1WJ3A

Solution structure of the fourth fn3 domain of kiaa1496 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
GSSGSSGTVNVTTKKTPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1496 protein
publication title Solution structure of the fourth fn3 domain of KIAA1496 protein
rcsb
source organism Homo sapiens
molecule tags Neuropeptide
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wj3A01
4RRPG 1LEIB 4Y4KA 5ICYA 4LCCB 1P7QB 3PWUB 4NWTH 2BY3A 3MGTB 4U1SB 5J56B 2ESVA 5CLWA 3V4PH 3WEXA 2HT4C 4OCSH 3VFPA 2G60L 2A83B 3QUZC 2AW2A 4RFNB 1AQDB 3OR7A 5J12C 4XBPB 1DBKL 3QG7L 3T0VA 3ZE1E 1CGVA 4Z7QF 2FEDD 5B4MD 1T6VN 3OJDB 3KXFE 3Q6GH 4XMLL 5DJAB 3VXOB 5T3ZL 3BIBX 4LSQH 1S9XB 5GS3A 5HHOE 4EKXA 4FFZH 5CAYB 1RZGB 1R24B 4TUKL 5DD5H 3G5YB 3LVEA 3D6GA 5INCA 5MEPA 2E9IA 3TBYA 3N1FC 4LHQB 2E27H 3PJSB 1KTDA 5EBMA 4HEPG 2FO4B 3BRGC 1QR1B 2K7QA 4HT1H 4LSRH 3BP5A 2VQUA 1YEGH 4LGPB 1PG7L 1QFWL 4IMLA 3TZVC 4LLVA 2A6IA 3DECA 4ODHH 4QHLA 3JV4B 1DBJL 3OKMB 2OTWB 2NY5L 4S2SB 1A6TA 5F6IB 2CIKB 3FQNA 1BBJA 4Z76B 2V2XA 1U8QA 4JREC 4JRYE 2R2CA 5H37G 4GXVL 5DJ6B 1IAIH 1XF3B 2EDKA 3RGVC 5I16B 3MUJA 5HGAA 3W9DA 2EDOA 5LBSL 3T3PF 1CFNA 5HHPA 4ONOA 4PRHD 1CDJA 3CXDL 1EA9C 1KJ2L 3P30H 4M7LL 5HGDA 3SDAC 1SY6A 1FHGA 4FOMA 1AD0B 3DWTA 4L1DA 4O02H 5CEXA 3L95B 1FG2B 3F12A 3PWLB 5J11C 4I77L 5GSRB 4HHAB 4P3DA 2ZUQB 3GJFA 5CGYC 2CSPA 3P9LB 5JNYA 1FH5H 1MCIA 3P73B 3WFEH 2J4WL 4ZSOB 1KCUL 3GKWH 4Q9CA 4GRLD 4WI7A 5HYSA 4LPUA 1IKFL 3K4AA 2WWMC 1KOAA 3L5XH 5CJXA 2YD4A 5BZWA 1KBGH 2DLIA 2OR9H 2NY3B 5E8PA 1IBGH 1EFXB 3FOLB 2XZAH 1AGCB 2R23B 3V9FA 1S5HB 1AR1C 1KCKA 2J12B 1N4XL 4HMDA 4U31A 4P2RE 3MLRL 3VG9C 4RWYL 3RPIB 1C1EH 2ZSVB 3INUL 3V5HA 1UM5H 2NXYB 4EN3D 3KPSD 2AEQL 1LDPL 3LKPB 3RUGE 3IU4L 2D03L 5IFJB 4MMXC 1F8TL 3IDIB 1GAFL 1A6ZA 4ELME 1JZ4A 1VESA 3BXNA 5ADPH 5EPMB 2QSCH 3OL2A 5L9DL 1P7KA 1CWVA 5D6DC 4TRPL 1FGVH 1G9MC 1C16A 3LDBB 3LN5B 1YNLH 4OLZL 3V2AR 1R3HB 4PGCA 1KEGH 4ZPVB 3MA7A 4Y7MA 1LVEA 3QRGH 1OSZA 5BW7A 4IS6A 4U1MA 1UB5A 1OAYH 5JHLH 3LKOA 3QDJE 4PFEA 1NC4B 3ARFD 1MREH 3ZKNC 3E6FA 3BRFA 1ZEAL 1KTRL 5JIPA 1YMMD 4Y5XC 2CLRA 3CH1B 4ACPA 1FO0L 1A3RH 1I85C 5EU7C 2J8UA 4KRPD 2VC2H 4MJIE 4J6RL 2DWEA 4ODVL 2C1PB 5CZXC 1R3IL 2FIKB 4KI1A 1BREA 4NT6B 1YPZA 3DROA 3QWRD 1P69B 1MRDL 1FORL 2E6JA 1D9KD 4KK8D 2CDGB 2JCCA 4E41A 1YN6B 4OZIA 3QCVH 2AJYH 3G5XB 4NPYB 4XVSH 1QKZL 3HUJB 3WXWL 4PRID 2I9LA 2AP2A 5TH2B 5IROA 4HWBA 1J18A 4YXKL 3ZYIA 3C6LA 4H8WH 1P6AB 1W0VB 4OCXH 3MREB 2A73B 3NMEA 3ROLB 1NAMB 1IE5A 4NRZA 6FABL 3BO8A 4CADA 2DOCA 4FQXA 5HDQL 1A1NB 4LOUD 3BYYA 3TBSB 4D9RD 2Z4QA 3VFNB 3LRSB 3GB7B 3MOBH 2XNAB 3LKSB 3AREA 3U9PL 4ZFGH 4KDTC 1NBYB 2JELH 2OXHA 1VFAA 2NY0D 4OUUA 4YO0B 3WYRA 2DIAA 3CVHH 1IQWH 5DQJB 4PJEF 4GAYA 4FN0A 3LIZH 4ZAKA 1QRND 3IXTB 1MIEH 3K2MC 1TVBB 1QFPA 4BQ9A 1YEIH 4X7CC 5E99H 5ETUA 2YPKB 2VXSL 1UJ3A 1X5AA 4BK4A 1JGVH 3HNTH 1X5XA 4EXKA 2CRMA 4J1UB 2BSTB 1RZKH 2XICA 4PY7A 2BNRD 3QSKB 5DEGB 3WHXB 2OP4H 1PX3A 2D31B 5I1GH 5DXWA 4XWOD 3BGMB 5ALCL 3LEXB 4P46C 4PJGA 4KC3B 4BH8B 3HE6A 2B4CL 4MD5A 3HC0A 2UWEE 4OI7A 1WK0A 3JVGC 5C07D 5TF1L 4AEIL 1BZ7B 4X7EC 2DQCL 4M7LT 3FAWA 4GMTH 1QSVA 1H3WM 3ARYA 4N0CD 3C5ZD 1LGVA 4I18A 2C26A 3ARGC 2EDFA 3KYMB 4LLYA 2BSRB 4GKNB 4PJHB 5BRZE 2EH7H 1OSPH 3PDOB 3KR3L 3VXNB 2IAND 3ARDD 4FQCL 3R06A 2A1WH 1ES0B 3C8KA 4HIIB 5IBUB 5AZEL 1DFBH 4PJ7F 2Y07H 4HK0B 4QRPB 3D39D 4PB9H 3V7AG 1X5GA 3EYOA 3NCCB 3GSOB 3GM8A 3SKOA 1RK0B 1WWBX 5DJ8B 5DT1H 1T7YA 1U41A 3S35L 1KIPA 2EKSA 4N68A 2F8VA 3MRFA 2QSTA 4LCWA 1KXQE 2C7UA 3BVNA 4P4KC 1UADC 3IVKB 1FNGB 5D70H 1IC1A 4XI5C 3UTSD 1XIWC 4PG2C 4WFFE 3L5WA 1KCVL 2CRZA 4L8DB 5EIVA 4JZOB 3QIUC 8CGTA 2ERJC 4TVPH 5GHWH 3T0DA 3I6KB 4PJFE 3WFBL 5LGHH 3I50H 5C0CA 1FQ9C 1FSKC 4TSBH 1MEXL 4MWFB 5INDA 3VI3F 3X12A 5JQHC 3UJJL 5DRZA 4MNQA 2HG5A 1E4JA 1IGTA 3KPNA 3QT2A 5DRWA 3SKNA 2YN5A 1KGCE 4PJCF 3KHQA 3G9AB 4FG6D 4NO3A 1HDMA 2R2EA 4YHLH 4U0QB 1N3NA 1K6QH 2O61A 4FQ1L 4HWEL 3ARBB 1WTLA 3JWDL 2WZPD 3U0WL 3UJIL 2X6MA 1N0LA 3V7MA 1FFPB 4OCWH 3MRLB 2H32A 4Z7UF 4Z7OF 2YRLA 5KSAB 2VWEC 2BMKA 2VLRD 4OD3L 2VDQH 2R0WH 4XPAL 2DIJA 2HTLC 1CXEA 5E1AB 3HG1B 1KN4H 4U7SA 4MAYD 1F90H 4QRSB 3QJHB 5EUKB 5ITFB 2F53A 4EDXB 5FOBA 4FXGA 2NY1D 2P24A 2X4SA 3S34H 1MCPH 1CD8A 4JEGB 2DYPB 4OLWL 4ZFFA 4WHDA 4OLVL 4OCRL 1ZLUK 1XR8A 1IFHH 3N1MC 3NA9H 5K59E 3RFZC 2ICWJ 1QO3B 3AS2A 1V3JA 1ZHNA 5T3ZD 3MRDA 2I60H 1KLUA 2NY2C 4G9FD 2HVJB 2XT1B 1RHHB 1RZIB 5DJDB 2AK1H 5EC1B 4WO4B 2RHEA 3STBA 5ISZB 1T2JA 2NY7H 1YECL 4YPGB 3GBML 1JPTL 5E6ZA 4WU7B 4ELKB 4NQVA 5DMKA 4FQ2L 4NHUA 5JMOC 1MCBA 3GIZH 1QSED 1I3RB 5K9JH 1W72A 2V5YA 2E9WA 3C9NB 5DJZA 4L4JA 2GSGA 1A6UL 1BBDH 4PBXA 2ICCA 5L7XH 4KRLB 1E27A 4HIHB 1T83C 1J1OH 3T0EE 2ADJA 1IM9B 1I8IB 2GITA 3K8KA 3BAEH 5F1NB 3LY6A 3WDIA 3MRGB 5T5FH 1AY1H 2P47B 2P1YA 4LIQL 3IAQA 3SGJC 2VZUA 3FFCB 4ODBD 4DGIL 4WEBL 5KG9A 3O6LH 5KSVB 3UDWC 3OGCA 3FB5A 5FM4A 2ESVE 4ODWB 4JN2A 4GUPB 1YN7A 1A21A 3PV6A 1FNHA 3DMMD 2OJEB 2EH8L 1KXVC 1U8PA 4LCYB 1NCCH 3CVHB 5IVOA 4DKDC 2JJSA 1K9TA 4HC1A 4JO2L 3QZWA 2QQLH 4XVUD 3WLBB 2XZQH 3EFDH 3VGEA 2XTJE 4XX1E 1YEHH 5FAAA 4Z5RA 3DGGB 4BH7B 5E7FA 3MV9D 4GRMB 1NCTA 2GCYB 1PQZB 1TZHA 2ADIA 4HS6B 2VH5L 2VDLH 1I8LA 1E4XH 1TQBC 4FQHB 4OZGB 2BFVL 2KKQA 2DLGA 5IMKB 1GVIA 2ADFL 4QHKJ 4PRHA 3X13A 3F8UB 1J8HA 2EDYA 1HCFX 3ZTNL 4QXTB 1UQSB 1DVFA 3MRHA 1C8PA 3P77B 2DBLL 1J12A 4M02A 1EAPA 4XC3L 3QDAA 1HOCA 2DI9A 4NQUA 4NQED 5A2KH 4GRLA 5E6ID 1B4RA 4XPGH 4NQXA 2P5EB 4JR9L 1S3KH 4PJIA 3RVUD 4FQLL 4X5XB 4C59B 4PR5A 5BZDB 2RGSA 5BV7B 5IWLA 5IHZA 5JDJA 4PRAB 5BXFA 5CP7A 3PGDA 4GBXB 4MX7B 4YHZL 4XMKL 1G1CA 2CO6B 3O0RH 1H15A 4EN3A 5EU6B 1MCRA 4TNWK 1OP3K 4LSDA 4AJ0A 2R4SH 4TULH 4ZNCD 3HNVL 1RUKL 2X1QA 4X0KB 1FPTH 2EDJA 4YEEA 3NCEB 1Q1JL 2X05A 3VFSA 4HJ0C 1QBLH 2FBOJ 4J3WA 4UQ3A 3AFLA 4UV4H 3QQ9C 2AXFA 2VXVL 4YHKL 2ITDA 1LK2A 1CICB 3OX8B 3IFPA 2DQIH 5IV2A 3U2SB 1KN2H 3KYKH 5DK0A 3G5VA 3T4YB 2ZCKH 3KGRA 3MJ9A 5E8NA 4P23A 2BRRH 3ARFA 3DX7B 3TT3H 3PIQB 4ZS7H 5EZLB 3TYFA 4NCC1 5I30H 4LLMB 3MBXL 4G8GB 3QDGD 4UAOC 4G6KH 2F5AH 3RWDA 3IDNB 3KPRD 4Y2DA 1JZ7A 4M43L 4M61A 3QEQB 3EO1B 2OTPA 3PP4L 4L9LB 4MCZB 3NZHL 1XGPA 4S1SL 1KPRA 1FFRA 1HHKA 2EICA 3H3BC 1NAML 3JV6B 2MPAL 2CDEA 1BQHB 3D9AH 5J6GB 3MCKA 3QWRA 4QRRB 1D9KA 1U3HD 4QRTB 4DKEL 3SQBA 1KB5A 2FJGA 3DRTB 4F9PA 3WJLA 2P5WB 3SCMB 4YZFF 4ZOEA 3RRQA 2C4XA 2BSSB 3GUTA 3QI9A 3O4LE 3RY5A 1KCRL 4N8PA 2X1PA 3GRWA 3KJ6L 4XP4H 4BSVB 3SJVD 3O2VH 1FIGH 2DBJA 3CMOL 3CUPA 1U42A 1YPZE 4DQOH 2BNQD 4OUOA 1V5JA 3HR5A 3MLVH 5T1MB 5HGHA 2JCCE 2DMCA 3QIBB 2R15A 4OCSL 5TDPA 4WUUD 2XN9D 5D1ZC 2HT3D 3B4NA 2FWOA 2KZWA 3P9WB 5D71H 3CPLA 3N85L 5TF0A 2AJVH 2JKXA 2ZJSH 3EO9L 3Q6GL 3X3GL 4NIKB 4IRSD 1QRNA 4BQ6A 4KMTH 2DLEA 3C87A 3LKRB 1JNNL 2OR7A 3OAZH 3LCYA 4I3RH 4V1DB 3VRIB 2YS4A 1LO0H 2K7PA 5LAXB 1ZLVK 1NLDL 5DD3L 1FZMB 2DM2A 4Q9QH 2GJ6B 3RKPA 4F15C 4OGYL 1T22A 1CFBA 3GMNA 4FMFA 3STLB 1WWWX 1JF1A 1PVHA 4Z18A 1VPOH 1T66C 2BNRA 3FJTA 1PYWB 3KDMA 5GS0D 4TUJB 3OPZL 3IDUA 2WSKA 3EYSH 1YEGL 5FECB 1T80A 1BZ9B 2R69H 4KKCD 4W70A 5FKPB 5JXEC 1H0DB 1KT2B 1N64H 4FHBD 4R7NB 4NOBA 4PLKD 1N5YH 5HHME 5CJQH 3H0TB 3IJYB 4YR6A 5IJKA 1ZLWK 5D7JC 3WL9B 2QHRH 1T04A 1W0YT 2VISB 5DJ0B 1T21A 4WHCA 4HG4K 4ZXBA 3NFPB 1WIUA 3MXVH 5F9JA 3MA9H 3C08H 3STZB 5ANME 5CUSH 1KCSL 3NH7H 2YBRB 3MZTA 4NKQB 4I3SH 3ARTA 1AGEB 3RZWA 2IANA 3ARDA 4N0UE 2G75A 5C0NC 4XXDA 4PJGE 5DFVD 1I4FB 1MAML 4JM4H 2WP3T 4EIGB 1MRFH 4GXUN 5IVXF 3UROR 1YEKH 4YQXH 1YYLL 3DXAE 3TVMB 1ZS8A 2BC4A 3L5XL 1P5UA 1S7RB 1CI5A 2W0FB 4PYGA 1QYGL 5GIRB 1UA6L 3FB7B 1S7XA 4JFFB 3PWVA 5BOZG 1NCWH 1PGRB 1SBSL 2JJWA 3AUVA 4PJ9C 5L0QC 3P0VL 3MLPA 2EYRB 2QQNH 4G6FD 5D2NA 2VLJA 5F88B 4ZUUA 2LE9A 4CVXB 4KKLD 4RMQA 2DB8A 4FQIH 4QNPF 5DK2A 1IARB 2NMSA 4Y88A 1PG7W 3UBXI 2FBJL 2VAAB 3OKNB 4TNVK 1JYXA 4KRNA 1DE4B 1NUDA 1PJ9A 4G6AC 4RGNB 1HNGA 2LU7A 2QSCL 3Q5OA 5H8DA 3H9SD 4CRPA 3HNSH 1GPOL 3F5WA 1F4HA 4DVRL 4FFWC 4OF3A 1ZTXH 4OT1L 3FN9A 5E5MB 2GT9B 1P7QD 4D0BA 1BIIB 3O8XC 1JIBA 3QRGL 3S96B 3ZE0E 5MEND 2J1KA 1F2QA 4XH2B 3BMVA 2VABB 4O2CA 2NTFA 1RI8A 3OKLB 3NFSH 3X14B 3QIWD 5JHLL 1YEFH 4QXGL 1ACYH 3S7GA 3MGOA 2W59A 1FBIH 1V7MH 3KYOA 1S7UB 2C1OA 3TFKC 5DI8A 3K4ZA 1N2RA 43CAA 2VC2L 3WXVH 4ZFZB 3DO7A 1AXTH 4PGBA 4EI5B 1I8KB 5GJTH 4OBSA 1QFOA 4M6OH 4UIMA 3KPMB 2GSIB 5EO1A 4MAYA 1C5DA 3NN8A 4HS8H 1QLEH 5HGBA 4JFEB 1N7MH 4GKZB 1YY8B 1RZJH 4G3YL 3MROB 4RX4D 1NUFA 5KVEL 4CN4A 4XVSL 5T1DL 5JXAH 4WFEE 4Q6IB 3U30B 5C2BH 1Q94A 1IGYA 3GSNA 3O3BB 3UC0H 4B7IA 3RI5K 5KAQG 4U0RB 4PV9B 2AKRA 3DV4A 5CJ8A 1R3KA 1NQBA 3QNYB 4M5ZH 3ARSA 5CP3A 2IAMB 3BI9X 3RTQC 2DQTL 4YDIH 4X98A 3V79C 4MD0A 2AEWA 5AG9A 4S11A 1QSEA 1P2CA 3K81A 1WT5A 3SQOL 1NMAH 1CS6A 5DJCA 3H42L 4M7KH 3UJTH 4Z8FH 5ILTH 2X4NB 5BO1H 3MFFB 1UZ6F 5L8LB 3GMOA 4DUVA 5CBAA 1HHJB 3MOAH 2O93L 1BOYA 1NCUA 4B53A 4LGRB 4AEHH 3K74B 3F7YA 2IH1A 1B0GB 1UXSB 2IFFL 3WNPA 1ZA3A 1MIEL 5BS0B 1GRWA 1YEIL 1A6VH 4H88L 3PWNB 4IRJD 4OM0H 4JKPH 1VGKA 3VFOB 2Q3AA 3TNMB 1UC6A 3R0NA 4M9OA 4XPFH 3SGKC 5F3BB 4JO4H 2H1PH 2IMNA 1GL4B 1JWUA 3G5ZB 4LNRB 1IGFL 1YQ2A 3HN3A 4UNTA 3TO2B 1EFXD 3KVQA 2FGWH 1A14L 3U9UB 5CJOL 2F19H 3VMNA 2GFBA 3DMMA 1JPSL 4BK5A 1R3JA 5TPWH 2Y36L 3KYNA 4MJ2A 4Z0XB 1J9CT 2NXYD 4HUKB 4J3XA 5FFLA 4MB5A 4Y16B 4MA3B 4LRNH 1RHFA 3B3IB 3C09B 4L3CA 4OSUL 3BN3B 1RUPH 1JUFA 3F7VB 3LV3A 1CG9A 4GMTL 4M1CD 2WIIA 3B9EA 5EBWA 3ZYJA 1KSRA 3S5LB 2VXTH 3MV7E 2X10A 4JN1L 1F6AA 3B9KB 4RNRA 3KLHD 3MYJB 5C6TH 2HH0H 5IB3A 4C56B 5FYKE 1TVDA 2BVOA 4Q9RH 4U7KA 1A8JH 3LPWA 1ADQL 5BV7L 1DR9A 2EDDA 4JHAL 2Y07L 5SWQA 2NCMA 1WC7B 3LMJH 1G6RB 1QVOA 5D1QC 4Q7DA 3S3SA 4LCIH 1LDSA 2DM7A 1XR9B 4G8FA 1YEJL 5GGTL 4YEFA 1A7RH 1IGIL 3FO1B 4QRUA 4U6HB 5HHQB 3IJHB 4L4TD 2A9NL 4D0CA 2R0LH 4WENB 4NQEA 5FUZL 3VWKA 4UZGA 3T4AB 3TIEB 1LD9B 4MJ6B 3P4MA 4WTXA 3HI5L 3UTZB 3V6FB 5KSBF 3T2NH 4LVNC 5F7YC 4UIKH 3RVVD 2A9ML 5L6YL 3O6FC 1A7QH 2CRIA 3VGGA 1J8HE 4M93B 3U0TB 3RWJA 3BE1H 4TVPL 3QNZB 1FL3A 1IEAB 5JW3H 4JFZL 5IVZB 4U2YA 4Q0XH 4PUBH 3D48R 5HDLA 1FNFA 4PP1C 4PRPA 1H8SA 1U8MA 4YC2B 1S9KC 2IPTH 1UZ8A 4PJIE 1TFHA 1MCWW 2X42A 1SJXA 1I1AB 4QF1A 5JLZB 3QPXH 4XCFH 3S4SA 5C0AB 3LSOB 2CKNA 4J3VA 4OZHB 5KSUA 3B43A 1CQKA 1MUJB 2DI8A 4JPVH 3R8QA 3DX9B 5I8EB 1S7VB 3QFDB 4PIRF 4P2OB 4ONHA 4RMRA 4E5XB 1Z3GL 1G7MB 3KPOA 3RWIB 1CXLA 5JQ6H 2OBGA 3DARA 4R0LC 4Y4FB 4TOYL 3PP3H 1FFOB 3MNWB 5IBUG 5SWZE 2BCKB 2WW8A 2Z93A 2IQ9L 5EU5B 4S1DC 5FUCC 3KPRA 1WBYA 4PJAE 3TA3C 3V0VA 2YUZA 4A2MA 4KJYA 2VL5A 2GKIA 4GH7B 3VXRA 5HHOB 5B38A 4MDJB 4NKOB 3OXSB 2YEZB 1UVQB 4QWWD 3UTTA 3P9MB 3WN5C 1AHWA 4OM1L 2HJFB 5D5MA 4YHNA 3VDCA 4P57A 4WHYH 5EU3B 2AI0H 2AK1L 2HFGL 5GGVH 1U8KA 4GRWE 2R8SL 3O3DA 2CPCA 3O9WC 2Z8WC 5DURB 1G7PA 3ZHLA 2APTA 3SJVA 4JM2F 1OWWA 5D96C 1OB1B 1C5BL 1X5JA 3BD5A 4JFOA 1EEZB 3KHOA 1RD6A 5TQ0L 2DMBA 2MKLC 4KK6C 5JZ7C 5BQ7A 3V4UL 3SKMB 5L7XL 3VWJC 4WUUA 5JIKA 2KUTA 1MFEL 2XY1A 2A74A 4QRPD 5J6HB 4JFPA 2H6PA 3VU2A 2M26A 1Z9SA 4TTDC 2XA3A 4FFYL 3HS0A 4HK3J 4QXUH 1YYML 1AY1L 3MRCA 3QXDA 4QHUA 1G7IA 4YX2H 5AAWA 4IRSA 5IK3B 1FAIH 4X6DF 4Z78B 5D9SA 3FFDA 4PJDA 4RA3A 3KWWB 2P46B 3WIHH 5C3TA 5B8CC 2ADGB 2YD2A 4EEEA 4D9RE 1U36A 5I2IA 5F7WC 1CGSL 4I8DA 4F7TA 3D2UA 4WI5A 5FB8A 3CFCL 2QQLL 4JVUA 1VENA 5DQ9B 3RDTD 4NDMA 5C0FA 2CIIB 2X7LB 5E4EB 1NCAH 4X7TB 3ZE2F 2XI9A 3S37L 1JGEB 5K9OA 2G5BA 3RUGB 3TNNB 4YAQA 4QRQA 4XPBL 1IMHC 1KC5L 1HSAA 2DF3A 2HAZA 3V52H 4M62H 4K23H 3TPUA 4L1HA 2GY7B 4G43B 2JJVA 2VZSA 2GK0B 2Z92B 4XP5H 3HLAA 5FYLL 4K7PH 4EOWL 1OPGH 3DVGB 3WBDA 1MCOH 3ARBD 4TSCL 4J4PC 4LDOB 3AGVA 1KACB 2LAGB 4CN1A 15C8L 1NC2A 4POYA 5ESQA 5F9DC 3QUYD 4PGEB 4I48A 5KSAD 3OV6A 4WW2A 3UO1L 1EBPA 1IKNC 4OQTL 4ZYKB 3QDJB 2NY4C 5T33H 1LO2L 3QHZH 4KK5D 4W68A 3ZKMC 1DN0B 2J88L 2P45B 3T1FB 3HG1D 5A16A 5HYJA 1HH9A 1TCRA 3IFNL 4P9MH 5DFWH 5HHNA 3ARRA 4GQ9H 5E5RB 4C4KO 1FL6A 2Z91B 4ZNEA 3WO4C 2L7JA 3THMH 2DYPD 3M8OL 1QEWA 4NN5C 5MEOA 2WQRA 4PJ8C 3O0RL 4WDIA 2WBWB 3TN0B 5HY9A 4OGXH 1CDGA 4DWHA 1KIUA 2BVPB 3LEVL 1G9MH 5CEYA 2HFFB 2ICWA 5D7KD 3HRZB 4PRBB 2NZ9C 3O41A 4YXHH 3OAYH 2AGJL 3H9SA 4O9HH 3RNKB 2AV1B 4CU8A 4WO4D 5IMLA 5ISZD 2QKIB 4NNYA 1OTSD 2HRLA 2VLJE 4U3CA 1HH6B 1LEIA 1P7QA 3RA7H 4I13B 5FCSH 1HHHA 3BJ91 5HHXL 1Q9WB 3LQZA 5H2BB 4U1SA 5KANG 2ZCKL 4OFKA 2OZ4H 4HGWB 5HPOA 3CNKA 2H9GA 1R3LA 3SDDC 1IM9D 2A83A 4KI5E 1AQDA 4XBPA 3EO0B 2ZUSA 4HXBL 4FTVD 2E7LC 3C8DA 5E1HB 3OJDA 5DJAA 3VXOA 4ZFOL 1RJCA 1H3VA 2X4RA 4UT9L 2XIDA 1ZT4B 3FFCD 1S9XA 2EEAA 5C7XH 4X7SL 1RZGA 3G5YA 1NEZB 2WINB 2XWJB 2B7DT 3RAJH 2VYRE 3PJSA 1KXTB 3E1F1 4RX4A 2FO4A 25C8H 1QR1A 2X4OB 1YC8A 5IFHL 3X11B 3D5OF 5FO9B 5CD5C 3SGDI 3QQNA 1CD0A 3PGCB 5E2WH 5DGQA 4PB0L 4GW4B 3JV4A 3OKMA 2OTWA 5MERB 4XP4L 1Q72H 1CDHA 2CIKA 2PW1B 3O2VL 1FIGL 4Z76A 2UWEB 5TDNB 5M7QA 4ALAL 3BPOC 2GYSA 5DJ6A 5MHSE 1XF3A 2VO5A 2Y9RT 5I16A 3J8F7 2UYLA 3LZFH 4QCIA 2DTMH 1O7VA 3O4OC 1J0KA 1MPAL 1A5FL 4KK9C 5C0BB 5C8JB 1AD0A 3IT8D 4HAGA 3L95A 1FG2A 3PWLA 5GSRA 4HHAA 2ZJSL 3FOMB 4OF8A 4F7MB 2FH8A 3IKKA 3ALPA 1N6QH 4NSKA 4JZJC 1R5IB 3P9LA 3DBXA 4U33A 3T3PE 4YXLL 3QUZB 4I9WD 3P73A 4ZSOA 1BFVH 5I1JL 4Q9QL 2P5ED 3MBEB 4Y4HA 2DKMA 3UTQA 3ULVL 1HWHB 1EFXA 3FOLA 4AIZB 1AGCA 1RK1B 1DZBA 4GBXD 2R23A 5SX5K 1S5HA 5CJXC 1CFSB 3RPIA 1IC4L 1G6RL 4R3SB 5EU6D 3S9DB 5E94A 3RVTC 3LKPA 3MZGB 1ZVSB 3B9VA 4J12A 5IFJA 4JHWH 5CEZE 3IDIA 3BPCB 5JO5B 4OF0A 5EPMA 2QSQA 3QDHA 1KLGA 4HPYL 4DGYH 3HMXH 5ACLA 5BVJB 1FC1A 4MGXA 5B3JF 1ZGLM 3NH7L 1U92B 3UYPA 5TE6L 4JREB 3QQ4B 3LN5A 1SJVA 2YK1L 1CICD 1R3HA 2O5XH 4ZPVA 3EZJB 2D2OA 4YBHA 4BZ1H 4TVPD 3UPCA 4PLJD 1AE6L 3L3OB 2Z31B 3RGVB 3PL6C 1OTUC 1NFDB 3HZYB 4JFQB 4I4WB 1ZK9A 2HMIC 4E42A 3H6JA 1YEKL 3BKJL 4TNVF 3I02B 1NC4A 5ALBH 3SDAB 4G5ZH 3NACL 1QPXA 4QYOB 4OFIA 1UWGL 4G8GD 3ULUL 4WV1B 4Z95L 1IGCL 3FHAA 3HI6H 3LKNB 2IH3B 3RZCC 5C86A 5CJ5A 2C1PA 1AXIB 3CAFA 4LSPH 1T20B 3WIFB 4NT6A 3SO5A 3V6OC 3VD3A 5J89A 4QRRD 5CMAB 2CDGA 3RVXD 2FATH 1YN6A 3G5XA 4GFTB 2F15A 1YC7A 2AK4B 4NPYA 4AQOA 3HUJA 3SCMD 1NMCC 2YA1A 5DS8B 5TH2A 1JRHH 2W9EL 3HNSL 4NQEE 1G7JB 2PCPB 4GAJH 1J1XL 3HR6A 4XT1C 1MCJA 4LEXL 1HHGA 2PYFB 4HGMA 1W0VA 1ZTXL 3LQMA 1IZKA 3MREA 5IROC 1A7NH 2A73A 3U4BH 4UT6L 5E6YA 4N9GB 3ROLA 1NAMA 3RY6C 1Q9OB 3C6LC 1MHPH 1BGXL 3U82B 2E7MA 3MXWH 5HVWA 1A1NA 2D0HA 3TBSA 5H94A 3VFNA 1A0QL 3QIBD 1YEFL 3GB7A 4WIQA 1GJIA 4YFEA 4E0RA 2XNAA 3LKSA 3RX8A 2R2HB 2UUDH 5C0DB 1V7ML 4DW2H 4PRPE 1HYRC 5E2VL 1FDLL 4LBEB 4X5WA 2ENSA 2ITCB 4JO3H 3RI5F 1E6OL 3ARUA 3WXVL 3T0EB 4MXVF 3IXTA 4BQCA 2RIKA 3U46B 4AYFA 3EYQD 3MUGB 3BGAA 4FQQB 4BKLA 1TVBA 3BP4B 4O4YL 5GJTL 4DGVH 4V1DD 2YPKA 1BD2E 4OGAD 3SOBL 5DVOA 4HS8L 5DJYB 5C9JB 1VFBB 2HLFC 3JWOL 1I9IL 4MA8L 3HTLX 5MI0C 4HWUA 4J1UA 1LP9F 2BSTA 4G8EB 3D18B 4JY5L 3UAJD 2YPLB 4GSDL 2EZ0D 4AEEA 2H2PD 5JXAL 4MB4A 3BPLC 4TQEH 5DEGA 3WHXA 3NABH 2D31A 4NKIL 1A2YB 1V7NL 3CIQA 4CMHB 2XA8L 1LMKA 5F89B 1RV6X 3LEXA 5F7FA 4ODSL 4N8VG 3T77A 1MRCH 3QUXC 4BH8A 2BHZA 4NBZB 2ICES 3G9VA 4D3CL 4JPKH 1BZ7A 5F21B 4DK6A 3BN9D 1MLCB 5FM5M 2XTJB 3A6CH 3G6JB 3VXRE 1JGLH 3HE6C 3MJ8B 1CLYH 4MXWH 4YDIL 5A2FA 4JANB 5HD8C 4ZD3H 1HIMH 1Z6JT 3KYMA 1E4WL 2BSRA 4GKNA 4PJHA 3TF7C 1X4ZA 3PDOA 4M7KL 3UTTE 3VXNA 3OF6A 5A3ID 1ES0A 4HIIA 5I1CH 1CU4L 5D5ME 1SMOA 4LSSH 4X5LA 1CLCA 1F13A 1NANH 4HK0A 5BCAA 5EFIB 3VFTB 1D5XB 3QWOB 5JPMB 5DVKA 1A6VL 3GSOA 4P5TC 1RK0A 1IQDB 5DJ8A 2PNDA 4N5EC 2CUHA 3QWQB 4UB0H 2P8PB 5I19H 4JO4L 3IDXH 4Y5YB 3AY4C 5EU4B 2FECL 2W60B 5EORH 3P2TA 3IVKA 4YK4B 1FNGA 3B5HA 2ZOKB 1YEDB 5HHPB 2V17L 3VH8A 4BA8A 5HGDB 3GIVB 2BX5A 2HJKA 2Q76B 4GG6A 3E3QE 1OCWL 2AQ3A 5CEXB 3GHBL 4WFHE 2DAVA 3I6KA 5C09D 3WLWD 5L8JB 1A3QA 3QPQC 4F3FB 4K07A 1DJSA 4MWFA 4TPRH 1RUQL 3VXUE 1GCFA 2HH0L 2BRQA 3FT4B 5BZWB 1NUGA 2I24N 2QV2A 4X6FB 4OCYH 4ZUVA 5E8PB 5I1AB 3TJEH 2AJ3B 4NJ9H 4LCIL 3ARGB 3ARBA 4WEUD 4L8BB 1A7RL 2P8MB 2Y1VA 1MFBH 5FO7B 4HPOL 5IBLD 1FFPA 1A4JB 4U2ZA 3SE8L 3MRLA 5KSAA 1HILB 2UV3A 1WTGT 4OLXH 5I1IH 1HYSD 4L4VE 3E6HB 1T7XA 3HG1A 5KBNC 3RIAK 1L7IH 2YUVA 3RU8H 4QRSA 4HFWB 3QJHA 5EUKA 5ITFA 1HI6B 2V2TA 3L7EB 4EDXA 3A6OA 4JFED 5DC9B 5KAQF 4Z7UE 1JMZA 4Z7OE 2EC8A 1J0IA 2DYPA 4P4KB 5GZND 5I6XC 4OI8A 2X89D 1G0YR 2E7HA 35C8H 3BQUC 3NPZB 4U1MB 5HSFA 1MY5A 2YD3A 4KHTL 5ECJE 2OI9C 3BZ4B 1MAKA 3GMLB 1KB9J 1XAUA 5DA0B 1X3DA 3PWPB 2W1NA 1QO3A 3QIUB 4F7EB 5L2KD 4YWGL 5DO2C 5HYJE 1M1SA 4D0DB 1FRGH 4UMGA 2HVJA 2EIDA 1RZIA 2XQYG 5DJDA 4RMTA 3IRPX 1NUNB 4WO4A 3U4AA 3O4LB 4B7LA 5ISZA 2IAMD 3F6LA 1FSKB 4YPGA 2CK0H 4ERSH 1VEMA 4P2QB 1I3RA 4XAKD 32C2B 3C9NA 1V3KA 4DN3L 5CS7A 5IGXL 3VI4E 1EO5A 2E6PA 1KULA 1KTKE 3B8SA 3H8NA 2D7MA 5F7EH 1KUMA 2JB6B 5CILL 1I8IA 3HI1A 4K7FA 5GSVB 1W0WA 2ICWI 2X09A 2I9LB 1YJDC 3MRGA 1CR9L 3VGFA 2W65B 1TETH 3FHQA 3FFCA 1ORQB 1ED3B 2FEDC 5B4MC 3R1GL 1JNJA 4CADB 1GSMA 3AM8A 1NAKL 7FABH 2ZPKH 4ODWA 3MLTB 3QULB 4OCLC 1UH3A 4P59H 1MIMH 3GSQB 4U3HA 5EIQA 1OAZH 2Q86B 5HYEA 2OJEA 2DQUL 2PUQT 4LCYA 3CVHA 5CZVH 1FFNA 5IEKB 4OUUB 4Y16D 3BD3A 3WLBA 4MVBD 3TC9A 5C9KA 4LQ1A 3QBTB 3ZHDA 1OP9A 2JJSC 4ZAKB 4FXKB 1B0WA 3DGGA 4BH7A 1L0YA 1Q0XH 3L1OL 4GRMA 2GCYA 1PQZA 5ETUB 3B9KD 4M7ZC 3SY0B 4C56D 5LKNA 3W2DL 2GQHA 3DIFB 4QTHA 1UKQA 3AVEA 4FQHA 4OZGA 3ULVD 4KAQH 5IMKA 4RAVB 3DTXB 3S88L 5ANMB 5J0BA 4PY7B 1SJEB 2NYYD 3BSZH 4NHCH 2HVKB 5FCUL 2XKNA 2HTKD 4N0UB 4CMMA 4QXTA 1UQSA 3JZ7A 1MJ7H 4YX2L 4HMCA 1M05B 2P8LA 1AP2B 4IBLT 3ZYOA 4IOFD 1NKOA 5ITBH 2A77L 2VDNH 3WIHL 4H0GA 2Y06H 3BKCH 4WUKL 3N9GH 1T89A 2VUOA 3DXAB 4RGOL 2P5EA 2FZ3A 3W82A 2UZIH 2YD6A 1S78D 4WGVB 5BZDA 2X41A 4LLYB 4KKBD 2F5BH 3O6MH 2W0KA 2DQDH 4PRAA 5CHNB 2DDQH 1D6VL 4HQQL 1MOEA 4KFZC 5TGBB 2B1HL 3ET9F 5DD1H 3DYMA 1MHCB 3O3EA 4YUEH 4R4BB 4Y5VC 3VXMB 1RMFL 1T1YB 3ULUD 2I26N 3OB0K 4JKWA 1KIPB 4K23L 1JHKH 4X0KA 2QR0B 3MRFB 1EO8L 4DZBB 1I1AD 5FDWB 5C0AD 1GC1C 5I74B 1MCOL 1CICA 4KQ3L 4YJZL 1DBMH 2XQYK 3OX8A 4OFYA 2VLME 4UV7H 4L9DA 4JQVC 3T4YA 4P2OD 5EBLB 4Y4FD 1BQLL 5GGQL 1I7UB 3DX7A 1IRAY 5D4QA 1I9EA 3MRJB 3PIQA 5T33L 2CR6A 5EZLA 4Z7WB 1ZLSL 1FNSH 1T1WA 3OJMB 4G8GA 3IDNA 1EMTL 1F2XK 4BUHA 3QEQA 1E4KA 3EO1A 4L9LA 4MCZA 4X9GA 4PGJA 4OIBA 3KPNB 5HHOD 3JV6A 2GW5A 2V6HA 3THML 4IIQC 1ZT7B 4KRPC 5A40E 1BQHA 4GRWH 4NO3B 5I1KH 3ABZA 4LMQE 1PAMA 4Y89A 4OGXL 4QRRA 5GRXG 4YHOH 2ZZUT 1G9ML 4PTTA 4QRTA 3N1GC 3G6AB 3DRTA 4O2FA 1UWXK 5EZOH 2O5ZH 4LMQI 2P5WA 3FT3B 4YXHL 4QXWA 4KK8C 1E6JH 5KTEL 1RULL 3T2QA 3RL1B 5EUOB 4HH9B 5DURD 4BSVA 3DUSB 5DJXA 5IB2B 1IZJA 2NX5E 1KV3A 5I18H 5IT2L 4JRYD 2CRYA 3NIGE 4YE4H 4HKBB 5T1MA 4N0FB 1FCGA 1KG0B 3QIBA 4FP8L 3HUJE 4PPTA 5E2TL 1ZSDA 4ODTH 2CMRL 3C2SA 2FL5B 2VLKE 4AL8H 4LOUC 3QDMA 1VFOA 3WKML 1PD6A 3FZUD 1J11A 1A6WH 1X5ZA 2BNUB 4UI2A 4AEFA 5I71B 3LKRA 1DQDL 4V1DA 3VRIA 4K94H 3TV3L 3CFEB 5LAXA 1PSKL 5E0QA 3U1SH 2YD5A 1FZMA 2OMNA 1MCKA 2GJ6A 3RAJL 4NQVB 4S1RH 5I75C 1QFUH 3STLA 4LLQB 2CUIA 2W0LA 1L4IA 1PYWA 2ENYA 2OSLB 4TUJA 5FGCB 2DN7A 3T2PA 3SKUD 3RBSA 3QCTH 5FECA 1BZ9A 5FKPA 4JQIL 5E2WL 1H0DA 1KT2A 4MJ5A 1OF2B 3P4LA 4P2RD 2BDNL 1JN6B 2E9BA 4IJ3C 4R7NA 2V5SA 4XHJD 4HCRL 1Q72L 4KH2A 3L3JA 1F11B 3H0TA 3IJYA 5HI3C 4XWOC 3WL9A 1NJ9B 5DMIH 4U6VH 3GBNL 2VISA 5DJ0A 3GI8L 5KVDH 2I5YH 3NFPA 4NUJB 4LARH 3STZA 1FYTB 3MLWH 3MV7B 3FT2B 2YBRA 2WUBH 1AGEA 4FQJH 1N0XH 3GSUB 3DURB 4BUGA 4N0CC 3C5ZC 3VXQB 3FRUB 1FYHB 4HSQA 5FK9B 4FABH 1TJGL 3HFMH 1X5YA 3JTTB 2GEEA 5EWIH 5F7HA 1BFVL 1JP5A 3QDJD 1GOHA 4NGHL 3VDAA 3TVMA 2APBA 1DQLH 1Q0YL 1S7RA 2W0FA 1TZHB 4QHNA 1ZGLP 4PJHE 4HLZG 2MSPA 3FRPA 5GIRA 3FB7A 4JFFA 2DKSA 3LN4B 4LVHC 4MJID 5DD0H 5A2IH 5KS9F 3GSXB 1WEJH 5AZ2H 1WWCA 2EYRA 1WICA 5F88A 4NNPL 4CVXA 1ZE3C 3TN0D 4LVEA 2VDOH 4RAUB 2VR5A 2UY7A 2JJTC 5D2NC 2EE6A 3FQWB 4JHWL 2VAAA 1S8DB 1BFTA 3OKNA 1CFTB 3ZDZE 5F6HI 3OAUL 1G7QA 3WNKA 2OL3H 1UWEH 2XZZA 1IAII 2EC9U 5LJYH 5D7JB 3P4OB 5E5MA 5C2UB 1AQKL 2GT9A 2WWKT 1BIIA 5F44A 3S96A 4BZ1L 1J5OL 1IT9H 1SYSB 3LKQB 1LNUB 4GG6E 4JPWH 5IHZB 1MI5E 2LFGA 2IC2A 2MHAB 4XH2A 5BXFB 5CP7B 2VABA 1MCQA 1EVTC 1EEQA 1L0XA 3X14A 4NZTH 4JM2C 2V2WB 1CGUA 5F70A 1HHIB 4Y19E 5ALBL 4FG6C 4G5ZL 2IBZY 4DN4L 4XPHH 1CBVH 1S7UA 4H1LH 5F9OH 3IYLW 4S1QL 1IEHA 3QCUL 2XRAH 4QT5B 1DP0A 3DO3A 4KXZH 4ZFZA 3B6SB 4LSUH 1TMCB 4WWKD 4EI5A 1I8KA 3CFBB 2C3HA 3KPMA 5SWZB 4JFEA 5HDBE 4PJAB 2AXFB 4GKZA 1QBBA 1YY8A 1ZKAA 2ITDB 4ONGH 3MROA 3DGCR 1KNOA 4YHIB 4OFVA 4MAYC 5I1DB 5IV2B 2X89A 1ETZA 1CK0H 2K1MA 4Q6IA 4RFOH 5AWNH 5TE4H 1EJOH 5CSGA 2NY1C 4JDTL 2VMFA 3O3BA 4IDJH 1CLZH 4R4ND 3RKDD 1URLA 4UT7L 1HSBB 3E8UH 2WLZA 4PV9A 4HWBL 3TYFB 4R2GB 3VFMB 3QNYA 5FDYA 2ATPB 1QHOA 2IAMA 4LSVH 4W4OC 2BERA 4GRWB 4OD1H 1DBBL 4R4FH 2EXYD 5C70A 2YN3A 3I6GB 3IFLH 3LB6D 1OGAB 1R5WB 1UM4L 1JNLH 5EOQH 3MJ7B 2NLJB 4ORGA 5BRZD 2X4NA 1PFCA 3SGEH 3ETBF 5I17B 1HHJA 1F58H 3D3VB 3IF1B 4FFVD 4JO3L 1IC7H 1ZHKB 3O45B 1V05A 1B0GA 1UXSA 1KYOK 5LWYL 2YKLH 5A2LH 5BS0A 1YUHB 4PREB 3PWNA 5D72L 4RBPK 3PDDA 1TCMA 2PTTB 4XBEL 3REVB 3TNMA 3VFOA 4DEPC 2PW2B 2NY5C 3MBED 5F3BA 3WFDH 5DRNB 5CEZH 1BVKB 1TJHL 3MPCA 4N1EA 4XVTH 3TO2A 5HGHB 3U9UA 3U83A 4ZQKB 4UOW1 1G0XA 2AXHA 4WI9A 1P5VA 4YBQD 4WFFD 2QLVB 1NLBL 4JLRB 4NQSA 1OQXA 4Y16A 4MA3A 4HUMB 3F7VA 3LH2H 3P11L 1JHLL 1WF5A 4ISVB 2X4TB 1JGLL 1GHFH 4YNYB 4YDVA 3NVQA 1CGXA 1RJZB 4XVUC 3S5LA 4N0YH 1ZA6B 3DSFH 5IBTL 3B9KA 3H9ZA 3MYJA 5D7IB 2CJUL 5LVEA 3AS1A 5T1KB 2OQJB 3T0WA 3NPSB 1YNKH 5TFSH 3LS4H 1I3GH 1JF1B 4P5KB 1R0AL 4X8XA 1KGCD 3RTQB 4MAUH 4P2CG 1WC7A 2Z31D 3NA4A 1GZQB 4KTEL 1XR9A 3O81A 4HMEA 4HUWB 5T3XH 4WI8A 4DCQB 3FO1A 2FD6L 4G9DB 4U6HA 5I19L 1VDGA 2DQFB 3H9HA 4G7YH 1RY7B 3IJHA 5HHQA 1OTTD 5DHYB 3SDYL 5CGYD 3T4AA 3TIEA 1LD9A 3V6FA 1NH6A 3UP1A 3GO1L 5E6IC 5E70A 5GRJH 3T0XA 5J3HD 3ES6B 4YGAB 1RZFH 3RVUC 3U0TA 1T1XB 4LRIC 5TJWK 3QNZA 1IEAA 1AI1H 5FXCH 4G7VH 4JKLA 1O0VA 4R7DA 4ZUWB 1AR1D 4ZO9A 2IPUG 3WS3B 4KUZL 1FIEA 3GSWB 5JR1L 3OZ9H 4NWUH 4XC1L 1BF8A 1K8IB 3O2WL 3PABA 2OR8A 5F3HB 5HYQB 1CE6B 3RQ3A 1EHNA 5C0RL 2XWBB 3RIAF 1I1AA 4KTDL 5IKCA 4A6YH 3D0VB 4HUXB 2AABH 5C0AA 3LSOA 3I3EA 4OZHA 4JAMA 2CXGA 2QADB 2VLJB 3UYRL 1MUJA 1OLZA 2ZCHH 3BX7C 4XX1G 5DMJB 5HI5D 3KLDA 3HC4H 3DX9A 5I8EA 1S7VA 3QFDA 4AMKL 4K3DL 1ZGLB 4P3CL 4E5XA 1G7MA 2IFGA 3RWIA 2MOVA 5CD3B 3Q2CA 2X4UB 4K71C 3T0ED 3VRJB 1XF4B 4OLXL 1GOGA 1VERA 1M6OB 2LTQC 4U05A 4JDVB 1FFOA 4M00A 3BZEB 4GAGL 3MNWA 4L29B 3F5WB 2VXUL 3NAAL 2HKHH 2BCKA 5EU5A 3OQ3B 4MXQC 4OFYD 4XCEA 4F58L 3TO4B 5HI4D 1U8OB 4MDJA 4NKOA 1KLFA 3OXSA 1FLRH 3BD4A 5CFHA 2YEZA 5ESAB 5J1TC 3EYUL 4M4RA 35C8L 1UVQA 4U1KB 1FGNL 1JGUL 2ESVD 5DVNA 2NTFB 1AJ7L 3DLQR 4I1NB 4LVNB 4H1LB 4JB9H 2HJFA 3O6FB 3GK8H 4XAWH 5HVHC 1FRGL 5EU3A 4AZ8A 4NZJA 3TBWB 1U3HC 3GSVB 1U3JA 2APWA 3QEQE 43CAB 2XTJD 2VAJA 3ZDYF 5IIEA 2N4IA 1EVUA 3G6DL 3V4VL 2CK0L 1EUUA 4POZC 1OB1A 1RU9L 1JGDB 2A38A 1EEZA 2R9HD 1HKFA 2C3VB 4QRRE 1O7SA 3SKMA 3CFDB 3A6BH 1SM3H 1W72L 2VDRH 1PZUB 2DQGH 2YMXL 2P5WE 5J6HA 2R1YB 4PJBF 3W0WB 1Q94B 1TNMA 2QBWA 2F58L 3GSNB 4NZUL 1CL7L 4X99B 2BY2A 3BEWB 2HT3C 5IK3A 1UCTA 1M7IA 2B4CC 4R0LB 4ZTPH 3RY4A 2I9TB 3KWWA 3LEYH 2CKBH 1VGEH 4KROD 2Q6WB 5GXBB 2ADGA 1AO7B 7FABL 1TJIL 3HPJA 4IRSC 4L5FL 3HAEH 4Y8DC 4P59L 5JORB 1CIUA 3MLSH 2I25N 3QYCA 3BUYB 1L7TH 3CSYB 5FYKL 3QDME 1TZIB 3GMOB 1G9NL 3OAYK 2FB4H 1T03L 2B0SH 3EZ8A 5FYJU 1OAUH 5IB5A 2NR6D 4HC1L 2CIIA 4X4XB 1TTFA 3EDFA 2IH1B 2MNUA 1C7TA 4X7TA 5ACMA 1ZA3B 5FGRA 3MO1B 3WN5B 1JGEA 3RUGA 1NGPH 5CWSB 3TNNA 5M94B 4KKCC 5LXGH 1F45A 4I0PA 2GJ6E 3MOQA 3G04B 3GI9L 4PLKC 4OZFH 4G43A 5FO8B 3MX0A 2GK0A 3RWHB 2Z92A 5FIEA 1U93B 1ITBB 5FYJE 5D96B 4X6CF 1IGMH 3LQAL 2GFBB 3CU7A 3DVGA 1F4XH 5AUMA 1A1OB 1OP5H 3PNWB 1MJ7L 1IJ9A 1WWAX 4PGEA 4YDKH 2ZNWA 1IC5H 5DFVC 1CVRA 5DTFB 4ZYKA 3LV3B 3VFVB 3BKCL 3N9GL 1JZ2A 2CGRL 1DN0A 1WAAF 3MSPA 3T1FA 5JIIA 1I9RH 1ITCA 5FHBH 3GEWB 2Z91A 4U1GC 4XP6H 4JCLA 4P4KD 3M07A 4XHQA 1RIHH 3SE9H 1RUMH 4KVNL 3NCYS 5C0GB 4TVSa 4XI5D 3B5GA 2BVPA 3VFWB 2HFFA 3JWDC 1PEWA 4HDIB 3QIUD 1J1PL 4KKLC 4LAQH 1RVFH 3HRZA 4PRBA 3RNKA 2AV1A 4JFFE 3MRBB 3O4LD 3VWKB 5DMGD 1E4XI 3I6LE 2APXA 5F97E 3ULVF 2QKIA 4XWGH 3OJVC 4XCYB 5DZNA 4DVBB 1F4WH 1QACA 2B2XH 1I9JH 3CDGA 1Q9WA 1OAQL 4EUPH 4YBLC 5H2BA 3QJFA 4U1IA 4ODXB 3PV7A 4HGWA 4JFXB 2XPGB 4RMWA 4LCCC 2J8OA 3NCBB 3O2DH 1FL3B 4UDTB 4RGNE 5HPMB 3GJFK 3LRGA 4WTZA 1B2WL 3ISWA 3EO0A 3PGFH 3MJ9L 1BIHA 4PBWD 1WCQA 3WJJA 2VSDA 3QIWC 4XP9L 4KJPD 3P40A 3SPVB 2O5YH 3QA3B 4OTXL 1XH3A 1BD2B 1NEZA 2WINA 4FQXD 1UACH 4NO0B 2XWJA 2DQJH 1N6VA 1A3LH 5KSUB 3IDGB 4NO5B 4DOHE 5B22A 1CDYA 1EEYB 3FCTB 2DMKA 3X11A 5I1HH 4LDEB 5FO9A 3WO4B 4Z6AT 5EA0L 2QL1A 1H3PH 1E6JL 4NN5B 3PGCA 3ULUF 4GW4A 5K9QG 4ZAKD 5MERA 2PW1A 5D2LF 1NGWB 2IPKB 2X2YA 2UWEA 5DZOA 5TDNA 5KZCD 4X6EB 5C6WH 2W0PA 4RWHA 1RFDL 1KF9B 1MWAH 3M1BB 4GKSB 3VXRB 1BF2A 4NZDA 1MJ8L 5B38B 3FQXB 5I15H 1KTLB 4M5YH 4N8CH 43C9B 1U91A 4DAGH 5C0BA 5C8JA 1J05B 3F58L 3UTTB 2PXYC 2VZVA 1AXSB 1AHWB 1QFWM 4DUXA 3FOMA 3EOTL 4F7MA 3TWCH 1XF5B 3TYGL 3ZE1F 1JWMB 1R5IA 4Z7NE 3SDDB 3WD5H 3QUZA 2DQHH 4OV6F 1GGCH 4K94L 1H9VA 5DD6B 4AIXA 5I9QC 3DXAD 3S3JA 3MBEA 1XF1A 2UVEA 4HJJL 4PJ7B 2Q20A 4L3EA 4IRJC 3ELAT 4FZ8L 4AIZA 4MNGE 1RK1A 2VDPL 4PGZA 5F93C 1VA9A 5DEZA 4KUCD 4M03A 1XGYH 5E00B 4R3SA 5BS0E 4G8IB 1ZVSA 1GGIH 3QXDB 2F54E 5I8KH 3BPCA 5DMIL 2CKBB 3HE7C 5JO5A 1WZLA 3WIHA 5SWSB 3WNLA 5BVJA 3FFDB 1P53A 4KQ4L 2BVUA 5HBBA 1EBAA 3VXUB 2AJXH 1U92A 4D9QE 1XCTB 3Q6FB 2UUDK 1QSFE 1RIUL 1YQVH 2JTDA 3QQ4A 4M1CC 1A6AB 3FL7A 2C3XA 3BPOB 3D2UB 3L3OA 3RGVA 4M8VA 1NFDA 3HZYA 3HFML 4JFQA 4I4WA 3KPTA 3O4OB 4JG0L 4NDMB 4WY7H 5EWIL 3I02A 3SDAA 4N5UA 4R90H 4QYOA 5I0ZA 4NM4H 2H26B 2H2SD 4OZFB 1F3JA 3D25A 3TGXA 4PJCB 2Z35B 5TE7H 3LKNA 4UTAH 2IH3A 1CLOH 2EKJA 4QOKE 4L4VB 4NKMB 3TCLB 4YHML 5I1LB 1T20A 2W9DL 3WIFA 3WE6B 4MDIB 3MLYH 4YDLC 2R2BB 5CMAA 1Z2KA 2IQAA 4XBGB 4Z7UB 4LLWA 3SDXF 2AK4A 1I8MB 4WI3A 1W8OA 2GAZB 3RVVC 3MCLL 4WFED 5DS8A 4YHYB 2WAHA 4I48B 5GJSH 1G7JA 2R29L 2PCPA 4ELMF 4PP2A 3BDYL 2PYFA 2VNCA 5HYJB 2BVQB 3AS3A 1Q9OA 3VCLA 1IT9L 1FP5A 1LEGB 4JPWL 1WCBB 2LVCA 1ZXQA 5D6DA 4WDIB 4PLNC 2R2HA 3C5JB 4FZEH 4ZTOL 5GRUH 4U1LB 5C0DA 4HBCH 4JO1L 4XPHL 4LBEA 1CFVL 1N6UA 3D0LB 3PL6B 3MRQB 1VSCA 3SDCB 3T0EA 2Y6SD 4JPIB 4XVJL 2XZCH 3MUGA 4M1DH 4FQQA 4HF5L 3BP4A 2UZYB 1U8HA 4NUGL 1B3JA 2HT2D 1EIBA 1K4DB 4JHBA 3T3MF 3HB3D 5C0AE 5C9JA 1VFBA 4NM8L 2X70B 1KJ3H 4ONGL 1VHPA 3RZCB 2DQEL 4HKXB 4G8EA 4MXVE 3D18A 1HHHB 2YPLA 4UINL 3LQZB 4RFOL 2DICA 1A2YA 1ZANH 2MQ0A 1UKTA 1KYOJ 4XNYH 2H9GB 1R3LB 3NCYP 4IDJL 4C83B 5F89A 5GS2D 4F80A 1A7BA 3FO2B 3VXSB 3V0WH 2IBBA 3E8UL 3GSNL 4QWWC 2FHBA 1P4IH 4MMZC 2R0ZH 2MTPA 5KVGL 1WGOA 1MLCA 3E2HC 5HYIA 3VD7A 2X4RB 3G6JA 1NMCB 3SE4C 1KJMB 4LSVL 1UM6L 3MJ8A 4M1GH 5D93B 5LCVL 5T1LB 4JANA 4MS8C 2HA1A 3MV7D 4OF7A 1YJDH 4JHZA 5E24E 5GGVY 5FYKD 1OT1A 4HXAL 2FJFB 4LSTH 5EOCL 3RBGA 4XMPH 2D7OA 5AG8A 2DM3A 1DEEA 1N5AB 2OJZL 4ZDHB 1MHHB 3I84A 1U9KA 5EFIA 5IP4A 1MFDL 3VFTA 1D5XA 3QWOA 4KHXH 4HCRA 1DANU 2IF7A 5JPMA 3UEZA 2G9HB 5HJ3A 4QTIH 2K3TA 4EBQL 1IQDA 2UZXB 3H3PH 1RURH 3C2AH 2P8PA 5E08H 1MWAB 2AEPH 4Y5YA 4DKFH 5EU4A 5CEZL 4FQPA 4X6BB 1NL0H 2W60A 5FKAB 1C5CL 4WWID 4X4MA 2OTUA 1LO3L 2ZOKA 4TYUA 3CU1A 3RNQB 2WBJB 3FKUS 1YEDA 1XGQB 2UYLB 4QCIB 2OK0L 1MF2L 3GIVA 4CKVX 2Q76A 5IQ7H 3X17A 1J8HD 4HFUH 4YLQT 2B1AH 4LK4A 2AERT 5J57B 1DVFD 3BPLB 2AJSH 4F3FA 4ZUSB 2FGZA 5DF0A 4NSKB 3WFCH 2UWEF 3FONB 5JXED 3GHEL 3DBXB 4P2YA 3WNMA 1VB9A 3QUXB 1VEPA 3P0YH 3RDTC 3JVGA 3TJHD 3FT4A 2D7TH 4QGTA 3BOVA 2NQCA 5DC0A 4X6FA 5DHVH 4LFHG 4Y4HB 3VFUB 4F57L 1I3GL 3UTQB 1EHLH 1T2QL 5I1AA 1ZWIB 3K80A 3PG2A 3VXPB 4S10A 2AJ3A 1MCDA 3IGAB 4K7PX 1Y6NR 3ARGA 2IJ0C 4L8BA 1A7PH 1HCVA 2P8MA 5FO7A 5E94B 2RQ8A 1A4JA 4KY1H 4K7PY 3ARBC 3HMXA 1I7RB 1HILA 4O5LL 5ADOH 4KZEL 5D7SH 1KLGB 1OM3H 3E6HA 3QUYC 4P5TB 4GAFB 3VE0B 2FECI 5SWZD 1YDPB 1RUAL 1T0MB 3CVIL 5KSAC 4HFWA 1HI6A 3L7EA 5IESH 4KK5C 1RZFL 12E8H 3RVWD 5H37H 5TQ2L 3MODL 4P4KA 2MCPH 2EYSB 3HKFA 3NGBC 4JFHE 4APQB 2YUXA 4G7VL 4KKAD 2E8ZA 4HAFA 1XIWA 2QQKH 4ONFH 4PG2A 4P23D 4XNQB 4E42B 3OZ9L 3BZ4A 4NWUL 3GMLA 1GC1H 5ACZB 4PJFF 4LFHD 3PWPA 3QIUA 4F7EA 1RIVL 3S36H 4D0DA 4R2GD 3FN0L 3ZT6A 2UVFA 3VA6A 4Y2DD 3VD4A 2H8PB 3O4LA 3D85A 2OX5A 3MRPB 1BJMA 1GIGH 2AABL 4K3HA 4X80H 1AKJB 4JFYB 4P2QA 5CIPH 2ZCHL 1OGAD 4Y8AA 3V8OA 1H3GA 2FLRT 32C2A 4CW1A 2AJUH 2NX5B 4HGKC 3CLFH 3HC4L 2OLDA 1OTSC 2WIMA 4MSWB 1S7WB 2JB6A 1S5IL 4XCCL 5GSVA 2VLKB 4L8SC 3QI9D 2W65A 4LQFH 2APFA 4XZUB 1TLKA 4U1HB 1ORQA 3RL2B 1HHGB 1ED3A 1DQML 4LASH 4PJ5E 3PQYB 1P9MC 4NN7B 1QLRB 3BT2L 3AB0B 4KV5F 5HHVH 3MLTA 3QULA 4FMKA 2X1OA 3EOYG 5H94B 3GSQA 1I3VA 4GMSH 1QOKA 1NBVH 2Q86A 3GNMH 4E0RB 4JB9L 4JDZA 5J4MA 5IEKA 5DR5L 2VRAA 3GRWH 3PE9A 4X5WB 5K59F 4HIJA 3BQUB 3RWFB 5AYUH 1VFMA 3MLUH 4FXKA 1NCBH 4BKLB 5B39B 1QP1A 1KELL 2YD1A 3SY0A 2EYTB 4OLYL 3DIFA 5T1KD 3D69B 5C0JA 3A6BL 1SM3L 4RAVA 2FX8H 3DTXA 1JF6A 5IM7A 5ANMA 1WVZA 1QG3A 1SJEA 3HMWL 3CJJA 4UNUA 5GRVL 2HVKA 2FX7L 3EJZD 1L9MA 1Z5LB 2FR4B 4N0UA 3CK0L 5GZOD 3QHFH 3T77B 1CDIA 1M05A 1AP2A 1F4YL 3VFGH 2CKBL 5BMFH 3MRKB 3ZO0A 2HWZL 4ZXBD 2CK2A 4BZ2L 3DXAA 3OWEA 1GZPB 4OLUH 3SGJA 2EDXA 5C0BE 3UX9B 3GDBA 5IVXB 4FNLH 3AS0A 4PRNB 3ZLQC 2B0SL 4WEMB 5CHNA 1S9WB 3I9GH 2NZIA 5TGBA 4X9IA 1BM3L 5GS0L 5BV7C 5ERWB 4LHJB 1S9VB 4LPWA 1QFHA 1MHCA 4GBXC 3BGFB 4R4BA 4RMVA 3VXMA 1NGPL 2H3NB 1T1YA 2QR0A 4H1LG 4JG1L 3ZSSA 5EH1A 4L3EE 2R56L 1G6VK 4DZBA 1EGJH 5JUEH 5I73B 5FDWA 5GGSB 3QHTC 2QADD 2VLJD 1F4XL 4M7ZB 2BJML 3VH8B 1WBXB 4M6NL 4N0RA 2HJKB 3BHBB 3CDCA 4R8WL 4GG6B 1MI5B 3NCJH 1DSFH 1OY3B 4QGYA 3U7WL 4YDKL 5EBLA 5E95B 1I7UA 3GMMB 4PLJC 4X9HA 4KI5D 4Y19B 3MRJA 3L9RB 3IXAB 4Z7WA 2Z0BA 4LF3B 1TTGA 2D3VA 2LV4A 3TO4D 1UCBL 5DLML 4M48H 1JZ6A 1INDH 3QO1B 4ZUVB 1ZT7A 1AIFB 1NFDE 2XFXB 1RIHL 3SE9L 1D5ZB 4NJAL 4L9LC 5EZIH 1MQ8A 2E9JA 1CDCA 3G6AA 1P4BL 4XP1H 3PHOB 1QBMH 3FT3A 4HZLB 4GS7B 5CLTA 5A2JH 5EBGA 3RL1A 5EUOA 4HH9A 3SKJH 2EEDA 3SCMC 4PP1D 2ARWA 3DUSA 2EIZB 5IB2A 1MQKH 4K2UH 2XQBH 5BVPL 1K85A 2V2TB 3JWNC 1I9JL 5MP6H 5CINL 2EECA 4HKBA 1OW0A 2PO6C 4XPTL 3T0AA 3MRMB 4N0FA 5MHSD 1KG0A 4Z7VA 5JA9A 2AK4E 4UTBL 2ZCLH 4WU5B 1HN1A 3G08A 4K3GA 2FL5A 3PGFL 2R4RH 1NCDH 2R0KL 2N1KA 5I1EH 4RISH 3VG0H 2GTWB 2BNUA 3ME0A 1HKLL 1YZZA 3H3KA 5CIPB 1Q8MA 3CFEA 3ZZ1A 1RAMA 3SBWC 3IU3B 4MZ2A 2C5DC 3EYQC 2G60H 4G6ML 1DBKH 4LLQA 3TP4A 4OGAC 4B41A 2OSLA 4LNVA 5KW9L 2GTZA 4O58L 4IIQB 1H3PL 1XGRB 4KRPB 4XMLH 2UY6A 2DD8L 5T3ZH 1OF2A 3WCYA 3HI1B 3UAJC 1JN6A 1I3UA 1AFVL 4K7FB 2EZ0C 5E5UB 5FYJH 5I76B 5K9KB 2H2PC 1W0WB 4TUKH 1F11A 3DVNA 4LPTA 2DL9A 2J8UF 3Q1SL 1TZGH 1NJ9A 2B5IC 5CEZD 3WSQL 5EU7E 1FL5B 1U8LB 3J7HA 4NUJA 1D5MB 1FYTA 2YPLE 1YPZF 5I15L 3DVIA 1HQRB 3MV7A 3VJ6A 5KJRL 3BN9C 3FT2A 3BKML 4M5YL 4URTB 4IDLA 4OKVB 5B3NA 1PG7H 1QFWH 3WMSA 2JCCF 5DK3A 3GSUA 4OZIF 2YRPA 3C60B 1CDUA 2VDML 3DURA 1DBJH 3VXQA 3NIDE 2NY5H 3FRUA 1OP3H 1FFNB 4JY6B 5IW1B 5FK9A 4WI2A 1J0JA 5D1ZA 1H5BB 3G6JE 2DQHL 4GXVH 3JTTA 4RSVA 1WZ1L 5LBSH 4KVCL 4LVOB 3WFZA 1F6LL 3CXDH 4AENB 1KJ2H 3FB6B 3LN4A 4QTHB 4EQ3A 3GSXA 2WUCH 4YFLI 4F9LA 1NGXB 4A2LA 4U7MA 3BISA 3LHPL 4RAUA 5DMYA 4F7PB 1KCUH 2XKNB 3FQWA 1GGIL 5IVNA 5I8KL 1IKFH 1S8DA 3S4SG 4CMMB 1CFTA 1SEQH 2P8LB 3R4DA 5JXEA 1B4JL 3VWKD 2B39A 2AJXL 1DQJB 4X4ME 1AGBA 4JFDE 4MA7H 1YQVL 1N4XH 2FZ3B 3P4OA 5D7JA 3MLRH 4RWYH 1P6FA 3INUH 5IFAL 3LKQA 1SYSA 1HEZB 2AEQH 1LNUA 1LDPH 1U6AL 4XGZB 1X5KA 3IU4H 2MHAA 5C07B 1F8TH 2RCSH 1GAFH 5EC2B 5JDSB 2XV6B 4PJGF 1VKXA 2V2WA 4WY7L 4M8QA 1HHIA 3VRLE 5L9DH 2W91A 5B38G 3FO0L 4LU5L 3O3EB 4J4PD 3HZVB 3C5ZB 3BZFB 1NCNA 4PRPD 4F7CA 4QT5A 2Q8BL 3LPFA 4K9EH 1I1FB 2FYYB 3B6SA 5IBLC 3Q5TA 3GGWB 3BUTA 3CFBA 3EDEA 5SWZA 4NQDE 3S3PA 1BD2D 3HCVB 3D39B 4NO0D 3HHRB 4PJAA 1HYSC 3MLYL 1LK3L 1G7HB 2ICEA 4YHIA 5I1DA 3ARPA 4C54A 1ZEAH 2ZG2A 3B8YA 2FX9L 4CNIB 1FO0H 5DUPL 1A64A 1B9ZA 3T8XB 5GZNC 4ODVH 4Y1AA 1V3LA 3DRQA 1HSBA 3U30C 2CD0A 1R3IH 2VOTA 4IRZH 3UTSB 3VFMA 1T1WB 2X44D 2ATPA 1MRDH 1AC0A 3VXRD 4U0RC 3KLAB 3I6GA 5D6CB 1OGAA 1G7LB 4PS4L 3QQ3B 1R5WA 2IAMC 3MJ7A 2NLJA 3BW9B 2J2ZA 4HBCL 3EHBD 1U8IB 3UTTD 4PTTB 5I17A 3PWPE 1DBAL 1NSNL 3I3BA 4JRWA 3D3VA 3IF1A 4O2FB 1ZHKA 3O45A 4J7RA 1ZLWH 4M1DL 4JM2B 6FABH 3RWCB 1YUHA 3F7RA 4PREA 5HDQH 3MRNB 4RGMB 2KPNA 2PTTA 3REVA 2PW2A 5DJXB 5IB1B 4P2QE 1KJ3L 4U6TA 4W6WB 5DRNA 1BVKA 4NWTL 1U3ZA 5C92A 5KN5B 4ZQKA 2E7CA 3V4PL 3HA0A 2VLRB 3OG6B 1ZSDB 4U6XB 4X6DB 4JLRA 3QDMB 4ZPTB 4PJXA 5T5NG 3QAZB 1JRHI 2VXSH 2MJWA 1OT2A 1YEEH 4WFHD 4ISVA 5DDHB 2X4TA 2XG5A 5SWSD 4LSQL 4X9BA 2VWEE 4YNYA 4Y16C 1AGFB 4FFZL 1RJZA 1C12B 4MVBC 1ZA6A 5DD5L 2WQ8A 1LO4H 3MR9A 3VXUD 4PY8I 4RA0C 5D7IA 3I75B 1NFIA 4HH8A 1NDMB 4IMKC 5T1KA 2OQJA 3H7LA 2E27L 1DL7H 3KYAA 4X8JA 5ALCH 1UH2A 2ZUWA 2Y4SA 3V5DB 1YMHA 1WUNT 3B9KC 4P5KA 1T1ZB 2B4CH 3D2UD 1MNUH 3RTQA 5IEHB 4HT1L 1GZQA 2Y5TB 5TF1H 4G9FB 4LSRL 3ULVC 2DQCH 4JZNB 2HFTA 1CFQB 4ODHL 4HUWA 4MJ5B 4P48A 1F00I 2XXMB 4DCQA 4G9DA 2NYYC 3L3JB 3OKOB 2DQFA 1X5HA 5DHYA 2HRPH 4DKFL 2HTKC 3MACH 2CLZB 3W81A 3KR3H 2P43B 5FEBA 4FQCH 4YHPB 5MEQB 2W92A 3V0AC 1IAIL 4L4VD 5AZEH 3OKYA 4BSWB 4IOFC 5E03A 5EDXA 1U95B 3MCG1 4S0SD 5DQDH 3SGKA 3P30L 3ES6A 3UXFA 2E6QA 4XTRD 3N1QC 4O02L 1GGTA 1T1XA 1ZAGA 1NC2D 3CSGA 3HZKB 4ZUWA 1BECA 1HZHH 5IW6B 4PRDB 3WS3A 2BOBB 1MAJA 3GSWA 4M93C 1FH5L 5F1IA 1K8IA 1T7WA 3WFEL 3GKWL 5F3HA 5HYQA 1FE8H 4LAJH 3RVTD 3L5HA 2AEIT 1KJ2B 1CE6A 5C08B 5HYJD 4QHNB 2XWBA 1KBGL 4J8RB 4CAGA 2OR9L 3I3DA 5GS1C 4HUVB 4HV8B 4C58B 3ULUC 2HKFH 1EHLL 1IBGL 3D0VA 4HJGB 2XZAL 4HUXA 5EN2A 5GRVK 1QNZH 5DSCB 1I1AC 4V2BA 5K9QI 1NANI 1C1EL 1UM5L 3MV9B 1MEXH 4KJWD 3VXME 1ZGLA 1CT8A 4R26H 1IILE 4OIIH 5CD3A 5ADOL 3KAAA 2OL3A 3SDCD 2X4UA 3VGAC 3VRJA 1XF4A 5ADPL 1M6OA 5D1XC 3JUZA 4JDVA 4P2OC 2HMID 3BZEA 4L29A 2J5LC 1G7QB 3KJ4B 4Y4FC 1FGVL 4AH2B 4FQ1H 4HWEH 3TO4A 3JWDH 1U8OA 1YNLL 3RJDA 4KZDH 12E8L 1KEGL 3U0WH 3UJIH 2MCPL 2WM0A 5ESAA 3SO3C 4U1KA 1OAYL 4H1LA 4OD3H 4LGSB 3UPAA 3IAPA 3O6FA 1MREL 4DOHB 2QQQA 4Z7WE 1SBBA 4U3XA 2EXWC 4CVZA 1K2DB 1BZQK 2IG2H 1A3RL 3TBWA 2BSED 3GSVA 2EIEA 1CXHA 1X9QA 3CDFA 3L6FB 3MLXH 1JJUA 3AAZB 5JIHA 4PJIF 5J1SC 3TLRA 4OLWH 1BLNB 1JGDA 4OLVH 4OCRH 2AJUL 3GMQB 1SVZA 2C3VA 2K9UA 3LD8C 1WFTA 1FO0B 3BKYH 3CFDA 1ZOXA 3JWOC 3ZDYE 1KNOB 3U48A 3DI2B 3QCVL 2AJYL 1ETZB 1R5VB 2E7BA 2R1YA 3DV6B 3W0WA 2DWDB 2YSSB 5FF6B 1AR2A 5EUOE 1YECH 4X99A 4DFIA 2M8XA 1JPTH 3BEWA 3ORJA 1NDGB 5D7LE 1FZOB 4H8WL 4OCNC 4KWUA 4R0LA 1I75A 4LASL 3FO9B 4OCXL 2R39A 3FZUC 2I9TA 1AH1A 2Q6WA 2P4AB 1A6UH 1AO7A 1MY7A 5F9WB 4Z7VE 5JORA 2VKWA 4NFCA 2WBJD 1NBVL 3MOBL 3BUYA 5JHDE 3TA3A 3CZJA 5FV2A 4ZFGL 1CD1B 3CSYA 4ORGB 3WO3B 2JELL 1TZIA 1EUTA 4M7JH 4MNGB 1TTUA 3BDXA 4NOFA 3CVHL 1IQWL 4LKXB 1FG9C 3BIKB 3PF2A 4X4XA 4DGIH 3LIZL 5DJ2B 4WEBH 2A6JB 1NCBL 2WK2A 5C1MB 3MO1A 3WN5A 4MLIA 5CWSA 5E99L 3QUXD 5GISH 5F7MC 1JGVL 2F54B 3S6CA 3G04A 1EX0A 4XHJC 3HNTL 1Z9OA 2EH8H 5FO8A 4LLDB 2NY3D 4Y4HD 1RZKL 3RWHA 5FGCE 4JO2H 4LPVA 1U93A 2OP4L 3K3QA 2IALB 5I1GL 1QSFB 4P4RA 3JXAA 3B9AA 2NXZB 4ENED 3NOIA 1A1OA 2CXKA 3PNWA 4P9HC 3BMWA 2VLMD 3QH3B 4CL7A 4NQSB 3GZKA 1JBJA 2VH5H 3MMEB 1CL7I 1Q38A 2MWCA 3WV0A 5DUBB 4U6YB 5DTFA 3ZYZA 4LHUB 2BFVH 4KMQA 5DJYA 3VFVA 2VKXA 1G84A 2BHUA 4XNMB 4YDVB 4ZOBA 1FYTE 1PY4A 3UCRA 5J13B 2ADFH 5CGMA 5JPNB 2A6KA 1FVEB 1FZKA 2EH7L 1OSPL 3VW3H 3FTGB 1JE6A 5BOPA 2R1WB 3L5IA 1DLFH 1TPXC 5F71A 2A1WL 3SE3A 4QOKB 3ZTNH 1DFBL 2DBLH 3DI3B 4OAWB 4APQD 4PB9L 1WAAE 5CKGA 2N7AA 5C0GA 2MFNA 3TH2T 2EC9T 3VFWA 1NC4D 3UTPE 4HDIA 5DT1L 3T08A 5C0EA 4RAHA 2AJZB 4JR9H 4ZOAA 3TN0C 3H9HB 1TQCB 4P0DA 2RFXA 3MRBA 2ZP0T 4NC2B 5JUEL 2A0LD 1ORSB 2D7PA 5D70L 3OTTA 4XCYA 4XMKH 4DVBA 3W9EB 5JW4M 5CCKH 2NX5D 4N1HB 3ARZA 5ID0B 4ODXA 2VB5A 1P1ZA 4JFXA 3HNVH 2XPGA 1RUKH 5GHWL 4UDTA 5HPMA 5LGHL 5EOTA 3I50L 1JHTB 2VN7A 4R7DB 5L2JB 1Q1JH 1LQSR 4TSBL 2VLKD 4J4PA 1RJLB 2FSEA 3PABB 4YHKH 2VXVH 1RJYB 2CR3A 4I0KA 3F62A 4TSAH 4A6YA 3SPVA 4M48L 3L3KB 3WJJC 2QEJA 3DX8B 3QA3A 5IKCB 4Q58C 1BD2A 4NO0A 4YHLL 4JGJA 1K6QL 1OAXH 3TEUA 2DLTA 1JZ5A 4JAMB 5EZIL 4WWKC 3IDGA 2YD9A 5JW4Q 4NO5A 4PJEA 4JY4B 1EEYA 4XP1L 3FCTA 5FGBC 3EKCA 3EGSA 2YD8A 1QBML 2FCBA 3MBXH 4OCWL 2GJZB 2LU3A 4WHTB 4M43H 3BQUD 2E8YA 3SKJL 2VDQL 3NZHH 4S1SH 2R0WL 3QNXB 2I07B 1NAMH 1NGWA 4G6FB 2MPAH 4MD4A 2IPKA 1MQKL 4HKZB 4K8RH 1KN4L 1LP9B 4X6EA 5E4IA 1F90L 4P99A 4R4NC 3RKDC 4XCEB 4CGTA 3M1BA 4GKSA 3S34L 3VMOA 1MCPL 3FQXA 2PKDA 1MCEA 1KTLA 43C9A 4NBYB 2Z8SA 3NCFB 1J05A 1IFHL 1OGTB 3TM6A 2M2DA 2EXYC 3NA9L 2R4RL 1EH9A 1NCDL 2YR3A 1AXSA 5HVGB 3KJ6H 4Y1AE 3LB6C 4RISL 3F7PC 4YBLB 1CGWA 1XF5A 3FB8B 3CMOH 1NBZB 3EYFB 1JWMA 2I60L 3VH8G 3SDDA 3GSRB 1CQYA 3IFOB 5MENB 5IIEB 2NY7L 4FFVC 1O5DT 5DD6A 3OG4B 3QIWB 2E7LA 1OGAE 1WBZB 3GIZL 4WFGE 4PJ7A 5K9JL 1GGUA 3N85H 5D8JH 1JCKA 3JSSA 3C8HA 5I8OH 3OF6D 1BBDL 1A6PA 3L3GB 3MBEC 3EO9H 3D3VE 3X3GH 4WJ5B 4PGDA 1J1OL 4EVNB 2FO1A 1JF5A 3BAEL 5E00A 1RZ8A 5FYJL 4G8IA 1JNNH 5CBEB 1J10A 5T5FL 1JK8B 1TZGL 1NLDH 1OD9A 5DD3H 5DZLA 2CKBA 4OGYH 4YBQC 5JMRA 5SWSA 3QG6A 1M7IB 3HAEA 2LQRA 3O6LL 3VXUA 3OPZH 3HPJB 1XCTA 3Q6FA 1F97A 1A6AA 1XGUB 4E9LA 1NCCL 2FLBT 1U58B 2JIXB 4PJXE 3MNZB 1MI5D 2XZQL 3EFDL 5IB5B 1WZMA 5IJVB 1YEHL 3LOWA 4Y19D 4MQXD 2Z31C 5ID1A 2PXYB 1MJJB 1LO5B 2H26A 1KCSH 4OZFA 4DZ8A 5D7IE 5EOCJ 2P42B 4PJCA 3MV8E 2Z35A 2VDLL 4I0PB 1E4XL 4JZJA 1IEBB 1MVUB 2WUCL 3TBVB 4L4VA 1MAMH 4NKMA 3TCLA 1OTTC 5I1LA 4WV1C 5I9QB 5JOFB 3WE6A 2MQCA 2XY2A 3H9YA 3NIFE 4UOW0 4MDIA 3AXLB 1GGYA 2FRGP 2R2BA 1YY9D 4XBGA 3NZ8B 4IRJB 4U49A 4I0CC 4Z7UA 5DVMA 1YYLH 1JWSA 5AUMB 3P4NB 4R9HA 1I8MA 2GAZA 3JBG7 4TNWF 5J3HC 1QYGH 1SEQL 1UA6H 2F74B 3H2WA 1SBSH 4XPGL 3P0VH 1MCLA 2AXGB 4MA7L 1S3KL 1FNAA 2BVQA 3SDXE 4LKCB 4UU9B 3TPKA 3K4DA 3HE7B 2HJLB 1J0HA 1LEGA 1N59B 1WCBA 4O2EB 2FBJH 3IETB 2L4OA 2VTFA 2RCSL 1H3TA 4UDUB 3EUUA 2F8OA 4PG9B 3C5JA 1NPUA 3DUUB 4U1LA 1GPOH 4DVRH 2R4SL 3BPNB 3K8LA 4TULL 4K9EL 3DHJA 3T65B 3D0LA 3PL6A 3MRQA 3SDCA 5I0DA 5HI5C 4OT1H 1FPTL 4JPIA 1UXWB 3JTSB 1QTYT 1K4DA 1QBLL 1LEKB 3T0EC 4UV4L 2X70A 3BH8B 4AIOA 3BH9B 4EUPA 1QA9B 4QXGH 3RZCA 4PJ5B 4HKXA 2DQIL 3EFFA 3CDGB 1KN2L 3O2DA 3KYKL 3QJFB 4U1IB 3IKCB 3QUKB 2XTLA 2GY5A 5HI4C 4L4TB 4Y4KC 3T3ME 3EJYD 1INQB 4C83A 3V6OA 1MCSA 3FO2A 2BRRL 4GOSA 3VXSA 4YDLB 3TT3L 1UKSA 1Q9KB 1LILA 4ZS7L 1WFOA 4IRZL 4CMHC 5I30L 4F33B 4G6KL 2F5AL 5BJTB 1I7TB 1KJMA 4GG8A 4G3YH 1ZT1B 5AD0B 4I5BB 4LL9A 5T1LA 3U36B 5KVEH 5T1DH 2AQ2A 1XH3B 2XTJC 5SX5H 4Z7QE 3D9AL 2FJFA 1FZJB 1MFNA 1FVCB 3SN6N 3C60D 3RY6A 4GLRI 4R96B 3Q48A 1N5AA 4ZDHA 1MHHA 1A7OH 2R9HC 4HS3B 2Q7YB 2G9HA 1EAJA 3MUZ1 3V6ZB 3CD4A 4KXZI 1XZ0B 2DQTH 3BZDA 1IAOB 1X6NA 5JW4N 3QXUA 1MWAA 2VDKH 3SQOH 4DQOL 4X6BA 3H42H 3W5MA 5FKAA 1VEOA 4X9FA 3MLVL 1WLHA 1QPPA 3K8MA 2ORBH 5DHXB 3RNQA 2WBJA 5DFTA 4Y5YC 3B2UD 1XGQA 4KROC 4I2XB 3L3HB 3W0WE 4D2NA 2IFFH 5D71L 1U91B 5E9DA 4YK4C 3EDKA 4AM0B 3HC3H 4GT7A 4H88H 2AJVL 3M17B 1YEEL 2MQ3A 1ND0B 4LP5A 4ZUSA 4J3OC 1JV5B 4KMTL 3FONA 5CGTA 4HG4J 1IGFH 4I3RL 5J12B 3QUXA 3S98A 1AO7E 1LO4L 3P0GB 4Z77B 1LO0L 2NR6C 4DFHA 1A14H 5CJOH 5FUCE 5HI3D 1DL7L 2O26U 1JPSH 3W11D 3E2HB 3VFUA 2Y36H 4L3EB 1VPOL 1MNUL 1ZWIA 1PKQA 3GJEA 3VXPA 1IGJB 3NBNA 3SGEI 3EYSL 3IGAA 4OSUH 3OHXB 2R69L 1KCLA 5D5MF 1N64L 3WDHA 4GW5B 1N5YL 4ZG1A 4JN1H 5CJQL 3QB7C 1MHEA 1BQHG 2HRPL 2QHRL 2HFEB 3CFIC 1I7RA 3MACL 4NZRH 1OHQA 5EG6C 3DHMA 3TZVB 3MXVL 4ZUTB 3MA9L 1ADQH 3C08L 4P5TA 2RR3A 5EO0A 5BV7H 3UBXA 3VE0A 4JHAH 1YDPA 5CUSL 1T0MA 3A67H 2ATKB 1EXUB 4X4YB 4I3SL 5DQDL 2CDFB 1S9YA 4K3EH 3AY4A 1YEJH 5GGTH 1B90A 4X7DC 1HQ4B 2Y25A 5HTSA 1N8ZA 3ZKXC 1A4KB 1IGIH 4JM4L 2ZOLB 2EYSA 4APQA 1MRFL 1HZHL 2A9NH 3I2CH 1MCNA 5FUZH 1DTUA 4XNQA 5CJBA 4ODUB 3QXWA 5ACZA 4YQXL 2IBGA 5BW7C 1FE8L 4NC0B 2EIBA 3HI5H 4PJDF 3NFNB 5J11B 3MJGX 1F3JB 3D25B 1T3FB 4U1JA 3FQUB 3K7UA 2H8PA 2A9MH 5L6YH 2HKFL 3QEQD 4LDLB 3MRPA 1NCWL 3RDTB 1QNZL 1AKJA 2QQNL 4JFYA 4JFZH 5T3XE 1RQ5A 2NX5A 5DMGC 2AV7B 1ZHBB 4FQIL 4MNHA 4RZCB 4OFPA 2IQAB 4MSWA 4Q2ZB 1S7WA 2D9QB 4R26L 5E8DH 1T5XA 4LLWB 4OIIL 5CZKA 2P5WD 1B0RB 4POUB 4JM2D 5GPRA 2V9QA 2VLKA 5ICXB 3VG9B 1XGTA 1B6DA 3ESUF 2Q8AH 3RJQB 4PP2B 4XZUA 2LABA 3GFUA 4U1HA 3RL2A 1S7SB 4D94A 5T5NF 3N06B 3PQYA 4KZDL 2NW3B 3BFOA 1PZ5A 3VCLB 1QLRA 4KJPC 3QUYB 1NGZB 1Z3GH 4NQCE 1UH4A 3NFSL 1Y0LB 1PEZA 4NNXB 4TOYH 1ACYL 1FBIL 4FQXC 1FNLA 3QDMD 2IQ9H 1BX2B 2IG2L 4WW2F 3NGBB 3BQUA 1A9BB 4KV5E 3RWFA 3AREC 1SVCP 3MLXL 4R97C 4XRCB 5E8EB 1AXTL 1U8HB 4M6OL 5B39A 3T0BA 2EYTA 1QLEL 4Y5XB 4ZAKC 2FNBA 2GJ6D 1N7ML 4HW6A 5AEAA 1AGDB 1RZJL 4IM8A 3D69A 3BKYL 4PJEE 4OM1H 2EE9A 1UJ3C 4L8CB 2V7NA 2BVTA 4NRXB 3VI4F 1J0YA 5FYJD 4GXUM 5C2BL 2HFGH 2VQ1A 3FRPG 1Z5LA 3QFJE 3UMTA 1JYWA 2FR4A 3UC0L 1INEH 1IM3B 2R8SH 3REWB 3W5NA 1G9EA 1C5BH 1M7XA 5TQ0H 4OFDA 1UB6A 3MRKA 1LHZA 4M5ZL 1LE5A 3V4UH 2GJJA 2VR9A 4L8SB 4MCYB 1REIA 1F5WA 3BP7B 1JTPA 1MH5B 4AT6A 4M3JA 4J23A 1GZPA 1MFEH 3VGDA 2ZUTA 2P49B 1NMAL 4FFYH 1KIQB 4Z8FL 4M6MH 3UJTL 5IVXA 5ILTL 5BO1L 1YYMH 4ZOCA 4FTVB 1KPVB 1WIOA 4M7JL 4PRNA 3WFHB 1S9WA 2NPLX 3MOAL 4I18C 1DEEB 4AEHL 4ZS6D 3UZEA