4FQJL

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
215
Chain Sequence
b'QSVLTQPPSASGTPGQRVTISCSGSSSNIGTNYVYWYQQFPGTAPKLLIYRSYQRPSGVPDRFSGSKSGSSASLAISGLQSEDEADYYCATWDDSLDGWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/immune system
total genus 38
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjL01
4F57L 4R8WL 5IHZB 1KIQB 4NPYA 1CGTA 4JQIL 3IDGB 1P69B 1KCVL 2BC4A 1V7ML 1F3JA 5IBUG 1OTSD 4ZTOL 4ZFOB 3S35H 3ZMRA 2HT4D 4ZFOL 3RWEA 3TT1L 4I4WA 3VXTA 4Z9KB 4L3CB 5E6IB 2BY3A 3X11B 3L1OL 2JJSC 4XB8A 3V0VA 4L4TE 5D9SA 4YDJA 4GG6A 1NAMB 1P7KA 3KNBA 1JRHI 4LLVB 1KIUA 2YPLD 3K81A 1TQBB 1CD0A 4WEUD 1NAML 1J18A 4PB0L 5SX4H 4AEEA 3RRQA 1CTNA 4IRJB 2HRLA 3H0TB 4JFHE 1WC7B 4NYLA 1FVDA 1RUKL 1KT2A 2D7OA 4PJGB 5E95B 3WIFA 4IJ3B 3BO8A 1KCUH 1RUML 4X0KA 4I5BB 3NZ8B 1A3QA 1IQDA 2VZUA 3BP4A 1P4IL 1OCWL 3Q5OA 4HX1B 3KXFB 2HTKC 4BZYA 4OKVB 2EEBA 3QWQB 1RUQH 1Z6JT 2VDNH 1KJ2B 4LVOC 3CXDH 1KJ2L 1T5WB 5A3IC 1WVZA 3VRIB 4FABH 4QRRD 4KK8D 1BJ1J 3NIGE 1JUFB 4X7SL 1UZ6F 2W1NA 2H2PC 4JO2L 4Q9RH 3K4ZA 3EJJX 1DDHA 3GSWB 2XT1B 4PJHE 1GL4B 3PDDA 3ME0A 2QR0A 4R6UA 5E1AB 1M05B 1EIBA 2FWOB 1T2XA 4O4YL 4CBPA 2Q8BL 2JLLA 5DGQA 2B20A 3MJGX 3FB5B 4HUWB 5KANI 1I1AB 5L9DL 3MLRL 5I1CH 1MCQA 1CLYL 1RZFL 4K7FB 4PJAE 3RU8H 1CICB 4ZAKD 4XI5C 2OXHA 4DGIL 3C5ZD 4LAQL 4XCNB 1UWXK 4U1LA 3BE1L 1KPVA 3U46B 1S9YB 1LO5B 3BYTA 3MJ6A 5C70A 1NCDH 2A73B 3C2AH 3OKLA 4RAUA 5KTEL 2J8UB 1T5XB 1FLRL 2AK4E 4NP4L 4NZRH 3QEQE 5FYLH 3BGMB 1SJEB 3IF1B 4R26L 1QEWA 4EVNB 1EAPB 3PWJB 2DWDB 3P2TA 3S35X 3NCJL 3V8OA 2EXYD 4QF1B 3I2CL 5GS0H 1AXSA 1L7TH 1Q9KA 4P3DB 1CU4H 4G6KL 1N6VA 1U8JB 3BSZL 4PRBB 3KPPB 3MJ8A 4OUOA 43C9B 4PRHE 2X1PA 1NGYB 4JJ5A 5CHNB 1W2KT 3QRGH 1N8ZA 1DBKH 4EI5B 3SJVE 3S34L 1IT9H 2V2TB 5BS0E 4HKBB 4WUUE 1IGIH 3NFNB 2QSCL 3SO5A 4LKXB 4P5TB 1PQZA 2VNCA 4NN7C 3P30H 4WWID 3MBED 3V4VL 3GI9H 2QTEA 3FKUS 4NKOA 4K8RL 3DX9B 4P9HL 4GRLB 2FX9H 5CD5C 3QUZA 2YD5A 4IRJD 4OCSH 4RMTA 3HPJB 2IFGA 4GBXA 2VIRB 2XTJD 2NYYC 3WO4B 4JR9L 4PGCB 2MCPH 2IANA 1XGRA 3RDTB 4KMQA 8FABB 3QQ4A 5I73B 2Z31A 5DD6B 5AG8A 5INCA 3RX5A 5C7XL 4OCXH 1BQHA 4Y4KA 4J6RL 1T21A 4M9OA 4KAQH 1LO0L 2WIIA 5C0AB 3FQWB 1QA9A 4D2NA 1AJ7L 2J8OA 3RWJB 4LSQH 3SGDI 1U2CA 2Z8VC 1IMHC 5I1IH 4KI5C 1AO7E 2AABL 4KKCD 1DEDA 2WWKO 2CUMA 3QJHB 1HKLH 2YPKA 2Q8AH 1PLGL 1QKZH 1KNOB 3JSSA 3DSFL 1BD2B 2XA8H 1SMOA 3QUZC 4XPGH 4KK5D 4OLXL 4LARL 3I75A 4GBXC 3MO1A 4X83A 3VXMA 1C1EH 4YPGB 1AFVH 3TNMA 1C08B 5C6WH 5BXFA 2GY7B 4YHIB 4QRPE 4L1HA 4LSSL 1GCFA 2Z31C 5TDPB 3IDIA 1HK6A 5BZDA 3LQAC 4NO0B 4Y4KC 4KKBC 1DUYA 4OD1H 4R4FL 4I3SH 4M5YL 2Z4QA 3FHQA 4NO2A 3WEXB 1N7ML 4U3CA 4PB9L 1X5ZA 4FFYL 1YEKH 3MJ7A 3TC9A 3UTTE 4BSVA 3G5ZA 5HYFA 1YNLH 1U8KA 1I1AD 2DB8A 4GW4A 2KPNA 4S1RL 2XICA 4U1HA 1I3GH 1CICD 3RWCB 3D2UD 1BFVL 3SDXB 4LSRH 2DLEA 1MLBA 4AQ1B 1JFQH 2CLZA 3TN0B 1J0HA 5EO1B 2FATH 2W0FB 5IR1A 1KEMH 3D3VE 2NZ9D 4W4OA 5I19H 2XY2A 3VG0L 2P5WA 3ARZA 5JOEA 5EFIB 5KVEL 2VXTL 1TVHA 2WSKA 4I13B 4EJ1C 4JPVL 1DBAL 3PABB 4XPHH 1YC8A 4RISL 3F7PC 3V6FA 3S4SG 3MRNB 4KHTH 2DD8H 4OCYL 5K59F 3BH8A 4WTZG 1A5FL 3RVUC 5KVMC 4DK6A 1DUZB 4RIRA 1YY9C 3CCHA 2LV4A 4XXCA 3E8UL 4GKNA 1F4WL 1Q9OA 1S9XB 2DLFH 3CH1A 2X4UA 1S7XA 4JFFB 4MD0B 1KPUB 3X3GH 3SDCD 3DO3A 5DQ9A 5KSVA 3GMNB 4MJ6B 4Q97A 2J6EL 2IC2A 2JTDA 4W4OC 5IIEB 2CLRB 2EDNA 4D0CB 4K8RD 2DKMA 5EU5A 3C8DA 2IQ9H 4DOHB 1Q1JH 1PX4A 1JHKL 1UADC 4PIRF 1SEQH 5D8JH 4Z95L 5I0DA 4CVXB 1OGAB 4FMKA 1NC2A 1UB5A 4M1DH 4WY7H 3VXUA 2A2QT 3O2VH 3I6GA 2VQUA 3FOMB 5EOQH 1VEMA 1GC1L 2GTZB 1CQKA 4XXCC 2R2BA 3F7QA 4ONGL 5T1MA 1Y6MR 4UT9H 1BP3B 5ICXB 4F8TA 4ONHB 1ETZB 2CUHA 4Z7VE 3NOIA 2FB4H 5CJQH 4NN5C 2YRZA 1K6QL 4Y16D 3IU3A 2QLVB 1TVBB 3PDGA 4B7IA 4ZOCA 5DJCA 4P4KB 4P57A 3U0TB 2JK5B 3BHBA 3V52H 1VADB 1JPSH 4OUUB 3ZKMC 2NY0C 2FECL 3MUY1 5FOBB 3OKOB 1UEMA 4HGWA 1JZ8A 1H3VA 4N90E 3VWKA 3QNXB 3W5NA 4NDMB 1BD2D 2CO6B 3KPRB 2HT3C 2JB6A 3UTSA 1HOCB 1AE6H 3CX5K 1MREL 4NJAL 2BP3A 3RA7L 4DN3L 4P2RE 3STLA 2VXUL 4XXDA 2YS4A 2V2XB 4KRMB 2IH3A 1U3HB 5JORA 2E7HA 2F15A 3HPLB 1NGXA 4L29B 1U8NB 5J06A 1EV2E 2CDEA 1XIWA 3QJFA 3D69A 1HINH 2VR9A 4X7DC 2BJMH 3CVHH 2R8SL 3AXLA 1EO7A 1K4DB 5JPNB 1FSKB 4X9GA 2B1AH 2IBBA 4OJFH 1D6VH 3F7VA 1T7WA 3HNTL 4MZ2A 5EBWB 2C3VB 2XG5A 4S1QH 5I16B 2ZUWA 3VWKC 5JTWA 1ZHLA 4FFZL 4R96B 5E8DH 1JPTH 1CFVL 3IFOB 1U36A 3L7FA 3TJEH 1AGEA 4JO4H 4O02H 5ILTL 2CDFA 3F6IA 1TQCB 2MOVA 4BK4A 3RGHA 1HEZA 2C4XA 3BP7B 3OKMA 1AGCA 1TVDA 4OI8A 1VGEH 2XRAH 3T4AB 1FDLL 3WHXB 2IALB 2X4PB 1XIWC 3S8WA 1BF8A 4FQCL 4G42B 3IDJB 4PJ5E 1RMFL 3RWIA 4U2YA 1WIOA 4OD3L 5I18H 4YFLI 1U6AL 2FX8H 4R3SA 3MODL 3GKWH 5FA3A 3GBNL 5DMIL 4BA8A 2C1PA 5LAXB 4BFEA 4YWGL 1OTTD 5IOPB 3EYOB 3DVGA 3O11B 3VGFA 1XR8A 4QXGL 3MLTB 1R3IL 2GIYA 1R3LA 3MCKB 4K2UL 2AVGA 15C8H 4M62L 1Z2KA 4Y5YB 1T1YA 3WNLA 4JCMA 5IROA 4CNIB 4JPIB 3EOTL 5DMYA 1A14H 4N8CH 1HCFX 3C5SB 4MJIA 5DD3L 4L3EE 1AH1A 4POZD 4PBXA 1X5IA 3FB8A 3QNYB 1CR9H 1J1PH 4ONFH 3U2SA 3RJQB 3ZDYF 1JWMA 2GTWB 2VAAB 1JNJA 1CFQA 5I76B 5BCAA 2CRIA 2NTFB 2D7TL 2G9HB 1N2RB 3CDGA 1F4XH 3FQNA 1J87A 1QFOA 2Y23A 2X05A 3V5DA 5MEQB 3VFNB 2V5YA 3FB7A 1T1ZA 3ILQC 4KJQD 3RKPA 5GJTL 3CLEH 1A7QH 5IK3A 2R2HB 4P2QD 1Q72H 3EOBA 1GZQB 1TTUA 4WW2F 4UQ2A 1KGCD 5TPWH 3FQTA 3HR6A 5KOVC 5DJ0A 3MV7D 5IROC 4EUPA 1C12A 5D7IB 5BO1L 1NAKH 3DUSA 4ELMF 4P9MH 3OKKA 3QUMB 3QXAA 5EUOA 3I3EA 2J4WH 4HEPG 3O6LH 2APTA 4NIKB 4OBSA 1IAIL 2XTJC 3QZWB 1IKNA 1SY6H 3P73A 4PUBH 1CLOL 1FZMB 4TOYL 5C0GB 3MSPA 4HMDA 3QP3A 4I77H 1C5CL 1Q94A 5M95B 1EMTH 5IW6A 2XZCL 2GW5A 1IAOA 4RAVB 2HTLC 4O00A 5KN5A 2AXFB 3J8F7 1YC7A 2JF1A 3HE7A 3AS1A 5F88A 4Z8FL 4JHWH 3NAAH 1I9JH 5KW9L 4M1GL 3MPCA 3BW9A 2AEWA 4M7JL 1E4XL 1HH6B 3BUYA 3D2UA 2WP3T 1BBDH 5F3BB 1FNLA 4GJTB 4HBCH 1BEYL 3NFSL 4KK5C 5HJ3B 4QTIL 4H26A 3JVGA 5HYJA 5HSFA 4F2MA 1ACYH 5DEFA 3RZWA 1IKNC 3ZL4L 5DZOA 4L4JA 4MAUL 4LNRA 1RZGB 2YD9A 2HWZL 3BKML 4PJGF 1D9KB 3VGGA 1E6OH 3WKMH 4UV7L 1CG9A 1H3PH 4XWOC 4KQ3L 3T77B 3HE7C 4RMRA 3E2HB 5SWZE 4U1NA 2AV1B 4JO1H 4ODBD 1KXQE 3OAZH 2P8PB 3E6HB 4WFHD 5EIQA 1IJ9A 1F3RB 2MFNA 2F54A 5DHXB 4JFED 3K1DA 5T1KD 5EC2B 3D6GA 2DJ4A 5J0BA 1F90H 5IEKB 3CMOH 3SDCA 1UM4L 3DGCR 1L9NA 3JVGC 4PJ9A 4LCWB 3QUXB 5IT2L 4NJ9L 3WLWC 3A67H 2X1QA 4LHUA 2LABA 5CD3A 5HDBF 3FT3B 2HG5A 1DN0B 1OPGH 1R5IB 4X99A 3L95A 3V95A 2CJUL 1AR1C 5HI4C 3FO2B 3K80A 1DQJA 4AL8L 2EH7H 3CX5J 2GI7A 3HS0A 4G8FA 2XFXA 3V0VB 5DC9B 3SE9L 4ZS7L 4OFPA 1G7MB 1YMMA 1RZ7H 1BZ7B 3LS5H 4U6VH 4FG6C 2ZOKA 1JHLL 3T2QA 2ADJA 2ITDA 3SDCC 4O2CB 4M8QB 43CAB 1RD6A 4JHAH 1PSKH 1FORH 4Y16A 4PJ9C 3TYGL 1URLA 5HDLA 2FEDC 4MSWB 1S7UA 4E5XA 5CUSH 3EYVB 3N50A 5KAQG 3TESA 4NRXA 1R3KB 1SJHB 4GAGH 2RHEA 2J8UF 2FD6H 3SKOB 2FSEB 2E27H 5FCUH 1FC2D 5ITBL 3WS6A 2D31A 3OF6D 3K74B 1EEZB 5FDWB 5E7BA 1IBGL 4K9EL 4KZDH 1P4LA 1VACA 4M7LH 3UYOD 4OFYA 5D6CB 2Q76A 1A1OA 4MQTB 4Y16C 2ZP0T 2A6JA 4OQ1A 3DPBA 2LU4A 4XMPH 1K8IB 4XNYL 2D7QA 2LVEA 5EO0A 1MVUB 4RRPG 3WFBH 4L4VE 4LLWB 4OQTL 1DQTA 1CXEA 3UTQB 1Q38A 3RBGA 4L8BB 1IGJB 1PAMA 1UQSB 3B43A 2G5BB 1S7RB 4AYFA 2QHRL 3VW3H 2Z35A 4KVCH 5E9DB 3GHBH 1NGZB 3L3DB 4ZS6D 3RL2B 5HHXL 3RIAF 1EA9C 1A6ZB 1WJ3A 3H9SE 4GKZB 5JOPE 5DRNB 4PTTA 4WJ5A 1D9KD 4U4BA 2VE6B 4Y88A 1KIPB 3BZFB 4BSWB 4NKQB 2PW2A 1WEJH 1XF3B 4QOKA 1TPXB 3ZE0F 4ERSH 4OZFG 4NCC2 4JDVA 3BP5A 2NNAB 4GKOA 3UO1H 1EERB 3N9GH 3LMJH 1JV5B 4I48B 4WTWA 5IBTL 1MFBH 1NMAH 4LP4A 2FZ3B 1AQKL 1Z0NA 5GSVB 4EBQL 1OY3B 4LCWD 3QUXD 2AEPH 2LE9A 3W82A 4WV1B 2AGJL 4ISVA 1F58H 1BVKB 3KPOB 3D25A 4M93C 4PFEA 3BPLB 3FMGH 4FNLL 1QNZL 1A7OL 1Q9LA 1CE6A 4XCYB 3TIDB 4GQ9L 5CS7A 4M6OL 4WUKH 3BPCB 1EHLL 1MFCH 5DJXB 1OWRM 2FYYA 1Y18B 1KXTB 5EC1A 3RY5A 5EO9A 2NY5L 3ARBD 4ODTH 3KVQA 5A2JH 4AEHH 3F7YA 1N5YL 1TETL 4WEMB 4PJIB 4G80B 3HRPA 3RWHA 3SE8L 1OAUL 4P2QA 1GRWA 4W70A 5IFHL 4GRWB 5TGBB 3MV7A 2HLFD 2F58L 3SDXF 1F4YH 4Y7MA 1JCKA 3B3IA 3SKNA 3VRJA 3RIFK 4TPRL 3JV4B 5TDOA 3UBXA 3B5HA 1NEZB 4HULB 4EN3A 2VDMH 5IQ9A 1OD9A 4MVBC 4JPKL 4HKJB 1A47A 3PHOA 3GBML 2NY4D 1AD9A 3BUTA 4ESKA 2D0GA 3IJYB 4YDKL 5I8EB 3U9PH 4Z7UE 1T6VN 4QNPF 1EXUA 2G75B 2VDRH 3DIFA 5FGCB 4LU5H 5CJXA 1JI2A 5DFVD 3I3DA 1FL5B 4KJQC 2GSGB 5CCKH 3VXMB 1I9RH 1BOGB 2OL3H 5EORL 5A16A 1BVLB 2GCYA 2NW3B 3G6JB 3OXRA 3T0EA 3V0WH 1DFBL 5I17A 1KG0A 5DEGA 5FYKL 3ALPA 1ZSDB 4K23H 2Q86B 2XIDA 5IB4A 4EN3C 1UT9A 2BNQB 2JJWA 5EZLB 1C8PA 2MNUA 2HMIC 3VFOB 4JVUA 4JFDE 4S0SD 1KCRL 4H8WH 4Y0GA 4QT5A 2UWEA 2NX5A 2WP3O 1OAYL 2HVJA 4DTGL 4PV9A 5ANMA 3SGJA 3MA7B 5E9DD 2JCCA 1HHHB 1KTKE 2YA1A 1AQDB 2AXGA 3O0RL 1ORQA 1WISA 5CJXC 2ESVE 5IGXL 2W59A 1OP5H 3MLWL 3S88L 2RB8A 5J9PA 4BQCA 2ARJA 3TZVB 3T0EC 5AD0A 2ZJSL 4H88H 2XWBB 3BGFB 5EOCJ 4X98B 3ARED 2M1KA 3A6CL 5ADOH 4JFEA 5T1KA 2JJTA 2ICES 3DYPA 1I3UA 4OFIA 1G0DA 3L3KA 1J8HA 1YQVH 5E94A 3T8XA 2R9HC 5HGGS 3T2OA 2DQUH 1XT5A 1HILB 1NANH 5DHYA 1JMZA 3M8OH 4UAOC 2OZ4A 4X4ME 5CZKA 2ZCHH 5E5UB 1QSEB 2VLLA 3SGJC 5T3XE 2W9DH 3CK0L 2R1XB 2HVKA 3DX6A 3ECBA 1NSNH 3QIBB 5ESAB 5HDBE 4HFWA 1MUJB 3C09B 3RNKA 2YK1H 4I18B 1S8DA 1CDGA 1OTUC 3VD5A 5B38G 1OB1A 4JN1L 1QZ1A 3QDJD 3VRLF 2JJTC 1T04A 2B1HL 1FFOB 4G3YL 2KDGA 2DIBA 4O58L 3W0WE 5JZ7D 4PRIB 2ZSWB 1B2WH 1GGCL 3WNPA 3LKRA 4KUZH 1CF8L 3WXVL 4S1SH 2R2BB 4K3GA 1TCMA 3MBXL 2I9TA 4IOFD 5DC4B 1LILA 4G7YH 5D72L 4YHZH 1KN4L 2IFFL 1A22B 3HI5L 4JRYE 3ORJA 4DQOH 5DMGD 3M17A 3EZ8A 4NT6B 3MRIA 5L88L 2ZOLA 2EDQA 5IEHA 3OF6A 5IB1A 4D9LL 2J8UE 2DQEL 1QVOA 3C6SA 4KRPB 4MJ4A 5DVMA 1OSZB 2HT2C 5JIHA 1CLZL 1U41A 3O6MH 2RFXB 1QYGH 4BZ2L 4YFDB 5GZOD 1R5WA 4PY7A 1K4CA 5I8OL 4XVTH 1ZT1A 4XTRD 2VXVL 4KHXL 3P11H 2EC9T 5FYKD 1X3DA 4PJDA 3U1SL 2BNRB 4P59L 2CRZA 3VFTB 4I9WE 4X7FC 5FUZH 2HJLA 3VJ6B 4NZDA 1RVFH 3H7LA 2BNQD 1M6OA 3GMMA 3PE9A 4IMLA 4UNTA 5CIPA 1JF6A 1QLRA 2AI0L 2WZPD 4HUVA 1UC6A 5F96H 5H8DA 2A1WH 3GK8H 4NN6C 3SY0A 2Y25A 3ULUE 3VI3E 3QQ9D 1A6UH 3HC3H 2AJUL 2CIKB 3EGSB 3U0WH 1UYWH 4X4YA 4MA3A 4X4XB 3SKJH 3S96B 3BH9A 4Z76B 5GPRA 4JREC 5INDA 4R90H 5F6IC 3TZVD 5DR5H 3VXSB 3MFFB 1JNLL 3K1KC 1BFTA 3VMOA 4U1GC 4CMMB 2J2ZA 5HY9A 1LD9A 1RJYB 3GJFB 5GGTH 2DMKA 2DIAA 3O2DA 1DANT 5TE7H 2E6PA 4GAJH 1ULVA 1IGMH 4LSDA 2VUOA 4ZUSA 2P7TA 1WV7T 3IS1X 3B6SA 4FXGB 3VXPA 1C16B 5D7IF 3EYSL 1J10A 2HH0H 3PHQB 4XBGB 4LQFH 4G5ZL 4R7DA 3VXRD 5BOZG 1BECA 2XV6B 1D7FA 1F2QA 4ZS6C 2A6KA 3TBWA 1D5MB 1F11B 4U1MA 1AXTL 2VABA 3F5WA 2NW2B 3UYRH 1ZLSH 1FG2B 2DL2A 4QRSB 1JK8A 4BFIB 4M3KB 3I6LD 4YEEA 3QIBD 1DJSA 3C2SA 2APWA 3ARBA 4ZOAA 3ARPA 4OM1L 4U6TA 2X9YA 3C6LB 4H1LH 3FN0L 4GW1B 4BK5A 1F97A 1UEYA 1XGQA 3U2SB 4HJGA 4XP1H 4M7KH 3E6FA 4QRQB 3EJYD 3HNSH 2R0LH 1ZLVK 3GNMH 5JNYB 3NPSB 1RIVH 4Z7WE 3L5XH 4AZ8A 2J1KA 2BOBA 3DI2B 1UM5H 3TT3L 4GKSB 5CZXD 2B4CH 2FDBP 4HWBL 3WDIA 4JQXA 2HKHH 1AGFB 1JIBA 3IDMA 5L8JB 4K94C 3FFCB 5JXAL 2HP4A 3MC0A 2UUDH 3KGRA 1F3DJ 1YN7A 3QG7H 5D7SH 3OKKB 4ETYA 4HWZA 4JKPL 3PWLA 1U8MB 4GXVH 4IDJL 4KFZC 4MNGB 3GO1H 2MHAA 4NQCB 4QCIA 4H5SA 3KLHC 1O0VA 3IXAB 3MLXH 1BBJB 1KTLB 2HFEA 2Z91B 5ICZB 1ROWA 1FNHA 1A1MB 1WAAA 4HS8H 5IFAL 2EDRA 5K9QI 2BNRD 4IBLT 4NKIH 4DZ8B 4JQXC 4EI6A 1LP9B 4RDQF 1IKFH 4ODHH 2EC9U 3V5HB 2R15A 4OLYL 5HGDA 2AJZB 1IGFH 4J3OC 1KCSL 3BIBX 1QFPA 2XI9A 2EDJA 1QFWM 4UOW1 1DBMH 4GS7C 3JBG7 2E7BA 5HHQB 3NBNA 3AC0A 5HYJB 4N8VA 5KZCB 4JG1H 3WIHL 3IT8D 2Y6SC 5E2TL 3QPQD 5D7KE 4KK9C 2VWEE 3AREA 1UXWA 5T3XH 4MMZC 2EEAA 2FECI 2ENYA 1UB6A 2VZSA 6FABH 3UJJH 5AUMB 1HYSD 3PWUB 4ZMAT 5BOPA 5ADPL 1R0AL 4H1LG 4C56E 4OFVA 1A7PH 2P47B 1WBZA 4LCUB 1HXYB 2YSSA 5HYEA 1BHGA 5ISZD 1DANU 2FJFA 3DNKA 1PG7H 4CADB 1H5BB 3ETBF 5SWQB 3WFHA 1RZKH 5I1EH 2JKXA 1RUAL 1FAKT 5DA4A 1FVCA 5EU6A 4JKKA 4BELD 1AGDA 3AB0C 4XP4H 4N0YL 3P4MA 3IFLL 2E3VA 3QO1B 3MRHB 2AK1H 5J1TC 5J1AA 3MRMA 4HUKB 1HZHL 3TBTB 3AMLA 4BQ9A 4KPHH 5EBLB 1CE1L 3AREC 3C08L 3C6LD 5ALCH 2VDKH 3OR7A 3QDJA 4AIZB 4X99B 1YN6A 2OI9C 3VFWB 2D03L 3DETC 1VKXA 5FHBL 4GUPB 4K3DH 5ID1B 2H3NA 4QWWD 1MCWM 4KU1A 1BLNB 1M7DB 5FAAA 1W0WA 4GMSL 4PJEB 2ZCKL 1UWXH 1R3HB 3BKJL 3VFSB 5JHDB 3TGXA 4NCDA 3O2WH 1XR9A 2AJXL 4OGZA 2UY7A 1DQDH 3FFCD 5TE4H 1JF1B 2BFVL 4ZPVB 2F5AH 5KS9B 3KPNB 2R0KH 2J88H 4IIQA 5JR1L 5KSBA 3BMWA 2NY3B 3P0YL 4MNHA 5KG9A 1AY1L 4D9QD 3VI4F 4XP6H 3UMTA 2F53E 4MB3A 4QXWA 1KC5H 3CAFA 3RWFA 4NQCD 4WEBH 5HYIA 5EIIA 4XP9H 2P24A 4QYOA 1DQML 4CW1A 1QOKA 1G84A 1QSFA 1PKOA 5HHNA 1A02N 1E6JH 4PGDB 2X7LA 5GZND 3VH8B 3L3JB 4YDLB 5IG7A 3QHFL 3ULUH 4PJ7A 3MLYL 1P1ZB 1BAFH 2HFGL 4U1IB 2H9GA 2DM7A 1RZIB 3CFBB 5I74C 4M43L 1A2YA 5H35B 3LHPH 3I50H 1Z9OA 1OAKH 4PRAB 3G6DL 4OTXH 2WUBH 3CH8A 2ADFL 4HPOL 4ORGB 1JWUB 1FRGH 2BVPA 4LLYB 1ES0B 2WBWB 3DV4B 4IIQC 4FTVE 5CP3H 3FQXA 3S37H 3MRBB 1T0NB 1FP5A 5AWNL 1WIUA 4D0DB 5B39A 2H6PA 3G04B 3NIDF 3UTPE 2N1KA 4CKVX 4HMCA 4XTRC 2P46B 3P4NB 1IM3A 3PDOA 4TVPE 5KZCD 4F7TB 5DWUL 3TBVA 2CXGA 2NTSP 4PJIF 4OGXH 2V17H 5CMAB 4YHNA 3U82B 4WI7A 3CVHA 4BH7B 4AT6B 5IESL 1NGWA 3QB7C 4GRWF 4UDTB 2X4RB 4I2XB 3JTSA 3H8NA 4Y19E 4AG4H 1IAII 3REVA 3SDYH 3RTQB 2AW2A 4PJCB 3GJEA 4F9LA 2AEQH 4U7MA 4POYA 3VXRA 5JQ6L 1ONQB 2I9LA 1EHXA 3I02A 1AIFA 4N9GB 4TUOA 4Q9CA 5HVHB 4FQ1L 3S36H 2VKWA 5GHWL 3QNZB 1U93B 4PS4H 4YUEH 3KPSA 9CGTA 3P77B 1H8OA 1EUTA 4M3JA 4HFUL 3QH3B 1L0YA 1CGSH 2X4TA 1FNSL 3RIFF 1JRHH 4QXUH 1F8TL 4UT7H 2H32A 4HUNB 4MQ7B 2BNUA 3BAEH 1WITA 3VD7A 3HNVH 1E4XI 4HXAH 4LEXH 3U7YL 3AU1A 4XH2B 4NZUH 3WV0A 4UINL 3G6JF 3I3BA 4P4RA 2AXHA 4XMKH 2FHBA 4XVUD 4NQED 3CLFH 4F9LC 4CVZA 4LSVH 4CJ0A 1HSBB 3W9DB 1T89A 4PJXB 2NY1B 4G8IB 2Z92B 5HHVL 5JHDD 4NQXB 2DQJL 2BVOB 1O5DT 4QHMB 1NDGB 4S1DC 3LKQA 5DJDB 4HIIB 1WFUA 4R4BA 4NKMB 3M1BA 3UJIH 3DSNA 3FONB 1K8DB 1LE5A 4OZ4B 3VRJB 3JWOH 3QXVA 3U6RA 1IE5A 5FGSA 1VGKA 2NY3D 3SQOH 3T1FB 2FBOJ 4OIBA 3MGOA 4E42B 1UM6L 3X12A 1G7IA 5IVXE 1I9EA 2WM0A 4JFPB 3EJYC 1CFNB 3KLDA 4NNPL 3RQ3A 4LLMB 4JFQA 2HN7A 1NFDE 4ORZC 2E9JA 4YEFA 4WU5B 2VYRE 4MHHG 5HVWA 4B50A 1NCCH 3QA3A 5D2LE 1B4RA 3S37X 1CDYA 4RAHA 1T89C 2XN9B 4Y2DA 4RGNB 1JTTA 5JPMA 4HJJL 2DDQH 3OMZA 5GJSH 4XBEH 3GSOB 3FQUB 4KY1H 1WFTA 4JZNA 2YMXL 5EZIL 5F8QC 4LRNH 3FQRB 3MJ9H 1MAJA 3N1QC 4GFTB 1XFPA 1SVZA 1ZS8A 3KG5A 2VQ1A 3PWNB 4MS8D 3LKNB 5DT1L 1IFHL 5ERWB 32C2A 4F9PA 1JPFA 5KVGH 4UUJB 3H3PH 4NHCH 3HRZB 2K7QA 3L6FA 2BERA 2W9EL 4GG6E 1ZGLB 1NJ9A 3L3HA 3QFDA 1XF5B 3S36X 4YXHH 1EBPA 1X4XA 3X3FL 4Y2DC 1ZWIB 3KLAB 3QI9B 1CDBA 3U7WL 4Q2ZA 1NCBH 4JFYB 1UVQB 2P5ED 4DFIA 1JNHA 3NH7H 3RTQD 5AD0B 2X4SA 5JLZB 3LQZB 2EXWD 5ISZA 2EEDA 1VHPA 2E9BA 3SHSA 2N7BA 3T3PF 1EDQA 1BF2A 4HZLB 4XP5L 5E2JA 2VZVA 1IC1A 1OQXA 3RVWD 1G7QA 4F9PC 4JB9L 1KLGB 1HH9A 1T4KB 1HSAA 4GT7A 2AJVH 1G9EA 4FQLL 1I75A 3VXQA 3PIQA 2P8LB 4OAWB 2VLLB 4QRUA 4OM0L 5L2KB 1T1XA 3O9WA 4C58B 1QR1B 5HI3C 4XNUH 3SQBA 4TNWF 2EZ0D 4WDIB 4HPYH 3QCTL 4XHJD 5DK2A 5DMKA 4FZEH 3HG1B 3LKPB 2VLKB 3QWRD 1B0WA 2K1MA 1PYWB 4GO6B 1D5XA 2A9NH 5A2FA 1DP0A 2X89D 2XPGA 3JV6A 4FP8L 4XCEA 5JW4M 2DBJA 2FX7L 2R0ZH 4E0RA 3FT2A 2NY1D 3SGDH 4PJ8B 1YUHB 1QTYT 4E41B 3O3AB 2X70B 4HQQH 1G7LB 4WHYH 4J1UA 2GK0A 3WD5H 3EBAA 5FM8A 3S35L 1MFAL 3BWAB 3KDMB 2ICWB 5EU7C 4C4KT 4Z5RA 3O9WC 2YRPA 3RVXC 3DTXB 1IZJA 1ZLWH 2MQCA 4I0PB 2YEZA 1WK0A 4WHCA 3NA9H 4XWGH 5A43C 1OM3H 1YEGH 4UDUB 4WFFE 1F4HA 4N5UA 1YPZA 4WW1A 4AMKL 1KB5B 3GRWH 1JTPA 3HA0A 1KB5L 3BEVB 2XN9D 1J1OH 2VDQH 1A7NH 2GEEA 1DE4B 4U05A 4P23B 3MV01 3AS2A 2P45B 1BX2B 1SVCP 1KCUL 3V4UH 1Z3GH 4TVPH 5JW5A 1QFWH 1V3LA 1ZT4A 3JWDH 5DZNA 4EDXB 5HHPA 3N1FC 5MHSE 3MRDB 1DQLH 1U8QB 4QGYA 1CFSA 3TO4A 1D5IL 1SJVA 1HXMA 3GMMB 1R3JB 4LPWA 1RUQL 4KJPC 4HUUB 4UILH 2KL6A 2VDNL 1FCCA 3DVNB 2PYED 4RNRB 3DXAB 2NMSA 3WIHA 4ZXBD 2A74A 3KYNB 4Y4HD 4ODVH 4FABL 4KI5E 3QDGA 2X1WL 1WZ1H 1RJZB 4MZ3A 2XNAB 1KENL 1G7JA 4LF3A 5C0BB 3SGEH 1GGBH 4Q9RL 2YR3A 2PETA 1ZA6B 4UOJA 5IHUL 3RY6A 2P43B 1JGDB 4XVSH 5LCVH 1X4ZA 2IANE 1K5NB 5LBSH 4HF5L 1K2DB 1FJ1A 5IQ7H 4XNMA 3RX7A 5ENWB 3PGFL 1P2CA 4ZUSB 3TO4C 5I1DB 3BT2H 3EYQC 2EKSB 5GGSA 3O6KL 5HI5D 3RU8L 3FO1A 4RGMB 1GPOH 4U0RC 4LSPL 4DZBB 5BVPH 2P48B 3WJJA 1RK0A 3VGDA 3DYOA 2W65A 3FTGA 1NCDL 4G6MH 1JK8B 3CDYA 1FNEB 4X8JB 5C07A 3RY6C 1MHHB 1BIIB 5FYLL 4FQ2H 3VXME 1I8IA 4Q0XL 1DTUA 3HG1D 2WNGA 3SEPA 1INDH 5HPOA 2VLKD 4X6DA 2R56L 5DHVH 3GI8H 5BRZD 5F9AC 1LP9F 1JGLH 4LPUA 2O93L 4IS6A 3I84A 1L7TL 4HJGB 3T65A 3U7AA 1MCCA 3JWNC 1CU4L 5ESVA 5JO5A 5GS1A 4DGVH 1FFPA 4PJ8D 3BD5A 1L0XA 4OB5H 2DLGA 4XMLH 4E41D 2ZSVB 5IJVA 1UH4A 5F1IB 2OTUB 2AJ3A 1ZHNA 2KZWA 3QRGL 3WJJC 3ZTJG 3T2NL 3ULVD 5F7DB 1HHGA 5IV2B 3QCVL 1IT9L 2LU3A 5CGMA 4P46A 2VDPH 3GIZH 1IGIL 3S4SB 3P30L 1VFAB 4OZIB 1ZHBA 3IKCA 3OJVC 3GI9L 3U9UB 1BFSA 3K4AA 5B4MC 2P4AB 4UI2A 2FX9L 2P5WE 1YA5A 4TSAL 5JDSB 1IAKA 1YEDA 1Y6NR 2R23B 5GGQH 1LK2B 1I7TA 3B2UD 1PZUB 5SWSD 1I4FB 2X6MA 5BVJA 5IB3A 5GS1C 1KXVC 5ITFA 5TE6L 2DYPA 3CU1A 3ROLB 6CGTA 2F74A 1FIEA 2R4SL 3CD4A 2YUWA 5I9QB 4OCXL 3B9DA 4PV8B 5DUPH 3T09A 3GMLA 5CEZD 1QACA 1SEBA 3B5TA 3PP4H 3O45A 3QZWG 4P46C 4QHKI 1J0IA 4LSQL 3WN5B 1SM3H 5DI8A 1XGPB 1YNTA 1I8KB 4XAKE 2G2RB 5D96C 5I1IL 5DJAA 4F7PB 1NDMB 2HRPH 2AP2A 3IDNB 3DXAD 4J3VA 5LKNA 1HKLL 5DDHB 3OKNA 2Q87A 4A6YA 4OF8A 5EOCH 2AJSH 4NRYA 2YUZA 1YYMH 5C6TH 3ZE2E 2AV7B 3MFGB 4XPGL 1MH5A 1XGUA 4ZUTB 4P2OD 2NLJA 4BZ1H 5EOTB 1C1EL 2Q6WA 1AFVL 2Z8SA 3PF2A 2DQDH 4BM7A 2P5EA 1FVEB 3DVIA 5T33L 2WBJC 1OAQH 3VXUE 4PJEF 3UPRA 1QRNB 4OD1L 4RFNC 3ZE1F 2VISB 3WE6A 1PVHA 1UB6B 3ULSB 1NGPH 5HHOB 4I3SL 2M8XA 2Y5EA 2ZNWA 1ZVSB 4HKZA 1DQQB 4GRMA 4HCRA 3C9NA 1YEKL 1X6NA 2DLHA 3OAUL 4KJYA 4NKDA 1FH5L 5KS9F 3AVEA 1RULH 3CUPB 2XKNB 4QO1A 4N0RA 2OQJA 4Z7OE 4LSRL 5FIEA 2VQTA 5H2BB 2FATL 5DD1H 2PYFA 1KEML 1NCWH 1WTGT 1TDQA 5I19L 1TZHB 2KZ1B 3FOLA 4MDIA 4BKLA 3MNWA 5FYLD 3UTSE 4HIJA 2ADGB 3X13B 2YD3A 5FO7B 1NMCB 1IGYB 4TULH 1FGNL 1EBAA 4K7PY 2X89A 3ARDD 3OWEA 2AKRB 2H1PH 2DD8L 2XWTB 4JY6A 5TQ0H 1TENA 4YXLH 5IB2A 2ADIA 3RVWC 5D71L 4HUXA 4F8QA 1S7SA 4XPBL 4ENED 4G6JH 4U7KA 3VCLB 1PEZA 3P4OA 2GAZB 1L7IH 2DLFL 4OZGA 2DL9A 1DCLA 3HLAA 1FL3A 1ZKAA 3G5XA 3MXVH 5D5MA 2EZ0C 4Z77A 3GIVA 2X09A 1T1WB 4XHJC 1RIUL 3GFUA 2IAMA 2ICEB 3L7EA 3HE6B 1FZOB 4JHZA 1XF2A 2Y9RT 1Y6KR 4U1KA 5K9KB 1SEQL 5D8JL 5I75B 2VXSH 1RAMA 1DSFH 5SX5K 4P49A 4S11A 4M1DL 1I85A 4WY7L 3UAJD 3O2VL 1X5JA 5EOQL 3T04D 4PJCF 1U92A 5TF0A 4AEIH 4KXZI 1CXLA 5JIKA 3PWPA 1T20A 3TFKD 5FKPB 5C1MB 4UT9L 1EFXA 1YEIH 4KV5F 3MRCB 3D0VB 3GBLA 5JIIA 3R8QA 5CILH 5DQDH 4ZOEA 4PJHB 5D1ZA 4L5FH 2HLAB 3MROB 1A4JB 1JE6A 5D93C 2PYEA 1AD0B 5HVGB 3V52L 2IAMC 3RUGA 3U36B 1JPSL 4ZXBA 4Y4HA 4NGHH 4EIGB 1KJ3H 5DRWA 4JDTL 3UDWA 2VAJA 5CFHA 3RHWK 1LMKA 3LQAH 1A6VL 5ALBH 4UIMB 4MJIE 3U48A 2YPVH 3O3BB 3TH3T 4MD5A 3OHXA 3CVIH 4X8XA 1AE6L 1I85C 4PJAB 3ARXA 4JLRB 3MRQA 5E6YA 5J3HD 2VUYA 3TIEA 4MQXC 4F37F 3G6AB 3TBVB 4DKDC 1CQYA 5L7XH 1B4JH 4PJXF 2C3HA 1H15B 4YIQA 5HHOD 3RPIA 3HR5B 1D6EA 1J5OH 3QEQB 2BJML 2IG2H 4X6FA 3O81A 5D1ZC 2B0SH 4MX7B 1UZ8B 2B1AL 4OJFL 1D6VL 3K7UA 2GKIA 4OZHA 5IMOA 4ZXBC 4S1QL 4Y4HC 5T1LA 2WW8A 3HZVA 1DLFH 3UDWC 3JTTB 3W39B 5CJ8A 3TJEL 4JO4L 1SYVB 1MJ8H 3G5VA 4O02L 4PRHB 4JPWH 5H37G 1LO3H 5EUOE 3BZEB 2DTML 1G9NL 1JGUL 5HD8C 2R29H 2YWYA 5I30H 1UA6H 1R24B 2SEBB 4G8EB 4FZ8H 4MAYD 4YBHA 3SJVB 1U58B 5C0IA 1VGEL 2XRAL 4W4NA 3SDAD 4WUUB 2C4FT 5C09A 5CINH 2HJKA 5FEBA 3MRGB 3LD8B 4L4TD 5C0JB 1FBIH 5I18L 4P4RB 3QXUA 1F3DH 2DI9A 2OP4H 3BP6B 4OCWL 4WNQA 5FKAB 3VA6A 4N0UA 1QG3A 3QEHB 4JFHD 2WAHA 1KIRA 4QRTB 3MRRA 5DO2D 4OCRL 2DLTA 5B3NA 2WINB 4YBLC 1NMBL 2Y5TA 2APBA 3IVKB 1KJVB 2Q7NA 1C7SA 3PQYD 15C8L 3DV6A 4Z6AT 2L7UA 5FB8A 3IAQA 5HYJE 1A14L 3GSUB 4IRZL 3RZCA 4N8CL 3HE6D 1WZLA 2J5LC 4TQEL 3WMSA 2NXYD 4Q6IA 1QO3A 4IDLA 1CR9L 1J1PL 1NC4A 4M1CD 4ONFL 4LVHC 5SWSA 5CLWA 4X6CA 3WBDA 1AO7B 3LKSB 3O41B 4PPTA 4D3CH 1U42A 1F4XL 4IM8A 5DURB 5JW4N 5DRXB 1TJHH 1U8HB 3QULA 4XPAH 5EU4B 2HFTA 3IXTB 5TFSH 4O2FB 2XZAH 3ULVC 5E8PB 4O2EB 4NZTH 1SJXA 2F54E 4LFHG 2DBLH 4QRPB 5GGRB 1V3KA 2VLRD 4RMWA 3NGBB 5TPWL 2A9ML 2WK2A 3O4OC 3HUJA 3RZCC 1IL1B 1NAKL 3SKMB 3MMEB 4P9ML 4DGYH 4V1DA 1CT8A 3IAGC 3UTTB 3B2UC 3O6LL 4R4NC 4P2OA 2EIZA 3X14A 5IKCA 3K2MC 3MA9H 4F7CB 1SY6L 2CGRL 4PUBL 2VR5A 3H3BC 1CWVA 1DBBH 1I8LA 4XHQA 1FV1B 3TNNB 3BZ4A 3ZYZA 1X5LA 3TYFA 1ED3A 4I77L 4NSKB 3QQ3B 2B4CC 2VN4A 5D70L 2QHLA 1EMTL 1YMME 3BRGC 1YQ2A 4KJWC 2GJ6D 5L2JB 5JHLH 1N3NA 2AK4D 3Q5YA 4JHWL 3NAAL 5I1AB 4YHPA 1I9JL 3QEQD 4KKLD 4EXKA 5EN2B 3RVTC 5E03A 3P9LB 4TTDD 1WFNA 5GGUB 3TCLB 1BBDL 1XH3A 5BQ7A 4JFOA 2GY5A 3MYJB 1IGTB 4R2GC 4WFGE 2GJZA 4HBCL 4X6EB 1TNNA 5FHAH 2APVA 2IQAB 4YDVB 1RUPH 3IKKA 4TUJA 4X7TA 4UU9A 4PJFB 4BH8A 1ACYL 1Q0XH 1HIMH 5CJOL 1W72A 4KZEH 4PRHD 5SV4A 5J13C 1I8LC 4G9DB 4JZOA 1SQ2N 4DAGL 5IMKA 3G08A 1CL7H 3V4PH 4RWYL 3ARDA 5BS0D 4LKCB 3ELAT 1AR2A 5FUOH 2E9WA 2QKIA 3LEXA 3MV9A 1P4BH 4EOWH 4JO1L 1A4KB 3ZLQC 3FO0H 4X4ZA 1MCNA 2VN7A 3L3GB 4NRZA 4NM8H 3RGVD 1C5BH 4Y89A 4R0LA 4LK4A 2B5IC 2FJGB 3KJ4B 3EO1B 1MF2H 4UQ3A 2JE8A 5CBEB 1UKTA 3CMOL 1HDMA 5CEXA 4RZCA 2GT9B 4Y5VA 5CP7B 3BVNA 3HI1A 3MCLH 1NGQH 3ZKXC 5I8KL 1A6TA 5I1JL 3JUYA 3A67L 4WTZA 1MCPH 5GRZA 4M03A 2R1YA 4FXKA 1V7MH 4Z7VB 1NLBH 1I7RA 2F8VA 2ITCA 2Z93B 3IDUA 3IJHB 1OPGL 4ODXA 4O9HH 4OI9A 3ILPA 3U83A 3O4LB 1K9TA 1ODAA 4ZD3H 4BYHA 5C0CA 3HMWH 5KSUB 2EH7L 1AO7D 4OF3A 4HLZG 1BWWA 3MUHL 4NWTH 5DURD 1G9MC 3LS5L 4DWHA 5IMMA 4HKXA 4QOKE 4R0LC 1BQLH 1SYSA 3MOBH 4NUJA 4WHDA 2DOCA 4PJCE 4QKXB 3IJSA 2X4NA 4LIQE 4N0FB 1FIGH 4P2RB 4JHAL 2XQBH 1PSKL 5D2NA 4N1HB 1FORL 4QRPD 4Y5VC 4F33A 5IF0A 1P9MA 3OG6B 2DM2A 2GFBA 1NL0H 1FC1A 1H0DA 3ZDXF 5F8RC 3AGVA 2NY6C 5C3LD 2XKUA 2DWEA 3I6KB 5I0ZA 1A6AA 1CGVA 4JAMB 4J3TA 3UTTD 5BJTB 1LEIA 1TIUA 2FD6L 4PGBB 2E27L 4YC2B 5FCUL 1V05A 4HMEA 3UAJC 3RAJH 4JM2D 4DUVA 5CLTA 3SBWA 3RKDD 5HDOA 1MAMH 1RIHL 3HMXA 4EUPH 3TFKC 2F5BL 2VL5B 3D3VD 2P42B 4D8PB 4I0KA 3DMMD 5DMJB 5D2NC 1KBGL 2DQTH 1QUNA 1P9MC 5HYQB 5L8KB 4XMPL 3IRZA 5HDQL 3AS0A 3TLRA 3LPWA 2UV3A 3MV7E 3GGWB 4PJ5B 4P2CG 3BXNB 4U2ZA 2Q8BH 3TJHD 2R1WB 5B8CA 5DYOA 1FPTH 1FN4A 4DFHA 4OZIF 4F7EB 5IMLA 5T5NG 4YAQA 5MP6L 4GW5A 4YXKH 3VW3L 4KVCL 2E7CA 3MXWH 2CKBA 4MAYA 4DGIH 4PLJD 5HPMA 3SBWC 4R97C 3GHBL 4MGXA 3TVMB 1H3UA 3REWA 3SDAA 4OFKA 5D7JD 2VC2L 1EEYB 1XCQA 3BE1H 1UACH 3WLBB 1MPAH 5FFLA 3TA3A 1G1CA 4LP5A 1A9BB 1EPFA 3VWJA 4L3EB 4RGNE 1TJIH 4M6ML 4ERSL 4P5MB 4M6NL 3T0EE 3H9YA 3W2DL 3DGGB 2W92A 3RWDA 4GG8A 1JL8A 3LMJL 3N9GL 5GIRA 5CWSA 3T65B 3U30C 4U1JB 3BZDA 3QEGH 3FZUD 5B8CC 1RHHA 1NMAL 3NN8A 2FO4B 3PQYA 1FGVH 1HHJA 2IGFH 5ACLA 2AEPL 1SBBA 3MNVA 1F58L 4N8PA 4MAYC 5F3HA 2UWEE 1FE8L 2C1OA 5E2WL 2NX5E 3SN6N 4HIEB 1ZA3A 3SDAC 1CZ8L 4P46B 5ANME 2VZOA 3S34H 2JCCE 3TA3C 3NABH 3CNKA 4WUKL 3LSOA 1P7QB 5D96B 1MFCL 2QSCH 5LXGL 1FL6B 3VWJC 4ZYKB 1BIHA 3GMQA 4ODTL 2VDLH 4U1SB 2OTWA 4K8RH 4F7MA 5CEYB 4LCCC 1OGTA 4PRPA 4AEHL 5DO2C 2O61A 2CH8A 4L9LA 3IRPX 4JANB 3VFRB 3WUWA 1OAXH 4JFEE 4P2RD 3IETA 2VITA 4IRSA 4M9PA 4JR9H 4LPYA 4UOW0 1B90A 2VLRA 2F74B 2WBJB 3UEZA 4EUPG 2ZUTA 4CMHC 1J8HE 2XA3A 4K71C 5C0FB 1F4YL 1PGRB 3LQMA 4RFNB 4ZUWB 3HZYB 4ZSOA 4LPXA 3W5MA 5DJ8A 3QIWC 3ROOA 3N06B 5B38B 2NXYC 3ARGB 2I07B 1LO0H 1AGBB 3E3QC 3UJTH 3DROB 1AJ7H 2CIIA 1ORSB 2RQ8A 1KTDB 3FFDA 2HJFB 1FNGA 4NQSA 1HQ4A 3D0LA 1VCAA 2OSLB 1UWEL 1YY8B 3PL6A 4APQB 1T03L 1NUDA 1MJJA 3KYOB 3T0VA 4WWKD 1OF2B 2A0LC 5IW1A 3U9PL 2EYTB 4BFGA 5C9KA 1XCTA 1VERA 2VDRL 1DVFD 3IYLW 2A6IA 3DSFH 2OL3B 4L9LC 5CCKL 5EZOH 2GJ6A 3D87B 2OL3L 3UPAA 3AFLA 2H8PB 2AK4A 4XC3H 5ESQB 2ICWI 4IRSC 4IHOB 4YR6B 1EO5A 3MJ9A 4OGAC 4RBPK 3EOAA 4JZJA 4K23L 4L1DA 3BQUD 5F7KC 5JA9A 3GSQB 1MCIA 1S7TA 4RQQB 4UTAL 5SWZB 3C60A 3OR6B 4LSUL 4LVNC 4Y4FA 5J6GA 1ZHKB 1N7MH 3QG6A 1GZPA 4H8WL 4K3EH 2OLDA 1MRFH 3PL6C 4FHBD 1X5AA 5LWYH 3QDMA 4LLUB 1BFVH 3OKEB 3GSVA 5BS0A 2XQYK 3INUH 5H94B 4HH9A 2O5XH 5MEPB 3ZTNH 1JF5A 3T4YB 1A9EB 2NY2C 1JWSA 4F80A 1VEOA 3NIGF 4JFXB 4L3ED 5AG9A 1Z5LB 4H88L 1QBMH 1LNUA 1RZJL 4JZJC 2D7MA 3MRKB 1CBVH 2BCKA 3D85D 4PJDE 4LBEB 1CD1B 1BGXH 2FLRT 4RISH 1OW0A 1YQVL 3DX8B 4PJHF 3C60C 4UB0H 4Y4FC 4LOUC 2DQUL 3U0PB 3O3UN 4HC1A 4HUXB 3EO0A 2LU7A 4LHUG 1DBJH 3M8OL 3LN4B 5E1HB 5ETUA 5I8CB 2W9DL 2LFGA 1QLEH 3GMPA 4LIQH 3Q6GH 1B88A 1F5WA 2VERN 5FDYA 4PJAF 3D48R 5D7LA 1IM9A 1FCGA 4LLQB 2JIXA 1S9WB 4PJBA 2C7UB 2GUOB 2YK1L 3RHWF 3O6FB 5MERB 4U0QB 4U1KB 1RHFA 5ID0B 4XNXL 4HD9A 1M7IA 1YEFH 4C83B 1G6RB 3FO9A 4FQXD 1G6RL 4Z95H 1JGVH 1XGYH 3TPUB 5C71A 1OW0C 5FF6A 1VFBA 5IFJB 4O51B 1FYTA 1N5AA 3QAZB 1B2WL 2PCPB 2J12B 3OQ3B 4Z0XB 5C08D 3D39B 1T20B 5FM5M 3BIKB 4G7YL 4ONGH 4L8DA 2MQ0A 3ARGD 3EDKA 4ZQKA 3SOBL 5C0EB 3Q3GB 1WBYA 3ZDXE 4X9FA 5SV3A 3RWGB 4E9LA 3K2UH 1E27A 1YEJH 4L4VB 4QY8A 3KLSA 4APQD 2Y07H 3BKCH 4JM2A 5MEND 3LEVH 2IADB 3NIFE 5J8OA 3O6ML 4G9FA 4C57C 3QO0A 3NFPA 2X4QA 3D3VA 2QADB 4JM4H 3W81A 3DMMA 3PWVB 4XAWH 4XVTL 1F6AA 3A6BH 1CFTB 4MWFA 2YXFA 4NJAH 3S5LA 5IVZA 1FNAA 3P11L 3EKCA 2BOCA 1WBXA 3H9SB 1GOHA 4JG0L 3V0AC 3D18A 1N0XH 4LAJH 1AKJA 4ZUVB 1N6QH 1EEQA 3EAKA 5FUZL 3IGAA 1RVFL 3QIUB 5SWZD 3ARYA 3O8XB 3W11D 2PTTB 5C0DB 1I8MB 2ZUUA 3DX7B 3BEWB 1AI1L 5F96L 1S7WA 2R8SH 2LAAA 2A1WL 4XB7A 3GK8L 3LN5A 1F2XK 1MHCB 3LZFL 4K3HA 4UIKH 3ARFA 4JM2C 4MNQB 4QHNB 1W0VB 3RKDC 4NQDA 2WWKT 1FAIH 4O5LH 4XCCH 2AJYH 1A6UL 3CJJA 3HC3L 5D7JA 5AYUH 3U0WL 4FFZH 1I7ZA 1UYWL 4RRPA 3SKJL 3WS3B 5EPMA 4XNQA 3DMMC 2GITB 1XGTB 4HV8A 4ZTPH 3S98A 1R5VA 3OZ9L 3RPKA 1F6LL 1RU9H 5DR5L 5HYSA 4OV5B 3JWDC 3HC0A 5HGBA 4MXQC 2C9AA 4ZUUB 1I7UB 3L3OA 1G7HB 5GGTL 2ED9A 1T0MA 1WAAE 2VKXA 4TNVF 4F3FB 2D2OA 4OCNC 3TJHC 4PRDA 4GAJL 4S2SB 5TE7L 3EW3B 1WLHA 4FQCH 3WL9B 4KROB 3PV6A 2DAVA 5ACZA 5J11C 4URTB 1LE9B 4R7NB 1MOEA 2CK0H 2HH0L 35C8H 3ARTA 4LQFL 5EB9A 3ARFC 3MODH 3B9KA 3GBNH 1U95A 5DMIH 5GGSY 5C9JA 2F8XC 4OZFA 5D7JC 5C3TA 1ZLSL 3SPVA 2Z0BA 4XGZB 3VU2A 1IC5H 3STBA 2YN5A 1R3IH 1P5VA 5E8EB 1LEGA 4Z78B 4YZFE 4M62H 3QFJA 3TBYA 3Q6FB 3LPGA 2B2XH 3TBSA 3S7GA 4P3CH 4H1LB 3IS0X 1X7QB 2GJJA 1DEEA 5DHVA 4JHBA 5EU3A 5DD3H 3AM8A 4ODUB 3HCVB 3GMRA 5KAQF 1JN6B 4XP1L 3STZB 4M7KL 3FZUC 3PXHA 1NBYB 3HNSL 3EYFB 4CRPA 2UUDK 5JW3L 1U8LB 5D1QD 2R0LL 3GNML 1D5ZA 1E28B 1XF4A 3L5XL 4Z7UB 2FL5A 2D7TH 3CFKA 5KSAA 1UM5L 3CGTA 3L5WB 3UBXG 3B9KC 2BSTB 4GMTH 2HKHL 1IAMA 3MUJA 3UTZA 4PJFF 4CGTA 5CZVH 1MNUH 4KI1A 4WCYH 2QQNH 5EIVA 3QUKB 3LDBC 3OXSA 1EJOL 2X9WA 5D1XB 3QG7L 5EU6E 1C5DA 2X4OA 2YXMA 4DN4L 4LDLB 4L4VD 2KH2B 1MCHA 4RMQA 4WWKA 2PO6B 1F13A 1IARB 4MD4A 1FLTX 2CR6A 2A83A 4AH2A 1DVFA 3AM8C 4GXVL 3MGTB 1U8IA 4JFDB 3BDBA 2P8MB 2QADD 1D5BA 1UJ3B 3GO1L 4U6XA 3QDJE 3MLXL 4ZFZB 3GSNA 1CXFA 4LEOA 1GSMA 1XF1A 1OARL 1MI5A 4PREA 1MHPL 3V5KB 4HS8L 5JOPD 3CZFA 5KSAC 2ESVB 5CSGA 3BQUA 1C5CH 4J8RA 4F15B 4ODSL 4ODHL 4JN2B 2QEJA 3QIUD 5E00A 4TN9A 3V6ZB 4Y5XA 4Z8FH 4OD2B 1IGFL 1KLUB 3DRTA 2WQRA 4Z7VF 1TLKA 4HWUA 2YUVA 3DLQR 3I9GH 4M7JH 4WWKC 1MEXH 4J4PD 1TZIB 3Q1SL 1DVFC 3THMH 3F62A 1I1FA 5KSBE 1E4JA 1BEYH 3NFSH 1WCBA 4QTIH 5BV7C 5J6HA 5FYJE 1S3KL 1YJDL 5CIPH 4HHAA 4JG1L 5GXBB 4K7PX 3ZL4H 1RJLA 3LV3B 3KWWA 1FO0A 5T3XL 3PGCA 2BHYA 4MDJB 3A0OA 4X9HA 1QSFE 3OGCA 4J23A 3BQUC 6FABL 3D85A 3UJJL 3E1F1 1T22B 3MRFB 3KPQA 4PJ7E 3BKMH 1PKQA 2R39A 3CIQA 2BVTA 3JV0A 3D9AL 4Y5XC 2VLJD 4KROD 1A7PL 4MCYA 4KVNH 4HS3A 1RI8A 3GUTB 5E8OB 5C0ND 4LMQE 1S9VB 1YMHA 2OR8A 1LO4L 3GSXA 1AP2A 1JPGA 2FIKA 3UP1A 1Q9WB 3HAEA 4MCZB 4JGMA 3CC5A 1RZKL 3QEUA 2GQHA 1I3RB 3W0WB 3GKZA 1TCRA 3ARQA 5HGHA 3GMOB 4RMUA 3O2DH 5ICYA 4RX4A 2AK1L 3BESR 4ETQB 3OKYA 1UKSA 4XZUB 1RSFA 3QUYA 2W9LA 4NJ9H 3NCBB 4FXKB 3QXDA 1NBVH 5ALCL 2V2WB 3S97C 4FQXA 4GAYB 4JRYB 4NHUB 2EDYA 5F21B 2BMKA 3MR9A 3I85A 1ND0A 4K3DL 4K94H 1UJTA 3DURB 3LKOB 1IQWH 4FQHB 2GSIB 4PTUB 1FFNB 5C08A 3R06B 4PG9B 4YHYC 4PR5A 1U8OB 4J2XA 4X5XA 4G7VH 1EGJA 3O2WL 2IMMA 3UCRA 3VXRE 5CKGA 1DQDL 1LWRA 4PP2A 3BPOC 5DJ6A 5F70A 5TE4L 1HHKA 1INQA 4PRNA 5I1LA 4FS0A 3AAZA 1MRCH 5MEOB 4M61A 3KPSE 4G6FB 3QUYC 1CXIA 2R0KL 2J88L 3RNQA 5TH2A 5MENA 1OOAA 2DWEB 4M7ZB 5BZWA 3VFPA 3CSGA 1YDPB 1S7QA 2BY1A 2G5RA 4XP6L 4FQXC 3PJSB 4JFDD 1DN2A 1KC5L 2EIDA 5IB5B 3DOSA 3MRLB 5FO9A 2AEIT 1BJMA 1KJMA 4WEBL 2DQGL 5E6ID 4XP9L 3QXTA 3MNZA 5B3JE 4MA1B 3PNWA 3MUGA 4DKEL 1IEAA 1E6JL 1Q8MA 2FLBT 1MIMH 3ULUL 4XRCA 5EZJA 3WXWH 1WWAX 2ESVD 4S0TD 5JOFB 4TRPH 5CKAA 3EFFB 3VG9B 3IDYB 1HQRA 1IBGH 1TJGH 3KYMA 3I50L 1OAKL 3LB6D 1HI6A 1U8PB 2WUBL 1NFKA 2XXMB 2ATKA 1RZ8B 2RBLA 4FQQA 4ZDHB 4RA3A 3N85H 3VFUB 5LGHL 3NCEB 3WNMA 4XNYH 1F6FB 3S37L 5JMOC 2YBRB 4PGEA 1RURH 2FGWH 4DCQB 3KXFD 5F6HJ 4G8GA 3KS0J 1HNGA 1HHIA 5E08H 4NO5B 3ES6A 5F9WB 1JPST 1QLFA 3FT4A 2R2EB 3QHTC 4Y1AA 4YNYA 4QTHB 5E5MB 4B53A 5M7QA 5HGAA 1MQKH 1LEKA 3HZMA 5F89A 2V17L 1A0QH 5DJZA 2JELH 5F1NA 3SCMB 4FFVC 3U4EA 5FA4A 3K46A 3MV8B 1QSVA 5MI0B 3VFMA 3KPLA 3DWTA 2FR4A 3OKDB 4K3JL 4AG4L 3SDYL 3OJDB 4QHLB 4KTYA 4JO3H 4LCCB 1J05B 4FXLA 4H25A 1MFEL 3B8SA 4BQ6A 1TTGA 1KSRA 5CWSB 1Y0LB 3ZKNC 2Y7QB 3S3JA 3S36L 1FZKA 3C8KA 3W0WD 3FJTA 5I6XB 4YUEL 4PS4L 5DRZA 4Z7WB 3UPCA 1YEHL 1M71B 4DW2H 3VFGH 5ECJE 3BAEL 2AGJH 4X5WA 3QIWB 5DSCB 4GXUN 4LEXL 1BWMA 1MJUH 3MRJB 2MPAH 1QNZH 3BYYA 2C3GA 1FZJB 3H7BB 1N59A 2XWJA 1IEBA 1JNNH 4U6YA 5D1QA 1U0QA 1MIEH 2PW1B 3CLFL 1JZ7A 3DUUA 4NO3A 2EYSB 4JJHA 3TO2B 4LSVL 2V9QA 5ISZE 3Q0HA 3WCYA 1N5YH 1OLZA 4MXVE 2DI8A 5FECB 1OT1A 2B8OT 4YGVA 2I5YH 4AJ0A 1NKRA 1BFOA 4YBQC 3SDDB 4W6XB 4HJ0C 4PJFE 5L0QC 3AY4A 1ZT7B 2MKWA 1WUNT 3FAXA 4G6FD 3H9HB 4WTXA 3JWOL 1X6LA 4KRNA 4I9WD 5DJYB 2H45A 5F9JB 3SQOL 4U6HB 4EI5D 3C5JA 1MFDH 5KVDH 2CLVA 5EU7E 3CFDA 1MHEA 4P5TD 3NACH 4JPKH 5D1QC 2DMCA 1II4E 3FCTB 4MYWB 1N26A 5DS8A 3UZVB 2Y36H 3MREA 2CDGA 2MMXA 5B22A 1NCCL 2YPLA 4DVBB 1MCOH 4GRLD 1MRDH 4XX1E 3SO3B 3O3EA 4LCYA 5F7EH 3CSYA 4UTBH 4HDIA 4YK4C 2E7LA 4XBPB 1B0GA 2DDQL 4JQVA 5GJSL 3PGDB 4FQPA 3MRPB 3F12B 1ZANH 5DQJB 5FYJH 5EORH 3RDTD 4WO4B 4LRNL 4LHJB 3AY4C 4AM0A 2FJHB 3CFEA 4L8SB 4WI2A 5FYJU 2PF6A 4NNXA 2DICA 1OTSC 3DI3B 4J4PA 2HT4C 4N8VG 1IRAY 3G5YA 3P9MB 1DLHA 1MWAA 5C0AD 4ZFFB 4C56B 2EDEA 5SX5H 3EDEA 5TDNA 1CS6A 1MJ7L 3O4LE 1TXKA 2Q7YA 4JDZA 1JHTB 1ZTXH 2PXYB 2GHWB 4NHCL 5DF0A 3QWOA 2V7NB 1OAYH 3L9RB 4QRRA 3GSVB 1S5HA 4YXHL 4HH9B 4OLEA 3SCMD 2E7LC 4TSCL 1YPZE 5EUKA 3VXNB 5IGXH 4JQVC 2BVEA 4LNVA 4HK0B 2VLJA 3GSRA 3NH7L 5JW4Q 3GB7B 1AHWB 2ZJSH 3OX8B 2IPKA 4JFZL 4NO0D 2X44D 4J4PC 3A6CH 2NXZB 1PZ5B 4ZNEE 5K9OA 4JY4B 3DBXA 5DK0B 4JRXB 2KUTA 3O3DA 4M02A 4NQVA 2AJVL 5FO8A 1YEEL 4M5ZH 4ZAKA 4OLUL 3QYCA 2LTQC 3C5ZA 4WW2A 5L6YL 3CFJA 2H26B 3ZYJA 2PTVA 5DTFB 4KK8C 5DUBB 4CAGA 3QDGE 2IH1A 4QHUB 1IM9B 4X6BA 3TN0D 4ELMA 3CK0H 1BZ9A 4PD4K 3MX0A 1Z9MA 5GRVK 2MTPA 1T3FA 4I8DA 1KPRB 2OJEA 4W81A 3B83A 3OGOE 5FK9B 2XZQH 5C0NC 2A9NL 2ATPA 4LLDA 2V7HA 4TTGA 2DI7A 2F53B 4MQSB 1L6ZA 1A1NB 1MELA 2H32H 2R0ZL 1ZLWK 1DL7H 4BQBA 2B1HH 1I1YA 4G43A 4AENA 4PLKD 1UXSB 1XZ0A 2A6DB 5IM7B 4G3YH 5IHZA 4WENB 3HZKB 5FM5O 2UVFA 1KIQA 2EYRB 4HQQL 4ZPTB 3SDDD 4UT6H 3IDGA 1G0XA 5CJBA 4ZAKC 2AERT 1EAJA 3C5ZC 4WW2C 4ZFOA 1I3VA 3MBXH 3CPLB 3RL1B 4JFFD 3LRGA 3MLPA 2VZ1A 4L3CA 5E6IA 3NA9L 4XWGL 3X11A 5GRUH 3MBEA 4FTVB 5L88H 5C07E 1YEGL 3MZTA 5DJ2B 4DEPC 1NAMA 2DQEH 4LLVA 5E2UH 5F1OB 4G9FB 3GRWL 1J0ZA 4X6DE 2EXYC 4IRJA 3H0TA 4NWUL 1OGAD 1J1OL 2VDQL 1WC7A 4BZ2H 4PJGA 5FGRA 3M07A 4BFBD 3V4UL 4TVPL 5D7KD 3VA2C 4WO4D 1QFWL 5CGYD 4KHXH 1ZVYA 4I5BA 1NBZB 3NZ8A 4MJ5B 5B39G 3LN9A 4Y19B 4JRWA 4C56D 5I66B 4HX1A 4UILL 3KXFA 4AIOA 4GLRH 4OKVA 2M2DA 5E6IC 1A3LL 1KJ2A 3MBEC 2PXYD 4ODVL 4P4KD 4IOIB 5EA0H 4WHTB 3TPKA 5E6ZA 5I71B 2W60B 1WZ1L 1T5WA 1CLCA 5E8NB 3VRIA 1A6WL 1TQBC 3UC0H 4IRJC 4P99A 1GGBL 4XNQB 3QUML 3KPRD 4PBVC 2BSSB 5KJRH 5TQ2L 4Z7UF 4XVSL 3LB6C 5LCVL 4IJ3C 3GSWA 1P6AB 4HK3J 5LBSL 1E4WH 2VJXA 5IQ7L 1U3HD 3DO7B 5E1AA 1M05A 2FWOA 4YE4H 3IDXL 4YDIH 1F45A 4J7RA 4M7LT 2VSDA 1S7VB 4FA8A 3ESUF 4PGZA 3HFMH 3TP4A 4HS6B 1NFIB 3FB5A 2QSQA 4HUWA 5ACZB 1YJDC 2YC1B 1I1AA 1YZZA 1GPOL 3LRSB 1W8NA 4K7FA 5BVPL 4KKCC 1CICA 2C3WA 2CMRL 4HW6A 1F4AA 4XCNA 5KVFH 3BJLA 3BN9D 3U46A 1ITBB 1S9YA 1LO5A 2IPUK 3ZYIA 1AXTH 1JGEB 1MSPA 2OJZH 4G6ML 1S9KC 5I1HH 2A73A 3WDHA 1PY4A 4TSBH 1MLCB 3H42H 2J8UA 4FQ2L 1T5XA 4KXZH 3UZEA 4JKLA 4LPVA 3UZQA 4D9RE 3BGMA 1SJEA 3IF1A 2P5EE 5T5FH 4EVNA 3GI8L 1EAPA 3PWJA 2DWDA 4DK3A 1B0RB 2ZNXA 3RP1A 3V7MA 5IVXB 3FRPA 4YO0B 4QF1A 1BMGA 2HFFB 4LGSB 4D0BB 4DGVL 4P3DA 3ZT6A 1NFDB 2DQHL 2F19H 1U8JA 4XMLL 4PRBA 3KPPA 1I1AC 3OJ2C 5D2LB 43C9A 4HIHB 1KUMA 1CICC 1NGYA 5CHNA 1G7PB 4CU6A 1QQDB 1WWBX 4EI5A 2VDPL 3GIZL 4ODWB 5C8JA 4ELKB 2V2TA 4NPYB 4HKBA 3NFNA 4LCIL 4LKXA 3VMNA 2NZ9C 4P5TA 5JXAH 3TCXA 4M8VA 1QHPA 2BC4B 1F3JB 3OTTA 4KKAD 3DX9A 4GRLA 3RWEB 4EKXA 4JKPH 5DUMH 4I4WB 3HPJA 1N64L 4IDJH 2FHFA 3UTPD 3VXTB 2VIRA 4PGCA 4N9OB 4ZOBA 5F7WC 4CJ1A 3RDTA 3EHBD 3NCMA 4LVOB 5D9SB 4YDJB 1REIA 8FABA 4GG6B 1P7KB 3KNBB 1U9KA 5DD6A 5DUPL 2N4IA 1CGUA 3P40A 1VA9A 5C2BH 4NYLB 1FVDB 5C0AA 3FQWA 4N0CD 3TV3H 4EI5C 1KT2B 4OZGE 3T3ME 3WIFB 3RWJA 1OT2A 3BO8B 4I3GA 4P5TC 1UWGH 5D5ME 1EK3A 4X0KB 4HWEL 5EOCL 4K8RC 2AJSL 4P9HC 1YYML 5C6TL 3QJHA 1IQDB 4GRLC 1KNOA 3BP4B 1BD2A 3V7AE 2D7PA 2DQDL 4PD4J 3WO4C 4UBDD 4YPGA 1C08A 3K8MA 3RDTC 4YHIA 4UNVA 4I0CC 3WIHH 5I73C 5TDPA 3OGCB 4NO0A 3D39E 3PXJA 3EYUH 3PWPE 3FB6A 3UX9B 1I9IH 3WEXA 2G60H 1DDHB 4MCYB 5ADPH 2Z9TA 3MZGB 1WZKA 2QR0B 2PYEE 3RWCA 3RUGE 2FBJL 3SDXA 5DD1L 4NUGL 1NCWL 3TN0A 3QSKB 5EO1A 1WIPA 2W0FA 2A77H 1A7RL 4X9BA 3ULUF 4KQ4L 3VI3F 3IFLH 1GGIL 3WS6C 3QXDB 1IC4H 3DYMA 4M4PA 4OIIH 5EFIA 4TULL 4U1LB 2W0LA 1KPVB 1CE1H 3PABA 2H1PL 1KTRL 3MRNA 3OKLB 4CN6A 4RAUB 4NN7B 2F8OA 4G6JL 1QEWB 1OWWA 1V8HA 1DUZA 2WUCH 3HI6H 5DVNA 4OZHE 1S9XA 4MNQE 1AXSB 1Q9KB 4BJLA 4JFFA 4MD0A 1KPUA 3MXVL 1CDIA 2AJXH 3GMNA 4U49A 4LSTH 5I1LB 2J6EA 3MJ8B 4MJ6A 3QPXH 5IIEA 2CLRA 4JJ5B 2BFVH 4QLRA 4D0CA 2I60H 3EFDH 5JR1H 1N8ZB 2VXSL 5EG6C 5BMFL 1DSFL 2QJDA 3MLSL 1OGAA 2ZUXA 3VE0A 5C09E 1PQZB 2BXZA 1T2JA 4OT1H 5ABDE 2I25N 4AEIL 3MUGB 1NQBA 3LRHA 3FOMA 3ZDZE 4NKOB 1T80A 3MACL 1ZLUK 1ZMYA 3LEYL 2GTZA 1YEIL 3QHFH 3QUZB 4N0UE 1OTTC 5ICXA 4GBXB 5CILL 5DQDL 4ONHA 1ETZA 4Z7WF 3ULVE 2IANB 1XGRB 5IBLD 1TVBA 5F6HI 3QQ4B 2Z31B 1KJ3L 5INCB 4P4KA 3U0TA 1X44A 1WWCA 2JK5A 1BQHB 4Y4KB 2ADFH 1T21B 1VADA 4CVUA 4OUUA 4HPOH 5FOBA 3OKOA 5ALBL 4POZC 2YPVL 2WIIB 1CIDA 1QA9B 2IPTL 3QNXA 3CVIL 3TWCH 3KPRA 3KAAA 3BI9X 1HOCA 2YRLA 4X6CE 2NY7H 3ES6B 3LH2H 2AS5M 4XI5D 2ENSA 1GC1C 2YPKB 4MA8H 5L7XL 1GGTA 2V2XA 1B4JL 1U3HA 4PYGA 4A6YH 3HPLA 4YQXH 4L29A 1U8NA 3I75B 1QFUH 5CEZE 3MO1B 2B0SL 4OLZH 3TNMB 4L8CA 2XOTA 5IESH 5BXFB 2KKQA 1K4DA 5JPNA 1DLFL 3IDIB 4LPCA 4P4KC 5BZDB 2WWMD 5EBWA 3RBSA 2C3VA 1DUYB 5I16A 2DLIA 3HUJE 5JQ6H 4XVJH 1EJ6A 4R96A 2Z4QB 3EOYG 4NO2B 1N6UA 3IFOA 4JPWL 2XY1A 1LO3L 4V1DE 3MJ7B 4BSVB 3R0NA 3G5ZB 4HCRH 2R29L 1U8KB 2I27N 4GW4B 1UA6L 4U1HB 1EO8L 3IFPA 1X5GA 1JZ4A 2DQFA 4RBPH 3BP7A 1F8TH 3P0VH 4DKFL 1U3HC 1MLBB 5T3ZE 1IC7L 1L9MA 3T4AA 5CINL 2CLZB 3WHXA 2IALA 2X4PA 5IR1B 4UINH 4G42A 2E7MA 3IDJA 2OR9H 2OP4L 2P5WB 2RCSL 2O5YH 1GAFH 2EDHA 1QBBA 3MLVH 2CSPA 1FSKC 4GSDH 1TVHB 2MJWA 5IJKA 3SGKA 3GM0A 5LAXA 1MCJA 4JE4B 2IEPA 3V6FB 4YK4B 5IOPA 3EYOA 2QQKL 3O11A 2NYYD 3WFCL 3MLTA 3BH8B 3MCKA 3ZHKA 4Y5YA 1TQCC 4YHLH 5AAWA 4RIRB 1CDUA 1J0YA 3CCHB 1X5XA 1XAUA 2JB5L 3KHOA 4JPIA 4X7CC 4ZO6A 4CNIA 5MHSD 4GKNB 3C5SA 1Q9OB 3CH1B 2X4UB 1S7XB 5KSVB 5DQ9B 4NN5B 3VDAA 3QNYA 1FNFA 1UM6H 2Y06L 2GTWA 2VRAA 4NFDA 2VAAA 1TJHL 3MV9E 5I76A 1EEUA 4XPAL 5EU5B 2NY0B 2D9CA 2NTFA 2G9HA 1N2RA 5TFSL 5IJKC 3SGKC 5E99H 4NZTL 2D7NA 5MEQA 3QUZD 3VFNA 4EEEA 2DBLL 2YD7A 1NC2B 1UB5B 4GBXD 3VXUB 3P4LA 2MKLC 2R2HA 3I6GB 1P84K 1GZQA 4Y5YC 1TITA 2VXQL 1I1RA 4WVRA 4KKAC 4NNXB 4Y4KD 1EZVY 4CDHA 3QCUL 4KKBD 5D7IA 5T1MB 1CTOA 4MLSA 2ZWLT 3QUMA 3MA9L 4OSUL 2ILLA 5DEZA 1JTOA 4HAFA 3IU3B 3QZWA 5I2IA 1C7TA 4LFHD 5C0CE 4KKNA 1NCNA 5DJCB 2BZDA 4P57B 3Q5TA 3EHBC 3F6LA 3BHBB 1O7SA 1FZMA 5C0GA 4HGWB 3WHE1 3VWKB 1BVZA 2D0HA 1ZEAH 4ALAH 5TJWK 2JB6B 3UTSB 4RAVA 2AXFA 3VXMD 3U7WH 3STLB 1DR9A 4XXDB 5JORB 2IH3B 1HH6A 3ARSA 1TFHA 1NGXB 3R8BB 2V5TA 5F3BA 2CDEB 3KPMA 1RUPL 1XIWB 4GH7B 3QJFB 3D69B 2YKLH 5I1GL 1Q0XL 1HIML 5HJ3A 4KZEL 3RVUD 1ZVHA 3AXLB 2BDNH 4UBDC 1UCBL 3F7VB 4FQLH 2XQYG 1VB9A 1CL7L 5EULV 1ZHLB 1RZGA 4AY0A 5FUOL 2Y72A 3L7FB 1NUGA 1AGEB 1D9KA 1P4BL 5GGVY 4EOWL 2CDFB 2ZPKH 2BY0A 4MHHI 3FO0L 3T77A 1CD9B 1A3RH 2P5WD 4L3AA 2AV1A 4NM8L 1HEZB 1C5BL 2P8PA 3OKMB 1AGCB 1LQSR 3E6HA 2BHUA 1GXEA 4OLVH 1CDHA 4YX2H 5IEKA 3RWIB 3MCLL 1NGQL 4LCWA 3QUXA 1MCPL 2QSVA 3FHAA 4R3SB 1CXHA 5FA3B 2C1PB 3V7AG 1NLBL 1UG9A 4O9HL 1MFAH 1QSED 3DVGB 4ONOA 4ZD3L 3FT3A 1XR8B 4XAKD 3HMWL 1DN0A 3ULVH 4RA0C 1R5IA 1R3LB 1D9KC 2DKUA 3FO2A 1T1YB 4NWTL 3MBEB 3E2HC 5AZ2L 3MV8E 3ZKMD 2NY0D 4MJIB 1G7MA 1BQLL 1BZ7A 3MOBL 4XC1H 3FB8B 4AMKH 1FIGL 2HT3D 2XQBL 2XTJB 4P5KA 1NC2D 1JWMB 1KB5H 2I24N 4O2CA 4M8QA 43CAA 3VXUD 3KS0H 1CFQB 5J56B 3PQYE 1NL0L 3QUXC 1J0JA 4JKMA 4PRID 3CDGB 3WSQH 3CZJA 2HKFH 3FQNB 1NLDH 1S5IH 2R0WH 1OAZL 4MSWA 3V5DB 5TF1L 4PLOB 3FB7B 1T1ZB 4LHQB 3EYVA 1R3KA 5CEZH 1SJHA 3NCFB 1MAKA 5IK3B 3EOBB 3U79A 1ACZA 1D5IH 3E3QE 5A2LH 3SKOA 2FSEA 3RAJL 4UQ2B 3FQTB 5DJ0B 4EUPB 1C12B 1MAML 3AUVA 3ARBC 3DUSB 5IVXF 1EEZA 3VWKD 4KRPD 5FDWA 1NCAH 3QXAB 5EUOB 4PRPE 4Y8AA 1NFDF 1KENH 2DJUA 3ZZ1A 3UTSD 4QGTA 2DQTL 5D6CA 5D2LF 3P73B 5IBLC 5IHUH 1IVLA 2VLRE 2HLFC 1L0QA 2OXGA 1K8IA 5T3ZH 4HF5H 4OQTA 1MVUA 1Q94B 1NBQA 5IW6B 4LLWA 3UTQA 1IAOB 1XIWD 1FPTL 3PGFH 4ZSOE 5HHME 4ACPA 5KN5B 5F88B 3HE7B 1T7YA 4YXKL 4L8BA 1O7VA 1IGJA 4PY8J 5F1KC 4NQUA 1UQSA 3BW9B 2G5BA 2ZG2A 1S7RA 3MXWL 3O6KH 5JXED 2NY4C 1PG7W 3BUYB 1UH3A 5K33A 2DS4A 3D2UB 5AAMA 4LSPH 2EDXA 5E9DA 1CVRA 2ZUVA 1UACL 1MPAL 3RL2A 1NGZA 2VDOH 3L3DA 4K9EC 4MA7L 1A6ZA 4GKZA 5DFVC 5DRNA 1OD7A 4H26B 2EE3A 2QBWA 4F2MB 5DEFB 1T7ZA 2VE6A 2BX5A 2GJ6E 2XKSA 3NPZB 4I1NB 1KIPA 1TJIL 1W72H 3BZFA 4GG6F 2FRGP 4BSWA 4Z7QE 3FAWA 1XF3A 4Q0XH 2ZZUT 3VXSD 2CQVA 4LNRB 2WWMC 2R56H 2B7DT 2NNAA 3QEGL 1JV5A 4I48A 1CG9B 1FGVL 2IGFL 1YYLL 3BKYH 4U1NB 2FZ3A 5GSVA 1P84J 5GISH 4WV1A 3BIAX 1BVKA 1G9MH 2F54B 3KPOA 3UTOA 5E2VH 2O5ZL 7FABH 4YFLF 2IWGA 3ILQD 3T2NH 3QDME 3SDCB 5C8JB 3QCVH 3NABL 4IMKA 4XCYA 3IU4H 3TIDA 3RIAK 4PJ9B 2ZUYA 3BPCA 2EDWA 3BWUC 5DJXA 2DJSA 3LS4H 4N1EA 2VDLL 5DZLA 1Y18A 4LHUB 3ZHDA 1TPXC 4MJID 5LVEA 5FM4A 5CD3B 3HC4L 4TSAH 2HG5B 4RFOH 1KEGL 2DM3A 1OAXL 3L95B 4PJIA 4G80A 1DQJB 1PY9A 3HS0B 4G8FB 5TE6H 2PR4H 2XFXB 5LG1A 2R4SH 1YMMB 3MOAL 1LDPL 2BHZA 4JRXE 5TGBA 4C54A 4WV1C 5AZEH 2OK0L 2ZOKB 5CBAA 1P53A 2ADJB 3BPLC 4PYHA 4U7SA 3UJTL 3JV4A 4KK6D 5JUEH 2HTLD 2ITDB 1NEZA 4IMKC 3OAYK 4Y16B 4EQ2A 1JMXA 1CGYA 5D7LE 4HKJA 4PJBE 2NY5C 5LQBL 1S7UB 4E5XB 4OGYH 4XPFH 3IJYA 4NRXB 5I8EA 4KDVA 3BRDA 4XPTH 2G75A 5EZOL 2YOCA 5K9JL 3RI5K 1FL5A 4XC3L 2GSGA 3CMGA 1BOGA 1BVLA 3GM8A 2NW3A 3G6JA 5JZ7C 3WKNA 2D31B 2ERJC 1FYTE 1SBSH 5T33H 1S78D 5C6PB 4F58H 2XXCB 1ZSDA 4BSJA 3FB6B 2NZIA 2Q86A 3HMXH 4IOFC 4BQ8A 4UV4H 2PNDA 1P4LB 1VACB 3DECA 3WFDL 5CJ5A 4XWOD 4I3RH 2Q76B 1X5HA 3HE7D 1A1OB 2BNQA 3C87A 5EZLA 4K3EL 1EFQA 3VFOA 3OAUH 5F7UA 1MRFL 2A6JB 5DMGC 5LWYL 1FH5H 2IJ0C 5EO0B 1V7NH 1QFWI 3MA7A 3OPZH 3INUL 1HHHA 1KF9B 2D4FA 2O5XL 3ZTNL 1AQDA 4D94A 4WIQA 5GZOC 4G9FE 2EE2A 5HYJD 4KI5F 1RFDH 3WLWD 1QBLH 2Z35B 3TZVA 1QBML 4M93B 4ZODA 1PG7X 2CKBH 3BDYL 2XWBA 1CBVL 4X98A 1BGXL 1FGNH 2Q20A 5C0RL 1OP3H 1M1SA 4PTTB 1AR1D 4UB0L 4WJ5B 5HI4D 2UZYB 2VLME 5F72S 2OYPA 1T7VA 3SGEI 3WIIH 1DBJL 2PW2B 4QOKB 5D71H 2UVEA 1HILA 4XPBH 3VD4A 4FG6D 4JDVB 4TVSa 1QLEL 3BP5B 5F93C 2F54D 3B4NA 4LIQL 3Q6GL 2VTFA 5F7MC 1QSEA 4HUMB 4PP1D 4NQDE 3QQ9C 5EH1A 2R1XA 2QV2A 1ADQL 4PJ9D 4NZJA 3QIBA 5ESAA 4LGRB 2FEDD 1RIUH 4ISVB 3TZVC 1MUJA 3D25B 4I18A 1YEFL 4LHUD 4X80H 3BGFC 4BUHA 4DKAA 3J7HA 1Q9LB 1JGVL 1CE6B 1XGYL 2JJVA 3VE0B 1XMWA 1FFOA 3OSKA 3FRUA 2FYYB 4PRIA 5EC1B 1INEL 2ZSWA 5EO9B 3CDCA 2EIEA 1YMMD 1BPVA 3KYKH 4H20L 3F7YB 3OJMB 2V9RA 3RWHB 5L8LB 4WFED 1NEUA 4FQIH 4P2QB 1SHMA 3K2UL 3WFZA 3MGAA 1YEJL 3QIBC 2Y07L 3BKCL 3MV7B 1AXIB 4NT6A 4WFGD 1LO2H 5EWIH 5FCSH 3C09C 3LEVL 3QFJE 1EHNA 4I18C 3B3IB 3SKNB 4JDTH 1OSZA 5TDOB 3UBXB 4JM4L 4Z0BH 1A6VH 4XAWL 4EN3B 2RFXA 1KFAH 1T83A 1BQUA 5IQ9B 3A6BL 4CU7A 3LIZH 3PHOB 3K4DA 1AD9B 1ZOXA 5B21A 2XACC 1UZ6E 5D6DA 4JVWA 1N0XL 5F9OH 1EXUB 3DIFB 1N6QL 2BNRA 3WNKA 5CZXC 2ZKHL 3VFTA 1VPOL 2VMFA 4HG4K 5A16B 2GCYB 4OFYD 3VJ6A 4L8CB 3OXRB 2MQ3A 3T0EB 2NPLX 1ZV5A 5JXEA 4KTEL 4UIKL 5I17B 1KG0B 5DEGB 1H3GA 3ABZA 3GHEL 1FAIL 4O5LL 4OCLC 2AJYL 4XCCL 3F7RA 1T2QH 3MQIA 5AYUL 4A2MA 4KRPC 5IB4B 3PG2A 4ZTPL 2CIKA 3EGSA 1T83C 4X4XA 4HK3N 1RU9L 3S96A 4QT5B 3ZE2F 3OB0H 2DTMH 2UWEB 4Z76A 1G9NH 1JGUH 4A2LA 3IFPB 2NX5B 2HVJB 4UAOB 2DQFB 4PV9B 3CFIC 2OX5A 3HB3D 3VXSA 5ANMB 3MFFA 5D6DC 1MI5E 2JCCB 4CMMA 1RJYA 3GJFA 2AXGB 1ORQB 3ZSTA 3BPNC 4JY5L 1LK3H 5J9PB 3ZT5A 2ARJB 2FH6A 3NZHH 5F9DC 2XG4A 2J8HA 2CK0L 1Q0YL 1H3WM 35C8L 4K7PL 4QOKD 4FXGA 1C16A 5JXEC 3KJ6L 4OCWH 3CXHK 3UYPA 2C3XA 4XBGA 3PHQA 1WQVT 4JFEB 5T1KB 4OCRH 2EDFA 3MLUH 1D5MA 1F11A 1IC5L 3L3KB 2OTPA 1J8HB 2NW2A 3ARUA 1NMBH 3N1GC 5E94B 3T8XB 4Z7OF 1FG2A 4QRSA 4RMVA 1RK1A 4BFIA 2B2XL 4P3CL 4KMTL 5DHYB