1WJ3A

Solution structure of the fourth fn3 domain of kiaa1496 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
117
structure length
117
Chain Sequence
GSSGSSGTVNVTTKKTPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neuropeptide
molecule keywords KIAA1496 protein
publication title Solution structure of the fourth fn3 domain of KIAA1496 protein
rcsb
source organism Homo sapiens
total genus 7
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wj3A01
4J7RA 1W2KT 5FGCE 3FFCB 4P4KC 2GJ6A 1ND0A 3K1KC 4TN9A 4HX1A 4BSJA 4EI5C 1NFIA 1QR4A 2F74B 5GGTH 1DLFH 5BXFA 1MAKA 2NX5A 5I9QC 4ORGB 3BP7B 4ZPVA 3LOWA 1OVZA 4FTVB 4H1LH 5IP4A 3O0RL 5D1XC 1MWAH 1DLHB 1INEL 5J9PA 4CU6A 2JELH 3ZE2F 3T0EA 1UXSB 4KKAC 4G42A 4RRPA 1LO3H 4MCZB 4JHWH 4GAYB 1AD0A 5EA0H 3L9RB 4BUGA 3FL7A 4F3FB 3MCLH 3FO0L 4R4FL 3SGKC 5JORA 4WUUE 4CVZA 4HIEA 5CSZB 5FHBH 2PYFB 2JB5H 3RGHA 4NQED 2ARJB 2IPKA 3X12A 1KELL 3DV6B 3BSZL 3G5YB 1H3XA 2NTFA 2OLDA 2C4FT 1GGUA 1PX3A 3NAAH 1RIVL 3GSRB 3T77B 2ZWLT 5T1LD 3U6RB 4NFBA 1SYSB 1OAXH 2JTDA 1BD2A 4MNHA 4RFNB 2R2BB 4FRWA 2OQJA 1CU4H 3X11B 3GJFK 3AFLA 3QRGL 3S5LG 4S0TD 4PLJC 3DX6B 2AEPH 3ILPA 4GT7A 3MJ8A 3IS1X 3AC0A 1H8SA 4KWUA 1EEQA 1GZQB 2ZPKL 1HSAB 1B88A 1OL0A 4UTBL 2EEBA 5EU4B 4Q6IB 5HGBB 2VXVL 5SWZE 1RZGB 4X9FA 3FOMA 5DJZA 3QEGL 1BFSA 1JPTL 4FQQA 3FQXA 5DHYB 3H42L 4HCRH 2IPTH 4X6BB 3K81A 5GRWA 2NXZB 3QIBD 4F33B 2X09A 1OY3B 1V3JA 4YHPA 3DI2B 3T2NH 1KCVL 3LVEA 1JWMB 4I18C 1MH5B 1MSPA 4JFXA 4Y16D 2X42A 4YUEH 3CLFH 4PG2A 2FJFA 4NBXB 5JPNA 4QHMB 1ULVA 1AKJD 3JZ7A 5CINH 1J1PH 4O00A 5EUOB 1AXIB 2KQMA 4S1SL 4IJ3C 3L3IA 3FCTA 4NHCH 4D9QD 4PGCA 2XKUA 2NPLX 2GUOA 3AMLA 4AZ8A 5J8OA 3L1OL 1A14L 1MIMH 4AIXA 1QFPA 2R56H 4CADB 1N6VA 3V5DB 3GRWL 1J12A 2NW2A 2VDKH 2YD5A 5GHWL 1TVDA 3TYGL 5I73B 3VXNA 4MLIA 3QNXB 4TYUA 4QXTB 5BOPA 3MNZB 3QYCA 3CVHB 1U8MB 4M1GH 4S1DD 4G80A 1X5XA 1BBDH 1W0VB 3ESVF 5D71H 1OCWH 3DYPA 2CK2A 1C08B 3LKPA 4KJWD 1V3KA 5IEHB 4Z7UE 3Q6FA 4ZUWA 4P57B 4JDVA 3K2UL 1KUMA 5E6YA 3VFNA 2HH0L 5T33H 2APTA 4LKCB 1S5HB 1E6OH 1NCTA 3NACH 4NN6B 5FM5O 1ORQA 3REWA 2EE6A 3QUZC 1V7MH 4R3SB 5MENE 1TVBA 2Q7NA 4Y19A 4P2RD 5DT1H 3NIDF 1RJZA 1RZ7L 1FNHA 5T1KB 2Q8BL 4XP9H 2VDLH 2OZ4L 2NY6B 4MQ7A 5CEYA 5C92A 3C5ZB 3MOBH 2BNQD 3BJLA 1X3DA 2B1AL 4JFZL 1I8MB 3QO1A 43CAA 3SBWC 4ODUA 1SJHB 3C9NB 1YNLH 5E5MA 2X70B 3WXWH 4WW1A 4YO0B 3FFCD 1P2CB 4C58B 1BZQK 2HFEA 2XFXB 3FQNA 3G9VA 4FTVD 1AO7A 4HKXA 4KVNH 5C0RH 1P53A 3WD5L 4PJ8C 1NAKL 3FB8B 4LLYB 5FCUL 2WWKT 1LEGA 5T1DH 1QLEL 4LLQA 5C0IB 3CMOL 2E6JA 4MXWH 3WFDL 4LRIC 2Q3AA 4QTHB 5C0CD 4RMUA 5JQ6L 2UZIL 5DS8A 1YQ2A 4JVWA 4U6TA 5T3XL 1R5VA 1D6VH 1FYTB 3V6OC 2XTJB 1T66D 1I1YA 4XXCC 4Q74A 1QR1A 4NQEA 2K1MA 5LAXB 1KIQA 4M6OL 1L9NA 1QFWL 1T0NB 1U92A 2BY2A 5FA3A 1EJOL 5BV7L 2F54D 2ZCLH 3QUMA 5T1LA 4XPTH 3OBAA 2YR3A 2ARJQ 4XCEA 2IADB 3EO1B 4OLUH 1KV3A 1U95B 5IROA 5TGBA 2DTML 3HR6A 4LLMB 2BHYA 3P4NB 2OR8A 4O2FB 5C9JB 1XGTB 4NQSA 5TDOA 2HFTA 3DPBA 3O6FC 4PY8J 2F5AL 2OSLB 5GS1C 4MA7L 5KJRH 3I75B 4XB8A 1VFOA 3V4PH 5IVNA 4BFBD 1UFUA 1M6OA 3LKOB 1U8OB 4V2CB 1QFWI 5I1EL 3QNZB 1K5NA 4P46C 4LCUB 3IDUA 2XPGB 4PLKD 4X5XA 5L6YL 2VUYA 4MVBD 3MCG1 3QIBA 3OV6A 4LMQE 2VZOA 1FVCB 5CZKA 4LHUG 3ULVD 1HILA 2DMBA 4NQCB 3O8XB 5E2TL 5EORH 2FO4A 3IFLH 4KROC 3P30L 4Y16A 4NP4L 2DRUA 2VXSH 1LO4L 3ARFC 1A3LH 1W72B 3TN0B 4I9WE 1LEIA 2H41A 5HGDB 4U05A 5F9OH 2P8MB 3EYFB 1NBVL 2D9QB 4KK9C 1T5WA 4KPHL 3SY0B 5C8JB 3OR6B 4PJXB 1FBIH 1QSFE 1T21B 1MCOL 4KTDL 2V5YA 1I8IA 3K8KA 3QZWB 4GXUM 1FZJB 2QQLL 4C59B 1H9VA 4PTUA 3KPOB 5TH2B 3TPUA 3SE4A 5I8CB 1QBAA 4ZOEA 3TH4T 3BP6B 1GZPB 1FIGH 3FOLB 3GSVB 3RWEB 3SGDI 1JGEB 3QCUH 4YHIA 2Y07H 1IC4H 4HC1L 4NN5C 5D1ZB 4WEUD 4TVPH 4U3XA 4JKPH 1C12B 3H6JA 3S4SB 1JWUA 4CJ0A 3QDJE 2FEDC 4N0FA 2A9NL 5SWQA 5GJTH 4YJZL 1IGJB 2XWTB 1CE6B 4EOWL 1ZT1B 1PZ5A 4Y7MA 5SX4I 4KKLC 1OTSD 4P2RA 2XACC 4LOUC 4M7KH 5F7MC 3WO3B 1TQBB 3C5ZD 2J1KA 3RX5A 3SE3A 4Y5XA 1YYLL 3G5VB 2DWDB 5F6IB 3MLXH 4PJ5D 3V5KB 1RIHH 1XF3A 2BNQA 1BQHA 3F7VB 3C6SB 3H9SA 5DJAB 4N0UE 1CE1H 2VLME 2VLJD 4PJ9D 5C0BE 4X99B 2BFVH 4C83B 1CZ8L 4NBYB 4I3GA 4X4MA 3FFCA 2RJMA 5F3HA 1SY6A 1XF2B 5DJ6B 3RGVA 2AK4E 3VXMD 1J8KA 1GL4B 3QUMH 4J6RH 4RIRB 4Z0BH 4MWFA 1S7UB 3DO7A 1CF8H 5HI4D 4Q9QL 4R4BB 4XGZB 5ADPH 1QHPA 4GKNA 2VQ1A 4NQXA 5IW6A 4LLUB 1P4IL 3DBXA 1GIGL 3FMGH 3QISA 5ACZA 1FAIL 5ETUB 3PHQB 5C0CA 2HMID 4K23H 3BZ4B 4HEPG 2IANB 4QRUB 2XTJD 3UCRA 2BXZA 3RDTD 3QIUD 4GW1A 1QTYT 4RWYH 3G5YA 1ZS8A 4OV5B 2CLZA 3SO3B 1N6UA 2X4PA 1QLRB 1OGAD 2XI9A 3OXRA 6CGTA 4JREC 4OBSA 5SWSD 1OSZA 2F54A 2UY6A 5IVZB 2R2BA 1O5DT 4MLSA 1JGLL 3TZVB 3LB6D 4TOYH 1ODAA 1DBBH 4LASL 3GO1H 5F7YC 2YC1B 1KXQE 1KPVB 4TTDC 4XMKL 3ZDZF 3O2VH 1OGTB 1YEEH 3H9HB 4QRTB 3C2AL 2QR0A 1DBJL 4DZ8B 5K59F 4DGVL 3BKJL 1X5YA 3QIWD 1L7TL 3HUJB 3NFNA 3OPZL 3V7AG 1Z0NA 2XG4A 2HT4D 4TRPH 1YYMH 2Q6WB 1GC1H 5EB9A 5F9DC 2WZPD 1UACL 3QZWG 1L0QA 4X98B 5EUKA 1YEJL 1IGYA 2RHEA 3O8XD 1CGVA 2D7TH 5HI5C 5DRXB 5GPRA 4KJPD 4X6DB 1DDHA 1WWWX 4QRPE 2GI7A 5JOFB 1YY9D 3PNWA 3TN0D 5DWUL 4OF6A 2ZUQC 2VOTA 4W68A 3ZKXC 3GHBL 4S2SA 3J7HA 2J12B 3BGFB 4X5WA 1AD9A 4XPHH 3HNTL 1LVEA 2JJTA 4LF3A 1NL0H 1LQSR 1LP9F 4H8WL 3LQAH 4PG9B 1UWGL 3ZTNH 2NY3B 3EYVA 5FV2A 1B0RA 4HWEH 5EOQH 2CRMA 2CGRL 5CEZH 3MRJA 3CFJB 1QPPA 4MSWB 1Z9MA 3KGRA 1S9WB 3NGBC 4J8RB 2F9BT 4LQFH 4IRZH 2NY2D 3TVMC 4Z6AT 4WI8A 4CDGC 3MOQA 1MCEA 3TA3D 5KSBF 3F7RA 4HS8H 5CP7B 1M71A 4I2XA 4OFDA 4Y5VC 1DEDA 1G9MC 4FN0A 4NO2A 3LRSA 1F4YH 4AQ1B 2PXYD 1V3LA 2FATH 4PLOB 1SY6H 4OSUL 4JFQA 4ELME 5IW3A 5JZ7D 3HAEB 3MRNA 3DUUB 1MFDH 1G9NH 2JCCE 3BQUC 3N1QC 4NNPL 1I1FB 3GI9H 2ZP0T 1QRNE 3IFNH 2EDWA 4RAHA 3PQYD 3PV7A 2IG2L 3ARUA 4MD0A 4XC1L 5ANMA 4RNRA 5C2BL 1I8MA 1CR9L 4PJ5A 1WISA 1K4DA 5MP6H 1FFQA 4NO3B 43C9A 1J1XH 2J5LC 3D0LA 3C6LB 4KV5E 5TPWL 2VLJA 4PJ9A 1E27A 4WTXA 1Y6MR 1CQYA 2WMPA 3LEXA 2AV7A 4OZIE 2VAJA 3ZT6A 1CGWA 2DQFA 1A9BB 3QEUA 1OTUC 3VXMA 1GGIH 3VWKB 2DIJA 1T4KA 5F96H 4MAUL 6FABH 3W39A 3LKNB 5IVXB 5CWSB 4WNQB 5I8EA 5DR5L 2N1KA 1FE8L 4N8VG 5BVJA 1Z9SA 5IEKA 4Y1AD 3QPQC 2UWEB 3WFHA 1Y6KR 3MRBA 4E41B 1MFNA 4JM2C 5GRVK 1VFAB 4OD2A 2IAND 1PEWA 1UZ8B 5HGAA 3VXTB 1G7QB 5ICYB 1QBLL 1NGQH 1VERA 1RZKC 4QCIB 3ULUE 2P7TA 4ZD3L 3VI3F 5HXMA 1ZTXL 3RDTA 3QIUA 5IQ7L 4PRIE 2ZSVA 1RY7B 4JRYB 3D1MC 1A64A 2A0LD 4CW1B 4M6ML 1UKTA 3OKOB 1OGAA 2G75A 5HYQA 3UJTL 3TZVD 4KVCH 5DJ2A 5IF0B 5SWSA 1IKFH 2D2OA 1CFSB 3CFCH 1FFRA 3ULVH 4NN7C 15C8L 4HHAB 1Q9OA 4G9FA 4M9PA 2ZSWB 1D6EA 5I1LA 3SKUD 1A1OA 5H2BA 1TTFA 3RX7A 2J4WH 3UPRA 3EJJX 5LGJB 1DN0A 4YIQB 2GJJA 1JE6A 2GY7B 1Y6NR 5B3JE 1EAPA 3LZFH 4GRLA 4HMDA 4UBDD 1J87A 3BVNA 3GK8H 2FDBP 4LCIL 3QIWA 4GW4A 3OKKB 4LCUA 3RZCD 4ZODA 3BW9B 4PTTB 1KTLB 3HZYB 5E8OA 5A2FA 2Y25A 4CMHB 2VO5A 4UT6H 4GO6B 3LQMA 3S35X 5IVOA 3FQRB 3PXJA 4NOBA 4PJDA 4OFPA 1JGDA 4D9LL 1IAIL 3I6LD 2DQHH 1CK0H 5F7DA 3C08H 4QHKJ 5F8QC 2EDYA 2NW3A 4BZ1H 3EOTL 3H0TB 1KT2A 4CNIA 5EOTB 3GB7A 1AXSA 1RURH 3O9WB 2DF3A 2NY3D 1NMCB 1NFDE 5E7FA 3QQ3A 2XRAH 2DM3A 5ESQB 3S8WA 3HAEG 5D7KE 2WQRA 4K3DH 4G6KH 3HPJB 4H26B 3HG1D 3IU4H 3PV6A 1IAII 4JHBA 1TJHH 4NNXA 1Z6JT 2EIBA 3CX2A 4XP4H 5K9JL 2DLFH 5I66B 3PWPB 1Q1JL 2HT3C 1G6RA 4OUOA 1U8KA 1X7QB 3TA3A 4QWWC 3NCJH 3QPXL 4J1UB 4YPJA 5C7XH 1K2DB 4Y4FB 4OV6F 3KLDA 5IB4A 3STLB 3OAZH 2PXYA 3MNWA 4ZUSA 1JZ7A 1FH5H 5CILH 4YNYA 1YN7B 3X13A 2QSQA 5FCSH 1QKZH 4F7CA 5HYEA 1HE7A 4RCAA 4X6CE 4YHML 3ARDC 3EYUH 3U2SA 3TIEB 1WCBA 1U8JB 4U1NB 2NLJB 3ARYA 5EUOF 3EDJA 2XA8L 2MJWA 5CFHA 4YC2C 1DQDH 3PQYA 3G5VA 5HVWA 3PJSA 3VI4E 1KIPA 4PGZA 1DBAL 5K9OB 4OD1H 3I2CH 3BKCH 3C6LD 5E95B 3EYSL 5H37H 4P5KA 3KDMA 3C09B 5HHXL 2EC8A 2I27N 4OGAC 2APFA 4HDIA 4N0YH 4FQIL 3ILQD 1SYVA 3VFVB 3QDMB 3G5XB 1DP0A 4WW2B 4M4RA 3D39D 5E4EC 3EOYG 4R4BA 2WV3A 4U1MA 5F9WB 4ZS6C 2I60H 3S35L 3MUGB 4Y1AA 2XZCL 3VJ6A 2FSEA 3VH8A 1CFNB 3M45A 5FV1L 4DCQB 1JHKH 3VE0A 5I6XB 5DC4B 3LPWA 4QRUA 1X4XA 4Z8FH 5E2VL 1IL1A 1P1ZB 4M93C 2PR4L 3ARQA 4M7LL 4HF5H 3WUWA 4JPVH 3D69A 2R4SH 2BX5A 2ADJB 2GK0B 1DBKL 1YC8A 3SKNB 4R96B 4PRDA 1NGWB 4FHBD 1C5BH 3X3GL 3ARBD 3QULA 4JFPB 1UCBH 3L5WB 2R1YB 4MNGB 1KB5L 3TZVA 4PY8I 1KFAH 1A21A 1RUKL 4LPWA 3HC3L 2H9GB 5DEZA 1DVFB 3R1GL 3CFBA 2B4CH 2R2CA 4L5FL 3ES6A 5DD5L 4QRTA 1Z5LB 3L95A 3NFSH 1AGBA 1HZHH 3BT2H 5I76B 5IOPB 5DFWH 3WS6C 3BHBB 3DMMB 4HT1L 3Q5OA 5TDPA 2LTQC 1EO8H 2R1WB 5J6GB 1XAUA 2BOCB 5DD1L 4YHYB 2R1XA 2YRLA 1D5MA 3BH9A 2LU3A 2YPLE 3HNVH 3RPIA 3RZCA 4D8PA 4GMTH 4JRXE 3BKYH 3SE4C 3FO1B 3IDGA 3JXAA 1IT9H 5DI8B 2VH5H 3CZJA 2FNBA 2EC9T 1G6RH 1WBYA 3FN9A 1KN2H 2GJ6E 2HAZA 2L4OA 2ZJSH 1BVZA 3EKCA 1BPVA 2FRGP 2NX5E 1N59B 2XQBL 3NA9H 3S36H 3CSPA 3KYMA 1GYAA 4NWUH 4DUXA 2A73A 3GI8H 1CDIA 3T0EE 4Y2OA 5HSFA 2YS4A 3UXFA 3ZT7A 1FV1A 4KUCD 5ICZB 2F8VA 3HG1A 3IXAA 5F1KC 3RWJB 5DJXB 5EO0B 2JJSA 3EJYD 2G5RA 3PWPD 4EXKA 4JZJB 3RU8H 2HYMA 4XRCA 4M1DH 1GOGA 2BVPB 2VR4A 5K9KA 3HR5A 3ECBA 2AKRA 5BW7A 2GSGB 3LN9A 2P5WD 3MRFA 4QT5A 5AD0B 5IFHH 1BD2E 1PG7H 4MCYB 2M8XA 5IMLB 5ERWB 5CZXD 4I0PB 3RGVC 5EH1A 4YFEA 2V5RA 2XXMB 1JNHB 5EO9A 1A7BA 1DBML 3B3IB 1AJ7L 4UU9A 4P9MH 2H6PB 4F57L 1NMBL 1P4BL 1G9NC 5FKAB 3JTSB 3IKCB 2C3GA 4PRBB 5F3BB 4X9IA 5FUZH 4XXDA 5TF1L 2WM0A 3U30C 3OQ3B 3U0PB 3WL9B 3SDAD 2IBZX 2F53D 1BF2A 3MXWH 1D5IH 3CFDA 1UCTA 3PGDB 4NRYB 1BVKA 2P5ED 4I1NB 1UH2A 2OYPA 3A67L 4K7FB 4PJXF 4PJAA 1ZVSB 3G04B 2C9AA 3RNQB 4YHNB 3NA4A 3IDIB 1R3KB 4LIQL 2GTWA 1TENA 3C6LA 3T65A 2DYPD 2GEEA 3GHEH 5KZCB 2AJYH 1F3JA 2QKIB 1U8IA 4R4NC 3ARVA 3H7BB 5D7LD 4PV9A 2ZOKA 1D5BA 2E9JA 4UAOC 5D72L 1EO7A 4EIGB 4QRSA 4OLXL 2XZZA 2V17H 4WFGD 2VSDA 1IGCH 5FM8A 2IQAA 3D39A 4CUCA 2IBBA 3KJ6H 3TO4D 2GTZA 4FQXC 2VTFA 2G2RA 4BKLB 2EE2A 4KFZC 4HEME 1RD6A 5BRZD 1XH3B 1UZ8A 1RIUH 1R5IB 3MRRB 5D2NC 4CKVX 3U1SH 3DRTB 5DUBB 3P77A 1F3DJ 5DO2D 3MYJA 2O5YL 1NEZB 3EOAA 4WIQA 3GBMH 4PRHD 3OJDA 3T0VA 1MLCB 1IM3B 1ZSDB 2DMCA 2PO6B 2DKUA 2IJ0C 3OKOA 1N64L 2E6QA 4DTGL 3ARBA 1ADQA 4X6FB 4UQ3B 1N5AA 4R7NB 1EUTA 4NPYB 1MHEB 4HLZH 3SE8L 4H25A 3KYNB 3UDWC 1RZFL 1ZEAH 4KRMB 3OXSB 3KLAA 2I25N 1T1WA 2MCPL 4KTEL 4Y19E 4JZOB 1D5ZB 2OR9L 1IGMH 2GSIA 4D0CB 2G9HA 2BY1A 3O0RH 1WWAX 3QEQD 4WV1C 4OIBA 5LQBH 2Q87A 5HPOA 4WO4C 4NHUA 2B8OT 4O2CB 2OZ4A 1KTLA 1C7TA 3G08B 4DN3L 5IB3A 3VGEA 5FO7B 3FO0H 4R4FH 4TVPE 4DGIL 4LPVA 1EHNA 3BMWA 1KELH 3O3EA 3BI9X 3QXWA 4NJAH 3P9WB 4L9DA 5GIRB 5IG7B 1YEHL 4YE4L 1RIVH 1AO7E 3DX9A 4MNQB 3BGMA 1MF2L 3S7GA 4EQ2A 3S96B 4YHKL 4F7EA 4RFOH 1T3FA 4JFEB 3RIFF 4ZUTB 3QDGD 5EU6D 4ODWB 3QRGH 3VFPB 4GRMB 2DQCH 3VU2A 4P3DA 4AJ0A 2EDLA 4LSUH 4JFDD 3VA6A 5E8EB 1FZOB 2D7OA 2ZPKH 5EZOH 5J89A 5L0QC 5DJYA 1YC7A 2C7UA 2BSED 4NQEE 4TPRL 2VXVH 3P9MB 1MJ7L 1OM3L 3HUJF 3QEGH 1IM9B 1JPTH 1SEQL 4QXWA 2XICA 2V7HA 2P5WA 2R2HB 5ICXB 4BZYA 4I0PD 5I1GL 1E4XL 1FVDA 1QNZL 3BPNB 1KCVH 4R97C 4ZFZA 3BRDA 5D7SL 4JQVA 4X6EA 1RZ8A 4HQQL 2O61A 5DYOA 4X6DF 2R0LL 3MBEB 3TO2B 1A02N 4M5ZL 4EVNA 4U1NA 4S1SH 5HY9B 5F9AC 3UEZA 3BAEH 3SDAA 1MJJA 2F53A 3T4YB 3L1OH 1A14H 3RTQD 2K7QA 2V2WA 3T1FB 4D0BB 4ZFFA 4CN4A 2P5EA 3GRWH 1E4XI 4IHOA 5GHWH 1CWVA 1YPZB 1TITA 3P40A 3TYGH 1A9EA 5JUEL 1QA9A 3E0GA 5EO1B 4HJJL 5F1NB 3M17B 5D2LA 1NLDH 1S7TA 1TPXB 2DYPA 4YLQT 3FAXA 1FNEB 1FHGA 1J05B 3VXOA 1S7XA 1HEZB 2W65A 1JL8A 5D7LA 1A4JB 2APXA 3QXTA 3VFRA 5DVMA 1ADQH 5CUSL 1GPOH 4PY7B 4NRXA 5C0FA 3OX8A 3EDKA 3IDJB 4U1HA 1N5YL 1JYNA 3K2UH 4K2UL 1CDUA 1G7PB 3P3YA 3PWLA 4MXQC 1CT8A 1WBXA 4K7PX 2IQ9L 3TO4A 4D9QE 2HJLB 1J5OL 3HE7D 4ONGL 3LQZB 1F4HA 5BRZA 3SKJL 3UBXI 4W81A 4F9LA 4GRLC 1OAUL 2BVQA 5ALCH 1F00I 4PB9L 3QIWC 1UXWB 1RZ7H 2V2TA 4JHAL 1CXHA 2PO6D 3WNNA 5L2KB 2OZ4H 4JN2B 1T83C 3MV11 1VACA 4PRHA 4XNYL 2DB8A 5C0JB 3VFWA 2A6KB 4HD9A 2XTLA 4HIJA 4QRRB 2B1AH 4JFZH 3KLHD 5B3NA 4WHYH 2CUIA 1MRCH 5I17B 3HI6L 5DUPL 1E4WH 3SDDB 4AIZB 2X4TA 2B2XL 1GGBL 2RBLA 2BJML 1OTTC 3HZVB 3OAYH 1JV5A 5IFAH 4PGDB 5CEZE 3WFBL 1PQZB 3WD5H 4GAJH 2WIMA 4P2RE 5IVXF 2X4OA 1T20A 4XMLL 5KSVA 3QEQA 1BLNB 2DQUL 5IFJA 1X5ZA 2E27L 3HN3A 3K7UA 5GRYA 3WFDH 4F2MB 2GITA 2Y9RT 1UB5A 3ARGC 4HUWA 3DHJA 5JQ6H 2BNQE 5JIPA 3IDMB 3H9SE 2X4RA 4QHKI 3V52H 1KENH 3TH3T 4G8GD 3HZMB 4X4ME 3FFCE 4XVUD 4LFHG 4XTRD 4QF1A 4KHTH 4HUKB 4M6OH 5C0GB 4LRNL 2X40A 3PWNA 1WSST 4O2EA 1QFWH 3G6JB 1WZKA 4FTVE 1HI6B 5BV7H 4WU7A 3AS1A 4JFED 2GK2A 4FMFA 4U1LA 4X4XA 1K9TA 2E3VA 1CFTB 5CJQL 3DTXA 5JPMA 1U3ZA 2D31B 1JZ5A 2EH7L 5FGSA 3QDGA 4JKWA 4WENB 5EU6A 1OSPH 1ACZA 1WZMA 5C0CE 5C0EA 4MA7H 1KYOJ 4JFDA 3BH8B 3JSSA 1P7HL 4TUOB 3PIQA 2CXKA 3MRHA 2V7NB 3HE6D 5TE6L 4K7PL 1U2HA 5I16B 1RQ5A 1PLGH 1XR9B 2F54E 3V4UH 3BWUC 1IAOB 1YEFH 4HUUA 1FNFA 1ONQA 4MHHG 1T5XB 2ADFL 2VISB 4XNZB 1E6JL 3WNKA 5E2TH 5J57B 1KB5B 2H6PA 2MCG1 4J4PD 4YBLB 1MUJB 1RSFA 3P30H 4PGEB 4NP4H 4KKCC 3MO1A 3K4ZA 2X1XR 4EI6B 5GSVB 2L0DA 3OKLB 4P2YA 1HHKA 2Q76B 3NTCL 4IDJL 3VMOA 4JDZB 2P1YA 1NBVH 1TJIL 5H94B 1OD9A 1KCRL 3RL2B 4KAQH 3RIFK 4XX1E 5LGHH 3RTQA 3DIFB 4UNUA 2VZ3A 4KTDH 3ZKND 5D6DA 2YEZB 3LEYL 5KVGL 2J3SA 4BFGA 3H3KA 8FABB 2Z8VC 3ULVE 3FB7A 4OFIA 5D7IB 3F7PC 1I7ZB 2H8PB 4PRPB 1S7WB 3ALXA 5GISH 1JYXA 4RAUA 1U93A 4HC1H 4DOHE 3RL1B 3TV3H 1YMHA 1S9YB 4I5BA 1ZWIB 2D9CA 5E08L 1NC2D 2MWCA 3MACH 3ELAT 4MB3A 2B1HH 2ORBL 4OGYL 1VPOL 1MNUL 1XH3A 4B7IA 2VIRB 3HE7A 3GMPB 2Y72A 3BESR 5J3HC 4P9HC 1A7RL 3RVTD 5E9DB 1HYRC 1OP9A 3BIBX 3ETBF 1J8HA 4EOWH 4R26L 5IB5B 2EDRA 1NEZA 2X7LB 5B4MD 1UENA 3WIHL 4A2LA 1ZGLB 1OP5H 3RZCC 1T1YB 4XPAH 3EFDH 1I85A 3GMQA 3C5JA 1YYLH 1FFPB 4ONFL 4QRRD 1F90L 1QG3A 3RZWA 4I2XE 3O6LL 3QFDB 1JF6A 5K9QI 1HYSC 2ZUXA 2WBJD 3FO9A 5E8NA 2OK0L 3CH1B 2HKHH 3ZTJG 3OHXA 4DZBB 1NDMA 2HKFH 3V6FB 1U91A 3GSNB 5FHAL 2WUBH 4IMLA 5ISZB 2C4FU 1X5GA 5CHNA 1TFHA 3KYOB 1WICA 3CJJA 2VE6A 5DDHB 4ZG1A 1EEYA 4OZFA 4WW2F 2CO6B 3JV4B 5HYJD 2FR4A 4AENA 1P4IH 3QCVL 4X80H 3G6DL 5ANME 3D2UA 1FAIH 3ZYZA 4PJ5E 5BS0D 3LMJL 3U46A 3BD5A 4KKBC 2VLJE 1XGQB 4G8GA 3KLSA 1XIWB 4N9OB 5INCA 1NCDH 4M62H 1FL6A 3VXME 3QI9D 4P4RA 4DKFH 4YHZL 1S7QA 1TETL 1LK3H 2B39A 1RZJC 2FIKB 4JFEA 4R90L 1YEGL 3B9KD 4ODXB 1JGLH 4NC2B 4F7MA 4EIZC 4FABL 2VLKA 3O45A 2WIIB 3KNBA 3ARXA 2VYRE 1A7NH 4AYFA 3EFFB 3T4AA 3N50A 4XMKH 4LEXL 5FA4B 1BQUA 5EBLA 3MNVB 1WIPA 4XAWL 1DBJH 1CGYA 2X4SB 2Q86B 5JNYA 2CLRB 5D9SB 1KEGL 3IJSA 1A6AB 2HFFB 3IDYB 3MMEB 1L7TH 3IDNA 3OPZH 1FCCA 3RHWF 5A1AA 3U36B 1RZIA 3AY4A 4JO1H 1HCVA 1G7HB 3LKSA 3HE6A 4OF7A 1YECL 1WUNT 3SPVA 3F7YA 4UOW1 1OGAE 4DAGL 5JIHA 3MRLB 1XGPB 4IS6B 3KPRA 3I3DA 3LAFA 1UACH 3NFPA 5SWSE 4QHNB 1H3TA 1WQVT 1YEJH 4HMCA 5E8DH 2ATPA 5F7HA 2PNDA 4RMVA 4G9FE 3VXQB 2WNGA 2XN9A 3F65A 4PJEA 5AG9A 1U6AL 3VG0L 4PJBF 3MRMA 3DV4B 4J4PA 5DWUH 5EU7C 4U1SA 2IFFL 1MI5B 1BEYH 1TCMA 3C5SA 1E4KC 4LPCA 1JK8B 5HY9A 3MREA 5FYKL 3WIIL 5F7EL 4HWZA 4WJ5B 3HNTH 4M61B 3JV0A 5I1KH 2B7DT 5KN5B 4KDWA 1UWGH 3TJEL 1A4KA 1YPZA 2Z31C 4HKJB 3C60C 1JFQH 2CGRH 1EERB 5MEPA 1A7QH 2WWMC 4PJDE 2Z92A 5CEXA 4X4YB 3U7WH 1NCWH 2R23B 4D3CL 3AS3A 5DJDB 1QZ1A 1IGTB 2CDFB 2BVOB 3KPSB 1V5JA 3RUGA 1SJEB 5IWLA 3BIAX 3PWVB 4EUPB 5IM7A 1S9XB 1EFXB 1U3HD 1G7PA 5DD6A 4DUVA 2CDEB 5CLWA 3EO9H 1ZT4A 4U49A 1MVUA 3E2HB 1NC2A 2ICEB 4AM0A 3VDBA 4RAVB 4R2GB 1EXUB 1H0DA 5EBMA 2LAGB 4ZTOL 2RR3A 4C56D 4OZFH 4XNQB 3AAZB 2CIKB 1HINL 2YKLL 3RPKA 4Q2ZA 4HZLA 4P5TB 1YJDC 5KS9F 2JIXB 5E2WH 3VGDA 4XBPA 3D85B 1K8DA 4Z5RA 1IBGL 3PL6B 5FGCB 3OAYK 5FK9B 5TDNA 1ZT7A 3SGEI 5SV4A 4XC1H 3CGTA 4XBGB 3V0AC 5C2BH 2HTKD 2MTPA 1CR9H 4UT7H 3KPQB 4HWBA 1A22B 2WBJA 1EGJL 5TPWH 5E94B 1BOGA 3D48R 2WW8A 1DL7L 1QRKA 3D0VB 5I1IL 1UJ3C 3LDBB 2VITA 4OQ1A 4AL8L 1RUAL 1MREL 3BXNB 5BO1L 2BOBB 5DR5H 1MFBH 1FE8H 5DEGB 3ROOA 3RNKA 1XEDA 4WUUB 2EIEA 3PQYE 1TZIA 2QHRL 4XHJC 5HYJA 4P5MB 3VXRA 5FYKU 1U8NA 4PS4L 3IGAB 4V1DD 3WFCL 3GMLA 2OI9B 1J10A 5BS0A 4JO3H 3L5XH 4LHUA 4X7EC 1IC1A 5BMFL 3C2SA 2BY0A 3WIFB 4JRWA 1CG9B 4GQPH 2CLVB 1ZTXH 3UBXB 4GS7B 3VWJD 1OP3K 3VMNA 5AUMA 4M6MH 4FQCL 4WFHD 3QI9A 3T04D 3WJLC 4MZ2A 1YQVH 4JQVC 4LQ1A 1AGEA 3DROA 1ZHLA 1JN6A 4HMEA 1Q9WA 15C8H 3B9KA 5E8PB 2H32A 4Y1AE 1T80A 5SWZB 3GSOB 1HKLL 4K07A 2AEQL 5JW4Q 1HXYB 2QHLA 2IF7A 3UPAA 5CBAB 4YAQA 1OOAA 3HPLA 3T0WA 3WUZA 4Y0GA 3FQUB 5DSCA 1PDKA 4RA3A 1FAKT 3MZTA 4H0IA 3VRIA 2ERJC 1OWWA 4LCIH 3T8XB 2X9YA 4BFIA 1KTDA 3JVGA 3QUYD 1T1ZB 1FJ1A 4JPIA 1XR9A 3I3EA 2GAZA 1NDGA 1M7XA 3SKOA 5C0DB 4U6XA 1BQLL 1G0YR 2CK0H 3U0TB 4LLAA 1KB5A 5JHLL 3BDXA 4I77L 3N85L 3RY4A 3U7YL 1G0XA 4HG4J 1OPGL 2UYLA 4HW6A 4NO0D 4ZUUB 4KI5F 5CD5D 3SCMB 2AV1B 4NM8H 2EDQA 4EUPG 1DCLA 3OKLA 1AP2B 4Z18A 1XMWA 3ULUL 3UJIL 5H94A 3MFGB 5CJXC 2P8LA 4OCXL 5I19H 5HI3C 5FGRA 1LE9A 1NC4B 3N0PB 1RUPL 4QOKD 1HDMB 4ZFGH 4Z7UB 4XNUH 8FABA 5JOPD 2AEIT 1CGSL 5F89B 1AFVL 4JG1L 5K9JH 4CN1A 2HJFB 2H8PA 4GXVL 1HIML 1Q1JH 3I6LE 3NN8A 1WZ1L 5D7JC 4UINL 2JK5B 5TQ2L 3INUL 4HWBH 3SO5A 3DHMA 3QPXH 3ZE2E 1VKXA 5FYLL 1U3HA 3O81A 1OP5K 5EIIB 5MENB 2FZ3A 5HHQA 4X8JB 4OZ4A 4XCCL 3WS3A 4WI4A 3WE6B 1JUFB 3TYFA 3FZUD 5J13B 2AJ3B 3LS4L 1F2QA 1N7ML 4JQIL 4L9LA 4YHMH 4C56A 3HG1E 3QP3A 2P8PA 2JIXD 2QTEA 2ENYA 4WI6A 4ZNEA 2XA8H 4OZHA 2OP4L 4F9PA 4URTB 2OJEA 1J0IA 1U8LB 1AHWC 5I1CL 1BZ7B 1WIOA 3NIGE 4L8SC 3MA7A 1TQCC 3HI5L 3GSUA 12E8L 5GRJL 4HFUH 4PV8A 1Q9LB 2QQNH 3MODL 4HXBH 4N0CD 1CLYL 2FD6L 5IB2A 5ESAA 3ARSA 1OW0C 2W0PA 1D5XA 3MV01 1NGYB 4WUUD 2VDRL 1BWWA 2H32H 4XVJL 3TNMA 5JW5B 1F58L 4LCCC 5TE7L 2XZCH 3KXFA 3TM6A 1ZHKB 4XCYA 4MD4A 5LXGH 2BMKA 4PJAE 4ETQA 1G1YA 1FG2B 5GGTL 2DM2A 4LHJB 4V1DA 3CUPB 3ZE1E 1IEAB 2VLLA 2PR4H 1MWAL 32C2A 1SBSL 4WI9A 4ZXBB 4M7LH 1TZHB 1TVHB 3F5WB 4GAGL 2JELL 4A6YA 3DYOA 4LCYA 4DVRH 3AUVA 3T2OA 1V8HA 2ZZUT 2AJZA 1MJUL 4JHWL 3VWJA 5CJ5A 4ETYA 3D39E 1MOEA 4PBXA 3I6KB 1KB5H 1FGNL 1VA9A 4LHQB 4Z95L 5H8DA 3VFUA 2EYSB 3R06B 5FHBL 5F1IB 3O3AB 4NZTL 1T0MA 2MHAB 1D9KC 5KVDL 1FNAA 5J12C 5I1JH 4L5FH 1UEMA 4OQTL 1T2QL 1OAXL 2W0KA 1QFWM 2PCPA 5DHVA 4ZAKA 1CU4L 2VWEE 1L9MA 1IC7H 2DDQL 3BP4A 2PTUA 2AK1H 1A6TA 1S3KH 3QUYA 5ACLA 1I7UB 2VL5A 4JJ5A 2QBWA 4HIHA 2FJHB 4QHNA 2Y7QB 1F6AB 1CICB 3MRCB 3MRQA 4DVBA 4HKZB 3RY6A 3ARED 5EZLB 1EVTC 2R2EB 3MC0A 3NIDE 4POZD 1BZ9A 4XCNA 4OZGA 3WYRA 2YPKB 4NO0A 1QSFB 4LLWB 3PHSA 3X3FL 4WWKB 2IPTL 2XQBH 4QO1A 1GH7A 1Q9KB 2XQYK 3SHSA 4FXGB 5T1MB 3T2NL 5FOBA 1P4LA 2W0LA 4FFVD 1NCNA 3RVXC 3WV0A 1NC4D 4KRNA 4XH2A 1J1PL 1FVEA 3U0WL 3VFTA 2XA3A 4QOKA 1I85C 4EI5B 1LE5A 5F7UA 5GSRA 2A77H 1OB1B 3IAPA 1MIML 3QDJB 2R56L 3PWVA 5DRZB 4PYHA 4UV7L 1KB9J 2VN4A 2C1PB 1JBJA 5EZIH 3T0XA 3BO8A 1SEBA 3IAGC 1GXEA 1WCQA 3T3MF 4M1GL 2VABA 4RAVA 1GOHA 1DBMH 2YBRB 1FFNB 1EMTL 3MLUL 4HS3B 5D71L 4CU7A 1AJ7H 2G5BA 1N8ZB 2HJKB 4HUXB 4KK5C 4NCC1 4WI7A 1P4BH 3CK0H 1DE4B 1NBYA 4KHXH 4M43L 5EOCJ 5DRWA 4M3KB 3OKEB 4P23C 2IBZY 4JFHD 5D5MF 3N1GC 3DYMA 5TF1H 3LRGA 5T33L 2Z8WC 4N0UB 4Y2DD 1QACA 1E6OL 5C0BB 1FO0B 1KG0A 3RKDD 5J1SC 2C3VA 5DQ9A 3A67H 1UB6B 4PD4J 2RGSA 4HV8B 5DFVC 2AK4B 5EU3B 3WN5C 1OQXA 2EDDA 2P5WE 4U0RC 4LLDB 4TNWF 3D18A 3CH8A 1KXVC 4HH9A 1EZVY 2XKSA 5DHXB 3TCLA 4A6YH 5CBEA 4WHTB 5IJKA 5EIVA 3WNLA 2VDLL 2AABL 2P4AB 3D0VA 1EK3A 3F6IA 4QYOB 4E42B 1PY9A 3MUZ1 4NDMB 1HHGB 3MOBL 4WI5A 4YR6B 5D7IF 4KDTA 3GJFB 1I7RB 2HRLA 2EEAA 1YNLL 3MGTB 5BZWA 1VGKA 5DURB 5KTEH 3WXWL 3CCHA 2AJXH 2ED8A 2F5BL 2F53E 2LFGA 3DOSA 4YPGB 2P5EE 3PWJB 2GCYB 5I74C 4I18B 1PG7W 2BNUA 2OL3A 2KBGA 1MCLA 5IV2A 5T1DL 3QSKB 2O5YH 1HWHB 2OTPA 5D2LE 5M95B 4JQXA 4HH8A 3EBAA 5L2JA 2F8XC 2AXGA 5GS2H 4IJ3B 5D7LE 5A3IC 1DUYB 2AXFB 2HG5B 4DTGH 4B50A 4WFGE 1RZKL 4JFYA 4HJ0D 1CTNA 1NCCL 1QOKA 1RU9L 3VFMB 2AJVL 3ZLQC 2M2DA 3SGJA 3SE8H 2VZ1A 3HI1B 3X14A 1P84J 3OGCB 5BRZE 4NM4L 3W82A 1U8PB 5CD3A 4KUZL 2AJSL 2HN7A 2PUQT 2R8SL 4I0KA 5LWYH 1HQ4A 2NMSA 3QXAA 3GSQB 3BUTA 4OLUL 3A6CH 4PRHE 5DJ0A 1BJ1J 1FL5A 4ZPTB 4QRPB 4HGWA 3AMKA 4DN3H 1L7IL 5KJRL 3QUZB 4W70A 5CS7A 1ED3A 3LKRA 4PRNA 4GMSH 5GZOC 4M1CD 3G6AA 5ID1B 3AREA 5J6HA 4WWKD 4UV4H 1YEHH 4Y4HD 3RWGA 1NMAH 1WC7A 3LV3B 3MLVH 1WGOA 4YHKH 2GY5A 4U6YB 3HC4L 3QEQE 1F4XL 1WLHA 2IFGA 4RMTA 5EULV 4XP1L 5EBWB 3GMRB 3L3HB 5DQDH 5EFIB 1G7MA 3IFLL 2DI9A 3FT3B 1CIDA 5FO9B 4GQ9L 4P4KD 2VXSL 3D25B 4RQQB 1IEBB 3NZ8B 2NY1B 4KJQC 4LNVA 1HDMA 5FFLA 4HFWB 4EI5D 4X0KA 3VRJB 3TBTB 5F9OL 3CD4A 1FZKA 3R0NA 5D1XD 3QDJD 3CFKA 1CDJA 1XCTB 4TPRH 4PJ8B 2NXZC 4YFDB 1MFCL 4UQ2A 5GRZA 1M7DB 3SDCA 4ELMB 5B39B 2EH8H 1XZ0B 4JLRA 4KKAD 4JVPA 3NBNA 2ESVD 2JCCB 5EIIA 1RHHB 2COQA 3D9AL 1MELA 1QNZH 4XI5C 3MLZL 4NO5B 5D7SH 3QDGE 5EU6E 1FIGL 4HQQH 4YHLL 3QCUL 2R0LH 2BVTA 3PHOA 2PW1A 3P4OB 3MRGB 3QWOB 4JFDE 4M5ZH 3RWFA 4OCNC 3LCYA 4K9EC 3AU1A 5I73C 3T3PE 2CMRL 4Y2DA 4FG6C 4WFFD 5C08D 5HHOD 5KW9L 1Q0XH 3OTTA 4PLJD 2OL3H 4OZIB 4OCSL 2VDPL 4ZTPH 3K80A 1MCSA 4HJJH 3QXDB 1UM5H 3I3BA 2OTUA 3M1BA 1CVRA 3HZKA 1MHCB 3M8OH 4F58H 2VJXA 3E3QC 1WZLA 2ZG2A 4B7LA 1CLOL 4K7PY 3KHOA 3WNPA 4NN6C 1N5YH 1CE1L 2YA2A 4H88L 5FYKD 4L8CB 1DEEA 2IQ9H 4HXAH 4K94H 4UOW0 2ADIA 1J5OH 3ZE0F 3GMNB 4NKMA 5F7WC 3CVIL 4ELKA 1IAKB 4PRIB 5INDA 4I0CC 3QUML 1H5BB 3SKJH 4YFLF 4Z0BL 1OAUH 2NY6C 4KROB 3UTQA 1YY8B 1QEWA 2HRPH 4KXZI 4RZCB 4PB9H 2Y5EA 2ZCKL 3ARFB 4JHAH 5ADPL 5IJVB 3CIQA 2EXYD 4CVWA 2DIAA 4NNYA 5DD0L 4XNYH 3QA3A 3FMGL 5IHUH 1L0YA 3WHE1 4TUJB 5F88B 3P4MB 4BH8B 5IQ9A 3BDBA 4K23L 1A5FL 2A6DB 4RGNC 5HPMA 1PKQA 1NBZA 3HI6H 4NCC2 2R0ZL 1EBPA 2KDGA 1U8HB 2NY4B 4RWYL 3OB0H 1HOCB 3MV8D 4G9DA 4PRAA 1S8DB 4K3GA 3FTGA 1R6VA 1M05A 3DWTA 1J8HE 4NFDA 3LS5L 2SEBB 3CDGB 4NN5B 1FNGB 2DQUH 4TOYL 1QUNA 2KZ1B 5KOVC 3V79C 3GO1L 3CFEA 2VKXA 4U1IB 5BZDB 5C0AD 4I4WA 4QRPD 2CKNA 3BPOC 2V6HA 5LCVL 5C09D 3W9DB 5CGMA 2NY0B 3O2VL 1HNFA 1YN6A 2FGWH 1YEEL 1W8OA 3QUZD 5MEOB 2EDHA 3RVUC 4Y4KB 1U36A 4IMKA 2C3XA 3GBLA 4OF3A 4UOJA 1XGRA 3T0BA 5GGVL 4K71C 2MKLC 3PDDA 1R5WB 4UDUA 1NFDB 4TRPL 1PYWB 1YYML 5B39G 1GC1L 4TULL 2UVFA 4Y4HA 1Y0LB 5K93A 3GSXB 4M8QB 4QTIL 4O4YL 1UKQA 5CJQH 3WLBA 5C6PB 1UQSB 3VXPB 4DEPB 5MEQA 4HJGB 3QQNA 2EH7H 4I3RL 3QG6A 4L9LC 1X9QA 4QXGH 1KLGA 5KSAC 4QNPE 2VAAB 2NZ9C 3KPNA 4P4KA 5F44A 4HK0A 5E00A 3HS0B 4G8GE 5KANI 5KOMC 3STBA 4PJ8D 4MDJB 5DGQA 3U4EB 1RJYB 1QQDB 1NL0L 5D1XA 1MWAB 1T1XB 4XZUB 2V9TA 3BIKA 5TE6H 1KJVA 2I9TB 4K7PH 2OTWA 4HWEL 5EOQL 3LEVL 5CEZL 2YZ8A 3WFEH 1PJ9A 2ESVA 4X6CB 3L3DB 1HH9B 3DARA 4JFEE 4BK4A 1BOYA 4ZMAT 3SKMA 2ADFH 1AH1A 4PFEA 4LQFL 3BISA 4ONHA 3SGKA 4IRZL 3VCLA 1FFNA 1R0AL 3K8LA 5ID0B 2LVEA 1IGFL 3W9EB 4NQUA 1OAYH 4APQA 2GJZB 3OKEA 4HS8L 1T04A 1F4YL 3LN5B 4IDJH 4KZDL 1XR8B 4XT1C 4JO2H 3TT1L 5IR1B 5J1AB 3AM8A 1SY6L 1S7VA 4X9GA 3KPLB 2D0HA 4JY6A 4NKQB 4LU5L 5C08A 4XNXH 5HHOA 1T6WA 3PP3K 2EDXA 1K8IB 3UTZA 2PTTA 1MFDL 1G9NL 3KPRE 2VXTH 3O6FD 4HK3N 1C5CH 5KVGH 1RVFL 4PJBA 3IFNL 1NGXB 4Z7UF 2XN9E 1I9IH 5D1ZC 4PJEE 2I9LB 2ICWJ 2IH3A 3G9AB 5IMKB 4M7LT 5HGHA 4C4KT 3FRUA 3P0YH 3VW3L 4P46D 4QHUA 4N9GA 5IMOA 3IETB 2X89A 2DQGH 1J1XL 5E08H 2KZWA 5J0BA 3U7AA 4JDTL 1Z0MA 4X7TB 2EYRA 2ORBH 5FYJU 2PKDA 1MFAH 4OGYH 1LILA 1XCQA 1VPOH 5GJSL 1MNUH 1YPZE 3L7FA 4KROD 4M3JA 1TQBC 4ZAKC 1T7XA 3QEHB 3BD3A 3LHPL 3ARFD 4R26H 3STZB 4LPTA 1MCPL 3RWIB 5EC1A 2X4NB 1FL3A 2EZ0C 3BN9C 3ZKXB 1JPFB 4KK9D 3RUGE 4OIIL 4ONFH 2XV6B 1JNJA 4NRZA 1EX0A 1EEZA 1NGQL 1RJLB 1TZGH 4KMQA 4TUKH 1FLTX 2FH8A 3F6LA 4JZNA 5LG1A 5FYLD 2Q8AH 5D1QA 4P2OB 3DURA 1E28A 1I3RA 1B0WA 3MV8A 2W59A 1OAQH 3NGBB 3QH3B 1U8PA 1BIIA 3IFOB 4JM4H 1XGUA 2AERT 3ZL4H 4X7DC 2YPLB 2C26A 3NCEB 4UMGA 1WITA 1IKFL 4U1GC 4JRXB 3EDEA 3L3JB 2IH1B 4R0LA 3TBWA 2IC2A 4HIXL 5C0AA 1FNLA 2FEDD 2GJ6B 3G6DH 5DVOA 1Q94A 4HX1B 5C09A 1NFIB 3BP5A 3LMJH 1ZLVH 3SO3C 3LPGA 5BXFB 2NX5B 2QQQA 3NCBB 4O5LH 1LDSA 3LZFL 3MCKA 4MD5A 4KKLD 3GK8L 4H1LG 3V7MA 5J9PB 1EGJA 4LOUD 4GSDH 3BJ91 1FGVH 3T0EB 3N06B 3D87B 1AD0B 3KG5A 4UT6L 5DMIL 1E4JA 1YEGH 4MMXC 5DMJB 4ISVA 5JORB 4CVZB 1DQLH 3SBWA 4FABH 4HIEB 3BYTA 5TFSL 5HYJE 1B3JA 5IBTL 2H3NA 2IPKB 2R15A 5EOCL 3X12B 3VXRE 2DQHL 5IBLC 1FC1A 4LEXH 2NTFB 4P0DA 5C3LD 1R24A 2BHZA 5BS0E 1GGYA 1KEGH 1BD2B 3CDFA 4W6YB 4MNHB 2OQJB 3ZDXE 4MAYA 4XPFH 3O4LD 1DQJA 2XRAL 3ILPB 3MLPA 4LRIA 2ICCA 4NGHL 3IU4L 2WANA 1DQML 1TJHL 3X17A 5JOEA 4KDTC 1VCAA 3V0WL 1U6AH 3V6OA 3FOMB 4XXCA 5DJZB 3ZSSA 1I3VA 4FQQB 3FQXB 3NCJL 3ZKSD 1WTGT 25C8L 3MRPA 5FYKH 1OT1A 3WIIH 4YHPB 1FH5L 4ZO6A 3O3BA 4JFXB 1G1CA 4FQLH 3NCYP 3TJEH 4TTDD 1F3DH 5JPNB 3EYOA 4YWGL 3ZHLA 5I30L 1KTRL 3O6FA 2E5EA 4YXLL 5GS1A 4RGNE 1ZKAA 3L3IB 3FCTB 5CJBA 1X4ZA 4D3CH 4PGCB 1VADA 2GUOB 3O4OB 3H9YA 4AEEA 1I1CA 2I5YL 4N8CL 1MAML 1J0KA 2NW2B 3I2CL 4PP1C 4P46A 3VXNB 3SGEH 1MCFA 3UTPD 4G7VH 4K94C 3BDYH 1O7VA 3GMNA 4G80B 5HI5D 2QL1A 4N0YL 3DLQR 2A6JA 1MHHA 4Q58C 5T3ZL 3LKPB 4ZTOH 3B5GA 5GGQL 2DQIL 3Q6FB 4ZUWB 3TGXA 4JDVB 2YKLH 5JW4M 2Y4SA 4MA3A 1INQA 3VFNB 3OB0K 4NOFA 2HVJA 3NPSB 1FRGL 1JPSL 3VFOA 1IBGH 5JO5A 1ORQB 1PG7X 3REWB 3IVKA 2G60L 1FLRH 1NLBH 5L7XL 4NYLA 1TVBB 4Y19B 2GHWB 1EGJH 3BUYA 3HA0A 3VWKC 1RJZB 4OFKA 4NQVA 5B8CA 4PJGA 4MQ7B 5CEYB 4O58L 5JA8B 5AYQA 4NC1C 4OI8A 3TVMD 4AY0A 1C5BL 4RRPG 3ZKMC 3OMZA 3ABZA 4H0HB 4FP8H 4C56E 1MREH 3GGWA 5F93C 2WBKA 1UCBL 3FB5A 3TFKC 5BO1H 1LO2H 3QO1B 5CLTA 1UKSA 43CAB 3GIVA 3CLEL 4ODUB 1FNGA 1PFCA 4PGJA 5E5MB 4OCWH 4OZHE 4ZNEE 5BJTA 1KCKA 2IALA 4WW1B 1KFAL 4MS8C 2YRPA 2QHRH 2VDNL 3CC5A 3VD3A 5DZNA 1CBVH 2HFEB 4FQPA 3WFCH 3FQNB 3NFSL 1AO7B 4HKXB 4NUGH 3BQUD 1HZHL 4JGMA 2C3WA 1LEGB 5BMFH 3SDCC 1ZXQA 5F7LB 3RJDA 1CXLA 3QHFL 1EO8L 4OLZL 4BSWA 4P49A 5CSBA 2FL5A 1KPRA 1Y0LA 4FQCH 2YD4A 1DQQA 4YC2B 3AVEA 2CIIA 4GMTL 3LD8B 3BKYL 5DS8B 1UQSA 4M7ZB 3V7AE 5BCAA 1IT9L 5FB8B 5FECA 1R5VB 4OAWA 3B83A 1I1YB 3KXFE 2ENSA 1QR1B 2V5TA 4NQEB 1FCGA 4TSCL 2VAAA 1HKLH 1KIQB 2A9MH 3NZHL 2AEQH 3QQ4A 4V1DE 2CR3A 2D03L 1OTUD 1U92B 5FA3B 1YNKL 3G5ZA 3QUMB 5T1LB 5TE4H 4NWUL 1BREA 1RJYA 3GI8L 4XCEB 5DJ8A 1B2WH 1QQDA 4RISL 4LVOC 5E4EB 3H8NA 4CMHC 1I8KA 1F13A 4B41A 3O4LA 4JJHA 5DRNA 4NQSB 1VB9A 4JM2D 4WFHE 5TDOB 3L3DA 3MJ9A 3V2AR 3L3OA 4YEEA 3GJEA 4JGUA 1F11A 1M6OB 3RU8L 5JHLH 5D6CA 4I77H 3U7YH 4HKBA 1K5NB 2FHCA 3O9WC 1BP3B 5E4IA 4X5XB 1NMCC 3LN5A 1AIFA 1PG7L 1J9CT 4G8EA 4PJFA 4Z7OF 4OQTA 3QIBB 2FWOA 4UT9H 1PY4A 2X6MA 1QO3A 1HILB 1U8QA 4OCXH 4AT6A 2FO4B 1CVSC 4Y16B 1WJ3A 3IU3A 2O5ZH 3MXVL 3O6ML 2ARWA 1RUPH 5I0ZA 1LEIB 2W1NA 1CGSH 1AFVH 4UUJA 4NUJA 1MIEH 4JG1H 1T5WB 4POUB 1D5IL 4LNRA 4Y4FC 4GXVH 5CJOL 5IMKA 1TCRA 4CRPA 4OZGE 4QEGA 2Y6SC 1WZ1H 4XNMA 4POYA 4UINH 5TQ2H 1MRFL 4U7KA 4ELMF 1I8IB 4CVUA 3BPLC 5FYLH 2IWGA 1ZLUH 2EDTA 4X7TA 2JCCF 2AJYL 4PTUB 1UVQA 3TPUB 1RULL 3EUUA 5AAMA 1PGRB 3AROA 5E6ZA 1KIRB 2IPUG 1N7MH 5C07D 3FT2A 4YHIB 3RVVC 3STZA 4QOKE 5JTWA 3KJ6L 5JOPE 3V8OA 1KNOA 3WXVL 1JWUB 1NGZA 4N0FB 5TQ0L 4J3WA 4KV5F 1SMOA 5SWQB 3Q0HA 3N1FC 4RGMC 2JB6A 4P9HL 5JXEC 4Y19D 3U1SL 4DKEL 4PBWD 4JFFD 1PZ5B 3MLWL 3HI5H 7CGTA 4WW2C 5KSUA 1ETZB 3QHTC 1OF2A 2QQKL 5L9DH 1YEDA 3MODH 4HSQA 4Y5XB 1CLYH 2FD6H 5H35A 2HT3D 3TVMA 5IGXH 4U4BA 5F9WC 1XF3B 2BNQB 1BQHB 4QWWD 3H9SB 2AXJA 2VDRH 1K6QL 4Y5VA 4XVJH 2AGJL 2XNAA 5I6XC 1F58H 2EIDA 5TE7H 5F3HB 2W0FA 1ZEAL 5A16A 4L29A 3ULUF 4FQ2L 3RGVB 2BNRD 1AO7D 4NQDD 3BEWA 3FO2A 2DJ4A 1I1RA 1CL7L 4MWFB 3ARDD 3DO7B 1IGML 3BQUA 5A43C 1SBSH 3MJ7A 3WEXA 4PJCA 5LQBL 4GAGH 1A6WL 4GKNB 2NZIA 3U30B 1JHTA 4PR5A 2VQ1B 4NQXB 5IW6B 3ALWA 4FA8A 2E8ZA 1MJUH 3DBXB 3MJ9H 4FZ8L 1KTKE 3DSNA 5ACZB 5C0CB 3OJMB 3NOIA 3BN3B 3M07A 1DVFC 5JDSA 3DRQA 1BIHA 1FGNH 1FFOA 4Z95H 1II4E 3VGHA 2R29H 1MQ8A 5F70A 5B3JF 4APQC 4NZTH 4GW1B 4PJHA 3E6FA 5C6WH 1ZS8B 5KVDH 2CLZB 4NJAL 4WHCA 1CL7I 2X4PB 4OGAD 4WTZA 5E56A 3DMMC 4LLVA 3T2PA 1G7LA 3AM8C 3OXRB 3DVNA 4OQTH 1T2QH 1NAML 4RFOL 3LIZH 4YHYC 2A83A 1RZJL 1OSZB 2F54B 1DZBA 4RMQA 4UAOB 2YUWA 1WFUA 4IOFC 4F37K 2DDQH 2EIZA 3B43A 2DQCL 4ZS6D 1CTOA 3I02A 1ZLWH 4GG8B 4LSUL 5J11B 4PP2A 4JM2A 3WO4B 2QR0B 3D3VA 5EZOL 1ZK9A 3WHXA 4EZMA 3KR3H 1PBYA 2A38A 2D3VA 3FN3A 3NFNB 2N56A 1V05A 4DFIA 3F12B 3X3FH 1G84A 2DICA 1NFDF 5EUKB 2N7AA 1IGYB 1A2YA 3P0VH 3WHE0 1JYWA 5E6IA 2FBJH 4LDOB 1DDHB 5HJ3A 3D5OF 3PNWB 2ICWI 3PDOA 4JZJC 4ZYKA 3DJ9A 3U0WH 1IQWL 4DOHB 4UIMA 4OUUA 3DNKA 3BAEL 2EXYC 4S2SB 5JW4R 5KBNC 4X5WB 1AD9B 1OAZL 1XF5A 4LF3B 5EG6C 5CIPA 2R69H 3QUXD 4LSVH 4E0RA 3EYVB 4UV7H 1B0RB 5IT2H 2Z35A 5D1QC 5FYJD 1GHFL 2EDFA 3MRJB 1QYGH 4ZFOA 1QBML 4HUVA 4H20H 1R3LA 1BGXL 1NLDL 1O7SA 3CSGA 5E5UB 1EMTH 3MLUH 4YDKL 4OLYH 4HK3J 1ADQL 1GPOL 5C07A 4M43H 3KS0H 1M71B 4I2XB 4R0LC 3FFDA 4FQJL 4GRWH 1G9MH 4NO2B 1BQHG 3LRSB 4XB7A 4PYGA 1F97A 2BY3A 4F15B 3K1DA 3EOBA 4RDQG 1VFBA 4JFQB 3MRNB 1W8NA 2CKBL 3MLTA 4Z7WA 4MA8L 5CEZD 1YNTA 1SJXA 5ALCL 4JFFA 1IZKA 1YJDL 7FABL 2AABH 1IJ9A 3NH7H 4ZSOA 2CDGA 5L0QB 4MD0B 5ANMB 3H9SD 4RNRB 4JFHE 4AG4L 1NKRA 4PJ5B 1BWMA 1K4DB 1MRCL 43C9B 1E4WL 3D0LB 2FGZA 2F5BH 4Z77A 2VLJB 4PJ9B 1E27B 4PJIA 3RGVD 2I07A 3LEXB 1GJIA 2AV7B 5IW1A 4R97B 2DQFB 2BNRA 3QEUB 4NQDA 5E03A 3VXMB 2H2PC 4MZ3A 2BVEA 1T4KB 5IFAL 2FO1A 4WEBL 3W39B 3MRDA 4GAJL 4MAYC 3ARDA 5I8EB 5BVJB 5IEKB 4H5SA 2A6IA 4ZO9A 3WFHB 3MRBB 4PJ7A 1TIUA 3IB4A 4OD2B 4F8TA 5HGAB 1JWSA 4I48A 5DLML 3V52L 5FB8A 1RZKH 1KENL 1DFBH 4BSVA 1RV6X 1NCCH 2FJGA 1RU9H 4HUNB 2AJVH 1Z9LA 1WAAA 4JKMA 2P7TB 2MQ0A 1ZMYA 4JFOA 3RDTB 3QIUB 4KHTL 1JP5A 4L3CA 2ZSVB 1AGCA 4R4ND 4XX1G 2D4DA 2DAVA 2IMNA 4NM4H 4U1JA 4KUZH 2AJSH 2R8SH 3QDHA 4AMKL 2C1OA 5JA9A 1OGAB 4G6JH 2G75B 4KK6C 5HYQB 5LVEA 5DJ2B 2NY7H 5SWSB 2WP3T 4EN3A 1MLBA 3DSFL 5FUCC 1Q9OB 2NXYC 4FQXD 4G9FB 1OSPL 1D6EB 1MEXH 1FN4B 4X5LA 1A1OB 5I1LB 5H2BB 3MRKA 3UPRB 3MROA 1DN0B 3EYQC 4KI5C 1L7IH 1K4CA 1MQKL 4N0RA 5C0NC 1PKQE 1EAPB 1P7KA 1A1MA 4ORZC 4GRLB 1WT5C 5CIPH 3BVNB 3O3DA 3QIWB 4GW4B 1X5AA 1EHLH 2WWKO 3VFSA 1KN4L 2P46B 1HKFA 1PLGL 1KOAA 4P2CG 2A1WL 4YDIL 3QQ9C 5E8OB 3V4UL 1YEFL 3GDBA 4JGJA 3AXLA 4YQXL 3HC4H 1F4XH 5I18H 4UZGA 4YX2H 4XP1H 4PJDB 3KYAA 4MJ5A 1JGDB 4HULB 4GQ9H 5F7DB 2Z93A 3PUCA 2YD7A 1ZLUK 1UZ6E 2NW3B 1KT2B 4CNIB 3RBSA 3WJJC 5FF6A 2ZNWA 4LGRB 3GB7B 1AXSB 1R3JA 4KAQL 4ZUVA 5LGHL 1MFCH 3WS6A 5GGUA 3BPNC 3QQ3B 1JIBA 2X4QB 2J8OA 4WO4D 3QUXA 2V2XA 1T2JA 4OM0L 3WCYA 2KQNA 3D9AH 4U6HA 5B8CC 3ARGB 3MBEC 3PV6B 4G8IA 3THML 3MLZH 5I71B 1KIRA 4NNXB 1ZANL 4LSPH 4KRLB 5JIIA 1WEJL 4YHLH 5GISL 2NY2B 1G6RB 2B5IC 5GGVY 1U8KB 2DLEA 3TA3B 3TV3L 3JTTA 3MACL 5IB4B 2PXYB 3MNWB 2B1HL 2CMRH 2VQUA 4OJFL 4ZUSB 3CAFA 4V2BA 4YNYB 2BSTA 2HWZH 5KW9H 3X13B 4BH7A 4F7CB 4Q9CA 2YSSA 1TPXC 4OCSH 2ESVE 4N1EA 2VDPH 5HBBA 4LKXA 4MB4A 5DK0A 4QHLB 1L0XA 3U2SB 2AS5M 1WCBB 1QSED 3UMTA 3QUKA 1ETZA 4LCWD 4X8XA 4XPAL 3EFDL 4KXZH 1IQDA 1KYOK 1LD9A 3PQYB 3V9FA 5IIEA 5I1DA 3RIAK 5DMGC 1ZGLP 3PJSB 3CZFA 1DTUA 1KIPB 1CLOH 2Q1EA 5M7QA 1INDL 2YMXH 2XZQH 2HKHL 4H88H 2CD0A 3FQWA 4P5KB 3KDMB 2HKFL 5HDQL 4WFFE 4WU5A 5H37G 3EAKA 5C08E 3UP1A 3CVIH 1ZOXA 4LP4A 5HHOE 2WUBL 4HDIB 3MRIA 1J0ZA 1EDQA 1SYVB 3HRZA 3B6SA 4PPTA 4PJBE 2ZCKH 2EYTA 2ZUWA 2F19H 1I9JL 4U1MB 2W91A 2DQEH 3UTSD 5DD0H 5CZVL 4Y1AB 4X80L 2DL9A 3VJ6B 2FSEB 3SDDC 3VH8B 2D7MA 4W6WB 4UILL 5GS0C 3VE0B 1FNSL 1A5FH 3S9DB 1QSZA 4Z7VA 1IL1B 1WVZA 3PGFL 1UM4L 2E8YA 5FYKE 5ACMA 2R0ZH 3WUWB 3MFFA 3D69B 1NCDL 4M62L 3I6GA 1JI1A 1JJUA 4DKFL 3F58L 1NSNH 1LK3L 4OTXH 4PRDB 2QSTA 5T3ZD 1JZ3A 4E5XA 3QULB 4A2MA 1ITBB 1BX2A 3LS5H 3DX8A 4G9FD 4AEIL 4MXQD 3RWHA 2NYYC 1A7NL 4FQXA 5LCVH 1KF9B 3MV9D 4GG8A 3CFBB 4BQBA 3ES6B 2VL4A 3L95B 1X5HA 4GRLD 1AGBB 3DVGA 5D2NA 4WY7H 1AE6L 2XWJA 1OARL 2RFXA 4JO1L 3MV8E 5GGVH 5TDPB 2HTLC 2R1XB 3F12A 1D5MB 3BH9B 4TULH 3RPIB 3RZCB 4G6AC 5FYJH 2ATKA 3JWDC 4F7PA 4D8PB 3N1MC 4QTIH 4O4YH 3TIDA 5E8DL 4L4JA 3IDGB 4IEFB 4GUPA 4X83A 4I3RH 1WBYB 5C0AE 5C09E 1LO5A 1X6NA 5B21A 1OTTD 1BEYL 4IM8A 3UDWA 1RK0B 2XZAL 2VKWA 3KYMB 4BK5A 3MR9A 3S4SG 2A73B 3DX7A 4GKZA 5ESVA 4DUWA 4WV1A 1LNUA 4ZNCD 1HXMA 5I1KL 1FG9C 5DEFA 4JB9L 4XNZC 2X4UA 1AGDA 1JFQL 4WO4A 3LEVH 1C1EL 2ILLA 3CXDH 3ARGD 4YBLC 1FV1B 1C5DA 4JKKA 1T03L 1A7QL 5GGSA 3RJQB 3HG1B 3IRPX 3IXAB 3T2QA 3U7WL 1NCWL 1R0AH 2YHGA 4XRCB 4JR9H 1IGFH 5IB1A 4R6UA 4O51A 5K9KB 3HR5B 3ECBB 1R3HA 2AKRB 4KJYA 3MRFB 4QT5B 3TNNA 4LDEB 2MKWA 3EO9L 4R7DA 1KJMA 3ORJA 4KZDH 5GGSY 3TT1H 3RAJL 1NAMB 3MGAA 1CFVL 4PUBL 5EO9B 4LU5H 4FFYH 3FKUS 4YDVA 4UU9B 4NT6A 3CDCA 4QXUH 3RWCA 3WLWC 4LVHC 2FX7L 1RVFH 4XXDB 1QSEA 1I1AD 2E6PA 5E2WL 5BQ7A 4ZO8A 3HFML 4IRJC 4LCWA 3V6OE 1N26A 3CFDB 1BVKB 5EZJA 5D4QA 3VH8G 3H3BC 3VW3H 4PJAB 4YZFF 4UT7L 4HIIA 2VLRD 4W6XB 3WKNA 5EU5A 5IMMA 2GTWB 4JDTH 3T65B 1I4FB 5HHNA 3CSBA 4WI2A 1F3JB 3WUWG 1U8IB 4WCYL 5GJSH 4PV9B 2ED9A 2ZOKB 1D5BB 1JF1A 1ORSB 4UIKH 4QRSB 4KKCD 3SQBA 4LPYA 1X5IA 3LHPH 1AR2A 2QEJA 5DZOA 1MCPH 1MFBL 3GMOA 2MFNA 2IQAB 3D39B 2GTZB 1VGEL 3QHZH 2G2RB 4OIIH 3JV6A 3UTSA 1AQDA 5FOJA 3LH2L 1KXTB 4JO3L 3L5XL 3P77B 3IDXH 2Z31B 3MYJB 5EN2A 2BVYA 3EOAB 3IXTA 1H15A 4I3SH 3IF1A 5E1HB 3OJDB 4YDJA 1K3IA 1H3PH 3IFPA 1QD0A 3QNYA 1KLUA 3SDXF 3ARBB 1YQVL 1LHZA 1N5AB 4IIQA 2EDJA 4WDIB 5DC9B 5E6IC 4OI9A 1HHHA 4FQ1H 4X7SL 1JGUH 5KAQG 1FN4A 4HIXH 4H25B 3TLRA 4WGVB 1KCUL 4HLZG 4RDQF 3KLAB 3MV9A 4WUKL 1XIWC 1T1WB 2CH8A 1F6FB 2C5DC 1HQRA 5J3HD 3O2DA 1YUHA 5FYLE 2GSIB 2G9HB 2RIKA 1G7JA 1EHAA 4PJGE 4UDTB 5FDWA 2PYEB 4NHUB 3FONA 4X4ZA 4LGSB 1W0WA 1T83A 1G7IA 2HFGL 5IB3B 3NCYS 1JNLL 1HYSD 4J2XA 5DMIH 3K74B 2CK0L 5TFSH 5IBTH 5EOCH 3O3EB 2J8UA 4MA1C 4G8FA 4NM8L 3IDYC 3DX9B 3BGMB 2IPUK 4N5UA 3PWUA 4F7EB 1T3FB 1FZMA 4XPBL 1LO0L 3MZGB 4P3WA 1G6VK 2X4QA 5I19L 3L3KA 4P3DB 1S9VA 2YK1H 4YK4C 4ZFGL 2NCMA 1DANU 4NGHH 4XNUL 3ARGA 4L4TD 3TBSA 4KRPC 1R3IL 4KKBD 2E7LC 1DQMH 5DJYB 3W0WD 3UTTA 2C7UB 4GBXA 5A2IH 3V0WH 1TJGL 2FLBT 2OR7A 3OKNA 4QY8A 4HWBL 1CGUA 4RMWA 1JZ4A 5EDXA 2X2YA 25C8H 3RA7H 5A2LH 2V7HB 2P5WB 2W9LA 5BV7B 4X7CC 1FVDB 5SX5H 4QRQA 3OG4B 4MMZC 3QAZB 2GT9A 3CNKA 4ZFZB 2B0SH 3LN4A 4GAFB 3O4LE 4X6EB 1RZ8B 2R9HC 1PW3A 2BC4A 3ULVF 2O61B 5DYOB 3IJYA 4YWGH 4QHLA 5I30H 2MQ3A 2WUCL 3HRPA 4EVNB 4XHQA 2BSSA 1UH4A 4YXLH 5EC2A 3ZDYE 3ZHKA 5MI0B 2A74A 1I1AA 2KH2B 4Z7NE 3UC0L 3SDAB 1GRWA 1MJJB 4KKNA 2F53B 2V2WB 3FJTA 4ZFFB 3E2HC 3U4BL 2P5EB 1CI5A 4OCYH 3BMVA 2I5YH 2H2SC 1MAMH 4IHOB 4JY4A 4N8CH 1ACYL 5IESL 1A9EB 2Z4QB 4PJFE 4R2GC 4M5YH 2VLRA 1VENA 4Q7DA 1B0GA 5FUOL 1QA9B 1RUQL 1UWEH 5F7NC 5D2LB 2DYPB 1S7TB 4HFUL 5KG9A 3VXOB 1S7XB 2QQNL 4HXBL 2VDMH 2W65B 4P5TC 3HKFA 5D7LB 5T3ZH 3VFRB 5GGQH 4EN3C 2DQIH 5AYUL 4NRXB 5C0FB 1KJ2A 3OX8B 4U1HB 4HG4K 3PL6C 4IRSA 3ALPA 1LWRA 1BJ1H 3PWLB 1LEKA 4MQSB 1CT8B 1WBXB 3TO4B 4YBQC 1FRGH 1JPSH 1YDPA 1QVOB 5D96C 5LXGL 4GG6A 3T08A 2G60H 1Q8MA 3O2DH 5FO8A 5BRZB 5L7XH 2AXHA 2Z31D 3C60D 1XF4A 3MGOA 3LDBC 2BVQB 3UTPE 3QRFM 1ES0A 2V2TB 2WWMD 4DVRL 5L88H 4O58H 1RI8A 2OJZH 1UYWL 1VACB 4MDIA 4PRHB 3VFWB 4XCFL 5EPMA 2KL6A 4HIJB 1BFVL 2DJUA 3CLEH 3S6CA 2YD9A 4NC0B 4U1KA 4NZRH 3PABA 2OI9C 4M4PA 4WHYG 2X4TB 2N4IA 3L7EA 2VDNH 4MQTB 4Z7QE 1DUZA 2DOCA 3DETC 3OKDA 5I1JL 3DXAA 1M7IA 2DWEA 2UZYB 1JV5B 4GS7C 4MJ2A 1MCNA 1PD6A 3ME0A 4RWHA 3HB3C 2X4OB 1T20B 5KSVB 1IC7L 3QEQB 2PYED 4Y5YA 3QUXC 5IFJB 3QHFH 4OLZH 2AK1L 1S3KL 3PE9A 2GITB 2E7BA 1T2XA 1UB5B 4HUWB 4Z0XB 4HWUA 2X4RB 1OQOA 4GRWE 1MCQA 4NSKA 2LE9A 4QF1B 3MV7A 5HYSA 4TSCH 2VUOA 1TQCB 3NZHH 1RK0A 5JQHC 3PWNB 4O2EB 1WV7T 1N2RA 2D03H 3P73A 1YNKH 4WU7B 4U1LB 4X4XB 3WDJA 4PJCE 3DTXB 5JPMB 4RISH 3MBXH 2X1WL 1OHQA 3QDGB 5EU6B 5HD8C 4XHJD 1ZA3A 1OAKL 5JLZA 4ACPA 5C0EB 1WWCA 1S78C 5I0DA 4DW2H 1F4WL 3QFJA 4JFDB 4L4TA 3SCMC 4XVSH 3PIQB 1T89C 5IKCA 2OX5A 2A77L 4PJHE 2EDEA 3W0WA 3MRHB 4N8PA 2PW2A 1A7OL 3Q6GL 3CFIC 2CRZA 4OB5L 5MERA 4KQ4H 4N1CA 5EZIL 3ZMRA 3B2UC 4L3AA 4HUUB 1NAMA 1ONQB 1F2XK 3P9LA 4OI7A 2APWA 1ZAGA 5DJCA 1W72L 5DUMH 1BBJA 3JWOC 4PJDF 3CK0L 3MUJA 4KHXL 1KJ2H 3W11C 3WNOA 3MXVH 3MO1B 3O6MH 3LKQA 2BCKA 3D3VE 5J12B 1HHKB 3O3UN 2ICWA 5CJOH 3B2VL 1H8NA 1B4RA 3TPKA 1KPUA 3RTQB 4P2QD 1MRFH 5KVEH 4ZOCA 4G6MH 2X5PA 3VGAB 4ODTL 5J13C 1I4FA 2M1KA 4A6YL 1KEMH 1RULH 2NNAA 3FB7B 1EZVX 1WFOA 4LDLB 1ORSA 4JY5L 5HYFA 4RAUB 1U93B 4JG0L 1YMHB 2K9UA 3EGSA 5AG8A 4I5BB 4W4NA 5GGRA 5KTEL 3HMWL 3KWWA 3VA2C 1E4KA 4JANA 3REVA 3BEVA 2AJXL 2E9IA 3WXVH 2BSRA 3U9PH 3BZEA 4EBQL 5TQ0H 5GZNC 4AH2A 3HE7B 1DSFL 5HI3D 3HCVA 4HS6A 4P9HH 4DKEH 2Z31A 1AI1L 3C60A 4JN1H 1J8HB 1QLFA 3D6GA 5GGRY 3MLWH 3L3GA 4F8QA 3HNSH 1IGIL 1T7WA 3SJVB 2QQKH 3E6HA 3GMQB 3C5JB 5F9JA 5C07E 2AQ3A 4FXKA 2IAMA 1YMMD 5D7JD 2VZVA 3PGCB 1A7PL 3FO9B 4WDIA 5E8NB 1K6QH 3OAUH 3VXSA 5J06A 2AGJH 1ZHNA 3UYPA 1KB9K 3OHXB 1NDMB 4E9LA 3BE1L 4Z76A 2BVUA 5LBSL 1J86A 1U91B 4FQ2H 2OCFD 4ZXBC 3PP4H 2EDNA 2R39A 4Z7WE 4L3EA 4IMLB 5LWYL 1CL7H 5CHNB 4G43A 4JFFE 2CKBA 2VE6B 2WSKA 5ABDE 1EEYB 4OZFB 3VD7A 3VD4A 4K55A 3A6CL 1JPGA 4UDTA 1A6WH 4ZSOE 2PYEA 3UJJL 1N6QL 2FR4B 4AENB 3GMMA 2BP3A 3BWAA 4FZ8H 3WKMH 4D0DA 3BPCA 3D2UB 5HDLA 3V0VA 4M48L 4K8RC 3U46B 5D8JL 2YD1A 1X5KA 5C70A 4PD4K 5DA0B 4LBEA 4GMSL 2BZDA 1A47A 4G8GB 4PJIE 1JYVA 5INCB 2ZOLA 4UV4L 4ENEC 2BNRE 1FL6B 3MX0A 4NQDE 4LEOA 4P4RB 1NMAL 4W4OA 4F7TA 1S7QB 1UJ3A 3MLVL 2FHFA 1NAMH 5KVFH 2OM5A 2ADGA 4IOIA 2W9EH 3R0MA 2VC2H 1RZJH 5FGBA 5BVPL 2WINA 4F7MB 5DQDL 1FSKB 2VLKB 3DI3B 3O45B 1CICC 3KNBB 4K3EL 3T4AB 5D70H 4PJ7E 4FMKA 5F7FA 3OAZK 5EBLB 5SX5K 1C16A 1P6FA 4YXKL 3V6ZA 5JNYB 1WAAE 1NUDA 3IJSB 2VR5A 3OZ9H 5JR1L 3IDNB 1X5LA 1RZIB 4M7JL 3OKYA 2WBWB 3LKSB 3HE6B 3MUY1 2EH8L 8CGTA 2HT2C 5HVFB 3SPVB 3F7YB 4JPKH 3KPRB 3NFPB 4U3HA 4GLRI 3WJLA 3T1WA 4L8DA 3BZFA 1QFOA 2ATPB 1A1NA 2E7CA 1RK1A 5A2KH 2AVGA 2XN9B 1MY5A 4PJEB 5KAQF 3WSQH 3MRMB 5I1AA 1D9KD 2F15A 2NY5C 1Y18A 4BUHA 4U1SB 3C8KA 1CYGA 1IQWH 3C5SB 3MREB 4NKDA 1P84K 4HWZB 3EIFA 3MYZA 1MCWM 3HLAA 1OAZH 2DM4A 4G5ZL 4UI2A 1Q0XL 4G6FD 2OL3L 1A4KB 4P2QA 2DBLL 1JNNH 1GSMA 2FYYA 2Z4QA 3JUZA 3FT4A 4ZTPL 1GHFH 1QBMH 1CFQA 5MEPB 1BGXH 1NEZG 1P69B 3VG9B 4ALAH 1UM5L 2Z92B 1LK2A 5CEXB 5HHMD 4CDHA 5HDBE 4YDKH 2XQYG 3M8OL 4F58L 3TJHC 3RUGB 4IIQC 5IM7B 2EDKA 4FQJH 5DD6B 2Q7YA 1SHMA 1CDCA 1ZT4B 4HXAL 4K94L 1X44A 1MVUB 1NC2B 1FYHB 3NIGF 2W60A 1QVOA 3VRLF 4AM0B 5CJXA 3RVXD 3OR7A 1H0DB 5EBMB 2CKBH 1J8HD 5FYJE 4MA8H 2HRPL 1HN1A 3CSYA 3CX5K 4OZFG 2RCSL 3SJVD 4Q2ZB 4HZLB 4RFEA 1YJDH 4N5EC 7FABH 4XBPB 1K8DB 3ARWA 5JHDD 1HH6A 4Z5RB 1ZE3C 3EZ8A 5TDNB 5IHUL 1ZT7B 5EWIL 2H1PH 2EKSA 4HPOH 1YMMA 5D7JA 4AG4H 5DQJA 1ITCA 3QJFB 5DTFA 3MLRH 4PJAF 1NKOA 2WBJB 4M03A 5FKPA 5ECJE 1SM3L 3ZE1F 1BOGB 3T0DA 3MQIA 1U3JA 1RFDL 5GRUL 1A6VL 3MLYH 4KK5D 2VITB 4MX7B 2X44D 2BRQA 3ARPA 4WEBH 5HYIA 4P23D 4D2NA 3ROOB 1Q0YL 3FQTA 3RNKB 4CVXA 1TZIB 4RX4D 2ITDA 5HYJB 3D2UD 2UWEF 3VXRB 4Z0XA 1U8NB 2FGWL 1C7SA 2MPAL 3GSWA 4TNVK 3GMLB 5DFVD 5DLMH 5BS0B 5IK3A 4GBXC 3NABH 4LHUB 3EDDA 1AHWA 1NJ9A 2HVKA 4L8SA 1NFKA 4WEMB 4GW5A 5FM5M 2YPVH 1FQ9C 1P7QD 5E7BA 3MUHL 5AUMB 3VMPA 4AMKH 3QI9B 3L6FA 4GKSA 4PREA 1AGEB 1OW0A 5E0QA 3DROB 2VLKD 1ZHLB 1JN6B 3DSFH 1Q9WB 3RX8A 3B9KB 3ROLA 2H32B 1CD1A 4QXGL 4LCCA 3QWRD 3OG6B 2J8HA 4L4VD 5DK2A 1MQKH 4Z7VE 1I1AC 3KPPA 3HPLB 4YAQB 4JO4L 5DSCB 3OKMA 3VRIB 2ZUSA 4LAJH 2I24N 4L8BA 2Q20A 1WBZA 3QO0A 4BFIB 5B38A 1KTDB 4PGBA 4BQ8A 1FJ1B 4RMRA 1KN4H 2H26A 4JPIB 3KPRD 5A3ID 3ULSB 2A1WH 3WFEL 4YDIH 2GAZB 2EO9A 4YQXH 1NDGB 3SKOB 2XN9D 4U6XB 2NY1C 5DVKA 5I2IA 3E8UH 3NVQA 1AC0A 4RGNB 3TBYA 1HHIA 35C8L 1B6DA 3V95A 1OAYL 2UYLB 3FRPA 3K46A 4EXPX 4IRSC 5E99H 1D9KA 3ET9F 5CMAA 5D2NE 2DD8L 1I9EA 4JO2L 5ENWA 2P8LB 3IJHA 4XNXL 3VGBA 1IILE 2QADC 4KK8C 2F58L 1BVLA 4KGJA 1LE9B 1JPST 3BPOB 2VXTL 3OF6D 5ITFA 4R9HA 4OM0H 3EHBD 5DVNA 1AGFA 1C5CL 1EJ6A 3THMH 1I9IL 4KUCF 2GQHA 1ZANH 2P42B 1WEJH 5DMKA 5I8KL 3NN8B 5GZOD 5T5FH 3P0YL 5F6HJ 4K71B 4WFEE 2DQGL 1LP9A 3O41A 1VKXB 1U3HB 2FZ3B 5HHQB 4OZ4B 3FN0H 3KAAA 4OJFH 1MFAL 3WS3B 5DGRA 3TYFB 1BQSA 3QJHA 1H3VA 2KPNA 3OGOE 3O11A 4L9LB 5CJ8A 5KSAB 4KJQD 4C56B 2O5XL 1I7TA 2P8PB 4Y5YC 3BKML 1N3NA 1MCHA 1Q72H 5KSBA 3DGGA 3SJVA 4OZHB 2D7PA 3T09A 3BFOA 2OJEB 3EO0A 5JHDA 2NXZD 3PXHA 3ULUC 1ZHBB 1C8PA 3PGCA 1TZGL 4TUKL 1INDH 2VXQL 1S7SA 3H9ZA 4LVEA 1HHJA 3S5LA 2Q8AL 1H5BC 3MA7B 2Q3ZA 4U33A 4XI5D 5HDQH 3OWEA 3GSUB 3KJ4B 1OAQL 4TSAL 3MA9L 4PV8B 1L4IA 5D2LF 1AKJA 4JM4L 3ZL4L 3S88L 5IB2B 4F80A 5ESAB 1D5XB 3KPMA 3KS0J 5IHZA 1QSEE 4P23A 4HPYH 4LCWE 2XWBA 4OKVA 3TNMB 5HHPA 1I9JH 5CZVH 1AXTL 5E1AB 3VXRD 1CFBA 4FG6D 3UROR 4RX4A 3KXFB 4XCYB 4MD4B 2BMKB 4UILH 2NY4C 4ETQB 2Z91A 1FNSH 3H3PL 4LHUD 2DTSA 4V1DB 4O5LL 3WN5A 2VLLB 3PGFH 1UM4H 32C2B 4ZQKA 4Z78A 1BFOA 2ZKHL 4HAFA 1F8TL 4GSDL 4A6YB 4LCYB 1FGVL 3I9GH 4UB0H 3F58H 2AJZB 3VWJB 1P7QA 1EUUA 4KGLA 4NKOA 1S5IH 4OF0A 2NY0C 2YXFA 1DQLL 3VFUB 4ZO7A 4AEIH 2YA0A 1AY1L 1T0MB 3UTSE 4TSBH 4BELD 4Y4KC 4CMMA 3QWRA 5T1KD 1CS6A 1YEIH 4L4VA 4EDXA 2P24A 2NY6D 4FNLH 4MXVF 2PCPB 3EZJB 5DHVB 4NBZB 2YOCA 2J6EA 1T22A 1AE6H 4ZAKB 1OARH 5CGYC 4P3CL 4XPFL 3BP4B 3EJZC 3SDXA 5D93B 4DEPC 3NMEA 1A6TB 1IKNC 3QUYB 4PB0L 2VL5B 1Z3GH 4JJ5B 5T3ZE 4HIHB 2ICES 5CAYB 4GXUN 1VESA 4RGND 5HTSA 5I8OH 3MRQB 4DVBB 1H3WM 2F74A 3WDIA 4XAKD 3MV9E 4LVNB 1BZ9B 3BP7A 4ORGA 2OBGA 4FTVA 4OZGB 4XCNB 4NO0B 2Y36L 3PG2A 5L8JB 4X9BA 5DD3H 2WK2A 1DLHA 2XZAH 3UO1H 2BDNL 2A2QT 5FEBA 1UXSA 1UH3A 5FOBB 1P4LB 4GFTB 4MCZA 4U1GB 4FQLL 4GAYA 1VDGA 3L9RA 4JB9H 4F3FA 2DQDL 1C1EH 4XH2B 1FYTD 5CSZA 1FVEB 3VFTB 2PYFA 3OF6A 1T03H 4LSTL 4Q0XL 4QOKB 2ARJA 1LE5B 3DV6A 3RVUD 3VFGL 5GSRB 4G7YL 2IAMC 3GSRA 1I8LC 2J8UE 3T77A 3U6RA 3T3PF 1SYSA 4N8VB 3X11A 1MHPL 3BO8B 1SEBB 5I75B 4J23A 4G7VL 3RAJH 3BDYL 4YHOH 3DX6A 2VABB