1EXHA

Solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
110
structure length
110
Chain Sequence
ASSGPAGCQVLWGVNQWNTGFTANVTVKNTSSAPVDGWTLTFSFPSGQQVTQAWSSTVTQSGSAVTVRNAPWNGSIPAGGTAQFGFNGSHTGTNAAPTAFSLNGTPCTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cellulose degradation
molecule keywords EXO-1,4-BETA-D-GLYCANASE
publication title Solution structure of a cellulose-binding domain from Cellulomonas fimi by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Cellulomonas fimi
total genus 12
structure length 110
sequence length 110
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1exhA00
2RTTA 1QBAA 3NDZE 1C7SA 1EXHA 2CWRA 1HEJC 2XBDA 5DHDA 3NDYE 1E5CA 1EXGA 1HEHC 5DHEA 1E5BA 1XBDA 1C7TA 1QBBA 2CZNA
chains in the Genus database with same CATH superfamily
4K3JH 2D9QB 2OPCA 5AZEH 4UOZA 1W80A 3SJVA 4Q9RL 4ETYA 3NP4A 4W9LC 2N4IA 3I6SA 5D2LA 4QRSB 2W0FB 1WZAA 1Q1JL 2CJUH 3F85A 1YEJL 3DX9B 1QLEB 3O8XC 1N64L 1TQBB 3GBEA 1DBJL 1BD2A 2P5WD 5CGBA 3SKMA 4CC1A 5IEHA 1CD1B 2AFNA 1ET5A 3CFTA 3LKPA 2CE6A 2ATAA 1PZCA 1RMFL 2YXMA 3T3PF 4GIPD 4UCFA 2ICEA 2VZVA 4MA3A 2I9TA 4HIEB 1LK3H 4QRTB 4OFVA 1RK1A 5GGVH 2GTZB 4Z7WB 5E1AB 4KTDL 1NTDA 2VDQB 4QTIH 3NEOA 1P6WA 3IAPA 1WLHA 1BVLA 4PJIF 1VFAA 2N1TE 2DQFA 2A1WL 4UIMA 4WFEE 5C92A 1ZT7B 4UT9A 1G7JB 3QDME 1DUYB 4X7SL 5GRWA 3GKWH 3DYPA 2GCYA 2I25N 3FU5A 3HKZA 4GSDL 2PTVA 2B3IA 1FFQA 5L2KB 1J5DA 3LJ3A 1AANA 3HR6A 1JV2B 4EDWH 5H37G 4EI0A 1SDAB 4O02A 1WEJH 1LK2B 1U8PA 5EEYA 2XXCB 3W9EB 5HHOD 2Z31D 5LXVA 2CXGA 2A9BA 5CILL 5I1GH 3QDJE 4Z7VE 3KPQA 5BV7C 4S1SH 4Z77B 1X5LA 1BJ1H 1AO7B 2J1KA 3OL2A 5J1AA 3NOIA 1R3JA 4XNQA 3ZMEA 1DQTA 4P2OD 4U1JA 1U8JA 4LSDA 3TEWA 3BP4B 1PZBA 4NO5B 5D4IA 5C0AA 1GRWA 3EO1B 5I71B 1OE3A 4XNZC 4AKQA 2DWDA 2XZAH 1O0VA 1U95A 1OTTD 4R3SB 5DFWH 5KSVA 2K7PA 4NJAH 4PGEB 4YDVB 4M4PA 2ADFL 4NM4L 4DOHE 2GJZA 2WSDA 1CDBA 4EI5B 2IF7A 2XIIA 4MSWB 5HY9B 1AQ8A 2OSLB 4IDLA 2ZUXA 3CK0H 4XRCA 1Q38A 3DETC 4LF3B 5AWNH 2PR4L 2XFXA 2BOLA 2J3SA 4PJ5E 1N2RA 3G5XB 3MJ8B 3LKSA 2F15A 4G8IB 1F4WL 4GMTH 2ERJC 4RISL 4S1DD 2A7BA 4YOKA 4PSPA 3IMVA 5FO9A 3SPVA 1N6UA 1TZ8A 3GO1L 3SKNB 3RA7H 3TN0A 2GITB 4BDVA 1N8ZB 2ZKHL 4HGWB 5E56A 4F8LA 1IKFH 3QUYB 4HK3J 4YSDA 1E65A 4KRPD 2JQAA 4K7PX 3LKOB 4U7KA 1BPVA 4WQOA 4NJ9L 3W82A 3EOBA 3GI8H 5C1MB 3B3IA 3N3EA 3O2VH 2XPYA 2VR5A 4OJCA 2ADJB 4XZ4A 2OJZL 4QR7A 4NFBA 3BDYH 3NCCB 1N3NA 2EDFA 1IBGL 2J1YA 4P5RA 4ELKA 4YHIB 3VD9A 1G5AA 3LKRA 1QUNB 3ZTCC 4YZWA 2Q76A 2LR4A 4UB0H 2E6PA 2AGJL 3U9WA 4TVPE 1BGXH 2Z0UA 3DDFA 3A4EA 3ZDXB 1RZIB 3K71A 4KKCD 2BIQA 4PJ9B 3LAFA 5IFHH 1WICA 4G6AC 3ZQXA 5IEKA 3BZ4A 4GRMB 4LLYA 1HE8A 2YARA 4HV8B 5D1QB 2K70A 2H6OA 4H13C 4PJ6A 3TPUB 4GXFA 5D7JB 3KLHD 2QTEA 4LXFA 2W07B 1MJUH 3FN0H 3WGUB 5BVJB 3IXAA 3K6SA 4BGLA 4OGZA 4FI8A 4R26L 4KO9A 3TJHD 4J3WA 5FGCB 4NHCL 1ZVNA 2BO0A 4HSAC 5AB9A 1U2HA 5BMFH 1BMGA 2CIKA 3P0VL 1MCLA 3U4EA 3MV8E 3MLUL 1TXKA 4PY8I 2R4SL 2KZBA 4ALAH 5JIKA 1I8LA 3RJOA 1DQDL 4NRXB 5EC1B 1WK0A 5HGAA 1FZOB 1IILE 2AKRA 1EIBA 1E2WA 3QUMA 4OJEH 3AVEA 4ONFL 4W9IC 2BXYA 2UWEF 2DQJH 3LS4L 4YBHA 5C0IB 3FF8A 4K5LA 1OTSC 5I8KL 1AGCB 3L4TA 2F5AH 3DX1A 4UNUA 3TN0C 4ZMOA 5FKPB 4WHDA 4MNQE 4ABWA 2CA4A 5JW3H 5FW6A 4OLVL 2QSCL 3EJCA 4HS6B 5INDA 2ZUVA 3GSRA 3O9WA 4BZ1L 4ZFGL 4LHUB 3V0GA 1OV8A 2UZPA 4UTAL 3QHTC 4UYPA 4JDEA 2QSQA 1X5FA 1JFQH 3ARTA 1S6NA 4OZGE 4DAGL 3WHE0 2QSTA 2ZOUA 4GI6A 3PUCA 1FZKA 1A6UL 3W11C 5H37H 2D3JA 4PJFA 1HJCA 1CDJA 2VO8A 3BVUA 3R06A 3HAEG 5DK0A 5E6UB 4M6OH 4XPGL 4NWTL 4AE1A 3KPOB 4IGBB 1I9JL 3K80A 3BN9C 1RL1A 2F58H 2QMJA 2OYPA 4G3YL 2OS7A 4M7LH 5JPNB 4K94C 5CLXA 1ADQA 1RLBA 3V4PL 5LNEA 5G5DB 2R23B 3J7HA 2DQUH 4JR9L 5I1CH 1K8IB 2ZKXA 4X4XB 2EIZA 3G6JA 4M5ZH 2A4ZA 2W38A 4FMVA 3C6LD 1K3IA 4UTBA 1GGCH 1PMYA 1JK8B 3ECUA 2DBJA 1UURA 4MAUH 4CGTA 2CHXA 2Y5QA 2QFRA 5LGYA 4XNYL 4HU8A 5TE6H 3RDTA 4HZAA 2VXVH 2EDHA 4WO4B 3WJMB 1G7QA 1I8LC 3PHAA 5IBLC 4IRSB 1EXUB 1WJ3A 3WKPA 4O58L 1U8OA 5KSBE 2XSKA 3UZVB 1IKNC 3VVVA 5AOMA 1V3JA 2BLFA 2DD8H 3TWCL 3OGCA 4IMKC 3QR0A 4PP1C 1NDGA 3DGDA 3LQAL 5CBAB 2X0UA 5AALA 3C60D 3FS9A 1NBVL 3QWQB 2GUOA 1R5WA 5K33A 3QDJA 3ARDD 5ITBL 2DLFH 3T4AB 3US1A 4WGKA 4ZUSB 2FGWH 2APXA 1CGYA 3Q2WA 5EFIA 1GR7A 2HVKB 3O9WC 4OI9A 4XP5H 3DVGB 4ZPVA 4MRCA 1RUML 4H0LC 1KWGA 4R8WL 3X11B 4LAQH 4U1MA 2I5YL 4BQCA 1HS6A 2NNAA 4NI3A 4ZSOA 2ZKMX 1AMXA 1VPOH 2X3BA 1BP3B 3ET9F 3FTGB 2KERA 3MLZL 3RVWD 2DMHA 2QHRH 2VWEE 1HVXA 4JAMA 2X88A 4HIQA 4P2RA 4PRBA 5F71A 4HCIA 1N9PA 2B16A 2BSTB 4QRQA 4UQ9A 1CE1H 4NXKA 3SDAA 4A7GF 3LVEA 1F5WA 1IFHL 2X4PA 3ZHFA 2WLMA 4RVBA 3MLVH 1TEGA 4O2FB 4EZJA 3IDJA 5DVNA 2G75A 4DPCX 2F6AA 1HL8A 1PIGA 4W93A 5C0BD 3GIVB 4I7ZC 3HB3C 4N6RB 1QFHA 1FLRL 3UACA 3WFEL 2VLJB 3PABA 1VGKB 3RNKA 1WVZA 4XGZB 1TU2A 1X6LA 2IH8A 4HKBA 3OMAB 2KC0A 1JBJA 3ZBMA 4F7TA 5LGKA 1TYRA 3RDTC 2HA1A 5E70A 3TBYB 5JNYA 3VXOB 3PCYA 5IB4A 4X99B 2UYLA 1WA0X 4JKKA 4I1NB 1UWGL 3WEXB 2FWLB 1MW2A 2LABA 3BZFB 3KGSA 4PFEA 5IB5B 3HG1D 1GZPB 4RMSA 1FH2A 5FWQA 2X7LB 3I85A 3PP3H 2WXJA 4LVNB 1MY5A 2ZXQA 3E8UH 4AC2A 1G6RL 1JCVA 1LQBC 1QD0A 2XQYA 3HC0B 2BIIA 1MCJA 2K6YA 4KVPA 3UIZA 4PBWD 5TE7H 5HGGS 2JJWA 3SJVD 4LEOB 1SOXA 2F61A 1LE5A 3HKFA 2V3FA 1AHWA 5C3IA 1D5BB 5GGRA 1XB3A 3NTCL 4WKZB 2NXZD 3IGKA 1ZE3C 3TBSA 3GI9H 2BSEA 3STLB 5DMIH 1MQ8A 1I9RL 2WN3A 3MV11 3WTUA 3QFGA 5HGBA 2V37A 3HAEH 3GBDA 4P5MA 5DZVA 4PRDB 4ZPTA 4LSSL 5FKAA 4Y4KC 4P2AA 2EDJA 3QCTH 4C47A 1TFPA 4DGIH 3NIDB 3BVTA 4KK5C 2YD7A 1KIPB 4C4BA 3SDAC 5ICXB 4E9TA 1MZYA 3A6OA 2G3MA 2RACA 4LSVL 3DTXB 2WM0A 5F7MC 1NWOA 3U1QA 4MD5B 5J12B 1TQWA 4PWGA 1C5DA 1KPRB 3U46A 2DWEA 3SGEI 3V7AE 1KXTB 1P69B 1YEIL 2DWTA 2K3TA 3CE1A 3FUEA 2DWSA 2ZF9A 5KVDL 5JXED 5CCJA 1P7HL 3VCLA 5DR5L 4DQOH 3ZGHA 5HYJD 2V2TB 1CI5A 3MUUA 8FABB 1ZV9A 3FQ1A 3VH8A 1T66D 4Y9FA 5MI0C 4CBPA 3EHBB 3NIFB 4EMZA 2GBTA 3QUZA 3F6JA 1HEHC 3ARGA 3CPLA 4OAWB 2N0MA 3VDAA 4XAKD 1F3JB 4OGXL 5TDPB 3FW6A 3RI5K 3T0XA 1IC4H 3WEOA 2F54E 4TOYH 1NWPA 3UEZA 1Z9MA 5D1ZD 2XDHA 5DHVB 1JGEB 1HFUA 1TENA 1J10A 3VWKB 1U3YA 1IZJA 4Q2ZB 4I85A 4MS6A 4KH2A 5CN3A 1AHWC 2ZUQC 3BXNB 1BW8A 5F3BB 2B77A 4HC1L 1O7SA 3GMQA 3FCSB 2D03H 1TTUA 1TQTA 4UT6A 1UWEL 5F9WB 2B59B 1JRHI 4Z7QE 5GSRB 2ZKYA 2Q8AH 3F7VA 1R5VB 3CSBA 5I75C 3MLYH 2WVUA 3CBJB 4JFQA 3RGBA 3VXTA 3E38A 3NJLA 1X5JA 3K5SA 4U2YA 2FJGB 4OCNC 1RZGA 4PLKC 1T7WA 2C9PA 4UT9L 4TUKH 3B1UA 4MJ6B 4N0RA 3ATFA 2BIPA 4P2QB 4N0YH 4PV1C 2X4UB 1EZVY 2VAAA 2X4SA 3SY6A 1D5IH 3GSQB 4M6MH 4PH8A 1RIVL 5E5MB 1Y1DA 5IQ7H 2AQRA 3NEXA 5CGTA 1BZ9A 3VI4F 1RZ7L 2XXGA 3Q3GB 1NJ9B 5I1DA 4K55A 2A73B 2QLYA 4XMLH 3ZE1F 2AV7B 4O02L 2IH1A 2VDNL 2HB0A 1W8EA 2NOYA 4JPWL 4XMZA 4ZS7H 3V4VA 1U6AH 4PGDA 4FQ1H 3W11D 3QFJB 1WBXA 5IKCB 3QHFH 2NLJB 3EFFB 3HG4A 2VITA 3B6SA 2WNKA 3SE9L 1HHIA 2OZNA 3QUZC 1VZGA 4CC4A 3BD5A 4OJFL 4WW1A 3ARGC 5BOZG 1DSWA 2HX9A 3D0LB 1CC3A 4KKQA 1ORQB 2F53E 5AOLA 1Y18A 1QTSA 2YPLD 3V79C 3DI2B 3QIBA 3SODB 1NFKA 3LCYA 4F9LA 5AD0A 1KB9J 3LXAA 5E7FA 5DUJA 3T2QA 3W39B 1VADA 2B4CH 4H25A 5DLML 1JZGA 2WLZA 3HMWL 2BERA 3OKMA 5TQ0H 2UXFA 1FNAA 4CVZA 4F24A 1PEZA 4G1MA 4HKXA 3TCTA 1FG2B 1PD6A 4ANWA 4PIBA 3Q1SH 3VJ6B 4YSOA 2TRHA 3ME0A 4BELD 3PJNA 2AQTA 1FNHA 4HJUA 1VESA 4OFKA 4HHWA 3A4DA 3KHQA 3Q5TA 1EEZB 3HAEB 4DFHA 3CZGA 3KR3H 1NSNH 5AW2B 1HL4A 1JPTL 2R39A 1Z9OA 4JKNA 5MEQB 3QA3B 2QQNL 1CDGA 1E6OH 3T3MF 1Q9LB 1XZ0B 2XV2A 4LLVB 4KJPC 1F45A 4G80B 1IM9A 2FZ3A 1OVZA 4OT1H 3CSTA 1OB1B 2VUYA 5JIIA 2NXYD 1AQMA 1GZQB 5DMYA 4XP9L 1ZHKB 1KJVA 2BHZA 1SLXA 2AERT 1I3UA 2O1AA 3BP6B 5GRYA 5DZ9A 5KVEL 4F8QA 2L4OA 1BVKA 1VFUA 4HQQH 1Z5YD 5F7KC 1KJMB 3EOYG 2I60L 5EBLB 5KANI 4OFIA 5B4MD 2JQZA 5AVSB 4UOQA 2R7EA 1OF2A 4O5LH 1S3KL 3QQ3B 4DEWA 1I3VA 2BINA 3OAWA 3PXHA 1HE7A 4LRNH 1EHNA 3ML8A 4PJXE 3QIBC 4NZ8A 4Y19B 1M3IA 2NYYD 2WC7A 4F9LC 3FQNB 2NPLX 4L4TA 4P3WA 3S37L 1GGIL 1QYGL 3UBXG 3UTSA 3FU7A 2X4NA 2X4OB 4WUUB 2WQXA 3CNKA 3BQVA 2VE6B 3JUZA 4MTMA 4A39A 4WFED 3DURB 2OTWB 4WLCA 5KSUA 1TPXC 3QDMD 3WIIH 2XV6B 5J9PB 1AC0A 4ES9A 5IHZB 3BQUD 3F12A 1O9ZA 1W0WB 5FCUL 1Y6NR 2Z34A 5INCA 1MN4A 4G6KL 4GO8A 4M1DH 1CL7L 4RQQB 5D6DA 1SLUA 4BKTC 1ODAA 1XGQB 4PREB 4UUJA 3KWXA 2FT6A 2DQDH 5CBEB 4PJHE 5IW1B 1P53A 4HWNA 3PAVA 4YHKH 5CN2A 4FFZA 5F6IC 3BIKA 2KPNA 5ESVA 2ZOKA 3PYCA 3EJJX 3QDJD 5IB3A 2VZOA 4YQXL 4W4OA 3KNBA 4F8OA 2VZ1A 1BG1A 3DXAE 3SDDD 4PJDF 1VF5C 1SPDA 2VQ1B 4OTXH 3EH3B 1VB9A 1J9SA 1GGBH 2XOTA 3ECVA 3T1FB 4B0MM 1GA2A 3MOAL 5HGDA 4OIFA 1D9KB 4D0DA 1KGIA 3MRGA 4OD2B 5EO0A 5I1EH 2WHVA 4ERSL 3STBA 1EDQA 4L48A 5DDHB 1ADQL 2DIJA 4KFZC 5AG8A 5HDLA 3ZO9A 1WFOA 3TA3B 3C87A 3EKCA 1JWSB 4PHXA 4XVUD 1M1XA 3QWNA 4KK5D 3BPLB 4EN3B 1Z32X 3AG1B 4M5YH 2BH0A 1CYWA 3EADA 3EDDA 5EH1A 1I7UA 4HS8H 4MNGA 1CBJA 4MQXD 4UTBL 2Y7SA 1S7XB 3O3EB 1V3KA 4KK6C 3WJLA 1KCKA 1B90A 2CR6A 1FZJB 4GQ9L 1E9QA 2CRMA 4PI2A 4KRMB 5EU3A 5GRUH 1N7MH 2V6HA 3QXAB 1AACA 4XPAL 4R0LA 3V6FA 1AGFB 1UKTA 1I1CA 5D5MF 3V9FA 5I18L 2AMUA 5DHMC 1DZBA 1KTBA 3NGBB 3PWNB 5EO9A 5FLVA 4ELME 1A4BA 5KYYB 3UTPE 1N0LA 3TS8A 4DP2X 1BZDA 5L4IA 1S8DA 4Y88A 1MWOA 4RGNE 1EAPA 1E4XI 3LMJH 4HYTB 4G8EA 3VFOA 2WYIA 1K4CB 2YAHA 1RKRA 2VXQA 2HMID 3VXSA 3BKYH 4TVPD 1FDLL 1WZ1L 2ZNXA 3QULA 1DUZB 2ATPB 4MWFA 1DO5A 1KCUL 3A5VA 3KBEA 1ZKAA 5T1LB 3SDCC 4DGWC 3LKQA 3NUKA 2F08A 2CO3A 4KPHL 1C08A 4PRIE 3UTOA 3RKDC 3QORA 1ZGLM 2DB8A 4RAVA 4XWOD 3VGFA 2OBGA 2DQEL 3MJ9H 4JO3L 3F58L 5K93A 4CUCA 1PF3A 3L7FB 1SVCP 4GXVL 3RKPA 1THCA 4QHKI 5C2UB 2X9ZA 3UFIA 1BAWA 5FC9A 1WH0A 5DD1H 3LVTA 3MREA 4WU5B 3GS0A 3NIGE 3WE6B 1WYJA 3RWIB 2IFGA 3U9PH 2ZXBA 2HT4C 3HMXL 1JZFA 1MCFA 3K81A 5IBTL 2W88A 1S7VB 2CGRL 2XVGA 2PYEB 1KIRB 1EBPA 3QSKB 4R7XA 1BZ7A 3DVNB 3JTSA 4IJ3B 5DZNA 1CLYH 1MI5E 1PDKA 1B9ZA 3BEWB 4K0OA 1RJYA 3CCHB 1EEYA 1L9RA 3IXTA 4FI7A 2EVFA 3CVDA 3KPSB 1DFBH 3CZFA 5LWYH 1MVYA 4N6QA 4Z7UA 3WJLC 1QLRB 1FVDB 3GSWA 1Q9OB 2IWFA 2G3XA 3T6WA 3PIQA 3ECBA 3QI9B 4BH8A 4R0LC 3QEGH 5C0EB 3HLAB 3QCUH 4AMWA 1YLBB 3F7PC 3X3GL 4Z3EA 3MA9H 5B7FA 1BXAA 3B2MA 4DZBB 1QEXA 2CKNA 4TVPL 2BIOA 2A6IB 3U6RA 1VACA 3SDXE 3RPIA 3QZBA 4Z78A 1HU8A 3OZKA 4PBXA 4G8GB 3AY4A 4Q7DA 4S1QL 3TIEB 4RSYA 2KT6A 2Z4QB 3ILQD 3QRFM 1XGRA 2EAEA 2XKSA 3PQYB 4NUGH 5JIQA 2IPTL 1VLXA 4I8DA 3DOHA 4KMQA 1WCQA 2W9DH 2QT6A 4PRHB 4X5WB 5DFAA 1QBLH 3C9NB 1UB5A 3HZKB 3I9GH 4HXBH 3OKDA 2MSPA 2A9NH 3L3OC 4PJCB 3RB5A 4R5XA 4PP2A 3VB8A 1B0GB 3S97C 4F2FA 5BS0A 3BSHA 2DDQL 3NBNA 4Y2LA 4MXVF 3ZDZE 3TURA 3GJEA 4YK4B 1RZKC 4K8RC 3VI3B 2EDDA 3BFOA 4WEMB 3U0WL 1BEYH 5M95B 5C09B 3FFDB 4HD9A 3BPOB 4JO5A 4ESKA 1ZIAA 4HOMA 4U1NA 1MH5A 1FFPB 1SVBA 1TJGL 5DZAA 2HJFA 1FFOB 2HLFC 5EA0H 4MJIE 4YSPA 4FKHA 1J8HA 5FDWA 1PZUB 1C1EH 5L6YH 3PRZA 1YMME 4KJPD 3HC3L 3IMUA 1OOWA 1ZGLP 3ABLB 3MGTA 5J6HA 5D7IB 2GEEA 5KYNA 2AQSA 1M05B 4OSUH 3NPZB 1NLBH 4PRPA 1GC1C 5E08H 1GY2A 3HPJB 3MHZA 1E28A 3OXSB 4K3EH 5I30H 5D96B 1F6FB 2MEJB 1NCBL 2ZSVA 3B83A 1Q8MA 4OFDA 4Y2DB 5SWZB 1PNCA 1CU4L 5B7EA 1J5IA 2R2BA 3WFCL 3X14B 2CHNA 1NGZB 1J88A 2AXJA 3GMRB 3BC9A 5EORH 4XZUA 4YX2L 3JUYA 5E1GA 2P8LB 4QRPB 4NQDB 1WAAF 3K2UH 4Y7MA 5E00B 3VAEA 3AY4C 3SGJC 2ZG3A 2FBRA 3CXFA 2WBXA 4PJ7E 1BFOB 4QGTA 1N5YH 1PLAA 2R56H 1UJ3A 2FECL 3EYVB 4KKPA 3ZRFC 1ASOA 3BEVB 4XC1L 4UT6L 1A3ZA 1KLGB 5AW0B 4EDXB 4Y9BA 5CXPA 4OFQA 4A7TA 4JPVL 2Y9RT 5SWSE 2I7SA 4YSCA 4M7ZB 1PZAA 3ESVF 4HUCA 2FWOA 4H2CA 5A2FA 5LBSH 5T1DL 3FBKA 3S8WA 2A4CA 1I8UA 3NJMA 2FH8A 5I1LB 4ABUA 2HUEA 4ZNCD 1USZA 2JCCE 5JIMA 1IAOB 4HT1L 4ZBJA 4ELMA 1LQSR 4ZFOL 1MVFA 2E7DA 2EH8H 5ESAB 4RSVA 2AQ2A 1BZEA 2APSA 2FJUB 2ICWB 3GPEA 4NUJB 2PO6D 1YYLL 3JV6A 1WTGT 3D0VA 4AENB 5F7EH 5IBUG 1V05A 2MOVA 3V4VL 2X05A 1IM9D 2DWYA 3FT2B 3MCG1 3RTQD 5F7AA 4FTDA 3G5WA 3EYSL 4L4VA 1E6JL 5I23A 3UBXB 4ZXBA 2JELH 2OMYA 2RCSL 4L5FH 4PRIA 1VIWA 1PL3A 4NKOB 2RGSA 1J1OL 4P57A 2YS4A 1OLLA 4OLUH 2OW6A 4K23H 4PJAA 2BNRE 2OMWB 1OAKH 1PAZA 3Q48A 5GGUA 2BVPA 2BX5A 2GC7C 3K6OA 3OJMB 5LCVH 1TVHB 1OCOB 1YY9C 5CSZB 3IDMB 1F90H 1G7PB 4JRYE 4ENZA 6FABH 2E8YA 3CBRA 4P0DA 5T3ZH 1S4IA 4YXHL 4J8QA 1EO7A 2CHWA 1HESA 1AYOA 4E9LA 1F4XH 1JZ6A 1BEXA 1MI5A 4ZAKD 1UJ3C 4NNYB 4YSAA 1P5VB 2NCEA 4J7RA 5J89A 4BUGA 1RUKL 3PWPB 5F21B 1F18A 1FGVH 3LPGA 1SEBA 2NX5A 3CXDH 3P30L 5K39B 1J7VR 1BQUA 3BUQA 5DWUL 4QRBA 2E27H 4MQSB 5C97A 1BIIB 2C9QA 3U9UA 2Y25A 4QT5B 3EIFA 1NGQH 2Y69B 3IKCA 1B6UA 3N1FC 4H5SB 4MZIA 5JDSB 1AY1H 4JQIH 5I8CA 3KYOB 1L0QA 4AKPA 4YEFA 1AKJB 5MP6L 2ZCZA 4JHAH 1SDDA 3SKJL 3N44B 2AEOA 2DQTL 1KYUA 3ZK0A 5DS8B 1XTMA 4YXKL 1ND0B 2DTSA 4A6YH 4I3SH 3IFOA 1SY6A 3UO1H 4XAWH 3QJHB 3T0DA 2HTKC 4BE5A 4JFPB 5F8QC 1B0WA 1RJZA 4N90E 3RL2B 3V0FA 3VD2A 2F54D 2XLLA 5F6HJ 2I27N 5KBDA 3TVMA 2OCJA 3P69A 3ZTNH 3IU3B 3J27A 4IKJA 4MQ7A 2LW3A 3NQIA 3WXWH 3RUGB 2QQKH 2ATKB 3ZHNA 1YCSA 5IV2A 3FT4B 1ZVYA 3PY9A 3U4BL 1ZT4B 4DEPB 4V1DE 4P5TA 3BRFA 1TTBA 1IUZA 3QIWB 4OZFB 1DTUA 1GGTA 1S7UA 1O7DC 2C1PB 1DVFB 4Z0BL 3QJFB 4ZTPH 1L3WA 3EFOB 4UINH 3DMMC 5BZDA 3V8CA 1TO5A 4N2EA 4JQVA 3WTWA 4KXDA 3APDA 1PBYA 5J56B 1TKWB 5HSFA 1JF6A 5LQBL 1B0IA 1GOFA 5C07A 2X1OA 3V6ZB 2IG2H 1RJLB 3FNKA 5KWYC 2MPVA 4JFDB 4N4YB 1RHFA 1MFCH 1NMCC 5AZ2L 1H15A 2VUKA 3FU9A 4WJG3 4PTTB 4CKVX 1ZCRA 1V10A 1JYVA 3KCPA 4TSBH 3QZWB 4NIKB 2WNWA 3UBHA 4JRFA 2Y4SA 2FL5A 4GG8B 1M3JA 1X4XA 4JO2L 3FO1A 1T0MA 1TVBA 2X9XA 4FFZL 3C5SB 4U6HA 1GYCA 1E5YA 1FCGA 5EBMA 3LDBB 1I1FB 3NEEA 3MRKB 3ZR5A 2Z8VC 1M7UA 3MOBH 1R5IA 4U1SA 2HP4A 3UTTB 3TNMB 3IJSA 3EF4A 1QSEA 4F8PA 2Y22A 3CH1A 3H6JA 4ZMNA 3POHA 1WG3A 2FJFB 4GT0A 3CJJA 2F53D 2W0FA 3QORD 1QO3A 1A2YB 4FFYA 4OLYL 1FNEA 4GMSL 4AEEA 3TJPA 5IVXB 5JMRA 4TSAH 2AABH 4YGVB 4OCMC 1G7IA 1C5CH 2RD0A 3NZHL 4YSRA 1HHJA 3FQ2A 5FR3A 1YEFL 4YE4H 4AZ8B 4TPRL 3RG1C 2SEBA 4URKA 4P5TC 4LGRB 2VLKE 3ZYZA 1KYFA 4PAZA 3TF4A 3U6XS 4IBWA 5BRZE 2N7SA 2P8MB 3A6CL 1NGWB 1CQKA 2G60L 4GBXA 1R3KA 3IDXL 4QGYA 4GUPB 2AF2A 3KJ6L 5DMJB 3GMOA 2WZ5A 4P9ML 2BY1A 4AMKL 2VDPH 5DWPA 2BZ7A 2NNCA 3S35L 7CGTA 4YXLH 2J4WL 1X5XA 4JFYA 3VD3A 3RZCB 3O6FD 1UD2A 2WLYA 1SYSB 3BWAB 5DA0B 1KBKA 4TRPH 1FBIL 2F8XC 5JR1L 2Z9TA 3PL6C 1D6VH 3AXIA 4BQ8A 4AL8H 4JG9A 5F9OH 4NS0A 2Q6WA 3U4AA 4KH9A 3TEZA 2J71A 5E9AA 3F00A 3FU8A 4JG5A 2VXQL 1WFJA 1A6ZA 1SHXA 5DJ2B 4LPCA 4PWEA 4BD4A 3CC5B 1R3IH 1YJDL 5E6IB 1FORH 3DSFH 4LCUB 1K72A 2K78A 4XB7A 1TZHB 2E74C 4HOWA 1JFHA 7PAZA 3W3BA 5JA9A 1SEQH 3I9AA 1ACXA 1ZVHA 4A6YB 4HH9A 1XBDA 4LAJH 1C7TA 2C7FA 3PF2A 2A6KA 2NY0C 4A04A 5IJKC 4X6DA 3HUJB 4YDVA 5C7ZA 3QS3A 1JYXA 2J21A 4MA7L 4N0FA 3VXNA 5JMOC 5GGSA 4FP8L 2FAUA 3OZLA 3JYBA 3HI6H 4B9GA 1A7NH 4HIHB 4X8CA 3T0AA 1A9VA 4OZHE 4P46B 1IAIH 3VFPB 5K9QI 2J8UE 5I1KL 2C9RA 4MGXA 5DJ6B 3UYRL 1KCWA 2QEJA 3BUDA 1BIHA 4NCC1 4WUKL 3IDGB 3VNZA 1N10A 2IADB 3FZUC 4GBXC 4IKIA 4RWYL 4FQXB 5A7BA 4H8PA 2EE9A 1J18A 1FAIH 4HULB 1DQQB 3KLAB 1LTXA 2ESVE 4MNHA 4XMKL 3PUUA 3ZPDA 5ENWA 1FIEA 2XCMC 1KG0A 3M45A 3LZPA 5EEZA 3UJIL 3LRMA 2BS8A 1CGWA 2YFOA 4QYAA 1IGYB 5BOJA 1U8QA 4J3UA 3AWGA 1T04A 4FFWD 4S1RL 4EKXA 2VMCA 2YD2A 3DXAD 2ZYHA 1P4BL 2HRPH 3FU0A 5FM5O 4XTRC 2IBBA 3L54A 4JEGB 2WWNA 3MRRB 4L0ZA 5BZZA 4LEXH 5D1XB 3D4GA 3D3VE 1UTDA 1Q0YL 1JMXA 4B7LA 4EEEA 1Z1WA 3N04A 3CXHK 1UM5L 2WQ8A 3S34H 2H7WA 5IQLA 3TBWB 4CU6A 4F5CA 5D1QA 2NY5H 4HV8A 1AIZA 3Q2NA 5JO5A 5FYJH 5CEYB 1MCPL 1S5HA 1T03H 3NA9H 3QGVA 2OKMA 1GCFA 2EYTA 3P77B 2VL4A 1VEMA 3FTUA 5E24E 1TZGH 2YQ3A 5I71C 2WQSA 5TE4L 3O41A 4ZW6A 1XCQB 2NTFA 3E6FB 5IBUB 4YL9A 1RK0A 1CB4A 4JG0H 5F93C 1H8SA 4TUUA 3F84A 3K8KA 1E9OB 5EU5B 3C8KA 5K1NA 3IAQA 3D4CA 5EU6E 4FX5A 1Q90A 5JXAH 2B0SH 3KPNB 3RVUD 5A3IC 5CINH 4J1UA 4GEIA 1NCAH 4YHOH 2R29A 2VDRB 3ISYA 2BVQA 5ADPH 4MA8L 1B0RA 4DCQA 4XP4L 5C0IA 4QI3A 4JANA 3UTPD 1KGYE 2J8OA 1LE9B 1A47A 1L6ZA 1KEGL 2YMXH 3QP3A 4OM0H 3NRFA 1P5UA 5CZXC 4RGND 3RE0A 3B9VA 5HPMA 2X6BA 1GY1A 5FK9A 2R69H 4HS6A 1YEKL 4ZUVB 5KYWB 2VDPB 5D7LA 3TCLA 1PU0A 2Q7AA 2HG5B 4FQLH 3ARXA 2D7QA 3QZPA 4LHUA 1RP8A 3EYOA 3IFPA 2ZCHH 5EOCL 3VXMB 1LP9A 2PXYA 1M9SA 5HI3D 4ZXBD 2NT0A 1SXBA 2EO7A 2VZUA 1I1AA 2ENQA 3GNML 4PRID 1LNUA 4KX9A 4F15B 5ILTH 4FQ2H 2RFXA 5H94B 3UYPA 1A1NA 1RCYA 5KSAB 3B4NA 3QQ4B 1NIFA 2ZICA 2BW4A 1BQRA 1H9VA 2ADIB 3KYMB 2OW7A 1K8DB 1IM3A 2BCKB 15C8L 1AQKH 2YBRB 3EBHA 4N0CC 4NM8H 4PJ9C 4OZIA 4QCIB 4PG9B 4CVXB 4YLCA 3ARQA 2NR6A 4XODA 5G5DA 5D1QC 2XTJB 1Z9NA 4NZJA 3D6GA 3DTUB 4X4XA 3WY4A 3NZ8B 5DJDB 2V2XB 1MI5D 1C16A 3P2BA 3NJJA 3ZW3A 4DPBX 1IT9L 2NUTA 4ZFZB 1KYOJ 2BSRA 3IEAA 2H45A 1T0NA 2LLGA 4NRZB 5IJVA 1DBKH 4TXVB 1UCBH 2NX5D 1UH3A 2WZAA 4QDGA 5ESQB 5LGJB 3CU7A 2WGNB 3PHOA 1QR1B 3IJYB 4Y4FD 2RQ8A 4WO4A 3U2IA 2EDMA 2XPGB 3BVNB 2Y36H 2J1XA 3GBLA 3JWNG 3QDGB 1XGTB 4GAFB 2JE8A 2IDFA 1JD7A 4WTWA 3GHBH 4A7QA 5L8JB 4YE0A 5D71H 1P5UC 4ZYKA 4JFFE 3T4AA 3HFMH 5GIRB 4JFVA 4ZUSA 5DUBA 1HIML 3T77A 4HEME 2OCCB 5ERWA 3VWJD 5F72S 1B2WH 1JPFA 1H3XA 1JRHL 4ODTH 4Z7NE 5BZWB 1XWVA 2CNZA 5CEZE 5KVGH 1NFDB 3TVMD 2PPCA 5E0QA 2XVLA 3WUWB 1FI8C 1AGBB 2PXYC 2EXWC 4IBVA 2P7TA 4KI1A 5C0DB 4JVWA 4Z95L 3RQ3A 5FDYA 3C09B 5FUOL 5D7EA 5JZ7C 2OJEA 4K07A 3HPLA 4PLOB 3OXRA 3A67H 4M7KL 2OQJB 2EQDA 4IGBC 1X5IA 3ATEA 2WJ5A 4LPUA 1A1MB 1P7QD 3GHPA 4R4ND 5DC9B 3S96A 1CICD 2AJXH 3GF8A 3CDCA 3FHQA 1TTGA 2NR6C 1MJ8L 4BFKA 4FZEH 4L1BA 4C56B 3GIVA 2H2PD 1F6AB 4LLQB 2VDLL 5C07D 4BA0A 5HI5C 2ITCB 2P4AB 4MJID 1OT2A 1AS7A 5B38A 5DRXA 4PU2A 5AYTA 4X6CB 1YMMD 1NCCH 5HYQA 4P4RA 4NP9A 2C26A 1H8NA 1YZZA 4WO4C 3VXOA 3IWVA 4OLZL 3CFQA 1LGVA 4MCZB 1EBAA 2I07A 2EZ0C 4W9DC 5IB5A 3AW5A 2ZOTA 1A8JH 1XF5A 2CLZB 4ODVH 4PJEE 3EJUA 4LNVA 4L8CA 4YSQA 3ULSB 4A37A 3E6HA 4ZMVA 1R3LB 4KUZL 4WK0B 4CMMA 3WXVL 4UDTB 1HDMB 1IEAA 1PKQE 4TNWK 1DJIA 2H3NB 2NY6D 3HRZA 2PKDA 3GMNA 4R7NA 2PP7A 4K3DH 3T4AC 4R9HA 1NCHA 4JFXB 3LSOB 1HXMB 1YAIA 1CDYA 4NKIL 5GS1B 4L3CB 4LRIA 3UTZA 1WUZA 4WHTA 5JIDA 1MCOL 2R0LH 4OCYL 4KHXH 3VFVB 2IGFL 4ATTA 3DTDA 3QO1B 3RWHB 2C1OB 2ROYA 3ABZA 2X09A 2AJSH 4RFEA 4YHZH 3TO2B 1G9EA 3PJLA 1UVQB 2BRRL 4J3VA 4OVUA 4KMLB 4KNUA 3IMTA 2CCVA 5SWSD 4Q9RH 5I19H 2VR9A 5EU6A 4KK9C 4X4YA 3LNEA 3ZN6A 2X2IA 5F1NB 3FZUD 1FL3B 4GBXD 4WNQA 3FUIA 2XVBA 4G9FB 1Q1JH 4XXDA 4EZKA 1YEJH 3DTXA 4C59B 2EINB 1W0VB 1N64H 4JGNA 1B3JA 1DBJH 1WFMA 2VR8A 2X4QA 1T89A 4AJWA 4BFRA 5IMMA 5E8OA 4G71B 3MRLA 4AW4A 5B8CA 4N2GA 1RMFH 3WL9A 5DURD 1JZHA 1S9WB 3VRLE 2AW2A 4HIJB 5F7HA 2LLNA 1U3HB 5DTFB 2V2TA 1TMQA 1BXUA 1DSFL 3JV4A 4XTRD 3LPOA 1DEDA 4Y4HB 1VFBA 4KTDH 3N40F 4ALAC 5KS9F 2OMZB 3JWNH 3D12B 4JFHE 2A1WH 4YR6B 4DO4A 5IHUL 1F3JA 4X7SH 3RWJB 1CJYA 4AQAB 5KYXA 2N01B 4LVNC 2DEWX 5C0CA 4GAJL 3L1FA 2BNRD 2CO7A 2JB6A 3M17B 4GSDH 4BUHA 3ZRCC 4MCYB 3SIKA 1CT8A 4IU2A 4TV3A 3KZ8A 2Y23A 4HDIB 4FFYL 3HRZC 1OCCB 2XIBA 3NCJL 4PYHA 4KVCH 3T8XA 3B56A 4JRYD 3BH9A 3UJTL 2XXMB 1BJMA 2PPEA 2DMKA 4XPTH 4DZ8B 3S7GA 4FHKA 2RTTA 5FO2A 5KBMA 3WENA 4LRIC 4X5XA 4WENB 1G6VK 3EOTH 5CILH 1ZJAA 2Y24A 4OKVB 5PAZA 3SY0A 5FB8A 3BP5B 4PLJD 3COOA 3KPLA 2W95A 5J11C 3ZYJA 2ALAA 4LESA 5I66B 1ZDSA 2OJ1A 1CXHA 4Q4EA 1OQOA 1CR9L 3KLDA 2BIHA 2ALWA 4KJWC 4GRWB 2FJGA 5HDQL 1ORSB 5JUEL 1HHKB 5FOJA 1KV3A 3ZKMC 3ZYIA 3R7RA 2EIMB 4WI4A 3GMMB 2UUDH 3ESNA 3WAKA 1KIQA 2JKSA 4OF6A 4PQXA 3LEVH 1C12B 1TYEB 4I0PB 2D7MA 1IGCL 2WKOA 1PLBA 1T89C 3OAYH 1YECL 1II4E 1IQWL 4JO8A 2A73A 4CADB 1X5ZA 4PGCB 5T1MB 5B8CC 5GHWL 1A22B 2ZP9A 3QEQE 1E9PA 4RISH 3WFDH 1F4WH 4N90D 4ZMAT 3QDAA 3QXTA 4FGMA 3U1PA 5A6IA 5IMOA 3GO1H 5I17A 3F7YB 3QJVB 2BOCB 4XMVA 5IHHA 1KGXA 4RZCA 4EO5A 3B2UC 1UOVA 5B1AB 3MCKB 1H0DA 3KBFA 4F7MA 4NJ9H 3D0LA 1OAXL 4JJ5B 4V1DD 4AZUA 2ETWA 1EMTL 2OYKA 3H0TB 2XHNA 1R9FA 2ZPKL 1L9MA 3KW8A 2BP5M 5DJ0B 1IBGH 2GKIA 2ARWA 2DLGA 5JHDA 3R18A 2BC4B 3D85B 2AGJH 3DHMA 2D73A 3L2NA 3NAAL 4E5XG 1NCUA 1T4KB 4OCLC 3FONB 5FM8A 3ZSSA 4U6XA 4JVUA 4I77L 2FATL 5F9WC 3TZVB 2FK9A 1KIUB 2QPFA 3P4NB 1YPZF 2FBJL 2YPKA 4WAFA 5D2NB 4CILA 2Q7YB 2GAZB 3AS3A 2WYZA 3I6KA 4GFXA 5EG6C 2CLRB 4XXWA 3KH3A 4ISVA 4QXTA 4DUVA 3KYNB 4Q6YA 1Z5HA 4TL5A 4XO5A 4R26H 1IAKB 3T6ZA 2J1ZA 2NNXA 3VFWB 4NHCH 1LJMA 3P0VH 5IP4A 1D7DA 3SBWA 1DQJB 3ZJAA 1XIWA 3BAKA 1DQMH 3MLUH 3PWLA 5FHBL 3WHE1 2R4SH 4HZ1A 4YC2B 4Z7OB 1RHHB 1RAMA 4QRUB 5CS7A 4ORGB 5JIHA 3V4UL 3EAKA 5T33H 1MF2L 1OB1A 3UGUA 4QOKA 5CKAA 1Z3GL 3UL4A 1IGJB 1WWWX 4IBZA 3QEUB 1BBJA 2XWJB 4ONFH 4A7UA 2DRUA 1I1AD 3LS4H 3IS0X 3Q06A 2XWXA 4JGMA 3PGDA 4AIXA 4GAYA 3N55A 3QUGA 2VL5A 4KAQL 3REVA 5C70A 3MRQA 3JXAA 4OLVH 3ZDYB 5JPMB 4N0UA 2QSCH 1IM3D 5E9DA 1HHGA 3MC0A 4BZ1H 1PJWA 4ZFGH 2P5EE 1DJHA 1AZNA 2FSDA 4FS0A 3MFFA 4DAGH 3D34A 4NNPL 5BRZD 1AQHA 1LWRA 3LX9A 4J27A 5EV7A 2BZDA 5KJRL 2X4OA 2V3DA 4WUUA 5CZRA 2JKTM 3DGGA 1FL5A 4XPGH 2VE6A 4NWTH 4JN2A 3G5VA 4GKOA 2ADGB 2WWMC 3QZNA 2EXYD 4O51B 1M7DB 5J9PA 1IEBA 4BH7B 4HGMA 2R29L 3V4PH 1DJZA 1L4IA 1UGKA 4JR9H 2Q10A 3QB7C 2JNZA 4L1HA 3M1BB 5DYFA 4XXWC 2IWEA 4QTIL 2UV3A 1OP5K 1CS6A 4QAWA 4Z7VF 5FECA 1SXCA 3CFDA 4RZKA 4CVWA 2ZX8A 4LVHB 1AGDB 4GOSA 1HHHA 2P5WB 3SCMA 2WYTA 4XNYH 5DI8B 3SBWC 3K46A 4YBQC 2DQHL 1XIWC 5CP7A 5J0BA 4KI5E 5DYOB 4DETA 4ODUB 1KT2B 5IOPA 1HYSD 2R1YB 3PXLA 1T6VN 1LEIB 2TSAA 3DBXB 4GW4B 2Z1KA 3HE7A 4O58H 1WHPA 4M9OA 4MJHA 4EKJA 1WWBX 2YSSA 5BRPA 1Y0LA 2FIKA 1W6LA 2I24N 3TWCH 2V5YA 5BOPA 1IEHA 3MUGA 3LQAH 5DDHA 1NBVH 1OSZB 3BH4A 4ZQTA 1J0YA 3WEMA 1T5XB 4PJIA 1OIOA 3DLQR 1MFAL 1GS7A 2AJ3B 1NINA 3NFPA 4V2BA 5IMLB 1E3ZA 1XF4A 1CD0A 3MROB 1RUMH 4HS3A 3M88A 4R8WH 1JTTA 4QTHB 2I5YH 3T04D 3WTVA 3UJJL 2VN4A 5E1HB 3H2QA 5CFAA 3C2SA 5HHOB 2Z31B 3WKNA 1H3UA 1NLDL 5TF0A 2H5UA 2ESVD 1ZMYA 35C8L 4A2GA 4E0RA 3LZLA 2FO4B 3MNDA 3D2UD 4GRLB 3KJ4B 3O4LA 3QUXA 3MV7B 1PFOA 1IFHH 4P2OB 3WLWD 5CR8A 2Q2EB 1OM9A 1JHTB 1PS3A 2BSSA 2VISB 5F0JB 4L0YA 1BOGA 2G0KA 1CFSB 4OFPA 5CWSB 2E7MA 5FXCH 2OXGA 2AJYL 4NN7B 3O3DB 2WB1A 3SCMC 3BHBB 3GZPA 3AT8A 2ZF8A 3CBKB 1MFMA 3Q0HA 2BM3A 5FOBB 1A6TB 1UWGH 4CL7A 4LSUH 1UASA 5G4MA 3BUIA 1NL0L 4PRAA 3HE7C 2YOCA 2HVJA 4KKAC 4PGBB 1D9KC 3K8LA 4RIRB 3P2DA 1X9RA 3RWIA 2AK4E 1CG9B 1G6RH 3QJSB 2YXWA 2WWOA 4KRPB 4RBPK 5EZPA 3ZKND 1YN7A 5TH2A 5EU6D 4Y0GA 3FJTA 4PWIA 3OKNB 2CO2A 2DH3A 4BHUI 1MJ7L 3LV3A 3NTCH 4U1IB 1A66A 1Y7VA 3FCTA 5EN3A 2IANA 2H8PA 2MTAA 3TV8A 1P0SE 4FQHB 3CUPB 2OSXA 1MCRA 2Z7YA 1GW0A 1I9RH 3VE0A 5LHDA 4YHYC 4GKNB 4GP5B 2D31A 3KLSA 5BMFL 1Q9OA 1LDSA 1FYTB 3CMOL 4P4KA 3TBTB 4M62H 3TIDA 2B4CC 5H8DA 1A4KB 4ALAL 4LSSH 2QR0B 4BFEA 4CDHA 2HLAA 4OZGF 4A68A 2R2HB 4U3XA 3BGFC 5L7XL 2BW5A 4TLKA 1IGML 1OL0A 3NGBC 1OARL 2CG9X 5FA4A 1CTMA 1DANU 4LSVH 2NY7H 4QF1B 4F7PB 4H1LA 3BWUF 1L9QA 1MRFH 5DVPA 2NQ3A 2Z7WA 4YSTA 1YEIH 2BOBB 4MCNA 4GUCA 4FYSA 4F2MB 4YHLH 2X70B 5C0CD 1WFNA 5JW3L 4UTCA 2VLRA 4AUYA 4XI5D 3MX0B 1BSIA 1E2ZA 4R97B 3R19A 1L6XA 4I1RA 2XZQL 3MYJB 3UO8B 4JHWL 2WYHA 4M02A 5HYSG 3EBIA 2XBZA 1JFQL 4V11A 1OO2A 2K0RA 3AREA 4WWOA 1OP4A 4PJCA 3DO7B 2HN7A 4XCCL 1B0GA 4AT6A 3HFFA 4OGXH 4AIZA 3FCBA 2UWEA 2XTSA 3VQ2C 5DK2A 3FQUA 1NDMB 4M6OL 5SX5H 2P3YA 3O2DL 5CIPH 3PP4L 5B39B 1MUJA 4Q9CA 1O6TA 3K74B 3E8VA 4NB7A 3HZMB 2XN2A 5EOCJ 1FFPA 1XGZA 3O6KL 4NT6B 1K5NA 5KSBF 4PS8A 1JD9A 1ZA6A 4HC1H 3EO0B 1HSAB 1I9EA 2E7HA 3E80A 2P24A 4MQTB 4WGWB 1XGPB 1G7MA 1UWEH 2BNQB 3QXVA 4MAUL 3N0PB 3MJ6A 3WS6A 3L8QA 3B9KA 5AW5B 4TTDD 2WXPA 3CZJA 3ILPA 4P4KC 2IMMA 3DUUB 3VGEA 3SDYL 5J6GB 1CD8A 3AU0A 4BZ2H 5CP3H 2HFGL 3Q5YA 1SF5A 3MLXL 5CEZD 4UT9H 1G7LA 4Y1SA 4P5KA 4Y2DA 3B43A 1LEKB 2DJSA 1OZTG 3C6LB 1RIVH 5F7LB 3VG0L 4OGYL 4PS3A 5AL0A 3V95A 1RZ7H 5L9DL 2MCAA 1NBZB 3CFCL 3EF7A 4O02H 1YEDB 1A5FL 2DLFL 5E4EB 3MJ7A 2HFEB 4WDIA 4QUOA 1QPKA 2VDNH 1X4ZA 3IJEA 4JPWH 3HS0A 2VJ8A 4ETQB 3EYVA 4E42B 3KPMA 3NJVA 2IBGA 2NCMA 5JHDD 1LWHA 1KC5L 1KLGA 4QLWA 4HWUA 4YHPB 4LAQL 1NUNB 3OAZK 3SE9H 3AREC 2R2CA 4I5BB 3OHXB 3MJ9A 3S2AA 5ACLA 4FLSA 3C60B 1TEYA 4NC1C 4YK4C 3QUKA 2QHRL 3VI4E 2AAVA 3QT2A 3P3YA 4OUUB 2JWYA 4X98A 1PNDA 4TUOA 3IRZA 1G6RB 3ZE1E 1D6EA 2A0LC 2F8VA 3QG7L 4LVEA 4NSKB 4M8RA 4PVBA 3O8XB 4YVUA 3P4MB 3DBSA 4NQEE 1UH2A 3HMWH 1A7PL 5F7FA 5CJXA 5DMKB 2NW2A 4YBQD 4HMEA 3IN2A 4Y5VA 4XOEA 5EMYA 4MS8C 5DHDA 3WS6C 4LCCA 5CEZL 4Q9BA 1TJIL 3MGOA 5LG1A 2GG1A 4LSQL 2PWDA 3N41F 3GLZA 1I31A 2CM6A 4XVSL 4NKOA 1JPTH 1FF5A 4NPJA 5BQ7B 2JMRA 4QJ5B 5GGRY 3TH3T 4A7GA 1X9QA 1E4WL 5C0BB 4Y2DC 2HWZL 5AUMA 1UZ8A 3QIUA 4KQ4H 3RVTC 1EQWA 3U36B 1QFOA 1VZIA 1J11A 3NZUA 3IDMA 3X1FA 1G7PA 9PCYA 1FG9C 4JFUA 2MQGA 1DFXA 4ZUUB 4D0CB 5JQHC 3ARWA 1JSYA 3FQWA 3GK8L 3WNJA 1T21B 1CXFA 3NCYS 5K69A 4HALA 2R2EB 2BP0A 1BG9A 5ALBL 5KVEH 1B3IA 3PWPA 1AHMA 1QBBA 4HKZB 3GJFB 5K39A 5BV7B 5DMIL 1AR1D 2I60H 1P4UA 2X4TA 5EZJA 3BH8B 4XCYB 1QW8A 4UM9A 5I6NA 3AABA 2XKNB 1S3KH 4QAMB 2FR4B 4M7ZC 4NHUB 3N42B 2FSEB 4OY9A 4YFLF 5DSCB 3QARA 3RAJL 1HEZA 5I8KH 4G6ML 1LD9A 4X7DC 3SJVB 4NDMA 3VFMA 2Z65C 5D2LB 4N2HA 2H1XA 2FYYA 1NANH 3WHXA 3S37H 1HI6A 1QYGH 1DSYA 4JFWA 4WGVB 3GEFA 4MAYD 4XP1L 5EUOE 4GFTB 4ODHL 4P49A 4R7DA 1ND0A 2DY2A 1BD2B 5CJXC 3SKMB 5IEHB 3LKPB 3VFSA 1U4FA 2UY7A 1JNHA 5FCUH 4P04A 2AHIA 3BAJA 2GBAA 4XO3A 3WNLA 4G6KH 4R83A 1CL7H 2ICEB 1MW0A 4LCCC 1T20A 1Q0XL 2XQYG 4MA3B 2OMUA 2I9TB 1RK1B 5LDSA 4O4YL 1CQYA 2LLLA 5EO1A 5FUCE 4KTYA 1WC7A 3FT4A 1WPCA 4FFVC 1BVLB 1VFAB 4Z7QF 1PG7L 2DQFB 2R83A 4UIMB 2YK1H 2Y5TA 4BUQA 2VJ0A 3SGDH 4YQXH 4APQA 3QIUC 5MENA 2GCYB 4Z3TA 4TOYL 1T1ZA 2Q2LA 4C8XA 3ASNB 4NO0D 4E36A 5HYJB 4MJ5A 1KULA 2V9UA 5L2JA 3UH8A 2IBZX 1TITA 2AXGA 3MOAH 3EYQD 4O02B 4DP1X 4RRPM 2WCSA 2VDNB 3EJZC 3AWEA 5HP5A 1U8PB 1S7QA 2X28A 4N24A 4ERSH 1ADQH 5KVMC 1ZLEA 1U8MA 1I9IL 4JRXE 3KPQB 5KS9B 1ZLDA 3QQ9D 4LL4A 3JBG7 5J1AB 3MNZA 1IC5L 2Q8AL 1KB5L 3O4LD 1R3JB 4XNQB 3QUXD 4Z7WE 3HE6D 1H6UA 4U1JB 4UTBH 1U8JB 3QEQD 2BSDA 2Z7ZA 5HI4C 4KJQC 1LMKA 3C5SA 3FKUS 4MBOA 3KLLA 4CNIA 4J4PA 2DWDB 1MFVA 4TUKL 1I1FA 1U95B 2I69A 3BDBA 2PW1A 4GQ9H 2B15A 2L7UA 3ARYA 2BSBA 2H0FA 3KXFE 2GJZB 1YNTF 5IQ7L 4XPAH 1BAFL 4F9PA 5I18H 5KOVC 3CLWA 4FHJA 4LE8A 2QDVA 1A9EA 4XRCB 5I73B 2ZXGA 1A2YA 2XFXB 2XZCL 2YQBA 4AQZA 2VC2B 1N2RB 2QQLL 2XYBA 3BN3B 4FQ1L 4WJ5A 5LB1A 3SPVB 3TN0B 5FO9B 3BCDA 4BDVB 2IWKA 3P9LA 4G9DA 1YMHA 1AO7E 4HG4K 5EPMA 1FDLH 2QVIA 2YLKA 1HXYA 1G9NL 4H8WH 3CVHA 4B41A 4LCYA 2R0WL 3EOBB 3B3IB 2CLVA 4KPHH 3VI4A 1EO8L 1AJ7L 3OB0H 3PJSA 4LDLB 5LCVA 1N3NB 2VM4A 4X80L 5D5ME 3WY2A 3EYUL 3UTQA 2XY2A 2DQEH 4ELKB 4JO3H 3F58H 2DYRB 4F80A 3W37A 4GXVH 3QNZA 2DIEA 4OM1L 4WV1A 1XH2A 3W57A 2Q76B 4POUB 4N9OB 4I9XA 3V0WL 1F1AA 1TTAA 5TQ0L 5KG9B 3HMXH 2ZP0T 3PPEA 3OLIA 1SUJA 5IBTH 4LOUD 3K71B 2CGRH 1RK7A 3VXRE 3S3BB 3B7UX 4ZOBA 2EDTA 5DZJA 3BO8A 2C9UA 5IEKB 3BZ4B 3DJSA 4LLYB 1QSZA 1MAML 1SJMA 3DROA 1YEWA 5GZNC 2X40A 1X7SA 2WBJD 3IXAB 3K6SB 2KBGA 4LU5L 4FG6C 4GINA 4H7VA 4J4PC 4AY0A 1CTOA 1XB6A 4ODBD 5DD3H 4AVJA 4AQ1A 1JIBA 4LBEA 3L3JA 2CIKB 2ICCA 3O2WL 4UV4L 3U4EB 3N06B 2VLRD 3CVBA 3W2DL 3F83A 3LYRA 4F9PC 4PJXF 4A6YA 2BVUA 4OT1L 5HGAB 4DGYL 1PX8A 2P5ED 2KUTA 4DN3L 3BZEA 1N70A 2AKRB 5BUAA 3QQDA 3QUMB 5HYEA 1YPZB 3MR9A 3NCFB 4L1SA 4TVPH 5DS2A 3NYKA 4NNXA 3ZDXE 1TNMA 3SBRA 4J6RL 4PG2A 1ZLWH 2JJVA 1SJEA 4AYBA 1U2CA 4HQQL 3A3YB 3QZOA 4AUUA 4OI7A 2V5SA 4JHUA 1CBVL 1K9TA 1DP0A 1NBCA 5INDB 3FUKA 1YAZA 2IPTH 4O5LL 3GSRB 2X0VA 2K6ZA 1H8LA 2D8KA 2P43B 3X13A 5G4NA 5ISZA 2FNWA 4LRNL 3HBGA 1PX3A 3OPUA 4JDEB 4PJHF 2R0KL 2JSFA 1U93A 2PNDA 1FZKB 2YA1A 1TCRA 1ZDQA 4WV1C 4PJFB 2DDQH 4EIBA 2VR3A 3C5ZA 3R06B 5DK0B 3BE1H 3KEHA 3B5GA 4MS8D 4WEEA 3ULUE 4JE4B 3RZCC 3B9KD 3U0WH 4XOCA 2BFVL 1ZANL 4K9EH 3IRPX 4WTZG 4GG6F 3HZVB 4FQIL 4HJJL 5JW4M 2WKLA 1TJGH 2CSPA 5E2VL 3MRRA 5E2TL 3BWZA 2UX7A 4JL1A 2EIZB 4N1HB 1J9QA 1QAWA 4WTXA 3RVTD 1U58A 3C12A 4AYDC 2F7RA 3HC3H 4B3EA 4HKJA 4HUWA 3OWRA 2EABA 2OULB 5BO0D 3S8GB 3WGVB 5CEYA 3Q6GH 3CLFH 2FWSA 3WAJA 1RUQL 3VD7A 1AP2A 3Q8FA 3ZE0E 3D30A 1G7QB 5GGTL 2FEDD 1NCBH 2W60A 2YUWA 5DFVC 5LG6A 3C5XA 5HXMA 1URIA 4UOJA 1U8OB 5F0LB 3VW3L 1CU4H 3B9EA 3M6DA 2QVTA 2DKSA 4IBSA 5C86A 3MCYA 5F97E 3WFCH 3RU8L 5D4JA 2FBOJ 1SXZA 3OGCB 5EEUA 1NDGB 5I1EL 4YX2H 1R17A 1EAQA 3NCMA 1AZUA 4NUQA 4P46C 2GUOB 1R5WB 1U8HA 4JRXA 3QDJB 4Z7VB 5EF0A 2A6JA 1J9TA 3RRQA 1P4LA 2LOEA 4XMWA 1CE6A 1TUPA 2HTLD 1AD0A 5EFIB 4M5YL 1JPSL 4XC1H 3V7AG 5E51A 3L4CA 3H6AA 4UT6H 4PJDA 4YPGA 4L18A 1J0IA 3FTZA 4U1MB 3NT0A 2NNAB 2J8HA 4ZSOB 1D5ZA 4YDIL 4HIXH 3TTSA 4JPVH 3BVDB 3H9SA 4MB4A 5CU5A 3WIFA 1ANUA 5KYWA 3C5ZC 3EJYD 1HILB 4K7FA 1INEH 3KXFA 2HG5A 2WO3B 4PRBB 5EWIL 4JAMB 4P2RB 4MZ3A 2K1MA 2D3NA 3IRCA 4OLWL 1QRNA 1KJ2L 1A14H 3OKEB 2V5MA 2TRYA 4QRQB 5IK3A 1WTLA 3SDAB 3CN3A 1T5WA 2X4PB 5C6WH 1LO2H 4L3FA 1Z5LA 3IDJB 4JPIA 2QVKA 3D50A 2GK0A 1NCDH 2Z93A 3PABB 2BCKA 3RNKB 2X87A 1UOKA 2CJ3A 2NYZA 3S3PA 1TZOA 4E68A 1TU2B 3CHSA 4HKBB 4CDGC 3EYSH 1E6JH 4J23A 3G9AB 1A7OL 1VJSA 5DJDA 2RCSH 5MI0B 3T0VA 2YD6A 1KPUA 4IRJD 1CTNA 1KGUA 1ZRUA 5JNYB 3MCLL 5IB4B 4GSRA 5D5MA 2UYLB 4YO0A 3DK0A 5FIEA 1V7NL 3QJOA 2GT9A 2BNUA 3OLGA 4BK8A 1UEYA 1J0HA 4PCSA 3FRPG 4PVNA 1ZTXE 1RUPL 3FU3A 3BVNA 3DIDA 2IMNA 1E5CA 3VXRA 1OD7A 1KV7A 3F7LA 5J57B 4MHHI 4OLXL 3UAAA 3GXNA 5L8KB 1CLYL 1LE5B 1AHWB 1JK9A 5GGRB 4KBPA 2DLTA 4CN1A 4EE2A 5IM7A 1RUKH 3O3AA 3SDXF 3TBSB 3GXMA 2O5XH 3P30H 5DWUH 2VM9A 1HAUA 5AYQA 2IVFC 1VGEH 5CMAA 4BSVA 1KYOK 5E1IA 3SYOA 4HCRL 5J1TC 4N2AA 3KDMA 2YBGA 4P5MB 4RGOL 5AAWC 1F8TL 4ZPTB 5FKAB 4XR8C 2LU4A 2QADC 1A3LL 2X6AA 4R5VA 4AGNA 4DQAA 4DK3A 5MP6H 3QE5A 4F15C 1YEEL 3SKJH 3D9AL 2DQTH 4OGAC 3T2OA 4EOWL 4WSGA 5KSAC 2XNAA 3ZDZF 4YXKH 4AL8C 5ANMA 1C5DB 3U46B 2DWEB 5GPRA 1CDHA 2VERA 1BOYA 1JG9A 1FV1A 1A1MA 4APQD 2EYSB 1X7TA 2DMBA 3TFKC 3FTWA 3VCLB 1U41A 2L7JA 2ZCLL 4QMEA 2D2OA 4XMUA 4S0SD 3X17A 2XTJC 2BVEA 4ANUA 2FB4L 1QFPA 3L81A 3VH8B 1QR4A 4U4IA 5HHQA 3U4BH 3QUZB 3Q8CA 1A6VL 4N85A 2OXHA 1DCLA 1NIDA 3CPLB 3QZMA 1QSVA 5D93B 1KACB 1NDTA 3IAGC 1FNGB 3M1CA 2DMCA 1N59A 2DKUA 1E30A 4Z0BH 5IIEA 1QHPA 3K4ZA 1ITCA 2ODIA 2GFBA 5B1BB 1A3RL 2FUTA 1JN6A 1NAKL 4X9FA 3OR6A 5KAQF 3U1SH 3NSYA 2CLZA 5LQBH 4MKMA 3P0GB 4L8SA 5CLWA 3GMQB 4DN4L 1WFTA 2WNGA 1NC2A 2X1QA 3PFUA 5AZ2H 5CGYC 4HP5A 1KGCE 2H3NA 5A1AA 4B96A 1U9KA 2XU9A 3ARBA 3LSOA 3OPZL 1W0YT 3F7VB 4PJ7F 4P99A 1J1XL 2G2PA 3NIFE 5AW8B 1FHGA 3VXTB 1JF5A 1YVLA 3CFBA 4JO2H 4KKLD 3A6BL 4FFZH 1SM3L 1CDCA 1RZGB 2OLDA 2E4FA 2MWCA 4NENA 1KWKA 3MLWL 1RURL 2VAAB 2X4SB 2YD8A 4W68A 1FC2D 4GSXA 5IREA 4NEHB 1BZ9B 2E7BA 1GPOL 1F97A 3D4ZA 4QHLA 5DC0A 3HC2A 4DPAX 1T1XA 2JCCF 2IH1B 3EBAA 4OLYH 4GMSH 3V4VB 4DPRA 2Z92A 3BD4A 1F3DH 4PGDB 4YLQT 1W0VA 3BSGA 5AOZA 3B7TA 3HJ0A 1WBXB 3HA0A 2NY5C 3NZHH 1FO0L 3VFTA 4U3SA 2CCLA 2WVVA 1X5KA 3B6SB 2CU9A 4NQED 1HHIB 1F4AA 1CVRA 4FJYA 4WW1B 3ZY7A 3AU1A 4A55A 1FAKT 1TJMA 1JJUA 1WV7T 3FAWA 4G7YH 3ZKXB 5HBBA 3UMNA 1Y18B 2XG5A 1ZAGA 2EDBA 2G60H 3IDXH 3OM3B 4KNQA 3FK3A 1RY7B 4P2QE 2E76C 5AD0B 1WAAA 4P9MH 3B2DC 1BFSA 2C7UA 2R9HD 5GSVA 3T71A 2YAPA 3UX9B 1FVEA 1AC6A 1VADB 1T7XA 3S35H 2VLLA 4H25B 2J4WH 3K8MA 1RVFL 3QPXL 3OKMB 1TPXB 4L8SC 4CVZB 1FBIH 5ID0A 5F7EL 4HKXB 5JR1H 4HDIA 4IHBA 1M4KA 1X3DA 3DHJA 5KJ4A 3QXUA 3QNFA 3ME0B 3ARBC 3QFJE 2BHFA 2CAKA 3HHRB 1SHWA 4A63A 3BUTA 4LLAA 1ZGLB 2NY3D 1A7QL 2HG0A 3ZDWA 2PWHA 3GT6A 1SJVA 1CD9B 3RVXC 2PTUA 3CVHL 5F6IB 2DYPA 1YJDH 4K23L 2VCOA 5F6HI 2DJ4A 1SOKA 3RWCB 1YYML 1IM9B 2EEBA 1OAUH 2CALA 1KCBA 2FZ3B 3HZYA 3NK3A 4OF3A 2C3GA 4UBDD 1RSYA 1KJVB 3H3KA 2EDEA 1IRAY 1F4YL 4MA7H 2EH7L 3QJQB 4FP8H 5DRNA 2F1BA 2XTLA 5D4QA 1KZQA 2O5NA 4K7PL 4C54A 3ABKB 3FXIC 3CXDL 5T1MA 3V7MA 3S36L 1A7BA 5AW1B 3VM5A 1IJNA 5I1KH 4I18A 2J2ZA 1CVSC 4ZTEA 3UYRH 2R7EB 1JPEA 1OF2B 1DLFL 4WUKH 4XX5A 4EUPA 4ODXA 1T2XA 3I6LE 1JWUA 5B21A 4XXCC 5HD8D 2GSIA 2WWKO 3VDCA 4B9IA 2X4RB 2VSCA 3FUNA 4L4TB 4XMKH 4XHJC 1ID2A 4ZAKB 3FU7B 2EIKB 3FOLA 4HCGA 4XNBA 5DA4A 3UJIH 4ZO9A 5JHAA 1OB0A 1X7QA 3HI5L 4X6BA 1B2YA 3I3DA 1KJ3L 5KSUB 2XWDA 3UCRA 1AZCA 3UO1L 4UQAA 4ZT1A 1V3MA 4PBVC 3GTTA 4IRZL 1GAFH 3F12B 2YZ8A 4JRWA 2YMOA 1P4BH 2H32H 2QGCA 2YWYA 5INCB 4LLMA 3RVVC 5ABDE 3G6AA 2ZOLB 4AYGA 3ZTNL 3D85A 3RTLA 3I02A 4KXBA 2QQKL 4UUJB 3CFEA 1Q0YH 4H0GA 4AGQA 2W9EL 3L3IA 4C58B 2GHWB 2XQ0A 4TQHA 4WW2F 1UM5H 4E41E 4AEFA 2AQQA 5DMGC 5AVTB 3BIKB 4XH2A 3VTTA 1KZYA 4P48A 2ZOKB 4JRXD 5ESVB 3WO4B 2OMVA 1MCPH 5IB3B 2XVKA 4JFSA 1BJ8A 2CKBA 3L3HA 4Y19E 1XR9A 2P26A 3KNBB 4LARL 5E95B 3L17A 1CFQA 2CLRA 4JPQA 3M7FB 4EI6B 4GQPH 3BPNC 4FG4A 5TE4H 1UXWB 3E9TA 2W0LA 2WXQA 4XVOA 3MV9A 3NPSB 3WYRA 5HGDB 3BIBX 3ETSA 5HPOA 4AGMA 3L5XL 1SMDA 4PUBL 3H9SD 1U8IA 2IG2L 3MRGB 4I0PC 5EO0B 2Z3FA 1DQIA 1HINL 3BUYA 2WXIA 3DX6B 2WCPA 3KXFD 1SBBA 2YGOA 4YIQA 1NAML 2MCMA 5IT2L 1QOKA 5AKTA 5FO8A 1CYXA 1QRND 5AW6B 4Z0XA 1UA3A 3QEUA 3US0A 1M1XB 4ZDHA 5D7SL 4MA8H 4XP4H 2DJUA 1A9BA 1I7UB 1KEGH 1F56A 2YSTA 5CEXA 1OAYL 2XQBH 5DD6A 3WNNA 2XKUA 5I1IL 4GQZA 3OSVA 2L04A 1GJWA 1E0OB 1YEKH 2CUIA 1IV8A 3Q9PA 1AO7D 3QNXB 1E9QB 1MLBA 2A4EA 4ZMTA 4I9WE 5EU3B 1AE6H 2ICWI 2VRAA 2QZQA 3EW3B 1VFOA 3CIAA 2BFGA 3LIZA 5EOCH 3V6FB 3D39A 3W1ZA 1D7FA 1QLEL 5EO9B 2XWBA 3GNMH 2SODB 5H2BA 4IOSD 3WTTA 4KY1H 4BFGA 2OYLA 3H3PL 1N0LB 4ZO7A 3ZMRA 4PW9A 3T2LA 5LJYH 3IDUA 4U6YA 1Z0MA 3L5WA 1CGTA 2J6WA 2MQ3A 2ZXWB 1EAPB 1D5MA 2BRQA 4EI5D 4G8EB 4KRLB 3VFOB 2QKIB 5LVEA 1I7ZA 3CN2A 4KWUA 2WZPD 4ZZFA 3QULB 4MWFB 1IGTA 3SGEH 4RMWA 3LKQB 1GMIA 3K4DA 3ORJA 4ZS6D 2VTFA 1E5AA 3VXRD 2GJ6A 1OK8A 1C08B 1L9NA 2FLMA 4N5UA 2VUOA 5C9KA 3QORB 4HAGA 2XN0A 4RAVB 4BINA 1WD9A 2H2SD 4R90L 3QUYD 1RQ5A 2HFFA 4TLUA 4YXLL 3MREB 5KANG 1BA9A 4YC2C 4HOXA 3FB8A 3V0IA 1KT2A 3G3LA 2FQGA 4YHNA 2V5RA 4XN8A 5KAQG 1OPGL 5L4FA 2VN5A 2NY4D 2HJKA 3ESUF 4HU2A 1BZ7B 5A2CA 3JTSB 2HJLA 1PDKB 4YPJA 1CDIA 1MCEA 5KVFE 4HK0A 1RJYB 3RDJA 3R4DA 2A5UA 5E2UL 3IXTB 1EEYB 3K1DA 1ULVA 1A4CA 5DT1L 3LNHA 3RNQB 1OD9A 4YDKL 1O5DT 2YZ1A 3M1OA 1MFNA 5BW7A 1MRDL 4UMSA 4Z7UB 5JORA 5GGSY 2VMEA 1FORL 4W9JC 3GSWB 1J86A 1SJHA 2J8UF 3QYCA 1HIMH 3JWNC 1CMOA 1G94A 3AT0A 3PIQB 3ECBB 1JRHH 1JGVL 4QXVA 2J72A 1DJXA 2XXFA 2ZCKL 5FPIA 5D7JD 4BH8B 3D25A 4NGHL 5DHEA 4N8CL 2J73A 4QEGA 3RI5F 1XH3A 4Z95H 3DJRA 5FUOH 4DNLA 1BM7A 1SLVA 3AUVA 4N9GA 2JLLA 3HI6L 1VACB 2FO4A 4NUMA 3RPIB 3V9CA 2PYEE 3MRPA 4Y9CA 4Z78B 4I3GA 3ULUD 3EJPA 3LPWA 4BEIA 4Z23A 1ZPUA 2C9AA 5IG7B 4APXA 1XGRB 1YEGL 1MRCH 4J12A 1MJ8H 2F0CA 5CR1A 4M61A 4IKNA 1UB5B 3GC3A 1JGIA 1NCTA 1XH0A 3OKDB 3C75A 1J5OL 2X1PA 2ED7A 4PP2B 4HPOH 5F89A 3OTTA 5BS0B 1FFNA 1TSHA 1G0YR 4LVHC 3S3JA 1A64A 4NCC2 3VFRA 3GJEB 2EDRA 5EB9A 4YMPA 5JOPD 1FRGL 2M2DA 2YRZA 4OLZH 5JIPA 5FOBA 4OQTL 1PLCA 2X38A 3TV3L 4U1NB 1MH5B 3ERXA 4UQBA 4ZMYA 1MFBL 2CDFB 2H26A 2M1KA 4JLRA 4D7BA 3PV7A 3R1GL 1R0AL 4PTUA 1DJSA 1XAKA 3RX5A 4DKDC 4KUZH 3CSGA 3WXVH 1J8HB 3H7BA 5FDWB 3W81A 1OGPA 4PJHB 3VXQA 1KGWA 2QLVB 1K4DA 3PQYE 4E41A 3S34L 2H0EA 5J6HB 4RFOL 1UYWL 3IBOA 1RZ8A 1XMWA 4MASA 4U6VH 5FYJL 4NKIH 1P7BA 4PRPB 1E28B 1CFVL 4NLAA 5EU4A 1MCOH 2K9FB 5DC4B 2ZSVB 4X5PA 2E46A 2IGFH 2V8MA 3GPSA 2W81C 1XT5A 3HN8A 2HRLA 5EDXA 1XTLA 2BRRH 4O2CA 3VI3E 3ULUL 2N7BA 2R2BB 5M7QA 3MI6A 1A4KA 3FO2A 4XZUB 1FCCA 1D5XA 4OUOA 3KJ4C 5CCGE 2Y2YA 1G1KA 1CFBA 1ETZA 2QPEB 1A65A 4A7SA 1NCAL 2ORBL 5LLIC 3V4PA 1NM9A 1JWMA 1Z6JT 3CN1A 2YD1A 5IROA 2QPSA 3E2HC 4DK5A 2F1AA 1OTTC 2X70A 5D7IE 3Q1EA 2B1HL 3QK0A 1AZRA 2W91A 12E8H 1DSFH 2YLHA 2Z8RA 1J1PL 2R27A 4YUEL 1MCWW 4POYA 5E4IA 4FQLL 2FWOB 3BRGC 5EU7C 5BQDA 2ZCHL 1ZLSL 3DYOA 5SWZE 3L13A 4L3EE 4S1DC 2HVBA 4ELMB 2A74A 5IHUH 1UUSA 1YQVL 4W9CC 1GL4B 5FFGA 5DVOA 1CO1A 1FH5L 2DYPD 5A16A 4LSPL 2YUXA 3C5JB 3FU6A 4QRPE 4NQDE 3JV6B 3GEWB 3V0DA 2BS71 3D0VB 4KRPC 4NM8L 1TNNA 1M71A 2WQWA 4FFYH 3L7EA 3NCJH 1EGJL 1ZSDB 4FLQA 3WKMH 3O6LL 4HUXA 2D0FA 1HSBA 3UJTH 4JK0D 3CHQA 3WKYA 4ZXBB 1J05A 2OMYB 3UROR 4X50A 1QPPA 1NEZA 4FRWA 4PRIB 3IKKA 3EZ8A 3FUDA 4D9QE 3HNSL 3FT3A 3Q6FA 4D9LL 4P57B 1OTUD 4LLDA 1AKPA 4LPTA 4KQ0A 5C0FB 3I2CL 4PJAB 3S2CA 5JW4N 2EC9T 2BVPB 1P84K 1CR9H 3NIGB 2J55A 4KKCC 3ZT5A 4Z7NF 1I8IA 4LDOB 1XSKA 4CRPA 3ZZQA 4E5XA 5HDQH 5JUEH 1RUAL 3QPKA 1FA4A 5DJAA 3KLHC 3D51A 1MI5B 2QPUA 1XD0A 2ZXCA 2GSGA 1EWHA 1MHHA 1JXFA 4CJ1A 3CU1A 1NMCB 5IROC 4XP6L 3TJHC 1ILSA 4TTGA 1IQWH 1NBZA 2E3VA 2NX5B 3LY6A 5GHWH 3AGWA 2VDLB 3HFML 2VIRA 1OANA 4HGKC 1GYUA 4R97C 2G2RA 5LNGA 2FJSA 1B2WL 1HCVA 1U91A 3U9UB 1YDPA 2P48B 1U3ZA 1WBYA 4J3BA 3IKCB 4BV1A 4NAJA 5I8CB 4J2QA 1TYJA 1ZLUK 1SDDB 4Z3HA 5LAPA 4F7KA 1OAXH 5CNHA 3C60A 3GM0A 1PG7W 3VG9C 1GIGL 1ZTXL 3ARDA 1KLUA 3IFOB 2ZPKH 4OUUA 4ZW7A 4WI6A 3SDXB 3SQRA 5BVPL 2IOOA 2UZXA 1O6VA 1MREL 3LQAC 3VWJB 3RFZA 1UKSA 4W81A 3QYNA 3CFNA 4N1EA 5M94B 2ED6A 3TVMB 4PJEF 1PZ2A 3NAAH 3DECA 4MQ7B 5CKGA 5CM1A 5E4OA 2VDML 5F7NC 1J0ZA 3HTLX 5MEOA 1RXLA 2AJVL 3WLBB 5AOJA 2UY6A 4F20A 4I77H 1I7RA 1DE4A 2FATH 4JFEE 3V52L 4P5TB 2D0HA 3FB7A 1WBZA 1E4XH 5FWRA 3EXLA 4OD3L 1HCZA 1IGFL 1KGCD 4LPYA 1S7UB 1NCCL 2I9LB 4HMDA 1CF8H 2X9YA 5BZDB 2DZEA 3CFJA 3EHBD 5BQ7A 4E9SA 3FT1A 2ZAHA 3N43F 3IMSA 1M6OA 5FHBH 3C6LC 4ONGL 5C07B 4HF5L 1JCKA 5K9OA 1WHOA 4GAGL 1HH6A 3AT9A 4MJIB 1JZ5A 2C3XA 4JKMA 4PY7B 4N2OA 5L88H 1H15B 1CXEA 1M1SA 4L29B 1MF2H 4XNAA 4C83A 1Z3GH 1OCZB 3KCPB 5G55A 1ZJBA 3VWKD 4DT2A 2QVMA 4JRLA 2CUAA 2FL5B 2WLLA 2HT3D 3RIAK 1J87A 3IF1A 3HG1A 3L5IA 1ERNA 1T0MB 1TVBB 3FO1B 1FE8H 1IC1A 3OX8A 4JKLA 2GK2A 4KAQH 4KHXL 4M7LT 4U6HB 2F74A 5EBMB 3VRLF 2AJSL 5I1HL 2CKBL 4R4FL 1TLKA 1R5IB 4U0QB 1WZKA 2DMGA 3G5ZA 3C60C 4U1SB 5DSCA 2R4RH 3UG5A 4CC0A 2NY6B 2FR4A 1QSEB 1UACL 2AQPA 3O81A 3ARDC 3CH1B 5CJQL 5I19L 4LIQE 4JGUA 5B38G 4ZODA 4NNPH 2NY0B 2GJ6D 1KTLA 4Y2OA 5CIPA 2K4WA 1QO3B 3RFZC 3EJQA 4Y5YA 1FNEB 4P2QD 2D3LA 3KS0H 5CSBA 4KMTL 1GTNA 3QS2A 1G7IB 3AXLA 1HHJB 2RMNA 2JV6A 5FA3A 4A2DA 2C8NA 4G8FA 4HC1A 3MRJA 2DEYX 4KHTL 1CLZH 1GTFA 2SEBB 1DL7L 2R29H 3T2NL 4HUUA 4Z6AT 1FSKC 3RVWC 3K72A 2ZXEB 3U25A 1AD9A 5SWSB 2DQGL 4AH2B 2O6EA 3B2VL 8PAZA 5I1JH 3L3KA 4GBXB 1B88A 1R3KB 3QFJD 2AVGA 2GTWA 3PGCA 4PJ8A 2CMRL 3M86A 3GMOB 4UU9A 4X5LA 1MDTA 4BZ2A 3MNMA 2EC8A 5CP3A 4AVHA 3UTTE 4HUMB 4B60A 5IFJA 1QNZL 2DQHH 3LIZL 4JFYB 1EJFA 4JG1L 2DBLH 5JXEA 1KXHA 1WWCA 1A1OA 1XF3A 3ALXA 5JHBA 5DURB 1V54B 3F65A 4QHUA 1VERA 5HYJA 4LL9A 5F2FA 3ROLA 1LXMA 5E8PA 5FX3A 4CKQA 5IVXE 3U30B 4B5EA 3W5NA 3MQIA 4KVCL 1IC7L 1IL1A 5C0JA 2Q6WB 5IB2A 3O4OB 5DEZA 2FRGP 4MZRA 4XPTL 1SMOA 1A6ZB 3F7KA 3EOTL 5KS9A 3EJSA 6PCYA 1MFAH 4AX3A 5DO2C 2BNRB 3OHMB 4AM0A 5DVLA 4M43L 5CZKA 5D1ZA 4DVBA 1OAQL 1CWVA 3CDYA 5CCKL 4PJBE 3QRLA 4RMBA 4I2XA 4HH9B 3UJJH 4F37K 1DQLL 2A6KB 3I6LD 3VRIB 3HNVL 3ROOA 4X6DB 4GUQA 2NXZC 3R0NA 1NLDH 35C8H 2FVNA 3ABMB 4X5QA 5TDNA 4N0FB 3VXNB 5GGSB 2VR7A 3LEVL 3ATDA 4HOZA 4Z9KB 2XBDA 1QVOB 1UOLA 3FPYA 3DX8A 5C0RL 4UWQB 2APTA 1G4RA 1AGEA 2CBMA 2IQAA 5DJYA 3X12A 3UAJA 1Q4NX 3WFDL 2ICEC 3WMPA 1TJHL 4FC3E 3D1MC 1SXSA 4L4JA 3CXHJ 3CDGB 4DIXA 4W70A 2O5ZL 4FTVE 1TIUA 4L05A 2HRHA 4TQIA 2JTDA 3KAAA 4M93C 4MNHB 2AJYH 1J8SA 5ENWB 1OGAE 2XRAH 3TNNB 1KG0B 4W9ZA 3WDJA 2HT2C 3RHWK 3BCFA 4E41D 3DNKA 4M6AA 2EDXA 5JXEC 3DPDA 1U8QB 1T04B 4Y19D 3Q05A 4AIEA 5C6PB 4BWWA 4N3TA 4M3JA 4TULH 3HUJE 1NL0H 2B5IB 4ZUTA 3NFNB 1T66C 4G70B 5DRWA 3V2AR 5C8JA 2M83A 2CBTA 5HJGA 5KG9A 3GSNL 1MHPL 4YFLI 3F05A 1L5GA 3CN4A 4JFEA 1XO8A 5HYSA 4V1DB 1NFAA 2Q5BA 2Z4TA 1UD6A 2TAAA 3BIAX 2YPLA 3OJDA 3KYKL 4Y5XB 5JO5B 1L6PA 1FFTB 3FQYA 3ZZSA 1MJ7H 2ARJA 5D1ZC 1S5HB 2EYTB 4JFOA 2YD9A 2YUVA 2YEZB 4RMVA 4KKBD 5IROD 2IDQA 3O41B 2NTFB 1RK0B 3CMOH 4I48B 2IQ9L 4KZ0A 1DDHA 1DQML 2FX8H 3C8KB 2WXGA 5T33L 4I9WD 1AMYA 1WA2X 5LBGA 5L7XH 4JNXA 1IGMH 4YFDB 1OSYA 1OARH 3H7LA 4J1UB 1RPQA 5I73C 1YPZA 3Q5OA 2WP3O 3UAJC 1OWWA 1WS8A 3JTTA 2BVQB 5D1XE 3RWDA 1B0RB 4DCQB 4MFHA 4FNLH 5JW5A 4JANB 3CFKA 1LO4L 3FB5A 5ETUA 2UX6A 2EEDA 4Q6KA 4WI3A 4AW7A 1P5UB 2LE9A 2QL1A 2UZIL 5HPMB 2OX5A 4Y2NA 5FK9B 3BKML 4WK2B 3TA3D 5D7LB 1ZS8A 3TCLB 1MCHA 4OIAA 1OK0A 2XZQH 4KROD 4AE0A 2O5YL 5GRXG 5KYUA 1UT1A 2HKHL 3EYOB 4JHWH 3IFPB 2ZYSA 1LP9B 4QKXB 2PXYB 7FABL 4JB9L 1C8QA 3LD8B 2QVFB 1CZ8L 2XT1B 2Y07L 1I1AB 4X7TA 2AJUH 1LNUB 2P8PA 3MODL 4XCCH 4MMZA 1E3XA 2RFXB 3UYPB 1A1NB 1IBHA 1N26A 3DHUA 4FERA 4PSRA 3TF7C 3MV01 3W0WE 4HLZG 4MVBD 1NCGA 5LN4A 4KI5F 3FTVA 3O2DH 3N50A 3I84A 3PP4H 3U48A 3CWGA 3EZJB 1IM3B 3TGXA 5JLZA 4OZIB 3ENEA 1S2EA 3MRBB 3HZVA 3IFNL 2A6DA 3GMPA 4LO9A 3GSOA 1RULL 4HUNB 3UPCA 3UC0L 3O6KH 32C2A 5I74C 4LHJB 5TDOA 5EIIG 1C16B 4AK1A 4ADIA 2WLHA 4PJGE 3JZ7A 2Y0SA 2NUTB 3GJFK 3FULA 2GEQA 2BSRB 2Y72A 2ZT9C 1T0NB 4GXUM 5DVMA 5IJVB 5I76A 2FX7L 4EIGB 5T1LD 2VR4A 3OZ9L 3QDMA 2NW3A 2VOTA 1FZMA 3PHOB 1I82A 2YAMA 4WFFD 3BQUA 4UAOB 2OFQA 2YD5A 3GHEL 3SDYH 3M07A 1U8LA 5I28A 5L0QB 1VFMA 2HFGH 3MLXH 1I3RA 1TCMA 2NYKA 3IGLA 3ZR6A 4BRJA 1R24A 3MRFA 5F88A 1TVDA 3AUWB 4RWHA 3CVIL 3VG0H 4JM4H 1MNUL 4OGYH 3BLPX 4OJDH 3RY4A 2OZ4L 2ZX6A 8CGTA 5L9DH 3MRDA 1T6WA 3CFCH 4ZYKB 1L0XA 3S0PA 1A5FH 4Z7VA 4NO2A 1I8MA 4H44C 3SDDA 2QHLA 5DUBB 3T77B 5ERWB 2WLKA 4FG0A 5TGBA 1U8CB 1JPFB 1W72H 1KC5H 2NXYC 3KGRA 4OVVA 1KTRL 2H1PL 4UQ3A 4WI0B 2CIIA 2QDWA 4PM1A 2P7TB 1FVCB 1G7HA 4XNXL 3OKOB 1V55B 3VNYA 4MMZC 3U79A 3FHAA 1HILA 2PUQT 1R3HA 1UFGA 2OJEB 1HZKA 3HPLB 3V10A 2VLME 3OXRB 4JN1L 2V5TA 3QI9D 4BFFA 3QDGE 4GLRI 4N2BA 5B4MC 4EJ1C 3OKEA 4OZHB 1OQXA 2AEIT 4NN5B 3HMXA 3S96B 1AOZA 1JMZA 1KN4L 3QG7H 5KVFL 4ZW8A 4NZDA 4PJ5A 1EHKB 2VXSL 2NYYC 4IS6A 1A7PH 3DC0A 3FHEA 2MQCA 4DP4X 2XYCA 2LHAA 1N0XL 2Z35A 4Q6IA 2EECA 4FTVA 3AB0C 5B38B 2C4FT 5DRXB 2V4LA 5CEZH 3MBEA 1NFDE 1TJIH 3DV4A 5DGQA 5HYQB 1S3RA 4P4RB 4LSQH 1YN6A 5T5FA 3BQUC 3MO1A 4XVSH 1W2KT 4XC3L 4ZFQA 5I0WA 5HDBB 2I07B 4LSUL 5GS3A