4S11A

Gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
129
structure length
129
Chain Sequence
VQLQESGGGLVQAGGSLRLSCAASGRTFSSFVMGWFRQAPGKEREFVASISRSGSVTRYADSAKGRFTISKDNAKNTVSLQMDNLNPDDTAVYYCAADLHRPYGPGSQRTDDYDTWGQGTQVTVSSHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GELSOLIN NANOBODY
publication title An ER-directed gelsolin nanobody targets the first step in amyloid formation in a gelsolin amyloidosis mouse model.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 31
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2015-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s11A00
3CSYA 4N1HB 3OXSA 4R7DB 1ZMYA 3D3VE 2X4TB 5HVGB 5IESH 1FNAA 1TVHB 3PF2A 4BQBA 4IRJB 1DUYA 1HK6A 4JRXA 1JHKL 2PW2A 4HK3N 3GMRB 2CDGA 1K85A 4Y0GA 4HZLA 3C5ZC 3C60C 4HD9A 3QXDA 4HXAH 2B20A 1WAAE 3K80A 5E8PA 5DLMH 2Q76B 3LN5B 5HHQB 4LIQE 3C5JA 5ALBL 3MRRB 4ENED 4V1DE 1M71B 1MCBA 3BKCH 5DUPH 5AAMA 1IAOB 5KVDH 1MSPA 3IFOA 4GMTH 4U1GC 5ID0A 3MJ8B 2QADB 3VE0B 2F54D 3D48R 4IRZL 5AUMA 2ADGA 3EOBB 5FUCE 3NABH 4LVOB 4XB8A 1ZLSL 2Q3AA 3P40A 4K3GA 4E42A 5J9PA 3QPXH 1YMMD 1F13A 5F1OB 4UQ2B 3UAJD 3G5VB 5HGHA 2HKFL 4QTIL 2E9WA 1HILA 4RNRA 5HDOA 1KGCE 3RTQD 5D7JD 3RUGB 3ZTNL 1F90L 5EZIH 3UCRA 4ZG1A 3BN3B 1X6NA 4U0RC 4J4PA 3DV4B 4QF1B 3ZDYE 4CMHC 3D6GA 4JDTH 2A9ML 3LKRB 4QLRA 1NGXA 3C5SB 3FB7B 3L7EB 4TSCH 3AFLA 2NTFB 2NX5B 3VWKA 3QA3B 1CU4H 4XNQA 5I75C 2IPKA 3D0VA 3NFNB 1G9NL 2C7UB 1PSKL 5F9WB 3VWKC 3IGAA 3JWDC 2X4NA 2Q86B 2NY4C 4G8GD 2WBJB 3GRWL 3EDKA 5MEOB 1INQB 1E4KC 1P4BL 5J1AA 5C86A 3OKMA 1SY6H 4O2EB 2FHBA 4X4MA 1D6EB 1H5BA 4M1DH 1T3FB 4HT1H 1RUPH 5HYSG 3Q6GH 3FL7A 4R4NC 1I7UB 5I66A 2J12B 2IEPA 5SWZE 2H2PC 15C8H 4JAMB 4M93B 4RMRA 3SDAD 5JW3L 3WKML 4JQVA 4G9FE 3OKNB 4FTVB 1MI5D 5C9KA 5AG9A 1UJ3C 4JQVC 1XZ0B 2C26A 2WP3O 4PP1C 35C8L 1NBYB 3VXTA 3HMXL 1E4XH 4OGXL 3TBSA 1YEEL 2FJGB 4U31A 1FVCB 3VGEA 3N1GC 1V7MH 1WLHA 4XNXH 3UTPD 3OPZH 3MRNB 1BVKB 4LSVH 3KYKH 5EN2B 1MHCB 4I48A 5E56A 2XACC 1V3MA 4HULB 4PJCB 3H0TA 2IQ9H 3CDGB 3HB3D 2LE9A 4JG0L 2JB6A 3FN0L 5JOPE 5DZNA 2L7UA 1NBVL 2F8XC 4ONFL 1QRNA 3AY4C 5D7SL 4LLDB 1ES0B 5DWUL 1CBVH 5I8CB 4LQFH 5CINL 4LCUA 1A6VL 4M00A 2BC4B 3BPNC 2C3HA 4ERSH 1Q72L 3CVHH 3HG1D 4HEME 3S34H 3RFZC 3F62A 2RB8A 3GSNH 1BZ9B 3ESVF 3MJ9H 5EUKA 2NY1B 5C07E 4RBPK 5L2KB 5IBUB 2YS4A 1JNJA 1X7QB 1FFPA 5BRZA 2NLJA 3ARFD 3SPVA 4V2CB 1Q0YL 3NACL 3IDMB 1MJUL 4P5MB 4PRHA 5DJ0A 1UH3A 5GS3A 1MLBA 3VXUD 2R0KH 4IMLB 3NIFE 1AGEB 4FFYL 3U0TA 4RGOL 2FATL 1PZ5B 1AQDB 2IAMD 2FIKA 5DHXB 4L4VE 5JMOC 1TITA 4MVBC 4GXVH 4NM8L 1EO5A 2AK1L 1C5DA 1S9WA 2M26A 5C8JB 5JPMA 2EDKA 1LEKA 3QUZC 4YXKL 4Z7WB 4HKZB 5F97E 4EOWL 1WFUA 3CFEB 1RZJL 4X8XA 3HFML 3J8F7 1G7JB 3CSGA 1FIEA 2Y7QA 2GJZA 4GBXA 2O61A 2Y5TA 4PRBA 1FH5L 1LK2B 1ZT4B 1E6JL 4W6WB 3X3GL 4L8CA 5IP4A 5DZLA 1LO2L 1AGBA 3K4AA 4QHMB 4JY6B 5HBBA 5D2LF 2YPKA 4NQCB 4ZO7A 5E2UH 4PLOB 1DQDH 3EBAA 3ZDXF 4QRSA 2JB5L 2DKMA 1NMCB 1BAFH 2ADFL 2A6KA 2VERN 5TPWL 4WDIA 5DFTA 4M3JA 2WUCL 5CILL 1I9RH 1N5YL 2ORBL 4FZEH 3OWEA 5BQ7A 4Y5VB 2AKRB 1MWAL 3THML 1QSFE 4FZ8L 5T3ZE 1IKFL 5BV7B 4TOYH 3VWJC 1MPAL 4P5TD 1HHHB 4FFVD 4K3JH 1I7TA 3ULVF 1NMBH 5LWYL 1CL7I 1I1AD 4F33B 1S7QB 2FH8A 1JK8B 5FUOH 2ZJSL 5MI0C 4RGND 5EU4B 2FBOJ 4LLWA 1G7MB 3HRPA 5T5FH 4U1HB 1SMOA 3GJFK 1I75A 2BVUA 5HXMA 5E03A 1FBIL 4X6CA 2OJZL 3GMOA 1NAKL 3L3JA 4HDIB 5CZKA 3PWPE 1DQML 1IC4H 3REVA 1BM3H 1U3ZA 1UVQB 3RIFF 3GMNA 1Z0NA 1PKQE 1EEZA 1FZOB 4PJBB 1EXUB 2DQTL 4Y4FA 5C0IA 1KCSH 3SDCA 4H20L 4B41A 1KPUB 4FMKA 5DMGD 3QUML 1GIGH 5HHOE 4F7CB 2WINA 1A7QL 5E08H 4XCCL 1HI6A 1P4IL 4KVNH 3L9RA 4Y2DA 1ETZB 1J88A 2ZCKL 5HDLA 4XX1E 5F88B 4G5ZH 2CMRH 2JJTA 1MFBL 3EHBC 4Y2DC 3R0MA 5BS0D 1F8TH 1S7SA 3BQUD 3X13B 3JV4B 2JJTC 3SKOB 2ZUVA 2QHLA 4OLVL 3VDCA 3TT1H 4YIQA 3HR6A 5I1KH 3DIFA 4WI9A 1JWMA 3O2WL 4QTIH 4YHPA 3TWCL 2DIBA 4GS7B 5JW5A 4OF3A 2BOCB 1AD9A 2VDNH 2OMBA 3B9DA 3OF6D 3U1SL 3VJ6B 2EXWD 4HQQH 3HR5B 4KKCC 1IL1B 4RAUB 4HHAB 3C6LC 4M8QA 2VKWA 4UIMA 3OG6B 2F74B 3V5DA 4FG6C 5DD0L 4JM2D 1XGRA 3FB8B 5CJQL 4Z0BH 2IQAB 4GKOA 1RJYB 4UDTA 3MX0A 1G9NH 3W0WA 1QHPA 2V2WA 1AKJB 4JVPA 1AIFB 1EUTA 2EE6A 1NCTA 5HHNA 4MAYC 1AGCA 4G6ML 4GMSL 4NRXB 5GS1B 4GAFB 4H88L 3VDAA 3CVIL 4D3CL 1JZ8A 3UTSA 3PUCA 3ROLB 2YD7A 1CGSL 2VE6B 4FMFA 4JHWL 2PR4H 5KAQF 3LEXB 5I1LA 1FYTB 1BBJA 3IJHB 3O6FC 3T2NH 2W9EH 3V5KB 4DAGH 1KJVA 3WKMH 1NBZB 1RUAL 5IW6A 1FNGA 3RVUD 4U3XA 4UI2A 2BFVH 4RWHA 32C2B 1YNLL 1W0VB 5IMKB 5I15L 5KVGL 4Y16A 35C8H 4OD3L 3EO1A 4MA1C 4ODVL 5GIRA 4QEGA 1WZKA 1M6OA 4Y16C 1M05A 4ZPTB 4W81A 1FNLA 1QYGL 3HRZB 2PW1B 1JHTA 1MIML 3HLAB 1UKQA 5FO8B 5DYOB 3ULVC 4XWGL 1RHHA 3HC4L 5C0ND 4OFYA 5HJ3B 4G6FD 4JG0H 2WP3T 4OZHB 2CLVA 4HWBH 1NBVH 2XTLA 3FO2A 4XHQA 4GKSB 5D7SH 3D5OF 2ZG3A 5DWUH 4LKCA 1LO0H 5E6ZA 4XRCA 1WVZA 5ESVA 4JREB 3QHZL 1FZJB 4X8JB 3O4OB 1VENA 1ITCA 3GJFA 2R1XB 3LDBB 4PRIE 4OFPA 4MB5A 4NOFA 3KJ4B 5SWSB 3U30C 5C0EB 5ISZA 4PJEE 5C9JB 1AO7D 1GZQB 1TQBB 1FSKB 3S37X 5IW1A 3TIEB 4FQCL 3RZCB 4I18B 2J88L 2GCYB 2DLFL 3GMMA 1MJUH 2UVFA 4M48L 2ATPA 3CH1B 4AIXA 2R2HB 1CR9L 5JQHC 1X5YA 5FDYA 3LRHA 4HK3J 3RWGA 2DMKA 4WI4A 1MH5B 3LV3B 2FATH 5HYJB 1MY5A 3T0EE 5EU5B 3IF1A 4JZOA 5GXBB 5CP3H 1DANT 4JGMA 1U8HA 3V4UH 4I8DA 3I6KA 4NNYB 4NM8H 3BIKA 3QDHA 3LKPB 1FL6B 3UTOA 2PYFA 1ZKAA 2XFXA 1DN2A 5T1LA 1S7WA 1EBAA 1TFHA 3BISA 4N68A 4PBVC 1MJJA 4IJ3B 2ARJQ 4YXKH 4H5SB 5H94B 1NC4B 1SEBB 4OZFA 5EBMB 1FO0A 1RZJH 2CKBB 3OZ9L 2GJ6B 1RY7B 3P3YA 5DMKA 2MWCA 1FH5H 4PLNC 4JZJC 5DO2D 5CS7A 4BH7A 5I1JL 2ZUTA 3KPSD 2BERA 4JRXE 4P2QD 1S3KH 3VD5A 3QDJE 2GSIA 4HS6A 3MLTB 3VW3H 2CIIA 2O93L 4XP4L 3FN3A 5EBWA 4X9FA 1IC1A 2BNRD 4F7EA 2A6JB 4BA8A 3QJFB 3GNML 2JB5H 1EA9C 1CGYA 3LEYH 3RPIB 4KGLA 4Y5XB 1SEQL 1LWRA 3PHOA 4XPTL 2DM7A 5TPWH 4JFHE 2VXUL 3BGMB 3DTXB 4MWFB 4M1GL 3IU3B 1CK0L 4MA3A 3MRJA 1RZFL 2OTWA 4ZFOA 3IDYB 4XHJD 4YO0A 3C08H 3MOBH 3THMH 2OK0L 3QFJB 4FZ8H 4WHCA 1IKFH 5C6WH 1MPAH 1NAMB 1T7VA 1P2CA 2NY5C 4MNGB 1U8KB 5IVNA 1JYNA 3BEVB 1WISA 3FOMB 3UTTA 4EQ3A 2C1PA 5AD0A 4ENEC 1FYHB 2ZJSH 5FYJD 4UTAH 4DGIH 3TO2B 5IMLB 3MLWL 5DURD 4XAWH 3MV7A 4X80H 2DD8L 2X4PA 3BZ4B 3FCTB 3GSVA 3TZVD 1PG7H 2CLRA 2I60H 5IBTL 4OCRH 1ZXQA 1GOGA 2EIEA 1NAKH 4LRIA 3KPNB 1UYWH 2MKWA 5HD8D 3F7VA 5L88L 1DQMH 4X6BA 1TZHA 3MNWB 4LRIC 5SX4I 5BZWA 4KRPB 1Q94A 4M6OL 4YDKL 2FGWL 5FECB 3BD4A 2ZUUA 4JFOB 3RTQC 2EYRA 4R8WL 3IKCA 4JFEB 3JBG7 4B7IA 1WZMA 4G43B 2B4CH 4H20H 4WTXA 2XZCL 3JTTA 3QHTC 1AD0B 4X5XA 3QUMH 4NQVB 5ETUB 5IMOB 2FEEL 5GS2H 4X4ME 3EGSB 1S8DB 1P4IH 1VFBB 1K3IA 1R3HA 2ZCKH 2XNAB 3CFKB 4KUCD 5C2UB 4BH8A 1MFBH 5GGVL 4RFEB 1FNEA 5I6XB 2Z35A 5DDHB 2EO9A 3HZMA 4NN6C 4NWUH 3TVMD 5IB5A 4Z7QE 2DQJL 4OTXL 4L3ED 4Y4KD 4R4FL 1TJIH 1RZGB 1WFOA 3TWCH 4K94L 4PLJD 1ZT1A 1JGUL 2H32A 2FSEB 1RK0A 2R2EA 4H25A 2H6PB 3NIGE 2PYED 2I9TB 4JM2B 1BIIA 4UT7L 1OARL 2IPTL 3MRQA 4HMDA 5A2IH 1R5WB 1QLFB 3IDJA 1BBDH 1KEGL 3ZO0A 5JORA 3MRHA 3WIIH 4YC2B 2R4SL 1HXMA 1RIHH 5EBGA 4QOKD 1A4KA 5CJQH 1I7ZA 1DVFB 4P9MH 2WZPD 2BMKA 4WW2F 3TJHC 1ED3B 5IHBA 3BIAX 1ZLVK 3VXOB 4WHDA 4FQIH 4E9LA 4GMSH 1JI1A 3NCFB 3O41B 1OB1B 4D3CH 3DX8B 1BJ1H 2ENYA 2HG5B 1J1PL 4JHWH 4O2CB 1MAJA 3LD8C 3GMQA 5BRZE 3LS5L 1RUMH 2X6MA 1MHHA 4NQDA 3O3DB 4XZUB 1QNZL 1XEDA 3OB8A 4M02A 1N64H 4PRHE 3T08A 2I27N 5F7NC 4LOUC 1OF2B 3GSOA 1C1EL 4NC1C 5DD5L 3P2TA 1QUNA 1NANH 5JXAH 1S9VA 3ZTJH 4L8DB 1BFSA 4ODVH 4OD3H 5TDPB 1FG2A 3ZLQC 3PE9A 4XPFL 2A73B 3U9PH 4A6YB 1NC2A 4YNYB 4Y5YB 5KZCB 3L3KB 2XICA 3WNKA 4AEFA 1QYGH 3MRLB 2Q87A 3UPRB 1MIMH 1KFAL 3ARFC 2IJ0C 4U6YB 1KCRL 4WTZA 3DUUB 4PYGA 1X5IA 3GEWB 4DN4L 5J1TC 1NDMB 1QHOA 3TBWA 3P73B 1KB5L 2CGRL 5ERWA 5JTWA 3M1BA 4C83B 3S4SA 1EZVY 1KACB 2YD3A 3PGCA 3U4BL 43C9B 5IM7A 2IAMC 4N8VA 5ADPH 4NDMA 4YBQD 3VI3F 3MBXL 4DZBA 2YZ8A 4L29A 4GLRH 1F4YH 4PREB 3F6IA 4AENB 4LEOA 1YY9C 1A9BB 3K1KC 3FFDA 3WO4C 4IOFD 3DX7A 4G80B 4H1LG 5E9DD 4LNRA 4N0CC 2ITDB 4QNPF 5J06A 2WBWB 1J8HA 4XMPH 5IFJB 3JVGA 3O11A 4PLKD 1SVCP 3GMLB 1MLCA 3RWEB 1L0QA 2DLFH 3JVGC 2P47B 1CR9H 3IJSA 2DDQL 5IBLD 1OWRM 3ULSB 4GQ9L 4GUPB 5LKNA 3QNXA 3BUYB 3PNWB 1QSEA 3G5ZA 3LS4H 4N0YL 4NSKB 1BLNA 4HUVA 1GOFA 4X0KB 4MXQD 2VLLB 5D7LB 5SX5K 2XYCA 1LO4L 2A9NH 4LIQH 3RQ3A 4YHMH 3BVNA 2NW2B 3MRDA 2A83A 1S7XA 3N1QC 2VABA 1NEZG 3DI3B 2CRYA 1BOGB 5HI4D 4NZRH 1SM3L 3TT3L 3W11D 1GGBH 1XH3A 2BNRB 5KSBB 1EEYB 2DIAA 4X6CE 3F8UB 3WIFA 4IRSD 2X1QA 5JQ6L 5KSUB 2C1OB 2WAHA 3MLZH 3PWJA 5GJSL 4WW2C 1YUHA 2GTWB 4P2YA 1NJ9A 1OTSD 4D0BA 1S9YB 2XKSA 3DX6B 1P9MA 1RUKH 4XPTH 5FYLE 4P57A 1I3VA 1IBGL 1BQHB 4RDQF 4UIKL 2GAZB 4GG6B 5D2NB 1B0WA 1IC5L 2VXUH 3GBML 3GSQB 4M1GH 3ZT7A 5ITBH 4EN3D 3OKLA 4YDJA 4F58L 4PV8B 1G6RB 2PCPA 1OWWA 5FAAA 5E6YA 5GGTA 4JKKA 5FB8B 4N0RA 5D1QD 5SWQB 5EZLB 2Z31B 4Y19B 3H42H 2VDKL 2N56A 3W2DH 3QEGH 5FKAA 1I1FB 3CDCA 3B5GA 1GSMA 2H8PB 5I1DA 2DYPD 3KNBB 3TYGL 3I50L 3MZTA 4NO3A 1W72H 2BVPB 4I3RL 1TQCB 4KDTA 2VDMH 3KGRA 5MEQA 4D2NA 3GM0A 4FRWA 2AEPL 2ICEB 3EDJA 4LQ1A 3RX5A 4PY7B 3QIBD 4BZ1L 3EO0A 3REWA 1IZKA 1UXWB 4M6NL 1A14L 5GS0H 1M7DB 5LCVL 5D9SB 3RHWK 3W0WE 1IGTA 1I9IL 4HIHA 4NKOB 1EFXB 2ARWA 1TDQA 5IF0B 3U4EA 1BQLH 2B2XL 2OJEA 2P8LA 3MREA 4PRDA 3F7RA 3BE1L 3LB6D 3UTSE 2IFFL 3ZDXE 1MAMH 2EKJA 2FLRT 4HIJB 3IAQA 1B3JA 3OHXA 1SJHB 2HT4D 3MTRA 4NC0B 1H15B 3VG9C 1T22B 3VFGL 5ILTL 1L9MA 5E2VH 5CAYB 5GGVH 4Z78A 5DD6B 5I73C 5EO1B 3OAZK 5EIIA 3NZHL 4K8RL 4MA7L 4QHLB 5EOTB 1HNGA 2DQJH 4OTXH 4QRQA 3D3VB 1VFUA 1MRCH 5D6CA 3OGCB 1AGFB 1MCHA 4YWGL 4P2OA 3W82A 5EORL 2XOTA 4DZ8A 1XGYL 3RGHA 1JGUH 1AXTL 3MV9A 4EUPB 4P2OC 3V0WH 3UYOD 1RZ7L 2J5LB 1MNUH 4EI5D 1QBMH 1VFAB 2BSSB 5DRNB 1XF2A 2B1HL 4ZO6A 1TPXB 2IPTH 1WC7A 5L6YL 3QH3B 4EKXA 3IB4A 5TDOA 4PBWD 1KEGH 3EYOB 3RVUC 1IILE 1SYVB 3MODL 1A0QL 1YJDC 4Y88A 1FDLL 1A2YB 4MD0A 4HJGA 3HAEH 3RVXD 1F3JA 1AE6L 1G7HA 1LEGB 5INCA 2KL6A 4RFOL 4V1DB 2DQGL 2HTKD 2IPUK 2YD9A 4XXDA 2C4XA 2VQTA 3MRIA 2IBZY 2A74B 4XNMA 2R69L 3A6BL 1I8KA 3MYJA 1T2JA 4U1SA 3MXVL 3PWVB 5ISZE 2YK1L 3OKDB 4NM4H 3KPQA 2EYSA 1NANI 2H9GB 5F89A 1WBZB 1QNZH 2SEBA 2VZ1A 1DR9A 3EJZC 4JKWA 4YUEH 1RZKC 1SYSA 5CMAB 2NXYD 1C1EH 5DD5H 3KLAA 3OXRB 4URTB 1R5VA 4P2RA 3UC0L 1QVOA 5BJTB 1E28B 3CMOH 1YEGL 5SV3A 3IJYA 4TUOB 1KCRH 5DJ2A 2XIDA 3KXFD 5EH1A 5L8LB 3ECBA 4QHUB 3T4AB 5CZVL 4O4YH 1EHNA 1A6PA 3I84A 3B2VH 1KB5H 2AJ3A 2JCCB 3G9AB 4PIRF 3WUWB 5D96B 4Z7VF 2Z8SA 4EDWL 3EYFA 1LQSR 3S98A 2Y6SC 3HI1B 4BSWA 1HSAA 1S7RB 4TTDD 1NMAL 4MQ7B 4UV7H 2YPLB 1KXQE 3MLXL 1JI2A 3QZWG 5FYKE 3SO3C 3VGFA 3FB6B 1MCJA 6CGTA 4JPKH 3O2VL 5F3HB 3VH8A 3V79C 4Y4HD 2PO6D 3LKQA 4UQ3B 1C5CL 5F93C 2F5AH 3I3EA 4RMUA 3EYUL 3VCLA 4EJ1C 3INUL 1T7WA 5KOVC 2DN7A 3U46A 5FYJU 1I8MA 1F11A 1HN1A 2X70B 1H3GA 4GRWB 2DDQH 2ITCA 3HMWH 2YSSB 1KCKA 5DJCA 5IB4A 4M1CD 2PXYB 5E8NB 3S36X 3QUYD 1IEAA 1ZS8B 3NAAL 4N0YH 4MMZC 4EEEA 4APQA 3S35H 3P0VL 2GK2A 4PY8J 2MJWA 3JWDL 4WJ5A 5DC9B 2YPVL 3L3GB 4MXWH 2OL3B 4KV5E 2NY0D 2V7HB 2YN5A 4QRPD 2VAAB 4XI5D 1MFEL 3UTTE 4R97C 3KPPB 5E00B 1LO4H 3IVKA 4JLRA 2YWYA 1PKOA 4L4TA 3MV7E 5C07B 4Y7MA 5LGJA 3BSZL 1HKLL 5J89A 3TT3H 4JY5L 4UTBL 4PJIF 2ZOLA 2IADB 1D9KA 1HXYB 5JW4Q 3U9UA 2XT1B 3L3IA 1Q9LA 4XVUD 5CUSH 3MRCB 4P3DA 4GKNA 3IAPA 1VPOL 3TNNB 5GJSH 2G9HB 2Z8VC 3TH2T 4YHZL 4LVNC 4NQEB 2P8MA 4PJHB 4QWWC 5IKCB 1IKNA 1MCEA 2P42B 3OJVC 1YEHL 3DO7B 3RGVA 5ACLA 1IKNC 4UIKH 1DN0A 4LL9A 2MPAL 5EUOB 5A1AA 5B38G 4BZYA 4LPWA 3RGVC 1DE4A 1KYOK 2O5XL 3OQ3B 5HHPB 4F58H 4P46D 4WCYL 3VG0H 3Q0HA 1P7QB 5IOPB 1CI5A 3ES6A 3DUSB 3HE7D 3QNYB 3WFEL 4JY4B 1T7XA 4MB3A 1A3QA 3QHFL 4R90L 5E8DH 2WW8A 4OLUH 5C6TL 2OX5A 1XIWD 3TBTA 1WBXA 4P9HH 1CICA 5IHZB 3FT3B 3BZFB 3OJ2C 1A7PL 2HFFA 2J8UB 4PR5B 1HIMH 5DHVB 3TYGH 1QSVA 4JFXA 2ZG1A 2UZXB 3DMMD 4ZUUB 3EOAA 3QRFM 4XP5L 1A3LL 4OQTA 2AEPH 3Q48A 3H9SD 3QQ9D 1MUJB 1NCWL 3ZHKA 2IC2A 4M6NH 2AK4A 5LCVH 4K71B 4M6MH 2APFA 1JYVA 4KRNA 1RZIA 4XMKL 4LARH 2EECA 1ZT7B 3IXAA 4OIBA 1IGCL 4NJAL 4DEPC 3B3IB 4ZXBA 3DSNA 3QQ3B 2GITA 1FFNB 2BXZA 3TESA 1EO8L 1XF1A 4NQDE 5C08A 1L6XA 2D7PA 5CGMA 3NZHH 3TO4A 1JNHA 4I77L 5DJXB 3ARED 5CEZL 4XH2B 5J11C 1EAPB 3BPLC 4TN9A 4WEBL 2JKXA 2V9QA 3CCHA 4PGBA 5EORH 1KXTB 1XGYH 4WUUE 2AEQL 3D25A 5I2IA 3I75B 3LQMA 3DLQR 2NYYD 2CIKA 2RCSH 3PWPB 5E4EB 2QTEA 3ZYZA 5HYQA 3TPKA 2I9LB 4M7LH 1IM3B 1X9QA 1H3XA 2X4RB 4K3EL 3F6LA 2V17L 3I9GL 1A0QH 2Q3ZA 25C8L 4RIRB 4WO4B 1AE6H 2R23B 4PJIA 4ZNEA 5JOFB 4RFOH 4LLUA 2DQGH 4EI6B 4F15B 2VRAA 5FA3B 4X99A 1L6ZA 4PS4L 3H7BB 3S6CA 1WWAX 1UWGL 3VXSA 3B2UC 4M43L 2ED8A 3QIUA 3AS2A 5JUEL 4MNHA 3VXRA 3GHEH 3UMTA 4WU7A 1OAKH 2YK1H 3R06A 3QIUC 4WVRA 3MLRL 1BFTA 3NN8B 1WT5A 1JN6B 4G9DB 2BNQA 3RUGF 2R15A 4GAJL 1N2RB 4YBQC 5L0QC 3RZWA 2GHWB 3UC0H 2DWDA 5I8EB 5D1XD 2C4FT 1QSEE 4IOSD 1YEGH 5CCKL 1H0DB 3D0LB 3W5NA 1MCCA 5ACZB 1XGQB 3EDFA 2B7DT 4KK5D 4MJIA 4YZFF 3QEHB 3KDMB 2AJZB 3C6SB 4L5FL 4JFDD 5LAXB 4U4BA 1EERB 4WV1B 1F00I 3O0RH 2IBGA 3OGOE 1FNSL 4PG9B 2LU3A 4N0UE 3AU1A 3CZFB 4Y4HB 2IH3A 1T1XB 1JNNH 1JV5B 2YUVA 4NFBA 3B5TA 2R1WB 1YNTB 1F5WA 3O2VH 3QQNA 3ULUE 1W0WB 3QUKB 1GHFL 5HVHC 1T0NA 4WEUD 1D5ZA 5DF0A 1U3JA 1HHKB 3SDDB 1KN4H 3L7FB 3EYUH 4F9LA 2KUTA 2YRZA 1U8IA 4RAVA 3KR3L 5HDQL 3SE8H 3EW3B 4KFZC 4MNQD 4UT6L 1CDIA 2RR3A 1NH6A 1EPFA 3TYFB 2X9YA 4QRTA 2AP2A 1ZWIA 5CSGA 4JM4L 3FQNB 3KPRD 4IRSC 4PJCF 2X2YA 4OUUB 3NAAH 4R7DA 1N7ML 3WDHA 4AEHL 2BVQB 2HT2D 2VR9A 1TVHA 3JWDH 4IRJA 4G3YL 1LE5B 1M1SA 5FHBL 3VRLF 3FFCB 3MUHL 3GMRA 2CJUH 1D5IL 2FGZA 4PRIB 4IDJH 2CR6A 3MLYL 3LN4B 1HHGB 1UQSB 3BSZH 4R3SB 1B90A 5GRJL 2JK5B 3LN5A 5FKPB 5HHQA 5D1QC 3MQIA 3AMKA 3G08B 3BRDA 1BPVA 1ADQL 3MRRA 2UUDK 4UILL 5C1MB 1M71A 1QSZA 3B4NA 4AZ8A 3FHQA 1IAOA 3VI3E 3MJ8A 5F9AC 1F3DH 4YHZH 2V5MA 5HYEA 3EOBA 7FABL 4U33A 1U3YA 4ELMB 1PAMA 1YEHH 2AV7B 3G6DL 1KTLA 4WFHD 3O4LD 3NTCH 3C2AL 3M8OL 4G7YH 2MPAH 4UQ2A 4LVOC 4Y1AB 4XBGB 3ULVL 3G5VA 3KHQA 5DA4A 1A6AA 5CGYD 2O5XH 3PXJA 4XMLL 5FUZL 1DLFH 3RUGA 3PIQB 1L7TH 5ICZB 1KG0B 2R29H 4WI7A 5E2TL 4Z7WF 5DI8A 5F6IB 3WIHA 3DV4A 4QF1A 4R7NB 5HGDB 5FEBA 1I8IA 3WFEH 1CDBA 1B9ZA 2BP3A 2ICWI 3I6LD 3ME0A 3LKRA 3QCUL 4F2MA 5A2LH 3C5SA 5AG8A 5GZNC 5C6TH 5TQ0L 3FB7A 3L7EA 4PJAB 2NTFA 2NX5A 3QA3A 4HC1A 2WIIB 1A7PH 1T80A 4QCIB 3MV9E 3NFNA 3A6OA 3EJYC 3QDJB 4UBDD 4ETQB 4M8VA 4XC3L 2UY6A 2Q86A 5MEOA 4C59B 1INQA 1A3LH 2XWJB 5F9WC 3BKJH 4O2EA 5E8PB 4PJ7B 2WBJC 1URLA 3CU7A 3RVVC 4QKXB 1NCWH 1D6EA 1T3FA 2XZQH 4ONGL 2LTQB 1I7UA 4L3AA 1OW0A 1X5JA 4JAMA 5E5MB 4LRNH 2UWEB 1VEPA 1FLRL 3KYNB 4Z8FL 2FRGP 2V9RA 1OW0C 3GI9L 3OKNA 4M93C 4FTVA 2JIXB 1IGCH 4NJAH 3LRGA 1UA6H 1XZ0A 2FD6H 2EC9U 1U3HD 1NBYA 5DQJB 5M95B 2FJGA 4HMEA 1FVCA 3V7AG 1G9EA 1EO8H 3ZKND 4ZS6C 1BVKA 2EIBA 1HILB 1UWXK 5KVMC 2IAND 1MHCA 2GSGB 2Z91B 3EO9L 3RU8L 5H2BB 4PJCA 1OTUD 2X1WL 3CDGA 2CQVA 1CE1L 4P2RE 4WEBH 1V3KA 4NFDA 4G7VL 5F9OL 1BVLB 1ES0A 1XAUA 4XPHH 2BVOB 5I8CA 4NOBA 4GQPH 3SOBH 2BC4A 4OZIB 3UJTL 1B0GB 3D39E 3NVQA 1JPSL 4K3EH 4PJBF 4LLMB 3MCLL 2V17H 2VLRE 4FHBD 4ZUVB 5L2KA 3I9GH 1DBAH 3OX8B 5D1ZD 2AXHA 1X7QA 1CFVL 1IAIL 2MQ3A 4KJQC 5A3IC 5F1KC 3UP1A 5J1AB 2NY1C 2YD8A 3T04D 2V9TA 2E5EA 1A64A 1N8ZA 3IDMA 3RX7A 4TUKL 4JB9L 5BOPA 1OGAD 1A1OB 4M43H 3EFFB 5I74B 4IMLA 1J87A 1AGEA 2BOBB 4LCWD 5JUEH 1LHZA 5I1EL 2NY5L 1S9XB 3HE6B 4QHNB 1T03L 3MV8D 1O7VA 3TBVB 3SQOH 3V9FA 1OCWL 4IIQB 3VD3A 3SJVB 2RAMA 5JNYB 2OR7A 2YD4A 2D31B 4GAJH 4KI5D 1JGLL 5C8JA 4KKAD 4Z7WA 2OTUA 4HKZA 2VAJA 3FOLB 4LU5H 3CFEA 5C09D 4PJ5B 5JHDD 1G7JA 4CN6A 1YEJL 3STBA 1X5AA 3UPCA 4NNPL 2VDQL 5FGCE 2QQKH 1LK2A 1ZT4A 3QUXD 4KXZH 4L5FH 2GIYA 2ZNXA 3K2UH 4OI8A 4KAQL 4QHMA 2QV2A 3MGAA 1T5XB 5GS2D 3ZKMC 2ZWLT 4Z95L 3RKDC 5JZ7C 2XN9E 1FNSH 1J0JA 1FL3B 2HP4A 4L4TE 4AIZB 4U2ZA 2RJMA 1J18A 4KK6C 5EUKB 3HNVH 2HLFD 2VC2L 5DGQA 2EDTA 2YD2A 3VXMD 1EMTL 1FPTL 3SPVB 1RUQH 5E1AA 2BY0A 1HSBB 5C7XL 1JRHL 1GHFH 3H3PH 4OD1L 1EX0A 1ERNA 2AKRA 2DQDL 1BD2D 1CFSB 3BIBX 2J2ZA 4X5LA 3DECA 1QLRB 2FIKB 4P3CL 1MJ8H 3E6FB 4Y5VC 3RVWC 1HHHA 3S97C 2XTJD 4KHXH 1V7NL 3O9WD 1P7KB 1TTGA 1JK8A 4W70A 1EHLL 5F9JB 3ALWA 1A6TB 1FE8L 3MACL 5F1SA 5JIPA 1ULVA 5EOQL 5KSVB 5EU4A 4OZHF 4AEHH 1G7MA 4HWEL 2E7LC 5HHVH 4JN2B 4U1HA 3QI9D 4U6VH 1S7UB 5F96L 4Z7OF 4G3YH 5FHBH 1KT2B 5L7XL 1N0XL 4GBXB 4JN1H 4PJGE 4KROB 4HDIA 2Y06L 3V95A 1IGFL 2J6EA 3G9VA 2WWMD 5C0CD 4WFFD 1UVQA 3V5HB 3MLYH 1KLGB 1FZOA 4PJBA 5GRJH 1EXUA 1NCCH 1CIUA 2YPKB 1KPUA 1U6AH 4IS6B 3ARQA 4F7CA 1NGWB 2OR8A 4ZAKD 1UKSA 2AK4E 1XIWC 4DGYL 1ETZA 7FABH 2OZ4L 5F88A 3BX7C 2DQIH 2WV3A 3QPQD 3X13A 1QPPA 3JV4A 4LHUG 5D7JA 2NNAB 3FMGL 3M8OH 3SKOA 2EXYC 3GBLA 3ULVH 2R0WH 1Q38A 4XMLH 2ICCA 1N6VA 4UU9B 2BOCA 3P4OB 4WWKD 4ORGB 5C08E 2VKXA 4JG1L 4GS7C 4U1LB 4HIXL 4AEIH 2BCKB 3HR5A 1UM6L 2F58H 4GSDH 1BFOB 1UEYA 4RAUA 4JHAL 3PL6D 2G5BB 5IGXL 2X9WA 2F74A 2P5WD 3QBTB 3S9DB 3GJFH 3FB8A 2Q6WB 2IQAA 1RJYA 1CFNB 1UT9A 4XVSL 3VD9A 5JDJA 1AKJA 1KTDB 4XC3H 1AIFA 4NCC1 3IS0X 5ICXA 4NRXA 3ARXA 3REVB 2I26N 1CGTA 1F58L 3ROLA 5MP6L 5GS1C 2H1PH 2VE6A 2VLJB 2GY7B 5IROC 6FABH 1FGNH 4FS0A 3LEXA 5DC4B 1FYTA 3VFWB 4PJIE 3IJHA 4ZNEE 4OCMC 5E70A 3V5KA 1U8PB 3C2SA 2F5BL 4XVTL 4EBQL 1NBZA 4K3DH 1HI6B 1A5FL 4Z8FH 1UJTA 3GI9H 2A38A 5HVWA 3VXSE 32C2A 1JYXA 2FZ3A 1W0VA 3VXRE 5I16A 5IMKA 1QFWM 5CWSB 5ECJE 4ZSOB 4ZPTA 5C0DA 4AIOA 3HRZA 2PW1A 3GUTB 1IQWH 2BNQE 4P23C 5FO8A 5B39G 4OZFH 3EO9H 3ARBD 3BUTA 1FO0H 5I8KH 5DYOA 5JW5B 5I19H 4AQOA 3WS6C 3S7GA 5F71A 4OLYH 4GKSA 5L8KB 5F9OH 5FYKH 2C3WA 4JO4H 4YFLI 4EXPX 2BZDA 1CWVA 1F4WL 1D3CA 1FZJA 2VSDA 4U1NB 4X8JA 1Z3GL 4MJIE 4FQQB 1KGCD 2R1XA 1MWAB 4JREC 1JPSH 5J3HD 3MCLH 3O4OC 5C0EA 3FKUS 5C9JA 3LDBC 5HHNB 4OZGB 1AGCB 1CFVH 1GZQA 1UCBH 4BUGA 3TIEA 2H26A 4HGMA 2HTLC 3RZCA 2R4RL 3MLSL 4I18A 1TQBC 1FSKC 2GCYA 1KXVC 4H1LB 4TUKH 5T1KD 3RZCC 3CH1A 4FQXB 2R2HA 3N9GH 4I18C 4JO2H 1IGIL 2EDEA 1IRAY 2J4WL 1WF5A 4KK5C 1MH5A 2IALB 4XBEL 2ZUQB 1FNGB 3SGEH 1OCWH 1JTOA 4MJ6B 5J12B 4NNYA 4DKEH 3DXAB 2JJSA 1VACA 3LKPA 1FL6A 4N8CL 4FN0A 4S0SD 1QO3A 4ZFZB 2AJSL 3HNTL 1M6OB 2JJSC 1BIHA 5SWZD 3HKFA 1ZGLP 3HI5L 5E99H 4H5SA 5H94A 4QTHB 1NC4A 3CUPB 4G9FD 5GS0D 4HX1A 1MCIA 3DGCR 5EBMA 3LOWA 4P4KB 2QQLL 2VISB 4HG4J 2CKBA 2DICA 2GJ6A 2CLVB 1HEZB 3V6OC 2Y72A 1FFRA 2DQUH 5AYUL 4LPCA 5ESVB 1NEZB 3MLTA 5DD3H 4Q9BA 4XCYB 4Z95H 3CK0H 4N0FB 1IVLA 2FX7L 2A6JA 1IEBB 3QJFA 1R3LB 3QO1B 2HMIC 2WK2A 3PDOB 4Y5XA 1JPTH 5JOPD 4NRYB 1CVRA 3KJ6L 1FPTH 2HT2C 4Y5XC 1XR9A 5GGRA 3I2CH 3BGMA 3DTXA 4L8BB 3RI5K 1JGVL 4MWFA 3IU3A 5F3BA 1FVDB 3B9KB 3HC3H 2DQDH 1A3RL 4WFGE 3VXPB 3LPGA 3RI5F 1NQBA 3QFJA 1CXIA 4P3CH 3IDYC 3RNQB 1NAMA 4U1JA 3VFSB 3BJ91 2H32H 2XA8L 4MNGA 4POZC 1U8KA 3I6KB 3QI9B 3BEVA 3U7YL 3FOMA 2N7BA 4X7SH 3K1DA 3U4AA 1K8DB 3W39B 1LK3L 1FE8H 1YJDL 3MBEB 5T1LB 3TO2A 3P4MB 3RUGE 5IMLA 3BZ4A 3ARPA 3FCTA 5C0CB 3CFBB 4L4VD 3ZE0F 5LGKA 4X6EB 3D9AL 1ZEAH 2MCPL 1W8NA 5C2BL 2NXZB 2YOCA 1GZPB 3KPNA 4HPOH 2DI9A 5DMKB 4J3OC 3VMOA 3NH7H 1IGFH 4CBPA 2XZAL 2NX5E 3MNWA 5J8OA 1J5OH 5TF1L 2MOVA 4HIIB 4YZFE 5DD1L 3ILQC 2YRLA 4U1IB 7CGTA 1HYSD 1CXEA 4ZAKB 4BZ2L 4JFEA 5I30L 4G43A 2BJML 1YMHB 5EBWB 3WXVH 5GJTH 4LF3A 1AD0A 1K4DB 1RZKL 4NQVA 1HZHH 5ETUA 5IMOA 2LAAA 1OT2A 4M7ZB 4GW1B 3EGSA 1KCVH 3E1F1 1S8DA 1ZHLB 4ZPVB 4WNQB 1VFBA 3JWNC 4DGYH 1LP9A 1HCVA 1BECA 2P4AB 2XNAA 3CFKA 5C92A 3GI8L 5DDHA 3ZZ1A 2ILLA 4UBDC 4FTVE 3FMGH 3KPOB 1SJXA 1Q0XL 5I6XC 3WJLA 3WS3B 1W8OA 1MRDL 1CYGA 3GJEB 4ODSH 3WJLC 5D93C 1WFTA 3L5IA 2FSEA 1B0RB 2P5WB 2H6PA 2I9TA 1CQYA 1I85C 3BP6B 4JM2A 4WI3A 4Q9RH 5IB1B 2MCG1 2FX8L 4TRPH 4NZJA 1R5WA 1QLFA 4PJCE 1VKXB 1JPST 5DK0B 1QSFD 4RSVA 4QHKI 1MCLA 5KSBF 4HUMB 1A21A 1IC7L 5F7EL 1DVFA 5JHLL 4YC2C 4YHOL 4DVRH 2AJYH 5KJRH 1QBLH 3VRLE 1A6ZB 4LSTH 1NCBL 1ED3A 3VGDA 1DVFC 5K9JL 3VXOA 4X6BB 1MCDA 1MCKA 3BDXA 1X5FA 3ZKNC 3O41A 1OB1A 1Q94B 3DX8A 5MP6H 3DVGB 2HG5A 5L2KE 3JSSA 2VNCA 4M4RA 3QIWB 4O2CA 1CFQB 1RK1B 3CXHK 4OBSA 1X5XA 4GG6F 3U2SB 2ED7A 5JXED 3O3DA 4XZUA 2CK0L 2VMFA 4FFWD 4XVTH 4OFDA 3NIDF 3T8XB 1OF2A 4JPIB 4L8DA 1UCTA 1WIPA 3ARBB 5TDPA 4JCLA 4A6YA 5IB5B 4RX4A 4YNYA 4Y5YA 3D85D 3L3KA 4KK9D 2WWKO 5HHOD 3UPRA 4NHCH 4U6YA 2DIJA 4Y5YC 3DUUA 3S5LG 3T4YA 1QR4A 1S78C 2AGJL 3PQYB 3HUJB 3DRTA 4I0CC 1NDMA 2F53B 3ZT6A 1F02I 3P73A 1MJ7L 4K3HA 5TFSL 3IYLW 3DYOA 4WUKL 4Z7WE 4C83A 5D7IB 4JRWA 1JPFB 2UVEA 3M17B 1MREL 1D5XB 4M5ZH 3LHPL 5INDB 2YUZA 5J6HB 2ERJC 1IAII 5FCUL 5EZJA 3IFNH 1RULH 5IT2L 5FYJL 1F6FB 4PREA 4Z7NF 4AENA 4ALAL 4MD5B 1A9BA 4MQXC 1DFBL 4I2XB 5T1KB 1S7TB 4G80A 2ITDA 2YA1A 5I1GL 5IFJA 5GZOC 1SJVA 3MRGA 3GMLA 4NBXB 3QZWB 4PYHA 4GW5B 3A6CL 3RWEA 2EDQA 2OP4L 5TQ2L 3SGEI 4PB0H 1YEFL 1G7QA 4I3GA 1J0HA 4XXCC 4YGAB 1IGIH 2YEZB 1QRKA 3ULSA 5GGTH 1CIDA 2J4WH 5J1SC 1A1NB 4NQDB 3QUXC 4XBEH 1RMFL 3BUYA 4KK8C 3PNWA 2NQCA 5CBAB 4KKLC 2R1YB 4DUVA 4NSKA 4NT6B 4I0PD 3G5XA 3I6GB 5GGUA 4O9HL 1IEHA 1U93B 3OR6B 4N8CH 4P0DA 4AL8H 2R2BB 4WUUB 4X0KA 1NC2B 3U6RB 4OLEA 1UZ6E 1QG3A 4L3CB 1NUGA 3UPAA 2VDPL 2VLLA 5D7LA 1ORQB 5EIQA 1JZ5A 1A9EB 1VDGA 5T3XL 3LMJH 3IXTB 2NW2A 1ZGLM 4DFIA 1PBYA 4IMKA 5F1NB 2AI0L 3IETB 3WYRA 4JQIL 1BOGA 2ZUYA 3N0PB 4HPYL 2BNRA 1EEYA 2HKHL 4FXKB 1GGTA 1INEH 2QLVB 5KSUA 3K3QA 2C1OA 4PBXA 5FO7B 4BFGA 1CD1A 4Q58C 3N85L 2FX7H 5KSAD 2GTWA 3FFDB 3AB0B 3C09B 4JGUA 4PJBE 1JRHI 1S9YA 3DX6A 1XF5B 4GG8B 1H3VA 1BQHA 3O3EB 2AW2A 4BM7A 5I17B 2GAZA 2CRZA 4GG6A 1T6WA 4JFZH 3V4PH 1J9CT 3GSQA 2X4QB 3BFOA 2EDLA 1T6VN 5D2NC 4PP2B 4PV8A 1G6RA 1A3RH 5B38B 5FB8A 2EKSB 1WFNA 1U8JB 5EZLA 2Z31A 1CDUA 3QNXB 4GRLD 1AJ7L 2B0SL 4XCNA 1I1FA 3EDEA 2Z31C 3O6KL 4X7TB 1IM9D 3OBAA 2H8PA 3GO1L 5EWIL 1X44A 2W59A 1UADC 1YJDH 2BX5A 1BREA 2DQEL 2BVPA 2JCCF 4XGZB 4BQ9A 3T0ED 3H9HB 3UJIL 2MMXA 1OPGH 1LMKA 4PUBL 2ICEA 2MCPH 3F58L 1TQCC 4N0UB 3UTZB 2VZTA 5FDWA 2VZSA 4M7KL 4PY7A 4G6AC 1TJHL 1J1OL 5M7QA 4RCAA 1UXWA 2VLKB 5T33L 3M45A 5JW4M 1M7DA 5TF1H 3TN0B 1BJMA 1N4XH 5D9SA 3D2UD 4QT5B 1OSPL 4NKOA 3FONB 1EFXA 5IF0A 4BYHA 4AEEA 1I8LA 1YDPA 2Y36H 1ITBB 4ZO9A 4HKJB 1I8LC 4GRWF 3TVMA 1U58B 4YJZL 1SJHA 1I1RA 4L3EA 1H15A 4JRXD 4DCQB 1T22A 1KB5B 3GI8H 5DD6A 5CJOH 2FO1A 5EO1A 1KBGH 4F7PA 4QHLA 1Q0XH 4CKVX 2NR6D 3DRQB 1MRDH 3OGCA 1AGFA 1EVUA 2K1MA 1P1ZA 4HG4K 4ODHL 5FKAB 4JFHD 4EUPA 5IB2B 1JTPA 3MNZB 5KVEH 3WEXB 1VFAA 2K3TA 3W81A 3MJ7B 1JP5A 1WICA 2X10A 4J6RH 2B1AL 2KZ1B 2J5LC 3QH3A 4W4NA 3DSFH 4CVUA 3EYOA 1SYVA 4PG2A 1A2YA 5E1HB 1QFUH 1HYRC 1I1YB 1IC7H 2VQUA 5F7EH 4Z7OE 1LEGA 1VGKB 4PG2C 3SKNB 3C87A 1BX2B 1NCBH 3LCYA 5K9JH 4NKIH 4C54A 2XZZA 2A74A 3NFSL 3QR2A 3PWVA 1ZGLB 3K2MC 3OKDA 1PLGH 3Q6FB 3JV6B 4BELD 5EUOF 1FP5A 1VHPA 2H9GA 1T1ZB 1WBZA 2DQHL 2R0LH 3WNPA 2OI9C 3FJTA 3WFHB 1VSCA 1HHIB 4DKFL 3VWKD 5CMAA 2NY4D 3OXRA 1CN4A 5BJTA 4D9RD 1TVBB 1E28A 1QBAA 2M2DA 4K55A 4TUOA 5DSCB 2H2PD 5GGSA 2J8UF 4I5BB 3G04B 4QHUA 3T4AA 4LHJB 3MV9B 5F8RC 1CF8H 3BD5A 5I1CL 4WUKH 2JCCA 5J6GB 1OD7A 3WUWA 4HCRA 1WC7B 4PP1D 2IMNA 3T3ME 4LLAA 3LHPH 5D96C 2GJ6E 3QEQD 1AR1C 1S7RA 2WWKT 3RL2B 2OQJB 4MQ7A 2YPLA 2V2XB 4HEPG 4QXWA 3FB6A 1DFBH 3MRIB 4XTRC 5JOEA 4PJ9B 3RDTB 4UQ3A 5EA0H 1OD9A 2APXA 3A6CH 4U1SB 3QRGL 5KN5B 4MX7B 3SDYL 2NY3B 1I4FB 4KRLB 5K9KB 1QRND 2G2RA 2X70A 2ICWB 4I0PB 4MD4B 2VXVL 4OUOA 2YSSA 2R8SL 1KB9K 2CH8A 4FQJL 3UZEA 4DKDC 5HVFB 2PXYA 5E8NA 1ZS8A 1Z9SA 2PXYC 1KTKE 4O9HH 4QRRD 1QVOB 1CXFA 2Z9TA 3MR9B 3OKKB 5BRZD 1OAXH 2QSVA 2D3VA 2OL3A 1NLDH 1G84A 1DBBL 4PRHD 3KPPA 5E00A 1CXHA 4OQTH 4X4XB 3D39B 3VFTA 1FAKT 3AS0A 1FFQA 5JIHA 5C07A 3QDGB 2AI0H 2VLRB 2ED9A 4MVBD 4FQ1L 1NFDB 4DK3A 5KSAB 2Z92B 3OKYA 4HPYH 2IGFH 4PTTB 3NCEB 1RZ8B 5I0DA 1OLZA 4N5ED 1RIVL 4NQUA 5DJ8B 3BO8B 3MRCA 3ELAT 3TNNA 4UT9L 2G9HA 4NQEA 1KEML 2EDOA 2HYMA 4PJHA 5IKCA 2O5YL 4X9BA 5LGHL 5TE6H 2COQA 3DO7A 1OGTB 4JFEE 5EO9B 3LKQB 4KPHL 3ARDB 1ZANL 1T21B 3OL2A 4ZUSB 5K9OA 5EUOA 5BS0E 5FO9A 1DSFH 4RRPG 4Z7UE 4NPYB 3QULB 5HHPA 1F11B 1P7QA 5CD5C 1LP9E 5IOPA 1BGXH 3QNZB 3VXQB 4F7MB 1B4JH 4FABL 3DUSA 5I18H 3QNYA 1M7XA 4PV9A 4TNVF 1DCLA 4JY4A 1AJ7H 1KJ3H 2D0FA 2B0SH 3O6KH 2YA0A 4APQB 1I3GH 3C9NB 1IFHH 3CNKA 4OT1L 3GO1H 5FGCB 5IESL 3FT3A 1DL7H 3BZFA 4WJ5B 2A1WH 2J8UA 4PR5A 5DHVA 5DR5L 4MLSA 3E2HC 2W0FB 2DRUA 1BZ7A 3Q3GB 3FQRB 1IGJA 4ZUUA 3DBXB 1GC1C 2XN9B 3LPFA 4CN4A 3VWJD 1RJLB 4HXAL 1J1XL 1MUJA 1CDHA 5JMRA 1OP3H 1J1OH 1EAJA 1QEWB 1WJ3A 1EJOL 1GVIA 1P5VA 4JHZA 1WTLA 3L3IB 1OP5H 4LNVA 3BKCL 4X7EC 1E0OB 3L3HA 3UDWC 5KVDL 4K71C 4ZTPH 3U36B 5HYSA 1ZT7A 3MXWL 3FB5B 4Q2ZB 1JMZA 1QBBA 3C5ZB 2FNBA 3C60B 4KMQA 4WEMB 3B3IA 3NABL 2V6HA 1JE6A 4RISH 3QPXL 4QXGH 3TIDA 2EYTB 1OY3B 5DTFB 3OSKA 4GXUM 3CZJA 4U1GB 2Y07H 1O7SA 4XH2A 1MFAH 3MNVB 3FN9A 1EAPA 1M4KA 3RAJH 3ARGB 4Y4FD 4JDTL 4DJMA 1YEDB 3SDCD 3I75A 4CVXB 4HMCA 4PJGB 4TSCL 1CICB 2HFGL 4FQ2L 2I9LA 3EHBD 3X11B 4Y2DD 2B1AH 4KKBC 4EXKA 1IM3A 5E4EC 4HIEB 5FIEA 3UYPA 1BHGA 2Y5EA 4U0RB 1GL4B 4RIRA 4WO4A 1KIPB 2P5EB 5JOFA 1SY6L 4EI6A 4NO0B 4WO4C 5C0BD 5FA3A 1IARB 2FX9H 3MOAH 4HT1L 1RUPL 3Q6GL 3Q5OA 5EU6B 3BYYA 4POUB 3H7BA 3UBXG 2AK4B 1GGIL 3FHAA 3MUY1 2LU4A 15C8L 1MCFA 4X6FB 4KKCD 4LBEB 4WRLA 5DEFB 3C6LD 4ODTH 3NN8A 3WN5B 1KIRB 1G9MC 4FG6D 2FECL 4PFEA 3T0AA 1JN6A 5ADOL 4G9DA 3GDBA 1E4XL 4S1QH 2YMXH 1N2RA 2GKIA 1PX3A 1TETH 1NCAH 3CIQA 1V7ML 3W0WD 2XA3A 3WBDA 5J4MA 4XNXL 5HDBE 4J2XA 5D8JL 4LSVL 3KYKL 5I8EA 3T1WA 1JNHB 5HYIA 3VDBA 1H0DA 3BAEH 4PJAF 2IQ9L 4E41D 3UTSD 3D0LA 2I5YL 5ACZA 1XGQA 3QEHA 3T65B 3KDMA 1S5HB 4N90E 2AJZA 3C6SA 5D7KE 5LAXA 2EDXA 4WV1A 5D7LE 3DWTA 1DBJL 4LAQH 5I1CH 2OR9H 3CVHL 1IMHC 1GOHA 2H2SC 4OKVB 4PJ7F 2EIDA 4PG9A 4P9HC 1RVFL 3GSNL 3MJ9L 1JF1B 3ZSTA 3CZFA 4ONHB 4N1CA 2PO6A 4Y16D 4Y4HA 1T1XA 1JV5A 2M8XA 2BNRE 2EDWA 2AVGA 3DX9B 2R1WA 2UWEF 2DLTA 3BESR 4D8PB 1YNTA 3ULVD 5DA0B 1CQKA 3O8XB 1W0WA 3LEVL 3LH2H 4YR6B 5KTEH 3QUKA 3RA7H 2R0KL 2VXSL 1H3TA 1HHKA 1YN6B 3SBWA 3SDDA 4EDXB 1X4XA 3L7FA 4WW1B 3WLWC 5TE4H 3SDYH 4JGJA 4NHUB 3QUYA 3SDDC 3RNKB 4K23H 2VXVH 5GRVL 4GG6E 4HUNB 2W1NA 4KY1H 4GXVL 5IQ7H 3TYFA 5JO5B 3FQNA 1V05A 4FQJH 3UBXI 4B53A 3LQAC 1KC5H 3PXHA 3NIDE 4OUUA 4HSQA 1MCQA 1JL8A 3NCJL 3DURB 3E6HB 2BVQA 5ISZD 1KLFA 1MCPL 1Q8MA 3LVEA 2I24N 4HC1H 3BPCB 5C0AB 1U8OB 1LE5A 4DGVH 2VDRH 1DBBH 3FFCA 3MGTB 2Z4QB 4OZIF 3DETC 2ADIA 3K8KA 4QRUB 3FRUB 3SGDI 2WUBH 1P5UA 4YPJA 1GGCH 4PRIA 4F9PA 4CNIB 3LN4A 5F21B 1HHGA 1UQSA 2DBJA 4R3SA 1EIBA 2JK5A 1UC6A 3QUZB 4WHTB 4HWUA 4ZUTB 2DWEB 3G08A 4C56B 4DW2L 1RIVH 3DYMA 5DK3A 5F7HA 3CX5K 5TE7H 1H8NA 3ETBF 1BAFL 1FVEB 4Q6IC 5TH2B 4UT9H 1OAQH 1ZTXL 4B50A 2YXFA 1A22B 4Z7NE 1JZ4A 2O5YH 1I9RL 2PTUA 4ELMA 1P69B 2AV7A 3LKOB 4YXLL 2I25N 4P46A 1IT9L 1U95B 1FFOB 1II4E 4Z7QF 3AROA 4LMQI 4B7LA 3BOVA 1D5ZB 5I71C 4Y1AA 4XBGA 3SCMB 4DWHA 4LSUH 1G6VK 4DKAA 4TOYL 4LHUB 3SGJA 3MV11 2HVJB 4GJTB 3D87B 4L3EE 3QSKB 3PIQA 1NMBL 5FYKD 5ICZA 1KG0A 3NCYS 3SGJC 1ZWIB 4FABH 3STLB 4R7NA 5HGDA 4KTEL 5FUOL 4JRYD 2FO4B 4NRZB 4ODWB 2DM3A 3JXAA 5T5FL 4PJAA 2BRRL 4OT1H 4D0CB 3VXNB 1LDSA 4OSUL 2WIIA 4HK0B 4KVCH 1L4IA 1PVHA 5DR5H 4QCIA 3QDJA 4ETQA 1J0IA 4K7PX 3SGKA 1IC4L 1BM3L 1C5BH 2XWJA 3JZ7A 2VLMD 1J1XH 2P8PA 4PJ7A 3ZHDA 2NY6B 5D71H 1KCSL 1EJOH 1EV2E 2NR6C 4TVPE 1Z6JT 5HHMB 5DFVC 4NZTH 5E5MA 1GIGL 2UWEA 5EULV 5E08L 2VH5L 3KYNA 3UTTD 1QZ1A 4KVNL 3MXWH 3L3OB 1YNKH 2JIXA 3N1FC 4OKDA 1TMCB 3MV7D 4G5ZL 2CMRL 1JGEB 2AJXH 1F8TL 1KTLB 5DQJA 4TPRL 5T1MB 2YRPA 1MCOH 3TT1L 5D5MB 1NUDA 4CUCA 5IVOA 5I1KL 4YDLB 3CDFA 2QSCH 1A6AB 5ENWB 1WITA 3ARTA 3TA3B 2GSGA 1J05B 2Z91A 5H2BA 2VDNL 1CVSC 1YEKH 5DI8B 4HLZG 2APWA 1I8IB 2E6QA 4HQQL 5B39B 4F2MB 4J4PC 1BVLA 4ZOAA 1Y6NR 2BVOA 2AEWA 3WHXB 2HFGH 1OAUH 3EYVB 4FQ2H 4OZIA 1D5MB 2DQCL 1B0GA 4Z0BL 2EEAA 4LLMA 5CSBA 1RV6X 2DMCA 4ZUVA 2NY2B 2JCCE 3OX8A 5HTSA 5F72S 2D2OA 3OAYH 3D18B 1F2XK 4R2GB 4R96B 2PR4L 4N1EA 1GGIH 1N3NB 3BWUC 3OJDB 1A1OA 2YPLE 3EFFA 2E7MA 1H5BC 4JANB 1IAIM 3T2NL 2BOBA 2W9EL 4DAGL 5D6DA 3HE6A 1S9XA 4QHNA 5BV7H 3BRFA 3TBVA 2RHEA 2BFVL 4MAYB 4IIQA 5EU7E 5GHWH 5D6DC 3HE6C 4PRPB 1MCRA 2VZUA 3PV6B 3SJVA 5JNYA 5ADOH 1MF2L 2YD6A 4IIQC 3TJHD 5FV2A 3RJQB 5CP7A 2D31A 4GRWE 2V5YA 3O6FB 4QGYA 1UM4L 5D8JH 4NNXA 3R1GL 1UWXH 5AZ2H 1UM5H 3FOLA 2OM5A 4G8EB 4JFDA 3MROB 4M4PA 4PJ5A 2H41A 3DUHA 1YYLH 4HWBL 2I5YH 2J6EH 4MA1B 3OR7B 2MQ0A 4X6CF 3P11H 2OLDA 2ZOKB 1LO0L 4LOUD 3K74B 3PWNB 5I8OL 1DBJH 1T5XA 4M62H 3RPKA 1FL3A 2VXTH 4AIZA 1XF3B 2A6IB 1RVFH 3MYZA 1L7IH 2X7LB 2P49B 2XKUA 3AM8A 3MJ6A 5I0ZA 2VDOL 1HSBA 1N8ZB 2BVTA 3LEVH 2VXSH 4NQEE 5E6IB 2D0HA 4PJHE 4J8RB 1CFSA 5CJBA 4OGYH 3DNKA 1QLRA 2IBZX 2WSKA 3E6FA 3V4UL 1X5KA 4N9GA 5EUOE 1DBML 3EFDH 1P7KA 1ZSDB 1YY9D 3GRWA 4X4YB 4N5EC 4JFFB 5F9JA 1A6TA 4N0CD 4UB0H 5KSVA 1MHEB 2CUHA 2QEJA 3HPJB 4ZTOH 3NCJH 4JN2A 1SBSL 1MCPH 5C70A 1N6QH 2OTUB 1S7UA 1RPQA 1J8HD 1KT2A 4NWTL 5DHYB 2EC9T 4OLZH 4LKXB 1R24B 5HY9B 2X4OB 1YZZA 1NSNH 4GBXC 4IM8A 1D6VH 2J8UE 4KROC 4J1UA 3V5HA 1S3KL 1KLGA 3WUZA 3PHSA 4OZGF 3VW3L 1QACA 2D7TH 3HMXA 2EE2A 3LIZH 4HWZB 4WTWA 1JNLL 5IV2B 1QSED 4F7TB 4POYA 3MRFB 4DW2H 4IS6A 4HS3B 4PJ8B 3LEYL 5FOBB 2ZKHL 3O4LA 4PGZA 1NGWA 5IMMB 5I9QB 1ZTXH 4JZJB 3ILPB 5E1AB 4DTGH 5B4MC 4NKMB 1MFDH 5F1IA 1WWCA 3MV01 4KTYA 4YXLH 4R6UA 3EDDA 4Q74A 5B8CB 3LN9A 5LBSL 1IT9H 5CHNB 4A6YL 2FEDC 2NNAA 5T5NG 3C08L 2EDDA 3MOBL 5EC2B 3GB7B 3K8LA 2NMSA 3V8CA 1FZMB 4UU9A 3P4OA 4ORGA 4UOJA 3N1MC 4U1LA 4ZFGH 4KTEH 4B5EA 2BCKA 1F97A 4UTAL 4DGIL 3TFKC 3WD5H 1BFOA 4XAWL 1UEMA 4X80L 3RKPA 2D03H 3IU4L 1FCGA 1PG7L 3T2OA 2G5BA 2BRRH 2I60L 2BY3A 3OV6A 4OSUH 4W6YB 2BNUB 4R26L 2Q6WA 4OCRL 1CFNA 1P53A 1XR8B 1T83A 1UYWL 2XQYG 1KTDA 1JGDB 4IBLT 1OM3H 3FAWA 4KKNA 4CU7A 4O2FB 3SEPA 2AJUH 1UGNA 4HUXB 2F54B 5IG7B 2QKIB 1GGUA 2VLJA 2B4CL 3KLHC 4LDLB 2JE8A 3VFWA 3B5HA 4Y4FC 3SDCC 5FXCH 1U8PA 5CFHA 4LK4A 5IIEB 1K5NB 2VH5H 1YMMB 4JHBA 1ZHBB 1J11A 1ZV5A 3H2WA 1XCQB 3WL9B 5CWSA 3RTQB 4TPRH 5D7JB 3HZVB 4G6KL 4NWUL 3TCLB 5DVKA 4ZSOA 3RBGA 2HT3C 4MZ3A 5CEXB 1Q9OB 1TJIL 1PZUB 3I02B 3GUTA 2RIKA 5DEGB 1RFDH 2AQ2A 4KTDH 2CKBH 4ODXB 3KPMB 1ND0B 1B2WH 2EH8H 5GPRA 1QFOA 4Z9KB 3K0WA 4WENB 4NN6B 1ROWA 4Z5RB 1BBDL 1HHJB 1Q9KB 5F7FA 5JDSB 4G8GB 5DC0A 3WIIL 1RIHL 4U1NA 2GW5A 1Y0LB 2DQCH 4FQQA 1N59B 4P9ML 1MWAA 2G75B 4C58B 1MELA 3LKSB 1QLEH 4Q0XH 4OZGA 4FQIL 5ICXB 4JO1L 3CLEH 2P24B 3SDAB 5I1IH 4I1NB 1F4XL 3UYRL 4BFBD 4H1LA 3EOTH 3O6LH 1MIEL 5DGRA 1MI5B 4P2OD 4FQXA 1DQQA 1RUML 2FECI 3GBNH 3U0WL 3DYPA 2ICWJ 1U8QB 1U91B 2IALA 3BDBA 1E4XI 4F8TA 4CADB 1N64L 4EIZC 4LSSH 5JXAL 2O26U 4MJ6A 2FZ3B 4LSDA 2ZUQC 5I16B 1OLLA 3DXAA 1MF2H 4XP6H 1ZVHA 2MTPA 4GW4B 5J12C 4WI8A 3M07A 4ZFZA 3U9PL 4KV5F 4OB5H 5ELIA 3OKEB 1WTGT 5C0DB 1A47A 1FZKB 4IOIB 4JR9H 3ZMRA 1UM4H 1CLZL 5BCAA 3R1GH 4MA8H 4OM1L 3CUPA 4QTHA 4P4KA 1JZ7A 1H9VA 2VISA 1J8KA 2YZ1A 4KZEH 3HG1B 1HEZA 4YGVB 2AABH 4BFEA 5DT1H 5ADPL 3EJZD 3FFCE 4CVZB 1NEZA 3QFDB 5I8OH 3BGAA 4XCYA 2PTVA 3ARFB 4KJPC 1F4YL 3UTQB 4E0RA 3GKZA 4N0FA 4KZDH 1W0YT 5CIPB 1IEBA 1R3LA 3QO1A 1KIUA 3PDOA 4P2RD 3VXUB 1V5JA 4NRYA 4XMPL 1BD2A 2H26B 2YD5A 5FYKU 2X4SB 2IAMB 2VDOH 4L8BA 3W9DA 5FK9B 5IFAH 4Z77B 3BH8A 3FTGB 1FVDA 3B9KA 3VXPA 3ESUF 4ELME 2W92A 3WO4B 1FAIH 3RNQA 2Y6SD 3VFSA 3JUZA 1HH9A 3LS4L 1E27A 4X6DB 3H6JA 3NCCB 1DBMH 2NTSP 4Y1AE 3QI9A 5JR1L 2QSTA 1VACB 1UENA 4NBYB 1K8DA 3W39A 1NGPL 1L9NA 1QO3B 3HUJF 2WQ8A 3MBEA 1WEJL 1HH6A 3P4MA 4LAJH 4AG4H 3RL1B 4XWOC 1SBSH 3FZUC 5D7IF 3F5WB 5C0CA 3CFBA 4HX1B 2A9NL 4LIQL 4X6EA 4YHML 1U8NB 5A2KH 1K8IB 4NWTH 1KPVB 1GZPA 5IEKB 4PJAE 4NZRL 2X1XR 3PDGA 4ZNCD 3CPLB 1GGBL 3FO9B 4J3SA 2RFXB 2NXZC 3H9SE 3S96B 2HN7B 4HIIA 1FCCA 1PW3A 1YEIL 3QWRA 4U1IA 2DKUA 1I3RB 4ZAKA 3S3PA 4OQ1A 3MLZL 1JNLH 1YMHA 3V0VB 5ICYB 4P5KB 1K4DA 3FO1B 4PJ7E 2ZKHH 1AXIB 4GW1A 1ZHLA 4ZPVA 1RUKL 5K9QG 4WNQA 3C8HA 3OB0K 1WCQA 4OLXH 4F37K 1XR9B 5HI5C 5GGRB 2G60L 2DM4A 2UWEE 3FRPG 3RWIB 4P5TB 5ITBL 4Q7DA 5LBSH 5F3BB 4WWKA 5FA4B 4A6YH 1OP9A 4UUJB 4I13B 1I1AB 1A6UL 3KPOA 1H3PH 4ZDHB 5BMFH 3WS3A 2EDNA 3ZE1E 3H42L 4GO6B 3GJEA 4RGNB 4U1JB 2Z93B 3W2DL 3QEGL 2VSCA 1D9KD 4U3HA 1EVTC 1HINL 1UXSB 1B0RA 2P5WA 5M94B 3BP6A 1P84J 4QWWD 4FA8A 4HCRL 4HKXB 5IB1A 4PRAB 4I3SH 1VKXA 4HJ0C 1W72L 5DK0A 5E8OB 3IU4H 2VDLH 3DVNB 1CGWA 2VDML 3RGVD 4R26H 3P0YH 4Y8DC 1A6ZA 3TH4T 3RX8A 8FABB 4PJFB 5GS0L 3H7LA 4OZIE 3BZDA 5L9DL 1WWBX 1SMAA 2ESVD 3SE4A 5AAWA 2LU7A 1PDKA 1NGQH 3DGGB 4I9WE 4ZOEA 2HLAB 4DK6A 3DVGA 5JW4R 2HWZL 3QIWA 1BQLL 1CFQA 1RK1A 4HKBB 1RSFA 2CSPA 2X4UB 1OHQA 4LF3B 3U2SA 1G7PB 5BS0B 3QIWC 3BQUB 4Z7UB 1MAML 1KJ2L 2CUMA 1W2KT 3EUUA 3T8XA 1L0YA 3B8YA 1LP9B 4JPIA 2CRMA 3A67L 5E2VL 4YHNA 1A4JB 1TIUA 4DVBB 2QBWA 2XG5A 3ARBA 2K9UA 5J56B 4G6KH 5DQDH 1WBYB 2OL3L 5T3XD 1V3JA 3SJVE 3BT2H 1MRCL 4PRNB 2W9DL 1QOKA 5K9QI 4LASH 3PQYA 3S37H 3HUJA 3P4NA 2F53A 4LVEA 3V0WL 2BHYA 1AHWA 1MNUL 1CT8B 1QBML 4NJ9H 5D7IA 1JPFA 1CZ8L 4JFDE 3M17A 4PJ5E 1K6QH 4LSQH 1D5XA 3BD3A 5INDA 2P46B 5K93A 5J6HA 4FQHB 3DHMA 4ZXBD 1MHPH 5A43C 5T1DH 3L5WB 4MD5A 3ULUF 4I2XA 5C08D 5T1KA 1S7TA 3E8UL 3WNOA 4JO1H 1N0LA 2OSLB 3QZWA 4GW5A 1JMXA 1F4XH 3UYRH 3HS0B 1MIEH 3QXTA 4NM4L 3B83A 4Q9QL 2F19H 2YEZA 3BKML 3U0WH 1A1NA 1J12A 4OGZA 1D7FA 4YUEL 4LCYB 5CBAA 2R1YA 2YUWA 4NT6A 1CG9B 3I6GA 1U93A 3HTLX 3OR6A 2R2BA 4WUUA 3CMOL 3U6RA 1KYOJ 1GC1L 4G6FB 1NPUA 3QXVA 4L3CA 4WY7L 2V2TA 1TJGH 3FAXA 1VEOA 1RIUL 3B2UD 3FQXB 1ORQA 1T1WB 1CLZH 3VFNB 4OM1H 3T4YB 3WFCH 1A9EA 3VXSD 3DRTB 3IXTA 4O4YL 2RQ8A 3QIUD 4X9GA 5F1NA 4MZ2A 3VXRD 3IETA 4DQOL 3B2VL 2KDGA 4R9HA 4FXKA 1OQOA 5E2WH 5FF6A 4CAGA 4OLWH 1AO7B 3IFLH 1G7IB 5HI3D 5DRXB 4PJDB 5EZJB 2BNQD 1D5BB 3NFPB 5FO7A 4UV7L 4XPGH 3LRSB 2E3VA 3LZFH 5T3ZL 2CLZA 4JPKL 3GFUA 1IZJA 3QXAB 4FNLL 1XF5A 3AB0C 4GG8A 3C09C 2VN7A 4JDZB 3MRGB 3SKJL 1KLUB 3O3EA 2F5AL 5I17A 1JUFB 1IAMA 2X1OA 4ZQKB 1G7QB 3O4LE 1NBQA 1EHAA 2X4QA 4OCXL 4OBRA 3ZSSA 4MJID 4PP2A 3HMWL 2FL5B 1EK3A 1K2DB 5B38A 2EKSA 5EU3B 3SO3B 1U8JA 2D7OA 2JF1A 4KJWC 5IQ9B 4Z0XB 4EUPH 3GKWH 4X7TA 3G5XB 5JR1H 5GGUB 3S35L 5DJAB 4P2CG 3TC9A 3I6LE 2MNUA 1NGPH 5KG9B 1Z9OA 4MXWL 1R3IL 1WEJH 4ISVB 4ZS7H 4NN7C 2GTZB 3BJLA 43CAB 4XGZA 5IEHB 3ET9F 3H9HA 3KPSB 2DF3A 4TVPH 4P2QB 4XPBL 2W60B 2WLYA 3QAZB 3QCVL 1QQDB 5MEND 4N0UA 2FYYB 3UTZA 5C0GB 2VLKA 3TN0A 5FHAH 3QCTH 1YEIH 4QT5A 5CUSL 1CL7L 2FWOB 1B6DA 1TCRB 3TN0C 1G9ML 3FONA 4F80A 2CKNA 4OCLC 1CD1B 1QP1A 4XPAH 3ULUC 2FHCA 3PJSB 4AH2B 3CXDL 4GFTB 4HKJA 2VLJE 1U58A 4IRJD 2IG2L 2AXGB 2G60H 4DCQA 1MFNA 1P9MC 1KB5A 1T1YB 2DS4A 1ZHNB 3HPLB 2NY7H 2CXGA 3VG0L 1A6UH 3O3UN 1OQXA 4AJ0A 2EEDA 3ARUA 3DRQA 4YHYC 4FQLL 1ZHKB 3T0XA 5IJKA 2Q1EA 5DURB 3JWOH 4XCNB 3TZVB 5F7MC 4ZSOE 5IJKC 5E8DL 5IB2A 4OLUL 3PABB 1HINH 3ARZA 3MNZA 4P9HL 3WEXA 4HCRH 3MJ7A 2QADD 4P99A 1HIML 4OF8A 3GGWB 4WFGD 5ANMB 1NFDF 1DLHB 1MFCH 1PX4A 2PN5A 1I1YA 2XQBL 3ZTJG 1VGKA 3LSOB 4KDTC 4HGKC 5FDWB 1R3KB 3SKNA 3NZ8B 1DZBA 1BX2A 1C8PA 4I4WB 4Z76B 1JWSB 5L9DH 4H8WC 4M6ML 5JXEA 1JCKA 5GISL 5EZOH 1ZGLA 2HWZH 5GZND 4LARL 4OZGE 3Q6FA 3JV6A 3UBXB 4GRWH 3RHWF 5IB3B 1YDPB 3WNMA 3HC0A 3LQAL 1T1ZA 1OTTC 2V5TA 4U6HB 4CJ0A 1KJ2H 3EJYD 3TVMB 3WFHA 3L6FB 2IFGA 1HHIA 2NX5D 4LCIL 4L3EB 2VIRB 4DUXA 1T7ZA 2JJWA 3FT2B 4Y4KB 3A67H 1UG9A 4KDVA 1HQ4B 4XCEB 2E9JA 2KKQA 4F7PB 1TVBA 2WBJD 3HZKB 3RVVD 5IVXA 2ZUSA 4YDIH 2VQ1B 2OL3H 2ZUXA 2PYEB 3QJHB 1EHXA 3DXAE 5DSCA 5J13B 4XCFL 2W9DH 2CDEA 1P1ZB 4I5BA 3G04A 4K07A 5C09E 4MCZB 2A2QT 4UMGA 1CGUA 4OCSH 2BY2A 2RCSL 4QOKB 1X6LA 1ORSB 5J6GA 1QR1B 4L8SB 4M7LL 1CZ8H 4FTVD 1RJZB 4OCNC 3G5YB 4K9EH 4LFHD 1T7YA 1T20B 4MDIB 1HNFA 3RL2A 4RMSA 2Q7YB 4RMTA 2OQJA 3V6ZB 5JPNB 3BXNB 4ZS6D 2V2XA 5HGBA 1CTNA 1UH2A 2LFGA 4LPXA 3MC0A 3E8UH 3L1OH 4PJ9A 3VGAC 2R2CA 3RDTA 3BP5B 4OZ4A 1GPOH 2GT9B 4PJ9C 3GHEL 5DRZB 5KN5A 4MX7A 3RDTC 1OAKL 1I4FA 3DVFA 1G0XA 5K9KA 4Q9QH 1X5ZA 1BD2E 2ICWA 4I0PA 3UEZA 3BKMH 4MD4A 2NY3C 1FORH 4G8FB 3SHSA 4QHKJ 2XTJE 1AXSB 3PHQB 5IFHH 3ZL4L 3EZJB 4C4KO 4KJQD 1P84K 3FQWB 4XC1H 5A3ID 2NY1D 1Y6MR 1YQ2A 5L2KD 2AQ3A 5FM5M 4YH6A 4DOHB 2R9HC 3MR9A 3OKKA 4PJGF 1EGJA 1GC1H 1Q9WB 4WY7H 4RGMB 5EFIB 1E4WH 1RIUH 5GGSB 4NO2B 5EC1B 3PG2A 4X4XA 3D39A 3L5JA 3B6SB 1E4JA 3QDGA 2VLRA 4DQOH 4GLRI 1NFDA 4TSBH 5E2JA 3O0RL 5C0CE 5KSAA 2Z92A 4PTTA 1JBJA 1FNHA 1RURH 1RZ8A 4FXGB 5E9DB 3GMPB 5DUMH 5BVPH 5DJ8A 1JNNL 3BO8A 4S10A 4YFEA 3SY0B 3TNMB 1BZQK 3GM8A 2FB4H 2GFBB 2VTFA 1BQSA 2JELH 3HI6H 4G8IB 4K8RC 5T3ZH 4OM0H 2E8ZA 1OGTA 4FNLH 3TM6A 1LD9B 5EO9A 3ARDA 1T21A 3SKJH 4ZUSA 3U0PB 3MSPA 4J23A 1KN4L 4MXVF 3ARDC 4OCXH 4NPYA 3BDYL 3QULA 2GK0B 2G2RB 3NCYP 2DJSA 5F7KC 3SE8L 2P44B 3ZKMD 5JZ7D 3RKDD 2JLLA 2VO5A 3QNZA 2VN4A 3VXQA 4F7MA 3Q1SH 3MA7B 1T04B 5DRWB 4KK6D 2KQNA 2VR4A 4NQCD 5DVLA 3V7MA 5IHUH 3CLFH 1HQRB 1NCNA 3C9NA 2BSRB 4KMLB 4APQC 1R3IH 3WFDL 1ZOXA 2W0FA 4MLIA 2P5WE 2X89A 3Q3GA 3FQRA 5ALCL 3DBXA 2CJUL 2XN9A 4XPBH 1R3JB 4L9LB 3VFTB 4IRSB 1RJLA 3QWQB 4IDJL 3QCVH 1GAFH 3RVWD 3K8MA 3KYMB 3NCMA 1QEWA 3MCG1 4ACPA 3QG7H 1CL7H 4ELKB 4QY8B 1G9MH 4ZYKB 1D9KC 4XP1L 3U36A 1IE5A 3FB5A 4Q2ZA 3MRKB 3NPSB 4O02H 4KJYB 3C5ZA 2A0LC 3C60A 3MMEB 1Y6KR 2LVCA 4EN3B 4LLVA 3CXDH 1O0VA 1OL0A 5DJ6B 1PD6A 2QHRH 5BO1L 5J57B 3NTCL 4UV4L 2IG2H 2VWEC 2YXMA 5D1QB 4G7YL 5K9OB 3KPLB 2CXKA 4ZODA 5FO9B 4M61A 4GT7A 4HV8B 2EYTA 5DJDB 5DTFA 3HAEG 1DEEB 2E9IA 1WZ1L 1DLFL 5HYFA 5DMYA 5EO0A 1L7TL 2R29L 2DYPB 3MNVA 4TNWK 4FQLH 3VFMB 1JVKA 2H3NB 4PV9B 4MJ5B 3ROOB 3ARGA 4NZUH 1YEDA 1FHGA 4CVXA 4TNWF 4G6JH 4PJGA 3ARGC 1LO5B 4JKPH 2NW3B 2E9BA 5A16B 3BGFB 1MVUB 1X5LA 3PQYE 4L1HA 4MQTB 3X11A 3HUJE 1JHLL 1T66C 3QIBB 1CICC 2F53E 3OJMB 4HIEA 5FV1L 1BZ7B 1IGJB 2EXYD 5D7IE 2XQBH 1KIPA 4HS8L 2P5EA 1RU9H 3BKJL 4NO0A 1BEYH 2XZQL 3QYCA 4JJ5B 4OV5B 4XT1C 5EU6A 2FEEI 1ZK9A 3I85A 5BXFB 2YKLH 4X6FA 4I2XE 5GISH 5C3TA 4LRNL 4M03A 4LBEA 3L3HB 4D0DB 4Z6AT 5LXGL 2YC1B 2BDNL 5HYSB 5DEFA 3IT8D 4NYLB 5F6HI 3X12A 3LQAH 1E4KA 1UA6L 1KIRA 2FD6L 4U1KA 3WN5A 4H26B 4K2UL 3WN5C 3EIFA 4LCIH 3IFPB 4HUKB 4YFLF 4ZXBC 1QPXA 1U2HA 3TIDB 1AKJD 4OCYH 2D4DA 2ZSWB 1A7RL 2CR3A 4XAKD 3ZKQD 4EI5B 1UJ3A 2UZIH 3TO4C 4BKLB 4XCFH 4LVHB 3T65A 5GSRB 1S5HA 1FYTD 4WHYH 4KHTL 4XPHL 3TJEL 5DVOA 3QEQA 5C0RL 4AT6B 1ZLWK 3SOBL 3SE9H 2FJHB 4BK5A 4WI2A 1LDPH 1MCWW 5B21A 5JIIA 4OKVA 3P4LA 1JF1A 1UACL 1DDHB 4ONHA 5BVJB 3C8KA 4RQQB 1DBAL 3BPOB 1I9JH 1SJEB 3S36H 2XKNB 5J7CC 3DX9A 3AY4A 3F7QA 4P23D 4D8PA 3BYTA 3STZB 3O8XA 1ZVSB 1CDJA 4YR6A 5MEPB 1ZA3B 4S1DC 1UWEL 3O8XC 1YN6A 3HNSL 4EDXA 4CU6A 4WW1A 1WZLA 2Q8AL 4CDHA 4NHUA 2NXYB 1A1MB 3B9AA 3PP3K 3SQOL 3VFVB 2KBGA 3F65A 4LPTA 3RNKA 5D5MF 3BKYL 4QRRA 5JO5A 4CJ1A 1WT5C 2L4OA 4XX1G 4RFNB 3O81A 5HI3C 3ZL4H 1XGUA 3VA6A 5SWSD 3DURA 1SHMA 3E6HA 2HTLD 3KXFB 5B3NA 2ZG2A 1AQKL 3BPCA 4LU5L 5C0AA 1U8OA 3U7WL 3RZCD 2B5IB 4G42B 12E8L 1XCTB 2CDFB 3MGTA 2Z4QA 4X9IA 2QQKL 4QRUA 4ZUWB 1PGRB 3FRUA 1CCZA 3MRPB 3B8SA 4CNIA 2YWZA 3K2UL 2C3VB 4C4KT 1C16B 5HYJD 3QUZA 5FYLL 2MKLC 4WHTA 1IJ9A 1FIGL 4U6TA 1CE6B 4OFKA 2DWEA 4ZUTA 2NZ9C 4ODUB 4C56A 5TF0A 3HNVL 2PO6B 2DOCA 4J12A 4X7DC 2VLKE 1UH4A 2HH0H 1FVEA 3IKKA 3L3DB 5TH2A 1RUQL 4YBLB 2HVKB 4R0LB 5CKAA 2FHFA 3NA4A 3UX9B 3BHBB 3LKOA 3DROB 4YAQB 1NC4D 1U95A 1FFOA 3H3PL 1Q1JL 2VL5B 3SCMA 4TQEL 4NO5B 2GJ6D 1MJ8L 3QUYB 3BDYH 3P9WB 2X42A 4LHUA 3SCMC 4XP9H 4F9LC 2HVJA 4KHXL 1GGYA 4S2SB 3STLA 3MA9H 1X3DA 2HMID 1DBKL 1U92B 3HHRB 5DJYB 2HRPH 2NY0B 1TZGH 2FO4A 4NRZA 2CRIA 4QRPB 3MFFB 4ODWA 5HHVL 4D0CA 2EDRA 3O45B 4U6VL 3VXNA 3VWJA 3ZDZF 4YPGB 4HK0A 4S1SL 5DZOA 1X5HA 3BEWB 4NQXB 3WFDH 3OTTA 4JN1L 3EYQC 4IRJC 5ALCH 2ADIB 5TJWK 4JKLA 3QB7C 4YHKH 3QQ4B 4LGRB 3QFJD 1NCCL 4POZD 1AI1L 3W9EB 1U6AL 1CD9B 2BSTB 2NY6C 4D9QE 2VUOA 3RVTC 2XPGA 1RHFA 4E5XA 4OF0A 4XP1H 1OOAA 3L3OA 4WHYG 1JHKH 3RIFK 4YXHL 5D4QA 2QADC 4ESKA 1JGEA 2DQIL 1VEMA 4P46B 1CTOA 1T2XA 5BO1H 1REIA 1LE9A 4UV4H 4TULL 5T1MA 4RWYL 4EVNA 4LDEB 5D5MA 5EOCJ 3HE7B 1F3RB 2R0WL 4HF5L 5ENWA 3CVHB 3ILQD 3TA3A 4MDJB 1J05A 5SX4H 4KRPD 1WZ1H 5ALBH 4CGTA 4YDLC 1XIWB 3GSNB 2X41A 3TA3C 4TYUA 4HW6A 4IRZH 4AEIL 4JFED 1EEUA 4M7LT 1TLKA 1Z2KA 5IVXE 5B39A 2F58L 4GSDL 1H3WM 3DMMB 3WHXA 3X3FL 1ZLSH 3EYVA 1D5MA 4GKZB 3H9SB 1F45A 1JHLH 5C0BA 2HKFH 2QR0A 3DJ9A 3ZTNH 1F90H 4HS8H 1BF2A 2EZ0D 3WHE0 2NY2C 2P8PB 5E24E 4WU5B 3C6LA 2A9MH 2H1PL 3D18A 4R96A 3VA2C 1YPZB 1N3NA 1FGNL 6FABL 3OJDA 4MJ4A 4JANA 4R2GC 5AZEL 5LXGH 3AAZA 2BDNH 4X98B 4K3DL 4MAYA 1PSKH 5FFLA 4PRPA 3MLVL 1FRGL 3PV6A 3GRWH 5B3JF 4K2UH 1IGML 3BWAB 4PJXB 1P4BH 1UZ6F 5D2LA 3AREB 4HAFA 4E41A 1DVFD 5IK3B 4LGPB 2Q20A 3HN3A 4Q6YA 3O6FA 1U41A 2IH1B 1JF6A 1XFPA 1IQWL 1A7RH 5I8KL 1BQUA 3NA9L 1QFWL 1FO0L 3F7PC 5I19L 4G8EA 3MROA 1YN7B 1ADQA 1PG7X 1JZ6A 5JW3H 2UYLB 5FGRA 2CUIA 5F44A 3SKUD 3OR7A 4OLYL 4PTUB 4OD2B 3S8WA 1F4HA 5FYKL 4JO4L 4KHTH 3TJEH 2ZOKA 1KUMA 3CFJB 3PWNA 5C0RH 3EZ8A 3HMXH 4W68A 4OGXH 4R4BB 3Q2CA 1YEEH 4BFIB 1C08A 2HAZA 4P23B 3VFRB 1FJ1B 1XF3A 2A6IA 1R6VA 3MGOA 3QDGE 1UACH 2PETA 5FOJA 2YA2A 2X7LA 1NFDE 1UCBL 3QWOB 4RX4D 4YBHA 5KZCD 3P30L 1S78D 3FN0H 1G1CA 4ONFH 2X44D 4CW1B 3N9GL 4JO2L 4ZFOL 1UWEH 4LLQB 5E6IA 5CINH 3HNSH 2OTPA 4J8RA 1A6VH 1KIQB 2Q8AH 1Q72H 3LKNA 5E6IC 2KZWA 3BKYH 3T77A 5IR1B 4DKEL 4OAWB 1ZSDA 5D1XB 1Z0MA 4AYFA 3V6BR 3TBYB 4X4YA 4MQXD 4JFFA 4DN3L 5CP7B 4KDWA 2ADJB 4KMTL 2ZCHL 1MHEA 1Q0YH 3NACH 4QO1A 4WI6A 3BN9C 3HPJA 5GZOD 3BP7B 5E99L 1O5DT 4NNXB 3WMSA 1AQKH 3K46A 4JFDB 3U7WH 3G6JB 4FFYH 4OF7A 3QDMD 12E8H 4RGOH 5DHYA 3RY6A 5I1AB 1F6AB 4LKXA 1R24A 5HY9A 2B8OT 1K4CB 2X4OA 3RY6C 4JFPB 1MVFA 2DQUL 4KK8D 3RWHA 5EPMB 4EIGB 2AK1H 4KKLD 5DD3L 5FYLH 4HWZA 4O5LL 1FIGH 4JZNB 3CK0L