4FQJL

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
215
structure length
215
Chain Sequence
QSVLTQPPSASGTPGQRVTISCSGSSSNIGTNYVYWYQQFPGTAPKLLIYRSYQRPSGVPDRFSGSKSGSSASLAISGLQSEDEADYYCATWDDSLDGWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/immune system
total genus 38
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjL01
4WHYG 3MRFB 4L3ED 2P8MB 2BNQE 5I1IH 1OQOA 5F88A 1CZ8L 4F7MA 4UT7H 2Z31C 5HHME 2Y23A 2R4RH 2J8UB 5IMLB 2AGJL 3L7FA 3BGFB 1OGAD 1F58L 4TSAH 1KENL 4XP6L 3CVHH 1MRDH 2DLGA 3DTXA 3W39A 1R0AH 2VQ1B 3UJTH 3LKNA 1CT8A 4RDQF 1PGRB 1OAQL 4Z9KB 3OB8A 4NO5A 2GIYA 4ODWB 3ZDXE 1CL7I 1NEZA 1HKLH 3KPNB 2BSSB 3MXVL 5T33L 3EO0A 1P5UA 1N5YH 3K1DA 1RY7B 5DD5H 4K3DH 4YZFF 2AJZB 1MPAL 2DBLL 4HWBL 2ED7A 3BPOC 4EOWL 3BN9C 5D7IF 1FRGL 5DMGC 3ZE1F 3MC0A 4LEOA 1IEAA 1CBVL 1H5BC 4NKIH 1IC4H 4QYOA 2HT4D 4LASH 5JZ7D 4UTAH 1LEIB 2CRYA 2X4OB 4LLDB 4XXCA 5DJXB 3VA6A 3DO7B 1MRCL 2ZP0T 1HILA 2CMRH 4Y2DB 1GPOL 4W68A 4G6AD 5DZOA 1DLFL 4KZEL 4UILH 1V05A 2VC2L 1AH1A 2ZPKH 1CXKA 4X7SH 1YEGH 3VG0L 5BV7C 3DVIA 4XBEL 3P9MA 3MRHB 4KGJA 3PWVB 4HWZA 2COQA 5D1ZB 5GZOD 3I85A 5B4MD 3DV6A 4DOHE 3U1SL 5BZWA 1E6JL 3WHE0 1OTUC 2ZOLA 2WINA 4NQSA 5A16A 2P44B 4ETQB 4PLOB 5FKAA 3KPRB 4AM0B 4ZFGL 4PLJC 2ITDA 3AU1A 1Z5LB 2E3VA 3V0AC 5DJCA 1NCDL 1OLLA 5HVHB 4NN6C 3ULUE 1VACB 5IW1A 1BD2A 1ITBB 3B6SA 3IDYB 4GQ9H 4Z7WE 1W72L 4EJ1C 5EC2A 5DD0H 4BZ2H 2YA0A 4JPIA 3UBXA 3ARUA 1C12B 4JDTL 2JCCB 4RMUA 3VFUB 4TUJB 3PHQB 4P2OD 2HG5B 3VGHA 1KJVB 4EN3D 1CDJA 3WHXA 2PXYC 1IKNC 3MGTA 1M6OA 5I19H 1Y18A 4PJIB 3RFZC 5F8QC 1N64H 1V3LA 1DQDH 32C2B 5GJTL 4QRRE 2VMFA 4O2CB 2R2HA 1FO0A 5KSBA 4PRAB 5E5MB 3GUTA 5MEPA 4P2QB 4YHZL 3E6FB 2BVUA 3HI5H 1E4XL 1MCEA 3FO9B 3TO4C 4CUCA 2X4QA 4QTIH 3OX8A 1F2QA 4XHQA 1FC1A 5TGBB 1XIWA 4KI5D 3ULVC 3P9LB 5L7XL 1BGXH 2P42B 3LKQB 3ARXA 2X4TB 4I3RL 2R56L 3ECBB 3VJ6A 4U3HA 2GTWB 4D9QE 2NXYC 4CVZB 4NC2B 4ZOAA 5I1KH 3QAZB 3M45A 4AEIL 5A2FA 1DVFB 3EFFA 5L2JA 2IPKB 2APVA 3BESR 4Q9CA 3C5ZD 1TCMA 2IALB 1CICA 4XCEA 2NTFB 3CFEA 4FZ8H 1AIFB 1FIEA 2LABA 5DEGA 2AJUH 3E3QC 5JA8B 3EDFA 1KJ3L 5C0CB 4OZGF 5IMMB 3ULUL 3FQTA 3EFDH 1NFIA 2YD2A 1PJ9A 5D93B 3MNZB 5C7XH 1A7PL 3NABH 2BX5A 5FKPA 5I1CL 1QLEL 5HPOA 3BKCH 4MD0B 5C0DA 1XMWA 1KN4H 5TDNA 1KTLA 4NDMB 1GHFL 2PCPB 3NFPA 4GRWE 4GKZA 3QNZA 1RZ8A 1WZMA 2CRMA 3MUGA 3TYFA 4FXGA 2XWTB 2HWZL 3MRNA 1DBKH 1AE6H 4LU5H 1MWAA 5EBWB 5FGSA 1IZJA 4X4MA 1H3PH 1FBIH 3CX2A 4NSKB 2HMIC 2VR4A 2C3GA 1P9MA 2H1PH 1I7ZB 2FIRT 4MNGB 2FSEB 2MCPL 4ODVH 1CLYL 1L7IL 4XAWH 3QZWG 1WTGT 3LDBB 4UDTB 1ORSA 4M62L 3B3IB 1UXWA 1WBYB 1WICA 4RMRA 2FJFA 4OLYH 1A64A 2EKSA 2HT2D 3AB0B 4M7JH 2V5MA 5DUPH 3U48A 3IJYA 1KB5H 3MA9L 4KTDH 3QDMB 5DRXA 3NVQA 2MQCA 1B6DA 2AXGB 4KU1A 1KLFA 3SE9H 3LHPL 1LO3L 4Q6YA 5I75B 1OB1B 3LCYA 4YXKL 4IS6B 3C60D 5GS1B 2NNAA 4U7SA 2PR4H 4FFYH 1T0PB 1T1YA 4YK4C 3AXLB 4PJ9B 3KYMA 5GSRA 1IM9A 1N4XH 4XNUH 3RIFK 1YMMB 4KV5F 4MNHA 1T04B 4QRPE 3KPSB 4OF5A 5AWNL 1S9WB 3WIHA 1KB5B 3F7QA 5EOQL 4I18A 3DROB 2EO9A 1BZ7A 1B90A 3BRDA 2JB5H 2VAAB 2XA8H 1V3KA 4IIQA 1NDGA 3EHBC 5EZIL 2FZ3B 1K3IA 1P7KA 4KHTL 3U2SA 3GSXA 4DN4L 4X9FA 5GRJL 2R4SL 4BSVB 4LIQH 4P46B 4ZPTA 4DWHA 4WCYH 15C8L 3D3VA 4XAKE 1AR1D 3LPWA 4RGNB 2CDGB 5DO2C 2Z35B 3QUXB 4UOW1 1EHNA 5E2UL 4J3XA 4ELME 3KPOA 2Z9TA 5E8DL 1T1WB 3N1QC 3AGVA 5CSBA 2HT3D 1DCLA 4M4RA 1YN7B 4KKLD 1WAAE 4WI7A 3QEUA 1G9MH 1G1YA 3MRPA 2ZUSA 2WWKO 3BP6A 2FX8L 2PTVA 5TFSL 3QQ4B 4JG0H 4O00A 2VN7A 3UC0L 4H8WH 2YD6A 5CINH 3LIZL 2E6JA 1WC7A 3CD4A 1IKFH 2NZ9D 4LEXH 3QH3B 1DBBL 5B22A 3BYTA 3REVB 1MLBA 3V5DA 3GBMH 4FQ1H 5I17B 3RIAK 4WUKL 3ZMRA 5IGXH 3J7HA 3D85B 4Z76A 1VEMA 1FP5A 3QNXB 1JTOA 4XPFL 1E0OB 2L0DA 4POZC 3TA3C 3QR2A 1IGJA 4AQ1B 1EGJA 4JY4B 3BP4B 4N8VG 1XGTA 3TPKA 1A6VL 1ZT7A 4MQTB 4Z7OE 3U79A 5DD3H 1K5NA 1XT5A 2GFBA 3RWIB 4JN2A 5I15H 4ERSH 4F33B 3C5JB 3H7BB 3P0YL 4Q7DA 2MSPA 4NNYA 4Z7UF 3TBYA 2ATKA 1D3CA 3RVUD 3ZHKA 1JZ2A 2AEPH 1KIQB 4NNPH 1DN0A 3HE6A 4H5SA 4QOKB 1RMFH 3NFNA 5E8OB 3QDAA 4X0KB 2F58H 1V3MA 3S35X 1MCPL 1QFUH 2RFXB 3AY4C 5FA3B 1J05B 3CU1A 2I9TA 3AAZA 1BBJA 1LE9A 2Z91A 4G3YL 4EI6A 5DLMH 4KJWD 3EUUA 1IM3B 1LEGA 1YPZE 5CEZH 5C0EA 3EZJB 1WTLA 2A9NL 4ENED 4AT6A 1RULH 4JFXA 2H45A 1G7JB 5CHNA 1ZANL 3F5WA 4XZUB 4P3DB 5HHVH 1X9QA 5I8EB 3TNMA 1U41A 5C0AD 2VDQH 1I8IB 2VIRA 3DX6B 1JTTA 4RAHA 3MMEA 2RJMA 3O9WC 4U6XA 3EYSH 5I74C 1QNZL 3IB4A 2NY5C 4M7ZB 1KLGB 3LQAL 3WD5L 4HUWA 2J88H 3PWPE 1T89A 2G9HA 5CZKA 2IQAB 3E6HB 3FO0H 3SDYH 2DMBA 4LPYA 4J4PD 3P77B 4IRJB 1A6ZB 2GUOA 4U1IA 1FLRL 5EPMA 4I2XB 4LKCB 4WUUA 5DURD 3QJHB 3SPVA 3S3SA 3WO3B 1FJ1A 2EDDA 4I1NB 1AGCA 5IOPB 3C5SB 2BC4A 4MJIE 5F7EH 3WE6A 4MB5A 1LNUA 5T5FL 4X4YB 5LGHH 1RU9L 4LQFH 1VGEL 4Y1AE 3NFSH 4TVPD 1FYTE 4JHZA 1A02N 3UO1L 4LFHD 4OCSL 4F3FB 1JPSL 5T1LD 3MA7A 3RUGF 2E7LC 3NAAH 4AY0A 1KYOK 3UZQA 2AJ3A 1UACH 2BCKA 3NGBC 3TYGL 5KVFL 3LZFL 1B88A 4JM4H 2Z92B 1FLTX 4L3CA 4Y4HD 1AXTL 2Z93A 3TN0A 4V1DB 1BLNA 4OIIH 3FHQA 1CLOH 5GPRA 3LKOB 1QO3A 4Y4FB 1KCRH 1PYWB 5DC4B 3K74B 4YWGL 3L3KA 3L5WB 1NC2D 4PJXE 3TPUA 4GAFB 2XZZA 2VXVH 4YHKH 4YEEA 3UTTE 3SKUD 3IXAB 1R3HA 2X70B 4N0FA 1GZQA 4V2CB 4P4RB 3X14A 2NX5B 1NMAL 2GITA 3EOBA 3QDGA 3ARBA 4PUBH 4BZYA 2H32H 1T1XB 4U1SA 4JFOA 3QXAB 4DQOH 3QUYB 1TMCB 2Z31D 3NOIA 5C0ND 3UPAA 1KTRL 4JN1L 2P5WB 1IEHA 3VMPA 4FFVC 3QI9B 4P0DA 4CDGC 1MRFL 4Z0XA 2IFGA 1F6FB 1Y6KR 3BPNC 4R7NB 4HFUH 2UWEE 2Q3ZA 3BEVA 4JZOA 4DW2L 4YHNB 5LXGL 3SDXF 3JV0A 3NH7H 1CD8A 1RZ7L 5A2IH 2CRIA 4M93C 4M1CC 5HYSB 3WS6C 1XGYL 4WDIB 2H32B 5GHWL 3VXTA 4X6CE 5ANME 3W82A 4FNLL 2W38A 2PF6A 3JTTA 1EV2E 4UV7L 3U4BH 3QFJB 3N85L 4LHUD 1MOEA 3F8UB 4Z7VE 5MERB 3ROLA 2BZDA 4JHWL 2D7NA 2QQKH 3BO8A 2P45B 4X5LA 3I02B 5L6YH 2EIEA 2MQ3A 1FV1A 3BN9D 4GG8B 3WIIH 5DMGD 1GGTA 4YHLL 2PTUA 4CNIA 2XQBL 2H9GB 4JZJA 3MLRL 4XPHH 4X5XA 3BZFB 1NUGA 4G7VH 5KSUB 1EHXA 2ERJB 5CKGA 3C9NB 4Y4KB 5C07B 2JJSC 4WW2F 4JKLA 4PYHA 1GGCL 1NAML 5EZJB 4LKXA 3QRGH 2FWOA 3EAKA 3O2WH 1QRNB 4BZ1H 2NW2A 4MB4A 3BE1L 4DVRH 2IFFL 5ISZA 1F3DJ 5L8JB 4IJ3C 3RY6A 2HFTA 2Y06L 4NRXA 4WWID 3G6JE 1BBDL 3CSBA 4JAMB 4RA3A 5ESVA 1LP9E 3PWLB 3WN5A 1OTUD 3SEPA 4PJ8C 4NZDA 5I8KH 4YX2L 4M7KL 2DI8A 1NL0L 1XFPA 4R0LA 2EIDA 4G80B 2VDOL 1QBLH 1JNLH 4PLJD 5IBTL 5EOCJ 1SMOA 5D8JL 2R1WB 1PKQA 4NRZA 4QHNB 4Y5XB 1P4BH 4PY8I 4PJAA 4YLQT 5DEFB 5E6IB 2QL1A 3THMH 4P2OA 2FL5A 4KPHH 4NWUL 1H15A 1SM3H 3C8KB 5H2BA 2EDTA 3MREB 3P4LA 4CU7A 3VFTA 4FN0A 4NM8L 3VRIA 3RL1B 1RVFL 5CP3H 1JN6A 4WI5A 4QY8B 1IGIH 5C6WH 1WCBB 5T5NF 3CFBA 1J1PL 4WTZG 5TQ0L 3PWUB 5EU6E 3VXMB 1BQLL 4WU7A 2PXYD 5AZ2L 4OF6A 1WBXA 2OXGA 4K94C 3S88L 3S3JA 1AC0A 2VXQH 1SVCP 2FIKA 4OKVA 4YDKL 3PL6B 1NAKL 1OAXH 2AV1B 4FQPA 4I0PC 4I9WE 4X7EC 4GMTL 1DBAH 2EXYC 1ZGLA 1RZJH 4E5XB 1JPST 3HC0A 3LRSB 2BVPA 4X6DE 2NPLX 3ZTNH 5FGCE 4NRYB 4MAYD 3DNKA 1MAML 1QSEA 4UBDC 2EYRB 1F4XL 4ZFOB 1IGTB 4OD2A 3PXHA 4G6ML 1TIUA 4QT5A 1MHPH 4UOW0 3MLXL 4B5EA 3U0TB 4K8RH 5L9DL 3IU3A 1RFDL 3ULVD 4KVCH 4K94L 2VXSH 1MCSA 1OOAA 3CSYA 4RMVA 3C5ZA 2XRAH 4W70A 3V5HB 2NXYD 3TBVB 1NBQA 5DYOA 1ZVSB 1UCBH 2I60H 3MRKB 1TCRA 4DKEL 3PABA 1NLBL 3UJJH 3TJEL 3PP3H 4OF0A 2PTTB 5DJZB 5DVMA 2Y1VA 4ZAKC 2X4PA 3MROB 4QRRD 5EU3B 1AO7E 2XNAA 3F58L 4X98A 5DC9B 3BHBA 3PF2A 4C83B 1BZ9B 3EGSB 5DHXB 4RMWA 5E8NA 1DDHA 4KHXL 4N0UA 1QA9B 3QQ9C 1NBYA 43C9A 3BRGC 4NP4L 2EZ0C 1L4IA 1LO0H 4XCFH 3WNMA 1H9VA 5K9QI 1FVEA 4E41E 3O6FB 3OQ3B 5D2LE 5ID0B 1XH3B 1KPUB 1M7DA 1XCQA 4D0CA 1UKSA 5ITBH 5EOCH 4RQQA 3WLWC 1HHKB 2J8HA 4EEEA 5KS9B 4HUUB 3DRTA 3OXRB 3R06A 3N0PB 3VXSB 2K9UA 3C87A 2EH8L 5D96B 3GBLA 2VKXA 3IF1B 1SY6A 4OGZA 1KJMB 3SBWA 2YA1A 2QSQA 4KMTH 1MJ8H 5FYLE 4M6MH 3IS0X 3DBXA 2HMID 1R24B 4JQIH 5SX4H 2F53D 3ULSB 3I3DA 3P4MA 2PYFB 4OZHF 2E8YA 3RGVC 4LCYB 4CKVX 1IZKA 3V8CA 4NBYB 2AW2A 4AEEA 2H6PB 3H9SB 3KLAA 5CWSA 5ETUA 5L8LB 2DIJA 2ZUXA 4Y8AA 4U1LA 3U30B 2YS4A 4NN7B 4XCYB 3EO1B 4PJ5B 2R1YA 4LLAA 5MP6L 4U3CA 2YXMA 4JFDB 4O2EB 3PG2A 4JQXC 1JF6A 4NCDA 3C60A 4KKBC 4QHLB 3VXUB 5HVWA 4ZD3H 4LPUA 4NYLA 3QZWA 3GHBH 2A74A 2ADFL 3BN3B 1NANH 4ISVB 1CTNA 4QCIA 1LO4L 1R5IB 1XF3B 4N8PA 3B2VH 5I2IB 1MIML 1H3UA 1NFDA 3MV7A 3EDEA 2DQIH 4ZUUB 4IHOA 5IVNA 4WNQA 4U0RC 3QQ3B 4Y5VB 5HHQB 1EHLL 3CK0L 3JUZA 3O2DH 5FYLL 5T1MA 1I9JH 4XMLH 1C5DB 5I1AA 2APWA 3KPPA 3SQOL 4PIRF 3EHBD 1RIHH 2DQCL 4HGWA 3DGGB 1ZLUK 4PTUA 1LGVA 2GY5A 5DUMH 2X6MA 5IBUB 3MRMA 3V0VB 3NCMA 2DIBA 3RL2A 3WIFB 2NY1C 4U49A 4HHAB 3PHOA 3D2UB 5KN5A 1FL5B 4HWUA 1UXSA 5DO2D 4G6KH 3ET9F 3HE7C 2IAMC 3MRDA 5KBNC 2YPVL 2W9EH 3RWGA 1F11B 2F74B 3QCTH 5IB1B 5BO1H 1BVLB 4QRPD 4YDIH 1UH2A 1GGBL 2E27L 5IK3B 1U8MB 4OGYL 3TT3H 1OWWA 4DJMA 4YAQA 4ZTPH 5IF0A 3PDOA 4U1MB 1XF4B 5I16B 3PGDB 1JHLL 2YWYA 3S5LA 5C9JA 1ZA3A 2DWDB 3RGHA 5BMFH 4LARH 1X44A 3BUTA 2BMKB 3UJIH 3U83A 5DVOA 2I9LA 3I9GL 1ZSDB 3TA3D 4POZD 4RAVA 3DRQA 3HC4L 3RTQC 2E8ZA 1RPQA 4YHOH 4X6BA 5D71L 4JQVC 3SKJL 4A6YL 4XNXL 3RU8L 1R5VA 1XGRB 1U93B 3OGCA 4G8FA 1MFCH 4H26B 4NO0A 2BJMH 1IGYA 1U8PB 4ZTOL 3PGFL 4J6RH 4JM2B 2WBJB 1DE4B 4XB7A 5HHPA 1TZHB 2VXUL 3VE0B 4I8DA 4P4KB 1NC4D 4LCWA 4RFOH 4IMLB 1Z6JT 2D7QA 4L29B 1XGQB 1IGFL 3IKCB 3GI8L 2B1HL 2W0KA 4H1LA 3ARTA 4MJ5B 2BNRB 3T2QA 1D5MB 1OP9A 3T3PE 1JGVL 2QADB 5D9SA 5BS0E 3GRWL 1A6WL 4YFLF 2YD5A 1OAYL 1FFPA 2G75B 1BREA 3BKJL 5C0AA 1TTGA 4UTBL 1BP3B 5L2KB 3BH9B 4RFNB 2EC9T 1HQRA 3TIDA 2FBJL 1KG0B 4HKXB 4LBEB 4ODTH 5DJYA 1KN2H 3SDCB 4FQCL 4FQIH 1WWAX 3MBEA 3O3BA 5HHXH 4PYGA 2EDFA 3HAEB 3GKZA 4L8CB 5IVXB 1HH6A 3H0TB 2YN5A 5C2BH 1EAPB 4G9FB 3ARWA 4IOIA 3ZKXB 1YEHH 4QHKI 3ZO0A 3MLYH 1UZ6E 3GNML 3IDNA 3EDJA 4G42A 1X5KA 2CK2A 5T3XE 2QQNL 1T21A 3BVNA 4XX1G 3QCVH 4PJEB 1G6RA 5C6TL 4F8TA 1VEOA 2ICWI 5GS0C 1U8HB 4KTEH 5DJ2A 2RB8A 5HVGB 1PG7W 3V5KB 4WI9A 1P69B 4OQTA 2P5EB 3MRCB 4U4BA 3IETA 3HUJE 4FABH 35C8H 5DD1L 3PWJA 4FTVD 2C3WA 3BKMH 3LN5B 2PO6B 4UZGA 3E8UH 3MLVH 4JY5H 3CX5K 3HZMA 1A2YB 1Q0YL 3WXVH 4JGJA 3VFGL 2CLVA 3QUML 4F37F 4LSRL 3MXWH 4PJDA 5KW9L 4PJHF 3B9DA 2D4DA 2DF3A 5C0FB 3LMJH 3JWOL 3PWPD 1NC2A 4K3EH 3REWB 3CLFL 4K07A 3RHWK 4GW5B 3GMRA 4FFZL 4Y5YC 2J8UE 5DJ0B 2OTUA 1CVRA 3SN6N 1CFTB 1IC5H 3RVVC 5IB5A 2VWEC 4PGEA 1WBZA 3LH2H 2X41A 3VGDA 4JPKL 3U7WL 3WJLC 4YHMH 2BNUB 4GMSL 4MJID 3FZUC 5DFWH 5CILL 1R5WA 3RBGA 3X3GL 1QSFB 1X6LA 5F7DB 2Z31A 5JMRA 4FP8L 4JO3H 4YFEA 3VRLF 1YNKL 4LSQH 1BQUA 3I6GA 4KC3B 2HLFC 1FL3B 3DJ9A 4RSVA 2OK0H 1UGNA 4IMKC 1SBBA 1UEMA 2QSCL 4LRNH 4FQLL 3IAPA 4HWBA 1NGZA 2G2RB 4FFVD 5CD3A 4UNTA 5DTFA 4ZNEE 4ZPVA 5KVGH 4OLEA 2DQHL 1GC1H 1J1XL 2VLJB 2XZQL 3U7AA 2R69H 3FFCE 4F7CA 5E8PA 4XMPL 3BGFC 2HKFH 1HNFA 5LBSH 2FGWH 3RWEB 3T0AA 1IC7L 2A6IB 4M4PA 2ICES 1E28B 1VKXA 3UTTD 4FXLA 4LHUA 2AJYH 2NLJA 4M1CD 1Z0MA 3FJTA 5I1JH 1FNSH 3TBWA 2IANB 3MFFB 1IILE 5HTSA 2R29L 3WNPA 3ILPB 4XP5H 2BHYA 1CG9A 5BVJB 3GJFH 5IG7A 1IQDA 5LWYL 4DK3A 1G7LA 1T4KB 3ZYOA 4XVJL 5ILTL 3B9KA 3VI3E 1HCFX 1UWGH 4FQ2H 4WY7L 3LS4L 2FO4B 1FSKC 4NO3B 1G7HB 1JUFB 4QRSA 4QEGA 1A5FH 1U95A 5EUOA 2BK8A 5DJDB 3DX7A 4PJGB 4OCXH 3PGCA 4X6FA 5J4MA 1KCVH 1MFBL 1WT5A 1NJ9A 2SEBA 3OXSB 1YYLL 3U0WH 2FCBA 3BQUB 1FNGB 4M3JA 1LE5A 3IXTB 4JFPA 1PG7H 2HYMA 2P8LA 3GMQB 1ZHLA 1BPVA 4HDIA 5GS3A 1X5ZA 5J89A 1Q94A 4JVUA 5I1IL 3RZCB 1HHIA 3CVHA 1FE8L 4AG4H 4PJ8D 2YUWA 3EYVA 5ICZA 1CXFA 3GJFB 1AJ7L 5DMYA 5D1ZC 3TO2A 1HKFA 4PJ7B 5CZVH 1VHPA 3GSOA 3OSKA 1FDLH 3IFOA 1YYMH 4S1DC 4RIRB 5F9AC 1MRDL 2GAZA 1EJ6A 1MCWM 1S9XA 2ZSWB 1EA9C 3UJTL 3DXAB 2ZUWA 1BJ8A 5INCA 5KZCB 2APFA 2APBA 3BKYH 1D5ZB 1KCLA 2PXYA 1IKNA 3GGWB 3BMVA 2OJZH 1HKLL 1FYHB 5HVHC 4JPWH 2NY0D 1YZZA 3G04B 3IFLH 1N5YL 3KR3L 1Y6NR 3D48R 2ZWLT 4K3DL 1UQSA 1U8NB 4LAQH 1A6TA 5IKCB 5JPNB 2JELH 4I0PD 3Q3GA 5A43C 3GMNB 1XZ0B 2EXYD 4OZFH 2ZCKH 4FZEL 1QOKA 2XZAH 3MRIA 3TO4A 4RZCA 3QT2A 1QFPA 5E7FA 4OJFH 4NKIL 1IC4L 5FOJA 4LASL 2AEQH 4UBDD 3U36A 4F2MA 5J6GA 4Z7WA 4GRMA 5C0CE 4QXTB 1E27A 1ZAGA 2XYCA 3V6OA 2CMRL 3X13B 1ADQA 5DWUH 5HPMA 4UILL 1AQKH 2ZPKL 3BEWA 1FG2A 4X7SL 1YEGL 2MPAH 4PP1C 3ZKMC 2JJVA 5L8KB 4XBGA 1U8LB 5CBEA 4FA8A 3QO0A 1SJHB 1FQ9C 2FEEI 5EIIB 4OCMC 2B5IB 3Q6GH 1CE6A 4DTGH 2C5DC 4L4TB 1U58A 3FB7A 2LVEA 3MV9B 3UYPA 3VW3H 5TE7H 1OP5H 2JJUA 3WO4B 2K3TA 1AGFB 4ZAKD 3KLSA 3L3IB 3U4EB 1DVFC 4J12A 3VGFA 3VDAA 2X1XR 3TIEB 1VFAA 3QQ9D 1RQ5A 4EI5C 1BVKA 5F97E 3CMGA 3PNWA 1AGDB 4MNGE 2EZ0D 3GZKA 3RJQB 5DJ8A 3ETBF 3ARVA 1EX0A 4PB9H 2IH3A 2VDRL 5DD0L 4BZ2L 1PZUB 5D93C 4HCRH 3WLWD 3LKRB 1T7XA 4X7TA 5D7LA 4GG6B 4TN9A 1MEXH 5I19L 4H25A 1PDKA 2F53A 3GSNB 2E6PA 4WGWB 1MJ7H 2V17H 4PGDA 3U9PH 3I6LD 1Q38A 3DVNA 5CLTA 1U3JA 2FD6H 2OLDA 5DJ6B 3MRLB 4XP1H 1S7TB 4HUVA 5F21B 3RGVD 1QVOB 1AO7D 3UYOD 4JFFD 4PJBA 1VA9A 4C59B 4ZUVA 1HDMB 4M8QB 1I8LC 2QHRL 3ARDC 1RK1A 4NC0B 3QUKA 4GRLB 1BGXL 5F9WC 1CD1A 4E41D 5JW4M 4B50A 4OFPA 1A1MB 4OLVH 3LDBC 5JXAH 3QIBA 2XIDA 1YMME 5C08E 4CU6A 5I1KL 4HS6A 1TVBB 1I1AB 2O5YH 1FCCA 4JRXB 4NC1E 1YY8B 3KPSE 2EEBA 3AB0C 4MMXC 2L7JA 4KKBD 3GMLB 1MVUA 3IYLW 1I3GH 4EIGB 4I5BB 4ONHB 5LVEA 4FZ8L 1O7VA 2W59A 2AJUL 4NM4H 5DS8A 5FYLD 4HS8H 3WUWA 3CFKA 1F3JA 5DF0A 5JW4R 1OQXA 4UIKL 2X9WA 4GW4B 5DRNB 1JGUH 3VFVB 3EFDL 1HSAA 2F5BH 3IDJB 1N6VA 1ZWIB 1HN1A 3HZYA 4LGSB 3VFRB 5I75C 3SE3A 3NABL 3BPCB 3OKDA 3BGAA 1FN4A 3BKCL 5GS1C 2CIKA 4LCCC 2CKBB 3FTGB 3JWDH 4RGNE 1CK0L 1KN4L 4MCYB 1NCAL 2GTZA 1CR9H 4R96A 2XN9D 5ADPH 2HVKB 1MCKA 5C0JB 4KFZC 1F4WH 2NY2B 3NN8B 1ZHNB 4NC1C 4Z95L 2IMMA 5E8EA 4LU5L 3HLAA 1ZA6B 1H3PL 1FBIL 2B20A 3DVFA 1Q9LA 5IQ9A 4JHBA 3U9UA 1U8KA 2H1PL 2P24B 2CUMA 2WMPA 3SCMB 1VFMA 1A6AA 3VXRD 5DRZA 2NY1D 5FDWB 4CJ0A 4OLUL 4OCLC 1IGMH 4I4WA 4LIQE 4XAWL 5JPMB 5B39B 3QHFH 2C4FT 3DSFH 4P46C 1EO5A 1FFNA 1YQVH 4OIAA 3HE7D 2IAMD 1KPRA 4OLYL 2B4CH 4M7JL 1IAKA 1JI2A 5DUPL 4C56B 4RGNC 5I66A 1KB5L 5E5UB 2ADJA 4P2CG 4F7EA 3QUXC 4KTDL 3MLUH 2B1AH 1MI5B 4ZOBA 4LLUB 1WWCA 4O58H 4Y16B 2VXTH 4UQ2A 3SE9L 4QTHA 4DUXA 2D9QB 2VSDA 3VGAB 2XWJA 3LV3B 3TA3A 5HJ3A 3L1OH 1ZT1B 4Z77A 5KJRH 3FB8B 2VO5A 3OV6A 4X8JA 1DUYB 2W92A 4G6FB 1WFTA 5L0QB 1UKQA 1HK6A 1JJUA 2PR4L 4FFYL 5CJOH 1Y6MR 3RTQD 1F3RB 4WI4A 3MR9A 4FFWC 3A6OA 4PRBA 4ELMA 1A4JB 3QG7H 3CSGA 3DARA 1N4XL 1A1OA 3LD8B 5HHOB 4ZFZB 5J7CC 3QUZB 1C8PA 4XNUL 1JHTA 2F54B 2VITA 4K2UH 5D2NE 4PJCF 1MJJB 5J9PB 1CXHA 4XVUC 5I6XB 3SDDB 3NIGF 3B9AA 1Q9WA 1JV5B 3RX7A 1NC4A 4OZ4A 2XTLA 4NKOB 1XF1A 4S2SB 5KSVB 1TQBB 5BVPH 4X6EB 5JHDD 2YSSA 3AY4A 3CFIC 2JB5L 4P2YA 1AXIB 4ZS6C 4P23A 3RQ3A 4LRIC 3BUYA 4RFEB 2VUOA 3FN0H 3ZE0F 1I7TB 5I8CA 1OAKL 1YEKH 3MO1A 2DKMA 5C09B 4JDZB 4LIQL 3HA0A 5SWSB 4WCYL 1NKOA 3FRPG 3GEWB 3NIDF 4NQXA 3NCEB 3CFJA 4H8WC 4JKMA 4NUJA 3QXTA 4HFWB 1N2RB 4PB0H 5J1AB 1RZFH 1BJMA 3VCLA 2GHWB 2VDNH 2WP3O 4JJ5A 3OHXB 3M1BB 4RAUB 1S7VB 1ZHBA 2BOBB 4NHUA 3GHEH 4Z78B 1CCZA 4JFZH 3DMMB 4JHAL 1OL0A 1A3LH 2NW3A 3O9WA 2CXKA 1R3KB 5E6YA 1G9EA 2ESVB 2Q3AA 2ZOKA 1YJDC 5CEZE 1YNLL 4R26H 1RZKH 1B2WH 4PV8A 4XI5C 1QEWB 5IFAH 1G7QB 1CFSA 5D1XB 4JG0L 1SYSB 3SGDH 4H8WL 4P9MH 4R7DA 5CJ5A 4OV6F 2FJHB 3C2AH 3EKCA 4FQQA 3H3BC 5D72H 4BSWA 1IKFL 2BSED 4KKNA 4R8WL 1WQVT 1FGNH 4M7LH 3DUSA 4MGXA 4YIQB 3GBML 1BHGA 5DVNA 2HJFA 2IJ0C 4J1UB 4P99A 2P8PB 3BIKB 5JW5A 5IGXL 3FFDB 2DYPB 3H9HB 4OF8A 1DLHB 3VGEA 4ALAH 3LN4A 4WU5A 4JFHD 5GS0D 4M7ZC 3VXQB 1T22A 3K0WA 3TNNA 4FTVA 2VR9A 4PR5B 1HHJA 3UXFA 4IRJC 5I15L 3O3DA 3V4PH 4U6YA 4ERSL 4HSQA 1I4FA 2AV7A 1K4DB 5F88B 3SOBH 1RUMH 1T2JA 4F7MB 4M5YH 3DO3A 3DHMA 3SGJC 4P2RD 3L7FB 1T1ZA 5TDOA 1AD0A 1I1FA 2OMBA 2AEPL 7CGTA 4K7PH 3C6LB 2C1OB 2NX5E 3B5GA 3LKPB 5IB3A 1RMFL 2VN4A 3L9RB 4HKZB 3W39B 1KNOA 2F58L 1DQJA 3LKNB 1QFUL 3GSWA 3I2CH 4JY6B 4XMKH 1CT8B 3QEGL 2R0LH 4PRDA 3F7RA 3KXFA 43CAA 4NKDA 3BFOA 4NO5B 5DLML 3SKOA 2P5WE 4RWYH 2GT9B 1IVLA 3AS0A 2EE6A 4LGRB 3RVVD 3EO0B 2EDQA 2ADGA 2DLTA 4HULB 1RULL 1S9VB 4Y4FC 3ZDXF 4N9OB 4N5UA 1BM3L 3RPIA 4HG4J 1PY4A 1UB5A 2VDQL 1A3RH 3EYFB 1N5AA 1YNTB 1IEAB 4LEOB 4ZODA 5E94A 3KLDA 2YUZA 3RWHA 4QYOB 2HLFD 5FGRA 3EYSL 4X7DC 2X4SA 2W91A 5AD0B 2J88L 3AS2A 3FO0L 1HILB 7FABH 5HHMB 5DZNA 1VPOL 3ALXA 1K6QL 2V5YA 5F1NA 5CP7B 3P9MB 1EXUA 2M1KA 3IDMA 2EECA 4HWZB 3VFNA 1T6VN 1FAIH 1GZPA 3QI9C 2AERT 5F7EL 2LU3A 5F1OB 5LGHL 3NFSL 2FB4H 2ZOLB 3FB5A 2WINB 5C07E 4NQSB 5A16B 3RZWA 5EDXA 1V8HA 5D1QB 1FO0H 4GUPB 3NAAL 3RX8A 3VD7A 2DRUA 1MCRA 3GSVB 1QRNE 1UACL 2ITDB 3AU1B 4RDQG 1SJVA 5JW3H 4JM4L 1OSZA 1D5IH 5DHYB 1MHEB 5IW1B 4D94A 1BD2B 3HCVA 4OIIL 3MYJA 3B6SB 4KDWA 4GKNA 2JJSA 5SV4A 1J11A 3PWNA 4JPIB 2R8SH 1W8OA 4G43A 1M71A 1ONQB 4CJ1A 1KCRL 1K4CA 1C5BL 3G5ZA 1DR9A 3WHXB 2A0LD 4GLRI 1CU4H 4NQDA 4QRTA 3MGTB 1M6OB 3DOSA 1Y18B 4HPYH 4Z7WF 2V2TA 2VXVL 3LPGA 3KWWB 4PJFA 4Y19A 4BFBD 2D31A 2GCYA 3DI3B 2VLRB 1NUDA 2ERJC 4GW1B 5JOFB 4ZUSA 2D2OA 4Y4KC 1FO0B 3LQMA 4PUBL 5J12B 2GSIA 3HC3H 5KSBB 4WI6A 5MEPB 1UWEL 4X5WA 4Y8DC 3AMKA 3VXME 4DQOL 2QQLH 3LRHA 4Z0BH 3RWJA 2E9WA 5D1ZD 3HPLA 1XIWB 1ZEAH 4S1DD 1EEUA 3GB7A 1U8OA 1OGTA 2IGFH 3VJ6B 1DZBA 1P7HL 2HTKC 1G7IA 3QJFB 4HF5L 3KPRD 3QCUH 4AK1A 3X17A 4Z7QE 4WFFE 4LSDA 3S4SB 5SV3A 3NH7L 5I8OL 2NY4B 4Y5XC 1CICB 5GGSA 1HOCA 5E6IC 3CFEB 4I0PA 5DEGB 3RIFF 3T2OA 1KXVC 5J1SC 2DQTL 4Q6IA 4KK5C 2FHCA 3D69A 2FATH 5K93A 1GGUA 2IQ9H 3FQTB 4WW2C 3U4BL 4X99B 5LCVL 4LVOB 2QQKL 4XXDA 5L6YL 4M48H 2Q8BH 2R0ZH 3WIIL 5FKPB 3G5VA 1U92A 1J0YA 3JUYA 1YDPB 2Y07H 3PL6C 5DHVB 4XPHL 4G7VL 4RCAA 2DQEL 3QNZB 5TE6H 3IVKB 4K7FB 4MNQD 2A38A 3MUGB 4MHHG 3TYFB 3QNYB 4FXGB 2UZXB 4OZIA 4KROB 1BF8A 4P2QD 3QRGL 1W0VA 1MWAB 3BT2H 4R6UA 3O2WL 4PP1D 5DMIH 3ZKMD 4P57A 4X9GA 4Q9QL 5DRWA 5JNYB 1NLDL 4W4NA 2EYTA 4ZAKA 2A73A 2EICA 4V2BA 4MD5A 4DUWA 2W07A 4OZFG 4LSPH 3VXSE 4BUGA 2DWEA 5I1GH 5I8KL 3SY0A 4MZ3A 1ORSB 5F89A 1QBLL 1JNLL 1DVFD 3VFWA 2E7MA 1F6LL 3TH4T 2FJFB 2EKSB 3OAUH 1EO8H 1P4BL 2QJDA 4RRPG 3RIAF 1YEEH 4EI5D 3MRGB 2ADIA 3WIHH 3GIZH 3LEYL 4ZDHA 3THML 4NNXA 4KPHL 4KRPC 1SM3L 4I3SH 5C0CD 1A4KA 2E9IA 3LVEA 4WFGD 4BKLB 3RWCA 1LQSR 1ZVHA 5FO7A 5J8OA 2KL6A 3K2UL 3O8XC 3PJSB 4X80H 1U36A 3H9SE 3K4ZA 3QEQE 1IGIL 5KANG 3BZDA 3G6AA 1XEDA 4K8RC 4GRWB 3O6FC 4XWGH 1T20A 1TTUA 3GK8L 4AYFA 1W8NA 4XP4H 2VXQL 4PJ5E 2KBGA 4ETYA 2NNAB 3QXWA 1W0WA 5HBBA 1OAXL 2W60A 3QULA 5DA4A 3RGVA 4K9EC 1AO7A 4DEPB 1DBAL 1YEJL 1T1YB 1RZJL 2CIIA 4JFFA 4Q0XH 5J57B 2D0GA 4WO4B 1IM9B 5D96C 3ZTNL 3QB7C 3TP4A 1HQ4B 4D9RE 1CGYA 4HLJA 2ED9A 2Z8WC 3L3JB 1SYVA 1JWSB 1EFXB 1LK2A 4G8IB 2RHEA 5IUSA 1U9KA 2HRLA 1MHPL 2Q86A 1MNUH 3ARDD 4QHUA 1BZ7B 1ZKAA 4K8RL 3VGBA 3P73A 4KVCL 2BP3A 2VXSL 3UDWC 2DL9A 2ZUYA 5T1KB 4JQXA 4IIQB 1NDGB 1GRWA 1XAUA 2X1PA 2XRAL 1JE6A 2XPGA 3GSXB 1UCBL 2A6JB 4HIIB 4D8PA 4ZPTB 3H6JA 1P1ZA 3U30C 4NN7C 3UJJL 4GXVH 3VRJB 2EIZA 1JP5A 2BVYA 1EGJH 4BK4A 4EUPB 2YBRA 3UPRA 3QDMD 2BY1A 1KTDA 5HGDB 25C8H 4MJ6A 2R2BA 1NCBH 4L3AA 3FMGH 3U46A 3KPOB 5C0BE 1ACYH 1FNFA 3FONB 3D25A 2H2PD 1OVZA 1U91A 3BJLA 5MENA 1ZHKA 4QNPE 1LO0L 3OAZH 3MRPB 5JR1H 2XN9A 5KVDH 2QR0A 3BP6B 1F2XK 4ELMF 5E2WH 3PDDA 5I18H 2DQDL 1WAAF 3V5DB 1MLBB 3TM6A 5JQ6H 3OKKB 1YMMD 4Z76B 5CGMA 4N68A 4KMTL 4JFQB 1MJ8L 1IGJB 3VXRA 3PP3K 4M6ML 4Y5VC 5E00A 4OSUH 4O51B 2ZG3A 4JQIL 2WIMA 2QLVB 1QLRB 1QBBA 2DI9A 5DI8B 5CEXB 1ZT7B 4J8RA 3HE7A 2GFBB 2NYYC 4JN2B 5ITFB 5B39G 5IQ7L 4FRWA 2CJUH 5CMAA 4YBHA 5IWLC 4P46D 3TBYB 2ATKB 4G9DA 5ERWA 4A6YA 3MGOB 3RWFB 5J9PA 4PGCA 5I1LA 4Z7OF 5ID1A 3VXPA 1DN0B 3HE6B 5EZLA 3OG4B 4RGND 3JSSA 1T5XB 3QUXD 3C2SA 3F62A 3ZKNC 3LEXA 1F6AA 2I9TB 4JRYD 3IFPA 4HK3N 3M17A 4MDJA 2Z91B 3NTCL 1LE9B 1MH5B 3VU2A 3RTQA 4JO1L 4EI6B 5JIHA 5CEYA 1PAMA 4TPRL 5DMJB 2P43B 1YEDA 5EUKA 4JQVA 2Y7QA 1OP3H 3B43A 1PQZA 4AT6B 4JFXB 4W6XB 4FFWD 4UU9B 3ZDZF 1XF2A 4HZAA 3F5WB 2VAJA 1INQA 1B0GA 2FBOJ 3D85D 5IMOB 3HG1E 3JVGC 2KUTA 4EDWH 1YPZF 2A2QT 2A83A 2VIRB 5JHDA 3MMEB 2DQIL 1TJIH 5AEAA 4CDHA 1A7OH 4CBPA 2OBGA 3DHJA 3O2DL 4HUWB 3BGMB 2G9HB 4ZUTA 4AENB 2UV3A 1I9JL 5L2KE 2Y36H 4ZS6D 1UVQA 1RHHB 4HIEA 1RIHL 3VD5A 2GUOB 4UAOB 4IRZH 4LLWB 4U1IB 4G8GA 1P2CA 2WBJC 4JM2C 5H94B 5DUML 1FJ1B 4EIZC 5IESH 5IVXE 4WGVB 1X4YA 2BC4B 2KQMA 3I75A 4G9FE 3WE6B 4U2ZA 4P4KC 4QOKD 3JV4A 2CLZA 2PYEA 1CDCA 4WFEE 4G6KL 3R8QA 2VDPH 3ORJA 4PJEE 1WUNT 3MA7B 3FT4B 3ZLQC 2O61B 5FF6A 1RZGA 1TQCB 2W9EL 2AJ3B 3V4UH 3DX8A 3QCTL 2BCKB 3ARSA 4QRQA 1X5IA 5BO1L 1YPZB 4EBQH 5B38G 4YDIL 2HFEA 4YR6B 1FZKA 2QADC 5I1HH 3IDIA 2P5EE 2Z93B 5I9QB 3N9GH 4XGZB 5IW6A 3OKEB 3CMOL 4ZTPL 2ICEB 4BH7A 1EEZB 1JZ6A 3FRPA 1WISA 4RFNC 2O5ZH 3NACH 3QUMA 4L8SB 3MNVA 1QO3B 1VADA 1KIPA 3D9AH 5JDSA 1KXTB 5BXFA 5BMFL 2UUDH 4LL9A 3ZYJA 3SDCC 4LARL 3MLTA 2H2SC 1EFQA 3MLSH 4NKMA 1AKJD 1NCWH 1GYAA 3ZKXC 4N0FB 2V7HA 3PIQB 2GW5A 1OT1A 4OLWL 2ICWB 2GITB 3QDGB 3ARBB 4HJ0C 4ORZC 1TDQA 3BZ4B 4P2RA 3MRBA 4IRJD 1MFCL 3UTZA 4JFOB 4X7CC 2BJML 5C0IA 4J6RL 4Y1AB 3MV8A 2CK0H 1PD6A 3P30L 4Z0XB 1IAIH 4RFOL 4XCCH 1S5HA 2ZG2A 4IBLT 4Y5YA 4LDOB 2QKIB 3BRFA 2VQUA 3X11A 5C0GA 4YHIA 4B53A 1F4AA 2MNUA 3QEHA 4N90E 1T3FB 1X4XA 2BDNH 2X4NA 3RWDA 5GSVA 1NEZG 2WSKA 2FECI 4J3VA 4XNMA 3WJLA 2R23A 4H0HB 3MRJA 4V1DD 1ND0A 2OR9H 5J11C 5D5MA 3T77A 4Z18A 3VXTB 5DJAA 2VLJE 5TQ2H 4PJXB 4Y4FD 4LGPB 3STLB 1WFNA 4ODTL 4N8CH 2YXFA 1KN2L 2EC9U 4FQIL 5HHXL 5EB9A 1PX3A 4X6CF 4C54A 4CNIB 4Y88A 1HXYB 1NAMB 4JZJB 5C2BL 1C7SA 3IDGA 1YEHL 2IMNA 1PEWA 2NX5D 3TBTB 3MLYL 2IANE 5EH1A 4J7RA 3QCVL 1S9YA 3EYQC 2NW2B 3KYOA 3FQWA 4RBPH 2VQ1A 2P5WD 5ISZB 4HMEA 3SGEI 4ELKB 4L9LA 3LS5H 3QI9D 2VLLA 5FUOH 1I1CA 1Y0LB 2UWEB 3FN3A 4NRXB 4YUEH 3PDGA 35C8L 1RUAH 3RNKA 4F58L 3BKML 4ODWA 3WNOA 1VCAA 1S7XB 5ESAB 4AQOA 3E8UL 3MLVL 3KPNA 2X44D 4JY5L 4R0LB 4PJGE 2BSSA 4MDIB 3WXVL 1OPGH 2A6DA 3BP7B 3G6JF 3CNKA 4PRHD 1PKQB 4NRZB 2AJZA 4H0GA 5ANMB 1JF1A 3MXWL 3HI6H 5IVZB 3QP3A 4PJAB 1QQDA 5EC1A 4Z7VB 3LMJL 3S98A 4OIBA 4P2OB 2FL5B 1H15B 1RUKH 5H2BB 4K3EL 3VRIB 3UBXG 3QFJD 4L5FL 1LHZA 1JN6B 4A2LA 1LEIA 3OR7A 4IDLA 4PJ7E 5HYJA 3KS0H 3CFBB 1II4E 2AK1H 5JHLH 1TLKA 3DO7A 4WU7B 1IC5L 1WBXB 1B4JH 1T7WA 1DEDA 3DXAE 2FIKB 4YHML 1XR8B 3QWRD 2ARJA 4ODXA 3B5TA 3MRHA 3QHZH 5SX5H 4OZIF 4JO3L 1YUHB 1C16A 4NQEA 2BVPB 4Y4KD 5GGUA 5C07D 3EOTH 4LNRA 1CL7L 2YA2A 2YD3A 1BQSA 3WFZA 3O4OB 1QSEB 5BRZE 2OK0L 1QRND 2DN7A 4LRNL 3MUY1 5CBAA 3BQUC 1RJYB 1LP9B 4M1GH 4R4FH 3BW9A 1NGWB 1TTFA 4QT5B 3KPRA 3O11A 4C57C 1T83C 1P6AB 2D7TH 3IU3B 3I3BA 4AM0A 5KVGL 1J8HA 5D7IA 5HHNB 1GC1L 5TPWH 4NCC1 3CSYB 1EBPA 2R69L 2HTKD 2ZUUA 5DYOB 1ETZB 1BIIA 3TV3H 2FGWL 4FOMA 5GGTA 1TCRB 5EO0A 1AFVH 1SY6H 2F8OA 1C12A 2AJYL 2JCCA 5E6ID 5EU7C 3FL7A 4TNVK 5HGBA 5IIEB 1J0HA 4TUJA 2X4PB 4BK5A 2HG5A 2VLKE 3CFDA 5I1JL 2UZYB 1I8KA 4KK5D 5ACMA 1FNSL 5IW3A 4Y0GA 4PJIA 4X98B 5EU6B 3RNQA 4BFEA 5E8NB 3BH8A 5D7JB 4KDTC 5K59E 4XP5L 2V5TA 5FO8A 1NBYB 3O3AB 43C9B 3QXVA 3QRFM 3VXMD 4HUMB 4O2CA 4L4TE 4K7PY 3MV9E 1NGPH 1FVEB 3R1GH 4MNQA 4HGKC 4KI1A 4PRAA 4X6DB 3PL6D 1UWGL 1M7DB 4FQ2L 2OZ4A 4P2QA 4K3JH 4ONFH 3FO9A 3DRTB 5CUSH 4OM1H 3HR6A 4BH8A 4NBZB 4BQ6A 4NOBA 3AROA 4OCXL 3W81A 5D2LF 4NWTH 3CJJA 4WFFD 1KCVL 2CUHA 5F6IB 2X4TA 1TJHH 3ECBA 3U0WL 4JFYA 2GTWA 2D7OA 4PS4H 4FQHB 5D7KE 1PG7L 3EYUH 3SO3B 3P4MB 1AQDB 3L3OA 1ZLWH 3PQYA 1I9RH 5L88H 4AG4L 2NTFA 1AXSB 3VFOA 2IPUG 4EI5A 2CO6B 3GJFK 2N7BA 3KLAB 5CWSB 1OTTC 5JO5A 5CZVL 2B5IC 3MOAL 1G9NH 1NMCB 1FDLL 3U6RA 1YYML 4HWEH 4U1LB 3NPSC 4BQ8A 2JJTC 3D0LB 3WO4C 1I3RA 1T7VA 4JO2H 4OFYD 1D5BB 2N4IA 2HAZA 4ZO8A 4KRPD 2H8PB 3BKYL 3VD3A 2APXA 2FGZA 1M1SA 3G9AB 1A1NA 1A6UL 1B0RA 4MD0A 1FVDA 4OV5B 4OB5H 2OJZL 2OTWA 5E2JA 1MIEH 2BVEA 4NYLB 4JPWL 1IAOA 3QZWB 4K8RD 3KNBA 3IFLL 4KQ3H 2A74B 3O6FD 4L4VA 4LAQL 4G8EA 1CGUA 2LQRA 5EBWA 5HDBE 3L5IA 4LAJH 2ZCKL 3VXSD 3DGCR 3MTRA 2GK0A 1NFDB 3ARDA 3MV7B 5DD6B 1QFWI 3D39D 4OJFL 5JMOC 2ZZUT 1L0XA 2XTJB 2AEQL 3RKDD 3WHE1 1UENA 4Z5RA 4GOSA 3T0WA 4WNQB 1PLGH 3IAGC 4LP4A 3W9EA 2DMCA 2VDKL 2E7BA 2EYSB 1N7ML 3JV6A 1I1YB 1SBSH 5C92A 1TETH 5DWUL 5T1MB 1TVHA 3QG6B 1LVEA 5I1AB 1AQKL 5HYQB 3TBSB 3AM8A 3KPPB 3M8OH 1KACB 2A9MH 5DUBA 4MA1B 4PTUB 1TFHA 1VSCA 3V6FA 3QDMA 3CXDH 3MRMB 4JVWA 3Q6GL 4OCRH 4DTGL 3RL2B 4HQQH 4ZQKA 4PJ5D 4U1KB 1OB1A 1UXSB 3OTTA 1I1AC 4JFDD 6FABH 3TGXA 4FG6C 4LCCA 3INUH 3VXUD 4NZUH 4D9RD 1K85A 1P4IH 5FB8B 2BRRH 4WJ5A 1LD9B 3F6IA 1MREH 3AXLA 1NANI 5A2JH 3VMOA 1QR1A 4WEBH 3ZTJH 2OM5A 3A67H 3GFUA 4PB9L 1IGCH 4YAQB 4HCRL 4ZUWA 1MY7A 5FUZH 3PDOB 1S9WA 5C9JB 1ZA3B 5EWIH 2BVQB 1J0KA 3DROA 2X42A 1N3NB 4C56E 1H8OA 4E42A 4H1LH 5A40E 1MJ7L 2B2XH 1FGVH 4RAVB 3HFMH 2V17L 3U9PL 2FZ3A 1OP5K 4HIXH 4AIXA 2FD6L 4X6BB 1FFOA 4XP1L 2NY2C 2X10A 4P46A 2DIAA 4HKBB 4QHMB 1R5VB 1EMTH 2NYYD 4BM7A 3ARRA 2RCSH 4NO0B 4ZYKA 4AJ0A 1IGYB 1T03H 2XT1B 3RHWF 2Z35A 5K9OB 3QUXA 1P7QA 5EO9A 4JKPH 4HH9B 5HHPB 4JE4B 1OHQA 5FM5M 4JRYA 5T1DH 3D2UD 4GSDH 4OLVL 5JXAL 1OSPH 4LCWB 2A77H 4R2GB 5HHOE 1JHKH 4X7FC 3T1FB 3ZKND 1T5WA 4Q97A 2O5YL 4OCYH 5B3NA 4TOYH 3MODH 4N8VB 1MFAH 1I3GL 3QQ4A 4WI3A 1G6RH 2VNCA 3DYPA 3OR6B 4NM4L 3W11C 2ZCHH 1EEQA 3FRUB 3QH3A 4HS8L 4TVPH 2YD4A 2OJEA 2ZKHH 4Y16C 5I17A 1G7PB 3DETD 3KVQA 2AI0H 1JGUL 3D85A 4OQTH 5C0AB 2F5BL 3VGAC 1TJGH 4NZTH 5C09E 5SWSE 1HQRB 3T3PF 2VOTA 3TIDB 2AKRB 4NCC2 1FNLA 1REIA 5DJYB 4F7PA 2C3VB 3MBEB 4BELD 2FX9H 1P84K 3JWDL 3KYKH 3RWIA 1HH6B 1N0XH 1CR9L 3H7BA 5ADPL 3LD8C 3QUZC 3IDNB 3HI1B 3OZ9L 3G6DH 3GI9H 4G42B 2VL5A 5EN2B 5D6CB 2Z4QA 5KG9A 3BVNB 1F58H 5I6XC 1KIQA 3SDDC 4Q9RL 4B41A 4LVNC 3JBG7 4QOKA 3Q5YA 4HD9A 4JM2D 2WBJD 1BJ1H 1TQBC 1UZ6F 4LF3B 3MJ8B 3FQRB 3STBA 3CUPA 1J05A 4QXGL 5MI0B 4P4KD 1IGML 1TZGH 1CD0A 4U6VH 3T0EA 9CGTA 1WIUA 2IEPA 4LSUL 2J6EA 3QHFL 2OR7A 5FM5O 3DSFL 5FK9A 3NIFE 5IJVB 1PZ5A 1YQVL 1L6XA 4RMTA 4HEME 3HZMB 5DK3A 2B4CL 3MXVH 5BS0B 2C4FU 4XC3H 3VWJB 2CLVB 4JJHA 2BNRD 3DYMA 3HUJF 2MKLC 4I77L 4PJDB 2QADD 3MLUL 2DBLH 3GMMA 4HWBH 3O6LH 3NA9H 4O58L 5JXEC 1ZMYA 2VXTL 1I8IA 4BFIB 3DMMC 4Z7UA 1CBVH 2DAVA 3FT3A 3GMRB 1AKJA 5KJRL 1KLGA 1CQYA 3SDCD 2H2SD 5D1XC 3BDYH 3VFSA 1S7WB 4HAGA 5CJOL 3P77A 4IRJA 1A6ZA 2J8UF 4G9FD 3QG7L 4TTDC 3UTSA 4I2XA 1R5WB 3OGOE 3QJHA 4LLMA 4U1GB 4Y4HC 4WFED 2H3NA 4HJ0D 4YNYA 4K2UL 3SGJA 3I6GB 2FHFA 1E4JA 1UJ3A 1GH7A 3SGKC 5D7SL 4DZBA 4HV8B 1NGZB 5BVPL 1V7NL 1A22B 2P5ED 1A9BA 4PRIA 3T2NL 5DTFB 3MCKA 4ZPVB 4XNZB 5C3LD 3LAFA 3FN0L 1QP1A 4MQSB 4MXQC 3JV5A 2F5AL 3L3HA 4MA3B 2AJVH 4NQCA 1YEKL 5C2UB 5LGJB 1CFNB 5BV7H 2Z92A 3FHAA 4V1DA 4JPVH 5E99H 2CQVA 3C6LC 4NJAH 1H8NA 3E1F1 4PB0L 2YPLA 2X4UB 1RZFL 1VKXB 3G5XB 2VDNL 3G5YA 1MY5A 3LKOA 4LHUB 4HH8A 4JDTH 2NLJB 3QISA 4BQ9A 5C0NC 1DBJH 5C6PB 4G5ZH 5H8DA 3GHEL 1X5XA 1JNHB 3V4VH 4TQEH 3TBWB 4JFZL 4XRCA 2BY3A 3ARGA 1YMHA 2ZUTA 2MHAB 3IXAA 1PEZA 2GQHA 2X70A 4R26L 2WAHA 3VFMA 2VH5H 5IG7B 1KBGH 5IFAL 1A6PA 4JRWA 4DVBB 1G0XA 1G7LB 4OCNC 2YEZA 3B9KB 2I5YH 1JNNH 3C2AL 3RUGA 5SWZD 4XVSH 3QXAA 4M7LL 1QSFD 2AP2A 2E5EA 2KZWA 3MJ9A 4JFEA 1U95B 4MAUL 3NA4A 5EUOB 1S78C 5HY9A 3S36H 2J5LC 4ALAL 3QI9A 5FM8A 3VI3F 5EOTB 4ONGH 5CSZA 1UEYA 4N90D 3PGCB 4F15B 5GQBA 3C6SA 1BF2A 3ZZ1A 1NJ9B 4UUJA 3EYQD 1RZIA 4XXCC 1BD2E 5BQ7B 1HHHB 5BJTA 1LE5B 3WJJC 4R90H 2Q76B 4JFPB 2P8LB 3FFCB 3T65B 4TNWK 3V4PL 1Q94B 4GLRH 3DURB 1HHIB 3CVHB 2VLJD 5FCUH 1EEYA 1ZS8B 4WEMB 3SOBL 5IHZB 4PRHA 4M5YL 3EYVB 2D7MA 1JVKA 3WS3B 5HYSA 4BUHA 1MFEL 1JYWA 4NN6B 4LCIL 1BWMA 4K7PL 2VLRE 2JCCF 3O4LA 3IFOB 3ULVH 2GAZB 1S9XB 3QFJA 5MERA 5CKAA 1YN6A 1EPFA 4PJIF 4TRPH 3I2CL 5INCB 2OSLA 5D1QC 5KSBE 4XMKL 2R0LL 4GG8A 2P4AB 1ADQH 1QLEH 1CQKA 2DTSA 2PXYB 2IAND 2XV6B 1V3JA 5AZEH 4RWYL 4J3UA 4R9HA 5JOPE 3GSUA 2JIXA 2W9LA 4AL8H 3PHSA 4Y4KA 1UQSB 1A6TB 3UP1A 3DV4A 4MLSA 2X2YA 4JGUA 1QRNA 5HYIA 3SDXA 3TO4B 1A3RL 1HHGB 1XF5A 3GSQA 4NOFA 4N1CA 1H0DA 3WFCH 3BX7C 5DXWA 1SJEB 3BQUD 1E27B 1I8MA 4F7TA 2NXYB 7FABL 3CFCL 2PW1A 5HPMB 3RZCD 1KULA 1FG2B 3CDFA 3OKNA 3VMNA 4QHNA 4Y5XA 1F4YH 1L0QA 3VFPB 5E6IA 3QO0B 2EXWC 2GSGB 1FAIL 1XIWC 1KFAL 1KJ2A 3C8KA 3SKNB 3MBXL 4MAYC 3MREA 2CDFB 2HRPH 4DCQB 1U58B 3FB7B 3RL1A 2FB4L 1AGEA 5KVEH 4WW2A 3DXAD 1WIOA 3O6KH 4GS7B 5KZCD 1WCBA 2V5RA 4MHHI 4PGZA 1FO0L 3PWUA 4YXKH 3ULUC 3BD4A 5MEQA 4X4ME 2NY4C 1VFAB 1HWGB 5JW3L 5ICXB 3PL6A 3MLWH 3DVGB 2C7UA 3PNWB 3HZVA 1HINL 1X5FA 4TULH 1R3LA 1KCUH 3K8KA 4NRYA 5HYEA 3MCG1 2R8SL 1H3VA 5C0RH 4ZFOA 1IGTA 5AWNH 8FABA 1FIGL 5D7LB 1A47A 1CU4L 4K55A 4PG9A 4H25B 3U0TA 1S9KC 1MLCA 4I13B 3CDCA 3W5MA 1R3JA 1CGWA 1LDPL 2XY2A 4P3WA 4JR9L 3V5HA 4FS0A 3FQXA 3HC3L 1HI6A 4KROC 3MRKA 1JWMB 5GJSH 2V2XB 5KANI 4L4JA 4HXAL 4PJBB 2QQLL 1FPTH 1A0QL 4Z0BL 3EYOA 4R4NC 4OFYA 5J6HB 3L3DB 1KGCE 3ME0A 5KSAB 1OTTD 1RK1B 2AJSH 2BRQA 1KYOJ 1ZEAL 2UY7A 3MV9D 4XPTH 1WZ1H 2IGFL 2LE9A 4M7LT 3O8XA 3QIBB 5F3HB 3QCUL 1GSMA 4PY7B 2ZSVA 4HS6B 2OQJB 1UJTA 4POUB 2FX8H 3O6FA 4XP9H 1MWAL 1XH3A 1UM4H 4Z8FH 1HHKA 5KS9A 2F19H 4HUUA 4NJ9L 4YDLB 2D0FA 1DBBH 2IBZY 3WUWB 1F3JB 4HBCH 5C1MB 4U05A 5D7KD 4KMQA 2GJ6A 2IQ9L 3IF1A 3D39A 1HSAB 3IJHA 1Q9KB 3KGRA 2DTMH 3O0RL 3SDAC 2R0ZL 2P7TB 4M9OA 3D3VE 2CIKB 2EDKA 3OKMB 1QPPA 2Y07L 2VQTA 5M95B 1UCTA 4DEPC 3U7YH 3TEUA 2NY3C 4WV1C 2GTZB 3DSNA 4S0TD 3L3GA 4WO4C 5EBMA 3B9VA 5TE6L 2UYLA 2HFFB 2H6PA 1T0NA 3CXHJ 3TFKD 3D0VA 2HN7A 3L5XH 3GO1H 5E8EB 2E9JA 3BT2L 3HLAB 4HJJH 3EO1A 4KK8C 5DMIL 3ILQC 3WLBA 4APQA 5IQ9B 4RMSA 4PREB 3U9UB 4KJPC 4HIJA 4OM0H 1JNJA 2KZ1B 4JFDA 1A7QL 5C08B 4IIQC 4LSPL 5DRZB 4I0KA 3VXUA 4EQ2A 4I4WB 4K3HA 1JFQH 1I1AD 1FFNB 2VTFA 4JRXD 5E9DA 3FO2A 3OAYH 4EQ3A 4OFDA 3QPXH 2IPUK 4FG6D 2WLZA 4OAWA 2Q8AL 2OX5A 4ISVA 3OAUL 4QRUA 1EO8L 1U3YA 5HGHA 4M61B 1K9TA 1R5IA 4OZHA 5I66B 3WIHL 1XF3A 2ADJB 5T3ZE 4AEFA 2ICWJ 4I3SL 5GGQH 2VLMD 3CPLA 3V0WL 2W0PA 4FXKA 4DZ8A 2CH8A 4X80L 1A7NL 4QTHB 2AJXH 4ZUUA 2XWJB 3S5LG 5HJ3B 3QQ3A 1GAFH 2BSTA 1PG7X 4I3GA 4X8JB 1L7TH 4XP4L 3LQZA 1C5DA 2RR3A 3HKFA 1S7RB 3ARZA 2Y25A 4PRBB 4Q0XL 3DGGA 5TE4H 2YRZA 4OF7A 4UQ3B 4C58B 1A1OB 2NY2D 1JHTB 3V0VA 3CZJA 2VITB 3EZ8A 3NCCB 4XC1L 3ZTJG 3FT2A 4OZ4B 5DQJB 1MNUL 5HD8C 3IRZA 2NY5H 4OCSH 4QLRA 2YSSB 3WFDH 4RGOH 3BIBX 4KJQC 4GXUN 4P23B 2LFGA 3BUYB 1VFBA 1JGDA 2NTSP 5E5RB 1F11A 2F74A 3GJEB 5GGRY 1FNEA 4H1LG 1AXTH 1NEUA 3QQNA 1RIVH 5TF1H 4EXKA 2OXHA 4GXVL 4NQXB 1CVSC 3HE6C 4NUJB 3PP4H 4C56D 4YBLC 1EGJL 3B2UD 3W11D 1LO5A 2AQ2A 4WENB 5I16A 4R3SA 4M1DH 2K7PA 5ESQB 25C8L 1MI5D 4JJ5B 5E1AA 4Y16D 3QIWB 2BXYA 1NCBL 2P48B 5T3ZL 1ZHBB 3VXNB 5MEOA 4TUOB 1ACYL 2BMKA 4WUUE 2EDOA 3JVGA 1ZSDA 2E9BA 2NW3B 3O9WB 2LAGB 2OL3A 4RX4D 2BFVH 4JB9H 1DQQA 5ECJE 5JR1L 3H42H 4G6FD 4PV8B 5KVDL 1ZT4B 1SVZA 1CFSB 5E2WL 1XGRA 1S3KH 5I18L 4H26A 1T2QH 2JK5B 4AIZA 3VD9A 5I73B 3LQAC 1JGLH 4HZLB 5D2NB 3DUSB 3O2VL 2HJFB 3QUZD 2BHUA 5JQ6L 5JW5B 2F54D 4JN1H 1MAKA 1IE5A 2Q1EA 1CDYA 2CR6A 1KIUA 4GKSB 3SDDD 1QTYT 1RK0B 4WU5B 5JLZA 4P4KA 1FZJB 3QDJA 1T22B 2ZNWA 4IMLA 1Q1JH 1T89C 2DJUA 4MVBD 3B83A 1HHJB 3ES6B 3RY4A 3RDTA 3O3DB 4UAOC 4U6YB 3HMXL 5B8CC 1I4FB 2BNRA 2CJUL 1D5MA 3BI9X 2AK4A 5C09D 5SWSD 3AREB 4UDUA 1XGYH 1CE1H 2HJLA 1T1ZB 1I1FB 4WHDA 5GHWH 2R0WH 3KJ6H 4CMMB 5IB3B 1BFVH 4XH2B 5F9DC 3PUCA 3BH9A 2VYRE 3QDGE 4ZO9A 2YKLH 4RMQA 2XKNB 4OF3A 4PRDB 1P6FA 5JXED 2HKHH 1TQCC 4YHLH 5E4EB 3KXFB 3DMMD 3OG6B 4NKDB 3FOLA 3HAEA 2XQBH 2AABH 2H26A 4HAFA 4L8CA 5IVXA 2ESVD 4WVRA 1MCIA 3H0TA 3SKOB 3S37H 1D5XA 2V7NA 5I9QC 3SGDI 1KV3A 5D1XD 5ABDE 3CDGA 4L8SC 1G7MA 1ZOXA 5HI5C 4NO2B 3HRZB 4TTDD 3RPIB 4O5LH 3W0WA 4K71B 2PNDA 3BE1H 4QXWA 3S3PA 2DYPD 5E94B 3V5KA 4EDWL 4CL7A 4LLVB 2P5EA 3RWHB 1TJIL 1BBDH 1KIRA 2DJSA 5DDHA 3OF6D 2VDMH 4M7KH 5FYKU 3CAFA 2P1YA 1A2YA 1O5DT 3TWCH 1ZK9A 1KOAA 5IBTH 3CVIH 4MXQD 3KDMA 4L3EA 3RAJH 5F1NB 1EERB 5FFLA 3O41B 1JRHI 4P3CH 4PD4K 1EXUB 5DSCA 1U8QA 3VFNB 1NGQH 1GZPB 2I25N 2HJKB 1T7YA 1OP3K 3C6LD 1QR4A 5LAXA 4KWUA 4JG1H 4GFTB 3LN9A 2FR4B 1OGAA 3E2HB 4LHUG 4KZDH 2XFXB 2VDPL 1EZVY 4M43H 3F7YA 2OTPA 5TQ0H 4S1QH 3VRLE 3OJMB 3CXHK 3S88H 4OLZH 3SGEH 3L6FB 4EKXA 1H3TA 5ISZE 4YDKH 5LQBH 3DECA 5SWZA 1QSZA 5I1HL 3K7UA 3P0VH 1U42A 1ZV5A 1OSZB 1QSFA 3N9GL 3HR5A 1NUFA 3NACL 3PWNB 1FL3A 3KHQA 1M71B 3C09B 3D9AL 3F12B 1K4CB 4CRPA 4YH6A 3G5ZB 4UOJA 3SJVB 4NQDB 2G2RA 4QRTB 1S78D 5FECB 1PKQE 4PJHA 1D7FA 4UMGA 3MLSL 1NCWL 4JZJC 4PJAE 4PJFB 4Y19B 2GCYB 2BNQD 2J4WH 3GIVA 4ZUSB 1J87A 5MHSE 5HHMD 1MFNA 1MAJA 3UBXI 4H20L 2GSIB 4HC1L 3RWEA 2JJWA 4PLKD 3IFNH 2A6IA 4AH2A 4BFGA 1NBZB 3RWJB 4OGAC 3HPLB 2V2WA 3BWAB 3ABZA 3OJDB 4CVUA 1UB6B 2MJWA 4AMKL 3GB7B 3CU7A 4XCCL 1QD0A 4XVTH 1J88A 1G7IB 4R0LC 5D1QD 1TNNA 2UUDK 1QSEE 4KI5E 4UI2A 2BVOB 4JLRB 5HDLA 2E7CA 2IG2L 2WWMC 1IAMA 2BY0A 4YQXL 1UWXH 1HOCB 3Q6FA 4NO3A 1JUFA 1BD2D 1XGUA 1JPGA 2GJZA 2CDEB 4Q6IB 4Z7QF 3D69B 2EH8H 5DJDA 5HI4C 3HPJB 3OXSA 2D9CA 4XXDB 5JORA 1QKZH 4N8CL 3BQUA 1JGEA 3G5VB 5FYKH 4EN3A 2MKWA 4Z6AT 3GMQA 1HH9A 4HK3J 1UM6H 1T83A 2CLRA 2VLRD 1D6EB 1U6AL 2EDEA 5F6HJ 1S5IH 4ZNCD 1NCUA 4YDJA 4KUCD 2NY0C 5DEZA 3SE8H 4N0UE 1WZLA 5F72S 2NQCA 3O4OC 5EFIA 5F96H 1W0VB 1DFBH 5DRWB 2EYTB 3H9ZA 2EXWD 4ZAKB 3LS5L 5FUOL 1XIWD 5JOPD 1D5ZA 2ITCA 4MD5B 5IVOA 4YUEL 1RUAL 1XCTA 2WM0A 4K3GA 5IEKA 4YJZL 3GGWA 3WFHA 2R1XA 2DWEB 4KDTA 3ZE2E 1IEBB 3SY0B 4KXZH 1KB9K 4YFDB 5F89B 3P4OA 3VFWB 3WBDA 3ULUD 1OPGL 3G04A 3BJ91 3K1KC 3EJJX 1GCFA 2NY4D 5KS9F 2O93L 1U8NA 1CICD 5IKCA 3HI6L 5JPNA 3GMNA 4A2MA 2ADIB 1X3DA 4UT6H 4ZDHB 2YUXA 1RUKL 4MYWB 1A4KB 4MJ2A 3RWCB 5D7JC 1NKRA 5FO7B 2XACC 2J2ZA 1CLZH 1MCWW 3BXNB 4O02L 2V5SA 4RBPK 3G6AB 5JHLL 1FORL 4QXTA 4ZFFB 3ZYZA 3CIQA 1I75A 4WRLA 4K23H 5FYLH 1CFVH 1F3DH 1B4JL 1ES0B 1ACZA 1RIUL 3NMEA 1W0WB 2W60B 3QPQC 1FVCB 4JFFB 1NBVL 2CIIB 4O4YH 4MCZA 3QHZL 5IM7B 1U8LA 3EOTL 5HVFB 4MA8H 1SJHA 4KROD 5INDA 4K7PX 1MQ8A 5EIIA 1FC2D 2K7QA 4HT1H 5F6IC 3MV9A 1LK2B 1G84A 4M1GL 4R4FL 5DGRA 4R4ND 1AGFA 3C08H 4P5MA 3CX5J 4D9QD 4BYHA 2VL4A 4QHUB 2G5BA 5F7NC 2D7TL 3P73B 4XPGL 3TIEA 5DR5L 5EU4A 5LJYH 4E0RB 2EDRA 3NZHL 1QFWH 4LLQA 1NFDE 3MV7E 1HXMB 3KPTA 1AGDA 2XTJE 1NMCC 2M2DA 3TV3L 3C8HA 5I1DB 4KH2A 1P1ZB 1AFVL 4AIOA 1SY6L 2IWGA 1U8IB 4MS8C 1A9EA 2EIZB 5IT2H 3MACH 5AUMA 3FQNB 2YBRB 3WUWG 3S97C 3W5NA 5SX5K 3QEQB 4N0RA 4GG6A 4J2XA 4MJ6B 1ZLVH 2R2BB 4OI8A 3WL9A 3GSNA 5GGVH 3D25B 2FEEL 4CVXB 4UV4H 3SDAD 1U91B 4KRNA 1T6WA 2XWBA 2XKSA 5BOPA 5MENB 4U0RB 1ZHKB 2ID5A 4XNQA 1NGPL 3WXWH 3MLZH 3KPLA 5GGRA 2XN9B 3KPMB 3IKKA 3R1GL 1KGCD 3WFBH 2QR0B 4A6YH 1T66C 1I7RB 1QVOA 4K3JL 4ONFL 2NY3D 2WZPD 3ZSSA 3L5JA 5CUSL 4OM1L 4WO4D 4QNPF 1IM9D 1HDMA 2HP4A 1J0IA 4M8QA 4D0DB 5EORH 3PGFH 5F7HA 4HJGA 2XTJC 2X7LA 3V6ZB 4NWTL 3VG9C 1E4KA 1EFXD 3S34H 3VXRB 4N0YH 4KK8D 1J5OH 1A1MA 1MCQA 3ILQD 4OLXH 4PS4L 1MQKH 2XI9A 3EYUL 3N1GC 4KJPD 1PSKH 1TVBA 1AC6A 1I1AA 3GI8H 3LB6D 4JRXA 2B1HH 3VWKB 4J8RB 5T1KD 5L88L 1KLUA 3T1WA 1QBMH 3GMLA 4MA1C 5CLWA 1QLFB 2I07A 4DFHA 1V7MH 2AXHA 2YUVA 4TSBH 2XZCH 4Q2ZA 4CGTA 5CMAB 4WI8A 2PETA 1Q8MA 4G9DB 1G9NL 5CJQH 5ERWB 4HWEL 5I1LB 5KAQF 4GW4A 5ID1B 5I71C 1JYVA 5EZLB 3IDJA 1ZWIA 1CS6A 3QO1A 5C0BB 5F8RC 4IRSB 4YBQC 2FBJH 3A6BH 5FOBA 1H3GA 3IDUA 2CKBA 5CSGA 4EZMA 1MHHB 4URTB 1ZE3C 3ZT5A 3FTGA 3IFPB 4OB5L 2KQNA 4NZJA 3M17B 4KY1H 1MIEL 4MDJB 4CVWA 1J1OH 5CEYB 1LK3H 3UYRL 4KQ3L 2HVKA 1YEDB 5EUKB 5C0JA 1NGYB 3NN8A 1RJCA 4LCWE 5DMKA 4X9BA 4KAQH 4PGBA 3LEVH 4JM2F 1ZA6A 3MV11 1DQMH 3TZVB 1EJOH 4H88H 1XF2B 1R3IL 3SKMB 3WFEL 2P24A 3BP5B 4OUUB 4PRNA 5JHDB 2APTA 1ED3A 5B3JE 3V7AG 4X4ZA 2QEJA 3HHRB 4HWNA 3MQIA 5HD8D 1D6VH 1SBSL 1RJLA 1TETL 5T3ZD 5C0AE 4ZUTB 2F9BT 1RI8A 1M05A 4KJQD 4S1RH 1QFOA 1HWHB 2A9ML 2DM2A 3WKMH 3QUMH 2QSVA 4G8GB 1P2CB 4LSRH 5GS0H 1OWRM 4XAKD 1INDH 3CDYA 3CXDL 1MI5A 3I6KA 4Y16A 4HQQL 1NCCL 2YOCA 5JIKA 3HE6D 3Q5TA 1DQLH 3Q48A 3O3EA 1E4WH 3JV4B 4R2GC 4OD3H 2PYEB 3LV3A 5ENWA 4KRMB 1ZT1A 1ORQA 4ZOCA 6FABL 3FB8A 5IVXF 3INUL 1FAKT 3MZGB 4NZUL 1RZGB 1P4IL 2BRRL 2E7HA 3U7WH 3DI2B 2HFEB 1MREL 3OKOA 1F8TL 1FZKB 1BFOA 1A4JA 4WEBL 4C4KT 3IDIB 3A67L 3X3GH 2XY1A 4PJEF 1I3VA 3QUZA 1IGCL 3KJ4B 5IW6B 4KKCC 3N1MC 2F54A 1JZ8A 4BH7B 3HG1B 4S11A 1VADB 1KIPB 1JV5A 2QSCH 4S2SA 3UAJC 1CYGA 5KSVA 4X6EA 1J0ZA 2B2XL 1FGVL 2OP4H 4GKOA 4OCWH 4PJDE 1S7QA 4LMQE 1MCJA 4CN6A 2VE6A 4HIXL 4RFEA 2L7UA 3IU4L 2V7HB 2XZQH 3P9WB 4QXUH 2BSRA 4JDZA 3GMPB 4YFLI 4M6OH 5EU5B 1DQTA 1EMTL 2LTQB 3MRBB 4P2RB 1BAFH 2RCSL 4ZXBC 2Y72A 1ZXQA 3SHSA 4J4PA 1QHOA 1T03L 4JKWA 3MV8B 1GIGH 1D9KB 3M1BA 3T4AB 4JKPL 1AGBB 5MI0C 1ULVA 4PRPB 4RA0C 5A2LH 5T1DL 5JXEA 4Z78A 3OPZH 3DMMA 1OSPL 1HZHH 1JHKL 2ESVA 4I48A 4PJCA 4MQ7A 4CW1A 2K1MA 3JWOC 3T8XA 4OCYL 2W65A 5C0GB 4YHIB 4TOYL 3MODL 3QEHB 4IOSD 1U2HA 3MGAA 5T1LA 3VWJC 1G7QA 1L9NA 2HTLC 4FQXB 3RWDB 5GSVB 1G6RL 2Y5TA 4Z7NE 4XNMB 4NHCH 3ROOA 1S7SB 4L1HA 4B0MM 2ZCHL 1N59B 5DGQA 5GISL 3MRJB 2Z8SA 1TNMA 2A6KA 2EKJA 4P5TC 4KGLA 3BIKA 4Y4HA 5D5MB 3T77B 2AI0L 3FFDA 3V95A 5DJAB 4OQTL 4WIQA 4CN1A 3NZ8B 4Q74A 2ED8A 2FJGB 2D03L 2NY6B 5HI5D 1WLHA 3SGKA 5I76A 4MQXD 4RGMB 5AYUH 5LGKA 3T09A 1T7ZA 2FX9L 1GGIH 1UA6H 3CZFA 5BZDA 2FLBT 4XPAH 3DX9B 5FA4B 1N0XL 1K4DA 1FE8H 3IDGB 4U1GC 1S8DB 3QDGD 3ARBD 4JVPA 3G6DL 3GI9L 1I1RA 3OKLB 1AJ7H 2AEIT 2Q7YA 4TNVF 5ICYA 3C6LA 2C1PA 2CD0A 2C1OA 4FQJH 3LKPA 4GH7B 1S9YB 1JIBA 5J1TC 3KYOB 3FQWB 3L9RA 4HKZA 4Y1AD 4JZNA 4ORGB 2R0KH 3U82B 1FYTD 1IAII 4JY6A 4L9LB 2VLLB 2VERN 2ATPA 4XNZC 4ZSOA 4RNRA 5IMKA 1IFHH 5T3XL 1TZGL 3OL2A 4U6VL 3RNKB 1O0VA 3IJSA 4LP5A 5EUOE 2GT9A 2WLYA 4X4XA 3VH8A 3AMLA 4XC3L 2A6DB 2FO1A 1RAMA 3KR3H 1N8ZA 3BD3A 2N1KA 2UZIH 5D70L 3GKWH 1JF1B 1S9VA 4OD1H 1CLCA 1QQDB 1N6QL 5EC1B 2W0LA 4UB0L 4FZEH 1FSKB 4PJGF 3O6LL 3NA9L 1JMXA 1Q9OB 1CF8H 2YD7A 3EYFA 3F7VB 1YNTA 4HPOH 3ZT6A 5CFHA 4NQUA 4W4OC 4G6JH 1AI1L 1CN4A 5E7BA 3OR7B 5HYJB 5AD0A 2BNQA 2WK2A 5E2TH 2J12B 3BDYL 3AUVA 3WJJA 2CSPA 3B9KC 4DAGH 4LCUA 5GGTH 1ITCA 2YWZA 1N26A 1WWBX 4M8VA 1H5BA 3MJ7A 2ARJB 4O2FA 4GAJH 4M5ZH 4WW1A 3ZDYE 4NFBA 4ODXB 4PJ7F 5CP7A 3UZEA 1C16B 4NQEB 5GGUB 4LNRB 3GMOA 4L9DA 1YQ2A 5EIQA 4D2NA 1UADC 5TDPB 1HNGA 1GOHA 1MUJA 4F15C 1WT5C 4GAGH 3FB6A 5CBAB 1TVDA 4ZO6A 3VA2C 5ISZD 2JLLA 4TSCL 2A0LC 3BW9B 4OGAD 5D1QA 3O11B 1AHWB 4GUPA 2X1QA 4HBQA 3MNWB 4NGHH 3GSVA 1J8HB 5D7IB 1W72A 1WWWX 2OZ4H 4OUOA 5SWQB 2AJVL 4EVNA 5F9JA 5BV7L 5DHYA 4Y2DC 1MHEA 4JPVL 4KQ4H 3ULVE 1BIIB 5E99L 4NJAL 5EO1A 5EO0B 4ODBD 3JXAA 2WWMD 3HZKB 2VDRH 3JTSA 3LRGA 2YZ8A 4UT7L 3V6OE 1ONQA 1W0YT 3D87B 5HGBB 2FX7H 2R4RL 1DBJL 4M6NH 4G5ZL 3CFDB 4PLNC 2VZVA 5MHSD 1I8KB 3V4VL 5IEHB 4TQEL 4TSAL 3RNQB 3BH8B 2DOCA 3CVHL 3KWWA 5HI4D 1R0AL 3BIAX 5FO8B 2VLRA 3E3QE 1FHGA 2VH5L 5IFJB 1KBGL 4GW1A 5JOFA 5F7MC 1X5AA 3X3FH 3EOYG 4DGVH 2C4XA 1JNNL 2I5YL 2VUYA 4MNQB 3DIFA 4OBSA 4XVSL 5K59F 2KPNA 2NZIA 3BAEH 1TXKA 5BRZB 4IEFB 4BH8B 3U4AA 3WEXA 3IDYC 2QHRH 3S36L 2X5PA 1QSED 4QO1A 3MZTA 4ONGL 5DD5L 4MAYA 1WSST 4MWFA 4JFYB 5TF0A 3UX9B 3QJFA 3V6OC 1K2DB 4R90L 1IQWH 3HNVH 2R2EB 4HX1A 3L3OB 4L8BB 3PQYB 3S4SA 5FCUL 5D7LE 4UTAL 1FL6A 2ORBH 2EDHA 3V9FA 3QIUB 3RVXC 5GRXG 2YMXH 3VFOB 4CMHB 4EI5B 2F53E 4MX7B 5ALCH 5DVLA 1B9ZA 1XGPA 4W6YB 5JO5B 1LO2H 2EDBA 3P4NA 1DEEA 4HUNB 2VLKB 3U6RB 1UYWH 2G60H 3LOWA 4UIKH 3ULVL 3T0DA 4GG6F 1I3RB 4R97B 4GS7C 4X99A 4MXVE 4TRPL 2FYYB 4ODHH 1ADQL 4QRRA 1F02I 5EU6D 4PJBE 3KHOA 1A1NB 5D7JD 2ZJSH 1YDPA 5AZEL 4D0BA 1B0RB 1FVDB 5DHVA 2OTWB 1CK0H 1DUZA 3B5HA 4OT1H 4OZFB 1NCAH 4I9WD 3DUUA 1IAOB 3QAZC 2CR3A 3IVKA 3KNBB 4K7FA 5DK2B 4AL8L 2A1WH 4L4VB 1CDUA 3QNYA 4HIHB 4G8EB 4Z95H 3QXUA 3QPQD 5IR1B 5DFVC 2LU4A 5JNYA 1KEMH 2GEEA 4GQ9L 2GK0B 3ARFB 1CGTA 3ARDB 3WFCL 3TH2T 3B8SA 5F1IA 5F9WB 1U3HB 3W9DA 4Z5RB 1A14H 4OZGB 1J86A 5HDBF 2AXFB 4OLUH 3W9EB 1CFQA 4BQBA 1LMKA 2DDQH 3JV6B 3IDXH 1K8DA 1TVHB 3TVMB 1KTKE 1N64L 1DQDL 3T0BA 5DUBB 2Y6SC 4GO6B 1F4YL 5KSAC 3MRGA 3N1PC 4KKAC 3V6FB 4GBXB 4FHBD 4ZO7A 2HRPL 4BKLA 5GGSY 2OI9B 5KVEL 3HI5L 4MS8D 4ZQKB 3PJSA 2WWKT 4Q58C 3QIBC 3O6KL 3HS0A 4CAGA 5K9JH 3CH1B 3SDAA 2DBJA 4QTIL 4LCCB 3IAQA 1F97A 1WK0A 3MLWL 4WJ5B 3F65A 2X9YA 5K9KA 1QR1B 4YDLC 4WV1A 2QBWA 4TULL 2YN3A 1KCUL 3MRRB 4WO4A 3QBTB 1T66D 1HQ4A 3D1MC 1JZ3A 3L3JA 3VI4E 1BQHG 4ZUWB 5C0RL 1JWSA 1EFXA 3SE3C 4G8IA 2X1WL 2NR6C 1HSBB 2DS4A 3MV7D 2XTJD 2IBZX 4E42B 3KPQB 3FO1B 2H2PC 5T1KA 5C7XL 1KT2B 1I9IH 3T4YA 1BOGA 3TCLB 3MYZA 5DC0A 2GJJA 1FFRA 1FFOB 2H41A 1C7TA 1OAKH 2A6JA 4HIIA 1DANU 1YECH 3MJGX 4JREB 5GJSL 2WW8A 1BEYH 2WUBH 4EDXB 1FPTL 4PJ9C 3VRJA 4ZYKB 2VABB 3CCHA 1ZTXH 3MPCA 4EUPA 2NXZB 2AJSL 1X5JA 5IHLB 2DQGH 5HGDA 1P7QB 4JANA 5EO9B 4XPTL 1WZ1L 1DBKL 1AE6L 1MJUH 4JRYB 3FONA 4HS3A 3DYOA 4JHAH 2KKQA 4XBPA 5H37H 2EEDA 4YBQD 1T5WB 3PV6A 1YNLH 5GRWA 1Z3GH 1JI1A 4MXWH 4XP9L 3V7AE 4ODVL 1UM4L 4Z8FL 4HKJB 1IL1A 2HH0H 2F19L 4LDEB 4QRPA 4R8WH 2OJEB 4HBCL 4U6HA 3OKKA 1AD9A 3MRQA 3L95B 2DTML 4JFQA 4PP2B 4F80A 2J6EH 4O51A 3SE4C 1QLRA 2IH1A 4F7PB 1YJDH 3IGAB 2WQRA 2UVEA 5DI8A 4U1HA 5CEXA 2EDYA 3T3ME 3U7YL 5ITFA 3KYNA 1Q0XH 4NT6B 2CKNA 4P5KA 2HVJB 2R39A 2IADA 3RKPA 2VL5B 1QPXA 4KVNH 1GJIA 3L5XL 3MGOA 2MTPA 2Z4QB 3GO1L 3RWFA 5KG9B 3AS1A 5DQ9B 3QA3A 4HJJL 4BJLA 4NO0D 5IROC 2DKSA 1T5XA 3UZVB 2VDLH 4OM0L 4U1NA 3CUPB 3QEGH 1WAAA 4P23C 2IC2A 3MUZ1 1RUPH 1F5WA 2AQ3A 3V6BR 4LCWD 4R2GD 2B0SH 3T0EB 5C8JA 1O7SA 3ZDZE 1MH5A 1JFQL 3OKYA 5FK9B 2YD1A 1PZ5B 3K2MC 3QPXL 4DK6A 1P4LB 2ENSA 2XA8L 5D6DC 4FTVE 3HMXA 3ZT7A 4UU9A 1G9MC 3NIFF 1MCOH 1BM3H 3EJZC 3QIWC 1URLA 3GMMB 4YPGA 5GGQL 1JL8A 3V2AR 3Q0HA 5IMOA