1EXHA

Solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
ASSGPAGCQVLWGVNQWNTGFTANVTVKNTSSAPVDGWTLTFSFPSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGGTAQFGFNGSHTGTNAAPTAFSLNGTPCTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-1,4-BETA-D-GLYCANASE
publication title Solution structure of a cellulose-binding domain from Cellulomonas fimi by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Cellulose degradation
total genus 12
structure length 110
sequence length 110
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1exhA00
5DHDA 1QBBA 1XBDA 3NDYE 1E5CA 1C7TA 1HEJC 2CZNA 1EXGA 1E5BA 1EXHA 1QBAA 2XBDA 1HEHC 2RTTA 2CWRA 1C7SA 3NDZE 5DHEA
chains in the Genus database with same CATH superfamily
4K5NA 4Z7WE 3NOIA 4BFJA 2K8QA 3JT0A 2FEEL 3QUZA 2EC9U 3EYUL 1I1AA 3ZT5A 5D7LB 2H5UA 5FO9A 4M1GL 5ANMB 3ULSB 1NCBH 3PE9A 4E5XB 2EDYA 3WIFA 1KGYE 4LVNC 1H8OA 3FFCD 2FHFA 1QYGH 4Z77B 4JFFD 2ZXGA 4R2GD 4RBPH 4YDIH 1QSED 4BKLB 3OKMB 5LO7A 1J5HA 3MNVB 4JS7A 4N28A 3I9GL 3RX9A 3MKKA 3R06B 4AQ1A 1N67A 5DRWB 5SV4A 1E9QB 5TPWL 3HG3A 2EVIA 4UM8B 5CSGA 3B3BA 1V3JA 4TN9A 5D1XD 2ODIA 5MENE 1RUQH 5GGSA 2IPTH 1N0LA 3ZOAA 1HAWA 1TO4A 2D0FA 5AOLA 4BCXA 4ELME 4IYKA 1R46A 2P4AB 5I19L 4R7NB 3TTYA 3NN8B 1M7XA 3KNBA 3TFKC 2D7OA 2NW2A 4XMWA 4GG6E 3MV9D 1IAKB 3FU6A 4LLQA 3L17A 3LRMA 1ZTMA 3E6FB 4PJFA 1EHAA 2QPUA 1OSPH 4W4OA 3IAPA 5LVEA 3IBEA 3C2AL 1UM5L 3WTUA 2X4NA 3ZDWA 1ED3B 2CAKA 1PZ5B 3DMMA 5TF1H 4KPHH 2Q86B 5KG9A 3BAYA 1QLRA 1QRKA 1NANH 3CDZA 4U6VH 2CCLA 2AAVA 3EFFA 3R8QA 1K72A 5FO7B 5EF1A 3HE7C 3G5WA 4AYEC 4GMTH 1H8NA 4ZI8A 3ENEA 3TYFA 1AR2A 2NNFA 1LEIB 4LVHC 1YEDB 3FB8A 4JFQA 2XWJB 4OGXL 3TCLB 5E4AA 2YBRA 1S78C 4UOW0 3W2DL 5FA3B 5ADPL 1JXGA 5F7NC 4Q4EA 2AANA 5HI3C 1OEZW 3HB3D 1G9MC 1NCHA 3N91A 5EC2A 4FQIL 5KVFE 4UQIM 1BZ9A 2C3XA 1BIHA 5AW7B 1KT2B 2Q8AH 4UTAH 2X4OA 2D7TH 2N0MA 4L37B 1N5YH 5E0QA 5AVRB 4HH9A 5L7XH 1P2CB 4OF6A 3K8MA 3MXVL 2NZ9C 3ZW3A 2NQDA 2WINB 3OGCA 1E9OA 1KUMA 5I1AA 1PZSA 3QUKA 3MLTB 2Q2EB 3S34L 1N26A 1UJ3C 5B21A 1UM6L 4Y4HB 3AAZB 3HC2A 2O6EA 5ERWB 4X7TB 5L4MA 3ZMRA 3BP5A 3VXRD 2PYEE 4APQC 4JREC 1UA3A 5LXGH 5GGTH 1JPFA 4W6XB 1OT2A 1SBSL 4H4NA 2CRIA 3WJMA 5IFHH 2BCKA 3V6ZB 4RX4A 3ZUCA 2VLRD 3B56A 4KQ3L 1INQA 2NY3C 1IFRA 5GJTL 3O6FA 4OIBA 4AI7A 4OM0L 2VXVH 2FL5B 3T9WA 3GI8H 4DEWA 3VXMA 1FFOB 1VGKA 3O11A 3AACA 1P7QA 1SOKA 4MJIE 1OD7A 3OKDA 2CDEB 1HDMA 4MNQA 3ULUE 1VPOH 3FB7B 2EDKA 4GO9A 4KV5F 3VYNA 3MV7B 5CNHA 3H54A 4HXAL 1ZHKA 2WZ6A 2PCPB 2UVEA 2QHLA 1R5WA 2IADA 1QACA 3JWDH 5LQBL 2VM9A 5DC4B 3STZB 2H47C 4DZBB 2OQJA 3N1GC 1QFHA 4KWUA 4EXPX 1F2QA 4PJEF 3KVDD 3ZE1E 1W72L 2IXQA 5D2NA 2A5UA 4BM7A 4UIKH 3UTTE 1D6EA 3FT2A 1JPST 3KYAA 4UMGA 1MPAH 2ENSA 3PGFH 4A7QA 1PF3A 2J4WL 4HIIB 4F37K 1A7PH 3AUVA 1AY1H 3OTTA 2R51A 4TNWK 3LB6C 2ZNXA 4P49A 4XNQA 4JCWA 3SOTA 4YHYB 4ABVA 4KHXH 2Q7YA 3LN4A 1HXYB 1L9OA 4PRHB 1JZ5A 2CIIA 1AHMA 2C4FU 1LNUA 4LVEA 3TS8A 3IGAB 4LCYB 4YEEA 4AYDC 2ESVB 1XIWC 4K0OA 5EA0H 1GGUA 3QIWC 4Z7WA 4XO8A 5C6TL 3O2WH 1ZLSH 1ES0A 1BZEA 1XH2A 1ND0B 1YQVH 2IMMA 3QFDA 2FT7A 3VWKD 3A3YB 4ZFOL 4HG4J 5SX4I 4ZYKA 1M7UA 3VFNA 2DDQL 2BSBA 3GBDA 2E9GA 4M9OA 4TVUA 3M07A 1IEAA 2IO5A 1TLKA 3C75A 3GJFH 3M7FB 1J9TA 5D2LE 4I2XB 1T2QH 2BWDA 5FOJA 4EI6B 4FCHA 5C0BB 3B2VL 3OQRA 3EYVA 32C2A 5BW7C 3VRIB 4AJVA 3GXTA 3GGWA 3LD8C 4I0PC 4OGYL 5GS3A 3F65A 4OD1H 3T1FB 3UZVB 4JUTA 4U05A 4IDJL 1NFKA 4ELMA 4GNKB 4HDIB 3IDGA 3REVB 1B0WA 4KX9A 4BEIA 4EZMA 5E2TL 3GKWH 5DVOA 5GS2D 5BS0D 2YPLE 1E6OL 4GG6A 1CICB 1GXEA 1BFOB 2B1OA 2NLJA 5JW4R 3KDMB 4AJWA 4X2UA 4OFQA 3QJXA 1QO3A 4K55A 5LB1A 2CHZA 3CSYB 1GC1L 3D07A 3V4PB 4D8PA 5C0NC 1CLZH 1OCWL 4UQ2A 3MR9A 1FNHA 2Z64C 3HNVH 5AKTA 1FNEA 1DJIA 2OL3A 4O2CA 1GW6A 5JOPD 1HSAB 2CRYA 2ATPA 4NZJA 1AS6A 1F18A 1HH6B 3FQ2A 1FFNB 1RURL 1R33A 4KX8A 5HJGA 5C0JB 1THAA 4U31A 1DSFL 3PGDB 4ZUSB 4A7GA 3HNSL 2O4EA 1FFPA 5EU4B 5I6OA 5DS8B 4N90D 3PJSB 1DE4B 2QDWA 4HBCH 4U1NB 4BSVB 2R1YA 3EYFA 4G3YH 3CDFA 1U42A 3UO1H 3C60A 4BCYA 1T6VN 1ILSA 2E6JA 1Z9OA 2VTFA 4JDVB 3GRGA 2V3DA 5H94B 3IDXH 4L1BA 5E8NB 5HYJE 4JMXA 4WNSA 1U2CA 3KEHA 3ARGB 5I26A 1DYZA 2UVFA 2CUHA 4PJIF 1T1ZB 3S88L 5I71C 1NCDH 4YGVA 1AG0A 4WUUD 2AJYL 3NYKA 2Z93B 3ARBB 5J6GA 4JO1L 2CKBB 4NNYB 5E4EB 1E8XA 3LKRB 4L4VE 1FPTL 3C5ZC 3RTQC 3IMUA 3RPIB 5IHWA 2HVKA 3UTPE 5AZUA 2ZIDA 1PY9A 2EXWC 1E27B 2QQLL 4Y1AE 5T5FA 3U2IA 3ZKMD 1KB3A 2PYEA 3OKNA 3NIDE 3IRCA 3CFDB 4OZGF 4PSPA 1AOZA 1KCVL 5EZIH 1YNLH 3AADB 3Q8CA 1IIKA 2DOCA 1IGJA 3X3FH 3O45A 1N64H 3IETA 3W37A 2OJEA 4LSVH 4PG2A 3KBFA 1DFBL 4OQTH 3UO8B 3PIQA 1ACYL 2R2BA 5IKCA 1YEIH 3HLAB 1K4DB 3ZDZE 3CH1B 1MFAL 4MJIA 3O3BB 3MRLA 4XNYH 5C0RH 3CGTA 5ACMA 2CCVA 3HCVA 1BBJB 3V2AR 3FTGB 2XN9E 4LSPH 4M5YH 3QO0A 1OP5H 2B3IA 1AKJA 5LGHL 1J9SA 4PGEB 4KKLC 1UENA 3NSYA 3QQNA 4J3TA 2B59B 1F97A 4ES9A 3K6OA 4L3CA 1MWAB 3T4YA 4JO3H 3RY4A 3SDAC 2YC1A 5BO0D 2W9DH 1A6AA 1EFQA 2YD0A 2VWEE 1KIQB 3UTTA 4KMLB 2GHWB 4YDVB 3ARSA 4IEFB 3KPSE 5KSAD 1TNNA 3FONA 1I8MA 3NH7H 1R3KA 1JZDC 1EBAA 3U9UB 2PP9A 4BD4A 3D51A 4Q2ZB 4YC2B 4NO0A 2DEXX 1N7MH 4JM4L 3PF2A 5IG7B 3S5YA 3OHXC 3HEIB 3SE4A 5JHDA 1H19A 4GBXA 2LABA 3FO9A 1GPOH 1YN6A 4DOHB 3IAGC 1LE9B 3L5IA 1U8HA 2VERA 4ONOA 2VDLB 1VB9A 4ORGA 2P5WB 1O6SB 4DKDC 2GJJA 4FABL 4PI2A 5GS0D 4L0YA 1RY7B 5DQJA 3B2DC 3ARRA 4PIRF 5HDQH 1KFAH 2LW3A 3WLBA 5FM5M 3KCPB 1FGNH 4G8EA 1WLHA 4YSTA 2VC2B 4Z3HA 3EDKA 4EO5A 3WFHB 3R8BB 1EZLA 3PG2A 5D2LA 3DX0A 4AW4A 1KDIA 2JCCF 4C58B 5ICYA 4ZO7A 4V2BA 5FGCE 2KBGA 3UGUA 2VDPH 2YAMA 4OZHE 3V9CA 4X80H 1A9BB 4KKNA 5E8EB 1WBXA 3P69A 3FO0H 4KVNL 2YGOA 5EN2B 4ZMNA 1HXKA 4G6MH 4G71B 2ZSWA 4Z18A 1ZS2A 2GSIA 3BLBA 5GIRB 4YVUA 3TESA 4PBVC 2YPLA 5ESVA 5ABAA 3FMGL 4QT5A 2K9FB 4KHTL 3OAZK 4N1HB 5GRUH 4LCIL 1L9TA 2NY0C 5FECA 1A14H 3GEFA 5B38A 4GT0A 1COBA 5JA8B 4J6RL 5C9JA 5BCAA 1UB5B 1QFUL 2Z7YA 4Y2NA 4N2NA 1OTSC 3GSQB 5EBMA 4CMMA 2VISB 3BKML 4UT7L 3TJHC 4MQXC 3QH3A 3WO4C 5L2KD 1BG1A 1PLGL 2XVLA 1JNNL 1AVAA 1VFOA 5GGUA 1AYOA 3LN5B 5AAMC 1UA7A 1JN6A 1MW1A 2TSBA 3GWJA 4WHTB 1SUJA 3SOBH 4WW2A 5DJCB 4U6HA 3U30C 5I5MA 3RWJA 1G1KA 2P5EE 3FT4A 5EU7E 5PAZA 5TDOA 2WKOA 4FFYA 3DOIA 3HMWL 4O00A 4P5TB 5C0AB 4DFIA 4ZAKB 4HUVA 1RZJH 4JFZL 1E2ZA 5EZJB 2Y36L 3FB5B 1M4KA 3HNTL 4FTVE 2R8SH 4QLRA 3TNMB 3QIBA 1ZVYA 2PPDA 3DIFB 1AMXA 5HYJA 2MQGA 4K71B 3GNML 4ADGA 3T0XA 4Y16C 1OGAE 3T4AC 3MRFB 1HHKB 4FDWA 3C09C 1ETZB 5JDSB 3Q6FA 1C5CL 5FA4B 3JTTA 1FRGL 2CM6A 3ZPDA 4XXDA 3WUWG 4F7CB 1F4YL 5DYOB 2BCMA 4ZNEE 5KTEH 3OV6A 3CVBA 4TOYH 4HUUB 4NQED 3QPXL 4W9DC 4Z7NE 4L4VA 1SHSA 3DJZA 1QFOA 2AQ3A 4DVRH 5D4HA 3ABZA 4AEIL 1MFNA 3MV8B 4Y1AA 4ODXA 4KROB 4OGAD 2Y06L 4Y88A 3UTQB 4BSWA 4YSAA 3PWVB 2F9BT 3NJGA 2FIKA 1HE7A 4GRLB 3K1DA 4HWBL 4NYLA 2E56A 4PVMA 2Y1ZA 3RWHA 2FZ3A 5EBLB 2EZ0D 4NT6B 5FIEA 4EUPB 1X7QB 2P42B 1KCWA 2VMDA 3BOVA 2VAJA 4PRIE 1CFTB 4QGTA 2ZOWA 4MNHA 2OTPA 1NKGA 1QOKA 2HA1A 4B3EA 2X4UA 1I8AA 3EW3B 2XN9A 3KYNB 3QNXA 4O58L 5TK2A 4A6YB 1ONQA 1FE8L 1U8OA 1TFHA 4X6CB 3BAKA 1KTCA 2DD8H 4EKJA 3DXAE 4ZD3L 3H56A 3CFTA 3CZFB 2HJKA 1LO2L 1N4XL 1CZ8H 2P49B 1NM4A 3DRTB 2G5BB 1ROCA 2O1AA 4W93A 4BQ8A 4Z95H 1FI8C 1NGYA 2OMTB 3KPSA 4ZSOE 5IQ7H 1KJVB 3LV3A 4PJ7B 3E9UA 5I75B 1QHPA 1MRDL 4LVOB 4XMLL 5JZ7C 4RWYH 2A6DB 2MJWA 1OVZA 4DF9A 1AIFB 4GUQA 3WNOA 2Y4SA 3TP4A 2Z92B 2C1OA 4H88H 2VL5B 1N6QL 5I74C 2HFTA 1Q72L 2WP3O 1BPVA 1IGTA 5CS7A 2XX0A 2EE3A 4BFOA 4LOEA 2DQHL 1MF2L 3DYPA 5KVGH 3ARDA 2P8MB 2OJZH 1BP3B 2H3KA 2R0LH 3GSXB 3CVHA 2AK1H 5F7UA 3FQYA 3NIGB 3VA2C 2VLLA 5ADOL 4BK5A 1NFIA 4WDIA 3SO3B 4LLDA 4F7EB 1GGCH 5FFGA 5C0CD 3MBWA 4HLZH 3KJ4B 4JFDB 3RB7A 3MRRB 4IKIA 1IBHA 3WJJC 2BHYA 4J5VA 3R7QA 4KX7A 5DRXB 1XD0A 3QUZB 2LVCA 4HS6B 3SYQA 1I1AB 1OP3H 3ZHNA 4AX3A 5EIQA 1CGTA 4TLKA 1TJMA 4F27A 2FBJL 4EQ3A 1P7HL 3GXMA 2XVKA 5A2IH 4WO4A 1U58A 4OZHA 4FFVC 4W70A 4GSRA 3EH5B 4F1SA 1LEKA 4PRDA 3VWJD 1QI5A 3QDJD 1MCJA 4L9LB 4AQ1B 4QRRB 2K6ZA 4FLRA 4FQJL 4OY9A 3HI1B 4ZMXA 2ZYHA 2WBKA 1BF5A 1LMKA 3Q2NA 4NWUH 4PBDA 5GGSB 2FBRA 2ENPA 3AUWB 3RBGA 2YO3A 4HPOH 1FZJB 4L8BB 4NQVA 2ED6A 4NPYA 5ESQA 1A5FL 4FJYA 2DLGA 2WAQA 5E9AA 5HI5D 3FC8A 2JJVA 3HS8A 4HEME 1ET8A 5E6YA 1JCVA 3NVQA 1GMIA 3IJHA 1KY6A 3WFDL 1KBGH 1OALA 4AGNA 2P5EA 2WLLA 4JKPH 1WA2X 5J11B 3DMMB 4YH6A 3SEPA 3OZKA 5HY9A 5I1LA 5KG9B 1YEEL 4B6ZA 3DETC 1G9NH 1QLRB 1TTGA 2JV6A 2YKKA 3RNKA 3Q1SH 1ZLDA 3O8XD 4XMXA 1M6UA 2PLTA 3EFFB 2M83A 2W5PA 3E6HB 4FTVA 4A37A 4BRJA 3IS0X 1DQQB 1XFPA 2E9WA 2W9EL 5KSUB 3ZL4H 2KZBA 3R0MA 4OLUH 5TFSH 1NGQL 5DUPL 1I85A 4FF9A 1OE1A 3KPPB 3V9EA 4OCSH 2R39A 3IU3B 1OGAA 4AV0A 3C9NA 4JFQB 3DK2A 1OHQA 2BNRE 3FO2A 5D70L 5I1HL 2NUTA 2XFXB 4ZNEA 3IPEA 3O41A 4ZODA 1VEOA 1SOXA 4QKTA 3PJNA 5F7YC 2HFEA 2L7EA 3P0VL 3INOA 2GJ6D 4NOBA 1RUKH 3TVMA 1BZ9B 5EU5A 1D5XB 3JWNC 5C7XH 5L88L 2GUOA 2X4OB 1JK8A 4RFNB 2MQ0A 4HFUL 5EG6C 4YDLB 1D9KA 4JQIH 4X50A 3GXDA 1WT5C 4HH9B 3L4YA 4NZUH 5CCHE 4UAOC 2WO2B 2WP3T 1E9OB 3IFPB 3S8FB 5I1AB 3PDOA 2XV3A 4M43H 3CX5K 5LDSA 1W15A 2C9XA 1MHHA 1CYXA 4HHAB 3EYOA 4HJ1A 2H1PL 4NKMA 3WE1A 3BP5B 1SGKA 4AKQA 3KGTA 1QSEE 3BZEA 2H32A 1O9WA 2W0KA 4PRIA 2IWFA 2E9IA 4NKIL 2FQFA 3VFPA 1DO5A 3ZTNL 3LQAH 4WTQA 4P23D 2D31B 1TYRA 1UZGA 2B0SL 1JWSA 3CZNA 3NPSB 2EVJA 3N55A 2AABH 3O6FB 1X5XA 4I3SH 2A9AA 4KMTH 2HX8A 3DXAA 1VGKB 3M45A 3T2NH 3VXMB 3C5SB 3I6LD 4RZCA 2EKJA 3NDYE 1SDDA 2ZPKL 1HDMB 4MNQB 3MRIB 3BC9A 3MV9E 2VZTA 4HIXL 5KOMC 3EYUH 1IILE 5IW1A 4ZSOA 3JUYA 3PFUA 1ZHKB 3PUUA 4M1GH 4NZTL 4OF7A 2DQDL 4K5PA 5HJDA 1Q0XH 3WD5L 4CNIA 3ZZLA 1R5WB 2IADB 4HUCA 3L3KA 5A2CA 1JGEA 3QORD 2UWEF 2OQJB 5EIVA 2AZAA 3VXPA 4FXGC 2IXQB 4H8VA 3SDDD 4I85A 5D2NB 2R1XA 1SN5A 1D6EB 1MFDL 2NSMA 3FT2B 3N42B 1U41A 1KF9B 2VR7A 1BG9A 2DQFA 4U1MA 4Y1SA 3ZYJA 3RJQB 1H3PL 5CLWA 3MROB 1U91B 4JQXC 2PN5A 4F57L 3PP4L 3RRQA 1KEGL 4XNQB 1VZHA 5EO1A 1EA9C 5I19H 3PPSA 1ZK5A 4ZPVA 1TZHB 2J71A 3HKFA 3LN4B 2Q7YB 1BZOA 2CIIB 3CHPA 3RWCA 1AC0A 2BIIA 4ICXA 3V0WL 1WWWX 4G9DA 2Q20A 3W57A 5FDYA 3HPLB 5EOCL 5DUBB 3U2SA 4FQLL 2NMSA 2M26A 4HPYL 3C2AH 3I2CL 4LLMA 4XMVA 1T3FA 2WVVA 1IX2A 4F9PC 3S98A 2OAAA 3MUGA 1TTAA 1IGFH 1NCUA 3CX2A 3VFNB 3F7PC 1BYPA 2NXZC 1DVFD 3D08A 2B3RA 1IEAB 3TN0D 1HAUA 1VRSA 2PCFA 4N2OA 4X4XA 5LXVA 5T1JA 2EYTB 3WUZA 4NP4H 3EYVB 32C2B 4X8CA 3B7TA 3OF6A 3VXRE 2R0KH 3AT9A 2F7RA 5IEHA 3CSPA 2X6AA 1TTFA 3IDGB 4FEIA 4S1QH 5ADPH 2OMXB 4A7TA 1XB8A 4OH2A 2Z8RA 4UT9A 3VX1A 2VLRE 1BCIA 5H35A 4GG6B 1N68A 4FQIH 4PW4A 4HEMA 5TDNB 1J1OL 3WCYA 2P45B 1JG9A 2AEPH 4UQ2B 1NC2D 3MR9B 4WK4B 2CIKA 2JB6B 3BPCA 2OL3B 5D4QA 2V4LA 1YUKB 3E1F1 4C8XA 4AMWA 2J8UB 3RFZC 2FH6A 4G2AA 3S34H 1N6VA 1UM6H 1M7IB 1IGYA 2JKJA 2XXMB 4GQQA 4HV8B 4E42B 5KEZA 4J2XA 1T4WA 2SODB 4NO3B 3T0EB 1FFPB 4IGBA 5DWUH 3BVDB 1A2YA 3V0FA 1AQMA 2CKBH 2MKWA 4H44C 3TBTA 3V0JA 1MKFA 2BNRA 2R1YB 5D1ZA 2VDNL 5CGTA 4FGMA 1I7RB 5EHFA 3I9IA 4IOFD 3U0WH 5SWSE 1T6WA 4Z8FH 3DI2B 1NGPH 1CS6A 5FYLD 2GTWB 3GZKA 3QUXA 1F3JB 4KQ4H 2NX5D 5A3IC 2EDQA 2IWKA 1L7TL 3VM7A 4CU8A 4NQQA 1ULVA 4YGVB 1IZJA 1F3DH 1ID5I 3IDIB 1U8JA 3T0BA 4CJ0A 2EDRA 5J6GB 2NY1D 2VITA 2WO3B 2FB4H 1RH8A 3TONA 2ITFA 5LQBH 2HVKB 1JZ7A 3BCDA 5CZKA 3RKDC 1QSEA 2IPUK 4QR7A 5D1ZI 1KCRL 5LGJA 4ZUWA 1INEL 3VQLA 3PV6A 5SX5H 2FR4A 4WAFA 3MLPA 1AGDA 1IGJB 4Q6IB 4W9JC 3A47A 4RAHA 3IETB 1E4HA 2OJEB 1MWAH 5I6XB 3QBTB 1M7DB 3D0AA 5AVXB 2VM4A 1RZKL 2F54D 3DURA 3LKQB 3WTWA 3RGVD 4W4NA 3PIQB 3P3RA 2R2BB 5IKCB 4P5MA 4TQHA 5KZCB 1JNJA 4QKXB 2OMBA 2OI9B 2IOMA 3GXPA 2YJLA 5BS0E 5JTWA 5F6IC 3MV9A 2J12B 3UADA 5C6TH 2VN6A 2X12A 1RFDL 3DROB 5GSRA 1YNTB 1E7VA 1TG8A 3CG8A 4HS3A 4N8CH 2NZ1A 4L3CB 2DDQH 5JOPE 2VZ1A 2YC1B 3OGOE 1IM3D 5E1AB 5E4OA 3SKNA 1A6AB 2ZG2A 4CN1A 2EIEA 3LMJL 2K3HA 5GISL 5T33L 2VDLH 2J56A 1YEGL 4POZD 4EIBA 1MSPA 3R4DA 1AFVL 5AUMA 4OGYH 2WBJD 1R3KB 4DW2H 2VC2H 4IDJH 3MV11 4L0PB 4NO0B 2JKLA 3II2A 2IGTA 3EH1A 5FGBC 5JHDB 4J4PC 4PJDF 1C7SA 3GSNA 3ZHLA 4GBXB 3WXVH 3FO9B 3GLEA 3F5WB 5EF2A 1E6OH 1EHKB 1YN6B 2J21A 4UYQA 2DYPB 2JKTM 2QADB 1F6LL 1U8HB 3ESNA 5ISZD 1GR7A 4PGDA 3GM0A 1SFDA 1DQIA 1GC1H 1OCWH 3MJ8B 3RDJA 2BO0A 3QR0A 3NFNB 1IEBA 2VXSL 2OSXA 3FYEB 4QRFA 5ACZA 3WLBB 4WUUE 1W0VA 4X83A 3WN5C 4G6JL 3WG7B 4FQQA 2EH7L 3EF4A 4HQQL 1RURH 4OLZH 3WLWD 2ZJSH 2HKFH 3ULVE 1XR9B 3CVHL 5ICYB 6FABL 3BUTA 1B90A 5AVVB 1BD2D 2XTJC 4YSEA 3VXRA 5MP6H 2WYTA 3N6YA 3VG9B 3VDCA 1G7MB 3UGXA 2CDGA 4B9PA 1WBXB 4DP4X 5C0EA 3T2LA 4K8RH 4OBRA 5AW9B 3NT0A 1MLBA 5ES4B 3N04A 3NBNA 2GSIB 2VLRA 3UTZB 4Y8AA 5CEYA 1EBPA 2YPLB 5ESVB 4QT5B 1G84A 4KY2A 2Y25A 2RTTA 2IEPA 1HSBB 1J5OL 5FECB 3SO5A 1H3TA 5B38B 5EOTB 2BHUA 5HGGS 5C9JB 1F8TL 3N43B 4CMMB 4NI6A 3VJ6A 2UUDH 1WSST 2IFFL 3ZL1A 2IDQA 1WWCA 4B0MB 4NN5C 3OKOA 4KJYA 4MXVE 5CGBA 2DM2A 4LO9A 2YIHA 5GSVA 1K2DA 4RNRA 3Q13A 4Q0XH 5GGUB 1AGEA 5JPNC 3LH9A 4DKTA 1JN6B 3S36X 3D06A 4ZFQA 4WW2B 3BKCH 2GBAA 3Q9QA 4U6HB 2EC9T 3RWJB 4DTGL 5KBMA 2ITCA 5I73B 4EE2A 1E6JL 2I32A 3ILQC 4Y9FA 5CM1A 4HUVB 1LO5A 1T04A 4PJ7F 4KRPD 4N8UA 5DVPA 3AROA 1DFBH 3QIBB 1EEUA 5SWSA 1ACYH 4RAVA 5HYJB 2G75A 1ORSB 4ZW7A 2X89D 3C8HA 2PYFA 4R4BA 2M2DA 2ICES 3Q6FB 3JTTB 3CFMA 1OE3A 1Z9SA 2FQEA 2XV6B 4XXDB 4AYSA 5ABZA 4EZJA 1K5WA 3HS0B 3BIKA 3D3VD 4JVPA 5B39A 3D33A 3VE0A 3VWKA 4B7LA 4F7TA 5I18L 4EUPH 4Q9QH 4AYFB 1KPUA 4L4VB 3DVIA 3LNHA 3NIGF 5DJ2A 4JY5L 1NDTA 3GT6A 3OXSB 4NNPL 4UF7C 3VFWA 3NJIA 1MAJA 3VD5A 4DZ8A 4Y1AB 4ODXB 1FYHB 2NY2C 3LHPL 4HHGA 2VXQH 4XXCC 1QKZH 4BSWB 4K3JL 1RLWA 2YQ2A 3QCVL 4TYUA 3R4RA 4ILDA 4LHJB 5HHMB 3VXNA 4HS8L 4A2FA 1A3RH 1FVCA 4BK4A 5AENA 5HYQA 3CLFL 4ODHH 3ASOB 2FIKB 1X9UA 4OFPA 5AOMA 4XB3A 4QHMA 4JN2A 1DL7L 2FZ3B 4JG1H 2QSVA 1USQA 1CF8H 1A4KA 2XKNA 3AWEA 3VFVA 3ZDZB 3ELQA 2A9ML 4MNHB 3QEQD 4DN4L 3K5RA 3PWLA 5BS0A 3EO1A 5EULV 3K3QA 4TVPH 1KTDA 1CE6B 2XN9B 3GHBL 4NZRL 2N56A 3UG4A 4U1HB 1ONQB 4OIIL 2NR6D 3D50A 2Z7ZA 1U8OB 5IB5B 2YJQA 4LQFL 5CEZE 3HC0A 4Y5XC 5KVEE 4IRJC 2DEYX 4JM2C 1BX2A 7FABL 2A9CA 1IU1A 2HJKB 2HT3C 4UBDD 2F61A 2H3XC 1N2RA 4XN4A 2RA1A 4Y9EA 1QASA 4PJFF 3LV3B 3FXIC 2BFVL 2BIPA 3BZFA 4NQDB 4Z78B 3DYMA 2VLMD 1FA4A 3GI9H 1PAZA 3T6XA 5F1OB 43CAB 4KVNH 2WKGA 2O5XH 1A6VL 5EB9A 2NY6B 1SMDA 2ODHA 3ILPA 5E4IA 1MW3A 1F11A 2CO7A 2X38A 2XQ0A 4BZ2A 3U4KA 3FMGH 1IGTB 4ODTH 2OK0H 3ARZA 4P3DA 5AVYB 2QVTA 3ARDB 5D7IF 3HFML 3IFLH 1FFTB 2ZG3A 1JK9B 3VD1A 4LPVA 3L3HA 3TPUA 1T5KA 2K3TA 2VLLB 3DGGB 4N0CD 2GYSA 3MKGA 4MQSB 4UT7H 2C9VA 1I7TA 4WDIB 4LLDB 5T1DL 2CCWA 2CUMA 5IBTL 3MBWB 3TWCL 2YWZA 4WUUA 4EIGB 4M48H 2OTUA 2QT6A 4NQEE 1KELL 4JRYB 2VMJA 4WFED 1MI5D 4KJWC 4DN3L 3PPEA 3BGAA 3EG9B 3X13A 1WTLA 3KM1A 4PEEA 3NCYP 1KPVA 4TS6A 5AQ0A 1N5AA 3M17A 3GUTA 2Z1KA 5TF0A 5F7EL 4H2AA 4U1JB 4WO4B 1U58B 4JFZH 5HJBA 1NIAA 2Y36H 3QJSB 4J1UA 2XLLA 25C8H 4YK4B 2Q3AA 4PWFA 4S2SA 5IUSA 1FL6A 5DO2C 1VKXA 2FQDA 5DMGC 4RFOH 4U6YA 1NOFA 2C3HA 4QDGA 2FWLB 3GNMH 3MLXH 3O6MH 1UD6A 3BAIA 3BWUC 4AVHA 3K80A 3QQDA 3WIAA 4Z7VE 4LBAA 4NQVB 3US9A 5FYKH 1SUHA 3MBEA 4N6RB 5FUOL 3UX9B 4NPYB 5ESQB 3LZLA 4HJIA 2C4FT 4EI5C 4L8CA 3SODB 4FYQA 3AG1B 1XH3A 3NK3A 2WOBA 3VGAB 3KXFE 2X0UA 3IJHB 4AEIH 4P4RB 2P5EB 5JW4N 1JD9A 5I1LB 4WCYL 5FO8A 5HY9B 1MFCH 3EADA 1UZ6E 3OQ3B 3RNKB 1WFNA 3CDYA 1JFHA 3IU4L 1FDLL 1WFTA 4FTVB 1BLIA 3RVWD 4HMCA 3R18A 3F7LA 2X3BA 3VXQA 4CW1A 4MB3A 3VSVA 3N9GH 1QUPA 1MCWM 3ZE0E 1NLDH 2XZQH 3C9NB 4DKEH 1TYJA 4KKCC 5IB1A 4MRBA 4P2OC 1KN2L 1IGIH 1QQDA 4NWTL 1YY9D 3FO2B 3D0VA 1TQWA 4XT1C 1GTNA 2NUTB 1GYUA 4Z7IA 3FSAA 3DUSA 3MRBA 4NKDA 1X9QA 3O41B 4YHPA 2OZ4A 4D0BB 4PP2B 4Z7NB 2VDRL 3SQRA 1WFOA 2HFEB 2HFGH 1FH5L 2HPOA 1LO2H 3HHMA 3TGXA 2DF3A 3BWSA 1G7QA 3RVUD 4BRVA 5EU5B 1EGJA 4FXKC 4P2RD 1JK8B 1XSJA 1E4WL 1D9KB 4FTDA 3A6BH 5DMYA 3D85D 3LXUX 2MFNA 1LHZA 4Z7WF 2UYLB 4OCXL 1MRDH 1X6NA 3PDOB 4XMLH 3HE6B 3L5JA 1MHHB 4JQVC 4NKMB 3EYOB 2K45A 2BVPA 4AQEA 3EO0A 2QVFB 4AH2A 4PYHA 4NNXA 1N6QH 2H32B 1RHFA 2ZCKH 4FZEL 4PRIB 1TR7A 1FZKA 4G80B 3MUUA 3V6BR 3VFPB 5AB2A 3T09A 2VR8A 3IGUA 5DR5H 4BE6A 2CUAA 1OLLA 1Q8MA 2XRAL 5CLYA 2VRAA 3IDNB 3RVVD 3I50H 5E9NA 4L4TD 3GXIA 3NPZB 4I18A 2CJUH 1XXDC 3IN0A 5SX4H 3VI3F 1BAFL 4ELMF 4O2FA 4WFFD 4JO8A 1NJ9B 3SY0A 5A16A 5C2UB 1ID2A 1SDDB 4KZEL 2ZUYA 3ARWA 4AW7A 5FHBL 4P9ML 3T6WA 2G30A 4JHWH 5MHSD 3KPOB 1PDKA 1E5UI 4ZSOB 1X5AA 3L8QA 4XE0A 5HHNB 3SDCB 2FBJH 4UQ3A 4LCWD 3L3KB 5IB3B 4Y4KD 3GQFA 3VXPB 1PD0A 3BN9C 2B08A 5EZLA 3U4BH 4N4YB 2CO6A 2FX9H 5DJ8A 3PXHA 3SSGA 4LEXL 4QEGA 1V55B 5INDB 2DQEH 3WHE1 3W5NA 2DQFB 1PNDA 3BVUA 2RH0A 1XH0A 3CSTA 2VW7A 1WDAA 3EHBC 3M1CA 2NDGA 2YD5A 2N59A 5EO1B 1LWJA 4KFMA 2EUZA 1HYSD 5EEUA 3L45A 1OD9A 4ZJ9A 3RWCB 4PGBB 3ZGHA 4G9DB 4MXQC 1K3IA 3MTXA 4WFHD 2PWFA 1J7VR 4NQEA 3LQZA 3O3AB 1AD9A 3WNJA 2FLBT 2XPGA 5KYUB 4M6NL 2GJ6E 1XMWA 3WFDH 2PR9A 1UWEH 1N8OE 1TJGL 3DX9A 4JZJA 4LLMB 3WXWL 3RWGA 5F21B 1HT6A 2WVVB 1YEEH 2V9TA 3UAAA 3QJHB 3ZBMA 4MFHA 4Y5VA 3Q8EA 3FT9A 4XP9L 3O6LL 5ICUA 3EOAA 4U2YA 4QHPA 1BQKA 2W9EH 4X4XB 1I8KB 3VNYA 1JZJA 4O5LL 3WSQL 3ZRSA 5DUPH 2DW5A 1IT9H 4U0RC 5B3JF 1ZLUH 1F42A 3AS0A 1G1OA 2OL3H 5I2IB 1MJ7L 5KBLA 3LPFA 3VCLB 5J9PA 5I9QB 3SPVA 3HAEA 2CXGA 3L3GB 4Z7VA 4TUJA 4TUUA 2AMGA 1H9DA 5ENWB 3L7FB 3KVPA 3CZSA 3LRGA 3TFKD 4KTDH 3KXFA 3I6LE 5L88H 2YQBA 1KCBA 3RPKA 5E5RB 2ZNWA 3FRUA 3EBHA 4HFUH 1ZLVH 3VI4F 4B9CA 3QXTA 1NIBA 1WZKA 3ULUF 1KTRL 1SVBA 1IB5A 4UTBA 4P3WA 3FBKA 5G4OA 3SE8H 4LSRH 2E7HA 2IFGA 1RZGA 3UYRL 1E5ZA 2JXMA 4XP1H 5F2FA 4ES8A 1P6AB 3NZHL 1ZLWK 1IGYB 5KVFH 4ISVA 2JB5L 1IKNA 1MW0A 2A4CA 3ARXA 3TEZA 1OGPA 3BH8A 1QPXA 2HMIC 3O2DL 4E9YA 5D96B 1AQHA 3ZE1F 1C5DA 1JRHI 1MCLA 3O0RH 4IGBB 5TQ0L 5HDBE 2B5IB 3OX8A 3ZTNH 3TBTB 1V5JA 1E40A 5DD0L 2BNRB 5D1ZB 4JGJA 2A9BA 1M71A 4QXVA 4QHNA 5FK9A 1JPEA 5FLUA 1IC7L 1D7FA 2F19H 5T5FH 4I0KA 2GW5A 2ZPKH 1CGVA 5A6LA 4IMKC 3QUXB 5F88B 2AI0L 3LS5H 5ITFB 5HVFB 1IEHA 2DQTL 4D0CA 5C3TA 4NZTH 4QHKI 1I75A 2DQDH 3HG4A 1O5PA 3NESA 2VITB 3F62A 5GJSH 2C9SA 1S8DA 2KI6A 1AE6L 3M8OL 5B3SB 3FFCB 1H6TA 4JFFB 3ULUH 4R2GB 1QSEB 1NAMB 1MFDH 5LGJB 3VWJA 1YDPA 5G4MA 3KYKL 4ZUWB 2VLKD 1IM9A 1Q1PA 1BFSA 3HVDA 3PV6B 4W9ZA 5D2LF 5DK0A 1H3PH 3BAWA 1LK2A 4K94H 5IV2A 1AGDB 3FU5A 3L9RA 4Z7OB 1U8CA 1FNGA 2EE6A 5E2JA 4APQD 5D1XB 3U7WL 4ZQKA 4XC1H 3MRNA 2F53D 3QFGA 4JHVA 3L9EA 4XPFL 3ESPA 4P5MB 4KXBA 5C92A 2NY3D 5EOCH 2HXAA 2EEDA 4GINA 1JI1A 2Y7NA 3LEYL 4XMKH 2EXTA 1HXMA 2A6KB 4JGUA 5DFWH 3MV9B 3I9AA 5TGBA 3EZJB 3PV7A 4EIZC 5GSRB 3ORJA 1B88A 3OB0H 3IDYC 2YKLL 5DZ9A 3H3PL 4HS3B 5CWSA 2X9YA 1KENL 1JDDA 3DV6A 3O8XA 3CXHJ 1A1NA 2C7UA 2A6IB 1A7RL 4YQXL 1XVSA 1UCTA 3EJTA 5AUMB 4NC2B 2XYCA 1T6BX 1EJ6A 2XBTA 5DI8A 1PCXA 5CXPA 1TTCA 5EO9A 3FL7A 5HHXH 4MB5A 1JYNA 2ORBL 4XXWC 4LKXA 1ZKAA 3EBIA 3GSNB 4BFBD 2ZX6A 2E7CA 2ZAIA 3U1QA 4UANA 4CVUA 4N3UA 2WCSA 4W9EC 3QULA 3B3IA 5JIHA 1J1OH 5F9OH 4PGDB 2AV1A 2GJ6A 3HB3B 3HZYB 3SB3A 3V0AC 3TZVD 4LT7A 4AZ8A 3QA3B 2QLYA 2NX5E 3T5WA 1WS8A 4DGIL 2XHNA 1G7JB 3IMWA 5ACZB 3WY1A 1ZSDA 2BRRL 3BO8A 3FH7A 4BZ2L 2XSKA 3B34A 3VB9A 4FQQB 2WCGA 3CHQA 4LF3A 3E8UL 3HI5L 3WNPA 2WXIA 2X70A 3I74A 4LLAA 4QO1B 3EGXA 1J86A 3ROOA 4Q7DA 1P0SE 4YSOA 4FN0A 1YMMD 2HZHA 3K91A 3VXRB 2Y9RT 1NFDE 3CLEL 2MCAA 3K4ZA 3BT2L 3NIDF 1U6AH 4BQ9A 1KV7A 1DQML 2AC0A 3BSZL 1TDQA 2L0DA 4I0PD 3S7GA 2J73A 1MLBB 4HZLA 4RDBA 2NY4C 4BHUA 1TZIB 3BMVA 2VLRB 3ULVL 4PMFA 3GKZA 2QSTA 2F54E 4HCIA 4ZOEA 2YGVA 4K7PL 4PJHE 4RGOL 4GKZA 5B1AB 3DIVA 1JYXA 1N6UA 3VXUE 1D6VL 4N8PA 3ZDZF 4BFNA 4ZX3A 2YR3A 3U1PA 1IL1A 4FEMA 2X53A 3BUPA 3DUUA 3VJ6B 2L3BA 4AQZA 4EIUA 5HVHB 1X5MA 3OKOB 2PNDA 4KJYB 4M8UA 4XVTH 2ADIA 3BAEH 3O9WC 4QF1A 1K2DB 4RNRB 4XP4L 5GSVB 3KAAA 4XVUC 1VACB 1T5WA 1AGEB 1HX0A 2IG2L 4AKPA 5DMKB 4MMZA 4HG4K 3BRGC 3RIKA 4WGVB 4AQ8A 4JPIA 4U7KA 3SDDA 5JPMA 4JE0A 1VESA 4XI5C 1ZJAA 1AZNA 4ONGH 1FZMB 4OIAA 3P40A 2E47A 1LO5B 1PZBA 4ERSL 2I9LB 1NCJA 1T04B 3EDFA 2VDQB 4E0RB 3PYCA 3GIZH 1WISA 1HHIA 5EUKB 1U93A 2YOCA 1RZKH 1T20A 2RCSL 5SWQA 3UAFA 5IW6A 3G5XB 3SE9L 4UCFA 4RAVB 2G75B 4GAAA 3S97C 2PYFB 1TUPA 2XXFA 1G0XA 3K4DA 2QKIA 1JDAA 4ZTEA 1UFGA 2BK8A 4YHLL 4QRSB 2YMXH 4OF8A 3SZKC 3X1NA 3DHMA 3QQ4B 4N2LA 5ISZE 1RFDH 4BFIA 4PJ8A 1L0YA 5F1NA 5F7FA 4NBXB 4WWKD 5B39B 4JFHD 3VE0B 1AOHA 3VWKB 1MCOL 2BWQA 5EU3A 5TE6L 4NHCH 2ZUXA 3DOSA 4N9GA 1LO0L 2DBLL 2WQ8A 3ES6A 2H6OA 1I7ZB 3ZKXB 5DC2A 4M1CD 4DZ8B 2D8KA 5GISH 5T33H 1L3WA 1KLUB 3RTQD 3V5HA 3DTXA 2YARA 3U48A 4LOFA 4M62H 1YY8B 3KR3L 1WHPA 1RAMA 1GZHA 5K1JA 3CFBB 1FVCB 1IC4L 2N7BA 4FMKA 3JUZA 5IWLA 1CJYA 4PI0A 4NJ9L 4OKDA 5CFHA 5JYLA 4QHMB 4ZS6C 4JN2B 3VW3L 2HP4A 4OZHF 1SJMA 4O2EA 1TU2A 3VFVB 4WKZA 1A4KB 1E4KC 4Z0XB 2AXHA 2DJMA 3BP6A 1EVUA 1KIUA 4HPHA 1K9TA 5E7FA 1SJHA 3PWLB 4QYAA 5BS0B 3DX8B 1Y0LB 4LBEA 5D6DC 2WUBL 1KTDB 4JUSA 5BV7L 3IJEA 2I85A 5D71H 4F20A 1RHHA 2V2TB 4LOUC 2QZQA 4H8QA 4HKZA 3HC0B 4GAJL 5CJOL 4BIKA 5KSAB 1UH3A 3J7HA 1BX2B 1MELA 3FAXA 3IDUA 4J2QA 4KK9C 3BPNB 4QTFA 1J8SA 3DPBA 1FAIH 4HQQH 3MXWL 3RWIA 4WI8A 5I1CL 3CVHH 3SDAD 1JPTL 4RAUA 6FABH 3D18A 4XHJC 1CG9B 4LPYA 4Y4FD 4Z3TA 5CEZL 3GBNL 2J1WA 4KGLA 5KVEL 3VH8A 4KKQA 4PMEA 1PLAA 2YRZA 3MCYA 3MLUL 3GMNB 3AREC 5SV3A 2RD0A 1UGKA 2PWHA 4L1HA 5D9SB 5DD3H 1EQWA 3KPTA 2R1WA 1OLZA 1DBKL 2D03H 5IVZB 5BRZD 4OI9A 1F11B 4IOSD 4HJTA 1WEJH 1K6QL 2PPCA 2WHVA 5KVDE 1XF2A 3PQYE 3EGDA 2BW4A 3QNZA 1AGBA 5DO8A 4M6MH 5IBUB 4RMVA 4KVCH 5FFOA 3RLSA 3V4LA 3FCUB 3QXDA 1HC1A 4D3CL 2BJML 3L3HB 3Q01A 3TPUB 2NX5A 4Y4HC 3PWNA 3HRZA 5I16A 1OAUH 4WUUB 2A83A 2G3NA 3D3VE 2WLIB 3KLQA 4Z7NF 3F01A 5IFJA 2HTKD 3KHQA 1U8IA 4H25A 2EIMB 1ZT4A 2FD6H 4DTGH 1AP2B 3TEYA 3BPLB 2GHZA 3EUUA 1DVXA 5C7ZA 1N5AB 1EO8L 5AW6B 3GUTB 1F45A 1NFDA 2HB0A 4QRAA 4AIOA 1CBVL 1E6JH 3QI9A 3MNZA 1OB1B 2BOLA 4J1UB 5J3HC 2V9RA 2CR3A 4JM0A 2ZYRA 4S2SB 1FL6B 4YHKL 1VKXB 2GT9A 2FLMA 3L2NA 4U6YB 1OAZL 2Q8BH 2F54A 5MEQB 3CPLB 3F12A 3B1TA 3UG3A 2AJVL 3SBPA 2IH3A 4PJHA 1J0HA 1PTZA 3VXUA 3F7VA 3CCHA 3LKPA 3QEQE 2XIBA 5E7BA 3OBAA 2D4DA 1Q38A 1C8PA 5I18H 1QMUA 3ABKB 3TJPA 1OTSD 4L8CB 1XH3B 3TJHD 4NNPH 4MQXD 1MIEL 4OFVA 1LMIA 2BSSA 4HUXB 1U92A 2P46B 3SQOL 3I6GA 3DHJA 2CDFA 1NMCC 3BP7A 3P02A 3X14B 2VZSA 5FO8B 4KDWA 3DX1A 4YHNA 4K3JH 3P4MB 3QCVH 4FXTA 3U83A 2NW3A 4HS8H 2EABA 2NNXA 4J28A 5HDRA 3T08A 4BDVB 3CLFH 4YHYC 2JJSC 2YAEA 3DKHA 2WBJA 5K59E 5E9DD 2WXPA 3VXQB 4CW1B 5DZLA 1FQ9C 3V4UL 4DPBX 4JCLA 1N70A 4MS8C 4RGND 4UTBL 2EP6A 2A9MH 3KYMB 4WSGA 4BJLA 1LILA 1I9JH 4JW3A 5IB1B 3L9BA 1LP9E 4ZUTA 4JVWA 2J6EL 1ZJBA 1HQRB 4PS8A 3D0VB 3WKMH 4Y16D 4KKBD 4UM9D 5ISZA 4OIIH 1HKFA 1O75A 3DUSB 4B9KC 4OZFG 4LL9A 4TQIA 3LN9A 5ESAA 4LQFH 1MEXH 5J8OA 3U4EA 5C6PB 2YAPA 1A7QL 2H32H 4KY1L 4P8QA 4ZNCD 1Q9OA 3UDWC 3HN5A 4QXUH 4QPEA 4OZFA 2O61A 3BH4A 1U8QB 5I0WA 3H85A 1TTUA 1MI5E 2R59A 3VTAA 5AW5B 2BFVH 1LYQA 1R3LB 1NGZA 2QDVA 4OJEH 4X5RA 1MJJA 1S5HB 3MODL 2XYBA 1A7NL 2AEWA 3V4VL 1A6VH 4AQEB 1SM3L 2VH5H 3EO0B 3Q3GA 1KB5B 3K81A 4AH2B 4KI5E 4NNXB 2ATAA 4PY7A 2ZKWA 5A7EA 3WI9A 4HBQA 1L6ZA 4W9HC 1FZKB 2JSFA 5ALCH 5DK2A 5DUJA 2ZF8A 4JFXA 2VT0A 4KITB 3N85H 3HFMH 4ZK8A 5DA4A 2WXOA 4GJTB 2QPSA 4P4KD 5JR1H 1TQSA 4I18B 4X5QA 5T1DH 3CN0A 1NCTA 3FCSA 2XZAL 5IBTH 5F7AA 3TWCH 3W9EB 3X1EA 4ENZA 3KL0A 4RA0C 1EJOH 3TO2A 1NEZB 1XF1A 3T6ZA 5I24A 4FFZA 5L2KB 3RU8H 4G8GD 3MUHL 4XWOD 1KELH 1YNKH 3G6JA 3JWOL 5DGQA 5K5YA 3PL6D 2DI9A 4PRAA 5GGRB 4DN3H 4AGQA 1EAQA 3CU1A 1T03H 4X0KB 1MDTA 4WFGE 4IKKA 1MFMA 4UQ3B 4JRXD 5CZXC 1HN1A 4X9YA 3SN6N 4Z1PA 2CO4A 2XWCA 1IV8A 1MCSA 5C07D 2ED8A 2BNUB 1HFUA 3ARGC 5DJ8B 5JZ7D 3N3EA 4HALA 1BJ1J 4IBYA 2EXYC 5MEPB 5IJVA 5CJQH 1TMQA 1JWMB 3H6JA 1ITBB 2CLZA 2Z34A 3Q5OA 5DZJA 3AS2A 4PP1C 4G7VL 3WKQA 5E4EC 4OQ1A 3L48A 3TXAA 3GINA 4YPJA 4FI7A 1XX9C 2GK0B 4ZDHA 2VZVA 3D48R 1B4TA 1TQUA 4FNUA 4NENA 4ENEC 3D3VA 3LQZB 3UBFA 3VFSA 1HOEA 3U46A 2Z35A 1NDGB 3LSOB 3K7UA 3RWGB 1Z7JA 3SJVE 5AD0B 1WA0X 2WW8A 4Z7AA 3PDDA 3SBWA 4X6BA 4P46A 4R6UA 4UT9H 4IBTA 1AANA 4XZUA 4Y5VB 2D3JA 3RUGE 3L6FB 2D9QB 3FQWB 3DBSA 3S3BB 3KM2A 1BEXA 1KJ2L 1FDLH 4HCRA 4DJMA 2FWSA 1RIVL 2VR5A 3EOAB 3PABB 4DNLA 1EHNA 2R69A 1FNSL 3KWUA 5E1HB 4XC3H 4YBHA 4O51A 4L8DB 2MOGA 4EPSA 3L95A 1XF4A 2P8PB 5J9PB 3HAEB 1KN2H 1AI1L 1NC4D 4Z7VB 2KMWA 4C55A 5ID1A 4TUJB 3QEQA 4OUUA 3WKNA 4O02A 2K6WA 2X0WA 4LLYB 4NHUB 1BFVH 2VUYA 1GSMA 2NR6A 2VDRH 2XTSA 1YYCA 5BZZA 4GQPH 1UT1A 1A3LL 4WFFE 2H2PD 1ZVSA 3H7LA 2XVBA 2QV2A 4YC2C 5I28A 4OCXH 1CDUA 1RZGB 1KGXA 2GFBB 2JXMB 1BQ5A 3DETD 1NCWL 3O2VH 4E9XA 3C12A 3H42L 4LCWE 5E2UL 3SPHA 4NJAL 4YAQA 1CVSC 3FNKA 1PZDA 3LHAA 3PP3K 5CLXA 3AS1A 1C5DB 3NZ8A 1DJZA 2ZP0T 4F7MB 1XGRA 4XMUA 3RPBA 5L4FA 1EMTL 1LP9A 2C26A 4BZ1A 2HAZA 1P1VA 2BP5M 1OZTG 2XRAH 2WLZA 4A67A 5DZAA 3HVNA 4N8VA 3NCWA 2XXGA 3AMLA 4AENA 4JFED 2ICWI 5BRPA 4MZIA 2JK5A 4KZEH 2D3LA 5C0CB 2CUIA 5AVWB 3CFEA 1A9EA 4P9MH 5TJWK 3PWPD 4WFHE 1WPCA 4D0CB 1JV5A 2AJ3A 1MI5A 2JELH 1FCCA 2VERN 4XP5L 1NGWB 5GGVL 3A0OA 3ZT7A 1C8QA 4ALAL 1S8DB 4FZ8H 4YPGA 3S37L 3JV6A 3S5LG 1JP5A 4I89A 4TNGA 3LH2L 3VWJB 3QDJB 3QHFL 3FCTB 4F2FA 2V5TA 1J8KA 3QR1A 4NUJA 5DK0B 5IV2B 1LK2B 1FO0A 1OT1A 2WXGA 1U8CB 3L9RB 4WY7L 1FNGB 1CI5A 5IIEA 3MOAL 3B6SA 3MRNB 5IROC 3GTNA 1JF5A 1DP0A 5JUEL 5E08H 4CGTA 4GB9A 3INUL 4X42A 4F8OA 1QEWA 1IGML 1YN7A 3NIFF 3QWRD 4KJQC 4P5TC 2MHAB 1HXMB 4M6NH 5TGBB 2YD6A 4KXDA 2IGFL 1TJGH 2QTVA 5DQ9B 3WXWH 2R0ZL 3FCBA 2ZSVB 3EJSA 3UACA 1VDGA 3GSNH 2A77L 4GS7B 2ED9A 5F3HA 1OPGH 5CWSB 4PY8I 3THMH 3EDDA 2AQ1A 2OMZA 3HZKB 4LNRB 4LSSH 4K71C 4XP9H 1NMAL 2V5MA 3Q6GL 1BZDA 3DV6B 1RK0A 3F58L 3O8XB 4LDCA 1A1NB 4XPBL 5BVPL 4CU6A 4NRYA 1DQVA 1T89A 2C7UB 4K07A 4JKKA 3VGEA 4O5LH 3VU2A 3BYYA 1KNOA 1L0PA 1S9XA 2ADJA 3MRGA 3MLRL 5EOQL 4QHLA 5DI8B 3MFFB 5FOBA 5HYSG 2VN4A 3FU0A 5EO9B 4PGCA 5DLLA 5CUSL 3EFOA 3NCBB 1MVYA 5E2VL 2WZPD 1SJEB 2XKUA 4LKXB 3QZMA 4QWWD 5E6UB 3KEDA 3ZT6A 2E27L 1HZHL 2EACA 3EOBA 1IKFL 4KDTA 4RQQA 3P2DA 3B3IB 3QULB 3LNEA 3SDYL 3CD4A 5HGAA 2GJ6B 2MTPA 4AZ8B 3K1KC 1YO4A 3ASWA 3SJVA 4O9HL 2W65A 3RUGA 3U7YL 3D85A 2ID5A 5IREA 4X5LA 5T3XL 3UYRH 3K46A 4NIKB 4NAMA 1H6FA 2EDBA 3G08B 3NCJL 4X6FA 4AM0A 4JL1A 2X70B 4X6DB 2WLJA 3OWRA 1HWWA 4F93B 1PX4A 3H9SD 1MY7A 5TQ0H 5CZVL 1UQSA 3CIQA 4LP4A 4DGYL 2EDJA 3S5ZA 1I3UA 5DD0H 5D1QC 2DS4A 1QW8A 4P23B 4HZLB 1J1XH 3TH4T 3C08H 1OAQL 1IC7H 1U8LB 2V2WA 1UB6B 2PWGA 5INCA 5C71A 1BZ8A 2XBDA 1U3HD 4JLRB 4KDVA 4ODUA 1U4EA 5AEAA 4HOMA 3CMGA 4GKZB 3GMQA 1F90L 4UOZA 4G6AC 4WI0B 1VFUA 1IL1B 2Y24A 4RMUA 4LARL 4YE0A 4K3HA 3BSGA 1XGPA 4GMSH 3ZKSD 4QF1B 4CC4A 1A64A 4R97C 3H53A 2CO2A 5IJKA 1AE6H 2QHRL 1E4XI 3M8OH 1YCSA 4LCWA 4PTUA 5DQDH 5FHAL 5BJTA 1IC5L 4Y4KA 5IQMA 3QORB 4JPIB 1P1ZA 2FVNA 1NPUA 3SDDB 2B16A 5LJYH 1GCFA 5HDBB 4B96A 1HINL 2FX8L 3DJSA 4QXGL 2VRKA 4U0QB 4LESA 4URTB 3LRLA 3FQXB 3U7WH 3KJ4C 1ESOA 1T20B 4DP1X 3QK0A 4A55A 4XPFH 2BY2A 4G11A 3EAKA 3S35L 4A68A 3D4GA 1CT8B 2X44D 4ZUVA 5GRVL 4PREA 4XNBA 4QXWA 3NSCA 2QKIB 1L4IA 2G3XA 3AG4B 2NTSP 2ICWJ 2E0PA 4MDIA 4PUBH 4YIQB 4Q9BA 2E7DA 2WWMD 4F2ME 4ZS7L 2NNRA 2OXHB 3FQ4A 4YXHL 3TT1H 5AKSA 1MFEL 4AQAA 4L9LC 2WXLA 4IKJA 5BV7C 4NXKA 4PRBA 2AQQA 5EU3B 3RFRA 1CGUA 2IH8A 3X11A 1KENH 3RDTD 3ES6B 2YEZA 5TE7H 4AK1A 1FL5A 1DVFB 1CD1A 3K5SA 1BV8A 4A7UA 2R27A 4OVVA 3TN0B 2BP8B 4XCCL 3VQ1C 4YQXH 1A7RH 3DTXB 3V5HB 1EXUA 1VJSA 1YEWA 4WVRA 3I3EA 2AJXL 3JQOB 4J12A 4N3TA 3ULVF 2JE8A 1R3IL 2HT2C 1CFSA 2C8NA 3ESOA 1YMME 5C0DA 3TIEA 1U8PA 4L9DA 1XF5A 1B3IA 1RJYA 3H0TB 4J8RA 1EVTC 3UJTL 2ZX5A 5DJZA 3SKOA 2CHDA 4XTRC 1B6UA 1TU2B 4WKZB 3QISA 4YHIA 4PV1C 3BP6B 1KIUB 1ZV5A 2UZXA 5J11C 4L3AA 3L5WA 4P2QE 1UTDA 1SJHB 5JDJA 5I1JL 3VUAA 1BSIA 1IAMA 2IOOA 2YAFA 4LBEB 4WKXA 4AEHL 3CN4A 4TPRH 4QRPE 2TRHA 1HZLA 2KH2B 4DGIH 4MBRA 1NC2B 5FX3A 4K2UL 1KIRA 3DVNA 3IPBA 1JCKA 2BRRH 2VIRA 4UINL 4BZ2H 2E86A 3ZTDC 4A1RA 2EICA 1MH5B 3HI5H 1WITA 4LFHD 4IJ3C 4MXVF 3RWIB 1NLBH 1UWXK 4RAUB 1PLCA 2V0AA 4JFTA 3D18B 3EYQD 4XCYB 1ILUA 1ZIAA 2QGEA 2OMUA 2HPTA 3CLEH 1IMHC 3VH8B 1MNNA 1CD9B 4D8OA 3BSZH 3V6FA 3PHQB 5E24E 4L5FE 2DLEA 2UZYB 4NUMA 3ULVH 4X4ME 4D0DA 4D9QE 4X6EA 2VXUH 5TH2A 1L6PA 4RFNC 4YDLC 4KQ0A 3O3UN 2DQUL 4B9GA 3EGDB 2VJXA 1WUZA 1NSNH 3E80A 2BY3A 1EANA 2MKLC 1QHQA 3HTLX 2F58L 2QVKA 3V95A 1T21A 3GXNA 3QXDB 5D93B 2JCCE 3OWEA 5IB4A 4WK0B 5J13B 2NX5B 2BSTA 3ML8A 3TO4C 2X4TA 4FQXD 1BYNA 2R2HA 2A83B 4JFHE 1OCCB 2NY1B 3D2UA 2EE0A 5TE4H 1U8IB 4MXWH 3VRJB 1ZT4B 5CJBA 2OX5A 1NBYA 4YL9A 3NPSC 1ASQA 2DJUA 2B9BA 3MUJA 3MJ9A 3U1SH 1MQKL 1UJ3A 3MNZB 2GUYA 3V0VA 4J3OG 4TULL 4QD2E 3US0A 2HTLC 1MCIA 2J7LA 2W95A 4APQA 5I8OH 4QOKD 1JGDA 3AC0A 3SE9H 3U2JA 2F54B 2XPZA 1HHHA 4BFFA 3F12B 3RGVB 5AYQA 2CLRB 2MCPH 4PJHB 5IMKA 4LLUA 2X1QA 2AEOA 4PSRA 5DD1L 3CCHB 3FKUS 4R0LC 1CLYH 2YN3A 3W38A 5CJXC 5FM4A 3S9DB 1E8ZA 2EVHA 1OQOA 1I4FB 3PHOB 2D73A 3DJTA 4YHML 1DLHB 2HFFA 4Y19D 4HK3N 1HHGB 2RIKA 1KJ3L 1VAHA 1LO0H 2DBLH 4NLHA 1RIUL 1IM3B 3I6GB 1ECYA 1V3MA 2COQA 2CDFB 3D05A 4QJ3B 3VVVA 5JW4Q 4R4FL 4JFPB 4YHNB 3J07A 3KR3H 3QZWG 2OZ4H 4O02L 2NW3B 3AWFA 3IMRA 3FTUA 5GS0H 2FSDA 1YLBB 2WBJB 3FUHA 3QNFA 3ECWA 3G5YB 3ILQD 5IEKA 1EGJH 3ABMB 2FGWH 2E7BA 1OF0A 1D5MA 2Y2WA 1I9IH 1EAJA 4HC1A 5EV7A 5GZND 1KBVA 1UFUA 4I13B 1J8RA 1T83C 3G04A 1B0GA 1UKSA 1U8NB 2WUBH 4R3SA 4K7PY 4OCYH 2NZIA 4HWUA 1I3RB 4R83A 2HRLA 3U36B 5ISZB 1R5IB 4FNSA 3UZQA 4C54A 4F2MA 5BVJB 1LD9A 3NCMA 4OLVH 5LGKA 3APNA 1XIWA 2I7OA 3T3PE 3TZVA 3U4EB 2XA3A 1MREL 1CXEA 2IPUG 1Q9OB 4GQ9H 2YD2A 2DWEA 3UBXA 2X4RA 3WJLC 3F7KA 3MXWH 4WJKB 5AZEL 5CD3A 1PMYA 1Q0EA 2FWOA 3PREA 3UPRA 3US1A 1JPTH 2BMKA 3JWOC 2NY5H 5GRZA 5CEZH 5KVEH 5LKNA 2NY2D 1NGZB 5FM8A 1BD2B 4PVBA 1YMMA 1MJJB 3MLYL 4Q74A 3MLUH 2VDOB 3BEVB 5FKPA 1OTUD 3QJOA 2X41A 2Y3NA 3LEVL 3WIIL 4D9RE 2E5EA 5BW7A 3H3KA 4HOWA 2AJUH 4I0PA 1DBKH 5EC1B 4PY7B 4YNYB 3TBSA 4ZUUA 1AS7A 4P2QA 5ID0A 2OCFD 2WQWA 1P7QD 4TNVK 1CQYA 4JFXB 5CBEB 1A8ZA 4Z3FA 4ZMWA 5J89A 4WGKA 4GLRI 4N0UE 4JO4L 4QRPA 3UBXI 1JERA 5J1AA 3LVTA 2B2XH 1UJTA 1E50A 2W07A 3FCSB 4ODVL 2WLHA 3CPUA 1KGWA 3RHWF 2DKSA 3T0EC 3TO2B 2DL2A 1CIUA 1BECA 1QRND 3G6JB 1P53A 3DLQR 4IRJD 1IKOP 3UJJL 4FP8L 4HUWA 4PRAB 5GHWH 1ZHLB 4JN1H 4R5XA 3MRHA 3FQRA 1GTFA 1U36A 1CBVH 3F00A 4C56D 3CQQA 1F1DA 2N3JA 3QHZL 4GW1A 2J5WA 4IIQA 3RNQB 3ATBA 4KRPB 3VSUA 3NACL 3B5TA 2PP8A 3DTUB 2B15A 5EWIH 1J11A 1OAZH 5IJVB 1DQDL 4JJ5B 3BW9A 2AJVH 4KJPC 4CDHA 3SIKA 3ASNB 3ZE0F 2R4RL 4F5CE 2JCCA 5LG6A 3MYJA 1MFBL 1U3YA 5F70A 5D7JC 4NENB 2KKQA 1SRDA 3SPJA 2HVJA 2WKLA 3D3VB 1GGYA 4WWKA 3IJSA 5I82A 3NSDA 4URKA 4HVBA 1I53A 1MIEH 2Z35B 5GGSY 3U46B 3HAEH 4IKNA 5JA9A 3W56A 4Q6IC 3BN3B 3AITA 5I6XC 1JRHH 1UGNA 4WU7A 1HZKA 1ZXKA 4X6BB 5H2BA 5D7HA 3RTQA 2A74C 1HS6A 2VO8A 5MEND 3MNWB 3QCTL 4HZAA 4R5VA 2VNCA 2X4SB 5EO0A 2FT6A 5E6ID 2AXGA 5C8JA 1MAML 1NL0H 3V4UH 3ZDXB 3L4UA 3L95B 4UTBH 2CM5A 3NAAL 4IBUA 1CE1L 4I9WE 1WAEA 4I1NB 3MNMA 3HKZA 1A6PA 5LBSA 3ZXAC 3QEQB 3T65A 4ONFL 4A2MA 4IBVA 3VRLE 3MLWH 4PG9A 1PIGA 4NOFA 1NAKH 2NTFA 1WFMA 2FNBA 1A7QH 1R24A 4KY1H 4DHLA 3BI9X 3CFQA 1BM3L 4PJGB 5HHQA 3GUFA 1E4XL 4R4ND 3KPMA 3QUMA 1ZVSB 4EI5D 4MASA 4A7VA 5B3NA 3WDJA 1VADA 3DSNB 5IESH 2DQIH 4AT6A 1ZTXL 3SDAA 1AQKL 3M86A 2F7QA 3BD3A 3VYOA 5JLZA 4JRXE 4M93B 1DN0A 2YPVL 5CD5C 2QADC 1SM3H 2R23A 2YLKA 2MWCA 3C60D 1JGLH 2YAHA 3QUGA 4XPGL 2C3VB 4PD4K 4K73A 3ZTCC 4ZW5A 1XGRB 5FUCE 1E65A 9PCYA 1MIML 5J4MA 2AQSA 4IOSA 2YS4A 1LP9B 4JPKH 1R0AL 4FLHA 3CMOH 1GGBL 3MOQA 4KKCD 5T1MA 4AGOA 4PLKC 3L9YA 4N8VB 4ANKA 2FX7H 2ZOOA 2XZAH 1KZQA 3QUHA 2B1HL 5CBAA 3SE3C 2JK5B 2IVFC 1OAYL 1ZDQA 4E9QA 3VDAA 1FL3A 1KJMA 2C1PA 2G5UA 2VRQA 3VG9C 3E0GA 3RA7L 3DA0A 2AJ3B 3HC3L 1MI5B 2Z4QB 4X98A 4FHJA 1KXTA 2PYED 1OCZB 1KXVC 1PG7L 4Q58C 2E6QA 1CTNA 4X7SL 4AL8L 4FE9A 2Q2LA 3F7QA 4R8WH 4HYTB 4YPGB 3R1GL 3K2UH 2C34A 4UQAA 5AOKA 5CGYC 3S3DB 2HLAA 1I8IA 4GIOA 5CCKH 2VUKA 4A7GF 3MJ7B 4MNGE 3MUZ1 3N0PB 4NUJB 3FHAA 3OKYA 1IFHL 4IU3A 4MJID 5I6KA 1FO0B 2QR0B 4FQ1L 2CLVA 2GSGA 1MNUL 3BH9A 4N0UA 4Y7MA 4NXSA 3NCFB 1MCBA 4JY6A 3HG2A 4GQZA 3PAZA 3EBAA 2XA8L 1AKJD 1PYWB 1XZ0A 3HZMA 4LK4A 4S1DD 4MX7B 4GRMA 2F6AA 3ZE2E 1YN7B 2NXYC 1OAXL 1S5IH 2UWEE 5I73C 3IFOA 2VQ1A 4OJCA 3REWA 1E2VA 3UTTD 1CDBA 1S4IA 2XNAA 1RK7A 1RU9L 4WTZG 5DLML 4GKNB 2JWYA 4YBQC 5C0FA 5AAMA 5J7CC 1AKPA 1GKEA 3BDYL 4YUEL 5F9WB 2KDYA 1YECH 4L0ZA 1RIVH 4P5RA 4JNXA 3QIUD 5DJ6A 4NRYB 5DD5L 3M1BA 3RY6C 2GEQA 2A99A 5HI4C 3SYPA 4PV9A 3E7JA 3MA7A 1EZVY 3HS0C 1S9XB 3DX4A 4XBPB 4QHLB 2JNZA 3RTLA 5FOBB 4A04A 1AI1H 1Y6NR 2HRPH 1XH1A 4HJ0C 4MJ5B 4F5CA 5LNGA 2VDKL 3EFOB 2HT4D 1EXHA 1S7WB 4Y16A 1LDPL 4AYID 4M5ZL 4UM9A 1RQ5A 3FN0L 5HPOA 5MI0C 1SNRA 4OAWA 4WK2B 3FUJA 2EJ1A 2VN5A 4RQQB 1A3LH 1G7HA 5SWZE 5HGAB 2I25N 2V7NB 4YSDA 1DVZA 3QEHB 4X9BA 5F7MC 3W82A 1DSWA 1M3JA 3TA3C 1ZEAH 2V9UA 3K2MC 4FQHA 4P2RB 3CFKA 3RUGB 3D85B 4AUUA 4DP5X 1CVRA 2VZ3A 4LP5A 3ZO9A 3P4LA 1P5UC 3EFDL 4U1GB 1A21A 1XGYL 2IALA 4X6FB 4AM0B 3GMOA 4AVJA 5E00A 3KLSA 1IZKA 2AITA 4UILH 3SCMD 2NNAA 4X99A 4XNDA 4MCZA 3WGVB 4TNFA 3GMLB 1S46A 2UZIH 3I3DA 4OV6F 4AEFA 5ECGA 1S7SA 1P7KA 2YD1A 1R34A 3TBWB 5C86A 3F84A 1RJZA 4OLYL 2WLKA 3G5VA 1P4LB 2V2WB 3KLKA 4FG2A 3GM8A 3LVEA 2AQTA 4UDUA 2VWEC 1G0DA 4JDEA 2H26A 4DGWC 4P4KA 4L4TB 3M6DA 2F5AH 5AALA 2APTA 1LO3L 3MJ9L 2IAMC 4JKLA 2FH8A 1DJWA 3GMQB 4X9IA 3MRMA 3N50A 1HK6A 3WFCH 1D5IL 3NP4A 5LAXA 1JNLL 4OFIA 1T7XA 2PO6C 4Z7QF 4LCVA 1MXGA 3CSBA 2WXFA 4X4YA 5IP4A 4XP5H 1XGPB 2NY6C 5IHHA 4P57A 2EILB 3T8VA 4ALAH 3RZCC 4JRXA 3IRPX 3S37H 4LCWB 1NBVH 1GVIA 4G7YH 4Y4KB 5AOJA 1X7SA 3TL5A 5E6SB 1P1ZB 5LN8A 2DQGH 3LS4L 1DSYA 3QHFH 3RI5K 2H9GA 2QTEA 2DLIA 3GMPB 3AB0C 4FQCL 3BUIA 2HG5B 5E5LA 1DANT 4L05A 1ERNA 3EOTH 5I8CA 3MOAH 1ZT1A 3RAJL 3KLDA 1RD6A 5JUEH 4F37F 2MTAA 4TSBL 2EDOA 3QDHA 2Q5BA 1HL8A 1WFUA 4TNWF 4PREB 5KBDA 4JJHA 5IR1A 5ITBH 2WWKO 3KPLB 4PRNA 4WO4C 1DJXA 3GSRA 4KH9A 4QRTA 3X1BA 2HVBA 3UTPD 2IGFH 1XCQA 2YFOA 1WWAX 4UNIA 2KLTA 2R0ZH 2UV3A 3E2HB 4AITA 3S4SG 1C5BL 1QA9A 4AQAB 1A6WL 2FEEI 4PRBB 1BJ1H 4P9HL 1RIHL 4HC1L 2WVUA 3KYOA 1WWBX 4GT7A 4HD5A 2YMTA 3X11B 3WY2A 4ZW8A 3Q6GH 4ZMYA 2YEZB 4XPBH 3HLKA 4IQHA 5IGXH 1FL5B 2VDMB 1YEFL 1CD1B 1DQLH 4HWEL 1XZWA 4BFGA 2YK1L 5DZPA 3ISWA 4LVNB 4LRNL 3UJIH 2V17H 1DBJL 1WS7A 1OTTD 3HPJA 2X6CA 5EOQH 4NM8L 5K9OA 3AW5A 3MRDB 4DP2X 1Z5LA 3H9SE 1MCCA 4J23A 1CFSB 5FF6A 5C0DB 1UKTA 3QQ3A 2A6JA 1XF5B 1NFDF 3BWAA 5CUSH 5DVMA 1NDMA 1G7IA 3QAZB 5DJZB 3VGAC 2OSWA 3OR7B 4AWJC 2WLMA 2E27H 4AXWB 4YHIB 2GY7B 3WFBL 4K9JA 1LXMA 2UZXB 1IBBA 4NDMA 3L5WB 1C08A 4HF5H 2UWEA 4N2BA 2KT6A 4PJEB 4K15A 4RFEB 3TT3L 1ANUA 1TCRA 3N40P 3PGCA 4HP5A 2I5YL 2ZOUA 4O9HH 1D7DA 3KPSD 5A2LH 4JDTH 5EDXA 1KIRB 3DVNB 4WWID 2VIRB 4CVWA 5GGVY 3NCJH 3WKPA 4QAWA 2YQGA 1LO4H 3SDXE 1X9LA 5CP7A 1AXSA 4PJDE 4ZMTA 5DEZA 4TKWA 5JW5A 3QEGL 3BZ4A 4MZRA 1NCAL 3QYMA 1JGVL 1FV1B 4KKRA 2OMUB 4NQXA 1YMHB 4DAGL 1L9SA 4YLQT 4MYWB 1JF1A 1JOIA 1EAPA 2B4CH 4GO8A 5CN1A 4LIQL 5F1IA 1HOCA 1OAQH 4D0DB 5IFAH 2DH3A 4X6EB 2BM3A 3W3BA 2BY0A 5DUMH 1D9KC 1XR8A 1G94A 4HGWB 4HJJL 5DGRA 2GCYA 3OPZL 3Q48A 3WS3A 2A4ZA 3U0PA 5SWZA 4BFEA 2EDNA 5I8EB 4RGMB 4WHYG 1T7YA 4AMKL 5LG1A 1EJFA 1T21B 3JWNG 3HE6C 1FHNA 4IK7A 4A2EA 4L5FL 2J6WA 4LARH 1I9RL 3G9VA 2X4TB 4HCGA 3MCLL 2GJPA 3N44F 4XNXL 2R2HB 5HHOE 1NPNA 1GZPA 1KBKA 3H9ZA 3BPOC 3F7YA 3TEXA 1OGSA 2QHRH 1IAIL 1W9XA 2Y7QA 1WT5A 5JIKA 3PCYA 3GSUA 1R3HB 3ARTA 1NBYB 4TVSa 1BQLL 3KLHC 3NEOA 1HINH 4Z23A 1UJ3B 4YSCA 4L23A 4BQBA 4TL4A 2WWKT 1KOAA 2VLKB 4QTHA 1UOKA 4V33A 3V0VB 4NBYB 4RDQG 5BRQA 4ZZFA 3BEWA 1BDYA 4APQB 1W72A 2FQGA 4JB9H 4XWGL 1B2WL 1JGDB 1GAFL 2F53B 4P59L 5IB2B 1L5GA 3IK2A 5IMKB 3SDCC 3VDBA 2QJDA 2NY3B 4KKAD 4JKWA 2CWRA 3ZSTA 3ZSSA 1GHFL 2ZXQA 3CH8A 1S9WA 1YSOA 2WB1A 3MNDA 4ZS7H 1J0YA 4YXHH 3CK0H 3OC5A 2DY2A 1MFEH 2BDNH 2X2UA 2HFFB 1ZK9A 2VB5A 3HG0A 4MZ2A 4FNQA 4F7KA 2CHWA 1IC1A 3MREA 2E9JA 1H6UA 3EDJA 5I1KL 1GY1A 1IAIM 4YEFA 3TYGH 2LQRA 4XCCH 4XVUD 2P43B 1EHLL 4LCCB 1HILB 3DECA 5A6MA 1DVTA 4ZFOA 2A73A 1CDHA 2AJXH 5EIIA 3B37A 1OGAD 1JXKA 4CKQA 2FDBP 4FXGA 4XI5D 4PJIB 3U7AA 1ZAGA 4TRPH 4OZFH 3UJTH 5IEKB 1QLFA 2WZPA 1D5MB 3HZ3A 4K3GA 5K1NA 3NK4A 1A1OA 5DFVC 2ZKMX 4EDWH 1IBGL 3G04B 3HC4H 1RK1A 5E6ZA 1V27A 1GYAA 1HJCA 3TVMD 4R3SB 4DT2A 3FSOA 2EQDA 2VDOH 3RP1A 2BS9A 3CHXA 3UZQB 1MHEB 2AEIT 4OZGB 2FATL 4PYGA 5DZVA 5EF0A 3TZVB 2FEDD 1DEEA 1JHLL 1F4XH 2N01B 4K2UH 4XN5A 1KB9J 4UINH 2KZ1B 2FT8A 1WD8A 4GKOA 3IT8D 4XN1A 3UBXB 2YBGA 2X4RB 4Y9BA 4K3EL 5CD3B 3BD5A 5G4NA 2FWOB 4F9PA 2IQ9H 5AAPA 2BMKB 3KPQA 1ZHNA 4HJUA 1T0NB 2HN7A 3RL2A 2HRHA 4FYTA 4UOJA 5DEFA 3DO7A 1O7DC 2IH9A 3H9SA 4L3ED 3IJ7A 1YMMB 1I3VA 3H9HA 3MBXL 3DV4A 3MO1B 5T1KD 3TASA 3HG1E 4FFZH 5FKPB 4E9VA 1A6ZB 1T7VA 4X8JA 4FQ2L 2G0KA 4QTIL 3H8NA 4I0PB 3LD8B 2OMYB 3VGDA 4E9SA 4UZGA 4AEEA 7CGTA 4NFDA 4ZUUB 1QI3A 1FVEB 1KTBA 2IDUA 3DXAD 4JDZA 4QOKE 2DTSA 3ETBJ 1IO4C 4FAAB 4LL1A 2FGZA 3NJNA 4ZPTB 3OXRA 3A4EA 2CR0A 4JZOA 43C9B 1QR1B 2J2ZA 4OLXL 1W0WA 3VQ2C 4OR1A 1YC8A 2E7LC 2ICEB 4LQ1A 1FZOB 5KVDH 1MZZA 3FQTB 4Y19E 3GS7A 2DMHA 2WK2A 1F6AA 1PJ9A 3N1FC 5IVXE 3SDXA 3UROR 2AJSH 4HUWB 1DBBL 4PJDA 1HI6B 4HWZA 4JHUA 1C12B 2HJFA 3MRKA 4OF0A 3RFZA 1AO7E 1TZAA 3MRHB 2MRYA 3N1QC 3VFUB 3FQRB 4GW1B 2WNXA 2L7QA 3OR6A 4W9IC 1X5KA 4PS4H 4ADJA 3FRPG 4D9LH 4IIQB 2PW1A 1RMFL 3ZRFC 3BUDA 3ARED 4K7FA 1GY2A 5K59F 3BW9B 3FRPA 4M3KB 2BP0A 1M1XB 3LKSA 4KTEL 1S6NA 3IFNL 3K0YA 3QVAA 5DD1H 3OSKA 1RXLA 1FIGL 2JCCB 4HCRH 4ZMLA 4PV8B 3D25B 1KG0A 1LP9F 3IXTB 2XQYK 2R2CA 3MMEA 2R69H 3E38A 4R2GC 4YHMH 3HHRB 1X44A 2HVJB 1DUYA 1JXDA 1YPZE 3P30L 4M8RA 4TM9A 5HHOA 3UYOD 4ZTPL 1JPSH 2P48B 4WWKB 2P47B 3IJSB 3O81A 3MGTA 4AIEA 2Z0UA 3D9AL 3HI6L 3OAZH 2XWBA 3FHQA 3U4AA 1AQDA 2MCG1 2AJZA 4HXBL 1JZ2A 2IDTA 4ZBJA 5D1XC 3I85A 1QFWH 1AZVA 2IAND 1DCEA 2GVYA 4O02H 5H2BB 3RTQB 2OSLA 3VG0L 2CJSA 4OCRH 4C4BA 2PXYC 3FH5A 2AF2A 1A0QL 3OAYK 3OF6D 5FUZL 4XCFL 5EO0B 1ZS8B 4B60A 4F91B 2ENJA 3PHAA 4TLSA 5C8JB 3TCXA 3LIZA 2TSAA 3WMQA 1IQWL 4RETB 4UZSA 1EJ8A 5ELIA 5DHEA 3GF8A 1LDSA 4KI5F 3V0GA 4IBSA 1R5VA 1QWNA 5F8QC 2J55A 2YPKA 1TCMA 4DO6A 2YD3A 2R4SL 4PG9B 5B7FA 3AZUA 3GHEL 1G7LA 2QL1A 2NTFB 4NC1C 5AVTB 2NQ3A 1R24B 1MREH 4DIXA 3GBMH 4OB5H 4YSUA 3QC6X 3QUMB 5GGQH 1QAWA 2XWZA 3N5AA 3QCUL 4BZ1H 5C2BH 1VADB 1NKRA 2AEQL 1QRNE 2B7DT 3EXJA 4XPHL 3TNNA 1X5FA 3DVGB 3IB4A 4UIMB 2AK4E 4ABWA 1B4RA 3SDAB 4ANWA 5HHVL 5B22A 5H37A 5I5IA 2Q6WB 4Y4FB 5JLZB 4HU8A 3V7AE 3GZPA 1DN0B 4C56E 2OP4H 4AL8C 2COVD 2BVQA 3DX2A 2A2QT 3HB3C 3SZ6A 2AVGA 3GSVA 5F1KC 2NDFA 3FULA 5E8DL 3UAJC 5BRZB 2DIEA 1K4CA 3BQUC 3Q8FA 5AZ2L 4J4PA 1P7BA 1GIGL 4HEPA 4JO4H 4AQOA 5T1MB 4HGMA 5I17A 4LP8A 3T3PB 5CLTA 4EN3C 1X5ZA 4ODVH 1D2OA 4HIJA 2GI0A 5CBAB 3G5ZA 3E3QC 4FQXA 5ICZB 1FL3B 1FO0H 2BVTA 4TMPA 3K6SA 1KJMB 3UJJH 4FP8H 4BQCA 4X98B 1LL1A 5IF0B 1YYLH 2FJHB 3WV0A 4L18A 3C6SA 3WN5A 1MHPL 3V79C 1ML0A 1J9QA 3MOBH 3Q2LA 3QHZH 3WHE0 1UD8A 1FC2D 3RUGF 4OF3A 4XX1G 1M05B 1M9SA 2O6DA 1KSRA 4OV5A 2WQAA 3VI3E 4ABQA 1AXTL 3MPCA 3N1MC 1G7PB 5I1IH 4OCMC 3KD4A 4I77L 4QOKA 5D5ME 1E5CA 1JGUH 2R56H 2CLVB 4QHUB 4JZNA 3VFRB 2R4RH 3BH9B 4N0UB 3X2QB 4P5KA 2IBZX 4JY6B 1MFBH 3KWXA 4ZOCA 5I23A 1AG6A 4JE4B 5E8PA 4NB7A 4GRMB 2P7TA 4B9FA 1A02N 2WGNB 1H8SA 3OKEB 4GY4A 4Y19A 2O5YL 3JV4A 5IVXA 3IFOB 1FBIL 4YHZH 2VQ1B 2ZWNA 1A4JB 1UADC 3MLZH 3WHXA 2XNAB 1AO7A 4KK5D 2G2PA 4IRZL 5C0FB 2CK0L 4FERA 5JPNA 4L8SC 2K78A 1X5IA 2JLPA 3RWFA 2ZCLL 4G8FA 5D7IA 4DVBA 1XTMA 4NQCE 2R15A 3GYRA 4P2AA 3UZEC 5GXBB 3M1BB 1VHPA 4EKXA 2HG0A 2WMPB 4PV9B 4OT1H 4B41A 2GIYA 5E9DB 2EDFA 1O7SA 1HQ4A 4NO5A 4Q8BA 3NAAH 4R90H 4RESB 5GZNA 4RGNB 3CXFA 4PBXA 3G6AA 3LAFA 1KCSL 5CO1A 1H3VA 1XB3A 4HWBA 3ZKXC 4Y16B 4UM9B 4R7XA 1YPZA 3PWJA 4KAQL 4U4IA 5F7HA 4PJCE 1FWXA 3FUKA 3DVFA 4W6YB 3DDGA 3WFEL 5KN5A 2C9QA 2VMEA 4ENED 1M6OA 3NFPA 1G6RA 3GC3A 2V2XA 1P4BL 2WB7A 1SXNA 4FQHB 3RX5A 4MA8L 1JI2A 2GAZA 2A3TA 2DKUA 3HUJF 3MZGB 3CFKB 5B3JE 4UUJB 1AQKH 4APXA 1S7XB 3WEBA 5TK4A 2Z3FA 4XRCA 4XAWL 4AV4A 4DWHA 3T0WA 4K5MA 1KXQE 5EORL 3QJUB 5FO2A 4XXCA 2GC4C 2CALA 4J3OC 4XPGH 4DP0X 1J18A 4IOIA 3UYPB 1Z6JT 1DBMH 3BGMA 3U0TA 4L29A 3KMDA 1LK3H 1MIMH 3TV3L 3EJUA 1P7KB 5IMOB 4P2CG 8FABA 5B4MD 1R0AH 2XWEA 1JNHB 1F58L 4P48A 4NCC1 1UXWB 1RJZB 3VI4E 1HIML 3G5VB 3QXWA 4HUKB 1TVBB 5DRZB 3O4LD 3AXLA 4UDUB 5F7LB 1XCTB 4JDEB 3NTCL 5A2FA 4R7DA 2H26B 4GI9A 4P4KB 2B1HH 3RVXD 1A22B 4ZT1A 2Y72A 5L0QC 1XAUA 5I30L 1T5XB 5ICXA 1OXYA 1HKLL 1OAYH 4OD3H 4NM4L 2X4PA 2FO8A 3MRMB 1Q0YL 5E5MB 5B7EA 4G43B 4G8GB 3RA7H 1QRNA 3NEXA 3FQUA 4Y5XA 5LAXB 3V7AG 4IRJA 5KBNC 4JM2A 3PL6B 1PQZB 4X4YB 1PG7H 2AK4A 4C83A 1MHCB 3JBG7 4X7SH 1AJ7L 2CK2A 2HLFC 4GRWF 4P57B 1EH9A 1UXLA 1V3KA 3R1GH 4JRXB 4UZUA 4XN7A 4POYA 4C56A 2ZP9A 1NINA 1O7VA 5JW3H 4P9HC 2X3AA 1RP8A 5C07B 4C59B 2X2JA 4ZFGL 5SWSD 2P8LA 2HKHH 4CMHB 2Q87A 1HNGA 1IFHH 2P24A 4FKKA 5IHUL 5IQOA 1FGVH 5I15L 4CSZA 1A1MA 1ECZA 5CSZA 5I8CB 4YDJB 1ZT1B 4HIEA 1Z3GH 2VDMH 1C16A 3RBSA 3NCCB 2IBGA 4PWKA 1HEZB 4G1MB 5C08D 3BPLC 1FG9C 2FJSA 3FUIA 5D55A 1J0IA 2GJRA 3FT3A 2LFGA 3L13A 4KH2A 3ZL2A 5DSCB 5IR1B 1RZIB 1SHXA 2IV8A 1OAXH 5EPMA 3ZKMC 4H8WL 4PRNB 5I66A 3GSRB 5J12B 2JTYA 4QRTB 5F8RC 4N1CA 4K9EC 2P80A 2VSCA 5JNYB 3ZHKA 5KS9E 1XCQB 1WBZA 1OSZB 5DLMH 3K74B 1QA9B 2ADGA 2WQSA 1QNZL 1SEQL 1NANI 3BDYH 1UVQA 4N86A 1B6DA 4YUEH 3HJ0A 1VEMA 2R83A 5B1KA 3GPSA 5B1JA 4S1RH 3ZKND 5MENA 1LEGA 1SLWA 2D3VA 2ZXAA 1UYWL 3SYOA 1TQBC 2CGRL 2ARJQ