1FNEB

Histocompatibility antigen
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
213
structure length
213
Chain Sequence
KKVITAFNDGLKGGGGSLVGGGSGGGGSRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVYPTKTQPLEHHNLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (MHC CLASS II I-EK, ALPHA CHAIN)
publication title Structural and functional consequences of altering a peptide MHC anchor residue.
pubmed rcsb
source organism Mus musculus
total genus 38
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fneB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1fneB01
5DMKA 4NZJA 5BO1L 3O3EB 1CU4H 4AMKH 1XGQA 5MENB 3QEGL 4YQXH 5KAQG 5L9DL 3P4LA 3RVXD 1F97A 3VGBA 3MLVL 1TZIA 3OKEB 4JO1H 1GVIA 3NFSL 4I77H 4P3DA 3EYSL 4L3EB 4QNPE 1M71B 5FKAB 2A1WL 2GJ6B 1A1NB 4PJXE 2I26N 3SKMB 2FHBA 2EH8H 4G7VL 3GMMA 3QEHB 5FUOL 1DSFL 5KSBA 1PG7X 1PG7W 2EDTA 3CSYA 4KVNL 3UDWA 4BQ8A 5A3IC 3BT2L 1BVLA 1J0HA 2B2XL 1FV1A 2PR4L 4MNGA 4MA7L 5DJ8B 2BSTB 3CMOL 4O5LH 1CFTA 5IVXF 4HWBA 1DBML 1NKOA 1EJOH 2KPNA 4LPUA 4BFIB 5I8CA 1CK0L 4KZDH 4B7LA 1URLA 2BNQA 4MLIA 5CEZD 1QSEB 3BP6B 1L0XA 2WUBH 3MV8E 4OGYH 3IDIA 1HHHB 3GRWH 2EXWD 4HQQH 1U95B 1A7OL 3QI9D 4OKDA 2IADB 2W60A 4LLUB 1Z5LA 3JUZA 4LLMB 4PJBF 3LS4L 1WTLA 4N8CL 2QJDA 3WN5C 3X11A 5I6XC 4JFDD 1SQ2N 3LEVH 4WFFE 5D7JA 2R4SL 1KEMH 4PJIA 4N0UE 1MFBL 4ZPVB 1FZJA 1CXLA 5J1AA 3V4VH 3V8OA 3IAQA 3OKKA 3BRFA 4YE4H 5KSBE 1YMMD 5DRXA 5L2KE 3O2WH 1I1RA 2I9LA 2R2CA 4U1GB 1RJYB 4B0MM 1RHFA 3NCMA 5I8KL 3C08H 1DE4B 2PW2A 4AG4H 5J13B 4LF3B 1QBBA 3OSKA 1ZS8A 2HWZL 2IBGA 2XWJB 3JWOH 2WWKO 3IFLL 4I4WA 4NKMB 5DQJB 2GK0A 1FNLA 4GSDH 3GJFH 1FORL 1P7QD 2R23A 3BW9A 3FRPG 5IROC 2CR6A 5F7WC 3MLTA 2YBRB 1UB6A 1BQHB 3WFHA 4OZHA 2R2BB 2DLFL 5IIEB 2YUZA 2YC1B 5J1TC 4JFEA 1FE8H 2PO6C 4TPRH 5ADOL 5HBBA 1NMAH 3R1GH 1SJEA 3WUWG 5IR1A 1WAAF 3QQ4A 1U8IB 2HJLA 2GSGB 4JGUA 5H37H 4HC1L 3QEQA 3RWIA 1RIUL 1E4KA 3ULVD 4PJDA 1N6QH 5IKCB 1G7LA 3O8XA 4X0KA 3N1PC 2J1KA 1UEMA 4GRMB 4ZOBA 1RURH 5I9QC 1OGAE 5IUSA 3EJJX 4WTXA 3QA3B 5DD1L 3FZUD 1MCIA 1RK0B 5FCUH 3CC5A 1SEQH 1Q9LA 4Z78A 2IBBA 1DQMH 1KTLA 5DHVA 3RZCD 4DGIH 3UTZA 4X6CF 1JZ5A 4Y0GA 1U92A 3BEVB 4QHNB 3MLSH 4HPYL 1GPOL 5D70L 1W0WB 5HI5D 2OP4L 5EBMA 4JCMA 3CH1A 4I0CC 3RGVD 4HJGA 4CVXA 2NY2B 1S9WB 5I1IL 2A6IA 1OAXH 1J1XL 3H7BA 3I02A 1PBYA 4NC0B 5TGBA 4LSQL 2JCCA 4LHUD 1P4IH 3ULUF 3TT3L 3QDMA 3QXDA 1CT8B 3VXMB 1WC7A 1V7NH 4BK5A 1JUFA 2ADJA 1TJIL 4ELMA 5EZIH 2BOCB 3VXRA 3DBXB 5JPMA 1HH6B 4L1DA 5GGUA 4ISVB 5DVMA 2GK2A 4M1CC 1T0MA 3S36H 4WHCA 5A2IH 3NACL 2R0ZL 2X4OA 5DJCA 1NEZG 3LQMA 1Z3GH 2VMFA 3MJ9L 4GRLC 5IJVA 3QUXC 3V5KA 4IMKC 3B9DA 2BHZA 3PWPA 2NTFB 2YD9A 4LL9A 1OP3K 5IB5A 5K33A 4IBLT 4ODVH 4O9HH 4OM1H 1LMKA 1NGXB 1J87A 2J2ZA 3UJIL 5F6IB 4U6HA 3QPXH 1LO4H 4M6MH 4OV5B 3UZEA 4WW2C 4D9LL 4R7DB 2J6EL 2VXTL 4WGWB 5ID0A 4PJBB 1KTDA 1DBKL 1MCNA 2FBOJ 4FQQA 4DW2H 4HG4J 1JGEB 4V1DB 1N64L 5AD0B 3RNKA 1RZ7H 3QG7H 4HEME 3E6HB 3WE6A 4QF1B 5DD5L 3RTQA 2HJKA 3BZFB 3UZVB 1KG0B 5HGDA 1NMBH 1U8QB 4YXLL 4PJXF 1U3ZA 1RHHA 2CMRL 4WO4A 4CADB 2H26B 1GRWA 2CK0H 1E28A 5FYLH 5EOTB 4IRSD 3GSXA 5B39B 3EDEA 5C0FB 5K9QI 3VGGA 1MAKA 1CFNB 1INQA 2MMXA 4KTDH 3CVHA 1EGJA 1UKQA 4JZJA 4OZGF 4QRTB 2IANA 4H0HB 3U9PH 3H9SA 1K8DB 1MHEA 4TUJB 5JW4N 4LOUD 3IRZA 3HS0A 4I8DA 5DD0L 3LD8C 3H3KA 2HMIC 3QIWC 5DHYB 1RK1B 1DVFD 2O61B 4PB0L 4OLUH 2Q6WA 1HSAA 3PGCA 4IRJB 4IIQA 3HPJA 2A9NL 1B6DA 1A6PA 5DMIL 1A7BA 5JW3L 1U8PA 3LQAL 3GSWB 2ICCA 4CVZA 4Y1AA 1Z9OA 1HI6B 4PB9L 3LRSB 1XF4A 5J11B 2QR0A 3RL2A 2F54B 4LCCC 4KU1A 3RWGB 1NH6A 4P46A 3HNSH 5T3XH 3LQAC 1I8KA 4HT1H 1XGPB 1CE6B 2PETA 3UJJH 1DDHB 1AGEB 1I3UA 1IGIL 1MWAB 3W5NA 4HUWA 3SQOL 2E9IA 5EWIL 1TXKA 2K9UA 1KF9B 1FJ1B 1KBGH 2OXGA 5JMOC 5KSBF 4Z8FL 4X6CB 2DBLH 1WWWX 5HI4C 3EYVA 3D87B 4F2MA 4ODUA 2YPVL 5HHXH 4GBXA 4X99B 4LSUL 1JHKL 2HTKC 4RGNC 3TPUB 2IWGA 4TUOB 4CUCA 1JTOA 3VFUA 3WV0A 1QEWB 1MHHB 4NBZB 3T0EC 5DC4B 1B0RA 3ARBA 1EX0A 1NAML 1YJDL 3PQYB 5BRZA 4WU5B 3ARXA 5EBWB 1CTNA 1FYTA 1FH5H 4KRNA 2AW2A 3MUJA 1EZVX 4ZFOL 1RZGB 5TPWH 4HWEH 1LEIB 3ECBA 1EEZA 2YD4A 4FFZH 5DVLA 1YJDC 5F7YC 4P2OC 1F8TL 4B53A 5IMOB 3TNMA 4X7FC 5FM5M 4YDJA 1U8NA 3HI5L 3DXAB 3FT3B 1G7MA 2FEEI 4X6FB 5GS1A 1HILB 3D18B 3V6BR 5ANMA 1RUPL 4LFHG 2FX7H 2BHYA 5IW1A 3VJ6B 1Q9KA 1VFBA 3QWRA 5HHVH 5D1ZC 4PJIF 1WFUA 5CSZB 4XNMA 1FNEA 1YZZA 5C0ND 2CLZA 1HXYB 1JRHH 3Q3GA 1WQVT 4PGBB 1AD0A 4LSRL 1ES0B 2P45B 3DVGB 2BCKA 3TBWA 5CEXA 1NLDL 1D5IH 2XZAL 3EO9H 1OD9A 3KDMB 4RDQG 1NBVL 1ZKAA 2NY0D 2EE9A 3CD4A 5HHOD 4Q6IC 1ZHKA 1IAIM 1XZ0A 4G7YL 1JHTA 1HWGB 1O5DT 1SBSH 3E1F1 2A0LC 1T21B 1RVFH 5FYJL 2NZ9D 1MH5B 3MCG1 4P9ML 3MA9H 1CLZL 4U0RB 1FNGA 4HV8B 4F8TA 3I50H 1U8MA 4GQ9L 3RFZC 3D48R 5DA0B 2VISB 3JSSA 4FFVD 1AD9A 4OZHF 3RAJH 2YMXL 1HINL 5EN2A 4HWUA 4R4ND 4TTDD 5HYSA 4YNYB 2B1AH 2UZXB 4CDGC 3AMLA 5HHQA 1U91A 4U3CA 5DK0B 2AJZB 2AV1A 1ND0A 2EDKA 3DX9B 3EFDH 2BY3A 3VXMD 3ZE2F 1HEZB 2EKJA 4OZGB 4K8RH 1WBYB 2NY4D 1EVUA 1UGNA 4X98A 4PJDF 1FL6A 2CH8A 1K2DB 1I7RB 3GRWA 5ALBL 1MRFL 2JJVA 4YXHH 2VYRE 1T4KB 4LFHD 5CJOH 1X5ZA 3L95B 1NGQH 1HYSC 4Y4HA 3ZL4L 3ARFC 2Y6SD 1N3NA 1XGYH 1XGQB 1GIGH 3JTTB 1JHLL 1YC7A 2C26A 4NN6C 1TZIB 3IFNL 3DX8B 1G7HA 1KACB 4LCWD 3TYFA 3DUUB 2BRRL 1MLBA 1T20A 1W72L 4P3DB 2VB5A 3B2UD 4RQQA 3T8XB 3TIEA 2F58L 3IFPB 4WFED 2JCCF 2FR4A 1MFNA 4XMPH 4Y5XA 5KSAC 3ZTNL 4ELMF 1B90A 3CSYB 4WUKL 2A83A 4RGOL 1A3RL 1WIPA 5CEZE 1BVLB 3GJFA 2K3TA 4OLWL 5FECB 1C7SA 1FV1B 5F7DB 3BPLC 4MNGB 5ALCL 4PJCE 1EO8L 2HT2D 2VE6A 1CFTB 4Z0BH 2ZWLT 4I9WD 5GJTL 3KJ6H 4F7MB 2OBGA 4QRUB 5I1HH 3ILQC 4NRXA 4JO2H 1JTPA 4K9EL 2VLLA 3MNVA 1VACA 2BNQB 4JY5L 4JFDE 5HYJA 1AE6L 2WK2A 2EXYD 5BO1H 2H1PL 4G8EA 4S1QH 3MV01 4YLQT 3MBEA 4MQTB 3SE3A 2A74A 1IT9L 4TQEL 3O6ML 3MLVH 5DJAB 4GRWF 4XVTH 5FCSH 2W60B 1YMME 3BGMA 2LVCA 1Z5LB 3X11B 5I71B 5D7JB 3OKNA 4M7LT 4M93B 2VXUL 4G7VH 4PJIB 1JPTH 1S7QB 3L5HA 2VXVH 4KK5D 1FZJB 1Q9WA 1E4JA 1LHZA 3KYNA 5J1AB 4KJPD 3RGVA 3OKKB 3QISA 4KVNH 2B2XH 1BFOA 4JHAL 2VDNH 2I9LB 3CFDA 4H88H 5DK2B 3FAXA 4MA7H 4F9PC 2NXZB 3FMGL 2PW2B 3QZWB 1DBMH 1MNUH 1ZS8B 4Z95L 5D2LB 3T4YB 1ZA6A 4H0GA 4I4WB 4MS8D 1UM4L 4MAUL 4LIQE 3BW9B 1G1YA 3BVNA 3MLTB 3MLXL 1BJ1J 1NPUA 2H8PA 3ULVE 4OZHB 3MJGX 3SGEI 3WIFB 3WUWA 4LCYA 1A7OH 2WBWB 2PXYD 3DO7A 2HKHL 5IR1B 3MA7B 1NC4D 5D96B 3LS4H 35C8H 3QQ4B 4KDTA 2QHRL 4P57B 3MXVL 4DTGL 1FIEA 1U3HA 1MAML 3QEQB 3RWIB 1LVEA 5I1DA 4W6XB 3P40A 3Q1SL 3ARDA 1J8HA 1G7LB 1UYWH 4H8WL 1IAII 4PJEA 1MF2L 4X0KB 1LE5A 1CD9B 4C59B 1NAKL 3UZQA 1NDMB 3NCJL 3CC5B 4HUUB 4L8BA 2Y23A 3LN5A 3SO3B 5I8KH 5DHVB 3UTZB 1U92B 2XPGA 4MHHI 1MLCB 5C6WH 1AJ7H 1K8IB 5IHUL 2AXFB 3PP4L 2QADB 1I7UA 6FABL 3UPAA 2VLKD 3L3JB 4MMXC 4YDLC 3IRPX 3FOMA 3TBYA 1EFXD 5EBMB 2UYLA 2ATPA 4DGYL 5GRYA 4K94L 4KAQL 4OGAD 3CH1B 1OD7A 1V5JA 3GSQA 3O0RL 3QB7C 4HJGB 4CVXB 1S7VA 4LLWA 1QKZH 2Z92B 2DWEB 5FHBH 3Q48A 3H7BB 3I02B 2DLFH 4P2QD 4ALAL 3RY6A 4M62L 2NYYC 1EEUA 1JFQL 4AIZA 5TGBB 4UV7H 5ADOH 4NN7B 8CGTA 4HAFA 3QIUC 4KJWC 5T1MA 3QDMB 5IVOA 3QXDB 3CLEL 5BVJB 4NCC2 1FCCA 4APQA 1JUFB 5DI8A 5E2TL 5BMFL 4L4VD 4ELMB 5FYKL 2CO6B 1P6AB 3EJZC 5JPMB 1D7FA 2VL4A 3TVMC 4K55A 4S1RL 3O3BA 1I1YB 4XT1C 3HR6A 4O51A 5IEKB 4FFWD 4BQ9A 1JNLL 4UAOB 4XI5C 4UT7L 5DD1H 2R0WL 2PF6A 3N1MC 5CIPA 2X4OB 3HI6H 4NJ9L 4PJ5A 2FJGB 3GIVA 4Y16D 5IJVB 4C56A 1HNFA 5ACZA 3V5KB 1MAJA 3B3IA 1GPOH 3L5IA 3PWPB 5JA8B 2Q3ZA 5IB5B 2OP4H 2EE3A 1AR1C 4XBEL 3HUJE 3HC3H 4U6HB 2X4UB 4EKXA 5I19H 5I1IH 1J1XH 1XGRA 2YSSA 1KB5L 5KTEH 2DQEH 2NY1B 1UKSA 4WV1C 4FQQB 3BUYA 5GGSA 3MREA 1A7QL 3RNKB 2ZUQC 4LSQH 3WE6B 1S8DA 4OZFH 2HJKB 2KZ1B 4P2RA 1AGDA 5HGDB 1FO0A 1S7SB 3BGAA 4YO0B 2VKWA 4LLDB 1RHHB 1Z9MA 4X7TA 2IGFL 4HIHA 3C60B 1E28B 2VQ1B 5FDWB 3SDDD 2PYED 3GSXB 5KOVC 3BMWA 3QO1A 5F93C 3CVHB 1QSZA 5K9OA 5DD3H 3SE9L 1IC5L 3MJ9H 1UVQA 3O2DL 3I2CH 3H9SB 2NY3B 3NH7L 1MHEB 5I1LB 1DTUA 1NL0L 5GRXG 1KLUA 1GGIL 4F7PA 4C83A 3VGAC 4AZ8A 4KROC 3NABL 5FF6B 4L9LB 4PUBL 4IDJH 5T5NG 5E6YA 3KLAB 1PVHA 2Q6WB 2DLIA 3PGCB 2ZSVA 1NCCL 2EIZA 3EJYD 3B2VH 3HPJB 4IIQB 3T2NL 4HBCL 4Q58C 4HBQA 2J6EH 3AB0B 4LSDA 5KAQF 1DBKH 1U8PB 4XGZA 2ESVA 2W07A 1N64H 3LKOB 1FC1A 5J57B 4LLQA 3GSNL 3O4LD 5DD5H 1XF4B 2QR0B 3RL2B 4S1SL 4Y4KD 1I8KB 3QJFB 5HHOA 2J8OA 4XX1G 2LTQC 1MFAL 2AJSL 1T83C 3MRFB 3K2UH 2DIBA 2QQLL 3BDYL 5I1GH 4XNXL 5IW3A 3SE8L 3RWJA 1D5XA 3QUKA 4GBXB 1XIWC 4ZTPH 5C08D 1QP1A 4R0LC 4OZIA 1S7UB 3FOLA 4PJFE 5IP4A 3QNZB 3ARBB 5DD0H 5BRZB 3KWWA 5F9JA 5FO9A 3PDOA 2QLVB 3D3VB 3C2SA 4Z7UE 1A4JB 4ENEC 4LLAA 3ECBB 1EEZB 2XA3A 4PFEA 3VXUD 3ULVF 2VDOL 5F1SA 5DMIH 3X14A 1V7MH 4UTAL 5FO7A 3P30H 1KCKA 4JANA 1RUML 1CDCA 1NEUA 4NQED 1INEL 5J6GB 1U8NB 3RWEA 5HVHC 1BM3H 4ODTH 4LARH 5H2BB 3S3SA 5ANMB 5INCA 3GO1H 3BPNB 4NQUA 2V2WA 3TO4A 3AREC 2XN9A 3SQOH 1VFBB 1MI5A 5EWIH 1T1YB 4P4RA 4U1KA 5HHOE 1WITA 5FO8A 5BVPH 4XNMB 1FNEB 2WP3O 2CLZB 1AIFA 4Z8FH 3Q3GB 2QTEA 3MODH 1EFQA 2YPVH 3TBWB 5CEXB 2BCKB 3TFKD 1JHKH 4K3DL 1LP9A 4I0KA 4FQHA 1AQKL 4LASL 5E5MA 1WZ1L 2VR9A 1JK8A 4Y19D 1FIGH 1ACYH 1DQJA 1ZHKB 1JHTB 2XOTA 3CU1A 3UTQA 3TN0A 4BSVA 3QUZA 3VFGH 1J0KA 1UZ6F 4A6YL 2D7MA 3VXME 4D0BA 4RAUA 2HLFD 4FQIL 4XVJH 1T66D 1U8MB 1P9MC 1F8TH 1PY9A 1AD9B 2P5EA 3SY0A 3WFZA 5EN2B 5HYSB 4MCYA 5CMAA 5HHQB 5GS2D 1U91B 3WNPA 4I18C 4RRPG 3IETB 1T2XA 2AV1B 3BZ4A 1RU9L 3OAUH 4PR5B 1QSFA 4LVOC 2BERA 2Z31C 4GUPA 2H2SC 4BQ6A 2M2DA 5F7HA 1BZ7A 4PJEF 3SDCA 2Q8BH 2PUQT 4RWHA 2JELL 1PX4A 2D0GA 2FHFA 1B3JA 4XXCC 5SV3A 3GI9L 4LCWE 4JKMA 2N1KA 4NNXA 4M48H 5CP7A 3GMNB 1G9NH 1NBVH 4DKFL 1Q1JL 3DUSB 1R3IL 1CQKA 4Y4HB 3LCYA 3O3DB 5M95B 2FBJL 4G7YH 4F7TB 1N3NB 3K0WA 4FQCL 4Y2OA 3NGBB 4AL8L 4AEHH 4HKXA 5SWZD 1R0AL 1TMCB 5H8DA 1FSKB 3X3FL 1HINH 3RKDD 3TIEB 3QUYA 4GAJL 2R29H 4HDIA 3MROA 5H94A 5IHBA 4QRQA 3SCMD 2FR4B 4LEXL 4I9WE 4Y5XB 1OW0A 5C6PB 2EDBA 4XMLH 4JGJA 3P11L 4YHKH 3VCLA 5EULV 4L3CA 5J6HA 1VEPA 5DWUH 5I1CL 3NZ8A 2A83B 3D39A 1RZFH 3DVNA 5DT1L 2H41A 3GJFB 3QAZC 3CCHA 4H1LH 2JIXD 3C60D 2G9HA 4MD4A 4YJZL 4G42A 5ALBH 1MRFH 2WSKA 2VE6B 5GGRY 3GUTA 4N9OB 2AV7A 1U8OB 2CIIB 1LO5A 4NRXB 1M6OA 1BOGA 2VLLB 4N9GB 3MNVB 3OAZH 4PRDA 4QHKI 1VACB 4R3SA 5HYJB 3ZL4H 1I8MB 1X4XA 3QBTB 5FYJU 1BFSA 4G8EB 4KJYA 3BQUC 2ZOKA 5D1QA 3MBEB 1JHLH 1IM3A 2HJFB 3HMXA 1X4YA 3MQIA 5JW5B 2P7TA 3BGMB 5ABDE 2BRRH 4CU7A 1QR1A 4XB7A 4Y4FD 4G6MH 5CHNA 5CZKA 3OKNB 1EFXA 4DJMA 1ONQA 1IAIH 5DA4A 1Q9WB 3RIFK 1MHPH 3S34L 4WUKH 5E5UB 4LPCA 2FGWH 4RGOH 1NGWA 4N68A 1IEAA 4JG1L 1BFOB 4OLWH 3MCLH 3NN8A 3C09C 2G60H 1QFOA 5I18H 5ALCH 4PJ8D 5D7KD 5IBTL 4JQXC 3L6FB 2ZNWA 1HXMB 4RISL 2C4XA 1ZA6B 4WHTA 1KPVA 1M7IA 3SDAC 4PJFF 4HS6A 4M9OA 4JY5H 1OP5K 1YC8A 2FRGP 5ITBL 2FX8H 1QLEL 2H1PH 3BVNB 1WWBX 4UB0H 2D9QB 4JO3L 4XCCH 4OD3L 1IT9H 2WIIA 4R4BA 1QQDB 4I1NB 3O6MH 5EC1A 3D3VD 3ZSTA 2Z35A 1A64A 2OTPA 1VEOA 3CGTA 4N8PA 1AHWA 4OGZA 2DJ4A 4GAGL 4XPHL 5JPNA 1U3HB 5DYOA 4Q9RH 5EUOE 3OXRA 4AM0B 5KVDL 2VXUH 3DYPA 4MB5A 5E6IA 5I1DB 4XVSL 3CDFA 1V3MA 3CNKA 2VLKE 1J8HB 4XCFH 1M1SA 1LE5B 4K7PL 4LRIA 2CKNA 1TNNA 3D0VA 4FZEH 4JHAH 4OLVL 1MPAL 4L8BB 3VDBA 1F3DJ 2B4CL 4ZUVA 1JZ2A 1XAUA 4P2QE 1HDMA 4UUJA 4CN4A 5B8CA 4AYFA 3FOMB 1RULH 3L1OL 3TBYB 1X5HA 2EZ0C 2ATPB 1OHQA 2UYLB 1EXUA 4KRPD 4MJID 5LJYH 1MFEL 5ENWA 2B4CC 2K7PA 1MHCA 2IJ0C 3GSQB 4P4KB 4L4VE 1S7VB 4DQOL 4LLWB 2Z91B 3MLRL 1INDL 3MLXH 4R2GC 1YNLL 1FLTX 5LG1A 2CD0A 1VFAA 4MXVF 3AGVA 2YRZA 4HHAA 3WS3A 4CJ1A 4ACPA 4UIKH 4XPFL 3ZO0A 2HKHH 4U6YA 3L3OA 1VCAA 4TSBL 4O58L 3T77A 1MUJB 1RMFH 2QHRH 1C5CL 3RIAF 2X7LA 1GOFA 4APQB 1MIML 5DI8B 2IFGA 4QHLB 2R69H 1MAMH 4KK9D 3GGWA 4M8VA 3BEWB 3MR9A 1ZVSA 3Q1SH 3OTTA 3UPRA 2NW2A 4J4PD 4O51B 4RX4D 5CIPB 3NCJH 4CVWA 4QKXB 3W2DL 4YZFE 4YK4B 3VGHA 4IDLA 3GIVB 3MYJA 5ACZB 2IPTL 5IHUH 3OWEA 4RDQF 4DVBB 2DF3A 3N0PB 4K94H 1BD2D 1IAKA 5I30H 4KAQH 4CW1A 4JHWL 2YN3A 3O0RH 1XGRB 3EHBC 4ZD3L 1BIIA 4P0DA 5IM7B 4M62H 1U58A 5GGSB 2PYEE 3MREB 5GSRB 1W0VB 5C70A 1S8DB 5C08A 1GH7A 5KS9A 4P2RB 1AGDB 3CLEH 5T3ZH 2UVEA 1TVDA 5ICYA 4NQDA 1J12A 5JIHA 1CGXA 3P73B 4X7TB 3EZJB 1GGCL 4HIHB 2BFVH 2I60L 2WAHA 3VG9C 4XCNA 1JNLH 3GK8L 4UT7H 2R0WH 2NQCA 2LVEA 4F3FA 5K9OB 5FUZL 3ESUF 3F7YA 3FB7A 5I15L 3MBXL 1UVQB 2C3GA 3HE7D 4HZLA 1KLUB 4ZYKA 5E00B 2FO4A 4U6VL 1XF5A 3E8UH 1NMCB 3O4LE 3ALPA 5IB1B 2EXWC 3IDYB 1PEZA 3B9VA 4WWID 1TPXB 2O93L 1G9MC 2ZSVB 2EIZB 3O4OB 1QHPA 1XT5A 2VXSL 2EO9A 1S9VA 3BUTA 1YEJL 5JXEA 5JUEL 1KB5H 1CDUA 2C3VA 2EO1A 3HE6D 1NCAL 2ESVB 4PBXA 3BKYH 5GGQH 5FXCH 2OTUB 3B9EA 4LLQB 3CUPA 3NIFF 2R1WA 5FYKU 4PJGE 3ZKMC 2CDEA 2I25N 4M7LL 1QZ1A 5C08E 5EU6B 5ID1B 2X40A 4HIXH 3U30B 3S37L 2IGFH 1WZKA 4HZAA 2MPAH 3CVIH 3VRLE 2AK4D 4KMTH 2X9YA 4HUXA 3TZVC 2C4FU 5GS0D 4AEEA 4KVCL 3RWJB 1D5XB 3QUKB 3V0AC 1IC5H 4FQ2L 5D5MA 3VXUE 3O2DH 4KC3B 4KFZC 5AZ2L 5CCKH 3LAFA 2FLBT 1MCJA 3PF2A 1TQCC 1BBJB 1QO3A 5GRWA 2X4SA 3GIZL 4OZIB 3D25A 4YHYC 3FOLB 4NQEE 2HFFA 3KPQA 4U1JA 3MRIA 3KWWB 4XMKL 3NABH 1I1CA 1BAFL 5FO9B 4HLZH 3PDOB 3H3BC 2DDQH 5DEFA 2Y36H 3X3GL 1LNUA 3CDCA 3T2NH 3UTPD 1Z9LA 2MSPA 3O45A 2VZVA 2RGSA 2O5ZL 4MB3A 4FQ1L 3DTXA 5FO7B 5AEAA 4M6AA 4S2SA 5MHSD 5IWLC 5F8RC 3RWEB 3ARYA 3FHAA 3AUVA 4S1SH 5B3NA 2BY2A 4NWUL 4PD4J 5DJ0A 3VGFA 2V2WB 5EUOF 3TO4B 5K9KA 5J12B 4QGYA 4YDIL 2AEQH 1NCUA 4LK4A 1T2JA 4R7NA 3FZUC 2XN9B 5BS0A 3Q6FA 4P4RB 4Y19E 4HG4K 3I3BA 5FO8B 1OAKL 5E6ZA 1BJMA 1IBGL 2GCYA 2HFGL 5J1SC 3SE8H 3CIQA 4KWUA 5SWZA 3QHZL 3PV6A 4Z7OE 2L7UA 3K3QA 2OTWA 1LP9B 5HI5C 4FQHB 5EO0A 4F7EB 1EBAA 5E5MB 4JN1H 3VRJB 1JK8B 4I3RL 4ETQA 4LAQL 5BV7B 1J1PL 2EEBA 1DQJB 1OL0A 1OSZB 5TDNA 2JK5A 3U7YL 4X80L 3FQTA 4PY7B 4QHMA 3TN0B 1G0DA 3MRNA 3QUZB 4YAQB 3N9GL 2VDOH 5HSFA 4NHUB 4UQ2A 4D0BB 4X6EA 4RAUB 3KG5A 2WV3A 4CU8A 4LSSL 4P4KD 4UTAH 4X4XA 1D5ZA 1FZKA 2P5EB 1INEH 2X09A 4MCYB 1IGCH 1YEHL 1BVKA 2DS4A 4NRZB 1E6JL 2X42A 3UTSD 1QRKA 5C0RL 3EOBB 3BZ4B 2WNGA 3HRZA 3AXLA 4LKXA 1A6AA 1QSFB 1JPFA 5C07B 1BZ7B 3MLZL 5IFAH 3SDCB 5E8EA 4N1HB 4EN3A 4G3YH 2RFXA 5MP6L 2UUDK 5SWZE 3ARGA 4RMRA 1AQKH 3PG2A 4NNXB 5CP7B 1CFBA 5D2NA 1WZ1H 1IL1A 5M7QA 1JGDB 3CXDL 2Q3AA 2A6JB 3L3IB 1T6WA 1A9EA 1DBJL 3O9WA 4UNVA 4FFYH 5FA4B 3FN9A 3UJTL 4A6YH 4L8SA 4FQIH 4HKXB 1SYVA 2FB4L 2XQBL 5T3XD 3MRDA 3QUYB 3O3AB 2XV6B 5H94B 4P3WA 1IQDA 4QGTA 2OJZH 4ZTOL 3ZT6A 2P5WA 3IS0X 3QSKB 3M45A 2CRYA 2RBLA 1RIHL 3VCLB 4ODWA 4L3CB 4Y5VB 3NZ8B 3D39B 5K9JH 4NQCA 3SGKA 1J5OL 4PJHE 2YRLA 3CCHB 4JZNB 3TH4T 1N0XL 4MD4B 3H0TA 4PRNB 3GUTB 1GOGA 4FQXA 3QXWA 3EGSA 4OF6A 1M6OB 1BOGB 1DVFC 5BQ7A 3GZKA 4Z7QE 1Q1JH 3LS5L 3QHTC 3ZT5A 4OCSH 4R3SB 2HT3D 4PY8I 1ORSA 2AXJA 4KJYB 1AQDA 2YD3A 3QDGA 1A2YA 3LDBB 2ZOKB 2V2XA 4FQCH 5D1QB 5SX5K 1K6QL 2LAGB 4KPHH 3KYKL 4XBPA 4M03A 1FLRH 1R0AH 2P7TB 2FL5A 1FGNH 3X3FH 3IDXL 2Q20A 4NC1E 1REIA 5CHNB 5D7KE 3M8OL 4PJGF 5GRJH 2F53A 3NFPA 1ONQB 5C3TA 5KS9F 3VWKD 1WEJH 1UM5L 3P11H 4J6RL 5I1EL 5I1CH 1FFPA 3MRHA 5DT1H 5EU6D 3ZKXC 2VDKL 1NGWB 1T2QH 3RHWK 1IEAB 3IKKA 3NN8B 2VLRD 4MA1B 3PWUA 1FRGL 4U1GC 3HHRB 3SDXA 2E9BA 3B8SA 5HYQA 5LGHL 3CLFL 3D3VE 1XF1A 3LKQA 1KPVB 4PJ9B 1M7IB 5AAWA 4HS6B 5EORL 4ZFGH 1CF8L 3HA0A 1IGYA 4PYHA 5T5NF 2P8MB 1NGZB 4OCYH 4QRRA 3KPSA 2EYTA 3FONA 1M7DB 1ADQL 5CJXA 4WI8A 4WI3A 2LFGA 2WIIB 1QVOA 5DFWH 5EC1B 1YEGH 3G5XB 3ZE1F 1XF3A 2DQDL 2Z35B 1E0OB 5HI3C 3DUHA 1R3KA 3WFCH 5KZCB 5IOPA 1D5BA 2E27L 5JPNB 3C8HA 2ZJSL 2IBZY 5DYOB 4KTYA 2XKUA 3OXRB 5E6IB 5J3HC 3FRUA 1J8KA 4DK3A 1KEGL 2JB6B 2OQJA 2J88L 5C0NC 4CN6A 2I5YL 4MJIE 3QDJA 1AXTL 3VGEA 4JG1H 3P3YA 1RY7B 4L8CA 3H9ZA 1N8ZA 3WIIH 4ZUVB 4X5WA 5F6HI 1FFRA 4UUJB 3OF6D 4Z7OF 2DYPA 4G8FA 5JDSA 2OMBA 3C6SA 1WZLA 1WZMA 4RISH 4NCC1 2CK2A 1VGKA 3KR3H 5D5MF 2E7LA 4OZFB 3S35H 4BFEA 2V2TA 3NPSB 4U2ZA 2HT4D 5ENWB 4DCQB 2NZ9C 4HMEA 1QLEH 3BPOB 2Q76A 4NC2B 3UTTB 1E4XL 3TA3D 3MSPA 4RAVB 4H25A 4M00A 1MJUL 1VFAB 2ED9A 1BFVH 3PIQA 4HHAB 4R4NC 4TTDC 5SX4I 5FB8B 2F8OA 3BAEL 4U6YB 5E94A 1ZLVK 3VXQA 4PGDA 1PKOA 1D9KB 1J88A 3T77B 2EIDA 4JM2A 1MCOL 1TVBA 4XPTL 2X7LB 4U1HA 4LEOB 4GAGH 1JMZA 5F9OH 4IOIB 1ZVSB 2NY4C 2BNRA 4RWYL 3UPRB 5CUSL 2VRAA 3DARA 4K7PH 1HQ4A 1BD2E 4Y2DD 4NM4L 4YGVA 1T1ZA 4PRIA 1L7IH 5JO5A 4L29A 1HHGA 1T89A 2BNUA 4OLVH 5F88A 1HIMH 1WSST 4NQSA 3BE1L 4OT1L 1N26A 3ZTJH 4P59L 4P9HH 1ZANL 1UCBL 3T65A 4YEEA 2EDHA 3SBWA 4YHPA 1GGYA 3MV11 1XR8B 4CW1B 4MA3A 1RD6A 4OSUL 2YD8A 2CKBA 2UZYB 4JLRA 4DQOH 5HD8D 2FZ3A 2BSRA 3MLRH 5F6IC 4Y5YB 1YNLH 4TSAH 1BIIB 1CVRA 5DZOA 5C0AA 3B2UC 2F5AH 2RCSL 1CE1H 4YUEH 5A3ID 5JORA 5EU7E 3P9MA 5KS9B 1GHFH 3BYYA 3LKPA 3RWDA 2V5YA 2CLVA 5FOJA 1MIMH 1UWXH 1NCDL 4NQDB 1QSVA 2VSCA 1HKFA 4EUPH 4F9LA 3V7AE 3W82A 1YPZA 2AXHA 1MVUB 2MCPL 2HRPL 5DMYA 1GZQB 2EKSA 4F3FB 2HT2C 4PJHF 1P4BL 1WUNT 2FATL 4ORZC 3FB7B 1OAUL 2XIDA 4JPIA 3H8NA 1EV2E 2LV4A 1TCMA 2IPTH 1YUHA 4ZYKB 4RIRA 1XF5B 3IS1X 1N5AA 4BSJA 4Z7QF 2X05A 3RVVD 1CICB 3FTGB 1HSBA 2X9WA 1C5BL 3X12A 5TDPA 1S9VB 2HTLD 4O02H 4OBRA 4IRJC 1L0YA 2AK4E 4JDTL 3ROLB 2BC4A 1PFCA 1F11A 1U8LA 3CUPB 1OAQL 3PNWA 4Z0XA 1DBAL 5CZVL 1A6VL 4P5KA 4KK5C 1Q0XL 5J11C 1Y6MR 1MVFA 1PZ5A 1AY1H 4JQVA 5DS8B 5GRUH 1Q94B 2CLRA 4NNYB 1T1XA 5CSBA 4D0CA 1P1ZA 1B4JH 2DIJA 2EC9T 1S7TA 1FBIL 4U7MA 4D94A 4KGLA 1A7RL 3WLBA 1KPUA 2XTJB 3DETD 4NN5B 4YFLF 5HPMA 1UACL 2C1PA 2EH7L 4JY6A 3UTPE 1KJVA 4F57H 5FUZH 1MFCL 2C7UA 5I15H 5E8NA 1XGTB 1U6AH 4C4KT 4MS8C 3HZMA 1CFSA 1QO3B 3BKCL 5A40E 2X4SB 4U6VH 3WXWL 2OR9H 2HFFB 5MHSE 4JG0L 3KPQB 4U1JB 4HIJA 1A4KB 3UROR 3U7WH 1F4XL 1N7MH 4GW5A 3OAYK 3HC0B 4OQTA 5DEFB 4QOKA 2D03H 4LCUA 4P99A 5C0BD 1LNUB 3GBNL 1JZ8A 2PXYC 4JFXB 2XXMB 3QQ9D 4OFYA 4PJ9D 1YEJH 4LVEA 5E2UH 5JUEH 1I3VA 5JXAH 3DTXB 3GB7A 5MEOA 3LOWA 4S2SB 5A43C 2APXA 4U1NB 3V4PH 1RUQL 4DN3L 2NTSP 1YYLL 5D72L 4G6KL 4M7LH 1I1FB 4PP2A 1NUNB 3HNTL 3C5ZD 5DJ0B 3MZGB 3S37H 5D7LA 3PWLA 1KIRA 4MNHB 5KZCD 4JZOA 2R2HA 4FQLH 5GRVL 3LSOA 3LEYH 1GCFA 2GCYB 1GJIA 4K71B 4CMHB 1RZKL 2ADGB 1EEYB 2VDQH 3KPMA 3JWDL 2OTWB 4BJLA 5EO0B 1QLFA 2BVEA 5AYUL 4DAGL 3MRQB 5DR5L 1F58L 3NCYS 2VZSA 3SDXF 3RY4A 4ETQB 2MFNA 2JLLA 2X41A 2JK5B 3JWDC 5F21B 3FQTB 2O26U 3UTSE 2AJ3A 4QHMB 4JAMA 3MRNB 2J8UA 3WKMH 4ZG1A 1TENA 4UQ2B 4NM8L 4X6EB 4M1CD 4M5ZL 1IZJA 3WDIA 1CDJA 3OQ3B 3QUML 1D5ZB 1FZKB 2JJTA 2JJWA 3G6JA 4KJQD 4U0RC 3UTTD 4PV8A 5CWSA 4H1LB 2F8XC 4NWUH 4BYHA 1BVKB 4GRLD 2R15A 4FFWC 3VMPA 3AXLB 2IH3A 2QBWA 3WNKA 1A6AB 1JPFB 1LD9A 3C5SA 3KPPA 4MVBC 1R5VA 1A9BA 1IQWH 3DROA 5E8EB 4EN3B 4MXQC 4L4TB 5B38A 2WBJA 1Y18A 3KPOA 3KXFD 5D93B 3N1GC 1A3LL 3PP3H 2SEBA 5D7SL 5T3XE 5D2NB 5GGVL 1UFUA 1H5BC 1AH1A 1JP5A 3FN3A 4I3RH 1JJUA 1J1PH 4NJAL 5EU3A 2F19L 3GMRA 4GW1A 3U2SA 3U7YH 5I73C 1A9EB 2VLJD 1HOCB 5DFTA 3O9WB 3N9GH 4MD5B 4MJ6A 3QQ3A 4NWTH 5C0DA 5F7UA 2ARJA 4RBPK 1LO0L 5CLWA 3MRDB 4JPKH 3WS6A 3TESA 3M07A 1IQDB 2IAMD 1YEHH 2D31A 2GFBA 3SDDC 4HMDA 4JM2F 4XP5L 4JB9H 1NFIB 4M6NL 3GI8L 4NGHL 1IEHA 4NQCB 1A8JH 2HMID 5E1HB 4NKDA 5AG8A 2Z4QA 4HWBL 2WLYA 3Q2CA 1YY9C 3SGJA 4JFHD 3H0TB 2OM5A 4LKCA 5MP6H 4FQXB 2GSIA 1AGFA 2OJEA 1Z9SA 3V5DA 2VOTA 1JTTA 1KFAL 3IU3B 4UILL 3EFFB 3VMNA 3EJYC 3TJEH 3WSQL 5JHDA 3PGFH 3VI4E 3V4UH 3INUH 1AQDB 3QDGB 1NUGA 1A2YB 2V2XB 4Y89A 3UJTH 1A7NH 2XA8L 1CICD 3OB0K 1CGSH 5EU6E 2FL5B 3DI3B 4Y4KC 4W81A 4PYGA 1QTYT 4MA8L 2VLRE 2J12B 3CFBB 3PUCA 3K8KA 3OBAA 4RGND 2Y72A 4EEEA 3BIKA 4UQ3A 5I71C 3NAAL 3NFPB 3B9KD 5D7JC 4UBDD 1RIHH 4M93C 5BW7C 5ELIA 4EXKA 3VXNA 3THML 1FFPB 3MRHB 1ZEAL 3O6LL 4FABL 1J5OH 4MAYD 1MFDH 3AM8A 1FZMA 1RSFA 3P4OA 3I75B 4QXUH 1TDQA 4AK1A 5ESQA 2P48B 4JY4B 5CGYC 3RRQA 3SDXB 5E4EC 5HYQB 3DPBA 1O7VA 1R3LB 2XTJD 2NXZC 4NIKB 3LKQB 3U0PA 4HGWA 1MELA 1IGYB 3RVUD 4YR6A 3NIGF 4QRRB 3KPSB 4LPTA 3GNMH 2P24B 2VQUA 3FONB 1JF5A 1K6QH 2APWA 1P5VA 3KYKH 3WFDH 3MO1B 1KV3A 2J4WH 5D1ZD 2OSLA 5DUML 5HGAA 1XF3B 3IDXH 1Y6KR 4L8DA 2H2PD 2XZZA 1AO7A 3O3UN 3A67H 3R0NA 5IOPB 1D5BB 3OG4B 3TO2A 2WANA 5F70A 4QO1A 2XY2A 1UZ8A 4Z18A 3FRUB 1H3VA 1T80A 5I1EH 2OQJB 3H9HB 1XR9B 2R2EA 5E2WL 2IFFL 2IMMA 5E08H 3MUGB 5JHLH 4Z7NE 5EIVA 4CU6A 4L8CB 1DN2A 1N8ZB 5F7LB 3V9FA 4X5WB 5LGHH 1CXEA 2DYPB 4WY7H 5BXFA 1NBZA 1GAFL 1VGKB 3OR6B 1GC1H 1WJ3A 5FYJD 1QYGL 2V2TB 1J9CT 1FL5A 3VXSA 3KPRB 2Q76B 5CS7A 2HLFC 3PWVA 1T66C 1VADA 4H25B 1ADQH 1FNFA 4RFOL 3PIQB 4WWKA 5FM8A 2BVQA 2YKLL 5E94B 1KB9J 1WCBB 3VXQB 5IMMA 4JM2B 4NN7C 2KL6A 3SDYH 4U1HB 2E27H 1DANT 2ZJSH 4TVPL 2E6QA 1IKNA 4EDXA 2PN5A 4WIQA 3WN5A 2EE6A 2OR8A 1CD1B 5DF0A 2BNRB 4NHCL 3OJ2C 3T1FA 1RZJC 2J88H 4BFGA 4ODSL 4PRHB 2M8XA 1T7VA 8FABA 2I5YH 4I13B 4PJ7B 3LIZL 1N6UA 3O6KL 4PRIB 4YHLL 3CH8A 5JO5B 4L29B 1UWEH 1HHGB 2V7HA 2UVFA 2BNUB 2BDNH 1OOAA 4AENA 4PJAA 5F88B 3PXHA 4PGJA 3NA9H 3H42L 3QHFL 4LVNB 4J1UA 4GKZA 4X6DA 1B0GB 4BKLB 4NQSB 3GJEA 5D71L 3T2PA 2CJUL 3H3PL 5DJ2B 1EBPA 3T65B 4WFGD 5EBLA 4YHPB 3AC0A 2CKBB 4JLRB 2FZ3B 1C1EH 2AERT 2BSRB 2J3SA 2E5EA 3CU7A 3KYOB 3MLPA 3K8MA 1F5WA 1MJUH 3BISA 5IROA 5C0AB 2BX5A 2X4NA 3RKDC 4X7SL 3TV3L 5JORB 2J8UF 3P9MB 5LAXA 3SEPA 1I8LC 2PO6A 2CLVB 3G6JF 1AKJA 1CDHA 4RWYH 3VGDA 1YPZB 1ZGLA 3JV0A 3CVHL 3BX7C 1EGJL 1KLGA 4UIMA 5C0BA 2BVPA 3C60C 3MOAL 5C0IA 5F97E 2EKSB 5IGXL 4PG2C 4OCMC 2VIRB 4KGJA 1J05A 2DM7A 3PWNA 4ZO8A 1X7QA 1YQVL 1YUHB 4PJAE 3BE1H 4OT1H 3P9LB 1MCPL 2NY3C 1SY6H 1N5AB 1I9RH 3AY4C 1HSBB 1TZGL 2EEDA 4GAFB 4ZPTA 3X12B 1OTSC 5TDPB 4L9LC 1ZLWH 3U1SL 1B2WL 3VH8G 3DRQA 2A2QT 1MJ8L 5T1DL 3F58H 3ARTA 3P0YL 2GW5A 4FXGB 1KULA 2BC4B 4Y4FC 4G5ZL 4IRZH 2IPUK 3LEXB 4HJJL 4U0QB 2F74B 1S7RB 1U8LB 4NKQB 5FOBA 1PSKH 4NO5B 1FZOA 4Z0XB 3DX6A 1J0IA 5C09D 3TC9A 2VABA 3G04A 2P47B 1GL4B 1PZ5B 4JFYA 3U4EB 1T1XB 2OL3A 3VFNA 1PKQE 4D0CB 4Z5RA 4NC1C 2HFEA 1S7TB 3ESVF 5TE4L 2MCPH 4PJ8C 2HRPH 3GMPA 3KHOA 4WUUA 1U36A 3WLBB 1KPUB 1KPRB 5DLML 2C1PB 5C0BE 1P7KA 1P4BH 1KJVB 5AZEH 1E6OL 4ZNEE 2C7UB 1XCQB 4GAYB 5E8NB 4DFIA 4RCAA 1SJHB 4GBXC 3SQBA 1NBYA 3HZMB 4U33A 4IHOA 3MC0A 2CGRL 1N6VA 2ZNXA 4OD1L 3HR5A 4GRLA 3QUXA 4GW5B 1NUDA 4RNRA 1C5BH 1PEWA 3ARBC 4LCUB 4S0TD 3MZTA 4JPVL 5LQBH 2ZUUA 3EYUL 2R4RL 4ZS7H 5HHPA 4HS3A 2VLMD 1T03L 3U4AA 2IALA 1CR9L 4P5TD 4WW2A 5MEOB 4RMVA 5DVKA 3NCFB 5FIEA 1F90H 2DQCL 3KXFA 1MCRA 5CZVH 5JOPD 2W1NA 5GZOC 5IK3A 4PP2B 3EYFA 1JGLL 5JR1H 2IQAB 4EDWH 4HKJA 5D7LB 5FV1L 3K46A 3PWLB 3UX9B 1KIRB 5SWSD 2OI9B 2H9GA 3BPNC 4GG6A 1CU4L 4JZOB 4AMKL 2R2HB 3D85A 2KZWA 4X4MA 4YQXL 3LSOB 2C3HA 4JVUA 4KY1H 1A7RH 4J3UA 2EH7H 1Y0LB 4XXDA 3BP4A 3QWOA 3KPMB 3RNQA 1QLFB 4E41A 3U79A 4LLYA 5IVNA 3UTTE 3LPGA 3WXWH 1II4E 4KJWD 2EH8L 1QFUL 1F4XH 3ULUH 2F8VA 1F6FB 3HZYB 5DD6A 5IB2A 3GBNH 1A6ZA 2E8YA 3MRKA 4JAMB 3QIWA 3TVMD 5KVFL 5T3ZD 1ZSDA 3ZZ1A 4O5LL 3G6JB 2A6DA 5FYKD 1TVHA 1B4RA 4PGCB 4YXKH 1FVCA 1RUQH 1EJOL 4EQ2A 1CFVH 1U3YA 1YYLH 5D72H 5ETUB 4G6KH 2VZ1A 3HNTH 3FB5A 2EIBA 4FHBD 4M7ZB 4KZDL 1PG7H 3AAZA 4J4PC 4PS4L 4LCCA 3FT4A 4X8JA 1ZTXH 5TFSH 2YR3A 3PE9A 2IH3B 5I17A 1BVZA 2WUBL 3DSNA 3GRWL 3KPPB 1AR1D 4HQQL 3RWFA 5IMKB 1A9BB 1P2CA 1JNHA 1KOAA 2VLJE 3WNNA 3VRIA 5B38B 2WBJB 1RZKH 4PRHD 1Y18B 4Y8AA 4MJ4A 4PGEA 3D2UA 1KCVH 4NQTA 5AYUH 3LEVL 1DUZA 3ALXA 1Q9OA 1KEML 3KHQA 3GMRB 3T0EA 1YA5A 4YE4L 3WFBL 4ZUTB 4MJ6B 5DVNA 3NGBC 4M02A 5C0DB 2ARJB 1K5NB 4FRWA 3QUMH 3C08L 4EI5D 4AG4L 5SWQB 1FSKC 4P2OA 3T2OA 4JFHE 1ULVA 3X13B 2D31B 3D69A 1YDPA 2GFBB 3FQRA 1JZ6A 1H0DA 1G6RA 4HCRH 1D5MB 4GSDL 3VFSA 4D3CH 3QG6B 4JM4H 3W0WB 5EU7C 2DMBA 4KROD 3FB8A 2IMNA 3QDAA 5CAYB 1ZV5A 2Z4QB 3JWOC 3HE7C 4G9FA 3PGDB 5D1ZA 5ADPH 4PD4K 4LKCB 3VXOA 1KIQB 1T6VN 2OJEB 3ZE0F 3V5DB 5D7SH 1N0LA 4PJAF 4Z7WA 4LHJB 4BFBD 5MEPA 4GXUM 5JHDB 4NJAH 2F19H 4LPXA 4RGNE 3G6DL 1N6QL 4G8GB 3BD4A 2XXCB 1KIUA 1RURL 1G7IA 3HE6C 4TYUA 4Q6IA 5HDLA 3G5VA 4YH6A 4G8IB 4W68A 3HLAA 1NUFA 4WFFD 3GSOA 1DQML 1LO0H 1ZHBA 4DGIL 3JTSA 5F7EL 4MJ5B 5INDA 3LVEA 1UT9A 3JV5A 4UQ3B 2VERN 4PTUA 5FHAL 2GAZB 4XP5H 2XTJE 4WJ5B 2P1YA 2XKNB 3VXNB 1WBXA 5FGBC 1OAXL 4NO3A 1OSPH 3DVFA 1FZMB 2FLRT 3P4OB 4ENED 5ESQB 3BJLA 3BDBA 3CFJB 1P4IL 3L3DB 3PHOA 1BIHA 4KKCD 5GZNC 4WTZG 4E9LA 1V7NL 1CVSC 1ERNA 4XPAH 3U0PB 4HGWB 4UILH 5EZIL 4NCDA 4YR6B 4K2UL 4OFDA 1RJLA 3VG0H 2HLAA 3V6ZA 3IYLW 2BVUA 3S36L 2UWEB 1KSRA 3DLQR 4WEMB 2XA8H 4G6AD 3ARFA 4I0PD 4GKOA 2OSLB 4XNUH 5HGAB 1I3GH 3ZHLA 3QIBA 3NOIA 3K4ZA 3LV3B 5FGCE 3TO2B 3L3GA 5T1KD 2VWEE 1UZ8B 4MNQD 1VKXA 4ODVL 3QT2A 4OM1L 4JKPH 3W11D 2AAVA 4LNVA 3LKRA 1LO4L 2R2EB 1MSPA 2YPLA 4ZSOE 5FYJE 4D9QD 5KSAA 3O6LH 4FABH 3WO4B 3ET9F 3MGTA 3VFWB 1W72A 5HDOA 5DURD 4DW2L 3GDBA 1OF2A 1OCWL 2DQJH 3IDUA 5DHXB 1YEFH 2X1XR 3N1QC 2V17L 3VE0A 1NMBL 2OMNA 5TE7H 3TBVB 5C2BH 4JPWH 3T4AA 3UYRH 5EC2A 3VXSB 3D0LB 4XC1H 2F15A 4X4YA 5FYLL 1OGTA 3PWVB 4HEPG 5AUMA 3TCXA 3RX8A 4P4KC 3TM6A 1VADB 3NFNA 4Z7VA 4KTDL 4WWKB 2Z31D 1UENA 2H2SD 4QYOA 4OUUA 5IMLB 3U9PL 4OQ1A 1ZHNB 1KN4H 3VW3H 1C12A 4WW2F 3HAEG 1H3GA 4EDXB 4NSKB 4APQC 2HKFH 5I6XB 2R1YB 3RUGB 4OLUL 1ORQA 4GMTH 4JR9L 8FABB 4WFGE 5E2WH 1JWSA 5DRZB 1SYSB 4PRAA 5DHVH 3RX5A 2X4TA 3BWAA 3QFJB 4NDMA 2ERJB 3HZVA 4OF3A 1J0JA 3LQZB 4AENB 4AH2B 4U7SA 2X4RB 3C9NA 2NNAA 4QCIA 3ARQA 4J1UB 4GKZB 4X6DB 4F37K 4I2XE 3GJEB 1OWRM 1QRNA 2XFXA 5D7IA 1GAFH 4F9PA 3HNSL 3DYOA 5DUBA 4HT1L 5EO1A 3V6OE 1QYGH 4URTB 3Q6GL 3QH3A 4FMKA 4LBEA 2Q8AH 2ED7A 4DOHE 1VEMA 5IESL 2XI9A 1KBGL 4GOSA 2DBLL 4W4OC 4XP1H 3KLHD 2X4NB 2DRUA 5HHXL 3CSPA 2YKLH 2DWDB 4RFNB 2CDGB 2MOVA 3VU2A 5I1AB 3KPNB 1AKJB 3DMMB 2QKIB 3S4SA 1KLGB 2BVPB 1HZHL 5C0IB 5TPWL 2EECA 3LIZH 1UG9A 3O6KH 5E2JA 3BO8B 3BMVA 3UBXG 5GRZA 4ZAKB 5I9QB 3W0WD 1ITBB 1ZLUK 3PWNB 1X7QB 2HT3C 2Y4SA 2X89D 4QRSA 3H3PH 5EB9A 5ECJE 1OB1A 5ERWA 5J0BA 4GRWH 1X5KA 2NY7L 2XYCA 1DP0A 5C09E 5IV2A 5DVOA 4ZPTB 4KMQA 5DO2D 2G2RB 2VDPL 1CXFA 2OYPA 1TPXC 3DRQB 4FP8L 1RI8A 1MRCL 1MY5A 3O4OC 3EUUA 3KPTA 3BH9A 3VI3E 2MNUA 3STBA 3RDTD 4X7SH 4G8GD 1Z0NA 1DQQA 1CFQB 2YUWA 4QTIH 1ZMYA 3VWKC 1OAZL 1T1WB 5DEGB 2VABB 3G04B 4NO0A 3QIUA 1R3HA 3ZDYF 4POZD 4HH9B 1NCNA 4JFYB 3V8CA 4GMSL 2V7NA 2OL3B 3VFNB 5JW4R 1UA6H 3SDAD 4Z5RB 1EGJH 2HFEB 1SBSL 4FNLH 1RVFL 3GMPB 4WUUB 5L6YH 2CUMA 3TVMA 3CSBA 3MA9L 1JN6A 4MDIA 2W0KA 1CGTA 3RAJL 2VLME 3BGFB 1NBYB 4CNIA 1KCUL 1KXQE 2ZG3A 5LVEA 1ROWA 1VA9A 4JRYB 3HR5B 3QNYA 2OZ4A 3FFCB 4YWGL 3QUXB 3S9DB 5JOPE 4Z7WF 3VWJB 2GKIA 5IT2H 4ORGA 3U1SH 1B2WH 4K8RL 2MTPA 5LXGH 5SWSE 1MJ8H 5T1DH 4HS3B 3P0YH 2XG4A 3HTLX 4KHXH 2IALB 1BZQK 4WW2B 4N5UA 4S0SD 5EZJA 1SEBA 1NFKA 3LKNA 4YXHL 4WV1A 3EZ8A 4DKEL 4O4YH 5CJOL 4K8RC 1LK2A 4WEUD 2MCG1 2YRPA 1V3LA 3T3PE 5C0JB 3E6FB 5KN5B 4JFFD 1EH9A 3EYFB 4UTBH 1NGQL 4MX7A 4XPGL 2NY6B 4BM7A 3MRRB 4U3XA 2NX5D 2P42B 2H9GB 4GG6B 1GYAA 1MEXH 3V6FB 5TE4H 3CFEB 1GIGL 1EAPB 1AGCA 2FGZA 3W5MA 5E9DD 3WFEH 3MUHL 4KK6D 5JLZA 3QWOB 3KNBA 4PJXA 5FGRA 3RNQB 1EJ6A 5BV7L 5T3ZE 4E41B 2HT4C 5B3JF 5J9PA 5I8EB 5FYKE 4XMPL 2WINA 3DURB 3TA3C 4PLJC 1UWGH 3STLA 4CBPA 1IM9A 2HG5A 5GISH 5EBGA 2DJSA 1KXTB 4UI2A 1A6ZB 2VL5A 3MRKB 4JPVH 3EYUH 1T03H 1CL7L 1PZUB 2WP3T 3LN4A 1LWRA 3A6OA 4LP4A 3MRLB 4R4FH 2NR6D 5CBAB 4RA0C 5E8DL 1FVCB 3DYMA 3WDHA 2ZKHH 2PTTA 4PRHE 4JO2L 4HIIB 2YA2A 3FB5B 3MV8A 4R96A 4Y7MA 2G75B 3I6KA 4PJ7E 3AAZB 4WHYG 4J7RA 4X8JB 1JIBA 3RP1A 5J8OA 4Y2DC 4E0RB 5I17B 2YUVA 3GMLA 3ALWA 4S1QL 3RWFB 3RWCB 2E9JA 1KTRL 1P2CB 3GSNA 5F1NB 1DR9A 4X5LA 4QRPD 1HCFX 1T83A 1MQKH 4U1IB 4XVTL 3EHBD 3QFDB 3VRIB 4I48A 4PGEB 2RB8A 2VTFA 2ATKA 3D2UB 4YHOH 1NC2A 2YPKB 1XIWA 2APVA 4G43B 4N0UA 2W9DH 1Q9OB 4AQ1B 4LSTL 5HD8C 3QCUH 1JPTL 1QFUH 4U1LA 1LEGA 2VXVL 4ZFFA 5L2KA 2BVTA 2ZCLH 2H32H 5KVFH 2VDNL 4H88L 5EU4A 4OFKA 2XNAA 4CGTA 4Z7VF 3S5LA 3B9AA 4UDUA 4WW1B 1OQOA 5CEZH 1MNUL 2VAAA 3QXUA 4P2OB 3IF1A 5DQDL 3IKCA 5AG9A 2YK1L 1H0DB 1G6RB 1JV5A 3OHXA 4PS4H 3VFSB 5HHMB 3WLWD 1OW0C 4ODXA 5C0CB 4AJ0A 4FN0A 3FB8B 1IC7H 5DJDA 4Y5VC 4KV5F 4R9HA 3J8F7 1E27B 5T1LA 3AREA 5GGTA 43CAB 1BWMA 3DMMD 3ZDZE 4LLVB 3K7UA 5IHZA 5JOFA 4KRMB 4JRXD 3VXOB 4PLKD 2ZPKL 1ZT7A 5CEYB 3RVVC 35C8L 2QSQA 5MEPB 3P9WB 4XNQA 3EYOB 5DJYA 3ZKMD 1OGAA 1I3RA 2CQVA 2EDLA 3DOSA 3C6LB 2HTLC 3HCVA 5D7IF 1UYWL 1TJHH 1IFHH 5HDBE 3HMXL 5I1JH 9CGTA 1G7IB 4S1DC 4Q6IB 3WFBH 1FN4A 3G5VB 3TZVD 1X6LA 3SJVD 1WK0A 3GSOB 1CL7I 2JB5H 3PWJA 1ZHBB 3FO9B 3MV9D 1P53A 3BYTA 3PL6B 1TJGL 1AJ7L 1MIEL 1P9MA 3IXTB 3JTSB 5F1OB 4BZYA 5INDB 1F02I 2Q1EA 4F7CA 4LHUG 3B43A 1PLGL 2CIKA 3OX8A 5A2KH 3DETC 4U1MB 1NFDE 1QKZL 1WBXB 4I18A 5F3BA 5F9DC 5FHBL 2B0SH 3QULA 4R97C 3G08A 1TIUA 4I3GA 4LIQH 2Z31A 4UV7L 2X44D 2X2YA 3PHOB 3QNXA 5BJTB 3ULVH 3TCLB 2GJZB 3O6FB 1T3FA 4XXCA 3WKNA 3RIFF 1O7SA 1LEKA 3WJJC 3F7VA 1CQYA 3QQ9C 4PJ9C 4F80A 3G6DH 1RJLB 2HLAB 3V6ZB 2W38A 2XRAL 4MNQE 3L7FA 3FFCD 1FG2A 3ARFB 4D9QE 1ACZA 3VWJD 3HI6L 4P23D 1T5WB 5C6TL 1H3XA 5ICZA 3T0WA 1QLRB 3C5ZC 3QIBB 1F2XK 1G7QA 5F7EH 1X5XA 1IILE 5GQBA 5FHAH 1VKXB 2A73A 3HC3L 3IDJB 4L1HA 3LKRB 5I19L 2YPLB 4G6FD 3TBTA 5KSUA 4KI5D 3CDGA 5DZNA 2NY6D 5CSGA 5KTEL 2DQEL 1FVDA 1OF2B 4N8VA 1WISA 3JXAA 3BPLB 1LO3H 4FTVB 2ZCHL 1VB9A 4X9IA 5IEHA 3S3PA 2Z0BA 3ISWA 4MDJA 1QFWM 3HZKA 4K2UH 4X4YB 4QHKJ 1J10A 3NPSC 4G6JL 4M3KB 5AUMB 3NFNB 3CZFA 5IVXB 2E9WA 4QT5A 4KJQC 2CDFA 4KUZH 5D9SA 3EW3B 3O41A 3BQUA 5DD3L 3TYGH 1GGTA 3HAEA 2Z93B 5IQ9B 4QYOB 4JE4B 1IGMH 4ZUUA 3I2CL 5E2VL 4N0FA 3OJMB 1C12B 2AJYH 4YDKL 3BKMH 3GKWH 1D9KC 1K4CB 2YXFA 1S7WB 2EC9U 3FB6A 2P8LA 4GS7B 4IDJL 3FT2B 1GGUA 3B2VL 3HG1B 1JWSB 3EOAA 3BWAB 3MV7D 7CGTA 3HZVB 5ISZD 2XWBA 3DSFH 4RMTA 12E8H 5DJZB 5IFJA 1OCWH 3C9NB 3DO3A 2NNAB 4X6BA 2FEEL 4EVNA 5MEND 2V17H 3BIBX 4KH2A 4QNPF 1QRNB 4JQXA 5HY9B 2XFXB 2DQGH 5DUBB 1J18A 5EO1B 4L3ED 4LBEB 4Z9KB 3SDAA 2GJ6D 3UO1L 3K2UL 3U0TA 3KGRA 2FX9H 5I1GL 4LSPH 5GS3A 2VZTA 4Y5YC 1ZWIA 1MCCA 4ZTPL 4IJ3C 3QJHB 4Z76A 2IAMC 4OCWH 1JWMA 1QA9A 3W0WE 1ZOXA 4ZXBB 1AI1H 4OIBA 1N4XL 1BQHG 3OZ9L 1U8JA 5HGBA 5CIPH 5I1KL 1FL3B 3S4SB 3FCTA 3MNZB 3LHPH 3UBXA 4JR9H 4M7KL 2AJUL 1QFPA 1N5YH 1OP9A 4OLEA 3B8YA 4P49A 1V7ML 1QSED 1V8HA 3ZDZF 2N7BA 3P30L 1RQ5A 2Y07H 1ZE3C 2DQUH 3QWQB 4M7JL 4NFBA 3EIFA 4G8GE 4RBPH 1BM3L 1IMHC 1G7PB 5IW6B 2N4IA 4ODTL 4UOJA 4LARL 1WGOA 3FL7A 3BZEB 3GO1L 5IV2B 2BMKB 3Q6GH 1CS6A 2ADIB 3GMQA 1CICC 3ORJA 4WGVB 1ZXQA 5IESH 4XP4L 5BVPL 4PRPB 3U4BH 5D1XA 5JW4M 1DBBL 3MODL 3G5YA 5E24E 1CCZA 3GSVB 2GUOA 3REVA 3S96A 3C6LD 1FO0H 2ZUVA 5EU5A 4JJ5A 3AS3A 1DQQB 3MOBH 2DMCA 1BOYA 1EK3A 5TH2A 3TF7C 3B9KC 4UBDC 2DAVA 3QIUB 4BH8A 1FIGL 3HKFA 2DQTL 3G9VA 3OGCA 4ONHB 1L0QA 4F58L 5E1AB 1ACYL 3DGCR 4E5XA 2V7NB 2ICWI 4MAYC 3PL6D 1HHIA 1HZHH 5B21A 1BZ9A 3MGAA 4I5BA 5D4QA 3WL9B 3VFGL 1KB9K 4XVJL 1JN6B 4MDIB 1S9YA 5IB3B 2XTJC 4RGMC 1A5FH 3RPIB 3LMJH 1GOHA 4J8RA 3OB0H 3RVUC 3OKDA 4QY8A 5HI3D 2NY7H 1L4IA 4JFFE 1FC2D 3OAUL 4ORGB 1T7YA 5J3HD 3O6FD 2VDPH 2OCFD 4FP8H 1W8NA 2NX5E 3RU8L 1MRCH 1L7TH 1U8KA 5FK9A 1HH9B 1K4DA 2H2PC 2Q8BL 5EZJB 1SEBB 3J7HA 3LKNB 5E9DE 4MSWB 4XP6L 4UOW0 3G9AB 4WV1B 1LK2B 2P8PB 1I7TA 4M48L 1OAZH 1G9NL 4MX7B 1PQZA 1PDKA 4IS6B 3WXVH 5A2LH 2VDMH 1TCRA 4GMSH 3U6RA 3TNNA 1XGUA 4LRNH 1AGCB 3NA4A 1G9NC 4XWOC 4AEHL 2VWEC 1YEKL 1WFNA 2H32A 2MKLC 3KNBB 2NY2D 3A6BH 4PJXB 4CMHC 5T33L 1KCUH 2R29L 3MPCA 5J9PB 3QUMB 4OJFL 5B39G 1HHKA 4YWGH 5CKAA 1MQ8A 3WNLA 1UXWA 4XMLL 2DQFA 5D6DC 4HULB 1IM9B 2HG5B 4FTVD 4YHKL 5KVGH 3DGGA 5DWUL 5DRNB 4R8WL 1RZFL 1SM3H 4LPWA 4JFOA 4PJCA 3WHE0 4M61B 1R3JA 5IB4B 1BBDH 2O5YH 3QCTH 3QI9A 1LO2L 4OAWB 5C86A 3LN4B 5EOCH 3EO0A 1KNOB 2VQTA 2DM2A 5E8PB 4DKEH 4QRPE 3RUGE 4CMMA 5L2JA 4JFDA 4G9DA 3KJ4B 3MV8B 4PREA 4XPGH 1I1AB 1ZVHA 3I6KB 3IDGB 2Y5TA 2ZSWA 4C55A 1I7ZA 2D7OA 5DMKB 2ZZUT 5L8KB 4JRWA 4ZDHA 3GMLB 4Q74A 1DQDL 1GGBH 4ERSH 2LTQB 1YMMA 4YHNA 4NRYA 1QFHA 3BI9X 3TZVA 1EMTH 3HG1D 5HHNA 2ATKB 5BV7H 4G6ML 1NC2B 3FQUA 5I16A 1XIWB 4N0UB 5DQ9A 5D93C 4V1DD 2W9EL 3GMMB 1IAIL 1JWUA 1IAOA 4U1LB 5KSBB 1PX3A 2JJSA 1P7QA 5L2KB 1MHPL 4PLNC 3BH8A 1DQLH 2FGWL 4EBQH 1C8PA 1R5IA 1T0NA 5T5FL 4F15C 1WIOA 1JI1A 1ZAGA 1HCVA 1TTFA 1XMWA 3MCLL 5TF1H 4KK8D 3VFTA 3ABZA 1CL7H 2G60L 5I18L 3V6OC 1IC1A 3BKJH 5ICXA 3FO1A 4GLRI 4KZEL 5E8DH 3S5LB 4UDUB 1WTGT 5HDQL 3RX7A 2VAAB 3IF1B 4JRXE 1VPOH 5I8CB 3VD4A 3DV6A 5IWLA 3IDNA 1JV5B 4LDEB 3SOBH 5HVHB 2FX8L 4ODXB 2AEIT 3IDIB 4ZXBD 5DJDB 3MRPA 4UB0L 4K9EC 2IPUG 4NQXA 4XCCL 3AREB 3F8UB 5IHZB 1DEDA 4XTRD 5JOFB 3CX2A 2HH0L 4IRJD 3RZCA 2V9RA 1ZT7B 1DUYA 3IDMA 3SJVE 4K7PY 4FQXC 1F4WH 3IAPA 4LGSB 4NOFA 2XKSA 4Q9RL 1YY8A 3MV9E 4XNQB 1I85C 3IGAA 2GITA 1HQRA 4LSTH 1CIDA 4M9PA 5ACLA 3EOTL 4ZUWA 1F4HA 2AABH 2F54D 1CGUA 1P69B 2KQMA 2GHWB 3F7PC 1S5IH 4XCFL 5CINH 2BP3A 5DRXB 4PBVC 1FN4B 1G6VK 4FZEL 2P46B 5E8OA 2KKQA 2GY5A 5K59E 2YD6A 1MJJA 3IJHA 4X4ZA 1DANU 4LHUA 4PRPD 2Y7QA 4OIIH 1WIUA 5DQDH 4F7CB 3FRPA 4UNTA 1RULL 2PCPA 2YK1H 2JJUA 2GK0B 1OAYL 4QHUA 5L8JB 2R23B 3L3HA 3OX8B 1BEYL 5F3BB 1UB6B 5JQHC 1XF2A 1KELH 4HJ0D 4O2FA 3WFHB 3QULB 3PQYD 3G08B 2NLJA 4JFEB 5JIPA 4JRYE 3RL1A 3FFCE 4UIKL 1F3DH 4XVUD 4PTTA 1SJEB 2ZPKH 3QNXB 1RMFL 3ULUD 2HJLB 2R69L 1LEKB 3F7VB 3OJVC 4H26A 2XICA 4PJDB 2ILLA 3S6CA 2EICA 3O8XB 3RHWF 3BJ91 3DXAD 3HMXH 1D6EA 4P5TC 3L7FB 1FG2B 1S78D 1Q9LB 4KI5E 4Z78B 4XPBH 1KTLB 4H8WC 1U93A 2WLZA 1TJGH 1MIEH 5IBLD 3HUJA 1G7JA 5AYQA 1R6VA 4NPYA 1AXIB 4YFLI 2A73B 1OTUD 1PLGH 2WUCH 5I30L 5IHLB 3WHXA 5CLTA 3PHSA 3TBTB 2GJ6A 4IRSA 1A1NA 2A6IB 3CFKA 5KSUB 1AXSA 3CDGB 1H8OA 3S3JA 1DLFH 3C8KA 3OGOE 1FVDB 4K94C 5CILH 1YNKL 3LN9A 4N8VB 4J3VA 1A0QL 3QAZB 2JCCB 1ZT4A 5FUCE 1WC7B 2Z8RA 5T3ZL 5IEHB 4UT6H 2ADJB 4E42A 2BSTA 3QYCA 3VXRB 5GGUB 5HYFA 2E7LC 1DVFA 3VDCA 3NCEB 2YZ8A 2PW1A 3VD9A 4OI8A 1NEZA 1T0MB 2BFVL 2XRAH 4PY8J 5D9SB 5DJCB 3A6CH 4MVBD 4OF8A 4NUJA 5C6TH 5E4IA 3MV7E 5ISZE 4N0FB 4MXQD 1Z6JT 4N1EA 5C0EA 1U95A 3E8UL 3U82B 3LPFA 5MENE 4LDLB 3FB6B 4LLMA 1AC0A 4GRWB 3C5JA 4WDIA 5TQ2H 3EOAB 4RMQA 4L3EE 5ID0B 1KTDB 2XWBB 2GJ6E 2Y9RT 4BSWA 5GGQL 3BKYL 4X6BB 4U05A 5DUPH 4X8XA 2E8ZA 3RTQB 4EVNB 4OD2A 4PGZA 2ZCHH 3MXWL 3QXVA 4LVNC 2CKBL 2NY5H 3O2VL 4HIXL 2L7JA 1A6WH 4G80A 4WO4B 2MPAL 4N90D 2P4AB 3CVIL 4G6JH 4KMTL 4OKVA 5FA3A 3TH3T 3U0TB 2XWJA 3QZWG 3I3DA 4EI5C 3CFCL 1JGVH 5DQJA 2X4QA 1INQB 2ZUTA 4JZJB 4XNZB 4Z76B 1VFOA 2G5BA 4FXKA 4KHTL 5TDOA 4PJCF 1RUKL 1RZ8A 2IANB 5E2VH 5CCKL 1JWMB 1QA9B 4PJFA 3D6GA 1QSEE 2R2BA 1YY9D 5GGRA 4AEIH 4YDKH 5I74B 3I9GH 2YC1A 1YNTA 4N5EC 4OTXH 1G84A 3HS0B 5JQ6H 3B5TA 2WQ8A 4Z7UA 4JO4L 3RI5K 2DDQL 3FCTB 1HSAB 2Y36L 4JFQA 4X9FA 4U7KA 1U8IA 5IG7A 1QHOA 2GSGA 2BNQD 4A2MA 3DIFA 4CVZB 4Y1AB 3HRPA 2FECI 2IG2H 3QA3A 1QBLH 3L3KA 4P46B 5F6HJ 4GXVH 1I75A 1TZHA 2AEQL 3SKJL 2NXYB 3GMQB 4HUWB 3LB6D 4QHNA 4R26H 5D7JD 3UO1H 1W0WA 5D1XB 3R4DA 4F2MB 3EYVB 3G5YB 3REVB 4ODUB 3S96B 1NKRA 4R2GB 1JNNH 4N0CD 3P0VH 1T0PB 2EDRA 5CGYD 5KOMC 3VFUB 5HGHA 4JN1L 4BH8B 1N4XH 3P4MA 1QFWH 1B0RB 2DTMH 2NXZD 3OZ9H 4TRPH 5GJSH 2RJMA 3RJQB 3K74B 4KKBD 1HHIB 2W9LA 5I1KH 1CT8A 3VXMA 1FYTB 5JZ7D 2DM4A 2QSTA 3AMKA 3IJSA 2L4OA 4I5BB 4M7KH 1IVLA 2AJUH 5L7XH 5ILTH 1QG3A 2BOCA 1CTOA 3DBXA 1S9YB 4KKCC 4ELKA 1YMHA 2V5MA 2RAMA 3TNMB 3L5XH 3OJDA 4YDJB 4J8RB 4M7JH 2ITDA 1ZK9A 1G7MB 5GS1B 4JFED 3UC0H 1IGCL 2A38A 4O2EA 3OKDB 1PGRB 4OIAA 1KJ3H 5IW1B 4G6AC 1Q9KB 4I0PC 2EYRA 1D3CA 4JGMA 5C0GA 4XP4H 2NTFA 5C7XL 3QEQD 1MCQA 1U8KB 4HPOH 1DBBH 5IFAL 1AD0B 1K4DB 1YEEL 4G3YL 4LCWA 3O8XD 1R5WA 5B22A 1I7TB 1F4AA 4KKNA 3W11C 3SKNA 5KW9H 4V1DA 5IBUB 4F58H 2DQTH 3E6HA 4JFZL 1XZ0B 1WT5C 3OAZK 3TNNB 5I8OH 2QADD 4JKKA 4TSCH 4RZCA 2C9AA 4FFYL 5TF0A 4FTVE 2ENSA 1FNGB 2H32B 4OGXH 5EOTA 3RA7H 5B39A 1UKTA 5C0FA 4WNQA 3V0WH 4M4RA 1CDIA 4YX2H 1EEQA 2OJZL 1UC6A 5IVXE 1CZ8H 1UXWB 2DQFB 1ND0B 1RZJH 3QDMD 1K8DA 2MHAA 2D4DA 5K9JL 2VN4A 2OR7A 4PJCB 3RU8H 3VXRD 4X98B 1FL6B 1R3JB 1RK1A 2F9BT 2J7LA 3QI9B 4GLRH 4ZO7A 3EO0B 4TVPD 4ZO6A 1FGVL 4XP6H 2AI0H 2YD1A 3MUZ1 5K93A 4CMMB 3F7RA 2N7AA 1CI5A 1MCDA 3HG1E 4PREB 4BZ2L 4KUCD 2Y5TB 4NKIL 1I7ZB 4OCSL 5A16A 4PJBE 4HW6A 1X44A 4ZDHB 3HUJF 3TWCH 5DXWA 2F54A 1W2KT 4V1DE 3RWGA 3PWPD 2FH6A 3JBG7 4J3WA 1YMMB 4KPHL 4NKOA 4NRYB 4YHNB 1CE6A 1YEKH 2FH8A 3Q0HA 1FLRL 1G7HB 4YHZH 1AGEA 1MWAA 4OCNC 3TYFB 1EHXA 2Y25A 4OCLC 1MLBB 1T20B 1FGNL 5HHNB 3S7GA 4RQQB 1I9EA 5T33H 2WBJC 1FJ1A 3FQUB 4JDZA 2NY1D 3AS0A 3JUYA 4MXWL 5DQ9B 1I8IA 2IH1A 4OJFH 5GRJL 2V5SA 4HXAH 1TQCB 1IAOB 1WEJL 3TPUA 4CDHA 1P7QB 3BH8B 3KLHC 4R8WH 4DUXA 1QEWA 1R5IB 1T0NB 2A9MH 1T2QL 5DRWA 1Q72H 3VDAA 1FQ9C 4WU5A 1L6ZA 1LO2H 1TITA 2PXYA 3T08A 4B5EA 5ICXB 1WVZA 2YD7A 1RZGA 1NC4A 2ZUSA 4GW4A 3DNKA 3T3ME 4JCLA 1FNSH 4FZ8H 2VXQH 3WS6C 3B4NA 3DV6B 5DC9B 1CGYA 2IAND 4ZFGL 1I9JL 5F3HA 3H9SD 4MGXA 2NY3D 1WAAE 3CZJA 4OCYL 4TUKH 3FT3A 1DQDH 1IJ9A 2LE9A 3MRPB 3D18A 4NQXB 2WM0A 1PYWA 1TETH 1OTSD 1WFTA 2A74B 2F54E 4LU5H 3WJLC 5IJKA 3JV6A 1YEGL 3VJ6A 1H3TA 1J0ZA 1T7ZA 3RZCB 3SGJC 5EUOA 5CSZA 3IDMB 3WFCL 1E4WH 3MNWA 1WWAX 2VLKA 1CD0A 3LH2H 4PRPE 2W9EH 2GITB 3IGAB 4Y1AD 1YEDA 3ROOA 2ZP0T 5DO2C 4X6CE 3GEWB 2O5XL 4YBQD 3KYNB 3RGVB 1H8NA 3KDMA 4RAHA 3RDTC 5T5FH 5KANI 3GM8A 1CIUA 3BN9D 3FO0L 1OT2A 3QRFM 3CFDB 4P2QA 3MACH 5E8OB 2NXYD 1ZT1A 1MJJB 3IJHB 3WIIL 1FNHA 3W81A 1NBQA 5LCVL 4KZEH 3PQYE 1T21A 4DKAA 5HDQH 2A77H 4POZC 2AP2A 3KR3L 4GBXD 4L4VA 2ADFH 3CX5J 1NGPL 3SHSA 2VISA 3S35L 3ULUE 4IEFB 4QHUB 3L3HB 2YEZA 1GXEA 4YNYA 2UV3A 1FPTL 4Z7UF 2H8PB 4O2FB 1BQLL 2EC8A 3U46A 3ARBD 5BRZD 3WUWB 2NLJB 3DXAE 5HYSG 4LCYB 4EI6A 1BFVL 3DO7B 3DX9A 3RL1B 4UINH 2E3VA 1FYTD 2HH0H 1BJ8A 2VDLL 4Y16A 1WBYA 5KJRH 1WICA 1YEIH 3RBGA 3K4DA 1I7RA 1NGYA 5F9OL 4J3OC 4JKWA 5JTWA 1IGJA 4OI7A 1SJXA 5GZOD 3EOTH 4H26B 1EERB 1N59A 3ARDB 1T4KA 1H5BA 2CRMA 4PJEB 3L95A 4PG9A 1L7IL 2AJVH 1UJTA 5C71A 2DI9A 1CDGA 1HIML 2B20A 2DLHA 3LN5B 4YHMH 3QWRD 1U93B 5MEQA 2XPGB 4K3GA 3MJ7A 3JTTA 1I7UB 3HUJB 5C2UB 3TP4A 1G7JB 1ED3A 3F6LA 3DX8A 4NPYB 4P9HL 3DUUA 1OAYH 1EDQA 2VC2L 2DLEA 3T8XA 2VR5A 3WHXB 1BEYH 1NJ9A 3SDDA 4IRSB 4JVWA 3CFKB 2PYEA 1AXSB 3IFPA 4LVHC 1T22A 4TSAL 4KK6C 4P9HC 5CGMA 3C8KB 2F5AL 3WO4C 2ZOLA 4AIZB 1FHGA 1CE1L 4HK3J 4YUEL 4ONGL 5T1MB 1ZT4B 1GHFL 5BZWA 5FECA 5F7DA 3GHEH 4IOFC 5F96H 1ZGLM 4OZGE 4E42B 2DL9A 1EIBA 3W39A 2XZQL 1VDGA 3V7AG 1DVFB 1ODAA 4F7MA 3O3BB 2PW1B 4TNVK 4QRUA 2HN7A 1NEZB 2IC2A 1AFVH 4NZUH 2ICWA 5EPMA 2NR6C 2R1XA 1HE7A 3FQWA 4PJ5B 4NUJB 4WWKC 1Z0MA 3O4LA 4C56B 3STZA 3B3IB 5C0EB 3UYOD 5H37G 2UZIL 4Y4KA 5DJAA 5DMGD 1LK3L 1IKNC 3FQXA 3C5JB 4WDIB 2YSSB 4O02L 2X1WL 4N90E 5BW7A 4Y4HD 5CKGA 3UCRA 1S7QA 3BUYB 3ZKXB 4BSWB 1YNKH 2ERJC 4PJGA 2Q87A 1A0QH 4LHQB 2JTDA 4K23H 4OD2B 3ZKSD 1U0QA 1FO0B 2I07A 2VZ3A 1EO7A 2C5DC 5DK2A 1JPGA 1Q8MA 3IFOA 1YN7A 4XHQA 1X6NA 1AY1L 4G80B 5GRUL 4MNGE 1BHGA 3QZWA 1K3ZA 2BZDA 1B4JL 5EOQH 3UMTA 4OKVB 5IFHL 5FA3B 5D2LA 3T4YA 4OFVA 3QO1B 1W8OA 3T0AA 2Q7YA 3VXUA 5KVEH 2X4QB 1X9QA 3EKCA 4F57L 5L0QB 2G5BB 4FXKB 5TDOB 1U6AL 2BNQE 1RZ8B 4OB5L 4NQEA 3GMOA 4PJFB 5GGRB 2R8SL 3T3MF 3N06B 4RFNC 4F7PB 3WIFA 3PDGA 1YNTB 4O2CA 3WLWC 5LWYL 2OR9L 4C83B 2AJXH 3OKYA 4Z7UB 4NZTH 1JNJA 1JPST 3U7WL 2X9XA 1N7ML 3MA7A 3RZWA 4JFQB 2D03L 4P57A 1HWHB 3DMMC 5IG7B 3OR7A 5E2UL 1MCWW 3BZDA 3GSUA 5JXAL 5L88L 4PLKC 5HYJD 4XGZB 5CJ8A 3DIFB 3CPLA 3SE4C 1G0XA 4PJIE 4ZAKC 2APBA 2CRZA 4PIRF 3V4PL 4UT9H 3MBED 1NDMA 1BGXL 1IC4H 3MXWH 4YBLC 3L3KB 2HFTA 3RJDA 1HKLH 2CKBH 3O2VH 2NY0B 4HUUA 4Y19A 5HHOB 3S88H 1TZHB 1RJCA 5GS0H 1MLCA 1K8IA 1F4YH 2AXFA 4FQLL 1CLCA 1FAIH 3L3JA 4NOBA 4YGAB 3LEYL 3CFCH 1VGEL 5MERA 2COQA 2GT9A 3DRTA 5D2LE 2DLGA 4KHTH 2VDQL 4R6UA 1RUKH 2Z92A 2DWEA 3T1WA 2OL3L 5HGHB 3P4MB 1A6UL 1LDPH 4OZHE 4HX1A 5GZND 5F9JB 4JO4H 4JFEE 1OVZA 2LABA 2FIKA 4TNWK 2EYSA 3IJSB 3L9RA 1QNZL 4OF0A 5BVJA 3UP1A 2NY4B 3WKML 4CAGA 3X14B 1F3JA 4GG8A 1OWWA 5TE6L 3ZE2E 1YECH 1UM6H 4ELKB 1YMHB 3QEQE 4JANB 1KIPA 4M8QA 1I1YA 3OJDB 5IEKA 1VFUA 2ITDB 4PJDE 3FHQA 5CBEA 1KJ2H 4CKVX 3BGFC 4O2EB 2Y1VA 1KLFA 3DV4A 5INCB 1DJSA 4DN4L 2FJGA 3SKJH 5D8JH 1MI5B 2EYRB 4U1KB 3TT1H 5C0GB 3VWJC 1U3HD 4P23C 1A7PL 1AIFB 4X5XA 1IQWL 1JI2A 4BA8A 5GGVY 3ARDD 1J8HD 2X4UA 4LCWB 2BSED 1CBVH 1R5WB 2D7QA 1NCBL 3SKNB 4ETYA 1L9NA 2BJML 3SCMA 1I8LA 3FKUS 1V3JA 4R90H 4KI5C 2NY6C 3OKLA 3UTQB 1S7SA 2JCCE 4YO0A 4BSVB 5HJ3A 4RZCB 4LLDA 3VFRA 3QDME 3EAKA 2QSVA 3N1FC 2JIXA 3MRCA 4NWTL 2BVYA 3C60A 4ELME 2VQ1A 5FDWA 4PG2A 3VXRE 3SY0B 1MRDL 4JPKL 4WNQB 5D6CA 4RRPA 4OQTH 4TVPE 5FYLD 4TTGA 5CMAB 3TBSA 3H6JA 4DGVH 4M1DH 2B5IB 4JB9L 4PJHA 1DFBH 2MHAB 2VAJA 5I1LA 1LGVA 5IF0A 4APQD 2FO1A 5FUCC 3AY4A 4GUPB 5C7XH 3EBAA 4M6OH 4WHDA 5FF6A 4L9LA 3WIHH 1CGWA 1YEEH 5LBSL 3PWPE 2IQ9H 3KLAA 4YZFF 4Y4FA 2JF1A 2V5RA 4PP1C 4WVRA 1JYNA 4GRWE 3DVIA 4PJ5D 3LKOA 5CD5D 3TJEL 5A16B 5CFHA 1A21A 2HA1A 4DEPC 4JFZH 2X5PA 1JZ7A 4C56D 3PGFL 3V4UL 3INUL 5BOPA 5AWNH 4V2CB 1A7NL 5F71A 4NNPH 5KSVA 4NKOB 3QJFA 4LMQE 1CGSL 4S10A 3BD3A 4PJ8A 4LQFH 3MRFA 2XACC 3E3QE 4HDIB 4JDZB 3MROB 1H3PH 1RZIA 4J23A 4QRQB 1I8IB 2IBZX 2IH1B 4LSVL 1QPXA 3ULSA 4HF5H 4P2RD 5J6HB 1OP3H 2OK0H 1S7UA 3DVNB 2IANE 5DRWB 3H9SE 1MFDL 2E6JA 3QNZA 1NSNL 4QXUL 2G9HB 2PXYB 4G42B 3D3VA 1FGVH 1A4JA 1FP5A 1DL7L 1G6RL 2AV7B 1NC4B 4GW4B 1KC5H 1LO5B 2X4PA 4PRDB 4BZ2H 4NKIH 5F3HB 1F00I 3PDDA 5J6GA 1J7VR 4Y1AE 3GNML 5H2BA 1PYWB 2R9HD 3WFDL 1IM3B 3JV6B 2J4WL 1J0YA 1RAMA 4ZQKA 1T1YA 1QR1B 2DI7A 5EUOB 3A67L 2D7TL 1F42A 3MNWB 5HPOA 1IGTA 4Q9QL 3LRGA 3NCBB 2FEDD 2VLKB 4MXWH 2AQ3A 2ESVD 4LDOB 2B1HL 1EFXB 1YEDB 3ROOB 1FG9C 4MJIA 4FS0A 3NZHH 5CJQH 3VRLF 1YYML 3C6LC 2D4FA 5E08L 3KS0H 5JHLL 4EZMA 4P2QB 1PAMA 1ZT1B 2I27N 3FO2A 5D2LF 2BOBA 2FNBA 2YUXA 5BRZE 1KGCD 4WY7L 3PHQA 3QPQC 4S11A 1FYTE 1GC1L