1EXHA

Solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
ASSGPAGCQVLWGVNQWNTGFTANVTVKNTSSAPVDGWTLTFSFPSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGGTAQFGFNGSHTGTNAAPTAFSLNGTPCTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a cellulose-binding domain from Cellulomonas fimi by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Cellulose degradation
molecule keywords EXO-1,4-BETA-D-GLYCANASE
total genus 12
structure length 110
sequence length 110
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1exhA00
3NDYE 1QBBA 1EXGA 1E5CA 2RTTA 2XBDA 1EXHA 1C7SA 5DHEA 1C7TA 1HEJC 2CZNA 2CWRA 1E5BA 3NDZE 5DHDA 1XBDA 1HEHC 1QBAA
chains in the Genus database with same CATH superfamily
3MA9H 4F7TA 4LCIL 1S7SB 2XC8A 4HLZG 4M8QA 3ROOB 4WCYH 2NW3B 3S8FB 3WHE0 1CT8B 3RHWF 4X6DB 3WTSA 4NQDE 4TUJA 3TA3B 3TASA 1KLGA 1PAZA 1UXWA 2BSBA 5DFVC 3BN9D 4NRXB 4YSRA 3BVVA 4JFYA 2XTJC 4A66A 5IM7A 4M7ZB 3E7JA 1SYSA 2XV2A 3K72B 3BKJH 3WJLA 4XT1C 5I6PA 5I28A 4Y16D 4N0CD 5AAMA 1MZYA 1CGXA 4CDHA 1KBVA 1VGEL 1OP3K 4XBEH 4OSUH 3UTPD 4M7ZC 4ABQA 2ADIA 4KKCC 5B1KA 1G9MH 4A6YH 1ERNA 2BVPB 3HE7D 4QXUL 4IRZH 2BWIA 4JHAL 1T6WA 2BOBA 3L1OL 1H15B 3FXIC 3QFDA 4ZPTB 2OSXA 4XNZC 2HFGL 4CMHC 2XKSA 4K3GA 4YS4A 4Q8BA 4YDVA 2FIKA 4LSVL 4NPKA 4MNQA 2EZ0D 2WXPA 3KEHA 4FKHA 3I50H 1SJVA 4B9PA 3SCMA 4HBCL 1YN7A 1L5GB 1CBJA 1NANH 1YN6A 5AVWB 5GJTL 5JR1H 3RFZC 4JRYB 1LEKA 1TPXB 3FB6B 3V4UL 1BAGA 1RUPL 2FX8L 4MXQC 1V7NL 1U2YA 4KC3B 1V3MA 4PBXA 2COVD 3BSZH 4LSSH 2XSKA 1KFAH 4RAUB 4WWID 1AO7B 1VCBC 1C12A 2NXZC 3KGRA 5EU3A 4JDEA 2W91A 3HI5H 3QAZC 4JY6A 1S5HB 5I6NA 3K8LA 4BZ1A 1CDCA 3V0AC 4LP4A 5CBAB 4JFDD 3HE6B 4Z7OB 5DEZA 3EDFA 4KDWA 1P84K 3EJTA 4NUGH 1UG9A 5KJRH 4B97A 4OCWL 3IB4A 2A99A 1ANUA 1TENA 4I0PB 1OM3L 3VFVA 5E2TH 2BNUA 4JCMA 1IGJA 1RAMA 4NZRL 4W70A 1JPST 2IG2H 2Z6FA 4NM4H 1UOVA 2YXWA 2ZKHH 4Y1AD 1BZ9B 2V5SA 4KK8C 3S5LG 3MUY1 1XGPA 1GHFL 1NDMA 2HJFA 2QFRA 3ARED 3LQAH 3RVWD 4EKJA 3D18A 3EYFA 3O6KH 1B3IA 2Z7UA 3QFJA 3R18A 4OTXL 4YHKH 3BUDA 5AB9A 3QWOB 2EIZA 4FXKA 3GSUA 3AMKA 4KKNA 4NNYB 4KHTL 5KSBE 2FGWL 2EICA 4JY5H 4EQ3A 3QJOA 5D5MB 4NQEB 4LSPH 1BFOB 3FBQA 4P57A 5EPMB 1DBMH 1MFCH 1T04A 4L1SA 4JKPH 5CN2A 2L7JA 4WTZA 5E2VL 3RGVA 3QCTH 4OKVA 3B8SA 4YDJB 4PS4L 3IGLA 1NIBA 1NBCA 3SDCC 5BVJA 1CFQA 2QT6A 3S5YA 1AZNA 4ZFOL 2MEJB 3WS6C 2X38A 3ARFC 1CJYA 4EI6B 2VJ0A 2Q7AA 4F9LC 1AP2A 4G1MA 1I7TB 2Z8SA 5TH2A 2A83A 1EZLA 3EJCA 5E4EC 4Q74A 5MP6H 4DKDC 5IT2H 1D5BA 4PJCF 3VFTA 4BK5A 5JHLA 1RUAL 1BVKA 4MS8D 4RFNC 4PW4A 2Z35A 1I3GL 2XPGA 3VGFA 3P69A 5I1HH 1W8EA 2KDGA 3DUHA 2I32A 4UIKL 4YSDA 3WO4C 4N0CC 3GUTB 1PLBA 1P9MC 1J12A 2HKFH 3IMVA 2GJ6B 3NIDF 4WW2F 2BRQA 1Q9LB 2H32H 3P73A 4JPKH 4H13C 5IJBC 4GXVH 3ZTJG 5IFHH 3I9GH 1F2QA 1TZGH 2IWKA 3OQRA 3PWPE 4IKNA 3SD2A 4FULA 2AV7B 4GS7B 4AI7A 2NY1B 2FLMA 5AW5B 2PW1A 1BAWA 3MRBA 3HR6A 2GIMA 1NCAH 2AK1H 5DZJA 1EAOA 1MI5E 5J0BA 3ARSA 1XR8B 5J13B 2YUZA 4UINL 5E8OB 2JTYA 2XZAH 1SOXA 4ALAC 3PAUA 4DJMA 5D1ZD 1F90H 4P3DA 3X3GH 3O0RL 4JR9L 1FGNL 3NCYS 2VLKE 1LHZA 2B2XH 1MVUA 5D7KD 3S5LB 1C1EH 4F7CB 4WCYL 1WZLA 3SBQA 3PUUA 5HJBA 4KNUA 4LHUB 5LGJA 1VPOH 5CLXA 2Y25A 1OZTG 5ACZA 2XWZA 4RETB 1A6WL 1RU9H 3OGCB 5DMIH 4L2YA 5ALBL 3WBDA 1TLKA 2LU4A 1N64L 4AIZA 3VFVB 3DIFA 4IRSC 2E4TA 4XNXL 3I6GB 4Y2DD 3KJ4B 4OCMC 3APFA 2O26U 3TBSB 2Q87A 3HCVB 3DPBA 2VXSL 4X7DC 4E5XB 1F6LL 4MD0B 4PRPD 4XP1H 4JRWA 4PMFA 1FORH 3TURA 3MRQA 1QBML 3ZDYF 2OJZL 4HJSA 2PW2A 3V0WH 4PHXA 1N3NB 2DWDB 5IF0B 2VR9A 2CLVB 3CFJB 4MAYC 4V1DB 3CG8A 4JHBA 5HGBA 4GMTH 1WBXA 2YOAA 4JFHE 1JDCA 2H9GA 2YGQA 3D39A 1YMHA 4WU5B 2CCWA 4B60A 1J1OH 4P48A 5SV3A 4NFBA 4PRNA 1YO4A 2UZYB 5DK0A 3ZDZF 1HSAA 1YAIA 1PCSA 4PJAE 2A0LC 4QOKA 5C6TH 4A55A 3FRPB 1KCWA 4B53A 1PG7W 4AWJC 4NDMB 1XO8A 4YXLL 4HCFA 3GSQB 4PYHA 1BCIA 1V5JA 4IGBC 1I8AA 4BSVA 3JSSA 3I6LD 2LV4A 3L13A 1T1ZA 2APTA 2VUKA 4FJZA 4HFUL 3H3PH 5JW4M 4PJ7B 3MR9A 4GRWB 5D1QE 3RUGB 2VKXA 2H7WA 2BNRD 3FT2A 3FU0A 4LLQA 1V7ML 4YVNA 4N90E 1XH0A 4EDXA 4RSVA 5EFIA 1SUJA 5GGVL 2BFVL 4HJ1A 1JXKA 5C0CB 4LLDB 4B50A 4NN6B 4K5NA 2BZCA 3SO5A 4C57C 5KBPA 4LCWA 3G5WA 2VRQA 1LD9B 4OIIL 2VDQB 2KMWA 2DQIL 1KJ2L 2F19H 1EXHA 3IF1A 2GJ6D 5B8CA 1HZHH 1GGCH 2R2EB 3JTSA 4TTGA 4M48L 1E27B 2X10A 3OL2A 4AJ0A 2YZ8A 1H6EA 3RIFK 2CHZA 4HGMA 2WUCL 1TMCB 1Z5YD 5AALA 2VQ4A 4FAAB 5ICYB 5K1JA 2ZXCA 3MYJA 4WTWA 3HNVH 2X87A 1G7HB 3JT2A 4O2FA 4ZO7A 5DRXB 5KYYA 5JIHA 2KERA 4BH7A 2J8UB 3ZMNA 3S9DB 3RFZB 1HJCA 4WFFE 4G2AA 4YDKH 1M3JA 2F9BT 2L7UA 2UZIL 5LGJB 1VFAB 3GHBL 3DHMA 4OLXL 3OKOB 4WO4C 4DTGH 3VB8A 2EDWA 4B41A 4WHDA 2X4SA 4XAWL 3WXVL 3L4WA 2C4XA 3GS7A 5JIDA 3GRGA 4BQ8A 3IDNB 4C58B 3KDMA 2QV2A 4L3AA 4I5BB 3MCYA 1OTUD 3FUHA 2F5BL 5I74B 4WGKA 2RBLA 4ABWA 4H1LA 3DKHA 3RBGA 4AMXA 2IALA 4QXUH 4O51B 5AOZA 4HXAL 2YD8A 1H6TA 1PNCA 4JM2C 2PR4L 4YVUA 1J87A 3T4YB 5B3JF 3VXOA 3VD7A 1KYAA 3QWQB 1SLVA 4XAWH 2Q7NA 2NUTA 2NSXA 2X6BA 2AGJH 1TQCB 3T3MF 3V7AE 1ODUA 3RVTC 3G5VB 2MCG1 3HAEG 4S1RH 3TYFB 5AAWA 1QVOB 3LMJH 4HZLB 1F13A 3VU1A 1YEDB 1YNTA 5GS1A 1V7NH 2H8PA 3O2DL 4G6FB 1FYTB 2LQRA 4U3SB 2ZXGA 1MRFH 4QHUA 3VD5A 3VXNB 1IEBB 4FMFA 1R33A 3MNWA 5SX4I 4PGDB 3US9A 3ZQ9A 5PAZA 1G0DA 3WFBL 3A6CH 1YDPA 3NVQA 1FL6B 1THCA 3LH9A 4OFQA 3LKPB 4FKKA 1Z3GL 5DUML 2A77L 5IROD 3EG9B 5GRJL 2A1WL 1CD1A 2XPYA 4APQD 1FL5A 2DICA 3SEPA 2CA4A 1Q0YH 4DUVA 3D4GA 1J10A 3VFWB 4XPHL 3VH8A 4OQTH 3QI9B 1MKFA 2GVYA 4GAGL 2P48B 5I1GL 4R7VA 4WGVB 4LASH 3O45A 4DGYH 3VGGA 4LP8A 4JANA 2HYMA 3ZZ1A 3MYJB 1MPAL 1F42A 4WO4A 1LO4L 5E94A 5B8CB 4NI6A 1SBSL 4WW1A 4B7IA 4P04A 4NJAL 1GMIA 2CGRH 3UXFA 3CTTA 1BQKA 1A2YB 1UM6L 3RDTC 1R0AL 2R1YB 1ETJA 1OEZW 1WFMA 2UUDH 2XTLA 3VFGL 1LO2H 4WK2B 4XN4A 2EO9A 2IAAC 4MJIB 1FL3B 1SJXA 2OR7A 1ZVYA 1I3UA 1KIQB 3L7FA 5DRNA 4H8WH 4XNMA 1OCWH 5JPNB 5B38B 2BSRA 5C9JA 4JLRB 2JIXA 4B9ZA 1MHHA 1I8MB 1ACYL 2YK1L 3ARGB 5GZOC 3MRMA 3OZ9H 4ZG1A 1F4YH 2FECL 2F54A 2AK1L 3DX9B 3FC8A 5C0EA 2YR3A 4XH2B 4A63A 1KPVA 2OM5A 2QQKH 4JGMA 5FYJD 1CFVH 4ZPVB 1T89C 3WIHL 4G8GE 4WKXA 2BP3A 3KXFB 5KBMA 3JTTB 4OJEH 1TEGA 3BWZA 2EAEA 1FVDB 2NTFA 3BC9A 2TSAA 5K9JH 3W37A 2FRGP 4MAYB 3DJSA 2O6FA 4QXVA 4EQ2A 3KR3L 3MUGB 1CE1L 2PMZA 1QR1A 4WEMB 1CTMA 3VFNB 3EJUA 1RU9L 4X6FA 3UYOD 4E9XA 1LE5A 4N0UE 1N3NA 5JORB 5TQ0H 2E47A 5F6HJ 4K8RD 2OX5B 1UUNA 3CXFA 3KJ4C 3KPQB 4ODXA 1CL7L 1FZMA 5CIPA 4F57L 1CXKA 4ETYA 1PX3A 3WNNA 2EKJA 1GJWA 3NJLA 3OKNA 4K5LA 1MWOA 3JVFC 1KLUA 4X6EA 2P7TB 3MZGB 5EULV 2QPFA 2P80D 4XMVA 5HVWA 3HUJF 5T1MB 5FW6A 5DMGD 4TUOA 4Y19A 3VXSB 1WAAE 1UKSA 3MRLB 4G6AD 4RNRA 4F9LA 4RGNE 4NX0A 1UM5L 2VUYA 3CFJA 3K6OA 1NA8A 1CBVH 4QRTA 1LVEA 4XP4L 2ZUUA 1VESA 4JFPB 4PY7B 1UB5B 2HX9A 5D71L 4MMZB 3GJFK 1F1AA 3HZYA 4PTUB 3OKLA 1L9PA 2XTSA 1T5KA 1TTRA 3P0GB 2QL1A 3UGUA 3K2KA 4UIMA 3U0TB 3KBHE 5CSGA 2BWQA 2EDBA 1EH9A 1MG3C 4LOVA 1XCXA 1FAIH 3IJHB 4EVNA 2HJLA 4H1LG 4YDVB 2A77H 4OZ4B 4QYOA 3V10A 5DURD 1Z9SB 4R7XA 4UIKH 4KXDA 4ZSOA 1ZY9A 1V10A 2BVPA 4LPTA 3AG1B 4XWGH 1DBAL 3UJJL 2EDQA 2WXFA 3ENEA 2E3VA 1L6PA 1QSVA 1BFVH 1TR7A 3MROA 4RQQA 1GGIH 1K2DB 3FUMA 2CBMA 1F4XL 2J88H 2O6DA 2EH8L 3UO1L 2BVYA 3P30L 4FNLH 1ZKAA 4DK6A 4WJ5A 5DMKB 3FH7A 3KVPA 3PQYD 1DQVA 4U1GB 4HK3J 3M45A 5BOZG 3MCLL 4G7RB 1UB6A 3JWOL 4HA1A 1NAKH 2C9QA 5EF1A 3FT3A 3L4UA 1X5XA 2BPBA 3DXAD 4D8PA 2DM7A 4OZGB 5GRJH 3K5RA 4ENED 3C9NB 1Q8MA 3FO0H 3NCFB 3V5DA 4ABUA 2ALWA 4HIIA 5H37A 4HMDA 1S7RB 2OMUB 4KKZA 2VLLB 4YR6B 4P2QB 4M93C 3C60C 4N3TA 4WHTB 1HEZB 3GBML 3JBG7 3J27A 5C0AB 43CAB 3SYOA 3W39A 3ULUH 3JTTA 4Z77B 2W81C 2Y2WA 3PU7A 2E27H 2OXHB 5F1KC 2EIZB 2B39A 4FXKB 4WSKA 1JZ3A 1KG0A 3MFFA 3DBXB 2FJGA 2OJEB 1A6PA 1DE4B 1N12A 2PXYB 4NCDA 6TAAA 4CGUB 4HK3N 3BPOB 1GYUA 1NDMB 2HJFB 4NOFA 3BH8B 1MH5A 2DLFH 2VERN 4GQRA 4X0NA 2VLRE 5H4YA 3GJFH 1S9YB 1AD0B 4LEEA 3SDXB 1RPKA 3HHSB 1RZGB 1J5OH 3Q05A 3F01A 4U6XA 3QUYD 2JCCB 5DZNA 3LH2L 4GG6A 2VLMD 4NQED 5IQ7H 5IBLC 2P42B 4BUQA 3QE5A 3QS2A 2G9HA 3SPIA 3PP4H 1HI6B 4EI6A 1CF8L 4PYGA 5F0JB 3LIZH 2J6EL 3EOTH 4S1DC 1IBZA 1MFNA 5JW4N 3SGKA 1ORSB 4YO0A 5HYSB 3EGDA 1JE6A 1JPEA 2GCYA 3LPWA 5C08E 5JDSA 3CPUA 1JPSH 1SPDA 3AREB 4GAJL 4U1KA 4BFFA 2DBLH 1DFBH 1ZSHA 2HT4C 3X1BA 1LEIA 5JOFA 4PAZA 1N8ZB 4P3CH 4YHLH 4NKOA 1KB9K 4M6NL 5LNEA 1INEH 3WFZA 3VD9A 3NK4A 1JWMB 3P0YH 3O41B 5KVDE 3RTQA 3W81A 1MI5A 4FE9A 2YN5A 3D8MA 3CK0L 4KQ4H 4IRSA 5C0FA 4FF9A 5D5ME 3H9SA 3QEHB 3TA3C 3V4PL 1INQB 3H54A 2V7HB 4NO2B 3KPMB 5KYUA 3VI4B 3TJHC 5CEZE 1MAMH 1SFHA 3INOA 4F7KA 1DTUA 1A1NA 3DGCR 2JV6A 4PLJC 2YPLA 2A74C 2Y6TE 5A16A 3WN5B 2DMBA 2C3HA 2WWNA 2YEZB 1FGNH 3DIFB 2HKHH 1U8PA 1ILUA 3HG4A 4JRYE 4LSRL 2ADIB 3ZYZA 5IIEA 3M17A 4QR7A 1PJ9A 2DYPD 2K6WA 5CZXD 5KYWA 1H9DA 5E1GA 1UVQA 1DVSA 1NBYB 1LILA 3LIZA 5T1KB 1UYWL 4XXWA 4WWOA 1QACA 1SHSA 1WVZA 2R0LL 4X4XA 1RZKH 1BQRA 2L8AA 3CN4A 1C5CH 1VACA 2ZJSL 4AC4A 5LWYH 4QRUA 4BD4A 3DDGA 2CGZA 3H55A 1KB3A 4CKVX 2P1YA 4BV1A 5C08B 1L5GA 3S37X 4PJBF 2NY5H 1V3JA 3BGFB 4JZJC 3ULUD 5EIIG 2XKNA 3BDYL 4FZEL 5FDWB 5C1MB 3K0WA 4PLOB 5JPNA 2D3LA 2MNWA 4FFZA 5DO2D 5K1NA 4ZMLA 1UFGA 4L4TA 3HS0B 2IANE 1SEQL 4N2HA 5KVEL 3OF6D 4WGWB 1BDYA 4DN4L 4N2KA 3EUDA 4HJGA 4F20A 5I1KL 5FECB 1KDJA 3KGSA 2HVJB 1CFSB 3NSCA 4QHMB 4ELMA 2DDQH 3TH3T 4WUUE 1FC2D 4MJHA 4GFTB 4H0GA 3FB8A 5IB1B 4P5MB 4LB8A 3GSRA 3L95B 5L7XL 2IV9A 3SDAD 1PG7X 3KG5A 3D85B 2QQKL 4JFZH 4GKSB 3A0OA 3PQYE 5I1DB 1MDTA 4F8NA 1WHPA 2QSCH 4CBZA 2W92A 5DC2A 1JZ5A 4XHJC 4MCZB 1E5BA 3TPKA 2C34A 4Y4KD 3D18B 3GSNH 2EXWC 2HZHA 1J5HA 1T22B 2Y5TA 4FG4A 4PJFA 5ESQA 2X4TB 5BO1L 1JZGA 4LCWE 4NO0A 2R2EA 4JFPA 5C09B 1X3DA 1EMTL 3TBTA 3JTBA 2WN2A 2QKIC 5DJXA 1Z9OA 4IU2A 1E40A 3NZHL 3QGVA 1SXAA 2CIIB 4TM9A 3F58L 2JQZA 2WXKA 3F12A 2ZNXA 5DQDL 3ZKQD 5F9WB 1J8HE 4PWEA 1BZQK 2ZSWB 2AJSH 5AZ2H 4NNPL 4J1UB 4D7BA 4F2FA 2EO7A 3CSTA 5GISH 1MCPL 3REVA 5FHBH 4Z76B 1RK0B 4K5MA 1OGAD 2FEEL 4LCCA 2DPKA 4ZXBD 3IEAA 3FOLA 4J5VA 2H0FA 1KULA 1C8QA 2GT9A 3RX8A 4BHUA 4YHZL 3RTQB 2GSGA 4H8PA 5IUCA 4IOSA 1Z0MA 3QDJE 4GSUA 2OPCA 1I7RB 2NQ3A 1NJ9A 2R0KH 1DJYA 3UC2A 3U36B 3F65A 3NDYE 1KSRA 2F53A 4OLEA 3KPMA 3QUGA 3VMOA 4HLJA 3AUWB 1YZZA 4ZUVA 3NZ8B 1I7UB 1EGJH 3SO3B 2HJLB 4L3ED 4KKLD 5A16B 3HG2A 4IBWA 4JPWH 3MRBB 2WWMD 4HP5A 5TE7L 1AHKA 2DH3A 2WLLA 1CLVA 2BVOA 2WUBL 3UO8B 4LAJH 1EFXA 1PZ5A 5CBEA 1BMGA 1M05B 2DWYA 4HFWB 3SIKA 2GJ6E 2H26B 2O6PA 3N41B 5CEYA 3C6SA 2MPAH 1HWGB 2E9IA 5C08D 4YSOA 2ENQA 1OB1B 3IE9A 3PXLA 1WIOA 2AERT 3BIAX 4ODWB 4XZ4A 2WSDA 4MMZC 4K23L 1QUNA 3G5ZB 3C6LB 3L3KA 1RZKC 1KTDB 4G7SB 4W93A 1F4HA 3PHOB 4O58H 4C56B 4AEIL 2VW4A 1RMFL 3HB3D 4G82A 3P30H 4FNLL 4XE0A 3WYRA 3O6KL 3RB5A 4AL8L 2UXGA 4HJJH 4F7TB 3O2VL 3MJ9H 3WLBA 4XC3H 1CMOA 3U9PL 4MAUH 3IJSA 4MRBA 2R2HA 2OCJA 4YGVB 2VWEE 1P4BH 1Q9KB 1JPFB 4OGZA 4BYHA 3ZY7A 3Q6GH 1HOCB 4HGWB 3TO4B 3CFEA 2R83A 1AHWB 3GMNB 4S1SL 5J1AB 2MCPH 3QIUD 4PV9B 4HIPA 3ZW3A 2BRRH 3O2DA 3LKRA 5MEQA 4AGNA 3N50A 3T71A 4GG6B 3FSOA 2J55A 2IQ9H 2VAJA 4MJ5A 4QNPF 4ZI8A 5L2KD 1KTKE 1KELL 5B4MD 1JPTL 3CU1A 3G6JA 5I1CL 1ORQA 3CZEA 4JZOA 1OE3A 4Q4IA 1NAMH 3WD5L 1CXLA 4D9QE 1HQRB 1CK0H 4Y2NA 3UG4A 4GBXA 3ZGIA 3WTVA 2FTAA 3FSZA 2P9RA 4YBLC 4KI5C 4XZUA 4YUEL 5FR3A 4Z0XB 3WGVB 4DW2H 4RIRA 2WLIB 2AQ2A 1KYUA 3QDMB 4HS6B 3WUWB 3ZKNC 2EECA 1XGQB 5DQJB 4P46A 3NA9H 3RG1C 5D2NC 4APXA 3TCLA 4K3DL 3ZDZB 3ESMA 1LP9F 1A6ZA 2YBRA 5EFIB 3KLHD 3QPQC 4JN2B 2NUPB 3OBAA 3WTWA 4ELME 5HD8C 5DD3L 1KGXA 2N7BA 1LO2L 1M4KA 3CN1A 4XGZB 1INEL 2YPLD 5EIVA 4HIEB 3GRWH 4PJIA 1KXQA 1X5AA 4J39A 1ZT1A 5DJCB 4Q0XL 1AGFA 4KJWD 4MDJA 2E7DA 4APQB 4U6YB 5ID0A 1BD2E 2ITDB 4NJ9H 1A4KB 4AM0A 1W72H 2YGNA 3UJIH 2MHAB 3QYMA 4A7QA 1BVLB 3ZTNH 2QDWA 4XNDA 3QI9D 1PX4A 3CBJB 1DEDA 3LEYL 4ZQTA 4MZ2A 4FQCH 4F2MB 1KIRB 3U2JA 4PJAA 1J0KA 5EEVA 1GYAA 4J3VA 1T1WA 3HB3C 4X99A 4XB3A 3QDHA 4NQCE 1N6QH 4XNUL 3H0TA 3QRGH 5AL0A 2R9HC 4KOCA 1ZTXH 1T83A 1SZNA 1ZCRA 1QA9B 1TQWA 4OZIB 3PHQA 1EJFA 2BJML 2OZNA 1W0WB 4W9LC 4Y5XC 3TF7C 4F27A 2PF6A 3WN5C 5HYJE 2QMJA 1KCRL 3RVVC 1IGML 3MRFB 4OY9A 5CP7B 1QRNA 4AKOA 5MP6L 3ZDZE 4P4RA 3CHXA 1GSMA 1VEPA 4NZUL 4DN3L 1YPZA 4M03A 1SJEA 4WFEE 4RMBA 5JPNC 1KEML 5IMMA 2P7TA 4Y2OB 2ZXQA 2MQCA 5EZIH 1F58H 2C3VB 4RDQG 4LASL 4FHKA 4Y19B 3AXLA 4K7FB 3G5YB 4LVHB 4MD5B 1SBBA 3BAWA 1NCNA 4Y2DA 1HHHA 2Q5BA 4MAYD 4F15B 1AVAA 2CLRB 1BIHA 1DBBH 1USZA 2ARJB 2DN7A 3L7EB 4YL9A 3T2OA 3W9DA 3PDOB 5ESAA 1CICC 4YGAB 3LYRA 4XAKD 1PKQB 1FG9C 4A2MA 5CJBA 3E1F1 4P5MA 2QSQA 3CFCL 3NJJA 1DN0B 1I3VA 1Z9MA 4AY0A 4BFJA 1BXXA 1KCLA 2FJHA 2K0RA 4ANUA 1EO7A 2AV7A 4ZSOE 1VLXA 2OTWB 4G43A 1QRND 3LKQA 3RNQB 1FRGH 5C3LD 1FA4A 1U3JA 3D2TA 2JB6A 3KBFA 3F58H 4KHXH 5CSZB 3VTAA 1H19A 4X8GA 4D0CA 3GKZA 3NIFF 5HDBF 3OXSA 2WZ5A 2VERA 1IGTA 4AX3A 2IVFC 3TONA 4OJCA 2V2TB 3DHPA 3JZ7A 3Q5OA 5MERB 4L4JA 3BAKA 2XCMC 5LCVH 5I2IA 3DPBB 2X40A 1NFDF 5AB1A 3DDFA 4X83A 1JFHA 2D3NA 2XA8L 4HUVB 1QWHA 2DTSA 3VXPA 4I2XE 1IT9H 4F8LA 4Q52A 1GY1A 2J71A 4BKLA 1VDGA 4U1MA 4WJG3 4Y16B 4JQXC 1NOAA 3NACH 2W80C 2GBUA 3D25A 3CZJA 4KXZI 2R23A 2BVOB 3EOAA 4NPJA 3Q8EA 5E2TL 4P5TA 3PHQB 3H85A 5GGQH 2K1MA 4HPOL 1U42A 1R3IH 2HLFC 1LEKB 4Y1SA 1X7QB 1OCOB 3E2HB 5ANMB 4C59B 1KC5H 5FUCC 1KIUB 1GYCA 1TCRA 3RGHA 1LL1A 1JRHL 3SD5A 1IT9L 1RXLA 4WO0A 5BZDA 3HNTL 3IRZA 1AR1C 4JVUA 4H25A 2IDQA 2V2XA 4KX7A 4HKBB 1FVEA 1FHNA 1R24A 4O4YH 1FE8L 4P46D 5E56A 1KGWA 1OGAB 3T77A 2NY3D 2Y07H 4NP4L 1WF5A 2C26A 4N85A 3IXTA 1NEZB 4N2LA 3F84A 3LPFA 1KXHA 1QNZL 2EE0A 1CXHA 4R9HA 4WSGA 3RTQD 1OB1A 1NBQA 2KDYA 5JW4Q 1IC7H 2FBJH 1DHKA 3U30B 1N2RB 3HRZC 3OWEA 2DI7A 3TEUA 1F3JA 3U1SH 4DERA 2BMKA 4TKWA 3W56A 5D93C 5EF3A 2NY5L 4Z7VF 1AQMA 3LZNA 5JUEL 3QDAA 1F90L 3X3GL 1MCJA 3II1A 4YX2H 3LKOB 5IMLA 1IGCH 2IIJA 1BLIA 3O4LB 3PV7A 1OCZB 3C5ZC 2O6EA 4X7SH 5HHPA 5JQ6L 1AZUA 4KRLB 4B6ZA 2GJZA 4LLWB 1WGOA 3CVHA 1T4KA 3W2DH 3O2WH 2HRPL 1DBBL 4NN6C 4RIRB 1I7TA 3L45A 1FH2A 4KKRA 3WFCH 4ALAL 3KGUA 3QDMD 2ZCZA 1IAKB 1A1NB 3L3OC 2NY0C 2F18A 4K8RL 4N1EA 5I8EA 5IB5B 4KQ3L 3F7YB 1HC1A 3HVDA 1NCCL 3X1NA 1UH2A 5FOJA 2EH7H 4JZOB 4LBAA 2DYSB 4NZJA 4RRPG 1RPQA 2JB5H 3H42H 5KYYB 4X5RA 2EDEA 4JPIA 3JYCA 4G6AC 4OZFA 3GBEA 1Q9LA 3QO0B 4KO9A 2W0KA 2CJUL 2BP8B 2DLHA 5EBMB 4I88A 4RMTA 3BVXA 4GFXA 2V5RA 5LO7A 1NGPL 3AY4C 1M1SA 4NC0B 3MLSH 4WTXA 5HHQB 3RTLA 3DO7B 1FZOB 4QCIB 3CIAA 5IB2B 1J5CA 4EZKA 3RWDA 1YEGL 5D1XC 4HISA 1NBZB 3EYOB 3US1A 4TL4A 4RQQB 3AB0B 4FX5A 4NQXB 2ZWNA 4XOEA 4RWYL 3OAZH 4DKFH 3CCHB 4YPJA 5F7UA 4MXWL 3K8KA 4JRXA 3G5VA 1SJHA 5DA0B 2YS4A 1DDTA 2ZKXA 3C8DA 3DBSA 4BCZA 4F92B 2VQTA 3C8KA 5JIPA 2V3FA 1F11B 3AC0A 1RVFH 4QKXB 3WFEL 3BZ4A 5A2AA 3D05A 5IOPA 1Y18A 1CIDA 4ISVA 4MBOA 4MWFA 4WI0A 1AO7E 5IEHB 2RAMA 1XGUB 2X4PB 5IHZB 1GR7A 5AEAA 2VAAA 2NT0A 1VJSA 1YC8A 5C3TA 4EUPB 4GMSL 2NNAB 5I19L 1K3IA 4HW6A 1XWVA 4OZHB 1TQSA 2DQCH 3IS0X 4MQ7B 4W6XB 5FGCB 1ROWA 1C7SA 4JQXA 3JVGA 4GSDH 4QTIL 5BO0D 5J6GA 4PCKA 5DJ0A 4LNRB 2YD6A 4HKBA 1DSWA 2XHNA 1E9PB 4G5ZL 3FTZA 3TNNA 3WNIA 1FNLA 3FYEB 4MB5A 3QEUA 5DTFA 5F88A 1U8NB 5AVYB 5KOMC 1FLRH 5F7MC 1JTTA 4DHLA 1XF3B 1U8OB 2GK2A 5FCSH 5GGVY 2CQVA 5EU6E 4N2DA 1HXMB 3F00A 2F5BH 1YDPB 3BDBA 5ENWB 4Y1TA 4R0LB 2GI7A 3PWUB 2VZOA 4G59C 4P05A 2AP2A 3WS3B 1BECA 1OPGH 1O9ZA 3G5YA 4E41E 1BGXL 3QJTB 1JP5A 3BSZA 2P5WD 1MWAB 4QUOA 3LNEA 3RIKA 1RJLA 2VDQL 4QMEA 5L4MA 2PPFA 4LCCB 3LKOA 4CJ1A 3LY6A 4CW1A 2DD8H 4MKTA 2VDKH 4TVPH 2QGCA 2GT9B 3HPLA 2O5NA 5FKAB 1WBZB 3UH8A 2AF2A 3LKSA 4R5VA 4ZD3L 4PLNC 1GL4B 3QUYB 3WY2A 3ARVA 3REVB 4NENB 4POUB 4ZFGH 4KUCD 4K5PA 3HNVL 1OT2A 2HVBA 2PWHA 2X88A 4HUCA 4I7ZC 3HLKA 3TJHD 1KJ2A 1TNMA 4PRIE 5EZIL 1KXQE 5FYLH 1T0MA 4XPTH 2ED7A 5I0ZA 3QXTA 4UNIA 5CJOL 3LXAA 4WNQA 4LRIA 1JG9A 1H3XA 3QS3A 2YFNA 1FQ9C 3OAZK 4OLXH 3Q2CA 5FHAL 4YHYC 4LHUG 4U1HB 4PRDB 3U83A 1UXMA 3FK3A 3LNIA 5K9KB 1CUOA 2FJHB 1YC7A 2RQ8A 2X4UB 3IXAA 1IBGH 5AVRB 1FJ1B 3O41A 2XBDA 4HX1A 1N9PA 1NKOA 4YZWA 1XVSA 5I1AA 1SM3L 5KVFL 2R1XA 2PO6A 2GUYA 4ZJ9A 3VFNA 3ZO0A 3QR0A 4UQEA 3UTTD 4FJYA 1OPGL 1G7IB 3B9KB 1DL7L 3B7TA 3QUKB 5KUMA 1UCBL 1Y18B 1WT5C 4ISVB 3NH7L 4O5LH 4WI0B 5AOIA 2X28A 4NO5B 5IEHA 3E3QE 4HSAC 2R23B 3FQ2A 5DHEA 3CFMA 4FNUA 1FYHB 2EXYD 3WOVA 4NQDD 4FHBD 1YA5A 4JFTA 1JHKL 1BQSA 4HSQA 1WWWX 1NCJA 3IJSB 3T09A 2YD2A 1X5ZA 5C7XL 1PCXA 4O02H 1YEIH 5F7EL 5IR1A 4MWFB 4W68A 4Y9EA 2W95A 3GI9L 2EXTA 4N0YH 1LEGA 2WCSA 1M6UA 3SE8H 1QP1A 1Z32X 1A02N 3WTUA 4KI5D 1XIWA 1A21A 2B3IA 5HHOA 2CHDA 3F05A 1SMAA 1JZJA 3OMAB 4NUJB 1AZCA 4HDIB 2YARA 2MKWA 3G6JB 2K8QA 5EDXA 2Y3NA 3VXMD 3IAQA 1Q0XL 2XRAL 2B1OA 4LLMB 1NCIA 2WIMA 1Q4NX 3FT9A 4OFVA 3TVMA 4BUHA 4RZKA 2BP5M 3KS0J 1ZDQA 5DZAA 5DSCB 1TCRB 2AJYH 2V2WA 3VTTA 1JNLL 5DJDB 4MJ5B 5K9JL 4XPGH 3RWHA 1MCOH 1T0NA 4PIRF 5D5MA 3QRGL 5L2KB 2IC2A 3S2AA 1MRCH 1H8SA 1VZGA 3L81A 3EJYD 4FFYH 5HHVL 2Q9OA 4TNGA 4CN1A 3A4FA 3LB6C 5JO5B 2CR3A 4BRJA 2QR0B 2XQYK 4GP4B 2I25N 4YHLL 3BUYB 5F93C 3X17A 1TFPA 1OANA 5GPRA 1LM8V 1J5DA 1AGEA 1ZVHA 4X5WA 4MYPA 4YQXL 1P7BA 3NABL 3P9MA 4DGWC 1MAJA 4GLRI 3NN8A 3PWPA 4M02A 4I3RL 1TMQA 3RKDD 4JN2A 2YBGA 2VR7A 2IANA 3GI8H 1CG9B 2OV0A 1SOQA 3M1BA 3NPSC 2FUQA 2G75B 5EOCJ 1NC2B 1IZKA 3EDEA 1YHPA 1MNNA 4M43L 5H2BA 2CK0H 1UM4L 3FH8A 2C4FU 1RURH 4F2MA 2V7NA 4WLCA 2OMTB 3GPSA 4D9QD 2ARWA 1URLA 4JFVA 4OR1A 4PGCA 1QSFB 4PR5B 3L9BA 2DB8A 2CBQA 5B7FA 4RFNB 1J05B 2R7EA 2K6ZA 1R47A 1DVFA 5FCUH 2ZG1A 4OIBA 2X1OA 4O2EA 2RD0A 2PO6B 2F6AA 1HHJA 5D7LA 4UUJB 5EUOB 3ABLB 2BNQE 2IOOA 5K9QG 1Y6MR 4ZMAT 5ADOH 2J4WH 1NOLA 2APFA 3KYAA 3ZZLA 4HUXA 3C8KB 3Q13A 4MJIE 4ZX3A 3OKKB 3IPEA 3V79C 2PXYA 5BOJA 3TBBA 1F3DJ 3ETSA 4GRLB 5AW0B 2FO4A 3KMDA 2X70A 3ARDC 4FXTA 3NQKA 2NY2C 4HF5H 1QFWH 4NUJA 2C3WA 1MY7A 1UGNA 3QISA 5TFSH 3L2MA 3NIDB 3KL5A 4GW1A 2DS4A 4MZ3A 3I9AA 3FJTA 1MCWM 5FYKD 3T8MA 3IETB 2NY0B 4NT6B 1M1XA 1L7TH 2Y24A 3U6XS 5E6YA 3VXMA 1BZ7B 5BJTB 1NM4A 4FTVD 5C09E 1DQDH 5F1NA 3QG6B 3AY2A 4A2FA 5JMOC 4WV1B 2DQJL 2Y72A 4I1NB 2CDEB 3LVTA 1DFXA 4L5FE 4PJCA 4UT9H 3BT2H 3CV5A 3GEWB 4JO2L 4BZ2L 4OKVB 4YDJA 4R96B 2BSTB 4IBTA 1RHFA 3C5JB 1EO8L 4HUNB 3U0PB 1VB9A 3OF6A 3SYAA 4ILDA 5F7DA 1D7DA 1PVHA 1F41A 3D2UA 3GM8A 3HZMA 1DN0A 2DQDH 4MMXB 15C8H 4Y0GA 2D4DA 3O6FA 2XWDA 2WSPA 1DQJA 3R1GL 4K94C 3G04B 3VRJB 4UZGA 3P4LA 3VI3E 3TEXA 2ED9A 3MRHA 4F2EA 4PJDA 5IHLB 3OXRB 3A5VA 1M7IB 1HK6A 1FFOA 5FV2A 1ZANH 2BIIA 3VI4E 2QBWA 2AEWA 2IOMA 4TMPA 4GY4A 2WGNB 2VDNB 4R2GB 1BGXH 1SLWA 15C8L 2YEZA 3FZUD 3L48A 4R6UA 4G7QB 5I1LB 5JIMA 3WU1A 1ZA3B 1M71A 1GGCL 5I2IB 3EJQA 3N0PB 3MRNB 1JN6B 3RB7A 3WNPA 1NBYA 3DA0A 4NZ8A 3H9YA 4U1JA 1RQ5A 4I4WA 4MVBC 4LFHG 4PJGE 2AEIT 1MFEL 3RIFF 3KPPA 1XAUA 4JKLA 1CZ8H 3LZPA 3BYYA 4N2BA 5GGVH 2OK0H 2FX9H 1AC0A 1AQKL 2R9HD 5K1VA 3S37L 1ZHNA 3O3BA 3QAZB 4XNYL 1EHLL 5T1KD 1CQKA 4NKMB 2O72A 4MDJB 1TZHB 1X4ZA 3CWGA 3BLKA 4HH8A 4RMVA 5C0IB 3MV01 3VXTA 1S3KH 1N67A 5FYKH 5H94A 2WLKA 4DZBB 5ISZD 2YRLA 5D1QB 5HY9B 4FQLL 4I18A 5F7NC 5LKNA 4WO4D 2QQNL 3L5HA 3PLYA 4MTMA 4QHNB 4A7TA 5L7XH 3QQDA 4AYFB 1J48A 2CDFA 4XP1L 1JZ6A 4JO4H 3RL2B 1ZEAH 4PBVC 2I9TB 25C8H 4Z77A 4A2DA 4P0DA 1BFVL 1D5MB 4BFKA 2AJSL 4L0ZA 3Q9PA 4E41A 1U21A 4FS0A 4U05A 2X12A 2XFXB 4JFOB 2A6DB 3VXMB 1ES0B 1EV2E 3O4LA 4HZLA 4LHQB 4G8FB 43C9B 1T03L 3RQ3A 2FSEA 5IR1B 1E50A 2IAMB 4FYRA 1JGDA 4HWNA 3REWB 3OAYH 4WI4A 4MNHB 3ZKND 5CN1A 4Q4EA 1EERB 3RNKA 4PJXB 4FLSA 1NMCB 3WKQA 1KZQA 3MBEC 5E8PB 3DUUB 4XMXA 4G8EA 2HFFB 2F61A 2MNUA 2DM2A 3F8UB 3O45B 4PP2A 5I8EB 1OP4A 3EYSH 4W9FC 4JUSA 4JANB 5E6ID 1KTLA 2BIHA 1UATA 1WTGT 2J1YA 4OF8A 3T2LA 4L1BA 2WN3A 2Z91B 1RP9A 1KNOB 3CFQA 3ZKSD 5CGYC 2GG1A 1DR9A 3I74A 1DUYA 1CD1B 3NJNA 4FXGB 3WEXB 5E8DH 4CADA 5GS0C 4JM2A 4KNQA 4KTEL 3ATAA 4L8BB 4DEUA 1D7FA 1NCWH 4MDRA 4BXVA 1E6JH 1WH0A 2IAND 1CGVA 1EDYA 2XV3A 1SXZA 3MV8D 4OQTA 4MB4A 4XNUH 4ZXBB 5BV7L 1X5HA 4DP4X 5HBBA 3ARWA 2EE3A 3MUUA 4OZFB 4J3OG 1HH6B 3RZCC 1IM9D 1CGSH 3STZA 3GSVA 3P9LB 4RESB 3WKMH 1MRFL 1WCBB 1QLFB 4OT1H 2IBZX 2VXTH 5E2JA 1G7HA 4W9EC 2R29H 2CO7B 3EDKA 3BVUA 3L3GB 1B0RA 1MLCA 1MOEA 2NXZD 3OMIB 2B77A 2EIKB 2FWOB 1KTDA 4L29B 1JN6A 4GP8B 2W59A 3PWPB 3HNSH 2D4FA 1PKOA 3ARBB 2WNKA 2BRRL 1HQ4A 3VYOA 2PKDA 3BIBX 3DC0A 4AV0A 3LIZL 2NOYA 3OD3A 1N0LB 1ETZA 2QV4A 4AJVA 3ZL1A 1MIEH 3SSGA 3LHPH 3FFCD 5HY9A 3ARDB 4L2LA 3GSOA 5KUKA 4FC3E 2R0ZH 3QZBA 4ANKA 4UI2A 4MAUL 1YQVH 3RVUD 4D9LH 4H1LB 2P8LA 2EDNA 2ESVD 4GW4A 3EBIA 5AVTB 3CAFA 2Q86B 3CH1A 1QPPA 1QD0A 3K8MA 4PJBA 2B0SL 3FPYA 4L9LB 5EA0H 1J0JA 3TEZA 2PO6C 4KMLB 1MCRA 1F5WA 4AGQA 2ICES 4RGNC 4XBMA 3DI3B 2QVMA 2V6HA 4LRNH 5I5JA 2XPZA 4PY7A 2UXFA 5JXAH 4BZYA 2E75C 4FI8A 4HSCX 3QJXA 2FX7L 1QO3A 2Y36L 1YEEL 1SOKA 1JD7A 1KBWA 1G7PA 4WV1A 2H0EA 1WBZA 3TX4A 4E9SA 2DQ6A 1JPGB 2IGTA 5F89B 2TSBA 4APXB 3U30C 5DD6A 1OE1A 3QUYA 4KX9A 2FGZA 1D2OA 5EF0A 3I6KA 2BIQA 3BD3A 2WLIA 4WI8A 5DVMA 1AXTH 4NT6A 1L3WA 1K5NB 1L9QA 2R56H 4DUWA 1CDYA 4MHHI 1NFDE 4TYUA 2EYSB 4HOZA 2I60H 1AHWC 3EYUL 3L3JA 3RZCD 4PUBL 2H1LM 1D6VH 2X2UA 4JO5A 3I50L 1DANU 5IMKB 5F3HA 4QHLA 3U6RA 2P5ED 3O4OC 5EMYA 4CADB 3L3OB 5GS0L 5K93A 1LQSR 3KYOB 2E46A 4KTDL 2GY7B 4TNVF 2YWZA 4LSDA 5D8JL 5C07A 2HFEB 1WFOA 4OCNC 1YPZF 3BAEL 5DK0B 1TTBA 5H35A 2R1XB 3C5JA 3GBDA 2CKBB 2GJZB 2P24B 3IDMA 3BN9C 1E5ZA 5ACMA 1BAFL 3HJ0A 2H32B 3K71B 1S7VB 3H3KA 5C0RL 1WFJA 3DYMA 4F80A 4H2CA 2R4SL 3C6LC 3ML8A 4JFWA 5CWSA 4MMXA 4JDZA 4RDBA 1NCOA 2PP8A 3M8OH 5J56B 4I9XA 2C9UA 5KVMC 4GO8A 2L7QA 1A4JA 3POCA 2AEOA 4IKJA 5DRNB 2OBGA 1CXEA 1KBKA 5E99H 1I1YA 5E24E 5FS5A 4ENEC 4TXVB 1N18A 4AMKL 3HRZB 1X7SA 4C47A 5IP4A 1D9KC 4OI9A 5IFAL 1A22B 2VQ1A 4PV1C 4H5SB 3UTQA 1QUPA 2A9ML 2N1KA 3QUZB 1GKOA 2DQUH 4HKXB 2ICCA 4LDOB 4PRID 5DHVH 2N59A 5FA4A 3I6GA 1OWWA 3ARRA 3DX7B 4K2UL 5IB2A 1L6ZA 3IDGA 1E6OH 1M05A 4HFWA 4KUZH 2X89A 4P4RB 4U6VH 1EHXA 1E4HA 3E1ZA 4JCLA 4ICWA 1QTSA 3S4SA 2P46B 3KPRA 4JHAH 4IJ3B 1X4YA 4MKMA 3EFOB 4PGBA 5IZ7A 5DUBA 4QHNA 3DLQR 1JNJA 3BO8A 4I48B 3ZDYE 1PQZA 4L23A 4KZDH 1BJ1J 1X5LA 2CR0A 4IIQC 1AQHA 3DWTA 3B9KC 4HEME 1IX2A 4FD0A 4GKZB 1MUJB 3ZN6A 5M7QA 2A9AA 4KVCL 3U2IA 3ZIMA 2EDXA 4ONGL 1H0DB 4MNQD 4PRAA 4PVLA 5TQ0L 1OSYA 5JR1L 3FT4A 4TUKL 4WUKL 1LXMA 4LPUA 2F53E 2VLRA 3KYNA 1K85A 4L18A 12E8H 4PWHA 5FWRA 3DTUB 1O6SA 3CQQA 3KLSA 2Z4TA 4WEUD 5HVGB 4NQDB 1ETA1 2EH7L 1RIVH 3L6FA 5D9SB 3RWHB 4LVHC 1JPFA 4M8VA 5DJ0B 5MI0C 2ZUSA 3FF7A 4Z7QE 2N4IA 1N8OE 4HJIA 5HHNA 4OI7A 1UA3A 4IRZL 3VWJD 1VF5C 4HPYL 3FTVA 2Z92A 2GW5A 3RGVD 4M00A 4X6CF 1FYTD 1TXKA 3TH4T 1KGCE 5CP3H 5KBLA 5J89A 3B34A 3UYPA 3NP4A 4BSJA 2NCEA 5IROA 3BUQA 2KZWA 1YYML 2DJ4A 2YHGA 4J3OC 2GB2A 1AGEB 3THML 4X5WB 2QTEA 4Y9GA 1DZ0A 5D7HA 4S1QL 2IAMA 1QG3A 3MLVL 3ZR5A 3SQRA 4DZ8B 3ZSSA 3FQUA 3KL0A 2O5ZL 4JS7A 2Z8VC 1NTDA 2BNRA 3ROLB 4R90H 3BP7A 4DFHA 4L4VB 4IHOB 3VD4A 3QNZB 5HJ3B 2WNGA 4FLRA 3D0LB 3ELQA 1QSED 2EIEA 5D6CA 4ZXBA 2F08A 4BA8A 2ATAA 2JTDA 2VM4A 1PSKL 4UT9L 5E2VH 1NH6A 4O02A 2CKBA 2DF3A 2AJVH 3KHOA 4IYKA 4S0TD 1RURL 4DP9X 1JGIA 1MJ8H 1O9VA 3OZKA 3QUML 5LLIC 3FZUC 1FE8H 3ATBA 5F0MB 1EXUA 2H2PC 4ODUA 1ACZA 3V0WL 2BS71 4YDMA 3AAZA 4ZTEA 2BM3A 1B6DA 1Q0YL 3S35L 3U2SA 3PJSB 2B20A 2ZZUT 4EJ1C 4PJFF 1IO4C 3L5WA 2WXRA 2DTML 4KH2A 1RZJH 4N20A 4LLYB 4TV3A 1CDUA 4KHTH 3VXSD 1TSHA 1WT5A 3JUYA 5HGAA 3FN0L 4TRPH 5AB2A 1DBJL 4JKPL 4PFEA 5EOQH 4P2QA 4X5PA 5AAMC 1EHLH 5E94B 4F58H 1R5VB 3QEGL 1XZWA 1BZ7A 4N28A 5GSRB 5BJTA 3W39B 3C6EA 3TJEH 2NR6C 2TRHA 2IPKB 1XCTA 2BNRE 2WLYA 4DO5A 1U8KA 2B4CL 2HRPH 5FV1L 4BCXA 1QPKA 3LQAL 1JHTB 1K6QL 2Y22A 3MJ8A 4QXGH 3V0EA 2RFXB 2O4EA 3RL1A 1AXSB 4FLHA 4KO7A 2YMXH 4JHZA 4OFYA 4CMMA 3L17A 5HYJA 1MLBB 5IMLB 4GO9A 4BZ1H 3QXAA 3ULUL 1JD9A 1C5BH 3NJMA 4N5UA 1EANA 5ILTH 2WXGA 2ICEC 2BVUA 4Z0BL 1P1VA 1OAXL 2VZ1A 2W9DH 3LRSB 4WIQA 3D2UB 5IFHL 3GSRB 3L95A 1VSCA 4WEEA 3HAEH 4AIXA 1FLTX 3OB0K 1NL0L 1KJ2H 5IVXA 5E8NA 3RU8L 4UOJA 1GIGH 5I8CA 2BS9A 4R96A 2J56A 4U7SA 3MBXL 4K3EL 4U7MA 1X5MA 4N8VA 3WFBH 4D94A 5J9PA 4QEGA 4AEFA 1R5IB 4PSRA 1F8TH 3VQMA 3G6AA 2VDRH 5IGXL 2Y07L 3O4LD 4NP4H 1SYSB 2IPUK 3FU6A 1DBJH 3HPJA 3SE3C 1ORSA 4ZFGL 5GJSL 4LGRB 2WLJA 1YLBB 3ZYJA 2LFGA 3K5SA 4H4NA 4IQHA 3AT9A 4KGLA 2OQJA 3B2UD 3TJEL 3OPZL 5F3HB 3GD1C 4FTVE 5C0BD 1U30A 4JFFD 4IRSD 4U1JB 2PYFA 3BPOC 2C5DC 1Z9NA 5IB3A 4FG6C 2UVFA 5F6IB 3IFPA 1U6AH 5CUSH 3H1ZA 4I77H 4BWTA 3FTWA 1E65A 3DUSA 4HMEA 3AG4B 4PI0A 3MV7B 3GINA 3GK8L 5IMOA 1JZHA 3LB6D 3VO0A 2FATL 3J2PA 5SV4A 2ZSVB 3KH3A 5BVPL 3NRQA 4V33A 5D7SL 1N5YH 3ABGA 1IKNA 1IGTB 3UTOA 1CYGA 1ZGLA 4U3XA 5DWUH 3M17B 4U0QB 3KPSE 3GMOB 5J6GB 5FC9A 4W4OA 5DJ8A 1HFUA 1A1MB 1SYVA 1HKLL 2OI9C 2YO3A 3GXNA 5F71A 3RWGA 2H2PD 4WDIA 3VX1A 4EUPA 2F58H 2UZXB 3CSYB 4IGBD 1U8NA 2G60L 4GEIA 3VGDA 4POYA 3WLBB 4LXFA 3V4LA 3L08A 2LLGA 1XV8A 2DD8L 3ESUF 2K3TA 3QORC 1JVKA 3ETTA 5DJ2A 3EIFA 1CGUA 4JFOA 1T0PB 3EO0A 2RH0A 5IQ9B 2EEFA 4L4TB 5JQIB 4G8FA 2ZJSH 3DMMB 2BC4A 1W16A 3EFDL 1BLNA 5HYQB 3FRPG 2WIIA 4HQQL 3UTPE 4UTBA 3BP5A 4HJGB 2IPTH 4F8QA 3CSBA 1D5MA 3O3AA 3RNKB 2HVJA 2GYSA 3MMEA 4P57B 1N6QL 2JB5L 1ES0A 4R7DA 3FT3B 4TNWK 3C12A 1YCSA 2CRMA 4PWJA 3U9UA 5JHDA 4H2AA 2BVEA 4AIZB 5KTEH 4UCFA 4W1TA 2LOEA 3WEBA 5J11B 3GZKA 3UPRB 3W1ZA 1HYRC 1NBVH 2X2YA 1OK8A 5K9OA 3MUJA 4MD0A 3VGEA 2JQMA 3BHBA 1H3TA 3UZEC 4B9JA 2DQCL 2ZX9A 4FKEA 4XN8A 4LRIC 1LDPH 2LU3A 3CVHH 2JKWA 2WXQA 3IKCA 4N8VB 5DO8A 1M2VB 4A39A 4S1SH 1A65A 3Q1EA 4EIGB 3K6SB 4MJJA 1D3CA 5E4AA 4PG9A 1IGYA 2Z31A 1L9OA 2VXVH 3MBXH 4TTDD 5GRWA 2CHNA 5BS0B 4HPYH 2E7MA 4F33A 4C83A 4QLRA 1UCBH 2GBAA 4KK9D 4KRPB 3IJ7A 2D3JA 2I85A 2WWMC 4Y5XA 4MDIA 3ILEA 1J86A 4U6YA 5I0VA 5KS9E 4HK0B 4PJ5E 1FAKT 1OAXH 1DCEA 1OSZA 2OXGA 2GSMB 1YEIL 3MGAA 4GG8A 1TZAA 5CR8A 3GBNL 4P4KD 2HH0L 5H37G 1WSST 3KW7A 4B9FA 5IHHA 3GSXA 3RX7A 4OLVL 1D5IL 1TVHA 3BVWA 3ZE2E 1JGVL 4FQXD 4Y5YB 4HCGA 4N26A 1B0RB 1BAFH 3EBAA 2Z65C 1XR9B 2NRDA 3ZTJH 5DHVA 1ZT1B 1R3KB 2IDSA 6PAZA 5I17A 3QPXL 4JM2D 1Q9WA 1CCZA 1KOAA 2AQTA 3CC5B 5IBLD 1X6NA 2GCYB 1IBBA 3GMMB 4P9HC 3FU7A 3IMUA 3LZFL 4AQZA 3WUWG 1XMEB 2ADJB 3VWJB 3CLFH 4QHKI 4UAOB 3BEVA 5CXPA 1WFNA 2HLAB 2VC2B 5I1JL 5E2WH 5I16A 3T0EA 3KPRE 4OCRH 4U33A 5DJ8B 2H26A 5CEYB 1QR4A 3MRKA 3EO0B 3L4VA 4FTVA 4S0HA 1E5YA 2JJUA 3MLWL 5A2IH 5KYXA 1WIPA 1OP3H 3VFOB 2V2WB 2WUBH 3SKNA 5BW7A 2XA8H 2OXHA 2VDNH 3HTLX 5D2NA 4UTAA 1M3IA 4DP1X 1G9EA 4H8WC 4L4TD 4QRRE 1CYWA 2FHCA 5JQHC 4P23A 5HDOA 5EU7C 2BHZA 3PWPD 1A14H 4QAMB 3LXBA 2CIKA 5AB0A 4RMQA 5FM4A 2J2ZB 3HVNA 3LN4B 4PJDE 4JN1H 4UT6H 5L4JA 4DGVH 1E0OB 1IJ9A 1Z5LB 3JV4B 2OSLA 5DJDA 1TQBC 1PTZA 3DXAE 2FB4L 5AAWC 3HE7A 4J2QA 1YPZB 3FU5A 4TLKA 1LO3H 3D39E 1P7KB 3B5TA 3MLSL 3ARYA 3PDDA 4M62H 3RPBA 3V8OA 4Z8FL 4GSQA 4XHJD 1OGSA 4XWOC 1BYNA 1Z9PA 1QZ1A 2IPKA 4X4XB 4I8DA 2F0CA 1FIGL 9PCYA 3UDWC 3I85A 3MRJB 4M6OH 5DI8A 3QHTC 1M53A 5AZ2L 1YEWA 3NPSB 4ONFH 5IMKA 2C8NA 2P8MA 2Z4QA 2QQQA 4G72B 1DVFD 4V2BA 3KPSB 1HL5A 4CC4C 3RWEA 2AQNA 4LO9A 4C54A 4G43B 1ZLWK 1S5IL 1OZUA 4BQ6A 1JF1A 4YHMH 3ZHKA 5A2KH 1M7UA 3TVMD 2N7SA 4KTYA 4JAMB 4NP9A 4OD1H 3LRLA 1C9SA 1MCBA 4IOFC 3HUJA 2A9NH 3BPCA 2ZAHA 1IGIL 1WAAA 3QZNA 4I9WD 4J3OD 2EQDA 5FB8A 2FQFA 1JWMA 1D9KA 1WA1X 2ETWA 2IPTL 5HYJD 1LMKA 2PCYA 3QIUB 3WFHB 2UUDK 5IVOA 2E74C 4JQVA 4EBQH 4UUJA 3UTTA 4GKNA 1BV8A 3QEHA 5T3XE 4NFCA 4G42A 5CN3A 3QUXC 5ESVA 5IEKA 1MIEL 4JDVA 4P4KB 5LGHH 1F4WL 4TQ8A 1R3KA 3QIBC 3FQTB 5HGDA 4KKQA 5IBUG 4NRXA 1KJVB 5LGYA 3O8XB 4YL4A 1XTLA 2F15A 3FU7B 4CNIA 2EEXA 4KO6A 3ARFA 4K55A 3C08L 3OG6B 3V52H 1O6TA 4APQA 5ID0B 3D50A 5CZRA 1A4KA 1S9XA 1T83C 3SDCA 4JBSA 5BUGA 2W9EL 3NSXA 5CCKH 1CU4H 1G4MA 1SQMA 1U91B 1WYJA 3ZT5A 5GGSY 3S34H 1D5IH 4U31A 5D7LE 3O6LL 2O5ZH 3KLQA 4P23C 2BOBB 2VIRA 4EI5B 3L3GA 1W72L 1NGPH 4QO1B 4N2MA 3VXOB 4GKOA 1ZJAA 5CLZA 1H0DA 4PRAB 1W15A 3ARBA 1AKJB 5SX5H 4BWUA 3HN5A 4KDTC 3HEIB 4PU2A 4JW3A 4QT5A 2E7BA 4DN4H 2IQAB 1CLZH 3DX6B 3AG2B 2XZCH 1NCDL 1NGWA 1S4IA 4Q14A 4W6WB 5GHWL 2HA1A 4G3YH 3S36L 2KLTA 5BZDB 2DQFB 4GAYB 4WWNA 2AXGA 1QLRA 4W9HC 1IIKA 4I3RH 1A7QH 2Z93A 5D70H 3ZL4L 3FB8B 5IB1A 3U4EB 4XX1E 4JKMA 1JZDC 1DFBL 1DVFC 1Z5LA 3QXUA 1NFIA 1G87A 2R1WB 5CGYD 3CH1B 4XBGB 2FEDC 1PZSA 2YUXA 5DZOA 1FGVH 3CXHJ 3V6OC 3KXFA 3QXDA 3VG9B 1EZUA 4JQIA 1BZOA 4LLWA 3BFWA 5LNDA 4MS6A 4MBRA 3ILPB 3P11H 4NM8H 4L4VE 2AZUA 3LXCA 2AKRB 2PCFA 2B08A 4RZCA 3BHBB 1A4BA 4LCUB 1NIEA 4XODA 3ULVF 3O3AB 3OMZA 3BP7B 2P5EA 4M5SA 2OMXA 1U95A 3QNZA 3DJRA 1T7ZA 1XL4A 4JUTA 1EAPA 3MGTA 4LKXB 3WTXA 3AT8A 3QQ4A 1UWGH 3D0LA 4CN6A 2WW8A 3NP3A 1P0SE 4JNXA 4PPTA 4Q9CA 1OD9A 3QZWB 4UQ9A 4MNGE 1U3HD 1E90A 1UJ3A 2HKAA 3F6LA 3VFSB 1M56B 1I7ZA 3J7HA 4X6CE 5D7JC 1SHWA 2NY6D 2DIEA 3FDWA 3QEQD 1KN2H 2YSSB 3IFLH 3LKQB 4CVXB 4NBXB 2QKSA 2OW6A 2VMDA 1BOGB 2VDOB 4B3EA 4UV7H 3BPNB 4FQQB 4GXFA 1QASA 3WIHA 1UZGA 3IMRA 4LOUC 2WQAA 1UB5A 1AQKH 1IGYB 2DMCA 4IRJA 3HZYB 4ZFOA 3IN2A 5C07B 3NZ8A 1I1FA 3QUXD 4K9EL 1R5WB 1O7DE 3FB5A 4OLYL 3FU8A 4AKPA 4CILA 3V0VB 5I6MA 1R34A 2QPDB 2YAEA 3ARPA 3HI1B 1JGUL 4G9FB 3B8YA 5AG9A 1W0YT 4Z3GA 1FCGA 2WO2B 2BSDA 4N2OA 3PIQB 3QORA 1HILB 2K4WA 3NGBC 1M6OB 4ATWA 1GAFL 1DQLL 4UBDD 3FN3A 4LBEB 3DIDA 1MREL 5B8CC 2WB7A 4ORGA 2LVCA 3ZK0A 4YWGL 2DZEA 3NA4A 1T4WA 3QQ3A 1R75A 4YLQT 5FGBA 5DHVB 1SDAB 1MJ7H 3WNOA 4AUYA 3EDJA 4HWBL 1G1YA 4WENB 2N3JA 5LG6A 3OKKA 3CUPA 3QDGE 1TQUA 1JV2B 3DGGB 2AXHA 1A66A 3I2CL 2KL6A 4E41B 3MOAL 2VRKA 1FNFA 5EOTB 4X5LA 2CUHA 3TTSA 2ZKWA 3ALPA 3JWNE 5I8CB 3WMQA 5I30H 1O75A 5BVJB 1URZA 1CYXA 4QTHB 2WYIA 3TFBA 2LE9A 3R7RA 4DFIA 3COOA 5FYKU 4LSUL 1IRAY 3UJJH 2W60B 3LRSA 3RZWA 4GIOA 3UG5A 4ES8A 4PG2A 1C08A 1UYWH 3N04A 3VFOA 1Q72L 2NQDA 1A0QH 1BX2B 2A7BA 3W57A 1GW6A 3QARA 1PYWA 1NSNH 2QLYA 4YDIL 3Q9QA 1HXMA 3WV0A 4LLUB 1H3PH 4ZAKC 3N6YA 3QSKB 3L3HB 4CRPA 4X8XA 1A9BA 2XN9B 3UG3A 1IMHC 1DQML 5D6DC 5D7JA 1TLMA 3WN6A 3ZHLA 1MY5A 1GPOL 5T3ZL 4L8BA 2XV6B 1Z1WA 1KTCA 4WHYH 4TSBL 3DARA 3NZUA 2DKSA 1B4TA 4WNQB 1LDPL 3M07A 5IB3B 1CD0A 3M46A 4AVJA 5KYNA 5EEUA 4OUOA 1AGBB 2H3XC 3NBNA 4HC1A 1ZK5A 3NQIA 3VXUD 4PJ5B 4Z95H 3SDXA 1HH6A 3U82B 2XQYA 3PL6A 3TCLB 2O5YH 4K73A 4NBYB 3HKZA 4XMWA 2YBRB 2J1WA 3BKJL 1CD9B 1QLFA 1FFRA 3R7QA 1YEKL 4Y1AE 1O5DT 4AGOA 1TKWA 3V0GA 2I07A 1KWGA 2Y06H 4W9JC 3KPOB 4EDXB 3KDPB 3DUSB 4JPIB 3TNMB 1GCFA 1DUZB 1UD4A 2VM9A 3CJJA 4G7YL 4JFEB 4ZUWB 3IPFA 3OGCA 3H9HA 3WTYA 2GTQA 4JFQA 1RIHL 2A9DA 1DQQA 3H9SE 3PGDB 2NXZB 1JWUA 1VFBA 2WZ6A 2V4LA 4QY8B 1KV7A 1RZKL 3IDXL 3VU2A 3EKCA 2QSTA 3LH2H 3OJDA 5DGRA 3CHRA 4YSEA 5DZPA 1MCSA 3GSOB 1S9VA 1KIPB 1R6VA 3H56A 3A4EA 4PJAB 1SN0A 3BUIA 2VZUA 2UWEA 4N87A 2P8LB 3WIIH 3KPPB 2DQGH 2ENSA 5CZKA 1EXUB 4R2GD 1XD1A 4Z7WF 3SZKC 5B1AB 5HSFA 4J27A 4F91B 3DGGA 4PJBB 5BNXD 2X4QB 3F7KA 1XF4A 4JHVA 1GC1H 3LZLA 4PRNB 4LEXL 2YC1B 2X2HA 3QIBB 4A68A 1YY8B 5TJWK 3GJEA 4J3SA 2A2QT 1CVSC 5F9WC 4QKTA 3LS5L 5J6HA 3VDBA 4UV4L 2JKIS 3FUJA 2W9LA 1C12B 2MSPA 2D9CA 5EU3B 5TD4A 2NDGA 3S3BB 2PLTA 5GSVA 3QIUC 2O30A 5LGKA 1QSZA 5AZEH 1IEAB 5IMMB 2QADB 2WINB 4M6NH 4Y4HD 5EC2A 5EO0A 3ECUA 5FUCE 2ZCHH 4KXAA 4JR9H 1QAWA 4OJYA 5JO5A 3T0DA 2YKKA 3CX5K 3T3PF 4EI0A 2WVVB 3NEXA 2GAZA 2WNWA 1KDIA 2YAHA 2Q7YB 2B9AA 1IC4H 1K72A 1MAML 4KKAC 5DSCA 5T1LA 3N1FC 2BP0B 3Q7JA 4Y4FA 1SMOA 5BS0A 1BZ9A 2FYVA 4RMSA 4AT6B 1YMMB 2DQFA 4EIBA 1KACB 3X14B 1FIGH 3GXDA 1IILE 4M56A 1I3RA 3MLXL 3QWOA 5IW6B 2BCMA 4NKOB 2VMCA 3IJEB 4URTB 4G8EB 1IM3D 2YIHA 1A1OA 2VMEA 1IKOP 5EUOE 5BV7B 4C83B 1RKRA 1FYTA 4U3SA 3I84A 4OV5A 3D2UD 2ZE0A 2Z91A 1RZ8B 1XX9C 2VR3A 4KMTL 5I30L 2IF7A 1I7ZB 3FFDA 3RPIA 1UASA 4X6DA 5CSZA 4JREB 3H9ZA 3NIFE 5HDBE 3MVSA 1U95B 1AGDB 2Y5QA 4GUOA 4I87A 3KPTA 2Y5TB 5ESQB 5LQBL 5FA3B 5MEPA 1FO0A 2PTVA 3VXME 5CLWA 5MERA 1KB5B 2A5UA 1XR9A 2PWFA 5EUOF 4HCRA 1MQKL 3N06B 5A6MA 4HC1H 3MNZB 1E3ZA 5CF3A 1EEZA 3LD8C 4N8PA 4I5BA 4U1IB 3PL6C 1WBYB 4LDCA 4IMKA 1I9RH 1G1OA 1WAAF 2YA2A 3OX8A 4HHAB 5D7EA 5IB4B 3M1OA 1JXDA 1YSOA 5D2NB 3DV6A 4BFRA 3B9KA 2C1PB 1P1ZA 3AITA 1OM9A 4UNUA 2X4NA 2XY2A 1EZVX 4ZNEE 1IAKA 4PI2A 5JYLA 4MA7L 1AH1A 1J8KA 1KWKA 4HWEL 1MF2H 1KT2A 3D69A 4ETQA 1N5AB 3TO4D 4NYLA 4H0IA 3EJYC 3L3DA 4QRQA 1D6VL 3QG6A 3FUIA 1UT2A 3KXFD 3ULSA 2Y36H 1MCPH 4FA7B 4KKAD 1S46A 1IL1A 3HE6D 3O3EA 3SPCA 2VDMH 5HHOB 1O7VA 4M29A 4J3XA 5EO1B 3K81A 5LHDA 1QFWL 1DVUA 1GCYA 2KI6A 3EYOA 4I0PD 1KN4H 3VVVA 1IGJB 4PJCE 1N2RA 5HPMB 4MXQD 3SDDC 4LEOB 5A2JH 1K8DA 5K9QI 4Q6IB 1UD8A 1BIIB 4X9BA 3FSAA 3HJEA 2XWXA 3VSTA 3L1EA 1PYWB 3N44B 2HPTA 1K8IA 2J4WL 1HINH 3HMXH 4JY6B 4TLTA 2Q2EB 4L8SA 1EDHA 3V5KA 2GIYA 1DANT 4GJTB 1MXDA 3SJVA 3CLEH 3RVWC 3QIUA 1IVLA 2UWEE 3CHSA 4M7LT 4DGIH 3ULUC 1ZDSA 4G3YL 1M7IA 4N1HB 2LAAA 3AVEA 4LZKA 5ESVB 3BUYA 4YC2C 1J1PH 5HHVH 4LLVA 4GKLA 4WEBH 3L1GA 3UIYA 1HVXA 2Z8RA 2BW4A 4KBPA 3V9EA 5IKCA 2O5XH 2WLNA 3O8XA 4FQHA 3IDYB 1I7RA 2KLRA 1OHZA 4GKNB 5GRVK 2F54E 3HN8A 1H9VA 2BSRB 4JJ5B 1SEQH 5KVEH 4OFIA 3ZRSA 4ADIA 1RUKL 1QMUA 4F5CA 1T7VA 2XPGB 1GGTA 2BJMH 5E6UB 1T21A 3WNMA 3ZYOA 3T4AC 2OTPA 4MYWB 1IBHA 3KWTA 5I6XC 1JGEA 1E4XI 3C08H 4PS8A 3V52L 2NR6A 5I66A 3WIHH 5C70A 2BDNH 1RULL 2OXGB 5IG7B 3SDAB 2CMRH 1E6OL 4FZEH 3IJYB 1JF5A 1Q94B 2NY4C 1KTRL 2B2XL 3NZSA 1RUKH 4JPQA 3IAGC 5LB1A 6CGTA 3RWCA 1MG2C 4ELKA 2NXYB 4XTRD 4UDTB 3QFJD 3MO1B 4A67A 2EXWD 1CO1A 3HRZA 1BM7A 1XL6A 4YEEA 4QRQB 5I26A 3SGDI 5C0NC 3N1GC 3NCBB 4JQIH 1UXSA 5CINH 1WK0A 4QNPE 3RKPA 4EZMA 4OZIF 1GZQA 5DJAA 2V5YA 1UT9A 4UOW1 4OZFH 4PB9L 2HLAA 4PRDA 2XZCL 1UM6H 1JZ2A 3VA6A 4JGNA 2X09A 2ZT9C 3FAWA 4HXAH 4PJEB 2MHAA 1VZHA 4RRPA 3MRKB 3LEXB 4HIIB 3GIVB 4I3SH 5KYXB 1E8XA 3GMNA 2DEXX 3QQNA 4QRSB 1SN5A 4UM9D 1X5JA 3DUUA 4Q7DA 3GO1L 4WHTA 1NCTA 4PQXA 1ZLSH 3T4AA 4KY1L 1OQOA 1VAHA 3ULVC 5EEXA 4PP2B 4ZAKA 4JPVL 3BKMH 4FGMA 5GIRB 2EDDA 3KBPA 1NC2D 2XFXA 3FN9A 2WTRB 3WFDH 5HHXH 25C8L 3P02A 5DVLA 4NO5A 3S3JA 4OZHE 43C9A 4ZMWA 2OA9A 3PJLA 3QQ9C 4KPHL 1AZZC 3CFNA 1JGDB 2X6MA 1EO5A 4Z1PA 1AO7D 1Y0LA 3MA7B 3P4OB 4GINA 1N0XL 1UA6L 1QSFD 4PJ7F 3TYFA 1CDGA 4ZFFB 2XWBB 3R06B 3O8XC 5AOMA 3HCVA 3L2NA 2WNXA 3EO9L 5GGTA 1QRNB 4NI3A 1SXNA 5FW7A 2DQJH 1Z9SA 1OT4A 3AWFA 3OB8A 4FG0A 1TDQA 4UZSA 3ZR6A 4NDMA 5CGTA 4FQHB 1AIFB 1KYDA 4Z0BH 3DVIA 3NFNB 2P43B 4JY4B 4Z7WE 1OAZH 4XRCA 4ELDA 2IWFA 3BZDA 5G4MA 4YIQA 1I1RA 1E4XL 3BVDB 4MXVE 4BFGA 3AGWA 2EE6A 1SY6H 3F64A 3FW6A 1TYJA 1SXSA 2XVLA 2DMKA 3JWOC 5B1CA 1VFOA 4UBDC 5C0CD 1DN2A 1ZT7B 2QQLL 3FQ4A 4IDJL 1GW0A 1WP6A 4WEBL 4YNYB 3G7TA 5EZJA 3GMLA 5ADPL 3US0A 4HUKB 4UDUA 3WXVH 4XN2A 3BPCB 3VM7A 2RMNA 5MEOB 4NC1C 2JKRM 5GGUA 3STZB 3OLEA 2OMUA 5GS0D 1CICA 5FO8A 2MPAL 2OP4H 2E7HA 3HS8A 5JHBA 3VD3A 4N8CH 5E03A 3KZ8A 5L8LB 3V6BR 1R17A 1Z66A 3VE0B 1JZ8A 4O2FB 1TJHH 1BPLB 4G7VH 4ATTA 2VN7A 1HWHB 4XX1G 1RZ7L 2CO1A 4PRBA 4NQSA 2Y9RT 1NKGA 2ZXAA 2WBJD 4KRMB 5DFTA 3MRFA 4YHOL 3PXJA 2FHBA 5EHFA 4DWHA 1DJXA 3GLEA 1MHHB 1I8MA 3BDXA 3WIFB 1TQTA 2A4EA 2AZAA 4X4YB 4RWHA 4N2NA 5CD5C 2VXVL 2OJZH 2EEAA 1MI5D 3TV8A 1TUPA 1GZQB 4QRSA 3SBWC 3F85A 1TQVA 2NW2B 4Y2LA 1PD1A 3CIQA 2EUVA 5EZOH 3GFUA 2ZUWA 5MHSD 2AJZA 4Q9RH 2VSDA 3H4FA 1RLWA 3PQYB 1XSIA 4Y5VA 3T0XA 2WQRA 5AWNH 2QGBA 1F1DA 1OVZA 4N90D 4JO1L 1U8MB 1RY7B 4XNQB 1BM3H 3F6JA 5FDWA 3K6NA 4ECNA 3QJZA 4CSTA 2ARJA 3L7EA 1EBAA 3BGAA 3LH8A 3GSWA 3W9DB 3K3QA 4GAYA 4PRHE 3ZQWA 4LCIH 1KIUA 1T03H 1UT1A 1WCQA 4UT6A 1PG7L 1JF6A 3TA3D 3TBYA 2AQRA 5BW7C 3U4EA 4Z7VB 3GSNB 4GS7C 3VCLB 3I75B 5K69A 2Z7WA 4QJ5B 2C1OB 2DDQL 3J07A 5ERWA 5K59F 3ET9F 2OTUB 4X4KA 2QADC 2D3VA 4TN9A 5F9JA 3KWWA 4JHUA 4LL1A 5EO9B 4ZS7L 2PTUA 4DKEH 4UTAH 1Y6KR 2XVGA 3QBTB 5KSVB 2AABH 3HN3A 3ES6B 4UILH 3U4BL 5EIQA 3EOBA 4N5ED 4JE0A 1T7WA 1K8DB 3MRCB 5I73C 1VCAA 3W3BA 1FFTB 3O6LH 4NFDA 3UBXI 1ZK9A 4RGOH 1OSZB 4W9IC 5E8DL 4RWYH 4X98A 1M1XB 1MHCB 1QLEL 2IAMD 5AOLA 4XMTA 1ACXA 1KCUH 5HGGS 3HUJE 3FCSA 1PIFA 1GC1C 4TLUA 1SVCP 2R59A 3EUUA 3PE9A 1XD0A 3VFWA 4BGLA 3EF7A 3UIZA 2PYFB 3NEOA 1RUQH 1D9KD 1UURA 3QDJA 4XO5A 4YPGB 2W0LA 3TBWA 1R0AH 5EG6C 1CU4L 4BELD 5DD0L 2ZCLH 2EYTB 4JFHD 2G2PA 1FSKC 2GTWB 3PG2A 4FABL 4OLUH 2UXVA 2XX0A 4D0BA 3PV6B 1AD9A 1CE1H 1G0YR 1ZE3H 2O6CA 3RIAF 1L0QA 2YA1A 2HT3C 4P59L 4FFWC 3T3PB 4JFDB 5F1SA 3ISYA 1QX1A 5JOEA 3QCUL 1VADA 1S9WA 1KIQA 5GGTH 1N0LA 1UXWB 2JLPA 5EDSA 3VQLA 2R27A 4JPKL 2P4AB 2VZ3A 4HKXA 3MGOB 2P28B 2KPWA 1GXEA 4N6RA 1NEZG 2G0LA 4IEFA 4M7JH 5SWZB 2G5BB 1B0IA 5D2NE 3QA3A 1MRCL 1A7PL 2NXYC 2FT7A 3CQPA 4AEHL 4NQVA 1N26A 4U1LA 4HWEH 4CC0A 4Z7IA 3VG0H 4XXCA 4K9JA 4M1GH 3QNFA 1GPOH 5KBDA 4E5XA 2A9CA 4MQXD 3L4CA 1BG1A 1ZPLA 3L5IA 3KYMB 3JV5A 4UMGA 2EKSB 3H7BA 4HIXL 1H6UA 5INDA 5CD3B 5B39A 5HYQA 3N42F 4KHXL 3BKYL 4XCEA 2B1HL 4F8TA 3T4AB 5IBUB 5I6XB 3QCTL 1E8YA 1UQSB 4ZAKB 3HUJB 1NFDB 2VLRB 3MXVL 4A7SA 5CO1A 1QTPA 1YMME 1KC5L 3D9AH 2Q1EA 3DOIA 5I8OL 3MN8A 4OGAC 3ZZSA 2ICWB 2MTPA 5DWUL 5GS2H 1YMMA 3TZVD 4OZIE 3IU3A 2NNAA 4UTBH 1U33A 1ZD6A 2MOGA 5AL8A 1FVDA 2NTFB 4N68A 4X6BB 3AADB 1P4BL 1HJBC 1C08B 5FGBC 3LIUA 2AXFA 1Q9KA 3ABZA 4P5KA 4JN1L 3UMNA 3VDAA 4TL5A 2MFNA 1T1ZB 3STLB 3TO4A 2VDOH 1A6AA 3BQVA 3Q2NA 5JIKA 3RDTD 2F7RA 2X1XR 5ABAA 5JYMA 2QGDA 4KKBD 1KLFA 1TEFA 2W5PA 4M7KL 1JZ7A 1FZKA 2VXQA 4L4TE 4QRRD 3R8BB 4AXWA 1CL7I 4DZ8A 4L37A 1VA9A 1LTXA 1AQDB 3ORJA 3S2CA 1RERA 5EC1A 1JHKH 5SX4H 5J57B 5HJ3A 2K6YA 1YUHA 3V6OE 4NZRH 5AOKA 3OHXB 1CFQB 3FO0L 3ZX1A 1BQUA 2QSCL 3LZRA 3QQXA 3D6GA 1U8CA 4PCTA 1A6UL 2SODB 2WKLA 1AE6L 1SLUA 2XIDA 1U91A 1P7QA 3VXRA 1SF3A 2Z7YA 4KFZC 4PD4J 4M7KH 4IBZA 3RA7H 3GXMA 3QIWD 3QHZH 2C9VA 2QQLH 4IDJH 4ZMVA 4WWKB 5E2UH 5TF1L 1GY2A 4LESA 1OAUH 2EYTA 4NRZA 4M7LL 3W9EA 2DH2A 3H9SB 3S7GA 3VD2A 4GQPH 2ZXWB 3A4DA 3B7SA 1OGPA 3KLKA 5HI4D 5AYUH 1ZT4B 3FO1A 4LCWD 5EZJB 2YRPA 5IW1A 3U0TA 3A22A 5GGSA 1J9RA 3ZRFC 5LXVA 5FOBB 1AKJA 3PWJA 3T3MB 5GGUB 1U4EA 2GEEA 4R4NC 1WC7A 2IQAA 3DX6A 5DC9B 3A4AA 1E43A 3JUZA 3DX2A 2J5WA 2JK5A 2EE9A 3OGOE 3SKMA 3C9NA 4A6YA 4ES9A 3NIDE 4OGYH 3SN6N 5IV2B 4AENA 1HSBA 2BFGA 2QHRH 1OGAE 3QO1B 3EFOA 4K94L 4ZUTB 5KSAA 8FABB 1JWSA 2I27N 3QWRA 3MRIA 3UADA 2FWUA 4F58L 2A4ZA 4L9LC 1MUJA 2XX1A 5CILL 5LAPA 2WOBA 1NCBL 1IZJA 2LABA 4B0MB 2D31B 4IK6A 4Y4FD 3VX0A 5ID1B 2B4CC 3SYQA 1YY8A 1R5IA 5EOCH 3MBWB 5T5FA 2DKUA 3CN3A 2HWZH 2FSEB 2BNQB 4WU7A 2QELA 4LL9A 3S96B 2XN9E 3IDIB 1ZGLM 2NLJA 2DTMH 1S7WB 2ENPA 1QFUH 3VW3L 3MRDB 2YKLH 2X4OA 4LHUA 1TSRA 1FZJB 1YJDH 1HYSD 4G6JL 3QQ4B 4XP4H 3TBYB 4TF4A 2PTTB 4FQIH 4PJXE 2FH6A 1XGQA 2AQSA 3FCTB 1DJIA 1U93B 2E7LC 4F1SA 1J5IA 1BSIA 4GXUM 4U6XB 5DRZB 2OMWA 3QEGH 1IAOB 4QJ3B 4XVSL 3G6AB 2FECI 5HHOD 5BV7C 3HB3B 2H0PA 4RFOH 3EH4B 4UV7L 4NPYB 3F7QA 5HDWA 1T0MB 1XIWC 5GRUL 4OM1H 4BK5C 4QPEA 3FUFA 4D7PA 5AENA 4FYTA 5HGBB 3BKCL 3LN5A 4G8GD 3AM8A 4FQIL 3T6XA 5HYSA 2NNCA 1U8CB 1QBMH 5ESAB 5FB8B 4XI5D 3P11L 2QEJA 2X4UA 3EGXA 1D2PA 5DQ9B 3U46B 2AMUA 4EN2A 5KAQG 3MBEA 2NY2D 5MENB 1G7PB 1L9RA 5KW9H 1U8JA 4P2RE 4PREA 2MRYA 1AMXA 1S3KL 2WBWB 1ZIBA 3TN0B 2DJSA 2NYKA 4FCHA 1KY6A 1UD6A 3VD1A 4P2RA 5EEZA 5J12C 5LXGH 2NX5E 4KNSA 3IBEA 4YXKL 1A2YA 4U2ZA 1P6AB 2CKBH 2J8OA 5EBWB 1TZOA 1J1XL 1K5NA 1OOWA 1G7LA 3F7PC 4PJHA 5L2KE 1OAYL 3NT0A 5D7IB 2YKLL 3ETBJ 3SGJC 4L1DA 1UWXK 1T6VN 4J7RA 3FT2B 1VGKA 3OKMB 1P4IH 5ITFA 3IF1B 2IDCA 2O61A 3RZCA 1UXLA 4PG2C 4FFYL 5D2LF 4YBQC 1FDLH 1QSEB 4OB5H 5L9DH 4M6MH 4A6YB 4XPGL 2R0LH 4N25A 4TVPD 4JL1A 4UNTA 5BRZA 4IMLB 1NCAL 3PWJB 4OFKA 5FO9A 5E6IB 3V4VB 4MXVF 2F2HA 1WC7B 5IY5B 1NLDL 3EDDA 3HZVA 3DV6B 1XCWA 1VERA 2D2CC 4G9FE 4ZD3H 4PGCB 5GGTL 4WNJA 2YLKA 4I0PA 4OI8A 1P4LB 4LGPB 3N3EA 3IWVA 4PEEA 1U0QA 4OJFL 4TOYH 5JPMA 4PVNA 5E00A 3WHXA 3TEYA 4GI6A 1BX2A 4AG4L 3ZO9A 3KYMA 1OALA 1UZ6E 3SDAC 4BJLA 3IMBA 2CDGA 3QXWA 1TZ8A 4FQJH 1EIBA 2CHXA 4KV5E 1H5BB 5ABZA 1KGUA 3V55A 4OV6F 3PP3H 3S37H 3PGCA 1FZJA 3SQBA 5AD0B 2H47C 1J9QA 1MFAH 5DXWA 2WZPA 1YEEH 4WJKB 3OZLA 3D3VA 4U2YA 5FF6A 4G7YH 4I2XA 2BO0A 1EO8H 4N2EA 3JYBA 3AQZA 2W9EH 5CCKL 3QJVB 4LKCA 4YHOH 5KAQF 2GEQA 3T0AA 1JV5A 3FTGB 3ZE2B 1AYRA 2FL5B 1KCVH 2DQHH 4K9EH 4IKKA 5TF0A 3EJJX 2MOQA 3DVNB 4E9YA 1HHIB 3O3DA 5HPMA 5CCGE 4G80B 4AQ1B 2JJTA 3H2QA 3IDYC 1E3FA 5G55A 1HL9A 4ONHA 3NN8B 4X9IA 1G6RB 1VHPA 1Z6JT 3BZFB 4KVPA 4L05A 3AS3A 2ZUXA 4FLQA 3DHJA 2ZOTA 3I02A 4HUUB 1I9JL 1U8LA 3O11A 3O81A 4DO6A 3GMPA 2AABL 2VO8A 1SY6L 3VSQA 1GGBL 3UZQA 4N0FA 3NCCB 5D8JH 3QJSB 4B27A 4A04A 3AU1A 3CXHK 3MA9L 4PJCB 2B8OT 2ALAA 1O6SB 2JI2A 5DEJA 3TIEB 3GMLB 4Y4FC 3FHQA 5C6PB 5HHPB 1MQKH 4OD1L 1V3KA 2DRUA 3D25B 3IMWA 1ADQL 5ABDE 2J73A 3DRTA 1YQVL 2Y7OA 3CVHB 4TRPL 3SDDD 3VRIB 3CHOA 4X6DF 1JSYA 1RJZB 5LDUA 1WGVA 4AVHA 3HFML 3ULUE 4P2YA 3MX0B 4LSUH 1A6ZB 1DVZA 2Y4SA 2VLRD 5DC0A 2IDTA 5AW2B 1FCCA 5LN8A 2E5EA 3H4HA 2XUWA 1BVZA 4LPXA 4Y5VC 5DMKA 3RUGF 8PAZA 1RZIA 1ZLVH 1DQDL 3LX9A 2F68X 3CVCA 4QRPE 4AK2A 2VLJE 2DQTL 1T7YA 2X4QA 3AQXA 1UB6B 1EBPA 2VSCA 4Z7QF 5FA4B 1HL4A 3FPXA 3VWJA 1F56A 1B9KA 5I6OA 2DM4A 4XVUD 1PD0A 3HBGA 3FOMB 4CL7A 1JRHI 1KCBA 2ZKMX 1V54B 4GLRH 4EDWH 1UM4H 4QHPA 1CDJA 5E4EB 4Y5VB 1P4LA 2WLMA 1PSKH 3BQUC 5DS1A 5JNYA 2W9DL 5C7ZA 4TNVK 1X6LA 5CEZD 5E00B 1DJWA 3WHXB 5I1JH 3WXWL 1UKQA 4BZ2A 3R0NA 5IBTH 4P5TC 2J25A 4MLIA 3Q48A 1KXVC 3BUPA 4XB7A 3AROA 3NIGE 4ZW8A 1W8OA 4F1ZA 1DQIA 1N6VA 4LMQE 4G8GA 1MFBH 2KHAA 5A2LH 4AEHH 3FFCA 3CUPB 4XH2A 4AVIA 4KKLC 3KYNB 4CAGA 1CDBA 5EOTA 3II3A 4BFIA 1M7DA 1XBDA 4Y4FB 4DN3H 2ICWI 4YUEH 3MBWA 4JLRA 2Z7ZA 1KTJA 2GJJA 3DVGA 5C0IA 5J11C 2EADA 3IDIA 4HD9A 4UOZA 4IW4C 3VFUB 3EYSL 1YG9A