1EXHA

Solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
b'ASSGPAGCQVLWGVNQWNTGFTANVTVKNTSSAPVDGWTLTFSFPSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGGTAQFGFNGSHTGTNAAPTAFSLNGTPCTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,4-BETA-D-GLYCANASE
molecule tags Cellulose degradation
source organism Cellulomonas fimi
publication title Solution structure of a cellulose-binding domain from Cellulomonas fimi by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
total genus 12
structure length 110
sequence length 110
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1exhA00
1QBAA 1C7TA 1QBBA 2CWRA 3NDYE 3NDZE 5DHEA 2CZNA 1E5BA 1XBDA 1E5CA 2RTTA 1EXHA 1HEJC 5DHDA 1HEHC 1EXGA 1C7SA 2XBDA
chains in the Genus database with same CATH superfamily
4ZFGL 4APXB 2ZYHA 4HH9B 5EN3A 2ZXEB 4YZFE 2F5AL 5BVPH 3WFZA 3HTLX 3S5LB 2RGSA 1MCBA 1B4RA 1A7OH 3R06A 1YEDA 4MAUH 5E5RB 3EYSH 4I9XA 2FZ3A 3RPIB 5IW6B 5LDUA 2WPGA 2Y25A 2X89D 4UMSA 3NEXA 2X2HA 2Y6TE 2CBOA 4CJ0A 1KBPA 3D87B 1I3GH 5GPRA 1JZ3A 4MZ3A 5KYUA 1MCQA 3PGCB 2QJDA 3OJDA 2BNRB 4HJJH 4MS6A 1BX2B 43C9A 1NDTA 2WVVB 1KF9B 3GHEL 4OB5H 1R5VA 2NZIA 4GOSA 4PLJC 2KBGA 2V2WB 3FB8A 4X5LA 6PCYA 1NCDL 4BA8A 2Z8RA 1UKTA 1YEFL 4XVUC 2X1XR 4JFDB 4L5FH 4PJHE 4XCEA 3SBRA 3I85A 5HHQA 2FIRT 1Q8MA 3UYOD 5J57B 1A14H 2EDQA 1FE8H 1VFMA 1IRAY 2XIDA 4HF5L 5AW4B 1QYGL 4KKCC 4Q6IA 1JVLA 2M1KA 1I9EA 5DHEA 4B7IA 4NC1E 4UDTA 4JRXD 4XO5A 1V3KA 1W0YT 3H2QA 3EHBD 1E9PA 3S5LG 4BFJA 2WNXA 4WEMB 1CF8H 4W4OC 3OV6A 3ZRFC 4OKVB 3G6JA 4CVZA 1E4KA 4JAMB 3VD0A 2XKNB 1S8DA 4QRQA 1RJYB 3CZJA 4ATTA 1BVKB 1FG2B 4I0PD 1ZS8B 4XMKH 1Z3GL 5GRUH 4YWGL 4IGBB 4XCCL 1LE5B 3HHSB 4J6IA 4PHXA 4Q74A 3LKPA 2ZOOA 1S9YA 3B4NA 5TE6H 2XN9D 3T6ZA 4F9PC 3BISA 1Z9NA 5CZXD 4U31A 5DJAA 1A8JH 4LSSL 4M48L 1PZ5A 1IBYA 3LJ3A 2ZOTA 4ZTOH 2VITB 5E1IA 2IANE 2MJWA 1L0PA 1KJ3L 4NCC2 5IEHB 5DJ6B 4LGRB 2ATPB 1MFAH 4XVJH 3B3IA 1R3LA 2YAMA 5E00B 1DE4A 1PNCA 5C1MB 2FX8L 4X7SL 4C4KT 4PWKA 4P2OD 1TFPA 3HI5L 2EO7A 4MMXB 1UJ3A 4FQJL 4XCNA 2XWDA 2XN9A 1DVFA 1JXGA 5F7EH 5HD8D 5BUGA 5EF3A 4HUVB 1UM5H 4MJ4A 4E41B 2N0MA 4OF8A 4XVUD 1KT2B 3HC3L 1QP1A 5LGHL 3H4FA 8CGTA 1LE9A 4X9GA 1B90A 2VR6A 4D9LH 3SDAD 1AIFB 3G6DH 2DLHA 3CNKA 3MYJA 2KZ1B 4UT6L 5B7MA 1AXIB 4N1HB 4GKZA 1GIGH 3POCA 5FC9A 3F5WA 2Q2LA 4FFWD 2WP3O 1IU1A 4IJ3C 4XWGL 1ILSA 1O9VA 2G3XA 3QORB 5TPWL 3V9EA 4RMTA 5JXED 5C0EB 4RBPK 1YC8A 4V2BA 2ZWZA 4XXCC 4WWID 5INDA 4DK5A 1OP5H 5K59E 3ML9A 2JKSA 3TF4A 4HS8H 1PX8A 1P4IH 5HDLA 2FQFA 4CAGA 4LLWA 3EJRA 3V0EA 5F1OB 1HWGB 1W2KT 3N40P 3KPOB 3RWFA 3B9KB 3K6DA 3EOTL 4A68A 2YC1A 1L0QA 4WWOA 5HHVL 5IJVB 4G6ML 3THMH 3NIDE 2IANB 4EI5D 4GSDH 3TNNB 4YSEA 1WHOA 4ZX5A 2CLRA 4NQCA 1FVEA 1MREL 3REWB 3MDJA 4BWUA 4G3YL 5EA0H 4A6YB 1OF2B 4IBSA 5JA8B 2J43A 4G11A 2FSDA 1J5OL 1CICB 1NGZB 2WKGA 5K9OA 3O2VH 4W6WB 5D5MF 5IB3B 2APBA 2AMGA 5JDJA 4LAJH 3OAZH 2B7DT 2NXYC 1JGLL 1FI8C 4ELKB 3RZCB 1DVFD 2QR0B 4BCYA 3B9VA 3P9LA 1DQKA 4LSVL 3COOA 1JI1A 1NBYA 3VI4B 2W07A 4KK9D 4ODHL 3UOAB 2IALB 3D3VB 3CSYB 3DK2A 4JHUA 3WIIL 2YLKA 4KPHH 3SJVA 1UQSB 2DQUH 2FH6A 5J8OA 3BQUC 4MJID 2DQJL 5D71H 1PG7H 4C83A 2R69L 3QSKB 3MODH 1NA8A 4LSRH 2W59A 1OOAA 3KS0J 3DVNB 3P4OA 5IW3A 1TQUA 1N6UA 1K8IB 3H7BB 3QDAA 2CQVA 2NQDA 3WGUB 4LESA 2X10A 4NRYA 5AVZB 3U2JA 1PAZA 1A6ZA 1CGTA 1GGBH 3RYMA 2IFGA 4ODSH 2N3JA 2OQJB 5GRXG 5F9WC 4Z7QE 1UENA 2G4EA 3FO1A 3BP6B 4FTVB 2VNCA 4UOZA 2WXGA 4EN3C 1SF3A 4JG5A 4YLCA 2ZE0A 3ARBB 3VRLF 4OFDA 1A6TB 4O2EA 4OCRL 3BUYB 4LSRL 1B3JA 5JXAH 1NEZG 4YSUA 4XCEB 3OKLA 2F53B 4OQTH 4WUUD 1UVQA 4NT6B 4DQOH 1E43A 2OMZB 5JZ7D 1BOYA 4PMEA 1JYNA 4G8EA 4QJ4B 3J7HA 1TQWA 3QVAA 4WV1B 2F5BH 2DAVA 3FZUC 3DUHA 1EANA 5CBEA 2B0SL 1LP9A 2HPTA 3RFRA 1J8KA 4G6FB 1IL1B 1GZQB 2HUHA 4JDEA 2BJML 4OKDA 5FYJH 2AK4B 3GUFA 5DJZB 3TO2B 1CFBA 3B2UD 3QRBA 3U82B 1UM4L 2Y36H 4WW2A 3GFUA 5FDWB 1SJMA 3UTTA 2QDVA 5K9KA 3VD1A 1D5IL 1DL7L 2HRHA 1W72L 2GAZB 4PS3A 1Q38A 1EHNA 5ANMA 1KIRA 3TEZA 1KBKA 2XTSA 3SE9H 2XIIA 2VJ0A 2JE8A 1ZANH 1HL5A 2OL3L 2HH0L 4BFIB 4FYSA 2BINA 2VLKA 2YA2A 2FCBA 5IROA 1WV7T 1JZEA 1CGSH 3HOGA 1NDMB 2PYED 3PL6D 4FQ1L 4BFBD 3LEVL 4YDJA 4PR5A 4A6YH 2B1HL 1WTLA 1ZHKA 3B1UA 5D1QE 2AEPH 2H1PH 5BUAA 2DJMA 4KV5F 1TCMA 1A1MB 5I16B 1RK0A 2BK8A 3M46A 2VABB 3EHBC 2V9TA 2ZYSA 4HUVA 4U33A 1LK2B 1MI5A 1JV2A 3FCSB 3II3A 1FZKA 3QPQC 4F7TB 4LKCB 5L88L 1GYAA 1EWHA 2WGXA 4B60A 5IFHL 4HUUA 3BVUA 2FDBP 5IB5B 5D1XE 2FBJL 3AMLA 3SD2A 2VR4A 3LZPA 4GSXA 2WTOA 5I71B 1BQHB 2B3RA 4F2EA 1OSZA 1RZ7H 3RWJA 1BFOB 4NDMB 4NSKA 4QYOA 4UZGA 4XHQA 2QBWA 2AKRA 5HI4C 3U4BH 5TFSL 2E7HA 4Y8AA 1IARB 1FNSH 4X4YA 4DN4H 3FC8A 3T2QA 4KKQA 2CHWA 3BCFA 1RUQL 3CJJA 3ZE0F 4FQQA 3O2DL 2NY1C 3SE4C 3L3HA 4U1GC 4OGXH 3ZKND 5LLIC 1JE6A 4P4RB 3O6LL 4R96B 5LBSA 4IDJL 3SOBL 2GITA 2YWZA 3O8XA 2WXIA 4I3SL 4X7SH 1XGPB 4RISH 1MAML 1T5XB 2ICWA 1AKJB 3LKQA 4BK4A 2LFEA 6TAAA 1V05A 4IRZA 4XAKD 4HWEH 1G1KA 4IGBA 4L4VD 4LEXH 4UYPA 1LE5A 1KPRB 3O6FB 3U9PH 3GNMH 4WFGE 3HC0A 4QRRE 1Y6NR 3ZE1B 1IL1A 3ZMNA 5ILTH 4ZXBD 2B1OA 4OU3A 4Y5XA 3FB5B 2MPAH 5DHVB 1K5NB 5FYLH 5K9KB 5TDOB 1MUJB 4Y2NA 1MFVA 2XHNA 2Y36L 1IILE 2FWOA 3BDBA 2FO4B 3ZL1A 4LEEA 4Z3JA 3SBPA 4DPRA 4BFIA 1PZSA 3EGDA 3C12A 4N1CA 3DJSA 1K4CA 2MTAA 5E0QA 1IGMH 2W9LA 5CMAA 4D0CB 1ZLEA 2OTUA 3OC8A 4NP4L 4PJXE 5DC0A 4XPAL 5HPOA 4EAEA 1EQWA 1DCEA 4YDKL 4C4KO 1NFKA 3QQDB 7PAZA 1DQLH 5TE7L 3DXAB 2CIIB 5GGVL 4MAYA 4KXCA 4M7JL 1JYXA 5KVFL 5C08A 3VD5A 2VABA 2NY3B 3SZ6A 4QXTA 3DX6A 2UY6B 3GZPA 5DLML 3VFNA 4AVKA 1X3DA 2X0UA 4EI5A 1DEDA 3NEEA 3TGXA 2FL5A 1TO5A 3MV9A 1U8LA 2XPZA 4U3XA 4O9HL 2ALWA 1QW8A 1LEGB 3AQZA 5LXGH 1ZVYA 3EYSL 4I0PB 3IJ7A 3UYRH 2VLJE 4ODUA 1XD0A 2QELA 4S1DD 4Z1PA 1ED3B 4LLAA 4AJWA 3ULVC 2D0FA 3V6FA 4AM0Q 5B39B 4A04A 3PWUA 2YAPA 1YA5A 2VQTA 4BCXA 1DQQB 3CN1A 3BLKA 3FTGA 1LEIA 4I4WA 2GBUA 2A6JB 3VFOA 1GKOA 2Y6SC 4WFGD 4OCLC 3REWA 3KPRA 3BYTA 5IVXA 1DUZA 3RVUC 3EJZC 4GMTH 3I3EA 4DNLA 5C0GB 3QO1A 4MSWB 2EZ0D 5ENWB 5DMKB 4UCFA 3BPLB 2CO4A 4Z5RA 4PG2C 1ET5A 1DFBH 3BAIA 2AXFB 3D18A 4IIQB 1P9MC 2YN5A 4BRVA 3UTTB 5FDWA 3PGDA 3RWEB 4XVTL 4DOHB 2G5RA 1W80A 2QTEA 5BMFL 1DVXA 4I48B 4NQED 3PCYA 2UZYB 5EZJB 5FUOL 1ZLSL 3EBHA 4NQEE 1CURA 1U8QA 4N8CH 3GXIA 3VGFA 1RZGB 2R4SL 3CSYA 1QSFB 1YO4A 3KH3A 4U6XA 2JCCA 4JQXC 2OSXA 2XA8L 2MPVA 4OCYL 1MF2H 4ZW5A 3E8UH 4YX2L 4V1DD 3FRUA 3GO1L 1WFTA 2NUTA 4Z7VA 3W9EA 5EO9A 3HG4A 3GMLA 4MDJB 5FHBL 4EDXA 3BZ5A 3MKGA 4X7EC 3QS2A 3QIWC 1C9SA 5DD3L 2Z93A 4WJ5B 3ARFB 2ED6A 5AKRA 3UJJH 1GMEA 2KPWA 2XCMC 3TWYA 3AACA 1FZKB 3SB3A 3ATDA 1A9EA 1RZJH 5HI3C 2IDTA 1YN7A 3SKUD 1F6AA 2C9QA 2ZUQB 1XB3A 1M3JA 2VR5A 2MMXA 25C8H 3I3BA 1KTLB 2X4NB 4MS8C 5DEGB 4ZFOL 4DN3H 3T0ED 4IEFA 1YEHH 3QQXA 3GBMH 1XR8A 3VXME 1T20B 1MHEA 2IH9A 4BXVA 1F11B 1WPCA 2J2ZB 1A7RL 1GZHC 2VOTA 5E8EB 1DO6A 3VFUA 3GTTA 1WUZA 4IKKA 3D30A 2F5BL 1CFNB 4GAFB 1FLTX 3VH8A 1UASA 5FUCC 3L3OA 1NKGA 3O2WL 5E9DB 1JF1A 1X5XA 1CVSC 4LVHC 1DZBA 1LL1A 4AKQA 2Y2YA 1JTOA 1QO3B 4ODUB 4PP1D 4E41E 4WUUA 4TRPH 1O7VA 3MRNB 4PLKC 5EZLB 2IH1A 1IM3B 3TCLA 4LHUB 1CLCA 5FFGA 5LGYA 1T1ZB 4ALAL 3K71B 2BVOA 2CGRH 2CPCA 4M5YL 2F54B 4P04A 5I9QC 2EEDA 1RLWA 4N22A 4W9FC 4JPKL 5DEFA 3C8DA 2VZSA 3TJHD 1G4RA 2J6EL 3HE6D 3QDMB 4NZTL 5L0QB 3L7FB 3TH4T 3S98A 3UTQA 4OZIF 5IK3B 5IF0A 3ROOA 3T0VA 3ZYIA 1T0MB 3D48R 2AK1L 2B3IA 4LVOC 1I8IB 2NXZD 4XXWC 3H6AA 1CT8B 2A6IA 5DRXA 5EF2A 3RZCC 1F4HA 2C7UB 4MS8D 4YX2H 4PVLA 4ZUVB 1WFIA 2UUDH 1DR9A 1NMBH 3FCTB 1SVCP 1MLBB 5AUMA 2K8MA 4ORGB 5ANHA 4F57H 1N7MH 1EZUA 4ECNA 4LQFH 4XP5H 1H8OA 3FCSA 1CXLA 3VGAB 4W9CC 1P4BL 4FZ8H 5IOPA 4ZPTB 1NL0H 2IWGA 1BP3B 2VUOA 1FSKC 2FAUA 2GJJA 2P5WE 3CTTA 3S36X 4JQIH 2ZWNA 1AGEB 1T22B 2CXKA 1HNFA 3WEMA 4KROC 1KBBA 4QRPE 3PWPD 5C0BB 3H9SD 1BZDA 1NBCA 1J12A 1ORSB 3KL0A 2MSPA 1WFOA 3KPQA 3WTUA 4PJXA 1WBZA 3BH8B 2YD8A 6FABL 3OQRA 4F58H 3LXUX 3P3RA 3C5ZB 4E41D 2A0LD 1MEXL 3IGFA 1CGYA 4NPYB 2AJUL 1QR4A 1EZLA 4PGCB 4JY5L 3UAJA 4PJ7F 2R0ZL 4I0PA 1H5BC 1L5GB 2I5YL 4BFKA 4YXHH 2FTAA 1Y6MR 5F44A 3K81A 3FU5A 4HCRL 1JTTA 3PNWA 3LKRB 3GSUA 5BRZD 2X7LA 3Q9QA 5HHPA 2P7TB 2YPLE 3LKSA 3MLYH 3QEUA 1NTDA 3T04D 4Q0XH 2Z4QA 3EH2A 4P2RE 3PP3K 5TGBA 4DW2H 1O5DT 1OCRB 2YBRA 2MCMA 5EZLA 3LB6C 3DA0A 1J0IA 3BVDB 1JMXA 2O6EA 1T1ZA 3MQIA 3KL5A 4PRHA 5AB1A 3RJQB 2VDOH 2XYCA 4B97A 3WKML 4L1HA 3I6LE 4BSJA 5ADPH 1HZLA 2XLLA 3RLSA 5A6MA 4P9HH 2VN6A 5GS1A 4PRAB 2QEJA 4EN3D 4P23B 1UXMA 4GSUA 3M1BA 4TQEL 4AH2A 2ZF8A 1A6VL 3P40A 4QKXB 1LO0L 1Y1DA 1FZMA 2MQ0A 4F8OA 1KB3A 1UM5L 5KYXA 5C0BE 5KSAA 2BW5A 3OHXA 2G60L 2N4IA 4QIRA 4XPFL 5DRXB 4N0FB 5JR1H 3QXVA 3PWPE 3NVQA 4ZUVA 5TF1L 1I1YB 4H5SB 3HNTL 4HCIA 4PRIB 3H9YA 4NXKA 3FCTA 3HJ0A 3ZIYA 1S7SA 2GIMA 4AJYV 3BVVA 4F8QA 3P9MA 3T8VA 4PJBA 3E80A 2D3NA 5A7EA 2K3TA 2GBAA 2KERA 2I60L 4WCYH 4XMLL 1YEEL 5AZEH 2G5BB 3IRZA 4LOEA 1VFBB 4P99A 4Z0BL 4Q8BA 5IOPB 5AVUB 4LP4A 1K72A 2WIIA 2V4LA 4LCWE 1IGFL 3GS0A 2R1YA 4PJGA 1KTLA 2DEYX 2X4NA 4JBSA 1EEZA 2ROYA 4N4YB 1SN2A 4NGHH 2WTRA 4FFYA 2GJRA 1OP5K 2OX5A 2CHZA 3V4VL 4TL5A 4UUJB 1TQCB 4E9LA 3D4YA 4N5UA 1T7YA 4NNYB 1UXWA 3QUHA 4NRZA 1FCCA 5FXCH 3PWUB 2EUXA 5FYKU 4WI0B 1FQ9C 2N1TE 3AUWB 2ROXA 4DN4L 1ROWA 3UC2A 4AGQA 2XBDA 4I1RA 5F7FA 2GSIB 4RSYA 3RPKA 3STZA 2VMDA 3M17A 2V8MA 1MFBH 3HKZA 5ENWA 1J9TA 4DKEH 4IBYA 4OCSL 1OCCB 2Q8BL 5JQIB 3MMEA 3O45B 5FLUA 3ZDZF 2NY6D 3V7AE 1QPPA 3KDMB 4YSRA 1JDAA 2CCLA 5EU3A 4POYA 4I18B 4IQHA 3SGKA 1E8XA 1H3WM 1DCLA 1URIA 2A1WH 5FO2A 3TWCH 5MHSD 5FW7A 3UTQB 1WT5C 4ISVA 4RGNE 3K80A 4NFDA 1JD9A 5IT2H 1IAOA 4HGWB 3PFQA 2VC2H 4NQDA 1HU8A 3BXNB 1FL5B 3RVXD 3CZFA 1SMOA 2AQ3A 4TVSa 5L88H 2OTWB 2D3JA 5J11B 3SGDH 3UL4A 1WWBX 2A77H 3BEWB 4JO2H 1CLOL 1UYWL 1HAUA 3NDYE 4R97B 5DS1A 4LLDB 3KCWA 1BFTA 2O30A 1NMBL 2OM5A 2I9TB 4K3DH 5FUZL 3ECQA 4EI0A 1J1PH 1GGCH 5KVGL 5IWLC 1CFQA 3HNTH 5LGKA 1A9EB 3VXOB 4U1JA 5DUJA 4RGOL 3BUBA 1TZHA 3BUDA 4NOFA 3U6RB 4Q9QL 1WFNA 3L13A 3ML8A 4TSBL 1MAKA 2VUYA 1FGNL 2AABL 3IFNL 3QWRD 4ZUTB 5IW1B 1BF5A 1T20A 1M7XA 2X2YA 3V8CA 3W11C 2X6AA 2VIRB 3ETSA 3SGJA 3IU4H 3EYVA 1J1OH 4JO1H 3C5ZA 2WN2A 4A7UA 2NR6C 2HLEB 3LPOA 3NRQA 4PJXF 5DQ9A 1N18A 2KPNA 4M7ZB 2K4AA 4UQ2A 1AC0A 5F9AC 1RD6A 4FCAA 1QATA 3M07A 3US0A 4GS7B 3AAZA 2D0GA 1LEKB 3D2UD 1F4WL 5AVXB 4AGLA 3US1A 1YJDL 3CAFA 4JGMA 1INQA 4X8JB 2J7LA 1DLHB 2GSMB 4QCIA 2ZYIA 2DWYA 2Q7YA 5EU7C 5DWPA 5IB4B 1CFVH 2G2PA 1CXKA 4B50A 4C8XA 2VXTL 3N04A 5HGBB 2PTUA 4B9JA 2DYPA 3F8UB 2ZUTA 5JYMA 2YBGA 1BPVA 3NJLA 4A2FA 3VM5A 1WRFA 4RIRA 4AIXA 1SMDA 4N5ED 1S7QA 2VQ1A 3N6YA 1W8OA 4OD3H 3SKNB 2HT4D 4PGEB 4E5XG 4ZZFA 1KGCE 1BMZA 3UP6A 3MGOB 2HJLA 2PCYA 5CJXA 3WV0A 2LV4A 3APNA 4YFLI 1PG7L 5I0ZA 2NY6B 3AWEA 3WUZA 2IWKA 5IWLA 4M7LH 4GSRA 1NCNA 5DJ8A 1PD6A 4LSPL 1MH5A 2PPEA 5D4IA 1OAQL 1MLBA 1IGYA 3GTNA 3KHQA 4PRHD 3LDBB 1MOEA 2WQUA 2OMVB 1MNUH 1FRGH 2WLIB 4X98A 3SDXE 2A74C 5L4MA 3WS6A 1WHPA 5EH1A 5J1AB 5EG6C 5E8DH 3N85H 4EUPA 3VXSB 4Z7WB 1PLCA 3O4LB 1HOEA 1LD9A 4IRSB 2VDPB 3HPJA 4HKJB 5JPMA 2BXYA 1MCOH 1XCQA 3MBEC 3ZR6A 5IHZA 1EDYA 1OIOA 1FNAA 5F88A 2Z31D 1RHFA 1P7QB 2WNGA 5GJTL 2C4XA 2GUYA 3ZRCC 4CVUA 1T1YA 4QGTA 3QP3A 4OZGB 3U7WL 3L5WA 4JFFD 3HMXL 5TDPA 1U6AL 4HOMA 3DRQB 3KJ4B 4XOCA 3MACL 3THML 4Z7QB 4J3OF 4OCXL 3S4SB 4QTHB 1MAMH 4X4MA 1ZOXA 1L5GA 5I17B 2PYEA 3MCLL 2FQDA 1OO2A 1AHWA 3VMNA 4G3YH 5DJYA 1SYSB 5IESH 1MRFL 3C08H 3L6FA 3V6OE 4B41A 4B6ZA 4ZFZA 5T3XL 1WBXB 4ZXBA 3HG0A 1I75A 5I6LA 2AGJL 4JY4A 1VGKB 2OYLA 3MRRA 1XIWC 3HE6B 2XIBA 2YBRB 5FV2A 3ZE1F 5TPWH 2DJSA 2NXYD 2WLHA 2V6HA 2DEWX 4DUXA 5E2WH 3JBG7 2J12B 5EC2B 1CD8A 2Y5EA 4J6RL 3UDWA 2GJZA 3I9PA 1YNTA 3P3YA 4CC1A 1XL6A 5IB2B 5HHME 4ZFFA 5JUEL 2P46B 4Y4KD 1HWWA 3UTSA 4NQEA 5GRVK 1T7XA 1RL1A 3IKCB 4NCC1 4DVRL 5IV2B 1E9QA 2K6YA 2OXGA 1CLZL 3FFCA 2YFNA 2WSDA 4PRPD 2VQ1B 2GTWB 4NQQA 3NK4A 3KG5A 3FUJA 3NIDB 3W57A 5BOJA 2WP3T 3GSNB 4L3EA 5I0DA 3Q3GB 3TP4A 1HILA 3DHJA 4OZGE 4ZTPL 5FPIA 3F65A 4JG1L 4YSOA 4NUJA 3BEWA 1AP2A 2P49B 4R3SB 5AYUL 3K2IA 4JGUA 4R0LC 3V95A 1MHHA 5TQ2H 3GHPA 1QFWL 2HA1A 1PX3A 2X70A 4WFED 3QI9D 1WEJL 3FSAA 3OAYK 5AAWC 4OVVA 3VB9A 4EXKA 1MCSA 1C12A 5GGUA 3MV11 3ABLB 3L3GA 3REVB 3ZL4L 2BC4A 5EOTB 3DO7B 4EI6A 3QXDB 5HDBF 3K46A 4HHGA 4G6KH 2WTRB 4NO5A 3I9GL 4LASL 4R4FH 5D7HA 1MNNA 3ATEA 2AV1B 4Z95H 5HGHB 1HI6B 1J0YA 2R15A 1U95A 2DICA 4NN6C 5HGDA 1XWVA 1EUUA 3FO9A 4JG1H 3JWOC 3HN8A 3KGUA 3MLTB 4RETB 4RRPA 3MV8E 1SOQA 3DI3B 4JEGB 1I8LC 3CSFA 4JJHA 1R17A 4TTDC 2XWXA 1K8DB 1TTCA 2I7SA 3UBHA 1IEHA 4JE0A 3CV5A 5D1ZD 1KYAA 5EUOB 5E8PA 3Q2CA 2BDNH 3N0PB 5DFTA 2O61A 3KM1A 3TBCA 1F3RB 3PE9A 1CBVL 2B2XL 1LQSR 3OJ2C 3CGTA 4KMTH 1OCZB 1T66C 1PZUB 4DN3L 4HZAA 2FHCA 3FT3B 5EEWA 4EZKA 4B0MB 5EU3B 1BGXL 4Y5YA 1BQRA 2QQKH 2YXFA 2J5LB 3CC5B 3GMMB 3FBKA 2ZD0A 3LZQA 2EH7L 4M5ZL 4XTRC 4YSDA 2CO3A 2P5EA 4DTGH 3QJVB 3VFMB 1IUZA 1YLBB 2A74A 2G75A 4ISVB 2YS4A 5DD3H 4MKTA 2YSSB 4N0UB 4Y1AA 2F53E 1JOIA 3G04B 5KZCB 4CC0A 2BFVL 4WJKB 3KZ8A 4FZEL 3LOWA 4QHKJ 1NLDH 3MRGA 1NAKL 3NCYP 3VDAA 2JMRA 3TYGH 4RMBA 3UZQB 4Y9GA 4GP4B 3RQ3A 5JW4R 4ZNCD 4ETYA 2WCPA 2F15A 3MLXL 4ANUA 4C47A 2OXHB 2GBTA 4BZ1L 3HJEA 4JFEE 2FSEA 3SDDC 2DL2A 3KVQA 1INEL 3MN8A 3D25A 1X9LA 3BZ4B 4HPYL 5K1JA 1OZUA 2I5YH 4Y4HC 3RWGB 4XN8A 3TEWA 1FVDB 3VMOA 4HH8A 1CDBA 3VXOA 4W9JC 4JCWA 4UV7H 3QCTH 4BFGA 4GUQA 3BUTA 2NY3D 3KNBB 3AU1B 1XBDA 3QG6A 4QF1B 5E6SB 2H0JA 3NK3A 3MRIB 3C09B 3DHMA 3CIAA 3ZQXA 1CF1A 4H25A 5IHZB 4ZDHB 3QNYB 1AD0A 4BZ2H 1KBGH 4P46A 5KUKA 4YO0B 4B95C 4KKBC 4I87A 4ZAKB 3VWKC 4X6EA 3QNFA 2FO1A 2GHZA 3DX9B 3RGVD 3SDYH 2YA1A 4F33A 1LQBC 1KN4H 4KJQC 4HDIB 1X5JA 3UCRA 4XP6L 2VZ1A 4GUCA 1TQCC 3NGBC 4P49A 2ILLA 3KXFB 1QPKA 3MRDA 2QHRH 3RL2B 1RURL 1TR7A 1G7HB 3ZHKA 1KB5A 3KEDA 4C58B 4J2XA 4N90D 4ZFZB 1F1GA 2BIPA 3FN0L 3IM1A 4YSPA 1BFSA 1U21A 2R0LH 3CC1A 3EKCA 3HFML 3A0OA 1A7BA 3CFKA 3QUML 3ZTNL 2XRAH 3OKOB 1NBZB 1BF2A 4M4PA 4BYHA 5EUOA 5DHDA 2V9RA 2MNUA 3HUJE 3FO0H 1UCTA 3UPRB 4KRPD 3MBWA 1EH9A 4FFZL 3IJEB 3TURA 4FNLL 4JW3A 2TRHA 1RZIB 1JV5A 4JM4H 4G7SB 2Y06H 3EH5B 3HIZA 3VACA 2W65A 2EEFA 4XPBH 5IHUH 3F3HA 2X2UA 5PCYA 1ZXKA 4HHAA 5D2NB 4BM7A 5ICYA 4ZYKB 5M7QA 2QTVA 3RWDB 3SPJA 1WBYB 3HS0A 5I24A 2IH3A 2H1LM 3QS3A 2I07A 4NO0A 5T1LA 2LVCA 4O5LH 3ZJAA 3EJYD 4L8CA 3CQPA 3FFDB 4X6FA 4L0ZA 5F3HB 1MIML 5LQBL 3I6GA 1JXDA 1ZV5A 2V5SA 2ZOKA 3MUGB 1DQML 2BWQA 4Q6YA 2JKTM 1JSYA 4X5QA 5SX5K 4HYTB 1D3CA 2CO6A 3IKKA 2PO6D 3O2WH 4TVPE 4DIXA 3IDGB 5A3ID 2F54D 4YHOH 2X6MA 5EU6D 3EXJA 2EIEA 3Q44A 3TFKD 3GZOA 4NERA 5D55A 4G1MA 4MVBD 2WVUA 4FP8L 1BWMA 2IGLA 4G82A 1RZKC 2ADFL 3MRPA 2HG0A 5SWZD 3OMNB 3G6AA 4Z77B 4ZMLA 4OD1H 1KXTB 2KHAA 4XO9A 4L3CA 4YBQD 5BXFB 4TUJB 4RGNB 1H0DB 3T0DA 3L5WB 1IX2A 4EQ2A 3FZUD 4PI0A 3DECA 3VU2A 1FZOB 4K94C 5HI3D 4P46B 4ZMOA 1NAML 5F3FA 2R2HA 2RACA 4D7BA 4JM2F 4YHOL 1J8SA 4F2FA 4I77L 3BGMA 3ULUL 3DX9A 2OKMA 3P4MA 5TDNA 3DXAE 3L6FB 4PBXA 4WU5B 2X3BA 3E9UA 4KDVA 4ELMA 4XMLH 5FO9A 3EGSA 2HRPL 3IS1X 5I2IB 2CJTA 2C3XA 3VXUD 3ZK0A 3R8BB 4NQVB 3V5HA 1JGDA 1CC3A 4U1KB 2OV0A 5IEKB 3G5XA 2GJZB 3ZHFA 3VG0H 4NAJA 3WY1A 5E2VH 2X88A 4MLSA 3C8HA 2EYSB 2EIZB 4J4PA 4HWBH 4LF3A 2FYYB 2R29H 1UXSB 5IY5B 3F7LA 4X99B 3UPRA 4P2RA 1UTDA 1L6XA 2K9UA 1KFAH 2A9ML 3PWNA 2H4EA 3W0WA 4B3VA 1INDH 4TS6A 5CF3A 2F8XC 2X6CA 3GK8H 4JKPL 3WLWD 5I0XA 1NCWL 4YSQA 2Y06L 1JZDC 4YFDB 5DDHB 5DK2B 1XH3B 2IH3B 3CSTA 5D7IB 4JG0L 1OPGH 4UT7H 4A1RA 3QUZB 1YQ2A 1AOHA 2Z91A 4Z7OF 1HVXA 1QBBA 2HG5A 1H3PL 4JM2D 4W6YB 4YE4L 2SEBB 1W0WA 4RMWA 5A43C 4MAZA 3BRGC 2ZOKB 3BZ4A 1AD9A 1WIPA 2HPOA 1KDIA 4C56A 2Q1EA 1YECL 3WNOA 4AC2A 4Z3FA 4I13B 1F41A 2O6FA 1X9RA 2F74A 3KPSA 1HH6A 3IU4L 1YAZA 1AQKL 1ZIBA 3OJDB 3Q8AA 4OM0L 5I1LB 5KVDL 3LQAH 5EEXA 3MBEB 2XWJB 1YEEH 1DQDH 1I31A 3MRPB 3KWVA 5GJSL 3QYMA 4XO8A 4F24A 3F58H 2XNAB 4UT6A 1NOAA 5HGDB 1TG8A 4CVXB 3QJZA 3O6KL 1JZ4A 1KXQE 1TNNA 2DQIH 4NI3A 4KKLD 3EYQC 2P47B 3Q6FA 4R6UA 2OAAA 2CHDA 1E6JL 3SDXF 5G4OA 4XPAH 4G6AC 4R4ND 1S7RA 3OBAA 3CDFA 1G7HA 3MLXH 2O61B 2XT1B 1S5HB 2G4GA 5BRZB 2XBZA 4LDLB 3ELAT 4CNIB 1ZJBA 2YUWA 5ISZE 3L4VA 4GQZA 5D2LA 1Y07A 5E4EB 2PNDA 3ULUH 1OLLA 4JFOB 5DZNA 1CYXA 2YXMA 4ODVL 1A6WL 2PXYD 3RIAF 4Y5YB 2FQEA 4JFYA 2DKMA 3RNQB 2WO2B 4R26H 4ZW3A 3RTQB 2XDHA 3T09A 4GO6B 2AVGA 2W0FB 2C1OB 1ZT4A 5JYLA 1BXAA 1JCVA 3FMGH 4Y5VB 3ZE2B 1MW0A 4G1EA 4XZ4A 4JHAL 5FGCB 3ZW3A 2XG5B 3D8MA 1XR9A 2KDGA 1S9VB 3D2UB 5MEOB 3VMPA 1N5YL 1QLFB 3FQTA 4KMLB 4RA3A 3PYCA 1WFJA 4WF7A 1MFBL 4HLZG 4KTYA 1BD2B 4L8CB 3V0VA 2AV7A 2IQ9H 5DRZB 5IKCA 1RIVH 4UZUA 3K2MC 5B7EA 3FU7A 1LMIA 3UO8B 3IXTA 1SDDA 4YDNA 4HUXB 5DFVD 1HDMB 3G5ZB 4IOIA 5T5NG 3S36L 4IS6B 2F1BA 1U8IB 1QFHA 4HU8A 3FSVA 1D5BB 1F8TH 2XYBA 3VXMA 2HKHL 2NY7H 2Y5TA 2YEZA 3L4ZA 3KH4A 3VXNA 5EV7A 4AMWA 3MXVH 5C07D 3MRIA 2NTFB 1XXFC 4HK0A 1UA6L 3UTZB 3WFBL 1XSIA 1P5UB 2DKSA 2LFGA 2V2WA 3FB8B 4RAUA 4Y2LA 5IJCC 3TEXA 1FORH 3DBSA 3TA3B 1CK0H 3VFRA 4BBWA 1WCBA 5LN8A 1FL6B 1FH5H 4GW1B 5LN4A 5F0PB 1XB8A 4AQ1B 5KAQF 2R0WH 2XQYA 1FYHB 4GSDL 1F3JB 4WTWA 5HVWA 5IFAL 5A7BA 3BT2H 3E6FA 1OXYA 1TTAA 4J8RA 4K8RC 1FC2D 1XZ0A 3F12B 1SOSA 5FK9B 3HNSH 5EU7E 4U6YA 3RY4A 2Y07L 3TNNA 2CWRA 2NSXA 3O11B 4IRZL 4KZEL 1SFHA 4LU5H 3UJJL 5IBLD 3IAQA 4E9VA 5JHMA 3PL6B 2C4FU 1OF2A 5AWNL 1S78D 4JO4L 3SGJC 3H54A 3IJHA 5C0RH 1BZ9A 1GOFA 4JZJC 1KN2L 3O3BB 4HIXH 5GGSY 4UQBA 5E2UH 1CD1A 4P5MA 1PZ5B 5KG9A 4G9FD 1P2CA 4OM1H 4OR1A 2D31A 2AQQA 3Q2NA 4TULL 1JZ7A 4PREA 3O9WA 4H20L 1AQ8A 1HNGA 2ZP8A 2W91A 3NABL 4CMHB 2R8SL 3N5AA 3GWJA 3NH7H 5JHLL 2YGVA 3PU7A 4LIQE 1NBQA 3BZFA 2R51A 2PCPA 3DDFA 1N67A 2FD6L 2R23A 3U9UA 3VXPB 4TVPL 4GMSH 3P3SA 4AITA 3FQTB 1XD1A 4M6NL 5CEZE 5J9PA 4Y16D 2Z7YA 4DGIH 3SDCA 4G9FA 1BIHA 5JXAL 2QKIB 3MRLB 4L8SC 3QC6X 4HCRH 2VWEC 3R0NA 4WEEA 4Z8FH 4N25A 4P8QA 5TQ0H 1AFVH 3LKNA 2NY0B 4G9DB 3QNXB 1A1OA 4LQ1A 5E5LA 5HJ3A 2MOVA 3WXVL 2BZCA 2EDEA 5T1DH 3MJ6A 3U83A 4PJ9B 1WWWX 4M93B 3Q48A 4JFVA 3VFWB 4M5TA 4GINA 1K3ZA 2BSBA 2YEVB 3IT8D 4YJZL 5I5JA 4XWOD 4ZMXA 5G5DA 2X40A 1G1OA 3H2WA 4JE4B 4IJ3B 4XI5C 2B77A 4QY8B 1KJMA 2OR8A 2EH7H 2W0KA 2X4OA 4M5ZH 1LDSA 1CYGA 4N8VA 4PJEF 3U0PB 5L8LB 1IGTA 5ICUA 3MJ7A 1YC7A 1HHKB 2HRPH 3OKDA 3MV7A 5GJTH 2VW6A 2Z8VC 1FNHA 4E5XA 2I9LA 5DR5L 1GS8A 4PI2A 1E5BA 3WJMA 3ARDD 3Q1SL 3UZEA 4AM0B 4PJAF 1ONQA 2FJGB 3VRJA 3S0PA 4DP8X 3QFJB 1S7RB 3MRCB 1T6BX 5I1DB 3SODB 1R24A 2R1XA 3QEGL 5KS9A 4UB0L 2ZWLT 2Q2EB 1IZJA 4UM8A 4OJDH 2JELH 5K39B 3ARYA 2IXQA 2OS7A 1QNZL 4QLWA 3N9GH 2EDXA 3DIFA 4PVNA 2OYPA 5T1DL 3RNQA 3I6KA 1GY2A 4AEFA 5ADOH 4X5WA 3ARXA 3TASA 4M7LL 4TSCL 4Y2DB 1AQKH 1BQSA 2IALA 2P26A 3GJFB 4OZ4B 1J48A 1NIDA 4N6QA 1TZGL 3CHRA 3VD9A 2JI1A 3C6SA 3INOA 5ERWA 2VLJD 1EFXD 5MEOA 3OB8A 4OIFA 3IBEA 1UADC 1A3ZA 3MJ9L 3OKMB 3IMRA 2DLTA 1MCIA 2VC2B 1W0VB 1HCZA 3H6JA 4U7SA 4JFFE 4OCNC 5DUBB 1W0WB 3GNML 3SY6A 3RHWK 3NH7L 3ULVD 2CDGB 5ITBL 1WUNT 2K4WA 1AD9B 5C0IA 5BPPA 3L2LA 4APXA 4M6NH 2P3YA 3ZYOA 1ZHNB 4NN7B 3B9AA 2DIBA 4JKPH 4Q9RH 2QQKL 4NRYB 3SYCA 1D5BA 3UO1L 4ZFOA 2P45B 2VR7A 2ZKWA 4KKNA 1NFDE 2LE9A 4PYGA 2D2OA 2O5YH 3KAAA 3DWTA 1UD5A 3NOIA 1KJ2A 4GAGL 3NBNA 3EO1B 5EWIL 5H4ZA 4E42B 1OAXH 4G8FB 3ZKMC 4DK6A 4M7JH 3CUPB 1P5UA 2OMYA 1A6TA 4O2EB 4JN2A 3VFRB 1R3IH 2NY0D 1XBRA 1U3JA 4DP7X 1PCXA 4G8AC 2Z0BA 1EV2E 1O6SB 3EUDA 4FOMA 2Q3XA 3NP4A 5FUZH 1O6TA 5JDSA 4F8TA 1OE3A 4KZDH 1B3IA 1KXQA 1UATA 1OOWA 4HSAC 3VXUB 1FLRH 1V10A 3EG9B 3WDJA 3FUDA 1HHKA 1KDJA 3OKDB 5IFAH 1RUML 3T1FA 4RGOH 4OZFG 1XGPA 3CN0A 1F0LA 3QIUA 3S37L 1UGKA 3AQYA 3IFPB 2LTQB 3NA9L 4DZ8B 4LZKA 1WE5A 5F9JB 5L6YL 4HG4J 2AJYH 4MBRA 1KC5H 1QRNA 4ENED 3ZSSA 2H1PL 4D2NA 4ZTOL 1NMCB 1XB6A 3BQUB 1CL7H 3TV3L 2XZQL 3C5SA 5FUOH 2BHYA 2GTZA 3RKDC 2Z35B 1NICA 1QD0A 2IDSA 2DBLH 4NNPH 3ZL2A 3BDXA 4R8WH 4LB8A 2BXZA 1YYML 2D03H 3LKPB 4JFED 4XCCH 4AEEA 1TZOA 4OGAC 3S5ZA 3CBKB 2XXFA 2BVPB 4HSCX 1UZGA 4KI5F 2JJVA 1PCSA 4X5WB 3S4SG 4Z3EA 5EOCH 2OLDA 4TOYL 5C0AB 4MTMA 4WK0B 2CHNA 3LHPL 5F1KC 3HLKA 1E4HA 3V0VB 4EDWH 4S1RH 1JZ5A 2R23B 1O6VA 1F4YH 1WISA 4W9ZA 2J8HA 5E23A 2NCEA 1IAIM 3VGAC 3PABA 5E00A 1FE8L 3SYPA 2DQHH 2G9KA 4DGVL 4QRPB 4FABH 2B16A 1KEMH 3QWNA 3MA7B 3D2TA 1HKLH 1F97A 3CK0H 1BQHA 4F5CA 3P77B 5AENA 3KEHA 4JKMA 5F7HA 3EH4B 4OQTA 1DQTA 5LNGA 4P0DA 3ZTEA 2FR4A 2XWTB 4L8DB 2GCYA 1QSEA 4JQVC 5K5YA 4JPIB 2YRBA 3G9VA 3UBXG 1F3JA 4W68A 4G8IB 1KTDA 1MZZA 1FAIL 1HEZB 3RGBA 1I3RA 2R0LL 5CHNB 4R4BB 3WDIA 1QVOA 4MD0B 3WN5B 2Y9RT 1CU4H 5LWYL 1ZV2A 1VACB 1TEYA 1JG9A 3CVDA 1FHGA 4HALA 4AQEA 1JGEB 3B3BA 1ZT7A 2DLIA 4PG9B 1HEJC 4TQIA 2E46A 5L7XL 3Q2WA 2H41A 4W4NA 1BYPA 3KWTA 1SJHA 3GHBH 4R7LA 4Y5XB 3WFDL 1OW0C 1CMOA 1MCFA 2DQIL 3RVXC 4LPTA 4A6YA 2P5ED 3IK2A 4LO9A 2VZVA 5IHLB 1A9VA 3A22A 5F8RC 3KBFA 5ESVA 3GXTA 4R7NA 3ZTDC 2FNWA 1VFAB 5A6IA 3PWJA 1QLEL 2EO9A 1AZRA 3PWPB 3EGDB 2CR3A 4YE4H 5CN3A 2YAOA 3GRWL 4HBCL 4PP2A 5D1XC 5E51A 2FT8A 4Z7QF 4U1MB 4NX0A 3PIQA 2CKBB 1JZ8A 3UCQA 4S1DC 1BBJA 1OCOB 1IGIH 4PJIE 2P80A 2XN9E 4OZFB 5I74B 2P52A 3E6HA 4PP1C 3QHZL 4M8QB 3EDJA 3QIBD 1QA9A 2FGWH 2FJUB 2Y0SA 4MDJA 1JZFA 1UQSA 2VR8A 1XGZA 4PB0L 5AD0A 3QIWA 1IBGL 2FEDC 3BDYL 2BMKB 1ZGLA 2RMNA 3EOYG 4Y2OA 3U46A 2K7PA 1J8RA 3MLYL 4HWBL 3JTBA 1L0XA 4RQQB 3UMTA 5HHOD 1EUTA 1M71A 5C09E 3NTCL 1A0QL 2NY2C 3ASOB 9CGTA 4CKVX 3APMA 4Y4HA 1SF5A 3V4UL 4CC4C 1DJZA 3GMRB 1V7ML 2OZNA 2X4QA 3K4AA 3CK0L 1JL8A 2UVFA 2IDCA 4F7MB 4HG4K 2BY2A 3QFGA 1OPOA 3VH8B 3L1OL 4P23D 2E7DA 3IDXH 3HPLA 4RX4D 3BKCH 4UIKL 4G7RB 2Y7SA 3FKUS 2K78A 1SHXA 1OSYA 4WWKA 3UC0H 3WIIH 3D05A 3MCLH 2UYLB 3CFBB 1QUPA 2ZXCA 2IH1B 2QV2A 1J10A 4D9LL 1AGDB 4J3TA 2IANA 4TNVK 5C86A 3INUL 3SCMA 5HYQA 1CXEA 3KWWB 2BVOB 4OZHE 3V0WH 1M56B 2EO1A 4PJHA 1K6QH 4HUMB 4LEOA 4KRPB 4KAQL 3L2MA 4HJTA 3PL6C 3HHSA 4K7FB 4PEEA 4R2GD 5DEFB 1ZVSB 3UG5A 1AG0A 3W38A 3OXRB 4NC1C 1FDLL 3NSYA 1H3TA 2P80D 2Y2TA 2OPCA 5BRPA 1B4TA 5E8NA 3TL5A 1NIFA 3AB0B 3CFCL 1T7ZA 4R84A 2VUKA 1W15A 5DJ6A 4PW4A 1I7UA 1GRWA 2BVPA 5DEJA 2H0EA 3QQ3A 4OFQA 1C5DA 5DD6A 1BBDH 3ZPDA 4ZX6A 1YQVH 4MD5A 4M8UA 3NJKA 5EZOH 1MSPA 3GMLB 4HOXA 3U7YL 5DVOA 4H2AA 3PAUA 4N2FA 4UQ9A 4PRBB 4A2EA 2X5PA 2ZX6A 3LXCA 5FM4A 1NDMA 1X5YA 4WU7B 4KX7A 2ADGA 4PM1A 3B83A 2BSTB 2WD0A 3K3QA 1UB6A 5AVQB 3BFOA 3QRFM 1YNLL 3HN3A 1A1MA 1KCUL 1AE6L 2QL1A 4TRPL 1HHJB 3F58L 1S9XA 2V33A 3CMOL 1UD4A 5D5ME 1XTMA 4FQXB 3AG3B 2AFNA 4BD4A 2P8MB 4YEFA 3WNJA 2Q6WB 1S3KL 2OMYB 2ZUYA 4KKZA 3DTDA 3BMVA 1U8KA 1XHHA 4L8DA 3OKKA 3ZZQA 3NJFA 4RGND 4H88L 4K8RL 4XX1G 1RP9A 1PY4A 1E8WA 4QXWA 5E2UL 3VDBA 2GJ6A 3LZRA 1JPGB 3KM2A 5KYWB 1MCPH 1ZDSA 1G9NH 1ADQL 5L9DL 3EG9A 1BFVL 3NJJA 4ESKA 4NKOB 4BSVA 2EECA 2BZ7A 5C0ND 2EYTA 2FJFA 2EDTA 1DDHB 1JPTH 3LS4H 4Z0XA 4FFYL 3RG1C 5GSVB 1E5YA 4NT6A 4Y4KC 4PJ6A 3EZ8A 1QG3A 1UEMA 4JDZB 1J9QA 1B0RB 1I8KA 1NH6A 4OFPA 2C3WA 3SKOA 3VWKB 1KBGL 3GPEA 5SWQB 5AOZA 2LOEA 1FO0H 4OF5A 1KTBA 3FQXB 4LKXB 5IQ9A 3ZDYF 3U7WH 4XC3H 3GI9H 5F9DC 2DM7A 2YA0A 4Y7MA 2VL4A 3ARWA 5DMGC 4FG2A 5E9DD 5F7NC 5C3TA 4YIQB 2Y72A 3V6OC 5DO2D 3RUGE 1RJLA 2X4RB 3JZYA 5CGYD 2LLGA 3A6BL 1SHWA 2PCFB 3F7VA 1KJVB 4IIZA 3GBDA 3LNFA 1MWAB 1XCTA 3OXRA 1HL4A 1UWYA 2R69A 5CIPA 5MERB 3FB5A 1DSFL 4LLMA 4MA8L 2DLFH 4BFNA 2EXSA 5KSAB 3B8YA 1JGVH 4PJFF 1AYOA 4CMMA 4MX7A 3T71A 4XNXL 4Z7WE 2OZ4L 3BPCB 3VXSE 4BH8B 3T77B 5IFJB 5J56B 2ZWKA 3BOVA 1HHIB 3O4LE 4NKQB 4M03A 1N12A 3PABB 1LK3H 4PRIA 4PR5B 1SEBA 1GAFL 2NX5D 4N20A 3G08A 3MR9B 1YY9C 1MN4A 2JQMA 2VDLB 5FWRA 1ILUA 5KVFE 4ZPVB 5DQJA 3P2BA 1NPNA 5D72H 1T1WB 2A6DB 2Q3ZA 3E7JA 4UAHA 2HUEA 1ASOA 3ZDXB 1KB9K 4RMUA 5FUCE 3EO9L 3GBEA 5GGVY 4MAYB 3UX9B 3ZT5A 3KL3A 1W6LA 2NPLX 4HCGA 4LEBA 5TE4L 3DPBB 3DTXB 5D6CB 2JB6A 3A3YB 3GMRA 1EO5A 4IU3A 2VN5A 2EE3A 3IDYC 4G71B 4L4VB 4RH4A 2DD8H 5KOMC 2H8PB 3QUXB 4QYOB 4X9HA 4AEIL 3V79C 3ARBA 3P4LA 4WHDA 2ODIA 1RUAL 1XVSA 2BHZA 1KGCD 2WN3A 1BZOA 3A6OA 4EF3A 3OHXC 3KWUA 3TF7C 1MFMA 5EIIB 2K70A 4L8BB 2UXVA 4LLUA 4NQXB 1D6VL 1F4WH 4K07A 4RGMC 5DO2C 1T03H 1S7WA 4G8EB 1H8SA 1HYRC 4KY1H 4B9IA 4D8PB 3SD5A 2X44D 1J05B 2FECI 1KB9J 2HTKC 4AYSA 2QQNH 1R0AL 1JP5A 2EYTB 1X7TA 1DANU 5M95B 2X0VA 4R7DB 3LHPH 4QHMB 3T6XA 5MEQB 1M7IA 4I4WB 2IF7A 3P1VA 3O6MH 4GB9A 4M6ML 4NZUH 5DJZA 4BQ6A 5DO8A 2NNRA 3RP1A 1NCTA 1FO0B 2WK2A 2GK0A 3H42H 1TVHA 3TBYA 5J12B 2GAZA 1TCRB 3QO1B 3BWAA 3QJQB 4H44C 1AXSB 1H8NA 4W9LC 4FNLH 1II4E 1Q0EA 4Z5RB 4GQPH 5I28A 2GYSA 3GIVB 3I75B 3IJYB 5CJ8A 3TV3H 3WELA 4GI8A 1MI5D 3VXSD 4NLAA 3GXUB 4L9LB 1RJLB 3CFCH 2QMKA 4Z7UE 2HRGA 2WLMA 2AC0A 1XCTB 2XTJB 4RISL 3D33A 2X4PB 3MLUL 4K0OA 1KY6A 4PJEE 4ZS7H 4OAWA 4YOKA 3U1PA 1X4XA 4YBLC 1RZGA 4L4JA 4OI9A 4XC1L 5E1GA 5E9NA 5IG7B 4YDLB 5I15L 3BT2L 3MXWH 4EKXA 2F68X 3IXAA 4LEXL 4PRBA 3S8FB 4R0LB 4XC1H 3MRJB 5CILH 1U2CA 4WO4D 5DD1L 1QYGH 4DFHA 4ZSOA 3E8UL 3QQDA 3WD5H 5DS8A 4RQQA 1IFHL 4RZKA 3ABZA 3N44F 1MRDH 4ZAKC 4MD4A 1BAFH 1R3IL 3P73B 4HJGB 3U2SA 1QABA 4N8CL 3BKML 2CPUA 4ZUUA 2UY6A 3CN2A 4FFVD 4KZ0A 3QGVA 4PJIF 2EVGA 1F6AB 1IC7L 3LRSB 4PY8I 1HXYA 3HKFA 3OX8B 2J56A 5E5MB 2RHEA 2IFFL 3KPPB 4BUQA 5FWQA 2JB6B 3RILA 4FQQB 4UQ2B 5ICZB 4IOSA 4CN1A 1ECYA 1DHKA 3CDYA 2QQNL 3NESA 2JB5H 2YXVA 1QFOA 3C5XA 5I8CA 1G9EA 3QAZB 3KPRD 2CUMA 3JVFC 5FECB 1HHGA 4PGJA 1RLBA 2CRZA 35C8L 4PS7A 3MROA 3TBSB 4NKMA 2Q7YB 4N0CC 4EDWL 4ZNEE 4YUEH 1RKRA 2MEJB 2XY2A 15C8L 32C2B 4HT1L 2DQCL 5T1MA 4ERSL 4Z76B 1Q9WA 3QUGA 1CJYA 3MACH 4FNQA 3BN9C 3GSVB 1N5YH 2F54A 2GK0B 2AXFA 4IIQA 1ZGLP 3H55A 1OAYL 2BWDA 2MWCA 3MZTA 3OZ9H 4X5PA 3IGLA 1IQWL 4G83A 1FL5A 3LYRA 4P9ML 4E9XA 3V10A 3VH8G 1G7PB 3PP4H 1KZYA 2AXWA 4OLZH 5IM7B 2NOYA 1CQYA 5CEXB 1OSEA 1J8HB 5GGVH 2ZT9C 1KGUA 3PG2A 3P54A 3CD4A 2Z92B 1CFQB 1PZAA 2BJMH 5DZOA 1H6FA 1DQMH 2BSTA 2IJ0C 4EUPB 2NXZC 3NIFF 2X9ZA 1RMFH 3QDGA 3FBQA 3KPLA 2BH0A 2G30A 3MR9A 1D9KB 1UJ3B 2FGZA 3S34L 1WAPA 4WW2F 2A9AA 4HKJA 3QDJB 4HKBB 4S2SB 4ZMPA 4MJ5B 4TQHA 3IFOB 2QFPA 4FQLL 4P57B 1T66D 2J55A 1HCVA 4B9FA 2EE2A 3ILPB 4UU9A 4GIPD 3VO0A 4E9SA 5A6LA 5H94B 7FABL 5LBSH 3T3ME 4JZNA 1TEFA 5IVXE 2EIMB 1GYCA 2F6AA 2X6BA 2QSVA 1KIQB 2V7NA 2YOAA 1JPGA 3KYMB 3P11H 3KYKL 1C5CL 4OBRA 2F2HA 5KOVC 2HWZH 1PW3A 3WTXA 3V0HA 4YEEA 3FUFA 4XH2A 2IOMA 2OMTA 2J88L 4M7ZC 4HBCH 3BP4B 3ZDWA 3VDCA 3V7AG 5H35A 1F1AA 3HI6H 3DYOA 2H9GA 4V1DB 3HCVA 5HGBA 2OJZH 5IMMA 2UV3A 1WJ3A 2A0LC 4BQCA 5BJTA 2GHWB 2HLFC 2JI3A 5FYKD 4LKXA 3MODL 2R29L 2UZIL 2VZUA 1Q9LA 4ALAC 3RI5F 3N1GC 1HHHA 3ULVE 2I24N 3C6LB 3NABH 3ROLB 4U6TA 3GGWB 3O41B 3QB7C 2HFFA 3U4BL 4WHYH 4LCCB 2Q3AA 2ZXDA 4A2MA 4ADIA 2V7HA 3S35L 5HPMA 5K9OB 1H9DA 3BAYA 3QIUC 1MG2C 2OZ4A 3KCPB 4DGWC 3QJTB 4ZOCA 1NEUA 2FEEL 5AL8A 1T7VA 2H32A 3O4OC 5I1CH 4H0HB 4N8PA 4N0RA 3LEYL 4HHWA 4W70A 4WKZB 3SDXA 4JQXA 1HWHB 4AQZA 1GGTA 2QR0A 1GOHA 1Y7VA 3ARGC 3ULUE 2W07B 5KEZA 4F57L 4OZHF 5IM7A 3CX5K 2CUHA 4TTDD 1CGXA 5MI0B 5FV1L 1ERNA 1XSOA 5AUMB 2MNWA 1VERA 4NPKA 5CSBA 4K4KA 3HPJB 3DOHA 2IAMA 4AYGA 3FT9A 1KCSH 3LNDA 2BOCB 3S37H 4QXGL 1Z5HA 2JKLA 1S7SB 1RK1B 1TJGH 1USZA 1NGWA 2W9DH 4JHZA 4LFHD 4NXSA 3VCLB 4X4ZA 3CZGA 5I1CL 1QX1A 3D08A 3SE6A 3QZPA 4FQXC 4LPWA 3GBNH 4NBYB 4NO3B 1IJ9A 1P4IL 2R2BB 3G6DL 4AEHH 3TT3H 5I5RA 3TBWA 3UBFA 1NLBH 1E28A 5HVGB 5FHAH 1QSVA 3DX4A 1WA0X 4BFOA 4I1PA 2OX5B 1I8LA 1NFDA 4PJ9C 2WXRA 3S36H 2B4CH 4MXVF 3EJYC 4UYQA 4H2CA 3BUYA 2IAMD 1MJ8H 3IFLH 4LHUA 1HCFX 1O9ZA 4MCYA 1P6WA 4MNQB 4EIBA 5IQMA 2IAAC 3NTCH 1YNTB 1JDCA 4Y19A 4FI6A 3PV6A 3C8KB 1T3FB 2HCZX 1CE6A 3QI9A 5E6IB 2NMSA 1EXHA 4DUWA 2APVA 2YGOA 4JHAH 1IEAA 3HG1D 3PDDA 1E9QB 5SV4A 4HWZB 4DUVA 5AZEL 4LFHG 1K3IA 1HHHB 4F7CB 3CDZA 1LDPL 2BSSB 5JOEA 1DANT 5IQ7H 3KDMA 1SZNA 3MGTA 1L9PA 2WWNA 2P24B 1NBVL 1T6WA 1HQRB 1FL3B 4PV9B 4KQ3L 4AQ8A 3TM6A 2C7UA 4AIEA 1PYWB 3KVPA 1E5ZA 3VQ2C 5BO1H 1G94A 3CSPA 5HI4D 3S96A 5BQ7B 3OG4B 1RUMH 1E4XI 1CFMA 3KS0H 4MMZA 4N85A 1GHFL 1IKNC 5PAZA 5E08H 2AXGB 2KLTA 4ONHA 2H2SC 4NQDB 5AZUA 4YGVA 4LU5L 3LN9A 5HYJE 3IS0X 2YO3A 2RR3A 3S3CB 2OMBA 4ZT1A 5FO7B 4LRIC 2BX5A 3KPMB 2LQRA 1LO2L 3MNVA 1I1AB 3NEOA 4U6HA 3HNVH 3QK0A 2P8LA 5I19L 1BF8A 5EN2A 2GW5A 2IAMB 3GHEH 1UUNA 4OB5L 5GZOC 3R1GL 5MEPA 1S7TA 2DQMA 4UQEA 1TZIB 4P5TA 2PTTB 4HV8B 3BUPA 1EPFA 1E5AA 1DBBL 3FT2B 2R1YB 4L5FL 3VNZA 1M53A 2WXHA 5KUMA 3WKYA 2ZOLB 1HL9A 2VLJB 4GY4A 3V6BR 2XICA 1BM7A 5JW5B 2YMXH 4AL8H 2BOLA 4F33B 3GLDA 1XX9C 1T1XB 4S0HA 3QUKA 1TJHL 1Z9PA 1AOZA 4HJJL 1TSHA 4WI2A 3NJGA 4K71C 3ETBJ 1BDYA 4XP1H 3SPCA 2I25N 4NRZB 3TBWB 3GSUB 5KYYA 3U7AA 1OARL 2Z0UA 5J6GB 5L2JB 3TYGL 3JV6A 3QIWD 4JX0A 5ACZB 2Z31A 1AXTH 3D4GA 4FG6D 1R33A 4G6MH 2FLBT 3FT3A 4R7VA 3L9RB 1TQSA 3H85A 2DD8L 4U1NA 2GVYA 4NJ9L 4I2XB 4QWWD 5BJTB 3VD2A 4J23A 1J5CA 1OB1A 3IJEA 1ZHLA 1I1AD 1DJXA 4MCYB 4HIEB 1NFIB 3CH8A 2FB4L 3NACL 2YSSA 3N42B 4N0UA 3X13B 5AQ0A 5GS1B 5KSBA 1ZE3H 1UEYA 2E4FA 2A4CA 2K8QA 1URLA 3MVSA 4KVPA 1O9WA 4H8VA 2WOYA 5J6SA 2Z34A 4AE0A 2C3VB 4WHTA 4TXVB 3MGOA 2FSEB 2OYKA 5I8KH 5E8DL 4WGWB 3LRHA 4NZRL 5T5FA 1FL3A 1GMIA 3H3BC 1ITBB 5F89A 1GS7A 2XACC 3HC3H 4J3OD 2CO6B 2VLRD 3S96B 2NNCA 1KPVA 1CFSB 5DMIL 5I8EB 3I2CH 5E9AA 5BCAA 1IM9B 1T0PB 2AXGA 1G7QA 1T04A 4WWKC 2B5IB 3L5XL 4UTAH 3SPHA 4HIIA 1TZAA 4X4XB 5ISZD 2DM3A 4G2AA 2ITFA 3ZRSA 3VGHA 2HLFD 4R4FL 3SDAB 4Z7NE 1H9VA 3G6AB 4U1JB 3V4VA 2OR7A 3AY2A 3DOSA 3IF1A 4MRBA 4UU9B 1E65A 3F85A 2EZ0C 3FO2B 3TBTB 4J4PC 1G6RH 5TTRA 3K4ZA 3X11A 3BWSA 3MUUA 2C3GA 4YK4C 4AV0A 3I50L 2PXYB 4QXTB 3EBGA 1X4YA 4J3UA 1NIAA 2ZOUA 1U3HD 3AW5A 3VFNB 3QEQD 3SDCD 1SUJA 2JKXA 5EPMB 3S5YA 2J20A 4X9FA 4QXUL 4RWYL 3QDGE 2X6VA 5T3XE 2VQ4A 4GW4B 4XN2A 2MQGA 4M6MH 4NZUL 1T2XA 2NX5A 3HG3A 3CXHK 5CSGA 2QGEA 1CQKA 2CRMA 2O5XL 4GBXA 4NOBA 1KTJA 3GMOB 4JDVA 5TH2B 1KFGA 1NCIA 5E9DE 5MEND 1JRHI 4XGZA 5EBLA 3I2CL 3V0AC 2ETWA 4YXKL 1A22B 3VFOB 2VLKD 4ONFH 3ZO0A 1C8QA 3L5HA 3DMMD 5I1EH 1JV5B 4AYMC 1NGQH 5LCVL 4HQQL 3HN5A 4B9ZA 3M8OL 4UWQB 3R0MA 5KTEL 4MXQC 3AS1A 1WSST 4WWKD 1OQXA 5B1AB 5DD1H 4Z18A 4FYQA 5FYJU 3NCXA 4P3DA 4HIEA 2Y1AA 1QQDA 5I1HH 1WD8A 3O4LD 1BECA 1BIIA 2CHXA 3W9DB 4G6JL 4H8HA 4FNRA 4X6FB 1G7JB 3QDME 3PGDB 2ARJA 4RMSA 3RWEA 2Y5QA 3VG0L 3SPIA 3V52L 3NACH 1ZGLM 1JUFB 4Y19D 1OTTD 5ETUA 5GGSA 1YNKL 3VXTA 4KMQA 5IVOA 4APQC 1JWSB 1WDAA 4KK5C 2QSCH 1B4JH 5I30L 3FFOA 4U6XB 2VKXA 4PQXA 4HFUH 4AW7A 5F97E 2F58L 3HI1A 1RZKL 1GGYA 4LLQB 3TJEL 5F1NB 4MWFB 2LAGB 4IDLA 5I1AA 2DYSB 3ES6B 3VX1A 5C7XH 4QOKD 1JZ2A 3OR6A 1I1AA 4EMZA 4UM9D 4XBMA 2VLRB 3N55A 1ET7A 4WI4A 1DSFH 4MA8H 1P7KB 1UWXK 5JPMC 2CIKA 2J8UB 2VSMB 1FIGL 5C0FB 1KB5H 3AT8A 4P59H 3L48A 2I26N 1AZVA 2VIRA 3SBWA 4BKLA 3T65A 5KBNC 3FO2A 3TBTA 1F13A 1NCCL 1B2WL 4WDIB 2OSWA 1ZVHA 2G3MA 1NUGA 2ZAIA 1FRGL 1PZBA 2DYPD 5I76A 3D9AL 4JRLA 1RZKH 4LHUG 4JFZH 2ED9A 3GSRB 1CE1H 1L6ZA 4KJWD 5F2FA 2ATKA 2NLJB 5CSZB 4R7XA 2TSAA 3JV4A 2AK4E 3V55A 4GLRI 4UINL 1I7ZA 3HE7B 2ZWYA 5CZRA 5KJ4A 4OD2B 4AYBA 4QCIB 3UH8A 4Y0GA 4TNVF 3HR5B 4UOQA 3FK3A 5IB4A 3D7PA 2DQEL 1B0GA 2E4TA 4G59C 4LL9A 3VXRB 5FYLE 1H3PH 4ZMWA 4LRNL 2QADB 3K74B 1J88A 3RTQA 3KPNB 2CNYA 4K9EL 3HAEH 3NZSA 4NGHL 3STLA 4H1LH 1SM3H 4WRLA 2E75C 2MHAB 3D07A 3OKEB 4L37B 4PGEA 1N0XH 5C8JA 3R8QA 1EGJH 3LSOB 3MNZA 4IOFC 2XTJD 4XOBA 2M2DA 2Y4SA 5LCVH 2GY5A 1I53A 2O1AA 3JWNE 3VFMA 3D0LB 4HUNB 1NCAH 1QSEE 2H3XC 2IBGA 2WTPA 2Z1PA 2ZG3A 4IMLB 2C7FA 5CJQL 5DMGD 3SBQA 1CI3M 1R3HB 4KRPC 4Y9FA 1N70A 4Z7VE 4PJDF 3TTYA 5DXWA 2UWEF 4HUXA 3DX7A 3RIKA 2ITCB 5C2BL 3ARGB 2YZ8A 3Q3GA 4L1DA 4FTDA 3QUZC 1A1NA 3MV7E 3ZQ9A 1V7NL 3MAWA 1S9WB 5I1IL 1CUOA 4NP4H 4BE6A 1M3IA 4TULH 3MV9D 3ZDZE 1CVRA 4Z7VF 4A55A 4X4XA 2PPDA 4PJDE 4S11A 1MFDH 1XF5B 2B4CL 4XP4L 5I1LA 2A73B 3CG8A 4HK0B 4KOBA 3SE4A 1LP9E 3V4PA 2G2RB 4UI2A 2OMXB 5AWNH 4PV8B 3MV8A 2VN4A 3QE5A 1SUHA 2BP8B 5CFAA 5D7JB 3RVVD 4QNPE 2EDKA 2WOBA 1F6FB 5TDPB 3TOPA 1SHSA 3TFKC 2AV1A 3LS4L 2HT3D 3QUKB 1G87A 4X7DC 3SOBH 5DT1H 2ZOWA 1S5IH 5K93A 1AACA 4NM4L 1ZTXH 5E95B 3WIFA 4ODTH 3CFEA 1QEXA 4YQXL 4OLWL 1N19A 3MJ8B 5K9JH 4GW4A 5D1ZA 1RUKL 4H13C 1NBVH 5FYLD 3LMJH 3A4EA 2DBJA 4JY4B 1G6VK 1R6VA 2HMID 2OMUB 3CPLB 3L9RA 4XMUA 4TPRH 5EBMA 4P5RA 2UZPA 3DV4A 2MOQA 1L6PA 5DJ0A 2C1OA 2W0FA 2CCWA 5IVZB 5I23A 1HXMA 4B27A 4WFFE 5HDBB 3VTAA 5TFSH 3O3AA 4YHYB 3VXQA 4ZW6A 5IT2L 3MRQA 4JDTL 2BOBB 3QUYC 4WIQA 2NQCA 3VB8A 3ZDZB 1C5BH 2E47A 3E3QC 1TTBA 1PSKH 4P3DB 3O9WD 1ORQA 2Y3NA 1XF2A 3DV6A 4PRHE 1LO3L 1MCEA 2VE6B 3LMJL 3QG7L 4OZIA 3LEXB 4NHCL 1CO1A 3JT0A 3BIBX 4K8RD 3JQOB 4H26A 4QRUA 1G9MC 3UTOA 1U8IA 1EXGA 3RL1A 5CR1A 5JLZB 3IGUA 1YEDB 4MB1A 4FL4B 4TOYH 2NNXA 3MJ9A 5AVVB 4G42B 2EDWA 2BY0A 3FUHA 3FCGA 4KJPD 2AEWA 3BSZL 1GCFA 4RAUB 4WAFA 3LZFH 2UZXA 4KTGA 3AS3A 3U1SL 5JW4Q 1NAMB 1CB4A 1Z9LA 4DCQB 3ZHLA 3OTTA 1YCSA 1AZCA 4NUPA 4KI1A 2YXWA 1XXDC 3BZEA 4Y1SA 1P5UC 5D1ZI 3R1GH 4OZIE 2Y6SD 2GSGB 2Y7QB 1QR1B 2AITA 2DLEA 3F7RA 4F3FB 5HJGA 3AM8A 4YWGH 3E6FB 4J8RB 4ZAKA 5BW7A 3T65B 1PS3A 1JK8B 3AXHA 1ZA3B 4HIJA 4HJ0D 3B2VL 3CFMA 1EXUB 2BVYA 2YQBA 1FZOA 2WKOA 2P5WA 4NBXB 3NJVA 4XVOA 2YKLH 4WI6A 1M05A 2MCG1 2KC0A 3G6JF 3DC0A 2VDMH 5LAXA 1SJXA 1YG9A 3GKWL 4S0SD 3S8WA 3FTYA 4KZDL 3IJHB 3KLAB 3OPZL 1MVUB 2R1XB 5CZKA 4BZYA 3MJ8A 1BZ7A 1VB9A 4PGDB 1I3VA 4UTBA 3GLZA 3B6SA 5FM5O 2AJVL 1QLRA 2IVFC 2EVJA 4P9HL 4PREB 4KFZC 3UAJD 3OB0H 4XZUA 3M17B 1XEDA 4XPGL 3D52A 1OM3H 5E1AB 1SXAA 3FT4A 3ZZSA 1QWUA 5DGRA 2MOGA 3EF4A 4LLYB 4MMYA 4HD5A 1QFWI 1RSYA 1R5WA 2N01B 4F37F 2FIKB 4BH7B 1DJSA 1QFPA 2PWFA 4P05A 5ICYB 1N0XL 3EZJB 3B3IB 2JJTA 1U3NA 1QRND 3VG9C 2GI7A 4NKDA 2NDFA 5C71A 5DWUL 3FQUB 4PJ7E 1MJ8L 4HIHB 3U36B 2NR6D 4G8GA 2EUWA 2Z65C 2F53D 1GJUA 1QUNB 4PCKA 4PJEA 1G1YA 4X6CB 4UIMB 2E7LA 4FLRA 1XIWD 1BVZA 5BZWB 1Q0XL 1KT2A 3MBXH 4FNSA 1XF4B 4PJDA 1ODAA 3U0WH 2ZWSA 4UINH 2UWEA 4PJ8C 1UZ8A 4GRMA 3QXTA 1A3RL 2EABA 2XV2A 2DWDA 3ATAA 4PJIA 2V9UA 3UAFA 1OD9A 3QAQA 5A40E 1IVTA 1F90L 3HMXH 1H3GA 2WLYA 2IMMA 4ZBJA 2J21A 3E8VA 2IWEA 2WMPB 5F6HI 1OGAB 4I0KA 3FULA 4RAHA 3AREC 1MDTA 3BGFC 4XRCA 2J71A 1EEYA 1BCIA 3K8KA 2XTLA 4WDIA 5DC4B 4A7QA 4RVBA 2EXWC 4JZJB 5JHDE 3VYOA 2Q86B 4J7RA 4HDIA 5JDSB 4I77H 4AM0A 4KV5E 1GR7A 4LHQB 4OZHB 3IGKA 3LDBC 1XGTA 1KC5L 2YC1B 4P3CL 3T1FB 2WWKT 1IFHH 2DH2A 1AI1L 1MDAA 4HOZA 5KW9L 1PLGL 2ZAHA 3QZOA 2ISDA 4PRID 3ZDYE 3B2PA 4QLRA 4CILA 2J72A 2CBPA 1OB0A 4M3JA 1VDGA 1UACL 4BV1A 4JPWL 2WO4A 1I9JL 2QSCL 3LH9A 3US9A 4V1DE 4B96A 4J3BA 1BZ7B 2QQLL 2D7QA 4FA7B 2VR3A 2GTZB 2P9RA 4LT7A 1D5MA 1E7VA 4LVEA 3E9TA 1IJNA 3B5TA 1JPFB 3LY6A 4U3HA 1YEJL 4KUZL 2QPUA 5I66B 1N3NB 3SKMA 1NC2D 2VXQH 5JXEC 4Y2DC 3CU7A 4WUKL 3L4WA 1E40A 4MMYB 1JFQH 2DLGA 3W0WB 1MZYA 4F9PA 1MELA 1XR9B 4XCNB 5DHXB 2CDGA 4U4IA 4YDKH 1NGQL 1HE7A 1U92A 4LPUA 2OI9B 2QZQA 5J6HA 4N6RB 5DJ8B 1LE9B 3SPVB 3IVKA 1AIFA 4JQVA 4OLVH 1SDDB 1NCGA 1F3DH 4NM8H 4C56B 4I89A 3T4AB 4IBUA 1FCGA 2DS4A 2R39A 1DUYA 3WLBA 3HS9A 2XRAL 4JN2B 1NAMA 5B3SB 2R56H 2Y24A 2BP8A 2BVQA 3BAWA 2ZF9A 4UILL 1KN2H 4HIXL 1P1VA 4MA7L 3CZNA 1THCA 3BZEB 5JPNB 2DQDH 3TXAA 5FO8B 1OGAA 2FH8A 5TE6L 3X17A 3CVHL 4XRCB 3BGAA 2HLAB 1HIMH 1XT5A 2FWSA 1D5RA 5KVGH 5MP6H 4Y4KB 5EUOE 1CG9B 1S3RA 3INUH 4KU1A 5B8CC 1HQ4A 1ZLWK 4YHLH 3MUJA 1ZT1B 2XJLA 4P2RD 1I8MB 2PO6A 4FQCH 3F83A 5DSCB 4BE5A 3LQMA 1L9SA 3P0VL 2JKRM 3V5HB 2OR9H 1BM3H 4OV5A 5IR1B 4J1UB 2WCSA 2NY2D 2HZHA 4KOCA 1SRDA 4KHXH 1F4XL 1XH1A 1OP3H 4GFTB 1OY3B 3WFHB 2Q76B 2Z6FA 1NGPL 4G8GE 4PTTB 1XZWA 4N3UA 4BDVB 1WK0A 4M00A 1R5WB 1G7MB 3QDMD 2FBJH 2VLKB 2CZNA 4NC2B 2IPTL 5IESL 5CINH 3NCYS 5TQ0L 3BEVB 5C0JA 2AHIA 3CZKA 1QSZA 2COQA 1NMAH 2QVFB 4UAOB 5C0NC 1DSWA 5CCJA 5I1JL 4K2UL 3PNRB 3HS0C 3D85D 3RDTD 4LCWB 3QNZB 3WL9B 1Z5LA 3ZXAC 2BP5M 1GY1A 3MNWB 4FADA 1XF4A 3RB5A 4KK6D 3RVUD 3APDA 3LPPA 5CM1A 4RBPH 4P4KC 3T6QC 2YD6A 5BRQA 1JTPA 2CBQA 2Z64C 3RX9A 5DHYA 4DF9A 3R06B 1TXKA 1T4KB 4XBPB 3UYRL 3V5DA 5D72L 5A2LH 3B9KD 5JHLH 2XWJA 1BFOA 4NSKB 4BUGA 1MJUL 4S1QL 4TUUA 2LTQC 2R0KL 3AG4B 3W5NA 4PJ9D 4F3FA 5GGUB 4O4YH 3K6FA 3GSOB 5H4YA 3VFWA 2F7RA 1N8ZB 4XBEL 4HIJB 4Z0BH 1QVOB 4MD0A 1EJ8A 3HZKB 3WN5A 3OQ3B 3MOAH 2EIJB 1E30A 3WFCL 1E4KC 3SEPA 4U0QB 3WJJA 4P2QB 1FZJA 4N2MA 3L3HB 1WGOA 1BEYL 3BI9X 3HBQA 2GFBB 3EIFA 1ZLUH 3SDDB 5C0RL 5L4FA 4R96A 4GNKB 3MV7B 2ICEA 4J3WA 1EAPB 4WTQA 4PBDA 5BRZA 2E7CA 5A2AA 3O11A 2VQUA 3MLUH 4AL8C 3APCA 1BQKA 1ETJA 4M43L 4GKSA 1E3XA 1DTUA 4K7FA 1WZKA 1ZT1A 2EXTA 2J6EA 2KDYA 1Z0NA 1E9PB 5KS9B 1PQZA 2WXKA 1D9KD 4OI8A 1IQWH 4PJCF 4EEEA 2UX6A 2VZOA 3GJEA 3ISRA 4YPGB 2EEBA 2KQMA 3MUZ1 5DHVA 1KOAA 4PJAE 4LAQL 1KGYE 2H6UA 4L9LC 3NFNA 3DIFB 5I5MA 1PJ9A 5ABZA 2AQTA 5DJCA 2XJKA 5I1KH 4PU2A 2C9RA 1AQDA 5F7DA 1VKXB 1ZHKB 3E6HB 3C75A 4P5TD 2VZ3A 4DH2A 5E6IC 4HAKA 5AG8A 5IMLA 5IB1B 5AB2A 2H5UA 5E4IA 3GMNB 3WY4A 3AY4A 2WQVA 5I74C 3ESNA 4MB3A 4DP6X 5C0DB 4OGAD 1KWKA 5JUEH 4YXHL 3PWVB 3IVKB 3ZGHA 3UJTH 2AVFA 3UC0L 4C55A 3KLQA 2YD5A 4OGYH 4XODA 1FFNB 3KR3H 4G5ZL 5D7LD 1SDAB 2CO1A 5B21A 1FVDA 3VTMA 3KLHD 3CHXA 1EHLH 4WUUE 2VDQH 4LPVA 1B2WH 1EBPA 1LNUA 3TO4C 3ZLQC 3PQYD 2QGDA 4F58L 3RRQA 5KVDE 2NT0A 3FQ1A 5LO7A 3CCHA 4I5BA 1FN4B 3D69B 3OKKB 2IDQA 2H26B 4MNGE 4NYLA 2B9BA 1EEQA 3BKJH 3V6ZA 3F5WB 3M88A 5JOPE 5E8OA 1AIZA 1P1ZA 3D0VA 4TTGA 1AZZC 5EBWB 3MTRA 1BQUA 3TA4D 1MCJA 4G5AA 1XZ0B 4IYKA 4X6EB 4OCXH 1RHHA 1DDHA 1WZAA 3HZKA 5AVSB 2YSTA 4XB3A 1U6AH 3OKYA 2A6JA 4JVWA 1FA4A 1SVZA 1QHOA 1ZEAH 5C08E 4MZ2A 3PQYA 5A16A 3SDCC 1YRKA 3MNDA 4NN5C 5GISH 3V6OA 4OFKA 1A9BA 3HC0B 1EAPA 4DP0X 4MJHA 3ZGIA 5I26A 4J2QA 3QZBA 2B1HH 3FQXA 4FGMA 3WNMA 4XNZB 5IIEB 4OV5B 4NQCB 1ZS8A 1U2YA 1N64H 2X0WA 4J1UA 5JHLA 2D31B 3OKOA 3NT0A 1HOCA 3QUMB 4YIQA 1ZTXL 2O5NA 3WI9A 4RZCB 4P5KA 1DLFL 2HH0H 2VO5A 2JCCF 4EVNB 5A2CA 2AEIT 1D5ZA 3LH2H 4UT6H 2FWLB 1EFQA 2WNWA 3H9HA 3ZE1E 3RGVA 1W72H 5E2TH 1OHZA 3DMMA 3U9UB 2V3EA 3WXWH 4ABWA 5ERWB 1A2YB 3GM0A 2WAHA 3LKOA 1NBYB 1Q1JH 4PRPE 2ZONA 4CDHA 3L3IA 5ITBH 5EO9B 1FFPA 3I6SA 1RQ5A 1KV3A 1IIIA 1MCWW 1JIBA 4TUKH 4GAYB 3MCKA 3QWOA 3WO4B 5L9DH 2EDLA 1JF6A 1EDHA 4DJMA 5JIPA 5T1KA 5IB1A 4UT7L 4XO4A 3KPRE 3MNWA 1A1OB 4PAZA 1BQLH 2L8AA 3JTSB 1FBIL 3T3MB 3UPAA 4PFEA 2IPUK 1N59B 5DRNB 1NINA 1U8KB 5F1SA 5JIQA 5DHVH 1TQBC 2AQRA 1WS7A 3NJHA 5DJDB 4UT9H 3V5DB 6PAZA 1CICD 1JNJA 4FRWA 2B4CC 2XWBA 4K9EH 4QY8A 3VQMA 3MLRH 3QA3B 25C8L 1U33A 2VDML 3VFVB 2OQJA 2GCYB 3AREB 3NAAL 2IDUA 3VSTA 4F20A 2R7EB 1TYRA 4OLXL 4RFNB 5D71L 2VN7A 5E8OB 1EBAA 3MRMA 4IBQA 1KTDB 4FFTA 4WGVB 2FX9L 3B9KA 5C3LD 1BAWA 3TCLB 5IHBA 1S4IA 4OTXH 1RXLA 4X6DE 3RIFK 2WYHA 4ATWA 1AANA 1WO2A 1YHPA 1FG2A 4B5EA 2J1WA 4F2MB 2Q20A 4F27A 4TLKA 3LIZH 1UWFA 4GLRH 3T0EC 2UXFA 4HZ1A 1OCWL 5C3IA 4NENA 1VHPA 1YECH 4HJIA 4NQVA 4OVUA 4KDTA 5IGXL 4LSTL 2DQCH 4CKQA 3A47A 4MCMA 3SQOH 3QZNA 5CP7A 2V9QA 1O0VA 4Q89A 3C6SB 4M61B 3SYOA 4RMRA 5ANMB 3TBBA 4A7GA 1V8HA 1AR2A 4KXZI 1GGIL 5DFAA 3A23A 4PG2A 4TSAH 1L7IH 4XNAA 4Z7OB 2W5PA 1F4AA 5FCUL 4KGJA 1KJ2H 4JB9L 5B3JF 1NM9A 4ORGA 4YHKL 3OLGA 2Z93B 4PP2B 4WJ5A 1EFXB 2LW3A 5DZ9A 3FQNA 3PPEA 3QNZA 2JKJA 2DTSA 2PW1A 3WL9A 4AIZB 2OI9C 5HYEA 3LNGA 2CLVA 4QRTA 4YC2B 3ZO9A 5JNYB 4K9JA 3WNKA 2WJ5A 3CMGA 4M8QA 3MA7A 2K0RA 2XXCB 1P6FA 3QIWB 1C7SA 2IPUG 3RWCA 4UV4L 1XR8B 2H0PA 3ME0A 2YMXL 2ZUVA 3GSWA 4G8FA 3WNNA 2EEXA 1A65A 4OGYL 4APQB 3QUXA 2CA4A 3PHQA 3UROR 2DV6A 4HS3A 1WBZB 2EDNA 1YY8A 2IDFA 3QIUD 3T0XA 5INDB 5F0JB 4DZBA 4F2ME 4Y4HB 2ZNXA 3MLPA 4HGKC 1BVNP 1HJBC 4CA4A 3RAJL 3VJ6B 2OP4L 4P48A 4R97C 3TTSA 3CFTA 1VAHA 1SBSH 3UTSD 2IGTA 4KH9A 3O0LA 1CICC 2WAQA 3ZDXF 1UD8A 3ZIMA 4Y89A 1PU0A 1X44A 3IWUA 3U0TB 1CGSL 4M5SA 1VADA 1IC4H 1PJWA 4HFWB 5AVWB 3BUIA 3FYEB 2ZNWA 5I15H 1S5HA 4K55A 4KROD 4DAGH 4R9HA 5E6RB 2Y1VA 4KHTL 3T8MA 1UD3A 5IV2A 3GSXB 3Q0HA 4BFRA 1YEIH 1O5PA 1HE8A 4DEPC 3GMQA 1AS8A 3K91A 4M43H 5DJXB 2AJXL 4K3EL 2R4SH 3P9LB 2BY3A 3BPOB 3C6EA 1NCOA 4MZRA 4AH2B 2QDWA 4CGUB 2CBMA 2ZKHL 2IOOA 5CBAA 1EIBA 4J3VA 2NZ9D 3IJSA 1FYTE 3WAJA 1PD1A 2V2TB 1J0ZA 3FQWA 5TDOA 4OJYA 1PTZA 2DTML 5LXVA 4FXKA 3NIGE 4GS7C 4Y4FD 1NKOA 1LXMA 3V0WL 2NTSP 4QHNA 3LPFA 3EJQA 2ID5A 4NZRH 4ZPTA 1SBSL 1TLMA 3QUXC 4OQTL 1U93B 4WLCA 2C9PA 2HT2C 1O75A 3MRHB 1PAMA 1JN6B 2R9HD 4MD4B 5J13C 5D2NC 1PBYA 3BESR 4J3SA 1NC2B 4LCVA 4OUUB 2NSMA 4HSQA 3IFOA 4RGMB 1HJCA 4QRTB 5JNYA 3T0BA 2X12A 4P4KB 1PGRB 3HAEB 3KPQB 5F96H 5IB5A 2WINA 1E8ZA 4G43A 1Z3RA 4AEHL 5IBTH 5I6OA 3Q8BA 3HMXA 3K8MA 4FJ6A 4PJ5B 1QSEB 3LIUA 5D1QD 3V6ZB 4UNUA 1JPSH 2HKFL 4PD4K 4AOFA 1IM9D 4GKNA 4GG6A 5E2WL 4R26L 1IQDB 1UACH 1NMAL 4KWUA 3QEQA 1SQ2N 4NNYA 4WJG3 1NPUA 5IJVA 3ERXA 5ALCL 4QEGA 1GC1L 4ZMNA 3TH2T 4TNGA 1Z9MA 5LAPA 4TYUA 3FQRB 3MRFA 5AEAA 3AITA 1IZKA 3MV01 2DJUA 1MQKL 2DLFL 2D73A 4CBPA 3V6FB 5DK0B 4A6YL 4B3EA 1FYTB 3S7GA 3ABGA 4KKBD 1NANH 1N9PA 2WQWA 3DJRA 3ROLA 2BSRA 1TT6A 1OGAD 2EEAA 2AQPA 2YPKA 5F0MB 3MBED 4P23A 1QLEH 1D7DA 3TN0D 1P4BH 4FZ8L 4NP9A 3KLLA 5FCSH 4JFWA 3IPBA 4DQAA 4ANWA 3HB3C 1FO0L 2YMOA 4QGYA 4EO5A 1U4FA 1IBDA 2DN7A 3W11D 4QRSB 3ECUA 2FE0A 4E0RA 5B7FA 2DIJA 2FYVA 2X4RA 1JHTA 2WLZA 3KHOA 2CKBA 5D1QB 5F7WC 5HHOA 5EUKB 1ZV9A 1BM3L 3CHQA 1T0NA 3RJOA 3QJOA 1C7TA 3IJSB 1G9NL 4AK1A 3H1ZA 5E08L 2E9GA 1YMHB 3OR7B 1RK0B 5SWZE 3OXSA 1B4JL 4KNTA 5I30H 2G5BA 4XCYB 1Y18B 2OL3B 3U46B 3W9EB 2YHGA 2DWXA 1JGUL 4KRLB 1TZHB 5AW6B 4FDWA 4PRIE 4UM9A 5AOMA 2IV8A 2WBKA 3GJFH 3X1NA 3DURA 1QFUH 4QWWC 3D39A 3RWJB 3TIDB 2XWBB 2D4DA 3C9NB 2E86A 2GABA 4KI5E 4XHJD 4JPSA 1AHMA 1D6EA 1T5WB 4BA0A 1PZ3A 3HZVA 3SCMD 2IAND 4N2DA 4EI5B 4WO4C 5CD3A 5KTEH 1DVUA 5KYUB 5H37H 1P69B