA 3IU4H 4K9EL 2Q86B 4PTUA 4XC3L 1E6JL 4BZYA 4LP4A 3PQYE 3L3HA 1FDLL 3I02A 2CD0A 4YHIB 3BH8B 2QLVB 4X98B 5DEGB 5ALBH 4RMUA 5C0EB 4MD5A 4DN3H 4FQ2H 5CSBA 1A6ZA 4QRPA 3UTTD 3NZ8B 3ULUH 5M94B 1F4XH 3BKJH 3MO1A 3LQAL 2NZ9D 2QJDA 1EFXB 3Q5YA 4PJ5D 1JK8A 1I1CA 3ZTJG 3ETBF 2EDEA 3RVTC 1K8IA 2ORBL 4ZXBD 4DVBA 3FO9B 3ARXA 2P8MB 5L8KB 2NPLX 3ARFD 1KXTB 4K7FA 1L0YA 3OJMB 3CSYB 4X6CB 4WUKL 3OSKA 4OFYA 4NCC1 1CFSA 1YZZA 3WN5C 3SY0A 3O6FA 2O26U 4Q97A 4ISVB 1LO5A 2LQRA 4UTBH 4DTGL 4WW2B 4QTHB 3TBYA 2R56H 4OBSA 3SEPA 2WINA 3B9VA 1B0GA 1NCCH 3U9UA 1D9KA 4C56D 2P42B 3RWGA 2NY1B 5JOFA 1KN4L 4UAOB 1ES0A 3SE4C 3QEHB 3HFML 1B0RA 3CCHA 4HLZG 1MREL 4YHPB 1Z9LA 1KIRA 4PRAA 1MCJA 4X6BA 2EDHA 5J56B 3HMWL 4U33A 1U8NA 3E6HA 1DQQB 2NW2A 4QRUB 1INDH 1JGDB 1TZGH 1PQZA 3HZMA 1II4E 1TVBB 2NXYD 4PV8A 4ZODA 1PD6A 4JVWA 4PRID 5BVJA 4U2ZA 5GGRB 5I76B 2DMCA 4Y88A 2HFTA 4KJYA 2BJMH 3F58H 1CT8A 3KDMA 4OLWH 3DETC 4XCCL 3CFBB 1QFWM 2FEDD 1ZS8B 2J5LB 4OGAC 4Y16B 1W0WA 3JWOC 4DUWA 1KACB 4JDZB 5D9SB 4AMKH 4F9PC 1Q9OA 2XOTA 3EGSA 4N0FB 3RY6A 4GW4B 4O02L 4D9RD 5IBLC 4KROC 4DN4L 5HVWA 3UTPE 2ZG2A 1DSFL 1KG0A 3WFBH 4KMTH 5KSBE 1EAJA 4PJHB 4X5WA 5LKNA 1MRDL 5LGKA 4NWUH 4YXLH 3MTRA 1CYGA 4Y4HC 1P69B 1J8HE 4X9FA 5J06A 1AR1C 1K6QH 2G75A 2IANB 4QHNA 4UMGA 2ZKHH 4M1DL 4ZOBA 2J8OA 2VYRE 1NANI 1INDL 3CC5B 1I3UA 2VC2L 3KYNB 3RWEB 3TC9A 4PLKD 3TO4A 5I2IB 3SDAC 4I13B 1JZ2A 4C4KO 5DGQA 1KC5L 1XZ0A 4WI2A 3WFDL 2HJFA 3INUH 3WS6C 4JM4L 4MHHG 5DMKB 3VA6A 1LK3L 2PETA 5FHAH 3RWFA 3HS0B 2VLJA 1T7ZA 3RAJH 3TV3H 5DK3A 2IMNA 3D0VB 4JRYD 4MX7A 5IIEB 1MIMH 4PJBE 3MRNB 3QUYC 2GT9B 5KSUA 1RZJH 1XGRA 5JPMB 1AE6L 4ZFFB 2EECA 2BNQA 2FR4A 1TZGL 5EFIA 3MREB 4WUKH 4UIKL 2CIIA 1LP9F 4JRXE 1QSEE 5GIRB 4OZIA 3B5TA 4M1GL 4XVJH 2BVUA 3EJYD 1IKNA 1UJ3C 3L3OA 3L5HA 4PJIB 4MQTB 2HFGH 4AL8H 1YYML 4KK8C 3IVKB 2XZCH 5D5MB 1I8IA 3UTSB 5D7LD 2EDFA 2YZ8A 1YMME 1LE9A 4Z7VA 4F8QA 2CGRH 3BN9C 4P2OB 2A83B 3QRGL 1FE8H 4MXWL 4G8GB 3T2QA 1RUAL 1ZHLA 4XP9H 3HC3L 1UFUA 1R5VB 1RIUL 3RWHA 4XNXL 1IM9A 5I8OL 2J88L 1YMHA 3QFJA 3NA9H 4P23B 3O6LL 2J1KA 3IDXH 4GAGH 3OPZH 1RHHB 3G6AB 4NQEB 2A73B 4CVUA 1C08B 1F6FB 2CK0L 1PQZB 2I9TA 1KCUL 4YBLC 5IJKC 5E1AB 4OLUH 4K8RL 3PNWB 2CKBA 5EU7E 1EVUA 5I1HL 4HMDA 3K2UH 1JPST 2D0FA 5TF1H 1HQ4B 2X1XR 1CGXA 5MEPA 3CFBA 1AR1D 3O6LH 4IRJA 5IT2L 3WKML 4GUPB 6CGTA 1YN7B 4OLVL 4ONGL 4YK4B 1FVCA 2D31B 4F2MA 4FQLH 1NGYB 1OB1A 1OTTC 5J6GA 2YXMA 1CICD 4PLOB 1NGXA 1HOCB 3L9RA 4WW2C 1U8QB 3IETB 4X99A 3N1FC 4FOMA 5IM7B 4GRWF 3HC0A 3L5XH 3QA3A 4UB0L 5EH1A 2J8UB 4GRMB 3VD3A 1QZ1A 1A6AB 4P5TD 1MWAH 3QUYD 2IAND 4TOYH 3SKNB 5CHNB 4PREB 1KFAH 2IFGA 1X5GA 3RWEA 4NQEE 1IZKA 2J3SA 1BVLB 4GAYA 2V5YA 3UPCA 3GKWH 4PS4L 1D5BA 3GZKA 5JLZB 3EYQD 5J9PB 5E8PA 4B7IA 5JPNA 4QWWD 5CCKL 5IT2H 3BP6B 4M9OA 1U36A 3NIDF 5HGHA 1FZMA 4OM0H 5IMLA 2YN3A 1G7PB 5EBWA 4N0UA 2IPKB 3AC0A 4GQ9H 1NH6A 4HH8A 4PJ9A 3NCJH 4U1SB 2DBJA 3OR7B 4HWEL 1UC6A 5FYLD 3GMMB 3IFNH 3U0WL 3G5YA 5CMAA 4L3ED 2H32B 3G6DH 4ZAKA 3MRQB 3AREB 3DVFA 2EXWD 3ARBD 2D7TH 1A3LH 3QO1B 2EDYA 3D3VD 1KB9K 3CD4A 2ZUTA 3CLFL 4PGEA 5TE6H 2GJ6D 4JO3L 5F7MC 1KEMH 1SBSL 3H8NA 5HHXL 5D7LE 4Z78A 1WICA 4M7LH 5B3NA 2KH2B 1QYGH 4Z7VB 1UWEL 1P5VA 2SEBA 4JJHA 2APVA 2EDOA 3MV7E 3Q5TA 4OT1L 3IFLH 3UO1L 3TH4T 5L6YL 2EXYC 1HHGA 3D3VA 4PY8J 5FF6A 2FSEB 4PJHF 4NYLB 1G6RH 3KLAB 4XH2A 3OV6A 3HNTH 3FO2B 3VGGA 5B8CC 4M43L 1S78C 2X05A 2K1MA 3PL6A 4EBQL 3FCTA 1OSPH 1LEKB 4HC1H 1YC7A 4JFEA 4YGVB 2P1YA 4G5ZH 5DJ0B 3SE9H 1S7XB 1RUPL 1XGPB 2AV1B 3CDCA 3QEUB 4Z77A 4GRWE 1GH7A 4KZEH 5C08E 3IFPA 2JJSC 3HE6C 4L5FH 3IDJA 2AABL 3DETD 4W4OC 3RL2A 5E03A 5HHOD 1BQUA 3AM8A 2IGFH 3T0XA 5E2WL 4XP6H 4B5EA 4BQ8A 4UU9A 1UXSB 2Z91B 2VZUA 4KAQH 4P9ML 5KW9L 2ZKHL 3IETA 4X99B 3QDMA 1UKTA 4CAGA 3QQ4B 4OBRA 3T4AA 5J8OA 4QT5B 4UT6H 1AFVH 4JB9L 5IK3B 1YEKL 3MJ7A 4XMPL 2VOTA 3QG7L 2CUIA 3WLWC 5LQBH 5LGHL 1DQJA 4P5TA 1WIPA 5LGJA 3T0ED 2PCPB 4YDVA 1Q0YL 1CXIA 1NSNL 3VGBA 1CE1L 1OAUH 3NIDE 5H94B 1URLA 1S7UA 2FH6A 1SVZA 2YUZA 3JWDL 5C09A 4DKFH 1C08A 2I9TB 1OF2A 4ALAL 2XWJA 3S37L 4LHJB 2NY6D 4MXVE 5HDQH 1NGWB 5CS7A 4NQUA 4YIQA 1MH5B 4PJXB 3BWAA 3MGOB 1D6EA 2AXFB 4OCSH 4AEEA 2IALB 4RGMB 5KVGH 3SDAD 4O58L 2OCFD 4M7JH 1HQRB 4ZNEE 1G7PA 4WEUD 3PHOB 1JNHB 1HH6A 2D7TL 3NPZB 4U1SA 1BD2E 1OAZH 4I0PD 3HMWH 4OB5H 1WGOA 4HIXL 2EE9A 3VFSA 2I26N 4KJWC 1J1XH 4QYOA 2NR6C 2VE6A 1MIEH 1DANT 2AK4A 3HRPA 5IV2A 1T4KA 3U82B 3DX7B 3JV5A 2DLIA 1GC1L 3AU1B 2P44B 4JREC 1SMAA 5DEZA 4YNYA 3IDYB 4U1JA 3TF7C 1QFWH 4PRNB 1JWSB 1DR9A 2FEEL 1NC2D 4AIXA 4JCMA 1RUML 3ZHDA 3CFCH 4R7NA 5I16A 3QG6B 5IMKB 4XCYB 4Z6AT 1MFCH 1OPGL 1TJGL 2O5XL 4G8EA 1HHGB 3D3VB 4LQFH 4UUJA 2BNQE 3SCMA 1N8ZA 1RIVL 3QWOB 2APXA 3HE6A 4TN9A 1I3GL 2NY2D 4NFCA 5IFAL 1Q9KA 4NFDA 2EYTA 2PUQT 5ACMA 2IQ9H 4ZTOH 3O6FD 1ZLWK 1QTYT 2VSCA 2ZOKA 3U4EA 3PL6C 4QRTB 3QO1A 4XC3H 3S97C 3IJHA 4M6ML 4P49A 2A83A 4JY5H 3L3DA 1T1WB 3MLVL 2B4CH 4MQXC 4PIRF 4JJ5A 3SQOH 2YRPA 4U1HA 1OAZL 3JUYA 5FEBA 5C6WH 3HUJB 1MWAL 4JN1L 1QFWI 4U2YA 5E56A 2R4SH 3ARFC 4XHJD 1IAMA 3HE7A 1G9NC 2DWEA 4ZTPL 4QCIA 4X9HA 4U6HA 3P4OB 5D70L 1F90L 2GJJA 5B21A 2FHCA 5IQ7L 1MCFA 1WFOA 4HWNA 5B39B 1DUZB 4LMQI 5SWQA 2PYEB 3FFCE 3ARBC 3DX9A 3FN9A 4MA7L 5EOCL 3VFMA 5EU6E 2P8LA 5DC0A 5GGUA 5F1NA 2HTLC 4JFFB 1KCVH 2JB5L 2VAAA 4XVUC 3QEQD 1IKFH 1S7QA 3RGVB 3H3PH 4HAFA 5GGQH 2ZG1A 5C0CE 3OJVC 1MFDL 2BZDA 1A4KB 1ZV5A 2X1WL 1NEZA 1NAMA 3WFZA 1XCQA 2F9BT 4C56E 4P5MA 1R3LA 3TPKA 4S1SL 2NW3A 3GGWA 2VDLL 5A16A 1DLFL 1RJYB 1VFBB 1JZ6A 1MEXL 4LRNL 5FGCB 5KOVC 4LLAA 5ITFA 4M6NL 1QRKA 5AUMA 1UVQB 4LSDA 4F7CB 4G7VL 5MP6H 4N8PA 2HFEA 1JRHI 2E6PA 2Q1EA 2R15A 3MRPA 3KJ4C 1I75A 2YC1B 5DUBA 2ZCLH 2RAMA 5LGJB 4MXQD 2UWEE 4M7ZB 4OUUB 2DQUL 4NKIL 3QCTH 5I0DA 5HI4D 1A6VH 3GMQA 5FDYA 4F37F 3E2HB 2VKWA 2XV6B 4YO0B 1BFSA 1KC5H 2BVQA 2V2XB 1D3CA 1IL1B 3BH8A 3KPMA 5B3JF 5GJSH 1BHGA 1BJ8A 1S9XB 4N9OB 1D5ZB 1Y6KR 4EXKA 4PGBB 2Z31D 4LVNB 1N5YH 1SJEA 1YYLL 4PB9L 3KPRE 1FFRA 3EOTL 1AGCA 1VA9A 4LFHG 4NOBA 1HQRA 1NLBL 2VN7A 4YXLL 4NZUL 1FNSL 4EUPA 5D6DA 1E27B 3FONA 3H9SB 1D5XA 2V7NA 2VKXA 4WJ5A 2PTUA 3KG5A 3BFOA 3QDGD 1UXWB 4DKAA 4Z78B 1F13A 1YUHB 3PWNB 3H7BA 3GHEL 1N0XH 5L0QC 2Q76A 3IJHB 1FH5H 1FIGH 2KPNA 2FWOA 1YPZF 2AEQL 3ULSA 1V3KA 2RQ8A 2ZUYA 1CK0L 3UC0H 3PV6A 4L8SB 4KQ4L 4PPTA 3LQZB 4AEHH 1BZ9A 2IAMA 2MQCA 4BK4A 3RPIB 4PRNA 2VXQH 2VTFA 4JQIH 4YFLF 5IESH 4X6BB 4G3YH 3I02B 3QPXL 4P9HC 2ITDB 4RFNC 4XNUL 2XA8H 4X4YA 4RAHA 5FKAB 2FGWH 5I16B 2DQHL 5D1ZB 1CE6A 3TBTA 1BJ1H 3P73A 4F7PA 3SGEH 5ACLA 2WWKT 1TZHB 3TVMC 3DOSA 1XGTA 4G8EB 5HGAA 5IW3A 1Y6MR 3SQBA 3VWKC 1K8IB 1MHCB 3FTGA 4N0RA 3KPRB 5DO2C 5T1DL 5DHVH 1MOEA 4Y4HB 1DP0A 4FQXA 4YDIL 3SY0B 4D0CA 1LEIB 1P6FA 1IEBB 4YHZH 2Y1VA 2Z8VC 4WENB 1D7FA 4XAWH 2Y36L 1JV5A 4LLVB 4V2BA 4WWID 3RJDA 4Y8AA 4K71C 1BLNB 3A6BH 1XCQB 2VXSH 5C0ND 1MFAH 2R23A 2QHRL 2ZP0T 3B4NA 4OLVH 3MJ9A 1KXVC 2OYPA 1LO4L 3L7FA 1NCTA 4UV4L 3VI3F 2IANE 3P9MB 3VFVA 4BSWB 2X4NA 2C3WA 3P2TA 4YFLI 4DJMA 1BIIB 1PLGH 1T66C 1GYAA 4HV8B 4I9WE 2FECL 4L4VE 4GSDL 3T3PE 3QXAB 2ICWB 5EORL 2D7MA 2BSRA 3VWJB 4XCFH 4OGYL 1KGCD 4QOKD 4TPRL 4XWOC 5C0RL 3BX7C 1DQLH 4KI5E 3RDTC 1F00I 1FDLH 4FFWC 1P4BH 1D6EB 2R9HC 5GS2D 3SDDA 4K94L 2Y5TA 1E6OL 3P77A 1QSFB 2X4TB 4HUMB 4S2SA 4DEPB 1RIVH 3L5WB 3SKUD 4QRRA 3VFPB 3EDJA 4JFFA 2EZ0D 4NKOB 2VAAB 4UDUA 3ZDXE 3PHOA 3VD9A 4GG6F 2PTVA 5E0QA 5IVNA 4Z0XB 3PABA 1UM5H 3WFCH 1I1AA 4WO4D 1S7RB 6FABL 1CTNA 3ZDYF 1PSKL 4NQXA 5EU6B 3C8HA 4V1DD 4NQDE 1NAMB 2C5DC 1Z9OA 1YEJL 4ORZC 1U8OA 4JHZA 3OG4B 2AXJA 3DMMB 3EO1A 1A2YA 5DJAB 5HYEA 4HBCL 2Q20A 3O8XC 5MI0B 3DX7A 5C70A 1ZKAA 4MQ7A 5CIPH 1I8IB 1SJXA 4KK5C 1VCAA 4LSVH 5TDOA 5IB5B 2KL6A 1MY7A 1J1PH 3KXFE 5DFVD 5GGVY 2D7PA 4I2XA 1I3VA 2H41A 4ACPA 2IQAA 4LLMB 1A6ZB 4QRPB 1PY4A 4L8SA 1G6VK 2WLZA 5EU3B 5TQ2H 2OBGA 5LBSH 3W5NA 3NFPB 2W60A 4R4BA 4LCIL 3HI5H 2DQGL 1NGZB 4JO2L 2YEZB 3W0WE 5EZLA 4X9GA 2PO6B 5E8EA 3BKYH 3T1FB 3KR3H 4O51B 5JA8B 4U0RB 3LKQB 3GM0A 2CLZA 5J11C 2V2TA 4NFBA 1OAQH 2QQNH 4ODVH 4A6YH 3P0VH 3FTGB 1MRCL 4I4WB 1D5IL 3OMZA 4LSUL 1P53A 2JCCB 2HLFD 2CQVA 4DCQB 1AD9A 2DQCL 1G7LB 4BELD 5I1KH 5D72H 5SX4H 1CU4L 3I6LD 3IKCA 3V0VB 3H9SA 4PP1D 3JTTB 1WZLA 3GSNL 2IH3B 5A1AA 4P5KB 2YZ1A 1WZ1L 1JNLH 5L7XL 4PRAB 3VJ6A 3S88L 5EU4B 2HN7A 4UI2A 1I1FA 3MBXL 2BOBB 5HI5D 2X9YA 5HHOE 1MELA 2VDNL 3S9DB 5BXFB 1ONQB 4K7PH 5AYUH 1S5IH 2AABH 1IAIM 4LCIH 3RUGF 5D93C 4P23A 3TNMB 5I1GL 3MRGA 1U8JB 4BSJA 5B4MD 3MUY1 3WUWA 2DJ4A 1D9KC 3QZWB 5FYKL 4JKPH 4N8VA 3S35L 3ULVE 1PDKA 4P4KA 5MENE 4GW4A 1S7VA 2IPTH 1I7TB 5EU5B 4Z7VF 3ROOA 2KBGA 2YD9A 5JLZA 4EBQH 5D2NA 1J86A 2KDGA 1U8PB 4PJGE 3MA7A 3WN5A 3BPCB 2BSSB 4FQ1H 3TO4D 1V7MH 1YEHH 5ALCH 4XP1H 4TUOA 2ATPA 3FOLA 5JW4N 2R0ZH 4HWBL 3LKPB 3TGXA 2H26B 2EEDA 4YDLC 3RIAK 3VXSD 1QO3A 2DQIH 3DMMC 4DTGH 4H5SA 4OIIH 4LAQL 4NQXB 4TTGA 1MQKH 4MAUL 1IGIH 3A6CH 4JG1L 5IWLA 4L4TB 4M6OH 1HHIB 1U3JA 2BXZA 5DUBB 4P2OD 2NY5C 3OGOE 4NCC2 1MCPH 1A7OH 3QFDB 1YNLH 1PGRB 3HMXH 2X4NB 3BZFA 4DKEL 2M2DA 4ONHB 4RQQA 2OTWB 1CTOA 1MI5B 3KPMB 1HCVA 4KKLD 5ALBL 4OZGE 3S4SB 4AT6A 4F7EB 2WBJD 5CBEB 5J9PA 5JPNB 3O2WL 4YAQB 2YD5A 3LB6C 5KSUB 4Z7QF 1FLRL 4PP1C 1GIGH 3OHXA 4HCRL 4LEOA 4XPHH 1FAIL 5GIRA 3WCYA 2YPKA 3R0NA 1OPGH 5D6DC 1M6OA 5E9DD 1YEGH 1KCLA 3WHXA 1QLEH 9CGTA 1JNNH 1RUMH 2ITCA 3UBXI 2Y36H 3QP3A 5MERB 4IJ3C 1NFDF 3FRUB 2AQ1A 1AXSB 2EYSB 1XGPA 2AV1A 4IRSC 4Z77B 1Y6NR 3SGJC 1LP9A 3K4AA 4TSAH 5H37G 4K2UH 3CPLB 4I3SH 4JHWL 5KANG 3GSVA 4G8GD 2H2PC 2A0LC 4Z95H 1OCWH 3LEYL 3LQZA 4MJ5B 2WBJC 4BJLA 4JN1H 5DS8A 1Q0XL 3C5JB 3EOAA 3QXVA 3TBWA 2B4CL 1T1XA 1T5XA 3AY4A 5E8NA 3MLUH 3ULVF 1BGXH 1H5BC 2ARWA 4MXVF 3MUJA 2CMRH 1X7QB 3GMRB 1NAMH 1DQJB 1IRAY 5E8DL 5F1KC 5HGAB 4YHOH 2QADB 3SJVD 1BGXL 4LNRB 1Z6JT 4PJ8C 1WISA 4MCYA 4Z7NE 2DI8A 2D0GA 4PJIF 3RKDD 5BVPL 5C2BH 5CINH 5JHDB 4G6AC 1NCAL 1YY9C 3CAFA 5MEOA 4HIIB 2Z8SA 2XQYK 3HHRB 3C60B 1T66D 3AVEA 1ZAGA 5INDA 1U8PA 4JEGB 3QXDB 4ALAH 3BPCA 5DVNA 4H26A 3L1OL 3FL7A 1JV5B 1UT9A 4R2GC 3RI5K 3FOLB 1Q9WB 5IBTH 2E8YA 5T5FL 1GVIA 3RX7A 4XVTL 2WWMD 1T1ZB 2DTSA 1DUYA 1LK2A 2YRLA 3GFUA 4BKLA 1OCWL 1NBVH 4L9LC 2YPLA 3MOBL 3SDDC 2XRAH 4I0PA 1EEYA 3RZWA 4Y8DC 1L9NA 5BMFL 4NIKB 3HAEB 1NCBH 1G9MH 3VFSB 1WCQA 5FGCE 5ICXA 3K80A 2MKWA 4NNXB 4PBVC 2FJGA 2DQJH 4Y5XB 3KJ6L 1EZVY 4P2CG 2DOCA 1J8HB 1T4KB 2X4QA 3QIBA 2E27L 3ELAT 4XPTL 4XXDA 5DF0A 1NUFA 2W65B 1D5BB 2CDGB 5FECA 3HUJF 3OPZL 1U8JA 3NVQA 3HLAA 4UTAH 1YNKH 1VKXB 4XNXH 2ZCKL 4GKSB 2AXGB 1FYTD 4IMLA 4HIEA 2VDML 4AY0A 3K74B 3BRFA 4X7TA 2X4OB 1S7RA 2BDNL 2X4RA 2JIXD 3IXAB 4M9PA 3U6RA 3QIUB 3UTTE 3VXME 5JXEC 1DLFH 2CDFB 1T04B 3ARBB 4LLYB 3WNLA 3S98A 1WAAE 5IOPA 1ADQL 2PW1A 4MD0B 1OD7A 3H3PL 5GGQL 2NYYD 2VR5A 4R4FH 1I9RL 1ZANL 2EIBA 4YDJA 1WBYB 4FMKA 3Q2CA 5FK9B 1AFVL 3TVMD 4G8GE 3HB3C 5J12B 3U30B 5AWNH 4K7PL 4PTTA 1MHPL 3HUJA 3L3IA 3T8XB 1LP9E 1OP5K 5C08A 5E08L 2GHWB 2Y06L 2YEZA 4Y7MA 2VXUL 2GEEA 3EDDA 4UT7H 4G6KL 1EHNA 1MFNA 4JFEE 1DL7L 5E2VH 4LL9A 3B9KA 3IAPA 2ADGB 5E4EB 4DN4H 3NZHH 3B5GA 2QADD 1X4ZA 4LGRB 3BMWA 3W5MA 3KPRD 3BISA 3SKMA 4MCYB 4DZBA 4WEBL 4Y4KC 1M6OB 1NCUA 1WSST 2BJML 5D2LE 4ZDHA 1G9NH 3IKCB 3FZUC 4LDOB 1OAQL 1N4XL 3VE0A 1NC2B 2ZOKB 3U4EB 1MJUH 5EIQA 2C4FU 3F12A 2JJTC 3MNVB 1ZOXA 4LVNC 1NCWH 3QDMB 1LP9B 3RNKA 3S7GA 5BW7A 3NAAH 1WIUA 2H32H 2F8VA 5I6XB 2P46B 3I75A 3QDJD 3IFLL 4KROB 3VXUE 4P5MB 1QR1A 4HHAB 5DD0H 2HP4A 2F54A 3F6LA