1EXHA

Solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
ASSGPAGCQVLWGVNQWNTGFTANVTVKNTSSAPVDGWTLTFSFPSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGGTAQFGFNGSHTGTNAAPTAFSLNGTPCTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,4-BETA-D-GLYCANASE
publication title Solution structure of a cellulose-binding domain from Cellulomonas fimi by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Cellulose degradation
total genus 12
structure length 110
sequence length 110
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1exhA00
1C7SA 2CWRA 1XBDA 1EXHA 1E5CA 1QBAA 1HEHC 2XBDA 1HEJC 3NDYE 2RTTA 5DHEA 2CZNA 1EXGA 5DHDA 1QBBA 3NDZE 1C7TA 1E5BA
chains in the Genus database with same CATH superfamily
1UFGA 3TIEB 2NY6B 3EOAB 1D5BB 3WS6A 5J9PA 3GRBA 1JXDA 4AQ8A 2R7EA 1YN7A 2DPKA 5DMGD 3O6LL 3NK3A 3EJSA 4ZODA 1CE6A 2GTWB 4U4BA 3MBXL 4GYBA 1CBVL 1A7BA 1PJWA 3NABH 1IGJB 4CBZA 4QHPA 1T6BX 3AREB 1R3LA 2H6PB 2D7TL 4FTVE 4NQCD 4HX1B 1P5VB 1TVHA 2EO9A 2WD0A 3NPSC 2EEAA 4N25A 4M7KH 2X7LA 2XZCH 2EDJA 5F44A 2XNAA 4OZFG 3H9HB 1G7JB 4A2FA 2IXQB 2YQ2A 1T0NB 1TCRA 4EVNA 4PV8B 2HFTA 2WJ7A 3FF8A 4UT6L 5IB4B 4I89A 3G5YB 4ODXB 1JRHL 4J3OC 4DP5X 5F7EH 1HJBC 2I5YL 3LZFH 1CB4A 15C8H 1I82A 4RDQF 3U1SH 4AK1A 5I30H 4YBLC 4MKTA 3NIGB 3DOSB 1XR8B 5D7KD 5D7EA 4RMTA 4G6JL 4IOIA 3Q2CA 3DRTA 5FGSA 3HCVA 5CEZD 3S37X 2I27N 2C7FA 4BA0A 1IFRA 5KVFH 3OKEB 3SGKC 4MJIE 3GMNB 2OL3H 3Q8BA 4BGLA 4D9QD 4MWFB 3VFMB 2HT2D 5HJ3A 1QSFD 3SODB 3ZOAA 5E2VL 3TO2A 5ECJE 3EYUL 2JIXA 3F00A 3MU3A 4L3ED 1YVLA 1JZGA 1PZSA 2EC8A 3MXWL 3FCGA 4LLVB 4GKSA 2P5ED 4HAFA 3GO1H 4I2XB 4IOSD 4X99B 1WPCA 1FE8H 5I1IL 1P9MC 3C6LA 1KFGA 4J12A 4R3SB 2EXSA 4FXGA 1RK0B 1ZLWK 2WGXA 4RMBA 1DUYB 3UBXA 4NQCE 5AEAA 5C09B 1UKQA 5JR1H 1KB9K 1WS7A 2EXWD 3BKJH 1M3IA 3OF6D 1WAPA 2EDHA 3QIUA 3U2SB 3EO0B 4QGTA 2CWRA 4NLAA 3RUGF 1QUPA 2Y7MA 1D7BA 5IVXF 4U4IA 1TSHA 4LSPL 1BLNA 4Z3JA 3QNZB 4O58H 3MRRB 4Q6IC 3HZKA 4YDVB 1C5CH 3KBEA 3CDGB 1G9ML 3L3GA 1FNFA 2CO7B 1BP3B 1EMTH 4XMTA 4I5BA 4JPKL 4I3SL 2JK5A 4FFZH 4WO4C 4FFYH 2KHAA 1U8KA 5GSRB 1YEEL 3U0TA 3RWJA 3W5MA 1DN0B 4X8JA 3MUHL 3ZKNC 1DDHA 4UYQA 3UBFA 2FR4B 3VMOA 4TV3A 1QSEA 1YAZA 1P4UA 3DECA 1EV2E 3BUDA 5JLZA 3DX3A 4D9QE 2H0FA 3IMVA 4H1LH 4YHZL 1QSFE 4NQXA 5EU6A 1CQYA 2Z31D 3C2AH 4G7QB 4N0UE 4JFYA 4Y4KA 2IF7A 4IDJL 3OMZA 3W2DL 3E8UH 1ANUA 4R4NC 2ODIA 3MODH 2IFFL 2P5EE 5IWLA 1XIWB 3E9UA 4JVUA 4OF8A 3B9KD 5ITBL 5F0PB 3D07A 3HPLB 4M43H 1LEIB 3ULSB 5K9KB 5CBEA 1T66C 4G7YH 3WKMH 4YX2H 3R4DA 2KZ1B 4AG4L 3RKDD 3ISRA 1U0QA 1Z5LA 5F1IB 1JGLH 1T2QL 3B56A 3MLRH 4ZFQA 3UTTB 2QMJA 1E6JH 1EAJA 1P6AB 2AF2A 2Y2WA 3GHBH 3D2UD 2H3KA 3KVPA 3CN1A 5DRZB 3DX6A 3NFSH 1MIEH 2Q8BL 2XX1A 2B2XL 3NAAL 1DP0A 1XH3B 2BCKA 4DVRL 4JG1H 2VLJB 3EGXA 5BNXD 4JO3L 4MCZB 2BHYA 3MYJB 4TQPA 1JPGB 3II3A 5AW7B 1WZ1H 3GXFA 2CGZA 3K4AA 1I9RL 2X2JA 1KGJA 2Y36L 4XC1H 5TE4H 3BUBA 5KVEL 4ONFH 2IBGA 1QYGL 4ZJ9A 3IB4A 3EFOA 4GIOA 1BXUA 3GFUA 1NDTA 1ZIBA 4YL4A 3HS0C 1HX0A 3K2IA 1F58H 3W56A 2CR6A 1KJMB 4JPWH 4JS7A 2AQSA 4KRNA 4NEHB 3TONA 1FRGH 4Y16A 3KL3A 4GSRA 4AW4A 5FO2A 4A04A 1QABA 1T5XB 1FGVH 4FG4A 4M29A 1SYVB 2P43B 4GXUN 4J23A 3VFVB 4KDTC 5DC9B 4AENB 4L29B 5EF0A 1PG7W 3W11C 4WNQB 1AXTH 2GTQA 4PTUA 1C8PA 4GBXD 5SX4H 3UBXG 4YN3A 3JQOB 1INDH 4RMWA 5J7CC 1BYNA 4DPBX 4PJDF 3RVVC 2RAMA 2DWDB 3JT0A 5D1QD 4R2GC 5BMFH 3AZUA 3QH3A 1C5DA 1CK0L 5KSBB 1DVTA 4HBCL 2DWYA 3H9YA 5I15L 3GI9H 3MN8A 2HN7A 1J5OH 1FUNA 1DVXA 1W8NA 3KM1A 3NJVA 2H0PA 4NQEB 5HVHC 4EZLA 3UZVB 5I0DA 3VXOB 1V3KA 4FKHA 2YC1B 4KXCA 1H3VA 4P3DA 4AQ1B 2P5WA 2ICWB 4V1DE 3QQ3A 3AUWB 1I31A 5HGDA 5LCVL 4JGJA 2ISDA 1JWSA 4JFEA 3ROLB 3VSQA 1JPSL 4AYBA 3AG4B 1UENA 5J56B 4F2EA 3WTTA 1WT5A 2HX7A 3LRLA 1Y7VA 4PJ5B 3UX9B 3VG9C 4RQQB 1OAXH 4ERSH 5BZWB 2D3NA 5JOPE 3COOA 3I6LD 1XDTT 1NDGA 3TZVC 1TJXA 2F5AL 3KYOB 4M61A 4LCCA 4GIPD 3INOA 4O2FB 1E0OB 4R7VA 4F37K 3Q2NA 1LL1A 2PW1A 2F61A 3L08A 5AVVB 1UWXH 2YPVL 3CHOA 1XF5A 1XL4A 2JVUA 2ADIA 4IHOB 3ZE1B 1HE7A 4JHAL 1F42A 1FDLH 1G7LB 1P7BA 4Y0GA 4A2GA 5LDUA 1MFDL 1WFUA 3SY0A 1NPNA 2CLRA 1L9QA 5J0BA 5DLML 4DIXA 3EXLA 3K3QA 2AKRA 4NO2B 2XZQL 4PREB 2HRPL 1TU2A 4PBVC 2FBJH 4NJAL 1C7TA 5HYEA 1MI5B 1N26A 1NFDB 1IQDA 1YDPB 1OIOA 3ZKQD 2WWMC 4P3CL 4H26B 3CVHH 4ODTH 3VCLA 3VDAA 2R39A 1K2DB 3LS5H 2EIKB 2ICWJ 1A47A 5C9JB 5IM7A 3MLVH 2KERA 1KBBA 2WLMA 1SN0A 5C71A 4M48H 2UWEA 2VRKA 1IVLA 1C12B 3REWA 4E41E 1SOKA 4NM8L 1UXSA 4TSAL 5E8EA 4LKXB 4LCUB 4B9IA 5CMAB 5JIDA 3G6JB 2R1XA 4R5VA 1E3XA 3UAJD 1ONQA 4JFQB 2P7TA 3HBGA 3OJVC 2WIMA 5CJQH 5AD0B 2DTSA 3KJ4B 3DV4A 3T3ME 4ZAKB 1BMZA 4XMPH 3DX9A 4S1DD 3ML8A 5I74C 1TZGH 3GWJA 1RI8A 1S2EA 4ZXBD 3KPSA 4ETQB 2APVA 2OTWA 4JKLA 5PAZA 5IIEB 5D70H 4KHXL 3T3MF 1GXEA 3IJ8A 2XN9D 4WU5A 4WV1A 3FZUD 2YPLA 4PRIA 1HSBB 1A7QL 2FD6H 2X1OA 4Y1AB 4N1CA 1JG9A 1NGZB 5E8DH 1SJHB 3EH5B 4HKJB 4WK4B 3GMOA 2IPKB 3DMMC 1NKOA 1RHHA 4OZIE 2CCWA 4NX0A 2ZF8A 3IMBA 3RX5A 2J56A 5HHOB 4BJLA 5ILTL 2C4FU 3FT9A 3U30C 2OQJB 5EUOA 5I6OA 4K3HA 5F72S 2XI9A 2CGRL 5EC2B 4BQ9A 2P9RA 5D4IA 1CDCA 1DVFC 1JXJA 2DI8A 1M1SA 4HOMA 1T04A 2EDWA 5AVXB 3GK8L 1L9MA 5IKCA 2MHAA 1TZIB 2YR3A 5HPMA 5D71L 3QDGA 4DZ8B 4LU5L 3KJ6L 4YSOA 1KCKA 4PGCA 1TTGA 1HI6B 1UOVA 2E7MA 1KN4L 3V5DA 1FFRA 4KHTL 4K3DL 4PW3A 4XVUC 2G2PA 1KC5H 1J10A 4HJ0D 2WM0A 3ZDWA 4D0CB 1B90A 1CE1H 2ZXBA 2IPTH 3T0XA 4RZCB 5DZVA 4E2OA 2FJGB 3IJYA 3FUKA 2VE6B 3QIWA 4P23D 2QGEA 3Q8EA 3S5LA 1I7UA 2CDFB 5EBLA 5GGQH 1SJEB 1P7HL 1A14L 1X6NA 3WFHB 3GKWH 1O9ZA 3SDDC 4UINL 4X50A 1A3QA 1EGJL 4A2MA 2P4AB 1FJ1B 4YR6B 4PJ9A 6FABL 5B38B 1FC2D 3QUZD 1RZ8A 4YHMH 4ABVA 2FSEA 1LO0L 2DEXX 1DJYA 5I19H 3T9WA 3MA7B 5IVOA 2E7BA 3WSQL 2V3EA 3MV9A 5JHDA 4FNPA 4EOWL 3REVB 2LFGA 4HETA 2B3RA 1T7VA 2Z35B 1HHJB 3ILQC 4DEPC 4KFMA 4I0PB 3GXNA 3PQYD 4NRZA 3F62A 4I48B 1MW2A 5EC1A 3VFOA 4KZEH 5I0WA 4Y5VC 3W9EA 3KDMB 4JGUA 5IMMA 4CRPA 1N59B 4PR5B 5IROC 1CD1B 4FEMA 2QVIA 2LLLA 4FMVA 5IT2L 3QZOA 3GEFA 2OR7A 2NLJA 4G83A 4Y8DC 2JXMA 3PWVB 5JQIB 2CGYA 2X44D 3PP3K 4S1SH 1H5BC 1XF4A 3BO8B 2WTOA 4JQVA 5I75C 4ANKA 3QT2A 3MRQA 4J8QA 4L4VB 1VFAB 5B4MD 1N10A 1MEXL 1UA3A 4KMTL 3LQAL 4ATWA 5ID1B 3S88H 4JLRA 3SBWC 4APXA 5J9PB 4X6BA 2FHBA 3KGUA 4M8RA 4EUPA 5JPNA 1DR9A 4AE1A 3DVIA 5F1OB 1CE6B 2WQSA 2V9RA 1K5NA 5KANG 3QHFH 1A7PH 2XA3A 1WZLA 4LRNL 3BPCB 5HDRA 3KWWA 1TR7A 1HFUA 1R3LB 1U30A 4B7LA 4MBRA 5F2FA 3VD9A 4E9SA 5JTWA 3ZTJH 1TQVA 3GNML 2AZAA 4XX1G 1CU4H 4OKVA 1BQLL 5K1VA 2BHZA 2E9BA 5I1CH 4BK4A 4KXAA 4XNUH 2X7LB 2JB6A 2XNAB 5E9DA 3BZ5A 4BFRA 4EBQL 2VUOA 3HS9A 3UMNA 4P2YA 3MKKA 1TCRB 3X3FH 3TJPA 1CDHA 4QHNA 3U7WH 5FCUH 3TA3C 3IFNL 3WHE0 1QFWH 1SDAB 1UA6L 3US9A 5FYKD 4KY1H 4GKLA 3WMPA 1RUKH 1OE1A 1OGSA 2X89D 1HL8A 1OGTB 1UM5H 3DRTB 2BP0A 3HCVB 1LP9F 1MNUL 1SDDA 5F3HB 2B08A 4J6RH 1ACYH 4OLYL 4X0NA 4DO6A 3ZHDA 2B77A 3O45B 1X7QA 2JI1A 3HFML 5D1ZA 5HJ3B 3S5LG 5C0RL 4KKBC 3TO2B 4J3OD 1XEDA 4JR9L 2C3VA 2JIXB 4W68A 3L5WA 4RWYL 5CM1A 1ZANL 5EEWA 1MHPL 2BWQA 4K7PL 3P4MA 2IQAA 3M17B 1P2CA 3KLSA 3L4ZA 4OH2A 4JY4A 1KIUB 1CLZL 2K1MA 4ZMXA 1PX3A 4DGVH 5CJXA 1AYOA 4NT6A 5I76A 3E6HB 2F7QA 3L2NA 3T6XA 4QRSA 7TAAA 5FKAA 4FXGB 3AADB 4PGJA 5L9DH 1YJDH 4PUBH 3UBXB 1C5BH 5EPMA 1G7PB 1N19A 1E4XI 4AGPA 3U0PB 2EUVA 4XBGA 4ZS7H 1I3GL 4TM9A 5T1DL 1F4YL 4HS6A 1LO3H 2WZAA 5ECGA 4ODBD 3KWVA 5ICZB 1BLNB 4KKRA 5E8OB 1SLXA 3MOBL 1EERB 2PP9A 5TFSH 3HZKB 5IEHA 5GRUL 4C59B 3CQFA 4E42B 1ERNA 2FIRT 2J8UA 1D5XA 2XN0A 3L3GB 3NRPA 3SKUD 4I5BB 1ZAGA 5C0ND 4DEWA 5G4MA 1U8KB 4M3KB 2JTYA 4ZT1A 1JHLH 3TN0A 1OT1A 2QBWA 4X8JB 5DK3A 1DBJH 3MRNA 4K3EL 4ZPTA 1QSEB 3UJIL 2O5XL 2WTRA 3NTCL 4G59C 3X3GH 5JLZB 4QYAA 3DIFA 2BNRE 2ZOUA 3MSPA 4NQXB 3KBFA 4MHHI 5D7LD 2A3TA 3L5IA 1EJ8A 3NEOA 4JFYB 4Y4KB 4N8PA 4OJAA 1BM7A 4P06A 1YUHA 3MV8E 4MDIB 4C57C 4JPSA 3BWZA 4J3OF 4AZ8B 2V37A 2OCCB 4PS3A 3L17A 3T6VA 4C56D 5LN8A 4EUPG 4IK7A 1EJ6A 1P4IL 3TNNA 1PNDA 3ZKND 4IJ3C 3G5VA 4KH2A 4TUKH 5SWZA 1JFQH 1JAEA 4ZRGA 1K72A 2F54B 3A47A 2I9LA 4XMVA 4BSJA 4WVRA 2Q86A 3WY2A 3ULUH 4WI0A 3RIFK 1R0AH 3DX6B 3VMPA 4ZTOL 1XCQB 4OLZH 2MTPA 4JM0A 5BO1H 2H0JA 1T3FA 4P5RA 4R4ND 3ZTEA 3WU1A 3DSFL 2BCKB 2GHWB 4FERA 4JQIL 4AUYA 2DF3A 1SPDA 4HMDA 1A8JH 2NY3B 3DUUA 1F3DJ 2XZAH 2ZOKB 2ZUQC 3EGXB 3QJTB 3WNKA 3WTWA 3V2AR 2XWBA 1MSPA 5ALCL 1T66D 3HNTL 2HRHA 1XGYL 4U7SA 2Z1PA 2WCGA 3R0NA 5BW7A 1OCOB 3OAWA 4PD4K 4YH6A 5JA8B 2E59A 4S2SA 2MEJB 1G6RL 4IKJA 2RHEA 1PEWA 1XSOA 3EFOB 1IC7L 3C5ZA 4TVPL 1B6DA 2HKHH 1OAQH 1GCYA 4FYTA 3MJ9H 1SVBA 3LH2L 2QTVA 1KXTA 2QKIB 4FLQA 4OFDA 4U1JA 2XKNA 3KXFE 5J6GA 2ESVD 4XHJC 1IC4L 1KTBA 5J1AA 2Z93A 4ZOBA 4Y16B 1JF5A 2OV0A 3TT3L 4C56E 5CXPA 2W9DH 2WY3B 4J3BA 4IHBA 1E28A 3FB7A 3P54A 4G1MA 3GSUB 3HZVA 3U4EA 1UM6H 2ZPKL 3K72A 1OPOA 2IOOA 2QGBA 3B7TA 1PCSA 3FU6A 1DLFH 3N91A 4H0HB 4PTUB 3SPIA 3ZYIA 4TQEH 4ZNEE 4JDZA 4KNSA 2D7MA 2V9QA 3EZJB 2NT0A 3MI6A 2AI0L 3EBIA 4QHMB 2HN7B 3ARWA 5FC9A 2XVGA 3SBPA 4ZFFA 2HFFA 4LFHD 1F4AA 4JFDA 4TL5A 1F4WL 5D8JH 2EEFA 3VXPA 1MXDA 1VKXA 1KTLB 3W11D 3AROA 4TSBH 1LHZA 2V7NA 1CFNA 2FL5A 2X4OA 3EW3B 4KH9A 4UT9H 3NFPA 4IJTA 4XP1H 1EAQA 3BAWA 2B15A 4NQDD 5HGDB 2MSPA 5TDNA 2MPAL 5CZRA 3RVVD 1JWSB 5LAXA 1N68A 2EICA 1A7NH 2QDWA 4AJVA 4QPEA 4RA3A 3BPNB 4TQHA 1ZRUA 4M5SA 4IQHA 3QORC 2UZIH 4WHYH 2VM3A 4Y2NA 4YQXH 2JCWA 3GSVA 2EXYC 2EH7H 2W8CA 3BZFB 4FEIA 2Y25A 4EZKA 5EEUA 5CILH 4AQOA 1NDGB 2CXKA 5KYUB 2CHZA 2NXYD 1GC1L 2R59A 3J2PA 3GSOA 4CC0A 3ABKB 4M61B 2WMPA 3GSNH 2LLNA 4NJ9L 5I73B 1PX8A 2PW1B 4KK8C 4U05A 4HVBA 1JZEA 1AO7A 1E2VA 1FQ9C 1JPEA 3MBEC 4U6YA 1M9WA 3WFBH 5GXBB 4JM4H 3QPXL 4JFEE 1BAFH 1H3PL 2ADIB 3NEXA 3C09C 1BHGA 1JJUA 3QZBA 3RJOA 4N6QA 2XZCL 4F7EB 4KJYA 5IJVA 1G5GA 2FQDA 4CA4A 3SY0B 2QL1A 4HOXA 3QO1A 2DQHL 1IGIH 3TZVD 1E7VA 1IM3A 3QDMD 3HMWL 4L2YA 2KBGA 1YMHA 4GKOA 4UIMB 4MCMA 3MFGB 3U1QA 1PZ5B 5C6PB 4CN6A 1MW0A 3B1TA 2Q6WA 4L5FH 4X9FA 3TO4A 2YZ1A 3OKNA 2EAEA 2G9HB 4G7SB 3GSQB 5F6IB 5CSBA 3VJ6B 2HJLA 2OMUA 2KH2B 3BUTA 4JB9H 1RK7A 1T4WA 1KCVL 1SQ2N 3HZ3A 3S4SA 4XI5D 2X28A 1R19A 4OT1L 1UXSB 5KBMA 1F6AA 2UY7B 4H8VA 2KQMA 1PVHA 5E8EB 4GXUM 2HFGH 2R1XB 2WWMD 5GS1A 4JHVA 4BSWA 1ONQB 2P7TB 4W1TA 2JJWA 2VLRD 3T0WA 1OHZA 1LE5A 1PY9A 3F7RA 1U3NA 4PIBA 4YZFE 1URZA 1R1CA 1OP3H 4JJ5A 3TEZA 4R97B 2OTWB 3LVEA 4WEUD 1U36A 1OP4A 3BKJL 4FA6A 4UQEA 2UWEE 1U8IA 1FIGL 4Z5RA 2YPLB 2DN7A 4PRIB 4WK0B 1HL4A 1TTAA 1IGFH 1S8DA 1TJGL 4N8UA 5F9JB 4BD4A 4DERA 5ICXA 5K93A 1MHHB 3TIDB 4AIZB 1W0VA 1S9WA 4L4JA 2B0SH 4IBLT 1RHHB 1ETA1 1C5CL 1JYVA 4PLJC 4KO5A 4ANWA 3GSRA 4XCEA 4AYID 1EMTL 2QVFB 2VMJA 5AAWC 3V9CA 2FH6A 4LNVA 2VSCA 4X6EB 5EUOB 4IOSA 3GGWA 4ZSOA 5T3XD 3MCKA 3WGVB 4AIXA 4ZUVA 2HLFC 1FL3A 2DICA 1D3CA 1BX2A 1JVKA 2QFRA 4NZJA 1II4E 1QPXA 2DH2A 4XH2B 5E6YA 1T04B 1BD2B 1EZVX 3S7GA 3FF7A 2DQTH 2ALAA 4NC2B 5IKCB 1NGYA 3DPDA 3OAYK 3DMMD 1ZA3A 3PGDA 3QDGB 3OF6A 3VFSA 5G4OA 1Z5YD 4R96A 3VXQA 3V6OC 1SRDA 1R3IH 2X9WA 3JV4A 1ILSA 2QSQA 2YMOA 2D7OA 4B3EA 4PGCB 2A0LC 3OQRA 2IG2H 2V3DA 3V5DB 5FXCH 2X4NA 4J3WA 4F3FA 1DVFD 3QUYB 3C60C 3ZKXC 5DGQA 3WEMA 5E4AA 1GTFA 3ULVC 5MEPA 1JGLL 5FDWA 3MLRL 4AEFA 1GHFH 3NFSL 4I87A 3RWDB 2VOTA 4KJPD 4EQ3A 2WYZA 3ETBJ 3IJYB 3NDYE 4HISA 2EZ0C 3RWHA 1YMMD 3BVUA 1PLGL 1WHPA 1IRAY 3QIWB 4GRLC 3SE9H 4ESKA 5SV3A 2NTFB 5EBLB 4YHLL 4N20A 3N55A 3BZEB 1C7SA 4OKDA 3U0WH 2FT6A 1E4WH 3HC0B 4XVUD 3F6LA 3MGTA 2O61A 1YA5A 3ETTA 2DQIH 2K8QA 2F7OA 3BPOC 4ONFL 3RNKB 5INDB 4RLDA 2AJVH 3ZYZA 2DYSB 4EI0A 1L0PA 3B9KA 4PJHA 2VR5A 3PL6C 2C9UA 2CH8A 2FSEB 3DBSA 5A2JH 3BAIA 4G6FB 5DEFA 3PAZA 1HINH 1ZLSL 5ISZD 4UM9D 3OX8A 2DQGH 1RCYA 1KTDA 3MNDA 2IWFA 4ODSL 6TAAA 4KKZA 1HYSC 5JHDB 3OD3A 1YNTA 2FAUA 3SYCA 1MJUL 4NRYA 2K70A 5DVPA 1CIUA 3SDDD 3D2UA 3UH8A 4UV7H 2C3WA 3BAKA 4QHUB 4GMSL 2IWKA 4H44C 4NRZB 3S4SG 1FRGL 4ZD3L 4XRCA 1F1DA 4YJZL 3IMRA 1SLUA 1UWGH 4KV5F 4XXCC 3VFOB 3SO5A 2D7QA 4OCNC 1IZJA 4QAMB 1KIRA 2DRUA 2PABA 4U1NB 3K6IA 2XV3A 3SQBA 3W9EB 3HLAA 1AGDA 4OQ1A 4K5OA 1SDYA 1VGEL 5IMMB 4OJFL 1V55B 1CDIA 3I3EA 1DO6A 1TMQA 1NSNH 1OCRB 4AEEA 3S8GB 3BHBA 4HIJA 3K71A 3KLAB 2BLFA 3FQTA 3U4BL 3AXLB 4FG0A 1XMEB 2EVJA 4ACTA 2NZ1A 2NLJB 3FO9A 3H2PA 3ILQD 4Y2DA 4G6MH 4GP8B 1CLYH 5HHMD 5IVZA 3CG8A 4M93C 3FB8A 4F9LC 2J55A 4C54A 1OL0A 3MRQB 4H40A 4JN2A 4OM1L 4E9YA 4J1UB 3B4NA 3NZHL 4I13B 3TBBA 1RJZA 4JLRB 4APXB 4FHBD 1KBGL 1MAJA 5IROD 1NKRA 2ZG2A 4M5TA 5FDYA 4OFPA 4EUPB 1INEH 4UNUA 1TVBA 4KGJA 4OZHA 1NBQA 1U95A 1M7UA 2WXIA 1DBAH 2DWXA 1EBPA 3KWWB 5C0GA 2WLIA 3SDXE 3QRBA 2DQUH 2H2PC 4PJXF 4QHKJ 4DJMA 5CSGA 2EVFA 4GBXA 3V4PA 1NIFA 1QRKA 4N26A 3G6DL 3HG1A 3AM8A 3SDXF 2JB6B 5E9DB 2PMZA 4X7DC 4RISH 3GIZL 4D7PA 5FS5A 4ES8A 2XDHA 3AS3A 3B2PA 4QHNB 4F2MA 5K9QI 4MB4A 4OQTA 5HI5D 5J6SA 1MWAA 4PCTA 1ZV5A 3QJSB 2ZKXA 1L9TA 3SJVD 3F6JA 4RFNB 5A16A 4U2YA 5C0CB 3ZKSD 4RSYA 1IU1A 1FNEA 2XYBA 1FDLL 4UT7H 4JGNA 3T2QA 1JZ3A 4GP5B 3E38A 3QO0B 1J1OH 5D1XC 4LVHB 3O6MH 2BP0B 3L3OC 1NOLA 5EZJA 3T0VA 1NC2D 5I8KH 1A1MA 4QRTA 2YLHA 1PYWA 5DC4B 1X7QB 3V4VH 5D1ZB 1NTDA 1SGKA 5D5ME 3TA3D 4OF3A 4GY4A 3L5WB 1ROWA 2C3XA 2BNQD 1OLLA 3LS5L 3P4MB 2BZCA 2XPYA 2CR3A 4JY4B 5E70A 3HFFA 5D5MF 4IKIA 4NT6B 5I76B 4FQJH 1HSAB 3M8OL 5AW2B 2BSDA 1BQHA 5CU9A 4M48L 4Z7IA 2JWYA 4W93A 3WENA 5I0YA 3P11H 1CT8A 1KWKA 3EH1A 3RNQA 5EPMB 4N86A 2OR9H 5IOPA 1EPFA 4ZW5A 4KKBD 4XBGB 4N2IA 3NIDE 3PHQA 2OZ4A 4X8XA 4KTYA 4HFUH 4HS6B 2ARJB 1ORQB 1WA1X 1TETL 4Z7NB 1BZDA 1TZGL 3SJVE 5IEHB 3HZMA 1E6OL 4OV5A 6CGTA 1D5XB 5T1LB 2WZ5A 2W91A 1GYVA 4G9FA 1NGXA 1B3IA 2R9HC 4O9HL 2FD6L 4PRAA 1DQJB 4Z7UF 3TN0B 4X98A 4G8EA 5E8DL 1DTUA 2HTKC 1ZS2A 1B0RA 2Z8WC 1KV7A 5J12C 3UC0L 1OD7A 4RGOH 4ZPTB 2YD3A 4JUTA 4OCRL 1JV2A 1XGTA 4JKWA 5LGJA 3H9SD 3DIFB 1LO4L 2UUDK 3KPMB 4FI7A 4OZFH 2Y72A 1DQMH 1FN4B 4YO0B 3UAJA 5GJSL 3P9LB 5EU7C 5DS8A 4WSJA 5I8OH 4CMHC 1I7ZA 1LTXA 3NCXA 2HWZH 3KYNA 1EAOA 5SWZB 3NJIA 3P69A 5CP7B 2CLZA 3UJJL 2G4EA 2VIRB 3WIAA 2I9LB 3ECUA 4LO9A 3ZE0E 2Q86B 2DMGA 3GUTB 2XN9A 1HCVA 1PZ2A 1UGKA 3IF1A 4WI0B 5LGKA 3ALXA 4LAJH 3AB0C 4F7MA 2EADA 1T3FB 4N2CA 3L48A 1KB3A 1QMUA 2PP8A 3SPVA 2P49B 3FSWA 2CBTA 2XWBB 1NEPA 2ALWA 2IJ0C 2QQQA 2XT1B 1TPXB 4JKMA 3FFCD 4KXBA 5LGHH 1X9QA 3A21A 3D87B 1ZLDA 5A2IH 4F91B 4GW5A 1JYXA 5IFHH 3VGGA 5E6IC 4LHUD 4S2SB 5F89A 1UT9A 1WWWX 2FQGA 3O41B 4XN7A 1AAJA 3FT4A 1MJ8H 3C5ZB 1IIKA 1KLFA 3NJJA 5I5JA 1YYMH 2GUOB 4FQHB 4KNQA 1G7IA 1T0PB 1DHKA 2XKNB 3AY4A 3CBRA 4RCAA 5J6GB 4ZQKA 4JFFD 1JZ5A 3KVDD 3QJFA 4QRUA 2HLAA 4NUPA 3MX0B 1QW9A 1T5WA 3P2TA 3THMH 2VXUL 5DMYA 2QTEA 4POUB 4O00A 4U33A 4PHXA 2BDNH 1OTUD 2QADC 4M8QA 2WWKO 3UTPD 5I1DA 2J3SA 1RSFA 3FB7B 4MS8C 2GG1A 3CC5B 4JCMA 1GZQB 4YPGB 3FMGH 4G1MB 4N2OA 3GXDA 3NCYP 4HMCA 43CAA 5EUKA 1JTPA 3NIFB 5TF1H 1BQHG 5IFJA 3LX9A 3K72B 2DIAA 1AD0A 5KVMC 2C1PB 4HKZA 5EV7A 12E8L 5GGTL 5IOKA 4XHJD 3BPLB 4P23A 5IW6A 1T7ZA 3L3IA 3AUVA 1DJWA 2IPUK 2OMXB 4JDZB 5FUCE 2YAPA 4Q7DA 3C6SA 4MQ7A 2WBJA 4PJ7E 4ICWA 3BSZA 3SE8L 4I18A 1TZAA 1TSRA 4ZFFB 2HFFB 4NO5A 3FFCE 4FD0A 4WI2A 4BQCA 5LLIC 1F8TH 1TTBA 4JFDB 4KQ4L 5FYJE 3VXPB 4PJ7F 2PUQT 3QUZA 4QR7A 2V7NB 1CFNB 2AABL 2FL5B 2X4OB 4X5PA 4YLQT 5CD5D 4E68A 3NFPB 1FG9C 2NT1A 5L4IA 2AJXH 2WV3A 5TDNB 1JRHI 3D0LA 5LAXB 4PSRA 5DC0A 1CGUA 1OW0A 5IGXL 2VR3A 2DDQL 1SEBB 1SXAA 1UWFA 2CBQA 2F7IA 4FTVB 5GGUA 4DOHB 4Q9CA 1Y07A 5J5EA 4KTDH 1BMWA 2PTTA 2C3GA 3RI5F 3PQYA 3V4LA 2IDCA 4CVWA 3GSVB 4TLUA 2D7NA 3OTTA 2PNDA 2XA8H 4GRWF 1V27A 1S6NA 3QHFL 2LT9A 3GSOB 3I3DA 3O81A 3VA6A 2WMPB 4HS8H 3FTUA 5T5FH 4HT1L 2WLKA 1NUGA 4I1RA 3ARFD 1U58B 2BSCA 1JDAA 2UY6A 1IAIH 1AO7B 2BP5M 2JQMA 1OHQA 1PKQA 5I1CL 3JWDC 1QZ1A 2D8KA 2DQJH 3K4DA 3SGEH 3HG0A 2E7CA 5L2KD 3A6OA 3CFJA 3QORD 5B1JA 3T6WA 2F5BH 2VSDA 2A6KA 4HZLA 4GS7C 1IKFH 5C0EA 5IZ7A 3I9IA 4K94H 3QO1B 1MFBH 4R5TA 1HXMA 4XPHL 4DN3H 5AENA 1DYZA 4AUJA 2DLFL 1IM3B 3ME0B 3T0ED 4X7SH 2O93L 3CH8A 1QFWL 3VGFA 2R15A 4X8GA 4KK8D 3U7AA 2EIEA 4FF9A 4OCXH 1QEWA 2QJDA 2Y06H 2Q6WB 2XBTA 3MBED 4XE0A 5FA3A 3FFOA 4LPUA 2IDSA 3GBLA 3OKNB 2X12A 4WEBL 3ZQ9A 2ADFH 1RIHH 1F11A 4MJHA 1T1YA 4WENB 4ALAH 3VQ2C 4Z6AT 2RR3A 1HWHB 3QS2A 5I6KA 3BFOA 2OMUB 2VDQH 1MF2L 4WK2B 3H6AA 5C08A 3RUGB 4OY9A 4NQCB 3BGAA 3S4SB 4GAJH 1MRFH 5IVXB 4FHKA 4IW4C 3RB5A 1F2XK 3PWJA 1F6AB 1A3RH 3LRGA 5LG1A 5TD4A 2AJSH 2WNGA 2EDKA 3FQ1A 2C9AA 1I1FA 5GS1B 1R34A 3QXAA 1Y18A 4BSWB 3O4LD 1NCAH 3EGDA 4KROC 1LE5B 1F3DH 1T22A 2A9MH 4Q58C 4MXVF 5DHYA 3VXRE 3ZW3A 5IY5B 4JY6A 4PUBL 5DD1H 1C5BL 3RWGA 1PU0A 1IJNA 4XMXA 4WU7A 2FT8A 1U8IB 4JO2H 3PREA 1L0YA 2X89A 4Z5RB 2QQNL 1NA8A 1BQUA 2MQ0A 2X3AA 5TDPB 2BO0A 1CCZA 1S8DB 5HDLA 2XJLA 1N7ML 3O3UN 4JRLA 5ICXB 1JWUB 4BFIA 4PYHA 1N70A 1AOHA 4M5ZH 4W9IC 4MX7A 4C58B 1W0VB 5TFSL 4TNVF 4EKXA 1QSFB 3GSRB 1C08B 3DTXB 2V33A 4L3EB 5B3SB 5KG9A 1NMBL 1DJHA 4Y7MA 1J18A 1QASA 2P5EB 4AUUA 4ZSOB 1UT2A 1NOFA 2E47A 3MCKB 1ZTMA 4HEPA 2XQYK 5D2NA 4ZUVB 1BX2B 3NYKA 4I0KA 2AANA 3SGKA 1F56A 5CLTA 4Z3FA 3SYAA 1MCSA 2F2HA 3Q5YA 3WN6A 2QPDB 3EFFA 2JJVA 4KI5D 1ZA3B 1NWPA 5ALBH 3VFSB 4PLJD 1IT9L 1JZIA 4R96B 3VXQB 43C9B 3O0RL 4LLUB 4ELKA 3JV4B 3L54A 3O4LE 3PU7A 5IHLB 3NA9H 2E6QA 3MGAA 5DHVA 2X4NB 3H56A 2A6JB 2CMRL 2HLFD 4FZ8L 4KNTA 2Y7SA 1JGVL 3ENEA 4HJIA 2H1PL 5MEPB 4RIRB 5FDWB 3TLRA 2WKLA 1NJ9B 3BH4A 3QEQD 1OCWL 3PP4H 3LRSB 4I8DA 3QZLA 1OANA 3GDCA 4UYPA 3VXNA 1XGPB 1JHTA 5EU3B 2XZAL 4P9MH 2WBXA 2DIBA 4XPFL 3O2DH 1X7TA 4HDIB 5D7LA 4Q6IA 2GHZA 2ZTBA 3HZYA 2Z31B 1X5MA 4XT1C 3C60D 4GXFA 5IQ7H 5JXAL 2O61B 3MGTB 2OMBA 4PRDA 2CJUH 3MLYL 2KMWA 4G6KH 5IB5A 3ROOA 4PP1C 5IHWA 3B9KB 3BC9A 1YPZE 3BP4A 2HUEA 2I24N 3OKKA 1T2XA 2EZ0D 1OAQL 4GRLD 5DS1A 4XMZA 5AYTA 5KJRL 3OX8B 2LQRA 3BYTA 1K8DA 1KTDB 5CUSL 4PJDB 1IBZA 3FNKA 1YPZF 4GT7A 5GS0H 4MNQE 1VDGA 4NRYB 4OJEH 4NI3A 1MJ7L 3D2UB 3O8XA 3DUSA 2FH8A 4W81A 3QHTC 5B39A 4KOCA 2BH0A 5DQDH 3W39A 1HOCB 1TQCC 4XRCB 1QHPA 3V6FA 4C4UA 1PAZA 2A4ZA 2ATPA 1H9VA 1X5AA 2X3BA 2CJTA 3O3AA 1KIRB 3SQBB 2ITEA 3MLPA 3HLAB 1ZT1A 1UM6L 3HMXA 4JQXC 3BHBB 4HIJB 1G0YR 4OIIH 1AR2A 3K71B 3FQTB 1WITA 1DLFL 2QSCH 5BS0A 2NSXA 1GS8A 1PS3A 2XFXB 3AT9A 3FO9B 4TQEL 4BV1A 2AK1L 3RA7H 3DI3B 4JBSA 5IVZB 3L8QA 5E5LA 3ZQWA 3MHZA 4FZEH 1UH4A 1DJSA 4MA8L 4Z1PA 1ID2A 2X4SA 3AU1A 4RGNE 2ESVA 3ZZSA 3LZQA 1RJZB 2EDNA 3ULVE 2MCAA 1QI4A 1QATA 2XUWA 1U3HC 3GI8L 1A6VL 1KPUB 1U95B 2IDFA 1JK9A 2EABA 2GJPA 3ULVF 2Q7AA 2QR0B 3FAWA 3TEUA 3KHQA 5C0GB 4ZMWA 2WLIB 4HEPG 5B1KA 1U9KA 3ET9F 2DY2A 4GKZA 3HS0A 3H4HA 4Q4EA 2AEIT 1N12A 1PIGA 2MCPH 3V0DA 5TQ2L 2VO8A 4GBXB 3V4PB 2EH7L 2LTQC 1WCBB 2WSDA 3DTUB 3ALPA 5D1QB 4ZK8A 5DK0A 1JZ6A 3UPRA 5TJWK 3GSNL 2EH8H 4D7BA 2Q10A 3BWAB 4QXTA 1KULA 5DUPL 4POZC 3IAGC 2G2NA 4N2MA 1RJLA 4F2MB 1QA9A 1ZVNA 1BFVL 3WFBL 2WNXA 4JM4L 3V0JA 1E4KC 4WUKL 1FNEB 2N7AA 2JKNA 1HAWA 2VITA 2H2PD 2AJYH 3ILPB 5B22A 1WEJL 3MZTA 4HSAC 4K3GA 2NW3A 5HTSA 1A6TA 4LRIA 4NQDA 3L4TA 2GSIA 4AYFA 4PV9B 5FKPA 3LXAA 3POCA 4XTRC 1A1MB 4BHUI 3I6GA 4QRTB 2XV6B 5JOFB 2MFNA 2GYSA 4IDLA 1OF2B 1RP9A 4AE0A 4OR1A 5EWIH 3IDYB 4P5TC 2KC0A 1M53A 1DQQB 2XG5B 5EOQL 2QT6A 1MPAH 4NN6C 3QRGH 2B3IA 4XMLH 5D1XD 1BQHB 2IO5A 4JB9L 3ZIYA 2HRLA 3Q6GH 1CT8B 5E24E 3NFNA 4FNSA 2ZUXA 5CEZL 3RNQB 3NESA 1AZNA 4K73A 1FVDA 4WJ5A 5T1KA 3BISA 4WCYH 2HFGL 3IMWA 4KKPA 3QC6X 5IB2A 1WAAA 1URLA 2LU3A 1B4TA 3CLWA 3PHQB 2ZUYA 3K4ZA 3I75A 4TSCL 5EBMA 2F1AA 1YN6A 3PXHA 4NENA 2EQDA 2ARJQ 3QDMA 4WFFE 5B39G 4RRPA 2F7PA 1NCUA 3F83A 3H3PH 1YEFH 1VEPA 4OV5B 1PLCA 5DD5L 3RGHA 1NM4A 1KTJA 4G70B 4YE4L 2NUTA 3F64A 2HVJB 4EXPX 4Y89A 3PABB 2F58H 3AFLA 3HI5L 4X98B 1ASOA 5KSUB 3P1VA 4FMKA 4G8EB 4KKAC 2O72A 3WTSA 1B0RB 1PSKH 1QRND 4JREB 4FNQA 3HAEA 3ZL4H 4TTDC 1JV2B 4O02A 5LGJB 2N7SA 4A6YA 5EORL 3PHSA 4F7TB 3EJQA 3QFJE 4L9LC 3L1GA 1D5ZB 1W80A 2VLRA 2Y6SC 5H8DA 4HUWA 5DS8B 2WINB 2R9HD 2FO1A 3C5XA 2BWIA 4JO4L 4G9FE 4L1HA 4Z3HA 1I7ZB 2HTKD 3AGVA 3KYNB 4ZXBB 4N4YB 4HQQH 4FABH 5AVYB 4G7VH 3IDMA 2CDGA 2CLZB 2O30A 2BSBA 4YDMA 2XN9B 3IF1B 2AC0A 3NCMA 3MO1A 3B6SA 4NUGH 2R4RL 3N0AA 2QGDA 4GI6A 5HHVL 2Z7YA 2BSSA 2VN4A 3TBCA 2JTDA 1O7SA 2VTFA 1KY6A 2EVHA 2ED8A 4X5WA 3GZOA 3DVNA 3FTVA 3G6AA 3SPVB 3TVMD 2YRZA 4GINA 2NW2A 1BPLB 5AOMA 3WNNA 2J5LC 4J3SA 3T2LA 4Q9RH 3HR6A 2RFXB 2ZXCA 4KKCC 1T20B 4GW5B 4M1CC 5JDSB 4NP9A 5FLUA 4LFHG 4H13C 5F89B 4OI9A 1QFUH 4HIPA 4QCIA 1BBJA 1T5KA 1K3IA 4LL4A 3TM6A 1QRNE 1ZGLA 2ZJSL 4KXZH 3TP4A 4IBWA 3QJOA 2WKOA 2ICWI 3CLFL 1ED3A 3DMMA 1E4WL 3IFPA 5ES4B 1NAMA 5L4MA 1RJYA 1XXDC 4FQ1H 2IDTA 4ZQKB 4N2EA 4QRUB 1M56B 2HLAB 1CFVH 1BZ7A 2V2TA 5DFWH 5EZLA 3LPWA 4XVSH 1MCWW 1UUSA 4POYA 4IMLA 4HLZH 1KXVC 2QSVA 5E6ID 4NHCL 3L1FA 3OLDA 4JHZA 4A63A 5I1DB 4GAGL 2D9QB 5IMLB 1KXQE 3A6BL 2Z4TA 2O6PA 43CAB 2OTUA 5IFJB 4BKSC 3MNVB 3GZPA 5HGAA 1YMMA 2QPFA 4P23B 1BBDL 2CBPA 5IW6B 3L3IB 1JD9A 4MA7L 5EU7E 4HIXH 3UACA 1AR1C 3ARZA 1UADC 4NIKB 2AVGA 4P9HC 1X5LA 2NRDA 5K69A 4RAUB 5L8JB 2QADD 3WTVA 1TEGA 4I18B 2EYSA 1BDYA 3IJHA 1NSNL 2QFPA 2K0RA 4QAWA 4MS8D 4NO5B 4FGMA 2Y23A 4RRPG 3VFRA 4B0MB 1EX0A 1OTTC 2B4CC 1MUJA 2B1AH 1AY1H 4ZOEA 3QUZB 1IEAB 3SGDH 3BT2L 4M1DH 1CLYL 2F8IA 3V8CA 3MJWA 4PJXA 3WTXA 4UB0H 5ISZA 1MRDL 2GJRA 3D0LB 5A2BA 2XTJE 3IPBA 2QLYA 2V9UA 3UG4A 4F8PA 4OVUA 1Q9WA 1TQBC 3P3UA 4OLXL 3SDDA 4WTZA 5E1QA 4FXKC 4XX5A 5FV2A 3HAEG 3ABMB 3PQYB 1A0QH 2H2SC 1BEYH 5TQ0L 1X5FA 2AXFB 4X4MA 1FVCB 2BVPB 2FJHA 3KZ8A 3P9MA 1UZ8A 4EQ2A 3FQXA 2ZWLT 1VAHA 4NKDB 1LP9B 4N68A 5A6MA 3G08A 3V7AG 1PKQB 5JDJA 1OAYH 4JRXE 4XP4H 4BWUA 1ID5I 4HK0A 4Y4HC 2Q0ZX 3BOVA 2A6KB 4HZLB 2I60L 3WV0A 3E80A 5C0EB 2MRYA 3E2HB 3QG6A 4HSQA 4HH8A 1HXMB 4I0CC 1CXHA 1I8UA 1YEHH 5GS2H 4ZUSA 3ZO9A 3CC1A 3IXTA 3VGHA 3OAUH 3GRWL 3WKYA 5EOCJ 3FT2B 4QJ4B 3LRHA 2W60A 3JYBA 4KAQL 3DROA 5FYLD 3GMQA 2P48B 3PWPD 1CXEA 3VW3L 3EYVA 1EO5A 1JDCA 3S48A 5FF6A 1LVEA 5GISL 5J3HC 3CXDH 5HDOA 3BCFA 3DX7A 1DBML 2WLNA 3U48A 3B5HA 3KEHA 4QF1A 3GMMA 5I1AB 1TIUA 3MLUL 3NSCA 4NDMB 4ZMQA 3BXNA 4HS3A 4XNMA 3NH7H 3R18A 2KZKA 3PWJB 3QR2A 1W6WA 1CGVA 3DV6B 3QDJA 1QPKA 5GQBA 3SBWA 5HXMA 2O5ZL 4CSPA 5IEKA 1PZUB 5DEZA 4FQJL 5C0AA 3EGDB 1T22B 3B2VL 1BIIB 3P11L 5DHYB 2WC7A 3UC2A 4JY6B 1NM9A 4Z7UA 4BRVA 4NXKA 4XVTL 1A66A 2OR9L 1G7HA 4M6NH 1NCDH 4WU7B 1MCEA 5E2WL 3NPSB 5DDHA 5GSVA 4JN1L 1XF1A 2RMNA 5HHQA 2NZ9C 2Y7QA 3IDNB 4MCYA 4NOFA 5MENE 1NGQH 1AZUA 1HYRC 2DYPD 2NNCA 2P8MA 3LAFA 2R2BA 4BFIB 4BRJA 3P0VL 2KDYA 3LKSA 3GC3A 2BHFA 4KROD 3ARRA 4LPWA 3FJTA 5DA4A 1TZOA 7FABL 3TA3A 3MRGA 2WUBH 5FYLE 3V9EA 4LCWD 3IETA 2IAMC 3MRPA 2Q7YA 1UC6A 3B83A 3GMLA 2DQCH 3FDWA 3Q3GB 4YBLB 3ZU8A 4EDWL 3WYRA 5C9KA 3ARBC 1TTRA 1QFWM 3MRLB 3MRMB 3WDIA 3X13A 3L9BA 2ADYA 1OOWA 1M4KA 3W38A 1T21A 3Q5OA 1O6VA 1F97A 3QJHA 3INUH 5AL8A 1Q9OA 4YXKH 3TS8A 3EG9B 1RFDH 4KI1A 1X6LA 1TJHH 2IOIA 2MKLC 5E4IA 3WEXA 4PI2A 3KVQA 4Y19E 2DW5A 3RB7A 2AJZB 5IMOA 4ELKB 3JWOL 4WTZG 5I8OL 2VT0A 3E6FA 3S3BB 3UBHA 5DHVB 1CXLA 1I85A 2GKIA 1C1EH 3PJLA 5DYFA 1U2HA 5D2NE 1HL5A 4XPGL 4BCZA 4U1KA 5CHNA 4BZ1L 1BOGA 1KJ2L 4NKIL 1GZPA 2ZNWA 3BAEH 2H26A 1DQIA 1JNLL 3CX5J 5KAQF 1AC6A 4G8AC 2XXMB 3VXNB 2WQXA 2VRQA 3QHZH 1JHTB 1KN2L 1EZUA 1OZTG 2ZYHA 1RERA 3LB6C 4C47A 2P24A 1J0HA 2NR6C 2AV7A 1QLRA 2PKDA 2WYTA 3H9SA 5D7LB 4BQ8A 4UTBA 4Q6IB 4ODUA 5C6TH 5FA4A 2ZXDA 2X6CA 4PRDB 4ZX3A 1N5YL 1KYFA 1E65A 5LBSH 2ZP0T 3ROOB 5ESVA 3CMOH 1MJ8L 3BP4B 4C56B 1O6SA 1UOWA 3OKKB 2ZYIA 2G60H 1D7CA 1YYML 3M7FB 4R90L 5FYJH 5DGRA 1U4FA 1L3NA 1V3MA 2VDLH 3EXJA 3LIUA 1Q1JH 1GH7A 4JZJA 3PWUA 5C3IA 5IHZB 3Q13A 3DUSB 2VDMB 5CKGA 1LWHA 3RX8A 3THML 2Y5QA 4GLRH 3V6FB 3HG2A 2OX5A 4PP1D 2CPUA 1TYRA 2Z91A 3O3AB 4IM8A 2LV4A 2HH0H 2ZT9C 4AJWA 2ZSVA 3AWGA 1ZT1B 1AFVH 4YXLL 1PD6A 2DQDL 2Y07L 4XO5A 2X4RB 3GJEB 4OCYL 3SPHA 4AEHH 3PV7A 4G5ZL 4BEIA 3L9EA 2J1WA 5EF1A 4PB9H 2JB5L 3QEHA 3SYQA 1UD6A 2O5NA 2ED6A 4XBPA 3V0FA 1IGYA 1N9PA 3MQIA 1NFAA 3D4ZA 1FZKA 2X4SB 3DX4A 4LSVL 3AU1B 4H8WH 1F8TL 2ESVB 2IGFL 1KT2A 4JFFA 3UG3A 5CKAA 3DBXB 3K6DA 3WMSA 3S36H 2IVFC 4ZW7A 3M7OA 2ITCA 1S7VA 1D6VL 4JKNA 4UAOC 5CIPH 4YSDA 5A40E 4ZFGH 4AVKA 3CD4A 2W81C 3CFTA 1JK9B 3W0WE 4G9DA 5EU5A 1QKZL 1YEWA 1IAMA 3NQKA 3MLXL 2PYEE 1J9TA 5DQJB 2PPAA 3HS0B 3MRFB 3AAZA 5D7IA 2I32A 5EO0B 1GCFA 4KMLB 4MLSA 3UGXA 4DN4L 1A21A 2XXGA 2VDKB 3UBXI 1OQOA 2DLEA 2XETA 4YGVA 4AQEA 5B8CC 5DK0B 3UPRB 1FYTA 5F0JB 4WWKA 3S35L 5J8OA 1WGVA 5F97E 5T5FL 4QXTB 3CFDA 4S0HA 3D39E 4IRJD 4XXDA 1T0MA 4KVPA 4R4BB 1ZE3C 3WLBA 1BECA 4P2OC 4V33A 3BP6B 1WFJA 4LSQH 2DQJL 2AQRA 4MHHG 4V2CB 2Q3ZA 5JIHA 2VITB 3TT1H 2WP3O 4CKVX 4LMQE 5LVEA 1XGQB 2CAKA 2FB4H 2NW3B 5LDSA 2J72A 3CSTA 4NQDB 1RIUH 2SEBA 1KB5B 1BG9A 5ICYB 5FKPB 3MV01 4J4PC 3RY4A 4HF5H 3DX8A 4JRYE 3BEWA 1ET7A 4BFGA 3UPCA 4POZD 4XODA 2DJSA 4F80A 2YOCA 2Y06L 3FS9A 3ZRCC 5HVHB 4GH7B 1RMFH 5KBNC 2K78A 1EZLA 4PJCE 1FYHB 5J13C 3NPZB 1N4XH 3L95A 2RD0A 2NXYB 5DR5L 3EYOA 1LD9A 3M88A 1B0IA 5FYKL 2R8SH 4NO0D 4DGIH 4K7PX 1I9IH 3BN9C 5LQBH 3ARFA 2VDQL 3I9GL 4RVBA 2VZVA 2FATL 4H2CA 3UCRA 4PJCF 4ELMF 2V2WB 2CKBH 1HXYA 4XTRD 4XB7A 3FO0L 1I3RA 3LIZL 5L2KA 3VG9B 4WJ5B 1FVDB 3QORA 4M7LT 5BQ7A 4PN6A 2FBRA 3O3EA 2GC4C 2MPVA 2JELH 3I75B 2P5PA 5EBMB 3TZVB 2PYFB 4ONGL 3T0EA 3QDMB 2W65A 3JWNE 1V7MH 5CF3A 3EDJA 1RULH 3CN0A 1RZJH 5ID0A 4WI4A 2L7QA 4OF0A 5KVDE 4J7RA 3WFDH 4S1RH 1VEOA 4NOBA 1FLRH 4JFOA 4YFLI 3MBEA 2OSLA 3F7QA 3PDOB 5KBLA 1E27B 1W8OA 3CWGA 1OAUH 2NUTB 3Q1EA 1DQLL 5AOJA 5FV1L 4KUZH 1R6VA 4W9GC 5B7EA 1BZQK 1WDAA 5FM4A 1EFXD 2Y7LA 4X6FB 5L88H 1FZJA 1M7IB 3BEVA 3HAEB 5AW1B 3IDXH 2V17L 4KJWC 4A6YB 2R29A 3MGOA 5AWNH 3FUMA 4PTTA 3PFUA 3N9GH 5HYSA 1MIML 3CMGA 3TYGH 3EJRA 4ODVH 4FP8L 5TDOB 3ZR5A 1ACXA 35C8H 2XACC 2VLRB 3LKRB 3CVBA 2Q87A 4HUWB 2YFOA 1U8LA 5BV7H 2B5IB 2VRAA 3RY6C 3DC0A 1CFQB 1HHHB 1DBBH 1KUMA 5DRNB 2ORBH 3T04D 4PJIA 1JF1A 5HHXL 1D5IL 2AXGB 4M8VA 2CDGB 4TTDD 4PLOB 2Y4SA 3CVDA 2FT7A 1P4BH 1QVOA 1RVFL 2DLHA 2OMWB 1BCIA 5E4OA 3KW7A 3MO1B 4R83A 3OAZH 2OMYB 3BDYL 5AVRB 5BRQA 1N3NA 2E86A 4WHTA 2BSSB 5KW9H 4JFPB 2LVEA 2VWEE 2N1KA 2GW5A 2Y6SD 5DFVC 4N85A 4U1IA 5CZXC 1RKRA 3ARDC 4X5WB 3G6AB 3D18A 5I74B 2NW2B 3UEQA 3WXWH 2WN3A 3MJ7A 3OSVA 2ICCA 1NMCB 2CXGA 1BVNP 2FZ3B 4HXBH 5DJDA 1NCBH 5JO5A 1HZKA 4QCIB 2NX5D 1XQ4A 5AAMC 2V3FA 4B60A 1ES0A 4P9ML 5I5RA 1ZGLB 5GIRA 4HBQA 4KY2A 3NJGA 3F05A 2Z7UA 1FCGA 2VDML 4PJFA 1ED3B 3BQVA 3DMMB 4OD2B 2FK9A 3IYLW 3RDTD 2J57A 3FQNB 4PRHD 3AQDA 3RGVC 4WW2C 4G6KL 1BZ7B 5DVMA 4K2UL 4KKCD 3KH3A 3NJKA 3U30B 2VISB 3CZFA 3MPCA 1WIUA 3LXUX 4M1CD 5KS9E 2A7BA 2FQFA 4YSTA 1G7QA 3HMXL 1BF5A 4DK3A 1DVFB 2YRBA 4NGHH 4GW4A 1SMDA 1BAGA 2VDOH 4OB5L 3D3VA 5KS9F 1FO0B 2RTTA 1WD8A 4QOKA 4BIKA 2LAAA 1XZ0B 4MMYB 2OTUB 1EWHA 3QEQA 5FM5O 2HXAA 3WG7B 2R83A 3D48R 1CL7H 1YMMB 5HGAB 4PH8A 1NL0H 1U8MB 4U1SB 2NY7L 3MBWB 2L7UA 4JY5H 1HXKA 5LJYH 4K5LA 4MA3A 2GBUA 1TYEB 3TF4A 4XWGH 4XPBH 4XN9A 3OB8A 3SCMC 2G4GA 4X4YA 3VRJA 1KLUA 1MQKH 1CPUA 3C60A 2EYSB 3IJHB 1JNNL 2YA2A 2CUAA 4OIIL 1F1GA 3T8MA 4AL8H 3GB7B 5GGRA 3N04A 1W91A 4N9GA 1XD0A 4D9RE 1TO5A 3BJ91 4NZUH 4PJXB 4P2RA 5F7NC 5ISZB 4K9EH 3MJ8A 3U9UA 2VXQH 4UM9B 1W72A 5JA9A 1CXFA 1AR1D 1H6TA 5DFAA 1I1AC 5BZDA 3SDXB 3FTGA 3LDBC 4A2DA 3VRLF 4AGMA 1ZTXE 5I66A 3SDDB 4PRHE 4K4KA 4QXGL 2W0KA 2CCVA 2ZSWA 3H54A 3V4PH 3O2WL 1IC5L 1OTTD 1QBML 1IQWH 4XPAH 3D05A 3SO3C 1T1XA 4PIRF 4X6DA 5HYSG 2PN5A 2DL2A 2CO4A 1UZ8B 3FQXB 2W0LA 4QRRE 4Z7WE 4DO4A 2C4XA 1MWAH 3RIAK 2CLVA 3QUMA 3VSTA 1GGBL 1T1ZB 1ZIAA 3G08B 5T33L 3RAJH 1KCLA 1SM3H 4NQVB 1KB5L 3QWQB 2ZXGA 1NIEA 1Q72L 4DEPB 4Z7WF 2VLMD 2AXJA 5HHMB 1I3VA 5AKSA 2H2SD 4IEFB 3QG6B 3ZDZE 5F70A 3KWXA 1XF3A 2A9CA 2O6CA 1T6VN 3FUFA 1KJ3H 4XXCA 4ZUSB 4DW2L 3IXTB 4OZGE 4KUCD 1QO3A 3MA9H 1BQSA 2EVIA 3DROB 3DO3A 2X1PA 4IBVA 4JFWA 3GMQB 2AJYL 1L4IA 3HB3D 3EYVB 2VMEA 5ENWA 4YSPA 2Y0SA 5AB1A 1J8SA 4GQRA 4O2EA 5EN2A 5FF6B 1JWMA 2VDNB 3GM8A 1Z3GL 3DX7B 4HIHA 4Y4HD 1PZDA 3FRUB 1YEDA 4AKOA 1SBBA 5DUMH 3HI1B 2CALA 4QF1B 5I75B 3GMMB 4JFUA 3VD4A 3FU3A 1EJOH 1DVZA 3T6ZA 4XNMB 4HS3B 2N7BA 4OZ4A 1S9YA 2YIHA 3S3SA 3SDYH 1TJIH 1UASA 1I8MA 4OM0L 4Q0XH 5KYXA 3QRGL 1QNZL 2QELA 4YOKA 1ZEAH 1PD0A 3NZSA 4W9FC 2OZ4H 3X2QB 3EYQC 2PW2A 3WUWA 2AQ1A 4UQ2A 1QFHA 3SJVB 4Z7UB 1E5AA 3VXTB 4HEMA 3PJSA 1G7HB 2GQHA 5CZVH 2W9EL 4UANA 3U2JA 3ZMEA 1HCZA 4B9CA 4CAGA 3QQ4B 2VLME 5DDHB 4JL2A 3RWCA 5HHQB 1PMYA 2CO6A 3ARGA 4OW6A 5AYQA 1NC2B 1OARH 3QDJE 4F5CA 4DK6A 3LKSB 2EKSA 3N42F 3VGEA 4EIBA 1H3XA 1RLBA 2IOMA 1CD8A 1G9HA 4FG2A 5C0AE 2XVLA 1E30A 3TA3B 2ZWZA 3IETB 3MLWH 2AEOA 3VXMD 3MRPB 2BNQB 5E8PA 3GMLB 2G3NA 4ADJA 4KUCF 3RHWF 2MH4A 3BSHA 3BVWA 5D1XA 1PSKL 3OR6B 2ETWA 2NZ9D 3X13B 3ZL4L 3FRPB 1T21B 5T5NG 4U6TA 1X5YA 1J8HE 1XB3A 4LGRB 4GB9A 4UDUA 4MNGA 4TVUA 3ES6B 2VZSA 1Q9OB 2IALB 2UVEA 2YLKA 3EYSH 4M6OL 5D93C 5FOBA 3WJJC 4DK5A 4LCYA 1A3LH 4Q56A 3NACL 4N90D 3WEXB 5JW4Q 3I50H 2M2DA 5KEZA 4QHKI 4ZO7A 4L48A 1MXGA 2BOLA 3EKCA 1O7VA 4O5LL 1GPOH 3ARBD 1FVEB 3P4OA 3VO0A 3ZTCC 4PV1C 4FABL 1JI2A 4G7VL 5T3XL 2BSRB 1KIPB 4U1KB 5CHNB 1M6UA 3L5HA 4K8RH 1BOGB 4HAKA 3MCYA 4YVNA 4Y5XC 1GZPB 4Z3EA 3CXHK 5DWUH 4HC1A 4DKFH 2VC2B 3MFFA 1OGAD 1ZLEA 2AQ2A 4HCRH 4TPRH 3MUGA 3SHSA 3CNKA 2VQ4A 2PXYA 5M7QA 1ODAA 5C3TA 2G75B 5D9SA 1MFAH 1HKLH 4YUEH 1XB6A 2AV7B 1QLRB 3H9SB 4F57H 1YNKH 4Q9RL 4JEGB 5GHWH 1SLVA 2J6EH 3VGAC 5FA4B 3OKLA 5FR3A 3OJ2C 4FX5A 4JNXA 4DPAX 4QRBA 1GZHC 3ATFA 3V52L 3S98A 4DP6X 4Z0XB 1FO0L 3F3HA 2DIJA 1N0LA 4HIQA 5BRZD 4NFDA 5K9QG 2JV6A 3LB6D 1EHLH 1KEMH 2NR6D 3NCEB 4FQ1L 4A37A 4JDVA 4YHNA 1IO4C 1DDTA 3ZKMC 3SKNA 2OXHA 1NBZA 3MV7D 1E9PB 1UH2A 1HH9B 1XAUA 1NIAA 4BWWA 4QGYA 5BRPA 5JIPA 4XPTH 4F9PC 3ZDYE 4PJ7B 3SE3C 3GS7A 3PRZA 5EOCH 2HA1A 1MFVA 3TVMA 1S5IH 2XWTB 2QVMA 4TMPA 8PAZA 1QUNA 2ZSVB 3FL7A 3FFCB 4IJ3B 3WUWG 1OAKH 3WOVA 1NUDA 2CPCA 3ZDYF 3L3DA 4LHUB 1KYUA 4E5XA 2JKIS 1RZQA 5E8NA 2A9NL 2X4TB 25C8H 4NO3B 3E1F1 4Q6KA 3OZKA 3X1FA 4RNRA 3AQYA 2BW5A 3A24A 3QEHB 2ZF9A 4XBPB 1IGYB 4NBYB 3D9AL 4GRWB 2ZUQB 1FZKB 3OPZL 1AXSA 4G8IA 4JFFB 1GY1A 2WSPA 1KT2B 2R0KL 4Z7VE 3DYPA 1YJDC 1AY1L 1B0WA 2QQKH 5FHAL 1CFSA 4G8GA 1S7VB 3SBQA 1N5AB 5D1ZI 4DHLA 1CDJA 5E6IA 3TV3H 4Z7VF 1QFWI 4G9DB 3LHPL 2BIMA 3WMQA 5BRZE 5EB9A 1YO4A 3AS0A 1LMKA 1QTPA 5D7IB 2WBKA 2IEPA 1XB8A 3WI9A 1SXZA 3WDHA 3EUDA 3F58H 2Y9RT 1I8LC 1UOKA 3LXBA 4UT6A 4WY7L 3L4UA 4ZPVA 5AVQB 3IFOA 5FGCB 4WSGA 4AQEB 4YGVB 2DJMA 4WWID 2NY5H 3IVKA 2VLLA 5L0QC 3BDXA 3QQXA 1Z9MA 5I1KL 3RJDA 4PJGE 3L3KA 1Z1WA 3QUGA 4GAAA 4FI6A 4XXDB 4YHKH 1P1VA 2BZDA 3HHRB 3WLBB 1GYCA 4ORZC 1ZLWH 4MAYC 2VDNL 3VI4E 3DYOA 5C0DA 1M42A 3FH5A 3U6RA 4FULA 5E4EC 3T0AA 4ZTPH 4DGWC 4OCLC 1S9XA 2SEBB 2WHVA 1T7YA 1SHWA 4WFGD 1YEKL 1PGRB 3DX8B 3OGCA 4GSQA 2OA9A 1QAWA 4OFQA 5ADPH 1FYTE 1T03H 3ECBB 5KVFE 1RP8A 3MROB 3QNYA 2Q5BA 5DMJB 1OSZB 4P2OD 5D96C 2V4LA 2M1KA 1O9VA 3L13A 3VFPA 3MUUA 2VN7A 4GMTH 4PP2A 3ULUC 3TJHC 1E4JA 1LD9B 4PGBB 4I77H 5DRWA 4R6UA 5HBBA 3B9DA 3ARFB 4IKNA 2DQEL 1HAUA 4PJEA 3NEEA 2ZKWA 4HJJH 4XNYH 2W80C 1A5FL 1HXYB 1W16A 4FKKA 4UQCA 3HKZA 1NANI 1IEBA 1SOQA 4DPCX 2VL5A 1QWHA 2DM7A 1WK0A 1XAKA 5L2KB 4GEIA 5BQDA 4HIIA 3QORB 1JOIA 2XVKA 2IPUG 1JPTH 5BQ7B 3DIDA 5IB1A 3IS1X 1JCKA 1JZDC 4F58L 1JF6A 4BWTA 1NCCL 1D7DA 4KQ0A 3WEBA 4D3CH 1EFQA 3T0EB 2W65B 4ZFOB 1WWAX 2XQYA 3FCSB 5ID0B 2J71A 1BZEA 3QPQC 4UDTA 3BN9D 3K5RA 1R3JB 3KBPA 3GPEA 4WWNA 4KO9A 4JFOB 3PWPA 4PJAA 3MBEB 1P84K 2OSLB 1SVCP 4QTIH 4OF6A 4Q9QH 1VGKA 3C09B 1NBYA 4LSSL 1INQB 4MD0B 3MNMA 4GI9A 1QBBA 4R26H 1MWOA 5EZIL 3RWIA 1NGQL 1TXKA 3ARSA 1IAIM 4L4TA 1FGNH 3JVGA 1R5WA 3IJSB 1FZJB 3BEVB 4E5XG 1XCTA 1ZPLA 4M03A 4JPQA 1UJ3A 4ZO8A 5ADOH 1CF1A 3HC2A 3PHAA 1E42A 2WUBL 2Z64C 3LZNA 3QEUA 4OD3L 1J1PL 2RH0A 3MGOB 4PTTB 2BVOA 1QLFA 1BJ1J 2C7UB 1YEGH 4OJDH 5DD0L 3T1WA 2DQCL 1UM4L 2X4PA 5GGSB 4K23L 3O4LB 3QJUB 1RXLA 3BP7A 1V7NL 4BINA 2WXGA 4TL4A 5E5RB 3HHMA 4LP8A 3FU5A 1A4JA 1WWCA 5KN5B 4ORGA 2D73A 3INUL 2KLSA 1I4FA 2A4CA 4C8XA 1JF1B 2VC2L 1OWWA 5SX5H 1UVQB 3AC0A 4KJWD 4HP5A 2FEEL 3QYMA 4RMVA 5CSZB 3MUY1 1N3NB 1HZHH 3K6OA 5FB8A 2YGNA 4U0RC 3IRZA 3F5WB 3G04A 4L8CB 4U1IB 1L6PA 3LEVL 1QR1B 4JZOA 4P2CG 2DV6A 2DEWX 4GG6E 4PMFA 4LCWA 1HNGA 2AK4A 3IJ9A 4FQIH 1ZDQA 3MJ7B 5DJDB 2ZP8A 1A1OA 3BAEL 4MMXA 1L9OA 2F1BA 4PRPE 4YXHL 1YPZB 3TYFA 2R2CA 4GG6F 3ZUCA 1G1KA 3A23A 5D7SH 4YL9A 1ES0B 5FGBA 5C7ZA 4MD4A 4HXAL 3ASNB 5GIRB 1FORH 2APWA 1AGCA 1KIQA 5DFVD 5HSFA 2PCYA 5CZXD 3N85H 3ARDD 4IU3B 2TRYA 2EDTA 3I84A 4JO1H 3Q2VA 4KRLB 1Y6MR 2WANA 5EBWB 4B5ZA 3ZHNA 3B2XA 5DVKA 3CMOL 1CLOL 3JZYA 2Z4QA 4JHWH 3CZFB 1HILA 1IBGL 2W38A 3LVTA 3ECVA 5C07D 1G7QB 3VA2C 5IP4A 5FYJL 3SDAC 2A83A 4PSPA 5DVNA 2OMVB 2ZXQA 3HUJF 3CZUB 1RUQH 3OKDB 3ZL1A 2EDEA 1LMIA 4QRPE 1KCSL 3QEQB 4PJFE 4XNXL 3LN4A 2OYPA 4W4OA 3RGVD 2YGVA 3IAPA 4IBZA 3V4UH 1ETB1 4CDGC 2PPCA 1G1OA 4MA3B 4UZGA 5JQ6L 2HH0L 4EAEA 5L4FA 5E9AA 5IJKC 1IGJA 3RKPA 4X4YB 4N0YH 3VRJB 2GSMB 3LS4L 2H1LM 3AREA 2PCPA 3C60B 3ZKXB 3CFQA 1U6AH 3HNVH 4OUUB 4WFHD 3BFQG 2XQYG 2GABA 4TNFA 5DJYB 3T1FA 5GGRB 3VACA 2ZG3A 1MREH 4EXKA 4N9GB 4QOKE 4P2QE 1A6UH 2FGZA 2LE9A 4KQ3L 3ZSTA 3PNWB 3H9HA 2E74C 2BIPA 4GRLB 2IXQA 3U9UB 5SWSE 1YSOA 5AW6B 1T0NA 1BPVA 1VF5C 4PV8A 5BZDB 1IC0A 3FTGB 1IB5A 4ODHL 3G5YA 1BJ8A 4H8WL 5CCJA 3SCMD 4J3UA 3I6KB 4LP4A 5J1TC 1CZ8L 3FU9A 3ZZLA 1EXUA 2GAZA 1WTGT 3RU8H 2OI9C 2VDKH 2YPVA 3DOSA 2G0KA 2EE3A 3BPOB 4NNPL 4AJ0A 2BERA 4KVNH 4LARL 4BH7A 3BUIA 4X6DB 5DHMC 1AZVA 4NQSA 5KBKA 3OKEA 1NCWH 1SF5A 3ORJA 3IFLL 2BRRL 2BWDA 4PM1A 4P2RE 1IM9D 3GMNA 3QUMB 4XMKH 2JCCF 2XBDA 3GXIA 4MWFA 3VFMA 1I1AD 1MHEA 1S4IA 2D31A 2CK0L 4HOZA 4EE2A 2PR4L 4LLVA 2FX8H 5EO9B 2F53D 4X99A 2AEWA 2VXSL 3HBPA 3HNSH 3ZMNA 4YEEA 5AB9A 5EEZA 4HCGA 5DJXB 1PNCA 5K9OB 1RK0A 4OCSL 4WW2F 1QO3B 4OJCA 1DUYA 2KUTA 3QXTA 1S46A 4JQXA 4LLQA 4NCC1 2WZPA 5C09A 3DX2A 3TT1L 4ELMA 1G1CA 3JWNH 2RA1A 4AITA 3EO0A 4XCFL 5DK2A 4MRBA 1HIML 2CM5A 1I8AA 4L8BA 4RFEA 1JWMB 4HIHB 5GRJH 5KVDH 4OBSA 2N3JA 5IW1B 1YEDB 4HF5L 1HK6A 4NM4H 4PVNA 4MD5A 1WFOA 4M93B 2EUWA 3WNJA 2BC4B 3B43A 4I9WE 3GLDA 3QUYD 2OR8A 2ZXEB 3ABGA 5IQ9A 4OZ4B 2YXVA 1E50A 1S9YB 2QSTA 2XVBA 1W6LA 3CDGA 4YDVA 3VXUE 3ZE2E 1A7OL 3DXAD 3M46A 1SXCA 1PD1A 2WB1A 3U82B 1KEGH 2PO6D 4DUVA 2W88A 4ZFOL 2GB2A 4BHUA 2W92A 1SHXA 4DGIL 2R69H 1MJJB 4IRJA 3N1FC 3T2NL 3WUWB 5IFAL 4L8DA 2FR4A 1Q9LA 5CCHE 3D51A 4X6CA 4X7EC 5E08H 5CFHA 4BQ6A 1BVNT 3CFBA 2NNAA 4HH9A 4DQOH 3WEOA 2X1XR 3AWFA 1NPJA 4J3TA 3RWCB 1L5GA 3OZ9H 2VR9A 5TH2B 5ANHA 2FQEA 5I17A 1V7ML 1UCBL 3HN3A 1E8WA 3A67L 4P07A 5GGVH 2EKSB 3ULSA 1LEIA 3TPKA 3EYQD 3WXVH 4Q6YA 5IREA 3H8NA 4O02H 4HWBL 1FLRL 3Q7JA 3OLGA 3DLQR 1IGCL 1J9QA 4Q4IA 4DP1X 1OAUL 2J2ZA 4YIQA 5ITFB 1E4KA 2E6PA 4R8WL 5DRZA 1IFHL 4R84A 4BK8A 5JIIA 4XBEL 3TASA 1B9KA 1UD3A 2AJ3A 2JKWA 3FN0L 4FLRA 5D1XB 5LBVA 1G94A 5L88L 2JI2A 2VSMB 1CGWA 1XMWA 2AEQH 1NLDL 3E1ZA 3NZ8A 5I6XC 3CDYA 1CTMA 3TBWB 3C8DA 4UDUB 5AWNL 3J27A 4MNGB 4JDTL 1KF9B 1Q0XH 1S9VB 1ESOA 3KDPB 1JGUH 2AJUL 3CK0L 4LCYB 1QD0A 4OFKA 3PGFH 3GJFB 1JNHA 4UQAA 5I1JH 5GJTH 35C8L 1RZIA 2ZCKH 3UYRH 3UCQA 5BV7L 4UUJA 1ADQL 1BM3L 3P4OB 4EF3A 7CGTA 3VI3F 3CHXA 3SKJH 3L4VA 1MFMA 3Q0HA 3A3YB 3I2CH 1S7RA 1VFMA 2NY2C 5E94A 2CDEA 5B1AB 5B7MA 1YECL 1WUZA 2DTML 3BE1L 1H3GA 3MFFB 4ENEC 1EGJA 3X14B 4NQTA 1SBSL 1QRNB 1VJSA 4EEEA 5JHLH 2CJSA 2PF6A 1LILA 2GEEA 1YZZA 2RJMA 5D9SB 3LSOA 4PLKC 3VG0H 3VFVA 3QULA 3ZTNH 4LK4A 4AENA 1R17A 4HXBL 1NAMH 5BPPA 1PCXA 3QSKB 4LIQH 1NCBL 4PJBF 3DJRA 4WNQA 2Y3NA 3N43F 1IILE 4JL1A 4WUUD 4MB5A 3NCJH 2XOTA 4C4BA 4EIZC 3C8HA 2Q76B 1U8PA 2EE9A 3PP3H 3BSGA 5KSBA 5J12B 1N0LB 5IK3B 5FIEA 4GQ9H 1YCSA 3UJTH 1ZKAA 4NQEA 3KYKL 3VGBA 2IBZY 3VXSD 4BZ2L 2HVKB 3RFZC 3L4WA 3UZVA 3ESMA 2OXHB 4L9DA 1NBZB 4OAWB 5C92A 1WFMA 2WQAA 3V0WH 2NDGA 1U8HB 3AABA 1ZTXH 3CQPA 2NY4C 3NJNA 4NGHL 3ULVL 5E23A 3KPQA 3OMIB 1IC1A 1TFHA 3ROLA 3AQXA 4CMHB 1JERA 3QUXC 2GJ6E 4A67A 2AV1A 3QZWB 4F8TA 1B9ZA 4RQQA 3MLTA 5AVSB 5C0BD 4M7JL 1FCCA 5BZWA 3L3DB 1CTNA 1V5JA 4NHUA 3CHRA 1KLGA 4KZDH 5E8NB 5CGYC 3AB0B 2NX5A 1F86A 3ZKMD 2OS7A 2WAHA 1SNRA 2WKGA 4K3JL 4DTGH 3KYOA 2IAND 2APTA 3WIHL 5EEYA 3QNXA 1K8IB 4Y2OA 1MQKL 2JJSC 4YC2C 1QW8A 3KS0J 4Z7OE 3MRJB 3RDTA 1AXSB 1UFUA 1NICA 2QPUA 4IU2B 3QGVA 2EC9T 3PJNA 1RQ5A 3OM3B 4JFSA 4W9JC 4DFHA 2ZCLL 3J7HA 3TBVA 1G7LA 4PG9B 2FX9H 3AMLA 3O6KH 5E6IB 1TENA 4N2DA 4BE6A 2RQEA 1H6EA 3QUML 3R8BB 5GRVK 1A6AB 1RURL 2O5YH 1GTNA 3SIKA 2K4WA 1UB5B 2IBBA 1DQTA 3VFGH 2BS71 2CNZA 1NFDA 5HYJE 2R56L 1OKEA 2E4FA 1CD9B 4LSUH 4GG8A 4ZPVB 4H26A 1HQRA 1IQWL 3IFOB 2VDRB 3UTSD 4AWJC 2E0PA 2FVNA 3P0YH 5T3ZH 1J48A 4IMKA 2VLLB 3S8WA 4G8GE 2QADB 4PBXA 5AOZA 3T4YA 3Q1SH 2LVCA 5I23A 3MVSA 4D2NA 3K2UL 2B9AA 1C12A 3UZQA 4G1EB 4NCC2 4ZYKA 1DFXA 4LCUA 2I26N 4PB0H 3AXIA 3MJGX 4A7SA 1IUZA 1AD9A 3NJXA 1WBYB 2P3YA 4DEUA 4LOVA 4JFQA 4AYGA 4K5NA 4TTGA 3T3PB 2P8LA 3SQRA 5AD0A 4M5YH 2DD8H 3OGCB 4FE9A 3F12A 3BKCL 4UM8A 2BK8A 4NZTL 4OLWL 4UF7C 5TGBA 1VPOL 2X9YA 1FH5H 1DUZA 1KTKE 5DQ9A 2IH1A 3QNYB 1ZK5A 4OJYA 4PHZA 4KX7A 4W6YB 2WWNA 3EO1A 4EI6A 1BIHA 4MAYD 5F7LB 3TEXA 5FK9A 5C97A 3B8SA 5TE7H 3LMJL 7PCYA 4PP2B 4UILH 1HSBA 3F65A 1RU9L 5LGYA 1SJHA 5B7FA 1DFBL 3VH8B 3WNMA 2IPKA 3NCWA 4H8QA 4G80A 5E2JA 3SDYL 1IEBB 2NY1C 5I1HL 4XC3L 2VL5B 5HHOA 2FGWH 3AS2A 2FUTA 2H6UA 3HBQA 1QG3A 3UTSE 3SD5A 4FFVC 3FW6A 4HHWA 2IV9A 1UHVA 3JTSA 2ATKA 4PRBA 1WAEA 3ULUD 1U2CA 3H53A 4KU1A 2V7HA 4RGMC 1KELL 5INCA 1UYWL 4XZUA 1CICC 4UDTB 3FCBA 3LY6A 3KYMB 2XWRA 3PWPB 4PJAB 4BBWA 4TUUA 1XGUA 5CZVL 3ZO0A 3UDWC 4G2AA 2FRGP 2XQ0A 3OZLA 4DZ8A 5J89A 3HG5A 4HPOL 1WWBX 4Y4HA 1UUNA 3RWIB 3DWTA 4NC1C 1R5WB 1YY9D 1K6QH 2CK2A 5I24A 4NBXB 3WCYA 1ML0A 1OGPA 3FCUB 4GO9A 3AG3B 1LO2H 4D9LL 3BLBA 3KPRE 4H88L 2FLRT 2YKKA 2DIEA 3QEUB 3QPQD 4UOJA 4KK5C 3MLWL 2BVOB 4NYLA 4J3VA 4HUCA 3CFIC 4OVVA 3TNMB 2X4PB 4RZCA 4GUQA 2XBZA 2GY5A 3O6FC 2QV2A 4U3XA 3L45A 2VE6A 3BP7B 5JNYA 5GPRA 4XWOD 2CDFA 5KSAC 1A4JB 1SJEA 2IAAC 4W9LC 3MC0A 1I4FB 2OSXA 4HC1L 3EYSL 4L4TE 4JQIA 2IDUA 4LSTH 4MQXC 4OD1L 2VH5L 1A3LL 1LDPL 3AGWA 4HCIA 4WTXA 5BZZA 1J5CA 4QRQB 1FJ1A 5DHDA 4BXVA 3AS1A 4JCWA 5AZEH 4YR6A 3T4AC 1LEKB 4CC4C 4DUWA 1F4XL 2RACA 3WS6C 5B38A 2IQ9H 3BKYL 2VLKE 1CDGA 1AGEB 2DYPB 1BZOA 4HA1A 3QYNA 1GPOL 1MDAA 3GXUB 5F88B 3G04B 6PAZA 3MA7A 4KROB 3WEAA 4RH4A 2R0ZL 2JLLA 4TVSa 4BFNA 1G6RA 1SJVA 4TNWF 4X9BA 3X17A 4UTBH 4LCWB 4UQ3A 3REVA 2J73A 3VXMA 1ZCRA 2P42B 3ULUF 4WGKA 2LLGA 2Z35A 3K8LA 3B37A 4YSUA 4OFYD 2YJQA 4GKNA 4UTAL 2NYZA 3TYFB 5BUGA 4HCRL 2LFEA 1AKJD 1M3JA 4DETA 4KNUA 3H55A 2D3LA 2VDPH 4APQD 2YFNA 4MD4B 4J2QA 5E2UL 3IU4L 1NBCA 3L9RA 1A02N 1AGCB 3WFEL 3KDMA 3CFEB 3HC3L 2J6EL 5GHWL 4PR5A 4A7QA 3EFDH 2W59A 5KVEE 4G8FA 1OPGH 2XPGA 2Z4QB 5IQNA 3QI9D 1HILB 1Q4NX 5F7DA 4BA8A 3BO8A 3ARBA 3HW7A 4XHQA 3RPBA 1CXKA 1F18A 3WJLA 2V9TA 4K94C 2HTLC 1X4XA 1QBLH 2I7SA 4W70A 4MS6A 4MJID 5KTEL 3RRQA 3G5WA 1FFOB 2RCSL 4P05A 4HG4K 5L8KB 5CEXA 4WZ9A 1FNGB 1GGIH 2B1HH 1AJ7H 4LHQB 4W9HC 3LN4B 4LSDA 4XO9A 1OGAA 4OCMC 4HJEA 4X7TB 3FQ4A 3WELA 3MXVH 1J8RA 1ROCA 1PX4A 1YEIH 3FU7A 4MB1A 3BPCA 4ALAC 3CFKA 4TOYH 2LHAA 1UGNA 2BM3A 1OAKL 1UXMA 2DJ4A 2PCPB 3C6LC 5DJ6A 5E03A 3SDAD 1KV3A 1TYJA 4XCCH 3T1FB 4GXVL 2H32A 5CN2A 5F9OL 3X1EA 2F74B 2GK0A 5JXEC 25C8L 3QIUC 4L37A 1NAKL 4HFWA 2BZ7A 1MY7A 4L23A 5F9DC 2PYEB 2ENSA 1KGCE 3HVDA 3SGEI 2NR6A 1MRCL 1XHHA 1CD0A 2DQ6A 2VDRL 2Y22A 2WLHA 2DQMA 3QQ9D 5H37A 1IZKA 1EXUB 3MV7A 4Z9KB 2GAZB 4XE5B 5DT1L 1I1CA 4CMMA 2X9ZA 3N41F 1OGTA 1OM3H 3CFCH 4BH7B 4HWUA 1FSKC 1A9VA 2WJ5A 1TEYA 1PZBA 3B7UX 4NQSB 5F3HA 1Z9LA 3IKKA 2MNWA 4A68A 2ZKHH 3WN5C 3O45A 1U8CB 1IKNC 1B4JH 3H42L 1LNUB 1F90L 1MHEB 1S3KH 2C9RA 4QHLA 1AQDA 1F13A 2D31B 4RFOH 3P3RA 2YK1H 3RURA 1X5ZA 1MAML 1NZRA 1U41A 3L9YA 4NZFA 2B16A 4KMQA 3F84A 3M17A 2NY5L 4Y4KC 1TQCB 1KIUA 3U4KA 3ZT5A 4Q9BA 2X6BA 3E6HA 5IWLC 1X5HA 5EA0H 5B38G 1Q8MA 4O51A 4Z77B 4FLHA 2EDDA 1HHIA 2X40A 3U6XA 4LLQB 4G7RB 5IV2A 2CHNA 5IB3A 1G7PA 4XNZC 5ERWA 2OL3A 4ELMB 3U0PA 5DK2B 2BJML 1QR4A 4RFEB 2OM5A 2Y6TE 4L8BB 2XWCA 2C4FT 4EIGB 3I9PA 1KPVB 4BFJA 4L5FE 4MD5B 4S0SD 5ICZA 3FONA 5E8OA 5ADPL 3EJJX 3QZPA 4I2XE 3JV6A 2NY3C 4GOSA 5IQ9B 4HPYH 1J1XH 1CTOA 4E42A 2X0WA 5ANME 1FZMA 3BZ4A 1WS8A 1HQ4A 2PWFA 5DJ8B 5BOPA 3NMEA 4X9HA 1YY8A 2X05A 2GIYA 4M1GL 5C09E 2OP4H 3L81A 5FYLL 3C5JA 4IRJB 4GSDH 4DGYH 1ZE3H 4L8DB 1Q9LB 4HJGA 5ICUA 4JFXB 4X6CB 4A2LA 3JWDL 2CO2A 1CF8H 1QLEB 3CFBB 2YBRA 2NNAB 4HH9B 5MP6L 3CX5K 1OD9A 4XCNB 3OAYH 1JHKL 4DGUA 3G3LA 2LTQB 1SQMA 2XKSA 1L5GB 2G3MA 4MDIA 1EDQA 4L1SA 5I17B 1YNLL 5B8CA 4AZ8A 4FFZA 4LOUC 2R29H 4HHGA 2J4WL 4QTIL 2F54A 4D0DB 1L7IL 2J2ZB 4YIQB 1KNOB 3VWJC 5GS0C 4H1LA 4LVNB 3RVUC 3QA3A 3P30H 5AUMB 2R23B 1XCQA 1Y6NR 4NO0B 1FGNL 2AJ3B 3TF7C 1YHPA 3Q6FA 2PWDA 1QTYT 2AEPL 2W5PA 5I1EL 3QFGA 3NZ8B 1WHOA 2ZOKA 3ZVVA 3WFZA 2XV0A 3WUZA 2A74A 3K46A 1FIEA 4RX4A 1P53A 2GCYB 3HBZA 4Y9GA 3F01A 4MDRA 1JNHB 4OIAA 1DSWA 4NN6B 3LN5A 1RZIB 2VERA 3QCUH 3UTTE 4V1DD 4QT5A 4UUJB 4XZ4A 5H37G 3QDHA 2FX7H 1PFCA 3TTSA 5FX3A 5GRWA 3K1KC 5C0FB 2GIXA 3WE1A 4DWHA 2QKIA 1DVSA 2CJ3A 1WT5C 2VLJE 2YD4A 4Q97A 8CGTA 2WVVA 4Z7AA 1S7RB 4YAQA 1HZHL 5E94B 4OUOA 2CDEB 5JOPD 4H20H 1KYDA 1EFXB 2J1ZA 1AQMA 2KL6A 3UADA 3D6GA 1RZ7H 3AXHA 3LSOB 1OTSC 4LCCC 4FQIL 3QULB 3PGCA 1MLBA 3GSUA 1VERA 1EXHA 3TWCH 1GGTA 2P47B 2I25N 5ABDE 4M6ML 3HUJA 5I18H 3H2QA 3MCG1 4MDJB 4B53A 2NY2D 3ZX1A 4UZUA 5K59E 5ACMA 1U8PB 1RJCA 1DSFH 3EUUA 3FOLB 4ENED 2BXZA